4MFJA

The crystal structure of acyltransferase
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
328
structure length
328
Chain Sequence
GSHMMMDPETVRIALGLEERTAAWLTELDELGPPAEPVRLPRGEEARDLLRRLEVPELDAEEIVAAAPDPDRDPALWWLLERTHHAIVRHMGDHRAKPRGGPPLPYEGGAAARYFHVYVFLATVPAVRRFHAERGIPDEVGWETLTQLGELVAIHRRKYGQGGMNMQWWTTYHLRGILYRLGRLQFSLATGKDGTPHLGLHVPEWGGPLLPKAYDESLHRARPFFDRHFPEHGARVAWGSSWMLDPQLEEYLTEDSNIIQLARFWTLTDSAPEPGNADGDSSILEFVFRYNGQPLDELPQRSSLERAVIAHLKAGRHWHMRTGFVKLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Putative uncharacterized protein tcp24
publication title Multiple complexes of long aliphatic N-acyltransferases lead to synthesis of 2,6-diacylated/2-acyl-substituted glycopeptide antibiotics, effectively killing vancomycin-resistant enterococcus
pubmed doi rcsb
source organism Actinoplanes teichomyceticus
total genus 97
structure length 328
sequence length 328
ec nomenclature ec 2.3.1.-:
pdb deposition date 2013-08-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18082 DUF5596 Domain of unknown function (DUF5596)
A PF18164 GNAT_C GNAT-like C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.120 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4mfjA02
4MFPA 4MFJA 4MFKA 4MFZA 4Q38A 4Q36A 4MFLA 4MFQA
chains in the Genus database with same CATH superfamily
3KR5A 3RO0A 1Z8TA 2P0WA 4UEZA 4DNCA 4OC1A 2G3AA 1CP6A 1CP7A 3IIBA 4GXHA 1CM0A 4PK2A 4CGMA 3D3SA 2WSAA 5EMIA 4AB7A 2XEJA 4R8FA 3B3VA 2WYRA 3R9EA 2R7HA 3B8GA 4MMOA 2ZW6A 2G3TA 5THWA 4MFLA 3I9SA 2PQ8A 4GM5A 3IWWA 1LFWA 5FVJA 4AVAA 3BI0A 4NJRA 2QJ8A 3GIUA 1MK4A 3NFZA 4CAFA 5BWAB 2Q04A 1CPXA 1IB1E 5LRKA 1DE4C 4R87A 1S7FA 5E96A 1CPSA 4AG9A 1RXTA 4AVBA 3SJGA 2Z3KA 3SI0A 3WR7A 2V8GA 1IOFA 3GLJA 1PU9A 2XEGA 4FD4A 3FVLA 3S9MA 2VQYA 4P4BA 2ABZA 3L2NA 5KTAA 2PJBA 3GYAA 1PCAA 2POKA 3C26A 3CPXA 4Y49C 4A38A 1YGHA 4BMHA 1NE9A 3F8KA 1QSMA 3D2PA 4MFKA 3V7ZA 3ZZIA 2VL1A 3CPAA 4PPZA 3R9GA 3VARA 2C6GA 1IOIA 3IU2A 4BD9A 2YNDA 1Q2YA 1YSJA 2FSRA 3MRUA 3S6KA 2GREA 4M6GA 4NCZA 4F8ZA 2B3UA 2PIZA 1FT7A 3NE7A 3T8WA 4MFZA 4C2ZA 3B3SA 2PC1A 2JDDA 1AYEA 1MJ9A 3R96A 4WJBA 1J4JA 1QSOA 4NF1A 4X2TA 2D4OA 4PV6A 3K9UA 4CAVA 1LAMA 5KTCA 1IIDA 2ZW4A 1Y0RA 4KOVA 2G0BA 3H5ZA 4EVYA 2V8HA 2ZOFA 5HMNA 3TO9A 5D29A 4CGLA 4JXQA 4B5PB 3T9YA 4AG7A 2XEIA 4OLLA 2YNCA 4R57A 4Y49B 2PVVA 3SJFA 5AG5A 4OC2A 4P4EA 4CRYB 4MCQA 2JEVA 1EE3P 4PSWA 3FF3A 1KUVA 4A31A 3VWEA 4B13A 4OIDA 4DYOA 1Z8XA 4F9VA 4YWYA 2BO9A 4KOTA 4HNXB 3VH9A 4NGTA 4CAEA 5A27A 3DLJA 4UFXA 5J1QA 2ZEHA 2Z3PA 3E0KA 2Z3MA 4PXCA 4GS4A 4C2YA 4MI4A 3KHXA 4X8IA 4R6TA 2FVGA 4QUSA 5C88A 2K5TA 2ZEMA 5K8NA 3DGVA 2AE6A 4HPSA 2PJ5A 1DTDA 2C6CA 3ZJ0A 2H5MA 2VEZA 4JXRA 3CXPA 4NGRA 4JLYA 4II9A 4H6ZA 2AFUA 1MJAA 3FEDA 2ZW7A 3D8PA 1ARLA 1XE4A 2GLFA 3WT4A 2VZYA 4XNHC 2JLMA 4UCPA 4UBRA 5I0CA 1QSRA 2X7BA 1VHOA 4KVOE 1XBUA 4CGNA 2EVNA 4J3GA 4FD6A 2WUUA 2Y0MA 1VHEA 4KOYA 4M3SA 2VXKA 3UY5A 4CGPA 2BSWA 3D7DA 3EO4A 1P0HA 4UA3A 2ZW5A 2F8HA 2J8MA 1BAVA 4FD5A 3B2YA 4TWEA 5DS0A 2Q4VA 3IEHA 4JWPA 4K3NA 2OZHA 2FCKA 2CIJA 2BCOA 2J9AA 4G1PA 4IAVA 2OOTA 4YRHA 2R1IA 4M6HA 3FJUA 3T90A 6CPAA 2Q4YA 2QIRA 2C1CA 4NGMA 4UEEA 3PP9A 4MJ8A 3D7FA 4JD6A 3NH5A 4QB9A 1TF9A 5EC4A 5HXDA 3RBUA 2F5IA 2ZENA 2DPTA 3SJEA 1XMBA 2PIYA 3GKRA 4OC4A 2ODFA 4A32A 4F6AA 2PVWA 3CXSA 2QECA 1IY7A 2PCUA 3PB8X 1R57A 1UFHA 3GUXA 1ZLIA 4UIAA 3WC7A 3SI1A 4U5YA 4A2ZA 1VIXA 1Z4EA 4H2KA 2PJAA 3SJXA 2O53A 4XNHB 2PJ6A 3IU1A 3QNVA 3SXOA 1X10A 3NH8A 1QMUA 1KUYA 1Z8LA 1Y7RA 3IO1A 2B3VA 2Q7SA 1S60A 1XMTA 1HEEA 2ZEFA 1YLOA 2HV2A 4ZY2A 2PR1A 4E2AA 5IB9A 2PJCA 4YFJA 1JWQA 3WABA 3EY5A 3WC6A 3H4QA 4JZ0A 1BOBA 1QQ9A 3R1KA 3PEIA 1LRZA 2PJ4A 3BI1A 4KOUA 2ZEGA 3LODA 5CBMA 1H8LA 2QYVA 5J8CA 2OU2A 2Q4ZA 1WWZA 2RC4A 3S6FA 4MBUA 2V77A 4PSXA 1Y9WA 2ZEDA 2ARHA 4R3LA 4ONWA 1OBRA 4FWUA 3RNZA 2CY2A 3F5BA 3IGRA 3D66A 3VATA 1TKFA 1OZPA 1ELMP 3LWUA 4EFDA 2RB7A 1P4NA 1S7KA 2Q0YA 3H8GA 4Q36A 4YGOA 4IF5A 3FEEA 1B87A 1LANA 1FNOA 2PDOA 1IGBA 4B6ZA 1BPNA 1IYKA 2IL4A 1XEBA 3FX6A 4KS9A 2YNCC 1ZG8A 2WZNA 5IX3A 3FH4A 4KZTA 4OMEA 2P6FA 4OC0A 4CPAA 1IYLA 3IJ3A 2QMLA 2CNMA 2Q43A 4R9MA 3TFYA 3R95A 1TIQA 5HVGA 1N71A 1A2ZA 4NSQA 3FRMA 5G1ZA 1TKHA 2GIVA 1S7NA 3DNSA 5AGEA 1Y9KA 3H8FA 4UWIA 1Q2CA 1MJBA 2P6EA 3RZAA 3KZWA 3TCVA 4HKFA 1AUGA 4MY0A 1V0CA 2IQ6A 1KUXA 4OAEA 5F46A 3SI2A 2AFMA 4M6IA 5JPHA 4PXDA 4NXYA 4MY3A 2OZGA 3I1UA 4QVTA 2ZELA 5LYDA 1R3NA 2PJ8A 2PRBA 3PB9X 2HQYA 3TX8A 3R9FA 5I4MA 3TO7A 5D8NA 1M1DA 2G9DA 4K30A 5JQ4A 1M4GA 2ZEOA 4ZY0A 5A28A 5F09A 1ON0A 3D67A 3H8EA 4MHZA 2Z10A 2EUIA 3WC5A 2JEWA 1ZLHA 4DUKA 1B6BA 2Q7BA 2BL1A 1LAPA 2PJ7A 4CYPA 1KWMA 2ZEPA 3MN8A 3KGQA 4P4JA 3VWDA 4CYNA 3JTKA 1NMTA 4KOWA 4XPDC 4CYQA 4Z65A 2DXQA 3B7IA 1M44A 4IK2A 4ZX9A 4MHPA 3LACA 4A39A 2Z3OA 5LYIA 4P10A 5LYFA 4FUUA 1BLLE 3BLNA 1ARMA 4FD7A 4MCSA 4UWJA 2B58A 4F0YA 1SQHA 1TKJA 2WPWA 1FY7A 2FIWA 1XOVA 2FT0A 2HC9A 2Z3NA 4IHMA 1ZG9A 4B10A 2BOAA 2F7VA 1L0CA 4AXVA 2BEIA 4LQ6A 2JBJA 2ZXVA 2YNEA 1IICA 2WPXA 2Z3LA 3FBUA 3PBEA 3SXNA 2Z11A 5ISVA 2C27A 2GFQA 5K8PA 3ISZA 4AVCA 3CZXA 4B12A 2OB0A 3D2MA 4PXEA 4EWTA 7CPAA 5JM6A 2I79A 3B3CA 2O4HA 1ZO0A 3KQZA 1BO4A 2IJZA 2J8RA 3D4UA 3KKWA 1CBXA 4C7HA 5K8OA 3KR4A 3PFEA 5G22A 4A37A 4LUAA 4KVXA 4H89A 2PJ0A 4OP4A 4P4IA 4A95A 1YQEA 2EK8A 3B3WA 4ZBGA 3K2KA 5LRGA 1F2PA 4A94A 4E0AA 3B3TA 3BJ7A 3FMCA 2GLJA 1BPMA 4NJQA 3PB4X 4PK3A 5AG7A 1CG2A 2CXAA 1X12A 2CF4A 4IUSA 1R43A 4BBHA 5G21A 2P6GA 2ZEEA 8CPAA 3NH4A 3PBBA 4XPDB 1Z9UA 5G20A 4RS2A 4X3RA 1LCPA 3A9LA 3DSBA 3P2HA 3BHXA 1YW6A 4E8OA 5IB0A 4FAIA 4MFQA 3BJ8A 4P4DA 4NFRA 4A33A 1M4LA 3EFAA 2EO8A 3S9LA 3QAYA 4BINA 1CX8A 3V38A 2JBKA 1NSAA 1Z4RA 4JYWA 4C2XA 4MHDA 4P4FA 2ZOGA 1CJWA 3PFOA 2Q51A 3N7ZA 4DJLA 1TF8A 1QSTA 1M4IA 4WWVA 1YLEA 2JDCA 4NEXA 1AMPA 2AJ6A 2DF5A 4R76A 3TOBA 3PGPA 5K8MA 3KQXA 3IFEA 3S6GA 4OC3A 1LOKA 2V8DA 4JJXA 3JVNA 5HH1A 3TC8A 4OADA 4YU9A 4MHYA 3CXQA 4KVME 4EMEA 4LX9A 1Z2LA 1U6MA 3FB3A 3KI9A 4UF4A 5CPAA 4Q38A 2AFZA 1ELLP 4CYOA 3OWCA 3S9NA 5DWNA 4KSAA 1GHEA 4Q7AA 3GY9A 3W6XA 3CT9A 3FYNA 3FIXA 3G3SA 5KTDA 1XFOA 5H86A 3QAHA 2PJ2A 2AFSA 1F57A 1HDUA 2ZPAA 1I21A 4CAXA 2ATRA 3D7GA 5AG6A 4CS0B 2ANPA 4HNWB 4RN7A 4F0XA 5AG4A 3K9TA 2HUZA 2GANA 2XEFA 4ONUA 2D4PA 1Y0YA 1S3ZA 3EXNA 2QVPA 3JRUA 3TTHA 4ZX8A 2CTBA 1IU8A 3TO6A 1JQGA 2PR8A 5DWMA 2EK9A 2B5GA 2CTCA 4KUAA 4L8AA 2PJ1A 1QSNA 3FNCA 1XF8A 4H6UA 4MFPA 4PXBA 1I1DA 4M85A 3SHPA 5JH9A 3JUWA 4B5OA 5HVHA 4C7IA 5LRJA 4MRIA 2VBQA 3EC4A 1ZG7A 2PE3A 3G8WA 4MFJA 5EBVA 3FECA 3W91A 2B5GB 1YVOA 1KZFA 2O28A 3NE8A 5F47A 3CDXA 1XRYA 1I12A 4P45A 1YW4A 2DPSA 2EWBA 2V8VA 3IC1A 3KHZA 3KASA 5HVFA 4KUBA 2VZZA 4P6YA 4B5PA 1XIXA 4RUHA 2PRQA 2IMOA 4LQGA 4PQAA 4UFWA 4ZGYB 4ZI6A 4I49A 3I3GA 1WK4A 2B4BA 4KSFA 3W6SA 4KOXA 4RI1A 4NGQA 2GE3A 1YX0A 2C6PA 4XPLA 1S5KA 4MCRA 2REFA 4CRZB 4QBJA 5C82A 5JGFA 4UEFA 2A4NA 3MGDA 1YK3A 3PB6X 2PJ3A 4UFVA 5GCNA 4XPKA 3PZJA 5LYLA 4TNUA 2FL4A 1GYTA 4OIWA 4X5KA 5IV0A 1VGYA 5F49A 3RYOA 2FIAA 3HLPA 4NGNA 3TT2A 2AFWA 2OR4A 2Q44A 3RAMA 2OZUA 3QB8A 2NSMA 1YR0A 1VKCA 2PJ9A 4MHNA 1UWYA 1YVKA 1VHSA 4MCPA 4W9YA 4KLWA 1NSLA 1Q2DA 1HDQA 1XJOA 1RTQA 2FE7A 3ISXA 4NGSA 4UCMA 4NGPA 3FXTA 2GU2A 4KSIA 3LD2A 2B4DA 3DDDA 2YGWA 4UIBA 3D7HA 5H84A 3S6HA 3BXMA 4ZY1A 1K4JA 2R98A 3GB0A 3P2FA 3IWEA 1RO5A 3N5FA 4ORFA 4KLVA 4C68A 4P44A 4UCNA 2PSWA 4F9UA 1Y7EA 3B35A 5F48A 4CGOA 2RFHA 4R3KA 4ZYQA 4B14A 2B4DB 2HB6A 4FBEA 3IWGA 2NYQA 3D68A 4MXUA 5J8FA 3HUVA 3NA6A 1Q7LA 1Z5RA 3F0AA 3PB7X 1YREA 5ELYA 2I3CA 2FXFA 4QC6A 2Z0ZA 2KCWA 4KORA 1M4DA 2DEAA 5CNPA 4L89A 4U9ZA 2CNSA 2REEA 2I00A 2VI7A 3DR6A 4U9YA 2EBJA 4OKOA 1F2OA 3DR8A 1TXRA 4HNYB 1PYTB 2OH1A 2CNTA 4CAWA 3LMSA 3KL9A 2NMTA 2AFXA 3TOAA 4OC5A 1Z8WA 1S7LA 2AFOA 1PUAA 2BUEA 2J8NA 2R8VA 3PRTA 4R7MA 4A30A 3TE4A 1YMEA 2FS5A 4KOSA 3V8IA 4O23A 4B11A
chains in the Genus database with same CATH topology
4DNCA 2P0WA 2G3AA 1CM0A 4PK2A 4CGMA 3D3SA 2WSAA 4AB7A 3R9EA 2R7HA 3B8GA 2ZW6A 2G3TA 4MFLA 3I9SA 2PQ8A 5FVJA 4AVAA 1MK4A 4CAFA 5BWAB 2Q04A 1IB1E 4R87A 1S7FA 5E96A 4AG9A 1RXTA 4AVBA 3WR7A 2Z3KA 1PU9A 4FD4A 2VQYA 5KTAA 3GYAA 3C26A 4Y49C 4BMHA 1YGHA 1NE9A 3F8KA 1QSMA 3D2PA 4MFKA 3ZZIA 3R9GA 3IU2A 2YNDA 1Q2YA 2FSRA 3S6KA 4NCZA 2B3UA 3NE7A 4MFZA 4C2ZA 2PC1A 2JDDA 1MJ9A 3R96A 1J4JA 1QSOA 4NF1A 2D4OA 4PV6A 3K9UA 4CAVA 5KTCA 1IIDA 2ZW4A 4KOVA 2G0BA 3H5ZA 4EVYA 5HMNA 3TO9A 4CGLA 4JXQA 4B5PB 3T9YA 4AG7A 4OLLA 2YNCA 4R57A 4Y49B 5AG5A 4CRYB 2JEVA 4PSWA 1KUVA 4A31A 3VWEA 4B13A 4KOTA 4HNXB 4CAEA 5A27A 4UFXA 2Z3PA 3E0KA 2Z3MA 4GS4A 4C2YA 4MI4A 5C88A 4QUSA 2K5TA 2AE6A 3ZJ0A 2H5MA 2VEZA 4JXRA 3CXPA 4JLYA 4II9A 4H6ZA 1MJAA 2ZW7A 3D8PA 1XE4A 2VZYA 4XNHC 2JLMA 4UCPA 4UBRA 5I0CA 1QSRA 2X7BA 4KVOE 4CGNA 2EVNA 4J3GA 4FD6A 2WUUA 2Y0MA 3UY5A 4KOYA 4M3SA 2VXKA 4CGPA 2BSWA 3EO4A 1P0HA 4UA3A 2ZW5A 2J8MA 4FD5A 2Q4VA 4JWPA 2OZHA 2FCKA 3T90A 4YRHA 2R1IA 2Q4YA 2QIRA 3PP9A 4MJ8A 4QB9A 4JD6A 5EC4A 2F5IA 2DPTA 3GKRA 4A32A 4F6AA 3CXSA 2QECA 1R57A 1UFHA 4U5YA 4A2ZA 1Z4EA 4XNHB 3IU1A 3SXOA 1KUYA 1Y7RA 2B3VA 1S60A 1XMTA 2HV2A 2PR1A 4E2AA 4YFJA 3EY5A 3H4QA 1BOBA 3R1KA 1LRZA 4KOUA 3LODA 5J8CA 2OU2A 3S6FA 1WWZA 2RC4A 4MBUA 4PSXA 1Y9WA 2ARHA 4R3LA 2CY2A 3F5BA 3IGRA 1OZPA 1P4NA 1S7KA 2Q0YA 4Q36A 4YGOA 4IF5A 1B87A 2PDOA 1IYKA 2IL4A 1XEBA 4KS9A 2YNCC 5IX3A 4KZTA 2P6FA 1IYLA 2QMLA 2CNMA 4R9MA 3TFYA 3R95A 1TIQA 1N71A 5G1ZA 4NSQA 3FRMA 2GIVA 3DNSA 1S7NA 5AGEA 1Y9KA 4UWIA 1Q2CA 1MJBA 2P6EA 3TCVA 4HKFA 4MY0A 1V0CA 1KUXA 4OAEA 5F46A 4NXYA 4MY3A 2OZGA 4QVTA 2PRBA 2HQYA 3R9FA 3TO7A 1M1DA 4K30A 5JQ4A 1M4GA 5A28A 1ON0A 2Z10A 2EUIA 1B6BA 2Q7BA 2BL1A 4CYPA 3VWDA 4CYNA 3JTKA 1NMTA 4KOWA 4XPDC 4CYQA 2DXQA 1M44A 2Z3OA 3BLNA 4FD7A 4UWJA 2B58A 4F0YA 1SQHA 5GCNA 2WPWA 1FY7A 2FIWA 2FT0A 2Z3NA 5JPHA 4B10A 1L0CA 2BEIA 2ZXVA 2YNEA 1IICA 2WPXA 2Z3LA 3FBUA 3SXNA 2Z11A 5ISVA 2C27A 4AVCA 4B12A 2OB0A 3D2MA 2I79A 1ZO0A 1BO4A 2J8RA 3KKWA 4C7HA 5G22A 4LUAA 4KVXA 4H89A 4A95A 4ZBGA 4E0AA 3BJ7A 4PK3A 5AG7A 2CXAA 4IUSA 4BBHA 5G21A 2P6GA 4XPDB 1Z9UA 5G20A 4RS2A 3A9LA 3DSBA 3P2HA 4E8OA 5IB0A 4MFQA 3BJ8A 4A33A 3EFAA 1Z4RA 4C2XA 4MHDA 1CJWA 3N7ZA 1QSTA 1M4IA 1YLEA 2JDCA 4NEXA 2AJ6A 3TOBA 3PGPA 3S6GA 4JJXA 5HH1A 3JVNA 4OADA 3CXQA 4KVME 4LX9A 1U6MA 3FB3A 4Q38A 4CYOA 3OWCA 5DWNA 4KSAA 1GHEA 3GY9A 3W6XA 3FYNA 3FIXA 3G3SA 5KTDA 5H86A 3QAHA 2ZPAA 1I21A 4CAXA 2ATRA 5AG6A 4CS0B 4F0XA 5AG4A 4HNWB 2HUZA 2GANA 4ONUA 2D4PA 1S3ZA 3EXNA 3TTHA 3TO6A 2PR8A 5DWMA 2B5GA 4KUAA 4L8AA 1QSNA 3FNCA 1XF8A 4H6UA 4MFPA 1I1DA 4M85A 3SHPA 3JUWA 4B5OA 4C7IA 2VBQA 3EC4A 3G8WA 4MFJA 5EBVA 3W91A 2B5GB 1YVOA 1KZFA 2O28A 5F47A 1I12A 2DPSA 4KUBA 2VZZA 4B5PA 1XIXA 4ZGYB 4UFWA 4I49A 3I3GA 1WK4A 2B4BA 4KSFA 3W6SA 4KOXA 4RI1A 4XPLA 2GE3A 1YX0A 1S5KA 2REFA 4CRZB 4QBJA 5C82A 2A4NA 3MGDA 1YK3A 4UFVA 4XPKA 3PZJA 2FL4A 4X5KA 5IV0A 5F49A 3RYOA 2FIAA 3TT2A 2Q44A 2OZUA 3QB8A 1YR0A 1VKCA 1YVKA 1VHSA 1NSLA 4KLWA 1Q2DA 4UCMA 2FE7A 3FXTA 3LD2A 2B4DA 3DDDA 2YGWA 5H84A 3S6HA 1K4JA 2R98A 3P2FA 3IWEA 1RO5A 4ORFA 4KLVA 4C68A 4UCNA 2PSWA 5F48A 4CGOA 4R3KA 4B14A 2B4DB 3IWGA 5J8FA 3F0AA 1YREA 2FXFA 4QC6A 2Z0ZA 2KCWA 4KORA 1M4DA 5CNPA 4L89A 4U9ZA 2CNSA 2REEA 2I00A 2VI7A 3DR6A 4U9YA 3DR8A 4CAWA 4HNYB 2OH1A 2CNTA 2NMTA 3TOAA 1S7LA 1PUAA 2BUEA 2J8NA 2R8VA 4A30A 3TE4A 2FS5A 4KOSA 3V8IA 4B11A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MFP A;  4MFJ A;  4MFK A;  4MFZ A;  4Q38 A;  4Q36 A;  4MFL A;  4MFQ A; 
#chains in the Genus database with same CATH topology
 3KR5 A;  3RO0 A;  1Z8T A;  2P0W A;  4UEZ A;  4DNC A;  4OC1 A;  2G3A A;  1CP6 A;  1CP7 A;  3IIB A;  4GXH A;  1CM0 A;  4PK2 A;  4CGM A;  3D3S A;  2WSA A;  5EMI A;  4AB7 A;  2XEJ A;  4R8F A;  3B3V A;  2WYR A;  3R9E A;  2R7H A;  3B8G A;  4MMO A;  2ZW6 A;  2G3T A;  5THW A;  4MFL A;  3I9S A;  2PQ8 A;  4GM5 A;  3IWW A;  1LFW A;  5FVJ A;  4AVA A;  3BI0 A;  4NJR A;  2QJ8 A;  3GIU A;  1MK4 A;  3NFZ A;  4CAF A;  5BWA B;  2Q04 A;  1CPX A;  1IB1 E;  5LRK A;  1DE4 C;  4R87 A;  1S7F A;  5E96 A;  1CPS A;  4AG9 A;  1RXT A;  4AVB A;  3SJG A;  2Z3K A;  3SI0 A;  3WR7 A;  2V8G A;  1IOF A;  3GLJ A;  1PU9 A;  2XEG A;  4FD4 A;  3FVL A;  3S9M A;  2VQY A;  4P4B A;  2ABZ A;  3L2N A;  5KTA A;  2PJB A;  3GYA A;  1PCA A;  2POK A;  3C26 A;  3CPX A;  4Y49 C;  4A38 A;  1YGH A;  4BMH A;  1NE9 A;  3F8K A;  1QSM A;  3D2P A;  4MFK A;  3V7Z A;  3ZZI A;  2VL1 A;  3CPA A;  4PPZ A;  3R9G A;  3VAR A;  2C6G A;  1IOI A;  3IU2 A;  4BD9 A;  2YND A;  1Q2Y A;  1YSJ A;  2FSR A;  3MRU A;  3S6K A;  2GRE A;  4M6G A;  4NCZ A;  4F8Z A;  2B3U A;  2PIZ A;  1FT7 A;  3NE7 A;  3T8W A;  4MFZ A;  4C2Z A;  3B3S A;  2PC1 A;  2JDD A;  1AYE A;  1MJ9 A;  3R96 A;  4WJB A;  1J4J A;  1QSO A;  4NF1 A;  4X2T A;  2D4O A;  4PV6 A;  3K9U A;  4CAV A;  1LAM A;  5KTC A;  1IID A;  2ZW4 A;  1Y0R A;  4KOV A;  2G0B A;  3H5Z A;  4EVY A;  2V8H A;  2ZOF A;  5HMN A;  3TO9 A;  5D29 A;  4CGL A;  4JXQ A;  4B5P B;  3T9Y A;  4AG7 A;  2XEI A;  4OLL A;  2YNC A;  4R57 A;  4Y49 B;  2PVV A;  3SJF A;  5AG5 A;  4OC2 A;  4P4E A;  4CRY B;  4MCQ A;  2JEV A;  1EE3 P;  4PSW A;  3FF3 A;  1KUV A;  4A31 A;  3VWE A;  4B13 A;  4OID A;  4DYO A;  1Z8X A;  4F9V A;  4YWY A;  2BO9 A;  4KOT A;  4HNX B;  3VH9 A;  4NGT A;  4CAE A;  5A27 A;  3DLJ A;  4UFX A;  5J1Q A;  2ZEH A;  2Z3P A;  3E0K A;  2Z3M A;  4PXC A;  4GS4 A;  4C2Y A;  4MI4 A;  3KHX A;  4X8I A;  4R6T A;  2FVG A;  4QUS A;  5C88 A;  2K5T A;  2ZEM A;  5K8N A;  3DGV A;  2AE6 A;  4HPS A;  2PJ5 A;  1DTD A;  2C6C A;  3ZJ0 A;  2H5M A;  2VEZ A;  4JXR A;  3CXP A;  4NGR A;  4JLY A;  4II9 A;  4H6Z A;  2AFU A;  1MJA A;  3FED A;  2ZW7 A;  3D8P A;  1ARL A;  1XE4 A;  2GLF A;  3WT4 A;  2VZY A;  4XNH C;  2JLM A;  4UCP A;  4UBR A;  5I0C A;  1QSR A;  2X7B A;  1VHO A;  4KVO E;  1XBU A;  4CGN A;  2EVN A;  4J3G A;  4FD6 A;  2WUU A;  2Y0M A;  1VHE A;  4KOY A;  4M3S A;  2VXK A;  3UY5 A;  4CGP A;  2BSW A;  3D7D A;  3EO4 A;  1P0H A;  4UA3 A;  2ZW5 A;  2F8H A;  2J8M A;  1BAV A;  4FD5 A;  3B2Y A;  4TWE A;  5DS0 A;  2Q4V A;  3IEH A;  4JWP A;  4K3N A;  2OZH A;  2FCK A;  2CIJ A;  2BCO A;  2J9A A;  4G1P A;  4IAV A;  2OOT A;  4YRH A;  2R1I A;  4M6H A;  3FJU A;  3T90 A;  6CPA A;  2Q4Y A;  2QIR A;  2C1C A;  4NGM A;  4UEE A;  3PP9 A;  4MJ8 A;  3D7F A;  4JD6 A;  3NH5 A;  4QB9 A;  1TF9 A;  5EC4 A;  5HXD A;  3RBU A;  2F5I A;  2ZEN A;  2DPT A;  3SJE A;  1XMB A;  2PIY A;  3GKR A;  4OC4 A;  2ODF A;  4A32 A;  4F6A A;  2PVW A;  3CXS A;  2QEC A;  1IY7 A;  2PCU A;  3PB8 X;  1R57 A;  1UFH A;  3GUX A;  1ZLI A;  4UIA A;  3WC7 A;  3SI1 A;  4U5Y A;  4A2Z A;  1VIX A;  1Z4E A;  4H2K A;  2PJA A;  3SJX A;  2O53 A;  4XNH B;  2PJ6 A;  3IU1 A;  3QNV A;  3SXO A;  1X10 A;  3NH8 A;  1QMU A;  1KUY A;  1Z8L A;  1Y7R A;  3IO1 A;  2B3V A;  2Q7S A;  1S60 A;  1XMT A;  1HEE A;  2ZEF A;  1YLO A;  2HV2 A;  4ZY2 A;  2PR1 A;  4E2A A;  5IB9 A;  2PJC A;  4YFJ A;  1JWQ A;  3WAB A;  3EY5 A;  3WC6 A;  3H4Q A;  4JZ0 A;  1BOB A;  1QQ9 A;  3R1K A;  3PEI A;  1LRZ A;  2PJ4 A;  3BI1 A;  4KOU A;  2ZEG A;  3LOD A;  5CBM A;  1H8L A;  2QYV A;  5J8C A;  2OU2 A;  2Q4Z A;  1WWZ A;  2RC4 A;  3S6F A;  4MBU A;  2V77 A;  4PSX A;  1Y9W A;  2ZED A;  2ARH A;  4R3L A;  4ONW A;  1OBR A;  4FWU A;  3RNZ A;  2CY2 A;  3F5B A;  3IGR A;  3D66 A;  3VAT A;  1TKF A;  1OZP A;  1ELM P;  3LWU A;  4EFD A;  2RB7 A;  1P4N A;  1S7K A;  2Q0Y A;  3H8G A;  4Q36 A;  4YGO A;  4IF5 A;  3FEE A;  1B87 A;  1LAN A;  1FNO A;  2PDO A;  1IGB A;  4B6Z A;  1BPN A;  1IYK A;  2IL4 A;  1XEB A;  3FX6 A;  4KS9 A;  2YNC C;  1ZG8 A;  2WZN A;  5IX3 A;  3FH4 A;  4KZT A;  4OME A;  2P6F A;  4OC0 A;  4CPA A;  1IYL A;  3IJ3 A;  2QML A;  2CNM A;  2Q43 A;  4R9M A;  3TFY A;  3R95 A;  1TIQ A;  5HVG A;  1N71 A;  1A2Z A;  4NSQ A;  3FRM A;  5G1Z A;  1TKH A;  2GIV A;  1S7N A;  3DNS A;  5AGE A;  1Y9K A;  3H8F A;  4UWI A;  1Q2C A;  1MJB A;  2P6E A;  3RZA A;  3KZW A;  3TCV A;  4HKF A;  1AUG A;  4MY0 A;  1V0C A;  2IQ6 A;  1KUX A;  4OAE A;  5F46 A;  3SI2 A;  2AFM A;  4M6I A;  5JPH A;  4PXD A;  4NXY A;  4MY3 A;  2OZG A;  3I1U A;  4QVT A;  2ZEL A;  5LYD A;  1R3N A;  2PJ8 A;  2PRB A;  3PB9 X;  2HQY A;  3TX8 A;  3R9F A;  5I4M A;  3TO7 A;  5D8N A;  1M1D A;  2G9D A;  4K30 A;  5JQ4 A;  1M4G A;  2ZEO A;  4ZY0 A;  5A28 A;  5F09 A;  1ON0 A;  3D67 A;  3H8E A;  4MHZ A;  2Z10 A;  2EUI A;  3WC5 A;  2JEW A;  1ZLH A;  4DUK A;  1B6B A;  2Q7B A;  2BL1 A;  1LAP A;  2PJ7 A;  4CYP A;  1KWM A;  2ZEP A;  3MN8 A;  3KGQ A;  4P4J A;  3VWD A;  4CYN A;  3JTK A;  1NMT A;  4KOW A;  4XPD C;  4CYQ A;  4Z65 A;  2DXQ A;  3B7I A;  1M44 A;  4IK2 A;  4ZX9 A;  4MHP A;  3LAC A;  4A39 A;  2Z3O A;  5LYI A;  4P10 A;  5LYF A;  4FUU A;  1BLL E;  3BLN A;  1ARM A;  4FD7 A;  4MCS A;  4UWJ A;  2B58 A;  4F0Y A;  1SQH A;  1TKJ A;  2WPW A;  1FY7 A;  2FIW A;  1XOV A;  2FT0 A;  2HC9 A;  2Z3N A;  4IHM A;  1ZG9 A;  4B10 A;  2BOA A;  2F7V A;  1L0C A;  4AXV A;  2BEI A;  4LQ6 A;  2JBJ A;  2ZXV A;  2YNE A;  1IIC A;  2WPX A;  2Z3L A;  3FBU A;  3PBE A;  3SXN A;  2Z11 A;  5ISV A;  2C27 A;  2GFQ A;  5K8P A;  3ISZ A;  4AVC A;  3CZX A;  4B12 A;  2OB0 A;  3D2M A;  4PXE A;  4EWT A;  7CPA A;  5JM6 A;  2I79 A;  3B3C A;  2O4H A;  1ZO0 A;  3KQZ A;  1BO4 A;  2IJZ A;  2J8R A;  3D4U A;  3KKW A;  1CBX A;  4C7H A;  5K8O A;  3KR4 A;  3PFE A;  5G22 A;  4A37 A;  4LUA A;  4KVX A;  4H89 A;  2PJ0 A;  4OP4 A;  4P4I A;  4A95 A;  1YQE A;  2EK8 A;  3B3W A;  4ZBG A;  3K2K A;  5LRG A;  1F2P A;  4A94 A;  4E0A A;  3B3T A;  3BJ7 A;  3FMC A;  2GLJ A;  1BPM A;  4NJQ A;  3PB4 X;  4PK3 A;  5AG7 A;  1CG2 A;  2CXA A;  1X12 A;  2CF4 A;  4IUS A;  1R43 A;  4BBH A;  5G21 A;  2P6G A;  2ZEE A;  8CPA A;  3NH4 A;  3PBB A;  4XPD B;  1Z9U A;  5G20 A;  4RS2 A;  4X3R A;  1LCP A;  3A9L A;  3DSB A;  3P2H A;  3BHX A;  1YW6 A;  4E8O A;  5IB0 A;  4FAI A;  4MFQ A;  3BJ8 A;  4P4D A;  4NFR A;  4A33 A;  1M4L A;  3EFA A;  2EO8 A;  3S9L A;  3QAY A;  4BIN A;  1CX8 A;  3V38 A;  2JBK A;  1NSA A;  1Z4R A;  4JYW A;  4C2X A;  4MHD A;  4P4F A;  2ZOG A;  1CJW A;  3PFO A;  2Q51 A;  3N7Z A;  4DJL A;  1TF8 A;  1QST A;  1M4I A;  4WWV A;  1YLE A;  2JDC A;  4NEX A;  1AMP A;  2AJ6 A;  2DF5 A;  4R76 A;  3TOB A;  3PGP A;  5K8M A;  3KQX A;  3IFE A;  3S6G A;  4OC3 A;  1LOK A;  2V8D A;  4JJX A;  3JVN A;  5HH1 A;  3TC8 A;  4OAD A;  4YU9 A;  4MHY A;  3CXQ A;  4KVM E;  4EME A;  4LX9 A;  1Z2L A;  1U6M A;  3FB3 A;  3KI9 A;  4UF4 A;  5CPA A;  4Q38 A;  2AFZ A;  1ELL P;  4CYO A;  3OWC A;  3S9N A;  5DWN A;  4KSA A;  1GHE A;  4Q7A A;  3GY9 A;  3W6X A;  3CT9 A;  3FYN A;  3FIX A;  3G3S A;  5KTD A;  1XFO A;  5H86 A;  3QAH A;  2PJ2 A;  2AFS A;  1F57 A;  1HDU A;  2ZPA A;  1I21 A;  4CAX A;  2ATR A;  3D7G A;  5AG6 A;  4CS0 B;  2ANP A;  4HNW B;  4RN7 A;  4F0X A;  5AG4 A;  3K9T A;  2HUZ A;  2GAN A;  2XEF A;  4ONU A;  2D4P A;  1Y0Y A;  1S3Z A;  3EXN A;  2QVP A;  3JRU A;  3TTH A;  4ZX8 A;  2CTB A;  1IU8 A;  3TO6 A;  1JQG A;  2PR8 A;  5DWM A;  2EK9 A;  2B5G A;  2CTC A;  4KUA A;  4L8A A;  2PJ1 A;  1QSN A;  3FNC A;  1XF8 A;  4H6U A;  4MFP A;  4PXB A;  1I1D A;  4M85 A;  3SHP A;  5JH9 A;  3JUW A;  4B5O A;  5HVH A;  4C7I A;  5LRJ A;  4MRI A;  2VBQ A;  3EC4 A;  1ZG7 A;  2PE3 A;  3G8W A;  4MFJ A;  5EBV A;  3FEC A;  3W91 A;  2B5G B;  1YVO A;  1KZF A;  2O28 A;  3NE8 A;  5F47 A;  3CDX A;  1XRY A;  1I12 A;  4P45 A;  1YW4 A;  2DPS A;  2EWB A;  2V8V A;  3IC1 A;  3KHZ A;  3KAS A;  5HVF A;  4KUB A;  2VZZ A;  4P6Y A;  4B5P A;  1XIX A;  4RUH A;  2PRQ A;  2IMO A;  4LQG A;  4PQA A;  4UFW A;  4ZGY B;  4ZI6 A;  4I49 A;  3I3G A;  1WK4 A;  2B4B A;  4KSF A;  3W6S A;  4KOX A;  4RI1 A;  4NGQ A;  2GE3 A;  1YX0 A;  2C6P A;  4XPL A;  1S5K A;  4MCR A;  2REF A;  4CRZ B;  4QBJ A;  5C82 A;  5JGF A;  4UEF A;  2A4N A;  3MGD A;  1YK3 A;  3PB6 X;  2PJ3 A;  4UFV A;  5GCN A;  4XPK A;  3PZJ A;  5LYL A;  4TNU A;  2FL4 A;  1GYT A;  4OIW A;  4X5K A;  5IV0 A;  1VGY A;  5F49 A;  3RYO A;  2FIA A;  3HLP A;  4NGN A;  3TT2 A;  2AFW A;  2OR4 A;  2Q44 A;  3RAM A;  2OZU A;  3QB8 A;  2NSM A;  1YR0 A;  1VKC A;  2PJ9 A;  4MHN A;  1UWY A;  1YVK A;  1VHS A;  4MCP A;  4W9Y A;  4KLW A;  1NSL A;  1Q2D A;  1HDQ A;  1XJO A;  1RTQ A;  2FE7 A;  3ISX A;  4NGS A;  4UCM A;  4NGP A;  3FXT A;  2GU2 A;  4KSI A;  3LD2 A;  2B4D A;  3DDD A;  2YGW A;  4UIB A;  3D7H A;  5H84 A;  3S6H A;  3BXM A;  4ZY1 A;  1K4J A;  2R98 A;  3GB0 A;  3P2F A;  3IWE A;  1RO5 A;  3N5F A;  4ORF A;  4KLV A;  4C68 A;  4P44 A;  4UCN A;  2PSW A;  4F9U A;  1Y7E A;  3B35 A;  5F48 A;  4CGO A;  2RFH A;  4R3K A;  4ZYQ A;  4B14 A;  2B4D B;  2HB6 A;  4FBE A;  3IWG A;  2NYQ A;  3D68 A;  4MXU A;  5J8F A;  3HUV A;  3NA6 A;  1Q7L A;  1Z5R A;  3F0A A;  3PB7 X;  1YRE A;  5ELY A;  2I3C A;  2FXF A;  4QC6 A;  2Z0Z A;  2KCW A;  4KOR A;  1M4D A;  2DEA A;  5CNP A;  4L89 A;  4U9Z A;  2CNS A;  2REE A;  2I00 A;  2VI7 A;  3DR6 A;  4U9Y A;  2EBJ A;  4OKO A;  1F2O A;  3DR8 A;  1TXR A;  4HNY B;  1PYT B;  2OH1 A;  2CNT A;  4CAW A;  3LMS A;  3KL9 A;  2NMT A;  2AFX A;  3TOA A;  4OC5 A;  1Z8W A;  1S7L A;  2AFO A;  1PUA A;  2BUE A;  2J8N A;  2R8V A;  3PRT A;  4R7M A;  4A30 A;  3TE4 A;  1YME A;  2FS5 A;  4KOS A;  3V8I A;  4O23 A;  4B11 A; 
#chains in the Genus database with same CATH homology
 4DNC A;  2P0W A;  2G3A A;  1CM0 A;  4PK2 A;  4CGM A;  3D3S A;  2WSA A;  4AB7 A;  3R9E A;  2R7H A;  3B8G A;  2ZW6 A;  2G3T A;  4MFL A;  3I9S A;  2PQ8 A;  5FVJ A;  4AVA A;  1MK4 A;  4CAF A;  5BWA B;  2Q04 A;  1IB1 E;  4R87 A;  1S7F A;  5E96 A;  4AG9 A;  1RXT A;  4AVB A;  3WR7 A;  2Z3K A;  1PU9 A;  4FD4 A;  2VQY A;  5KTA A;  3GYA A;  3C26 A;  4Y49 C;  4BMH A;  1YGH A;  1NE9 A;  3F8K A;  1QSM A;  3D2P A;  4MFK A;  3ZZI A;  3R9G A;  3IU2 A;  2YND A;  1Q2Y A;  2FSR A;  3S6K A;  4NCZ A;  2B3U A;  3NE7 A;  4MFZ A;  4C2Z A;  2PC1 A;  2JDD A;  1MJ9 A;  3R96 A;  1J4J A;  1QSO A;  4NF1 A;  2D4O A;  4PV6 A;  3K9U A;  4CAV A;  5KTC A;  1IID A;  2ZW4 A;  4KOV A;  2G0B A;  3H5Z A;  4EVY A;  5HMN A;  3TO9 A;  4CGL A;  4JXQ A;  4B5P B;  3T9Y A;  4AG7 A;  4OLL A;  2YNC A;  4R57 A;  4Y49 B;  5AG5 A;  4CRY B;  2JEV A;  4PSW A;  1KUV A;  4A31 A;  3VWE A;  4B13 A;  4KOT A;  4HNX B;  4CAE A;  5A27 A;  4UFX A;  2Z3P A;  3E0K A;  2Z3M A;  4GS4 A;  4C2Y A;  4MI4 A;  5C88 A;  4QUS A;  2K5T A;  2AE6 A;  3ZJ0 A;  2H5M A;  2VEZ A;  4JXR A;  3CXP A;  4JLY A;  4II9 A;  4H6Z A;  1MJA A;  2ZW7 A;  3D8P A;  1XE4 A;  2VZY A;  4XNH C;  2JLM A;  4UCP A;  4UBR A;  5I0C A;  1QSR A;  2X7B A;  4KVO E;  4CGN A;  2EVN A;  4J3G A;  4FD6 A;  2WUU A;  2Y0M A;  3UY5 A;  4KOY A;  4M3S A;  2VXK A;  4CGP A;  2BSW A;  3EO4 A;  1P0H A;  4UA3 A;  2ZW5 A;  2J8M A;  4FD5 A;  2Q4V A;  4JWP A;  2OZH A;  2FCK A;  3T90 A;  4YRH A;  2R1I A;  2Q4Y A;  2QIR A;  3PP9 A;  4MJ8 A;  4QB9 A;  4JD6 A;  5EC4 A;  2F5I A;  2DPT A;  3GKR A;  4A32 A;  4F6A A;  3CXS A;  2QEC A;  1R57 A;  1UFH A;  4U5Y A;  4A2Z A;  1Z4E A;  4XNH B;  3IU1 A;  3SXO A;  1KUY A;  1Y7R A;  2B3V A;  1S60 A;  1XMT A;  2HV2 A;  2PR1 A;  4E2A A;  4YFJ A;  3EY5 A;  3H4Q A;  1BOB A;  3R1K A;  1LRZ A;  4KOU A;  3LOD A;  5J8C A;  2OU2 A;  3S6F A;  1WWZ A;  2RC4 A;  4MBU A;  4PSX A;  1Y9W A;  2ARH A;  4R3L A;  2CY2 A;  3F5B A;  3IGR A;  1OZP A;  1P4N A;  1S7K A;  2Q0Y A;  4Q36 A;  4YGO A;  4IF5 A;  1B87 A;  2PDO A;  1IYK A;  2IL4 A;  1XEB A;  4KS9 A;  2YNC C;  5IX3 A;  4KZT A;  2P6F A;  1IYL A;  2QML A;  2CNM A;  4R9M A;  3TFY A;  3R95 A;  1TIQ A;  1N71 A;  5G1Z A;  4NSQ A;  3FRM A;  2GIV A;  3DNS A;  1S7N A;  5AGE A;  1Y9K A;  4UWI A;  1Q2C A;  1MJB A;  2P6E A;  3TCV A;  4HKF A;  4MY0 A;  1V0C A;  1KUX A;  4OAE A;  5F46 A;  4NXY A;  4MY3 A;  2OZG A;  4QVT A;  2PRB A;  2HQY A;  3R9F A;  3TO7 A;  1M1D A;  4K30 A;  5JQ4 A;  1M4G A;  5A28 A;  1ON0 A;  2Z10 A;  2EUI A;  1B6B A;  2Q7B A;  2BL1 A;  4CYP A;  3VWD A;  4CYN A;  3JTK A;  1NMT A;  4KOW A;  4XPD C;  4CYQ A;  2DXQ A;  1M44 A;  2Z3O A;  3BLN A;  4FD7 A;  4UWJ A;  2B58 A;  4F0Y A;  1SQH A;  5GCN A;  2WPW A;  1FY7 A;  2FIW A;  2FT0 A;  2Z3N A;  5JPH A;  4B10 A;  1L0C A;  2BEI A;  2ZXV A;  2YNE A;  1IIC A;  2WPX A;  2Z3L A;  3FBU A;  3SXN A;  2Z11 A;  5ISV A;  2C27 A;  4AVC A;  4B12 A;  2OB0 A;  3D2M A;  2I79 A;  1ZO0 A;  1BO4 A;  2J8R A;  3KKW A;  4C7H A;  5G22 A;  4LUA A;  4KVX A;  4H89 A;  4A95 A;  4ZBG A;  4E0A A;  3BJ7 A;  4PK3 A;  5AG7 A;  2CXA A;  4IUS A;  4BBH A;  5G21 A;  2P6G A;  4XPD B;  1Z9U A;  5G20 A;  4RS2 A;  3A9L A;  3DSB A;  3P2H A;  4E8O A;  5IB0 A;  4MFQ A;  3BJ8 A;  4A33 A;  3EFA A;  1Z4R A;  4C2X A;  4MHD A;  1CJW A;  3N7Z A;  1QST A;  1M4I A;  1YLE A;  2JDC A;  4NEX A;  2AJ6 A;  3TOB A;  3PGP A;  3S6G A;  4JJX A;  5HH1 A;  3JVN A;  4OAD A;  3CXQ A;  4KVM E;  4LX9 A;  1U6M A;  3FB3 A;  4Q38 A;  4CYO A;  3OWC A;  5DWN A;  4KSA A;  1GHE A;  3GY9 A;  3W6X A;  3FYN A;  3FIX A;  3G3S A;  5KTD A;  5H86 A;  3QAH A;  2ZPA A;  1I21 A;  4CAX A;  2ATR A;  5AG6 A;  4CS0 B;  4F0X A;  5AG4 A;  4HNW B;  2HUZ A;  2GAN A;  4ONU A;  2D4P A;  1S3Z A;  3EXN A;  3TTH A;  3TO6 A;  2PR8 A;  5DWM A;  2B5G A;  4KUA A;  4L8A A;  1QSN A;  3FNC A;  1XF8 A;  4H6U A;  4MFP A;  1I1D A;  4M85 A;  3SHP A;  3JUW A;  4B5O A;  4C7I A;  2VBQ A;  3EC4 A;  3G8W A;  4MFJ A;  5EBV A;  3W91 A;  2B5G B;  1YVO A;  1KZF A;  2O28 A;  5F47 A;  1I12 A;  2DPS A;  4KUB A;  2VZZ A;  4B5P A;  1XIX A;  4ZGY B;  4UFW A;  4I49 A;  3I3G A;  1WK4 A;  2B4B A;  4KSF A;  3W6S A;  4KOX A;  4RI1 A;  4XPL A;  2GE3 A;  1YX0 A;  1S5K A;  2REF A;  4CRZ B;  4QBJ A;  5C82 A;  2A4N A;  3MGD A;  1YK3 A;  4UFV A;  4XPK A;  3PZJ A;  2FL4 A;  4X5K A;  5IV0 A;  5F49 A;  3RYO A;  2FIA A;  3TT2 A;  2Q44 A;  2OZU A;  3QB8 A;  1YR0 A;  1VKC A;  1YVK A;  1VHS A;  1NSL A;  4KLW A;  1Q2D A;  4UCM A;  2FE7 A;  3FXT A;  3LD2 A;  2B4D A;  3DDD A;  2YGW A;  5H84 A;  3S6H A;  1K4J A;  2R98 A;  3P2F A;  3IWE A;  1RO5 A;  4ORF A;  4KLV A;  4C68 A;  4UCN A;  2PSW A;  5F48 A;  4CGO A;  4R3K A;  4B14 A;  2B4D B;  3IWG A;  5J8F A;  3F0A A;  1YRE A;  2FXF A;  4QC6 A;  2Z0Z A;  2KCW A;  4KOR A;  1M4D A;  5CNP A;  4L89 A;  4U9Z A;  2CNS A;  2REE A;  2I00 A;  2VI7 A;  3DR6 A;  4U9Y A;  3DR8 A;  4CAW A;  4HNY B;  2OH1 A;  2CNT A;  2NMT A;  3TOA A;  1S7L A;  1PUA A;  2BUE A;  2J8N A;  2R8V A;  4A30 A;  3TE4 A;  2FS5 A;  4KOS A;  3V8I A;  4B11 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...