4Y49C

Crystal structure of yeast n-terminal acetyltransferase (ppgpp) nate in complex with a bisubstrate
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
173
structure length
156
Chain Sequence
RDICTLDNVYANNLGMLTKLAHVTVPNLYQDAFFSALFAKDVHFTQMAYYSEIPVGGLVAKLVPKELSLKGIQIEFLGVLPNYRHKSIGSKLLKFAEDKCSECHQHNVFVYLPAVDDLTKQWFIAHGFEQVGETVNNFIKGVNGDEQDAILLKKHI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords N-terminal acetyltransferase A complex subunit NAT1
publication title Crystal structure of yeast N-terminal acetyltransferase (ppGpp) NatE in complex with a bisubstrate
rcsb
source organism Saccharomyces cerevisiae
total genus 8
structure length 156
sequence length 173
chains with identical sequence I, O
ec nomenclature ec 2.3.1.258: N-terminal methionine N(alpha)-acetyltransferase NatE.
pdb deposition date 2015-02-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4y49C00
4MI4A 5F48A 1PUAA 3D8PA 1Z4RA 2B4BA 2ZW6A 4NCZA 5JQ4A 4FD7A 1MJ9A 1Y9WA 1M1DA 2JDDA 3ZJ0A 3S6FA 3EXNA 3TOBA 4K30A 2R7HA 3GKRA 2B5GA 4XPDB 2HUZA 4IUSA 3TFYA 4JWPA 5C82A 4GS4A 3P2HA 5EC4A 4F0YA 2ZW7A 1S3ZA 1Z9UA 5DWMA 3S6HA 1GHEA 3DDDA 3N7ZA 2BEIA 1S5KA 2G3AA 3W6XA 2PRBA 2Z11A 4B5OA 4YGOA 5HH1A 1XEBA 2OB0A 3V8IA 4FD6A 4HKFA 1WK4A 2C27A 5C88A 1PU9A 1P4NA 3KKWA 4Y49C 2VZYA 1WWZA 2PSWA 1Y9KA 3TOAA 1FY7A 4IF5A 4HNXB 4MY0A 4FD5A 2AJ6A 1BOBA 3TTHA 4CAXA 2R8VA 4AVCA 4JXRA 4MJ8A 5H84A 1YVKA 4ZBGA 4U9YA 2VEZA 3DNSA 3TO6A 3S6GA 2G3TA 1ON0A 3LODA 4PV6A 1SQHA 4MY3A 2QMLA 1MJAA 4I49A 2EVNA 4CRZB 3BLNA 4KZTA 1CM0A 2CY2A 1YREA 5F46A 4CAVA 1IYKA 3E0KA 2P6FA 1B6BA 4NSQA 3TT2A 4BMHA 4LX9A 4RS2A 1MK4A 5EBVA 3D2PA 4UA3A 2JEVA 4R9MA 1XF8A 4KUBA 2I00A 4KOUA 4XPLA 2X7BA 5DWNA 3FBUA 4AG7A 3W6SA 2EUIA 5HMNA 3CXSA 3FRMA 1KUXA 1N71A 3JVNA 3I9SA 4KOSA 4M85A 3IWGA 4J3GA 2D4OA 1MJBA 2ZXVA 2VXKA 3TE4A 4XNHC 2GANA 3BJ7A 2WPXA 3SXOA 3DSBA 2B3UA 1M4IA 4R3KA 2J8RA 1QSTA 3CXPA 4KUAA 4MHDA 3LD2A 3JUWA 3CXQA 1L0CA 2PQ8A 2Q44A 4L89A 2R98A 3WR7A 2FXFA 1P0HA 1K4JA 4OADA 5I0CA 5IX3A 4OLLA 4KORA 4JXQA 3H4QA 1V0CA 1TIQA 1RO5A 1S7LA 4H89A 2RC4A 4EVYA 2A4NA 2Q04A 3EO4A 2FS5A 5J8FA 2PDOA 4MBUA 3DR8A 4NEXA 3TO9A 4CS0B 2VI7A 1IB1E 2K5TA 1IICA 2B4DB 4PSXA 5F47A 2FT0A 3EY5A 4CAWA 4B5PA 1I21A 2PR1A 3EFAA 4XPDC 2Z10A 4Y49B 1KZFA 5E96A 2BL1A 3TCVA 2B58A 1NE9A 4RI1A 1NMTA 5IV0A 2OZGA 3P2FA 1S7FA 2J8MA 5CNPA 2HQYA 1LRZA 1QSMA 1R57A 5GCNA 2CNSA 1Q2CA 3GYAA 2J8NA 2Y0MA 1XE4A 2WPWA 3D2MA 4II9A 3F5BA 3D3SA 2B5GB 3S6KA 5KTAA 1I1DA 2I79A 4PK2A 4H6UA 3W91A 4ONUA 3R9FA 2QECA 2VBQA 2Q0YA 3RYOA 1IIDA 1UFHA 2FL4A 2F5IA 5J8CA 3T9YA 4KLWA 3R96A 2CNTA 4UWIA 4YRHA 2VQYA 2O28A 3UY5A 1NSLA 2DXQA 1QSOA 2ARHA 1QSNA 4F6AA 1OZPA 4HNWB 3MGDA 1S60A 2R1IA 2FSRA 3IGRA 1S7NA 4LUAA 2JLMA 5FVJA 4L8AA 2AE6A 1YK3A 2HV2A 1IYLA 3F8KA 3PP9A 1J4JA 3C26A 4JD6A 3EC4A 3FNCA 4KOVA 4ORFA 4U5YA 1YVOA 2IL4A 4QUSA 1Z4EA 2QIRA 3BJ8A 2FIAA 4FD4A 5KTCA 3VWDA 2P6GA 2OU2A 1YLEA 3QAHA 2H5MA 1KUVA 2ZW5A 4PSWA 4PK3A 2ZW4A 2ATRA 3OWCA 4AVBA 1YGHA 2P6EA 2BUEA 4X5KA 1I12A 4OAEA 2Z0ZA 4U9ZA 3GY9A 4NXYA 3FB3A 1XIXA 3SHPA 2PC1A 3F0AA 1U6MA 4UWJA 5KTDA 2ZPAA 2VZZA 3DR6A 4CRYB 2REEA 3NE7A 3PZJA 1BO4A 1YX0A 2D4PA 4E0AA 3FIXA 4KLVA 4UBRA 3R9GA 1VHSA 3PGPA 3R9EA 2FCKA 2PR8A 5F49A 3ZZIA 2Q7BA 1B87A 4KOYA 1CJWA 4KOWA 4QVTA 2CNMA 4HNYB 1VKCA 1XMTA 4QC6A 2B3VA 1Y7RA 3SXNA 3TO7A 4R3LA 1KUYA 2FE7A 4XPKA 3T90A 2OZUA 5ISVA 1YR0A 4E8OA 4E2AA 2Q4YA 2Q4VA 3FYNA 3G8WA 3K9UA 3G3SA 2KCWA 3R95A 1RXTA 4H6ZA 5JPHA 1S7KA 3I3GA 4QB9A 1M4GA 1Q2YA 3QB8A 2FIWA 5IB0A 4B5PB 2P0WA 3VWEA 4M3SA 4QBJA 4KVOE 4AB7A 4JJXA 2JDCA 4R57A 4AG9A 3FXTA 1QSRA 4DNCA 4NF1A 2BSWA 2REFA 4YFJA 1M4DA 3B8GA 2G0BA 2NMTA 4AVAA 4XNHB 2GIVA 4KOTA 4KOXA 1M44A 4JLYA 3R1KA 2OZHA 2OH1A 4R87A 1Q2DA 4KVXA 2B4DA 2GE3A 4KVME 5H86A
chains in the Genus database with same CATH superfamily
4MI4A 4WJBA 4P4BA 5F48A 4CGPA 2HC9A 1PUAA 3D8PA 1Z4RA 3KGQA 1CX8A 3VATA 4A30A 4C7IA 2B4BA 2EK9A 2ZW6A 4BD9A 1JQGA 3KR5A 4NCZA 3SI1A 6CPAA 5JQ4A 1YLOA 3FH4A 4FD7A 1LANA 1YQEA 2G9DA 2GLFA 5G22A 1MJ9A 1Y9WA 1M1DA 4GM5A 2VL1A 2JDDA 4MXUA 4A94A 4JYWA 3ZJ0A 2QVPA 3S6FA 5EMIA 3EXNA 5LRGA 3IC1A 3TOBA 2EK8A 1FNOA 3IJ3A 3CDXA 4K30A 2R7HA 3GKRA 4B6ZA 2B5GA 2WSAA 3IU2A 4UEEA 4ZX9A 2IJZA 2CXAA 4XPDB 2HUZA 4IUSA 1A2ZA 3H8GA 2PJBA 5I4MA 3TFYA 4JWPA 2Z3OA 1KWMA 2NSMA 4C2YA 5C82A 4C2ZA 4GS4A 4MHYA 4B11A 3P2HA 5EC4A 4F0YA 2ZW7A 4HPSA 3SJXA 1S3ZA 4MHPA 4KSFA 4A2ZA 5LYLA 3V7ZA 1Z9UA 1VHEA 5DWMA 3ISZA 3S6HA 3KI9A 4B10A 1GHEA 1LOKA 3DDDA 2BEIA 3N7ZA 2CF4A 1S5KA 2G3AA 3W6XA 2PJ2A 4CGLA 2PRBA 3CPAA 2Z11A 4CYOA 4PXBA 4Q36A 4B5OA 2JBKA 5D8NA 3JTKA 4YGOA 5JGFA 3IWEA 5HH1A 1XEBA 2OB0A 3PRTA 3NH4A 2CTBA 3V8IA 3S9LA 4FD6A 5HVHA 1PYTB 4OMEA 4HKFA 2PJ5A 3PB4X 1WK4A 3GUXA 2POKA 3FECA 4A95A 2C27A 5C88A 1PU9A 1P4NA 2FVGA 3VARA 2GREA 1OBRA 4C7HA 5HVGA 4AXVA 3KKWA 4Y49C 1EE3P 2VZYA 1WWZA 1F2PA 2PSWA 1Z8XA 1IOFA 4P45A 1Y9KA 3TOAA 4R6TA 1FY7A 4UEFA 3RNZA 4DYOA 1ZLIA 3KR4A 4IF5A 4HNXB 4MY0A 4FD5A 2YGWA 4OP4A 4UFVA 2AJ6A 1BOBA 2WZNA 3SJEA 3TTHA 2I3CA 2Z3LA 4CAXA 4NGRA 2R8VA 4PXEA 2V8VA 1BPNA 2OR4A 3NE8A 4AVCA 3DGVA 3PB6X 4UFXA 5CPAA 2AFSA 4JXRA 4MJ8A 4UCPA 1YVKA 5H84A 4B14A 4JZ0A 4ZBGA 4U9YA 2VEZA 3DNSA 4Q38A 2ZEPA 3TO6A 3RAMA 3S6GA 8CPAA 4FBEA 2G3TA 4OC2A 1ON0A 1AMPA 3LODA 3PB7X 3CT9A 4OC3A 1YW4A 2Q7SA 4PV6A 3RBUA 5HXDA 1TKFA 1SQHA 2XEJA 2QMLA 1MJAA 4MY3A 3B7IA 3NH8A 4I49A 4NGMA 3PB9X 4A39A 3PBEA 2EVNA 4CRZB 3BLNA 1XFOA 4KZTA 1CM0A 2HB6A 2CY2A 4DUKA 1YREA 4IAVA 3B3CA 3B3TA 1CP6A 5F46A 5THWA 4UIBA 4P4FA 4RUHA 3T8WA 3SI2A 3JRUA 4CAVA 1IYKA 2ZELA 3E0KA 2P6FA 1B6BA 1ELMP 4K3NA 4NSQA 3TT2A 4BMHA 4LX9A 3BI1A 2C6GA 4P10A 4RS2A 3BI0A 4IK2A 1MK4A 5EBVA 3D2PA 3V38A 3NFZA 1F2OA 1CBXA 4UA3A 2JEVA 5LRKA 4R9MA 2PJCA 1XF8A 3IIBA 4NJQA 4KUBA 2I00A 4KOUA 2ZOFA 2ZEOA 4XPLA 2X7BA 4ZI6A 4OC5A 3IU1A 5DWNA 3FBUA 4ZX8A 4AG7A 3W6SA 2EUIA 5HMNA 3CXSA 3H5ZA 2GU2A 3FRMA 1KUXA 1N71A 3JVNA 3KQZA 2Z3NA 3I9SA 2PJAA 4KOSA 1ZG8A 1HEEA 4M85A 5AG4A 3IWGA 4J3GA 2D4OA 1MJBA 1VIXA 2BO9A 2ZXVA 5K8MA 4F0XA 2VXKA 4B12A 3TE4A 4XNHC 2GANA 3BJ7A 3B35A 4FUUA 4X3RA 2WPXA 1M4LA 4MFKA 3SXOA 3DSBA 2PRQA 2B3UA 1M4IA 4GXHA 4R3KA 1IOIA 2EBJA 2J8RA 1TKHA 2O53A 2PJ0A 4MCQA 1QSTA 3CXPA 5JH9A 4KUAA 4MHDA 5G1ZA 3LD2A 3JUWA 4MFQA 2WYRA 3CXQA 1L0CA 2PQ8A 2Q44A 4L89A 1X10A 2R98A 2FXFA 1P0HA 1K4JA 4OADA 4UIAA 3WR7A 5I0CA 5IX3A 4OLLA 2V77A 4KORA 3L2NA 2CTCA 3H4QA 4JXQA 1V0CA 4RN7A 1TIQA 1RO5A 2ZEEA 2PIYA 4KS9A 3KASA 1S7LA 2YNDA 4H89A 3H8EA 5HVFA 2JEWA 3BXMA 4ZY0A 2RC4A 4EVYA 2A4NA 4UF4A 2Q04A 3EO4A 3H8FA 2PJ3A 4A31A 4CYQA 2FS5A 5J8FA 4A33A 1NSAA 2PDOA 2AFMA 4MBUA 4ONWA 4P4JA 2Z3KA 3TX8A 5A28A 2QYVA 5K8OA 3DR8A 4NEXA 3TO9A 3QAYA 4CS0B 3B3WA 3WC7A 2VI7A 1IB1E 3FJUA 2K5TA 3NH5A 1IICA 2B4DB 4CAEA 4F9UA 4PSXA 5F47A 2EWBA 2FT0A 4Z65A 2ZEMA 3EY5A 1XJOA 4P4EA 4CAWA 4B5PA 1I21A 2PR1A 3EFAA 5AG7A 1H8LA 4XPDC 5G21A 4MMOA 1Z5RA 2Z10A 4Y49B 1KZFA 3IFEA 4EMEA 5E96A 2BL1A 5K8NA 3TCVA 2B58A 7CPAA 4UCMA 1NE9A 2ZEHA 4RI1A 2F8HA 1NMTA 5IV0A 2OZGA 2XEGA 3P2FA 1S7FA 2J8MA 2ZEGA 5CNPA 2HQYA 4NJRA 1LRZA 1QSMA 1R57A 2GLJA 5GCNA 4MCSA 2CNSA 1Q2CA 3LACA 3GYAA 2J8NA 2V8GA 2Y0MA 4NGPA 2Z3MA 5AGEA 1XE4A 1VGYA 2WPWA 3D2MA 2AFZA 3WC6A 4CYPA 4II9A 3B2YA 3F5BA 3D3SA 4DJLA 2B5GB 3S6KA 5KTAA 2JBJA 1I1DA 2DPSA 2I79A 4MFLA 1HDUA 3KZWA 4PK2A 3MN8A 4H6UA 3W91A 4C2XA 3GLJA 4ONUA 3R9FA 4CPAA 4EFDA 2PVVA 2QECA 2VBQA 3B3VA 2Q0YA 5D29A 1IIDA 1UFHA 3RYOA 1ARMA 3D67A 1UWYA 2FL4A 3PEIA 4IHMA 2F5IA 5J8CA 3T9YA 2PJ1A 4KLWA 4W9YA 3R96A 2CNTA 3KHZA 4UWIA 4YRHA 5JM6A 3WC5A 5DS0A 2VQYA 2O28A 3QNVA 3D7HA 3UY5A 2AFWA 3LWUA 4BBHA 2AFXA 2ZOGA 1NSLA 2DXQA 1QSOA 2ARHA 2XEFA 1QSNA 1DTDA 4F6AA 1LFWA 1OZPA 1IY7A 4HNWB 3MGDA 1S60A 4F9VA 2ODFA 4A37A 2R1IA 2FSRA 3IGRA 4MFPA 1S7NA 1TF8A 4LUAA 2ZEFA 3IEHA 1IU8A 4X8IA 1XOVA 2JLMA 5FVJA 4L8AA 3WT4A 3MRUA 2AE6A 1YK3A 2HV2A 1LCPA 1IYLA 4Q7AA 4NGTA 3F8KA 3PP9A 3FEEA 2EO8A 3DLJA 3K9TA 1J4JA 3D7FA 3HUVA 3C26A 4JD6A 3EC4A 3A9LA 1VHOA 4WWVA 4EWTA 2F7VA 2BCOA 3B3SA 3FNCA 4KOVA 4ORFA 4CAFA 4U5YA 4F8ZA 1YVOA 2IL4A 3S9MA 4QUSA 1Z4EA 1Z8WA 5F09A 1QQ9A 3CZXA 1JWQA 2XEIA 2QIRA 3BJ8A 2FIAA 4FD4A 4NGNA 2V8HA 4MCRA 5KTCA 1Z2LA 2P6GA 3FF3A 3VWDA 4FAIA 4G1PA 3PB8X 1ZG7A 1ZLHA 1YW6A 1Z8LA 2OU2A 4ZY1A 2ABZA 4R8FA 5LYDA 1BAVA 1R43A 4MCPA 1HDQA 1YLEA 3QAHA 2H5MA 2PJ7A 1KUVA 3SI0A 4KSAA 2ZW5A 4PSWA 3SJGA 4OKOA 4PK3A 2ZW4A 4M6IA 4A32A 1Y7EA 2ATRA 1CP7A 2DPTA 3I1UA 3OWCA 5AG6A 4AVBA 1YGHA 2Q4ZA 4NGSA 2P6EA 2O4HA 2BUEA 1Y0YA 4X5KA 1I12A 4OAEA 1ARLA 2Z0ZA 4U9ZA 2DEAA 3GY9A 3D66A 4NXYA 4PQAA 3FB3A 2C6PA 3ISXA 3NA6A 1XIXA 3K2KA 3SHPA 4OC4A 2PC1A 3F0AA 1U6MA 4OIWA 4UWJA 1BPMA 4R7MA 1YSJA 4O23A 2Q51A 1TKJA 2YNCA 4P4DA 1PCAA 5KTDA 5LYIA 5J1QA 2ZPAA 2VZZA 3DR6A 2PVWA 4CRYB 1CPSA 2REEA 3NE7A 2V8DA 4B13A 3PZJA 1BO4A 2OOTA 1YX0A 2D4PA 4E0AA 3FIXA 2AFOA 4KLVA 1QMUA 2IQ6A 4NGQA 5LYFA 4OIDA 4UBRA 3RZAA 3BHXA 1XMBA 4LQ6A 2PCUA 3PFOA 2BOAA 2PJ9A 3R9GA 3PFEA 4MFJA 3PBBA 1VHSA 3PGPA 3N5FA 2FCKA 2PR8A 5F49A 3R9EA 3ZZIA 3SJFA 4CGMA 2Q7BA 1B87A 4KOYA 2C1CA 1CJWA 4KOWA 4QVTA 4CGOA 1DE4C 1AUGA 2PIZA 1ZO0A 4P4IA 4PPZA 3D7DA 4MHNA 4R76A 4TNUA 1CG2A 2CNMA 4HNYB 3D4UA 3GIUA 3WABA 1VKCA 2QJ8A 4NFRA 1XMTA 4QC6A 2B3VA 1LAPA 1Y7RA 3SXNA 3TO7A 1GYTA 2GFQA 2PJ6A 4OC1A 4R3LA 3KQXA 1KUYA 2FE7A 4XPKA 3T90A 3KHXA 2OZUA 1ZG9A 5IB9A 5LRJA 4M6HA 5ISVA 1YR0A 4H2KA 4YU9A 2DF5A 4PXCA 3RO0A 4E8OA 3FX6A 5ELYA 2Q4YA 2Q4VA 5G20A 4E2AA 3FYNA 1Y0RA 3G8WA 2Z3PA 1CPXA 3IO1A 3K9UA 3S9NA 1Z8TA 3G3SA 4MFZA 2KCWA 3R95A 2C6CA 1RXTA 1YMEA 2Q43A 4H6ZA 5JPHA 4UFWA 1BLLE 1S7KA 2ZEDA 2YNEA 3I3GA 1ELLP 1AYEA 4P44A 4QB9A 3VH9A 1M4GA 1Q2YA 4ZY2A 2YNCC 3QB8A 5A27A 2ZENA 1FT7A 4P6YA 2FIWA 4C68A 5IB0A 1TF9A 2P0WA 4B5PB 4UEZA 4TWEA 4CYNA 4ZGYB 3VWEA 4M3SA 4QBJA 4KVOE 4M6GA 2RFHA 4MRIA 4A38A 2CIJA 4AB7A 4JJXA 3FVLA 2ANPA 2JDCA 4R57A 1XBUA 4AG9A 3FXTA 1QSRA 3TC8A 1F57A 3CPXA 4DNCA 1X12A 3HLPA 4X2TA 5AG5A 4NF1A 2BSWA 2REFA 1IGBA 4YWYA 4YFJA 1M4DA 3FMCA 3B8GA 2IMOA 4LQGA 2G0BA 2NMTA 4AVAA 4MHZA 4XNHB 1TXRA 4BINA 5CBMA 2GIVA 1R3NA 3KL9A 4KOTA 4KOXA 1LAMA 4FWUA 2NYQA 1M44A 1Q7LA 2PJ8A 3GB0A 3R1KA 2OZHA 4JLYA 4CGNA 4KSIA 4UCNA 2OH1A 2WUUA 4R87A 3FEDA 2J9AA 5K8PA 1RTQA 2PJ4A 1Q2DA 3IWWA 4PXDA 2RB7A 1XRYA 4ZYQA 3D68A 3D7GA 2B4DA 4KVXA 2PE3A 4OC0A 3LMSA 2GE3A 2AFUA 5BWAB 4KVME 5H86A
chains in the Genus database with same CATH topology
4MI4A 5F48A 4CGPA 1PUAA 3D8PA 1Z4RA 4A30A 4C7IA 2B4BA 2ZW6A 4NCZA 5JQ4A 4FD7A 5G22A 1MJ9A 1Y9WA 1M1DA 2JDDA 3ZJ0A 3S6FA 3EXNA 3TOBA 4K30A 2R7HA 3GKRA 2B5GA 2WSAA 3IU2A 4XPDB 2CXAA 2HUZA 4IUSA 3TFYA 4JWPA 2Z3OA 4C2YA 5C82A 4C2ZA 4GS4A 4B11A 3P2HA 5EC4A 4F0YA 2ZW7A 1S3ZA 4KSFA 4A2ZA 1Z9UA 5DWMA 3S6HA 4B10A 1GHEA 3DDDA 3N7ZA 2BEIA 1S5KA 2G3AA 3W6XA 4CGLA 2PRBA 2Z11A 4CYOA 4Q36A 4B5OA 3JTKA 4YGOA 3IWEA 5HH1A 1XEBA 2OB0A 3V8IA 4FD6A 4HKFA 1WK4A 4A95A 2C27A 5C88A 1PU9A 1P4NA 4C7HA 3KKWA 4Y49C 2VZYA 1WWZA 2PSWA 1Y9KA 3TOAA 1FY7A 4IF5A 4HNXB 4MY0A 4FD5A 2YGWA 4UFVA 2AJ6A 1BOBA 3TTHA 2Z3LA 4CAXA 2R8VA 4AVCA 4UFXA 4JXRA 4MJ8A 4UCPA 5H84A 1YVKA 4B14A 4ZBGA 4U9YA 2VEZA 3DNSA 4Q38A 3TO6A 3S6GA 2G3TA 1ON0A 3LODA 4PV6A 1SQHA 4MY3A 2QMLA 1MJAA 4I49A 2EVNA 4CRZB 3BLNA 4KZTA 1CM0A 2CY2A 1YREA 5F46A 4CAVA 1IYKA 3E0KA 2P6FA 1B6BA 4NSQA 3TT2A 4BMHA 4LX9A 4RS2A 1MK4A 5EBVA 3D2PA 4UA3A 2JEVA 4R9MA 1XF8A 4KUBA 2I00A 4KOUA 4XPLA 2X7BA 3IU1A 5DWNA 3FBUA 4AG7A 3W6SA 2EUIA 5HMNA 3CXSA 3H5ZA 3FRMA 1KUXA 1N71A 3JVNA 2Z3NA 3I9SA 4KOSA 4M85A 5AG4A 3IWGA 4J3GA 2D4OA 1MJBA 2ZXVA 4F0XA 2VXKA 4B12A 3TE4A 4XNHC 2GANA 3BJ7A 2WPXA 4MFKA 3SXOA 3DSBA 2B3UA 1M4IA 4R3KA 2J8RA 1QSTA 3CXPA 4KUAA 4MHDA 5G1ZA 3LD2A 3JUWA 4MFQA 3CXQA 1L0CA 2PQ8A 2Q44A 4L89A 2R98A 3WR7A 2FXFA 1P0HA 1K4JA 4OADA 5I0CA 5IX3A 4OLLA 4KORA 4JXQA 3H4QA 1V0CA 1TIQA 1RO5A 4KS9A 1S7LA 2YNDA 4H89A 2RC4A 4EVYA 2A4NA 2Q04A 3EO4A 4A31A 4CYQA 2FS5A 5J8FA 4A33A 2PDOA 4MBUA 5A28A 2Z3KA 3DR8A 4NEXA 3TO9A 4CS0B 2VI7A 1IB1E 2K5TA 1IICA 2B4DB 4CAEA 4PSXA 5F47A 2FT0A 3EY5A 4CAWA 4B5PA 1I21A 2PR1A 3EFAA 5AG7A 4XPDC 5G21A 2Z10A 4Y49B 1KZFA 5E96A 2BL1A 3TCVA 2B58A 4UCMA 1NE9A 4RI1A 1NMTA 5IV0A 2OZGA 3P2FA 1S7FA 2J8MA 5CNPA 2HQYA 1LRZA 1QSMA 1R57A 5GCNA 2CNSA 1Q2CA 3GYAA 2J8NA 2Y0MA 2Z3MA 5AGEA 1XE4A 2WPWA 3D2MA 4CYPA 4II9A 3F5BA 3D3SA 2B5GB 3S6KA 5KTAA 1I1DA 2DPSA 2I79A 4MFLA 4PK2A 4H6UA 3W91A 4C2XA 4ONUA 3R9FA 2QECA 2VBQA 2Q0YA 3RYOA 1IIDA 1UFHA 2FL4A 2F5IA 5J8CA 3T9YA 4KLWA 3R96A 2CNTA 4UWIA 4YRHA 2VQYA 2O28A 3UY5A 4BBHA 1NSLA 2DXQA 1QSOA 2ARHA 1QSNA 4F6AA 1OZPA 4HNWB 3MGDA 1S60A 2R1IA 2FSRA 3IGRA 4MFPA 1S7NA 4LUAA 2JLMA 5FVJA 4L8AA 2AE6A 1YK3A 2HV2A 1IYLA 3F8KA 3PP9A 1J4JA 3C26A 4JD6A 3EC4A 3A9LA 3FNCA 4CAFA 4KOVA 4ORFA 4U5YA 1YVOA 2IL4A 4QUSA 1Z4EA 2QIRA 3BJ8A 2FIAA 4FD4A 5KTCA 3VWDA 2P6GA 2OU2A 1YLEA 3QAHA 2H5MA 1KUVA 4KSAA 2ZW5A 4PSWA 4PK3A 2ZW4A 4A32A 2ATRA 2DPTA 3OWCA 5AG6A 4AVBA 1YGHA 2P6EA 2BUEA 4X5KA 1I12A 4OAEA 2Z0ZA 4U9ZA 3GY9A 4NXYA 3FB3A 1XIXA 3SHPA 2PC1A 3F0AA 1U6MA 4UWJA 2YNCA 5KTDA 2ZPAA 2VZZA 3DR6A 4CRYB 2REEA 3NE7A 4B13A 3PZJA 1BO4A 1YX0A 2D4PA 4E0AA 3FIXA 4KLVA 4UBRA 3R9GA 4MFJA 1VHSA 3PGPA 3R9EA 2FCKA 2PR8A 5F49A 3ZZIA 4CGMA 2Q7BA 1B87A 4KOYA 1CJWA 4KOWA 4QVTA 4CGOA 1ZO0A 2CNMA 4HNYB 1VKCA 1XMTA 4QC6A 2B3VA 1Y7RA 3SXNA 3TO7A 4R3LA 1KUYA 2FE7A 4XPKA 3T90A 2OZUA 5ISVA 1YR0A 4E8OA 4E2AA 2Q4YA 2Q4VA 5G20A 3FYNA 3G8WA 2Z3PA 3K9UA 3G3SA 4MFZA 2KCWA 3R95A 1RXTA 4H6ZA 5JPHA 4UFWA 1S7KA 2YNEA 3I3GA 4QB9A 1M4GA 1Q2YA 2YNCC 3QB8A 5A27A 2FIWA 4C68A 5IB0A 4B5PB 2P0WA 4CYNA 4ZGYB 3VWEA 4M3SA 4QBJA 4KVOE 4AB7A 4JJXA 2JDCA 4R57A 4AG9A 3FXTA 1QSRA 4DNCA 5AG5A 4NF1A 2BSWA 2REFA 4YFJA 1M4DA 3B8GA 2G0BA 2NMTA 4AVAA 4XNHB 2GIVA 4KOTA 4KOXA 1M44A 4CGNA 4JLYA 3R1KA 2OZHA 4UCNA 2OH1A 2WUUA 4R87A 1Q2DA 4KVXA 2B4DA 2GE3A 5BWAB 4KVME 5H86A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MI4 A;  5F48 A;  1PUA A;  3D8P A;  1Z4R A;  2B4B A;  2ZW6 A;  4NCZ A;  5JQ4 A;  4FD7 A;  1MJ9 A;  1Y9W A;  1M1D A;  2JDD A;  3ZJ0 A;  3S6F A;  3EXN A;  3TOB A;  4K30 A;  2R7H A;  3GKR A;  2B5G A;  4XPD B;  2HUZ A;  4IUS A;  3TFY A;  4JWP A;  5C82 A;  4GS4 A;  3P2H A;  5EC4 A;  4F0Y A;  2ZW7 A;  1S3Z A;  1Z9U A;  5DWM A;  3S6H A;  1GHE A;  3DDD A;  3N7Z A;  2BEI A;  1S5K A;  2G3A A;  3W6X A;  2PRB A;  2Z11 A;  4B5O A;  4YGO A;  5HH1 A;  1XEB A;  2OB0 A;  3V8I A;  4FD6 A;  4HKF A;  1WK4 A;  2C27 A;  5C88 A;  1PU9 A;  1P4N A;  3KKW A;  4Y49 C;  2VZY A;  1WWZ A;  2PSW A;  1Y9K A;  3TOA A;  1FY7 A;  4IF5 A;  4HNX B;  4MY0 A;  4FD5 A;  2AJ6 A;  1BOB A;  3TTH A;  4CAX A;  2R8V A;  4AVC A;  4JXR A;  4MJ8 A;  5H84 A;  1YVK A;  4ZBG A;  4U9Y A;  2VEZ A;  3DNS A;  3TO6 A;  3S6G A;  2G3T A;  1ON0 A;  3LOD A;  4PV6 A;  1SQH A;  4MY3 A;  2QML A;  1MJA A;  4I49 A;  2EVN A;  4CRZ B;  3BLN A;  4KZT A;  1CM0 A;  2CY2 A;  1YRE A;  5F46 A;  4CAV A;  1IYK A;  3E0K A;  2P6F A;  1B6B A;  4NSQ A;  3TT2 A;  4BMH A;  4LX9 A;  4RS2 A;  1MK4 A;  5EBV A;  3D2P A;  4UA3 A;  2JEV A;  4R9M A;  1XF8 A;  4KUB A;  2I00 A;  4KOU A;  4XPL A;  2X7B A;  5DWN A;  3FBU A;  4AG7 A;  3W6S A;  2EUI A;  5HMN A;  3CXS A;  3FRM A;  1KUX A;  1N71 A;  3JVN A;  3I9S A;  4KOS A;  4M85 A;  3IWG A;  4J3G A;  2D4O A;  1MJB A;  2ZXV A;  2VXK A;  3TE4 A;  4XNH C;  2GAN A;  3BJ7 A;  2WPX A;  3SXO A;  3DSB A;  2B3U A;  1M4I A;  4R3K A;  2J8R A;  1QST A;  3CXP A;  4KUA A;  4MHD A;  3LD2 A;  3JUW A;  3CXQ A;  1L0C A;  2PQ8 A;  2Q44 A;  4L89 A;  2R98 A;  3WR7 A;  2FXF A;  1P0H A;  1K4J A;  4OAD A;  5I0C A;  5IX3 A;  4OLL A;  4KOR A;  4JXQ A;  3H4Q A;  1V0C A;  1TIQ A;  1RO5 A;  1S7L A;  4H89 A;  2RC4 A;  4EVY A;  2A4N A;  2Q04 A;  3EO4 A;  2FS5 A;  5J8F A;  2PDO A;  4MBU A;  3DR8 A;  4NEX A;  3TO9 A;  4CS0 B;  2VI7 A;  1IB1 E;  2K5T A;  1IIC A;  2B4D B;  4PSX A;  5F47 A;  2FT0 A;  3EY5 A;  4CAW A;  4B5P A;  1I21 A;  2PR1 A;  3EFA A;  4XPD C;  2Z10 A;  4Y49 B;  1KZF A;  5E96 A;  2BL1 A;  3TCV A;  2B58 A;  1NE9 A;  4RI1 A;  1NMT A;  5IV0 A;  2OZG A;  3P2F A;  1S7F A;  2J8M A;  5CNP A;  2HQY A;  1LRZ A;  1QSM A;  1R57 A;  5GCN A;  2CNS A;  1Q2C A;  3GYA A;  2J8N A;  2Y0M A;  1XE4 A;  2WPW A;  3D2M A;  4II9 A;  3F5B A;  3D3S A;  2B5G B;  3S6K A;  5KTA A;  1I1D A;  2I79 A;  4PK2 A;  4H6U A;  3W91 A;  4ONU A;  3R9F A;  2QEC A;  2VBQ A;  2Q0Y A;  3RYO A;  1IID A;  1UFH A;  2FL4 A;  2F5I A;  5J8C A;  3T9Y A;  4KLW A;  3R96 A;  2CNT A;  4UWI A;  4YRH A;  2VQY A;  2O28 A;  3UY5 A;  1NSL A;  2DXQ A;  1QSO A;  2ARH A;  1QSN A;  4F6A A;  1OZP A;  4HNW B;  3MGD A;  1S60 A;  2R1I A;  2FSR A;  3IGR A;  1S7N A;  4LUA A;  2JLM A;  5FVJ A;  4L8A A;  2AE6 A;  1YK3 A;  2HV2 A;  1IYL A;  3F8K A;  3PP9 A;  1J4J A;  3C26 A;  4JD6 A;  3EC4 A;  3FNC A;  4KOV A;  4ORF A;  4U5Y A;  1YVO A;  2IL4 A;  4QUS A;  1Z4E A;  2QIR A;  3BJ8 A;  2FIA A;  4FD4 A;  5KTC A;  3VWD A;  2P6G A;  2OU2 A;  1YLE A;  3QAH A;  2H5M A;  1KUV A;  2ZW5 A;  4PSW A;  4PK3 A;  2ZW4 A;  2ATR A;  3OWC A;  4AVB A;  1YGH A;  2P6E A;  2BUE A;  4X5K A;  1I12 A;  4OAE A;  2Z0Z A;  4U9Z A;  3GY9 A;  4NXY A;  3FB3 A;  1XIX A;  3SHP A;  2PC1 A;  3F0A A;  1U6M A;  4UWJ A;  5KTD A;  2ZPA A;  2VZZ A;  3DR6 A;  4CRY B;  2REE A;  3NE7 A;  3PZJ A;  1BO4 A;  1YX0 A;  2D4P A;  4E0A A;  3FIX A;  4KLV A;  4UBR A;  3R9G A;  1VHS A;  3PGP A;  3R9E A;  2FCK A;  2PR8 A;  5F49 A;  3ZZI A;  2Q7B A;  1B87 A;  4KOY A;  1CJW A;  4KOW A;  4QVT A;  2CNM A;  4HNY B;  1VKC A;  1XMT A;  4QC6 A;  2B3V A;  1Y7R A;  3SXN A;  3TO7 A;  4R3L A;  1KUY A;  2FE7 A;  4XPK A;  3T90 A;  2OZU A;  5ISV A;  1YR0 A;  4E8O A;  4E2A A;  2Q4Y A;  2Q4V A;  3FYN A;  3G8W A;  3K9U A;  3G3S A;  2KCW A;  3R95 A;  1RXT A;  4H6Z A;  5JPH A;  1S7K A;  3I3G A;  4QB9 A;  1M4G A;  1Q2Y A;  3QB8 A;  2FIW A;  5IB0 A;  4B5P B;  2P0W A;  3VWE A;  4M3S A;  4QBJ A;  4KVO E;  4AB7 A;  4JJX A;  2JDC A;  4R57 A;  4AG9 A;  3FXT A;  1QSR A;  4DNC A;  4NF1 A;  2BSW A;  2REF A;  4YFJ A;  1M4D A;  3B8G A;  2G0B A;  2NMT A;  4AVA A;  4XNH B;  2GIV A;  4KOT A;  4KOX A;  1M44 A;  4JLY A;  3R1K A;  2OZH A;  2OH1 A;  4R87 A;  1Q2D A;  4KVX A;  2B4D A;  2GE3 A;  4KVM E;  5H86 A; 
#chains in the Genus database with same CATH topology
 4MI4 A;  4WJB A;  4P4B A;  5F48 A;  4CGP A;  2HC9 A;  1PUA A;  3D8P A;  1Z4R A;  3KGQ A;  1CX8 A;  3VAT A;  4A30 A;  4C7I A;  2B4B A;  2EK9 A;  2ZW6 A;  4BD9 A;  1JQG A;  3KR5 A;  4NCZ A;  3SI1 A;  6CPA A;  5JQ4 A;  1YLO A;  3FH4 A;  4FD7 A;  1LAN A;  1YQE A;  2G9D A;  2GLF A;  5G22 A;  1MJ9 A;  1Y9W A;  1M1D A;  4GM5 A;  2VL1 A;  2JDD A;  4MXU A;  4A94 A;  4JYW A;  3ZJ0 A;  2QVP A;  3S6F A;  5EMI A;  3EXN A;  5LRG A;  3IC1 A;  3TOB A;  2EK8 A;  1FNO A;  3IJ3 A;  3CDX A;  4K30 A;  2R7H A;  3GKR A;  4B6Z A;  2B5G A;  2WSA A;  3IU2 A;  4UEE A;  4ZX9 A;  2IJZ A;  2CXA A;  4XPD B;  2HUZ A;  4IUS A;  1A2Z A;  3H8G A;  2PJB A;  5I4M A;  3TFY A;  4JWP A;  2Z3O A;  1KWM A;  2NSM A;  4C2Y A;  5C82 A;  4C2Z A;  4GS4 A;  4MHY A;  4B11 A;  3P2H A;  5EC4 A;  4F0Y A;  2ZW7 A;  4HPS A;  3SJX A;  1S3Z A;  4MHP A;  4KSF A;  4A2Z A;  5LYL A;  3V7Z A;  1Z9U A;  1VHE A;  5DWM A;  3ISZ A;  3S6H A;  3KI9 A;  4B10 A;  1GHE A;  1LOK A;  3DDD A;  2BEI A;  3N7Z A;  2CF4 A;  1S5K A;  2G3A A;  3W6X A;  2PJ2 A;  4CGL A;  2PRB A;  3CPA A;  2Z11 A;  4CYO A;  4PXB A;  4Q36 A;  4B5O A;  2JBK A;  5D8N A;  3JTK A;  4YGO A;  5JGF A;  3IWE A;  5HH1 A;  1XEB A;  2OB0 A;  3PRT A;  3NH4 A;  2CTB A;  3V8I A;  3S9L A;  4FD6 A;  5HVH A;  1PYT B;  4OME A;  4HKF A;  2PJ5 A;  3PB4 X;  1WK4 A;  3GUX A;  2POK A;  3FEC A;  4A95 A;  2C27 A;  5C88 A;  1PU9 A;  1P4N A;  2FVG A;  3VAR A;  2GRE A;  1OBR A;  4C7H A;  5HVG A;  4AXV A;  3KKW A;  4Y49 C;  1EE3 P;  2VZY A;  1WWZ A;  1F2P A;  2PSW A;  1Z8X A;  1IOF A;  4P45 A;  1Y9K A;  3TOA A;  4R6T A;  1FY7 A;  4UEF A;  3RNZ A;  4DYO A;  1ZLI A;  3KR4 A;  4IF5 A;  4HNX B;  4MY0 A;  4FD5 A;  2YGW A;  4OP4 A;  4UFV A;  2AJ6 A;  1BOB A;  2WZN A;  3SJE A;  3TTH A;  2I3C A;  2Z3L A;  4CAX A;  4NGR A;  2R8V A;  4PXE A;  2V8V A;  1BPN A;  2OR4 A;  3NE8 A;  4AVC A;  3DGV A;  3PB6 X;  4UFX A;  5CPA A;  2AFS A;  4JXR A;  4MJ8 A;  4UCP A;  1YVK A;  5H84 A;  4B14 A;  4JZ0 A;  4ZBG A;  4U9Y A;  2VEZ A;  3DNS A;  4Q38 A;  2ZEP A;  3TO6 A;  3RAM A;  3S6G A;  8CPA A;  4FBE A;  2G3T A;  4OC2 A;  1ON0 A;  1AMP A;  3LOD A;  3PB7 X;  3CT9 A;  4OC3 A;  1YW4 A;  2Q7S A;  4PV6 A;  3RBU A;  5HXD A;  1TKF A;  1SQH A;  2XEJ A;  2QML A;  1MJA A;  4MY3 A;  3B7I A;  3NH8 A;  4I49 A;  4NGM A;  3PB9 X;  4A39 A;  3PBE A;  2EVN A;  4CRZ B;  3BLN A;  1XFO A;  4KZT A;  1CM0 A;  2HB6 A;  2CY2 A;  4DUK A;  1YRE A;  4IAV A;  3B3C A;  3B3T A;  1CP6 A;  5F46 A;  5THW A;  4UIB A;  4P4F A;  4RUH A;  3T8W A;  3SI2 A;  3JRU A;  4CAV A;  1IYK A;  2ZEL A;  3E0K A;  2P6F A;  1B6B A;  1ELM P;  4K3N A;  4NSQ A;  3TT2 A;  4BMH A;  4LX9 A;  3BI1 A;  2C6G A;  4P10 A;  4RS2 A;  3BI0 A;  4IK2 A;  1MK4 A;  5EBV A;  3D2P A;  3V38 A;  3NFZ A;  1F2O A;  1CBX A;  4UA3 A;  2JEV A;  5LRK A;  4R9M A;  2PJC A;  1XF8 A;  3IIB A;  4NJQ A;  4KUB A;  2I00 A;  4KOU A;  2ZOF A;  2ZEO A;  4XPL A;  2X7B A;  4ZI6 A;  4OC5 A;  3IU1 A;  5DWN A;  3FBU A;  4ZX8 A;  4AG7 A;  3W6S A;  2EUI A;  5HMN A;  3CXS A;  3H5Z A;  2GU2 A;  3FRM A;  1KUX A;  1N71 A;  3JVN A;  3KQZ A;  2Z3N A;  3I9S A;  2PJA A;  4KOS A;  1ZG8 A;  1HEE A;  4M85 A;  5AG4 A;  3IWG A;  4J3G A;  2D4O A;  1MJB A;  1VIX A;  2BO9 A;  2ZXV A;  5K8M A;  4F0X A;  2VXK A;  4B12 A;  3TE4 A;  4XNH C;  2GAN A;  3BJ7 A;  3B35 A;  4FUU A;  4X3R A;  2WPX A;  1M4L A;  4MFK A;  3SXO A;  3DSB A;  2PRQ A;  2B3U A;  1M4I A;  4GXH A;  4R3K A;  1IOI A;  2EBJ A;  2J8R A;  1TKH A;  2O53 A;  2PJ0 A;  4MCQ A;  1QST A;  3CXP A;  5JH9 A;  4KUA A;  4MHD A;  5G1Z A;  3LD2 A;  3JUW A;  4MFQ A;  2WYR A;  3CXQ A;  1L0C A;  2PQ8 A;  2Q44 A;  4L89 A;  1X10 A;  2R98 A;  2FXF A;  1P0H A;  1K4J A;  4OAD A;  4UIA A;  3WR7 A;  5I0C A;  5IX3 A;  4OLL A;  2V77 A;  4KOR A;  3L2N A;  2CTC A;  3H4Q A;  4JXQ A;  1V0C A;  4RN7 A;  1TIQ A;  1RO5 A;  2ZEE A;  2PIY A;  4KS9 A;  3KAS A;  1S7L A;  2YND A;  4H89 A;  3H8E A;  5HVF A;  2JEW A;  3BXM A;  4ZY0 A;  2RC4 A;  4EVY A;  2A4N A;  4UF4 A;  2Q04 A;  3EO4 A;  3H8F A;  2PJ3 A;  4A31 A;  4CYQ A;  2FS5 A;  5J8F A;  4A33 A;  1NSA A;  2PDO A;  2AFM A;  4MBU A;  4ONW A;  4P4J A;  2Z3K A;  3TX8 A;  5A28 A;  2QYV A;  5K8O A;  3DR8 A;  4NEX A;  3TO9 A;  3QAY A;  4CS0 B;  3B3W A;  3WC7 A;  2VI7 A;  1IB1 E;  3FJU A;  2K5T A;  3NH5 A;  1IIC A;  2B4D B;  4CAE A;  4F9U A;  4PSX A;  5F47 A;  2EWB A;  2FT0 A;  4Z65 A;  2ZEM A;  3EY5 A;  1XJO A;  4P4E A;  4CAW A;  4B5P A;  1I21 A;  2PR1 A;  3EFA A;  5AG7 A;  1H8L A;  4XPD C;  5G21 A;  4MMO A;  1Z5R A;  2Z10 A;  4Y49 B;  1KZF A;  3IFE A;  4EME A;  5E96 A;  2BL1 A;  5K8N A;  3TCV A;  2B58 A;  7CPA A;  4UCM A;  1NE9 A;  2ZEH A;  4RI1 A;  2F8H A;  1NMT A;  5IV0 A;  2OZG A;  2XEG A;  3P2F A;  1S7F A;  2J8M A;  2ZEG A;  5CNP A;  2HQY A;  4NJR A;  1LRZ A;  1QSM A;  1R57 A;  2GLJ A;  5GCN A;  4MCS A;  2CNS A;  1Q2C A;  3LAC A;  3GYA A;  2J8N A;  2V8G A;  2Y0M A;  4NGP A;  2Z3M A;  5AGE A;  1XE4 A;  1VGY A;  2WPW A;  3D2M A;  2AFZ A;  3WC6 A;  4CYP A;  4II9 A;  3B2Y A;  3F5B A;  3D3S A;  4DJL A;  2B5G B;  3S6K A;  5KTA A;  2JBJ A;  1I1D A;  2DPS A;  2I79 A;  4MFL A;  1HDU A;  3KZW A;  4PK2 A;  3MN8 A;  4H6U A;  3W91 A;  4C2X A;  3GLJ A;  4ONU A;  3R9F A;  4CPA A;  4EFD A;  2PVV A;  2QEC A;  2VBQ A;  3B3V A;  2Q0Y A;  5D29 A;  1IID A;  1UFH A;  3RYO A;  1ARM A;  3D67 A;  1UWY A;  2FL4 A;  3PEI A;  4IHM A;  2F5I A;  5J8C A;  3T9Y A;  2PJ1 A;  4KLW A;  4W9Y A;  3R96 A;  2CNT A;  3KHZ A;  4UWI A;  4YRH A;  5JM6 A;  3WC5 A;  5DS0 A;  2VQY A;  2O28 A;  3QNV A;  3D7H A;  3UY5 A;  2AFW A;  3LWU A;  4BBH A;  2AFX A;  2ZOG A;  1NSL A;  2DXQ A;  1QSO A;  2ARH A;  2XEF A;  1QSN A;  1DTD A;  4F6A A;  1LFW A;  1OZP A;  1IY7 A;  4HNW B;  3MGD A;  1S60 A;  4F9V A;  2ODF A;  4A37 A;  2R1I A;  2FSR A;  3IGR A;  4MFP A;  1S7N A;  1TF8 A;  4LUA A;  2ZEF A;  3IEH A;  1IU8 A;  4X8I A;  1XOV A;  2JLM A;  5FVJ A;  4L8A A;  3WT4 A;  3MRU A;  2AE6 A;  1YK3 A;  2HV2 A;  1LCP A;  1IYL A;  4Q7A A;  4NGT A;  3F8K A;  3PP9 A;  3FEE A;  2EO8 A;  3DLJ A;  3K9T A;  1J4J A;  3D7F A;  3HUV A;  3C26 A;  4JD6 A;  3EC4 A;  3A9L A;  1VHO A;  4WWV A;  4EWT A;  2F7V A;  2BCO A;  3B3S A;  3FNC A;  4KOV A;  4ORF A;  4CAF A;  4U5Y A;  4F8Z A;  1YVO A;  2IL4 A;  3S9M A;  4QUS A;  1Z4E A;  1Z8W A;  5F09 A;  1QQ9 A;  3CZX A;  1JWQ A;  2XEI A;  2QIR A;  3BJ8 A;  2FIA A;  4FD4 A;  4NGN A;  2V8H A;  4MCR A;  5KTC A;  1Z2L A;  2P6G A;  3FF3 A;  3VWD A;  4FAI A;  4G1P A;  3PB8 X;  1ZG7 A;  1ZLH A;  1YW6 A;  1Z8L A;  2OU2 A;  4ZY1 A;  2ABZ A;  4R8F A;  5LYD A;  1BAV A;  1R43 A;  4MCP A;  1HDQ A;  1YLE A;  3QAH A;  2H5M A;  2PJ7 A;  1KUV A;  3SI0 A;  4KSA A;  2ZW5 A;  4PSW A;  3SJG A;  4OKO A;  4PK3 A;  2ZW4 A;  4M6I A;  4A32 A;  1Y7E A;  2ATR A;  1CP7 A;  2DPT A;  3I1U A;  3OWC A;  5AG6 A;  4AVB A;  1YGH A;  2Q4Z A;  4NGS A;  2P6E A;  2O4H A;  2BUE A;  1Y0Y A;  4X5K A;  1I12 A;  4OAE A;  1ARL A;  2Z0Z A;  4U9Z A;  2DEA A;  3GY9 A;  3D66 A;  4NXY A;  4PQA A;  3FB3 A;  2C6P A;  3ISX A;  3NA6 A;  1XIX A;  3K2K A;  3SHP A;  4OC4 A;  2PC1 A;  3F0A A;  1U6M A;  4OIW A;  4UWJ A;  1BPM A;  4R7M A;  1YSJ A;  4O23 A;  2Q51 A;  1TKJ A;  2YNC A;  4P4D A;  1PCA A;  5KTD A;  5LYI A;  5J1Q A;  2ZPA A;  2VZZ A;  3DR6 A;  2PVW A;  4CRY B;  1CPS A;  2REE A;  3NE7 A;  2V8D A;  4B13 A;  3PZJ A;  1BO4 A;  2OOT A;  1YX0 A;  2D4P A;  4E0A A;  3FIX A;  2AFO A;  4KLV A;  1QMU A;  2IQ6 A;  4NGQ A;  5LYF A;  4OID A;  4UBR A;  3RZA A;  3BHX A;  1XMB A;  4LQ6 A;  2PCU A;  3PFO A;  2BOA A;  2PJ9 A;  3R9G A;  3PFE A;  4MFJ A;  3PBB A;  1VHS A;  3PGP A;  3N5F A;  2FCK A;  2PR8 A;  5F49 A;  3R9E A;  3ZZI A;  3SJF A;  4CGM A;  2Q7B A;  1B87 A;  4KOY A;  2C1C A;  1CJW A;  4KOW A;  4QVT A;  4CGO A;  1DE4 C;  1AUG A;  2PIZ A;  1ZO0 A;  4P4I A;  4PPZ A;  3D7D A;  4MHN A;  4R76 A;  4TNU A;  1CG2 A;  2CNM A;  4HNY B;  3D4U A;  3GIU A;  3WAB A;  1VKC A;  2QJ8 A;  4NFR A;  1XMT A;  4QC6 A;  2B3V A;  1LAP A;  1Y7R A;  3SXN A;  3TO7 A;  1GYT A;  2GFQ A;  2PJ6 A;  4OC1 A;  4R3L A;  3KQX A;  1KUY A;  2FE7 A;  4XPK A;  3T90 A;  3KHX A;  2OZU A;  1ZG9 A;  5IB9 A;  5LRJ A;  4M6H A;  5ISV A;  1YR0 A;  4H2K A;  4YU9 A;  2DF5 A;  4PXC A;  3RO0 A;  4E8O A;  3FX6 A;  5ELY A;  2Q4Y A;  2Q4V A;  5G20 A;  4E2A A;  3FYN A;  1Y0R A;  3G8W A;  2Z3P A;  1CPX A;  3IO1 A;  3K9U A;  3S9N A;  1Z8T A;  3G3S A;  4MFZ A;  2KCW A;  3R95 A;  2C6C A;  1RXT A;  1YME A;  2Q43 A;  4H6Z A;  5JPH A;  4UFW A;  1BLL E;  1S7K A;  2ZED A;  2YNE A;  3I3G A;  1ELL P;  1AYE A;  4P44 A;  4QB9 A;  3VH9 A;  1M4G A;  1Q2Y A;  4ZY2 A;  2YNC C;  3QB8 A;  5A27 A;  2ZEN A;  1FT7 A;  4P6Y A;  2FIW A;  4C68 A;  5IB0 A;  1TF9 A;  2P0W A;  4B5P B;  4UEZ A;  4TWE A;  4CYN A;  4ZGY B;  3VWE A;  4M3S A;  4QBJ A;  4KVO E;  4M6G A;  2RFH A;  4MRI A;  4A38 A;  2CIJ A;  4AB7 A;  4JJX A;  3FVL A;  2ANP A;  2JDC A;  4R57 A;  1XBU A;  4AG9 A;  3FXT A;  1QSR A;  3TC8 A;  1F57 A;  3CPX A;  4DNC A;  1X12 A;  3HLP A;  4X2T A;  5AG5 A;  4NF1 A;  2BSW A;  2REF A;  1IGB A;  4YWY A;  4YFJ A;  1M4D A;  3FMC A;  3B8G A;  2IMO A;  4LQG A;  2G0B A;  2NMT A;  4AVA A;  4MHZ A;  4XNH B;  1TXR A;  4BIN A;  5CBM A;  2GIV A;  1R3N A;  3KL9 A;  4KOT A;  4KOX A;  1LAM A;  4FWU A;  2NYQ A;  1M44 A;  1Q7L A;  2PJ8 A;  3GB0 A;  3R1K A;  2OZH A;  4JLY A;  4CGN A;  4KSI A;  4UCN A;  2OH1 A;  2WUU A;  4R87 A;  3FED A;  2J9A A;  5K8P A;  1RTQ A;  2PJ4 A;  1Q2D A;  3IWW A;  4PXD A;  2RB7 A;  1XRY A;  4ZYQ A;  3D68 A;  3D7G A;  2B4D A;  4KVX A;  2PE3 A;  4OC0 A;  3LMS A;  2GE3 A;  2AFU A;  5BWA B;  4KVM E;  5H86 A; 
#chains in the Genus database with same CATH homology
 4MI4 A;  5F48 A;  4CGP A;  1PUA A;  3D8P A;  1Z4R A;  4A30 A;  4C7I A;  2B4B A;  2ZW6 A;  4NCZ A;  5JQ4 A;  4FD7 A;  5G22 A;  1MJ9 A;  1Y9W A;  1M1D A;  2JDD A;  3ZJ0 A;  3S6F A;  3EXN A;  3TOB A;  4K30 A;  2R7H A;  3GKR A;  2B5G A;  2WSA A;  3IU2 A;  4XPD B;  2CXA A;  2HUZ A;  4IUS A;  3TFY A;  4JWP A;  2Z3O A;  4C2Y A;  5C82 A;  4C2Z A;  4GS4 A;  4B11 A;  3P2H A;  5EC4 A;  4F0Y A;  2ZW7 A;  1S3Z A;  4KSF A;  4A2Z A;  1Z9U A;  5DWM A;  3S6H A;  4B10 A;  1GHE A;  3DDD A;  3N7Z A;  2BEI A;  1S5K A;  2G3A A;  3W6X A;  4CGL A;  2PRB A;  2Z11 A;  4CYO A;  4Q36 A;  4B5O A;  3JTK A;  4YGO A;  3IWE A;  5HH1 A;  1XEB A;  2OB0 A;  3V8I A;  4FD6 A;  4HKF A;  1WK4 A;  4A95 A;  2C27 A;  5C88 A;  1PU9 A;  1P4N A;  4C7H A;  3KKW A;  4Y49 C;  2VZY A;  1WWZ A;  2PSW A;  1Y9K A;  3TOA A;  1FY7 A;  4IF5 A;  4HNX B;  4MY0 A;  4FD5 A;  2YGW A;  4UFV A;  2AJ6 A;  1BOB A;  3TTH A;  2Z3L A;  4CAX A;  2R8V A;  4AVC A;  4UFX A;  4JXR A;  4MJ8 A;  4UCP A;  5H84 A;  1YVK A;  4B14 A;  4ZBG A;  4U9Y A;  2VEZ A;  3DNS A;  4Q38 A;  3TO6 A;  3S6G A;  2G3T A;  1ON0 A;  3LOD A;  4PV6 A;  1SQH A;  4MY3 A;  2QML A;  1MJA A;  4I49 A;  2EVN A;  4CRZ B;  3BLN A;  4KZT A;  1CM0 A;  2CY2 A;  1YRE A;  5F46 A;  4CAV A;  1IYK A;  3E0K A;  2P6F A;  1B6B A;  4NSQ A;  3TT2 A;  4BMH A;  4LX9 A;  4RS2 A;  1MK4 A;  5EBV A;  3D2P A;  4UA3 A;  2JEV A;  4R9M A;  1XF8 A;  4KUB A;  2I00 A;  4KOU A;  4XPL A;  2X7B A;  3IU1 A;  5DWN A;  3FBU A;  4AG7 A;  3W6S A;  2EUI A;  5HMN A;  3CXS A;  3H5Z A;  3FRM A;  1KUX A;  1N71 A;  3JVN A;  2Z3N A;  3I9S A;  4KOS A;  4M85 A;  5AG4 A;  3IWG A;  4J3G A;  2D4O A;  1MJB A;  2ZXV A;  4F0X A;  2VXK A;  4B12 A;  3TE4 A;  4XNH C;  2GAN A;  3BJ7 A;  2WPX A;  4MFK A;  3SXO A;  3DSB A;  2B3U A;  1M4I A;  4R3K A;  2J8R A;  1QST A;  3CXP A;  4KUA A;  4MHD A;  5G1Z A;  3LD2 A;  3JUW A;  4MFQ A;  3CXQ A;  1L0C A;  2PQ8 A;  2Q44 A;  4L89 A;  2R98 A;  3WR7 A;  2FXF A;  1P0H A;  1K4J A;  4OAD A;  5I0C A;  5IX3 A;  4OLL A;  4KOR A;  4JXQ A;  3H4Q A;  1V0C A;  1TIQ A;  1RO5 A;  4KS9 A;  1S7L A;  2YND A;  4H89 A;  2RC4 A;  4EVY A;  2A4N A;  2Q04 A;  3EO4 A;  4A31 A;  4CYQ A;  2FS5 A;  5J8F A;  4A33 A;  2PDO A;  4MBU A;  5A28 A;  2Z3K A;  3DR8 A;  4NEX A;  3TO9 A;  4CS0 B;  2VI7 A;  1IB1 E;  2K5T A;  1IIC A;  2B4D B;  4CAE A;  4PSX A;  5F47 A;  2FT0 A;  3EY5 A;  4CAW A;  4B5P A;  1I21 A;  2PR1 A;  3EFA A;  5AG7 A;  4XPD C;  5G21 A;  2Z10 A;  4Y49 B;  1KZF A;  5E96 A;  2BL1 A;  3TCV A;  2B58 A;  4UCM A;  1NE9 A;  4RI1 A;  1NMT A;  5IV0 A;  2OZG A;  3P2F A;  1S7F A;  2J8M A;  5CNP A;  2HQY A;  1LRZ A;  1QSM A;  1R57 A;  5GCN A;  2CNS A;  1Q2C A;  3GYA A;  2J8N A;  2Y0M A;  2Z3M A;  5AGE A;  1XE4 A;  2WPW A;  3D2M A;  4CYP A;  4II9 A;  3F5B A;  3D3S A;  2B5G B;  3S6K A;  5KTA A;  1I1D A;  2DPS A;  2I79 A;  4MFL A;  4PK2 A;  4H6U A;  3W91 A;  4C2X A;  4ONU A;  3R9F A;  2QEC A;  2VBQ A;  2Q0Y A;  3RYO A;  1IID A;  1UFH A;  2FL4 A;  2F5I A;  5J8C A;  3T9Y A;  4KLW A;  3R96 A;  2CNT A;  4UWI A;  4YRH A;  2VQY A;  2O28 A;  3UY5 A;  4BBH A;  1NSL A;  2DXQ A;  1QSO A;  2ARH A;  1QSN A;  4F6A A;  1OZP A;  4HNW B;  3MGD A;  1S60 A;  2R1I A;  2FSR A;  3IGR A;  4MFP A;  1S7N A;  4LUA A;  2JLM A;  5FVJ A;  4L8A A;  2AE6 A;  1YK3 A;  2HV2 A;  1IYL A;  3F8K A;  3PP9 A;  1J4J A;  3C26 A;  4JD6 A;  3EC4 A;  3A9L A;  3FNC A;  4CAF A;  4KOV A;  4ORF A;  4U5Y A;  1YVO A;  2IL4 A;  4QUS A;  1Z4E A;  2QIR A;  3BJ8 A;  2FIA A;  4FD4 A;  5KTC A;  3VWD A;  2P6G A;  2OU2 A;  1YLE A;  3QAH A;  2H5M A;  1KUV A;  4KSA A;  2ZW5 A;  4PSW A;  4PK3 A;  2ZW4 A;  4A32 A;  2ATR A;  2DPT A;  3OWC A;  5AG6 A;  4AVB A;  1YGH A;  2P6E A;  2BUE A;  4X5K A;  1I12 A;  4OAE A;  2Z0Z A;  4U9Z A;  3GY9 A;  4NXY A;  3FB3 A;  1XIX A;  3SHP A;  2PC1 A;  3F0A A;  1U6M A;  4UWJ A;  2YNC A;  5KTD A;  2ZPA A;  2VZZ A;  3DR6 A;  4CRY B;  2REE A;  3NE7 A;  4B13 A;  3PZJ A;  1BO4 A;  1YX0 A;  2D4P A;  4E0A A;  3FIX A;  4KLV A;  4UBR A;  3R9G A;  4MFJ A;  1VHS A;  3PGP A;  3R9E A;  2FCK A;  2PR8 A;  5F49 A;  3ZZI A;  4CGM A;  2Q7B A;  1B87 A;  4KOY A;  1CJW A;  4KOW A;  4QVT A;  4CGO A;  1ZO0 A;  2CNM A;  4HNY B;  1VKC A;  1XMT A;  4QC6 A;  2B3V A;  1Y7R A;  3SXN A;  3TO7 A;  4R3L A;  1KUY A;  2FE7 A;  4XPK A;  3T90 A;  2OZU A;  5ISV A;  1YR0 A;  4E8O A;  4E2A A;  2Q4Y A;  2Q4V A;  5G20 A;  3FYN A;  3G8W A;  2Z3P A;  3K9U A;  3G3S A;  4MFZ A;  2KCW A;  3R95 A;  1RXT A;  4H6Z A;  5JPH A;  4UFW A;  1S7K A;  2YNE A;  3I3G A;  4QB9 A;  1M4G A;  1Q2Y A;  2YNC C;  3QB8 A;  5A27 A;  2FIW A;  4C68 A;  5IB0 A;  4B5P B;  2P0W A;  4CYN A;  4ZGY B;  3VWE A;  4M3S A;  4QBJ A;  4KVO E;  4AB7 A;  4JJX A;  2JDC A;  4R57 A;  4AG9 A;  3FXT A;  1QSR A;  4DNC A;  5AG5 A;  4NF1 A;  2BSW A;  2REF A;  4YFJ A;  1M4D A;  3B8G A;  2G0B A;  2NMT A;  4AVA A;  4XNH B;  2GIV A;  4KOT A;  4KOX A;  1M44 A;  4CGN A;  4JLY A;  3R1K A;  2OZH A;  4UCN A;  2OH1 A;  2WUU A;  4R87 A;  1Q2D A;  4KVX A;  2B4D A;  2GE3 A;  5BWA B;  4KVM E;  5H86 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...