4MFJA

The crystal structure of acyltransferase
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
328
structure length
328
Chain Sequence
GSHMMMDPETVRIALGLEERTAAWLTELDELGPPAEPVRLPRGEEARDLLRRLEVPELDAEEIVAAAPDPDRDPALWWLLERTHHAIVRHMGDHRAKPRGGPPLPYEGGAAARYFHVYVFLATVPAVRRFHAERGIPDEVGWETLTQLGELVAIHRRKYGQGGMNMQWWTTYHLRGILYRLGRLQFSLATGKDGTPHLGLHVPEWGGPLLPKAYDESLHRARPFFDRHFPEHGARVAWGSSWMLDPQLEEYLTEDSNIIQLARFWTLTDSAPEPGNADGDSSILEFVFRYNGQPLDELPQRSSLERAVIAHLKAGRHWHMRTGFVKLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative uncharacterized protein tcp24
publication title Multiple complexes of long aliphatic N-acyltransferases lead to synthesis of 2,6-diacylated/2-acyl-substituted glycopeptide antibiotics, effectively killing vancomycin-resistant enterococcus
pubmed doi rcsb
source organism Actinoplanes teichomyceticus
molecule tags Transferase
total genus 97
structure length 328
sequence length 328
ec nomenclature ec 2.3.1.-:
pdb deposition date 2013-08-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18082 DUF5596 Domain of unknown function (DUF5596)
A PF18164 GNAT_C GNAT-like C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.120 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4mfjA02
4MFPA 4Q36A 4MFQA 4Q38A 4MFJA 4MFZA 4MFLA 4MFKA
chains in the Genus database with same CATH superfamily
3V7ZA 3S9LA 1TKJA 5G22A 1N71A 2G9DA 4P4JA 4NEXA 5CPAA 3MN8A 4FWUA 4TWEA 3BHXA 4B6ZA 4XPKA 2J8NA 1LOKA 4JLYA 4MFKA 3B3CA 4Q36A 3B3WA 1Y0YA 1KUVA 5HVGA 1OZPA 2ODFA 2RFHA 1J4JA 1B87A 1YGHA 4QVTA 2Z10A 3LMSA 4UEZA 4UWIA 2ZENA 1S7FA 5DWNA 4WJBA 4EWTA 2PRBA 1GYTA 2DPTA 4IF5A 2GE3A 3IWEA 3K9TA 3EFAA 3NH5A 4ONUA 4IK2A 2G0BA 2PJ9A 4HNXB 4PXCA 4R8FA 5HVFA 5C88A 2B3VA 4PK2A 3TOBA 4UEEA 2Z3OA 4UBRA 1A2ZA 4KOUA 2QECA 2C6PA 2WPWA 3HLPA 4CYOA 3NA6A 5FVJA 3S6HA 2DEAA 3CPXA 4B5PB 1ZG9A 3BI1A 2GLFA 3PB4X 4MHYA 4PXEA 4CAEA 1DTDA 3SJFA 1ON0A 4E0AA 3SXNA 1LFWA 3TTHA 3PB7X 4OIDA 1WK4A 1IY7A 1KUYA 3IU2A 5J1QA 3B3SA 1R3NA 2KCWA 1CBXA 3P2HA 2NSMA 1S7LA 3VWEA 1QQ9A 3H5ZA 3OWCA 4M85A 4TNUA 3B8GA 3KHXA 4M6IA 4X2TA 2R98A 2Z3NA 2ZEFA 1P0HA 3N7ZA 3IWGA 1NMTA 2V8GA 4H6ZA 4KOTA 1HDQA 3D3SA 1FT7A 3FECA 3JUWA 4KUAA 1TXRA 4UA3A 4Y49C 2IMOA 1QSTA 4CAFA 2HC9A 1VKCA 2Z11A 3KI9A 2PR1A 4YGOA 3V38A 3PGPA 4RUHA 4P4EA 1BPNA 1Z4RA 2EVNA 1YX0A 3IGRA 4NJRA 1Y9KA 2VZZA 5I4MA 2Z0ZA 3JRUA 2PJCA 2Z3LA 1IICA 2ZW7A 4MRIA 2C6CA 1VGYA 4NXYA 1IOFA 2ZELA 3WR7A 5AG7A 1HEEA 4ZBGA 1PU9A 5LRJA 2WYRA 2PCUA 4UIAA 4B12A 1NSLA 2DF5A 3V8IA 3UY5A 4PK3A 5JGFA 2FL4A 1PYTB 4UFWA 2JBJA 2OB0A 3BJ8A 3N5FA 5C82A 4MHDA 4CS0B 4PQAA 1BOBA 2VBQA 2OZHA 2V77A 3PFEA 4AB7A 2Q4VA 4GM5A 4C2ZA 2GANA 3IWWA 2HB6A 2PJ2A 4P6YA 4F6AA 4OC2A 1H8LA 1M4LA 4F0XA 3I9SA 4NGTA 4CYQA 4PXDA 4CAVA 1ZG8A 1PCAA 2BOAA 4F8ZA 1RTQA 2WSAA 2PIYA 4XPLA 3RNZA 3D2MA 4CAXA 1Z8XA 2PSWA 4MJ8A 7CPAA 4HNWB 1DE4C 1I12A 2B4BA 2F5IA 2FT0A 4K30A 4AG7A 4HNYB 1MK4A 6CPAA 2FE7A 2GIVA 4G1PA 5IB0A 2P6GA 1Y7EA 2PE3A 2AFSA 4NGPA 2K5TA 1B6BA 5H84A 1LAPA 2CTBA 1YLEA 3CXPA 4KZTA 2JEVA 4JWPA 4JZ0A 3GY9A 4P4FA 4W9YA 3WABA 4FUUA 4A32A 3SXOA 1Z5RA 4CYNA 2PJ0A 3FB3A 1F57A 2RC4A 1Z4EA 2B4DA 4FD4A 1KWMA 1Z8TA 3PB8X 4KOSA 4YRHA 3KL9A 3PB6X 4FD7A 1CM0A 1TKFA 1Y9WA 3D7FA 3ZZIA 3FF3A 1CPXA 2P0WA 2PC1A 4R76A 2FS5A 3GIUA 3QAYA 4A39A 5ISVA 4R7MA 4U9ZA 3KQXA 3R9EA 5BWAB 3LD2A 4OIWA 1FNOA 3NE7A 2OOTA 4BMHA 3HUVA 4F9UA 4K3NA 4MCRA 1OBRA 2QVPA 4ZY2A 4F9VA 2ZOFA 4M6HA 4MCPA 4RN7A 3S9NA 3RYOA 1QSRA 4MCSA 4UIBA 2ZXVA 2GLJA 3ZJ0A 3NH8A 3C26A 4OC1A 5HH1A 2EBJA 4LX9A 2V8VA 4B14A 2IQ6A 4R6TA 4AXVA 4C2XA 4Q7AA 4OC0A 2ZEDA 3DDDA 1XJOA 4MBUA 5G21A 3KR5A 3VWDA 4EFDA 2OU2A 3IIBA 4LQ6A 1BLLE 4NCZA 4NF1A 4C2YA 2Q7BA 5IX3A 5LYLA 3TE4A 1R57A 1R43A 1XFOA 4UWJA 1M4DA 2CNMA 2CTCA 4J3GA 2ZW4A 5KTDA 3F5BA 1VHSA 4OKOA 1S7KA 2FIAA 1Z8LA 3FEDA 3PBEA 4QC6A 1CG2A 3KGQA 4QB9A 2JEWA 4FAIA 4KOWA 2XEGA 4M6GA 4KUBA 4O23A 4H6UA 4C7IA 2CNSA 4NGRA 2O28A 3B7IA 1L0CA 3FX6A 1TKHA 1BAVA 2PJ8A 3GB0A 5JQ4A 4CGPA 3GYAA 2QIRA 3ISXA 3BXMA 1F2OA 1Q2YA 4JXRA 4U5YA 2EO8A 2C1CA 1ARLA 1CP6A 1S5KA 2BL1A 3FBUA 2B58A 1HDUA 3SJXA 3EC4A 4Z65A 3W6SA 4NGNA 2PJ3A 2ZW6A 1XIXA 3R1KA 4PPZA 4C68A 4KVXA 3K9UA 1LCPA 4DUKA 4JD6A 2EK8A 3IJ3A 3CZXA 3FNCA 5JH9A 3IEHA 3VARA 2XEFA 1YLOA 4FD5A 5LRGA 1MJBA 3S9MA 3DNSA 2BCOA 2QYVA 4OAEA 1XMTA 5AG6A 4B5OA 2CF4A 2ZEMA 3D67A 3D68A 4X8IA 2Q43A 1JWQA 4MFJA 4RS2A 5LYDA 4I49A 3LWUA 4UCNA 2WPXA 2NYQA 1IIDA 1ARMA 2GFQA 1MJ9A 2BEIA 2AFMA 5HMNA 1LRZA 4U9YA 4IUSA 1K4JA 4R87A 3BLNA 4UF4A 5I0CA 2WUUA 4KSAA 4ONWA 3FXTA 4IHMA 3SJEA 2YNCA 1VHEA 5AGEA 4LUAA 4Q38A 4A37A 5F49A 2Q44A 3SI2A 4ZGYB 1QSOA 5HVHA 3IC1A 1IU8A 4KVME 3IU1A 2J8MA 1KUXA 1TF9A 4KS9A 2POKA 1YR0A 2IL4A 3RO0A 2JBKA 5A28A 1RXTA 4HPSA 4UEFA 3H4QA 5G20A 4MCQA 3TO9A 5KTAA 5F47A 4A30A 3GKRA 5LYFA 2HUZA 3FEEA 4KOYA 4GXHA 1IGBA 4R9MA 1X12A 3CPAA 3WC5A 5J8FA 3DR8A 3FYNA 2B4DB 3L2NA 3DLJA 5H86A 4H2KA 1QSNA 3K2KA 2PRQA 4P45A 4KOVA 4A94A 2Q51A 3TFYA 2NMTA 2AFWA 2I00A 1XOVA 5D8NA 3PZJA 4CPAA 5IV0A 2Q0YA 2B5GA 3ISZA 4NSQA 2Q4YA 4PSWA 2XEIA 3D7HA 4QBJA 2PIZA 4MFPA 2ATRA 5EC4A 2R8VA 4A31A 2AJ6A 4KSFA 1UWYA 2G3TA 3MRUA 3I3GA 4OC4A 2AFXA 3VATA 4JJXA 3TT2A 4C7HA 1Z9UA 5A27A 4L8AA 3PEIA 4KSIA 1YW6A 2WZNA 1UFHA 4NGQA 1WWZA 3DR6A 4PXBA 1Y7RA 3SI0A 8CPAA 2IJZA 4P4BA 3VH9A 1YSJA 4X3RA 3RAMA 1SQHA 2F8HA 3TCVA 3WC7A 3JVNA 4H89A 4ZY1A 3B35A 4XNHC 1I21A 3E0KA 1ZLIA 1M4IA 4CYPA 1RO5A 3PRTA 3R9GA 1IYKA 2PJAA 1Z8WA 4WWVA 4A2ZA 2PVWA 2PDOA 3FIXA 3NE8A 4MI4A 4MHZA 2BSWA 4P4DA 4MFLA 1ZG7A 2FCKA 4UFVA 5D29A 3DGVA 3PB9X 5EBVA 4CGLA 2ZPAA 3BJ7A 1Q2DA 2REEA 2G3AA 4F0YA 2C27A 2R7HA 4XPDC 4KORA 1GHEA 2O4HA 5G1ZA 2EUIA 3BI0A 1S7NA 3G8WA 3PFOA 5DS0A 3FMCA 2VEZA 3D4UA 4ORFA 4A33A 3PBBA 3B3TA 1LANA 1LAMA 4CGMA 3SHPA 2A4NA 2YNCC 3B2YA 4MFZA 1ZO0A 3SI1A 2Q7SA 4UCMA 4ZI6A 2Z3PA 5GCNA 1IB1E 3EO4A 2HQYA 2VL1A 1VHOA 2ZOGA 3A9LA 4A95A 4XNHB 2P6FA 2HV2A 2PQ8A 2PR8A 2QJ8A 4OC5A 3TC8A 4MY3A 2ZW5A 3H8GA 2BUEA 1Z2LA 3I1UA 4E2AA 4KOXA 4AVCA 2ZEOA 1ZLHA 3KHZA 1CP7A 3CDXA 2QMLA 2RB7A 2EWBA 4OADA 4R57A 4E8OA 2FVGA 1U6MA 3TO7A 2FIWA 3QAHA 3S6GA 1FY7A 2PVVA 4XPDB 3R9FA 3TO6A 2D4PA 1M1DA 1MJAA 1XBUA 2PJ1A 3EXNA 4OLLA 4A38A 1X10A 4OP4A 5EMIA 3WT4A 3W91A 4CGNA 4YFJA 2O53A 5K8PA 3NFZA 2J9AA 4B11A 1PUAA 3SJGA 4CAWA 3B3VA 1BO4A 4NJQA 1M44A 4B10A 1ELMP 3D7GA 4MFQA 5LYIA 2Q4ZA 5K8OA 3TOAA 1IOIA 4PV6A 2AFZA 3FVLA 3PP9A 1QMUA 3RBUA 1KZFA 4ZX8A 3DSBA 2FXFA 3D7DA 4L89A 3FH4A 5ELYA 2B3UA 4DJLA 5E96A 2BO9A 5JM6A 2JLMA 2Z3MA 2Z3KA 4YWYA 1TIQA 2I3CA 1XRYA 4KLWA 3WC6A 4BD9A 3W6XA 2AE6A 4DNCA 2OH1A 1YK3A 5JPHA 5F46A 5K8MA 2ABZA 2JDCA 2Y0MA 1BPMA 1S3ZA 4B5PA 4EMEA 1Q7LA 4NFRA 3GLJA 4NGSA 1XE4A 3G3SA 2B5GB 4M3SA 2PJ7A 4LQGA 4R3LA 4FD6A 4MMOA 2CIJA 5KTCA 3KR4A 2OR4A 2XEJA 1XMBA 2C6GA 2DXQA 3LODA 1F2PA 3KQZA 1XEBA 1S60A 2J8RA 2OZGA 1YREA 1YVKA 3NH4A 2ZEHA 4UFXA 3FJUA 1YMEA 2D4OA 2PJ6A 1M4GA 4AVBA 2R1IA 3GUXA 4NGMA 2ANPA 2PJBA 2V8DA 4QUSA 4IAVA 5AG5A 4BINA 5K8NA 1AMPA 1AUGA 2P6EA 2YNDA 1CX8A 3QB8A 4R3KA 4RI1A 4JXQA 4MY0A 2H5MA 5J8CA 3H8FA 1YVOA 2F7VA 4ZYQA 2V8HA 4YU9A 2VQYA 1AYEA 1I1DA 5F48A 3LACA 1YW4A 2ARHA 2VXKA 3T9YA 3JTKA 3T8WA 1CJWA 1P4NA 1QSMA 4KVOE 5CBMA 4Y49B 1YQEA 4P44A 3S6KA 3KKWA 4OC3A 1CPSA 4P4IA 4ZX9A 3S6FA 1XF8A 2X7BA 3D8PA 4MXUA 4UCPA 3P2FA 3D66A 5AG4A 4MHNA 2VZYA 1IYLA 1VIXA 2Q04A 4AVAA 1V0CA 2REFA 5HXDA 1NSAA 3T90A 3RZAA 3F0AA 3IFEA 4OMEA 2VI7A 4CGOA 2GU2A 4JYWA 2PJ5A 4BBHA 3CXQA 2ZEEA 4X5KA 3MGDA 2JDDA 2CXAA 2I79A 2OZUA 3D2PA 3QNVA 1NE9A 4CRZB 3TX8A 5THWA 4DYOA 1EE3P 1Q2CA 4MHPA 5IB9A 3H8EA 5CNPA 4HKFA 3R95A 4FBEA 5F09A 2YNEA 1JQGA 2CY2A 1Y0RA 2GREA 5DWMA 2DPSA 3EY5A 3IO1A 4II9A 3KZWA 4KLVA 2YGWA 2CNTA 4P10A 1TF8A 3R96A 4AG9A 1ELLP 3CXSA 2ZEGA 2EK9A 5LRKA 2PJ4A 2ZEPA 2FSRA 4B13A 2AFUA 4CRYB 2AFOA 3CT9A 3FRMA 4PSXA 3F8KA 4GS4A 4ZY0A 4EVYA 3KASA
chains in the Genus database with same CATH topology
5G22A 1N71A 4NEXA 4XPKA 2J8NA 4JLYA 4MFKA 4Q36A 1KUVA 1OZPA 1J4JA 1B87A 1YGHA 4QVTA 2Z10A 4UWIA 5DWNA 1S7FA 2PRBA 2DPTA 4IF5A 2GE3A 3IWEA 3EFAA 4ONUA 2G0BA 4HNXB 5C88A 2B3VA 4PK2A 3TOBA 2Z3OA 4UBRA 4KOUA 2QECA 2WPWA 4CYOA 5FVJA 3S6HA 4B5PB 4CAEA 1ON0A 4E0AA 3SXNA 3TTHA 1WK4A 1KUYA 3IU2A 2KCWA 3P2HA 1S7LA 3VWEA 3H5ZA 3OWCA 4M85A 3B8GA 2R98A 2Z3NA 3N7ZA 1P0HA 4KOTA 3IWGA 1NMTA 4H6ZA 3D3SA 3JUWA 4KUAA 4UA3A 4Y49C 4CAFA 1QSTA 1VKCA 2Z11A 2PR1A 4YGOA 3PGPA 1Z4RA 2EVNA 1YX0A 3IGRA 1Y9KA 2VZZA 2Z0ZA 2Z3LA 1IICA 2ZW7A 4NXYA 3WR7A 5AG7A 4ZBGA 1PU9A 4B12A 1NSLA 3V8IA 3UY5A 4PK3A 2FL4A 4UFWA 2OB0A 3BJ8A 5C82A 4MHDA 4CS0B 1BOBA 2VBQA 2OZHA 4AB7A 2Q4VA 4C2ZA 2GANA 4F6AA 4F0XA 3I9SA 4CYQA 4CAVA 2WSAA 4XPLA 3D2MA 4CAXA 2PSWA 4MJ8A 4HNWB 1I12A 2B4BA 2F5IA 2FT0A 4K30A 4AG7A 4HNYB 1MK4A 2FE7A 2GIVA 5IB0A 2P6GA 2K5TA 1B6BA 5H84A 3CXPA 1YLEA 4KZTA 2JEVA 4JWPA 3GY9A 4A32A 3SXOA 4CYNA 3FB3A 2RC4A 1Z4EA 2B4DA 4FD4A 4KOSA 4YRHA 4FD7A 1CM0A 1Y9WA 3ZZIA 2PC1A 2P0WA 5ISVA 2FS5A 4U9ZA 3R9EA 5BWAB 3LD2A 3NE7A 4BMHA 3RYOA 1QSRA 2ZXVA 3ZJ0A 3C26A 5HH1A 4LX9A 4B14A 4C2XA 3DDDA 4MBUA 5G21A 3VWDA 2OU2A 4NF1A 4NCZA 4C2YA 2Q7BA 5IX3A 3TE4A 1R57A 4UWJA 1M4DA 2CNMA 4J3GA 2ZW4A 5KTDA 3F5BA 1VHSA 1S7KA 2FIAA 4QC6A 4QB9A 4KOWA 4KUBA 4H6UA 4C7IA 2CNSA 2O28A 1L0CA 5JQ4A 4CGPA 3GYAA 2QIRA 1Q2YA 4JXRA 4U5YA 1S5KA 2BL1A 3FBUA 2B58A 3EC4A 3W6SA 2ZW6A 1XIXA 3R1KA 4C68A 4KVXA 3K9UA 4JD6A 3FNCA 4FD5A 1MJBA 3DNSA 4OAEA 1XMTA 5AG6A 4B5OA 4MFJA 4RS2A 4I49A 4UCNA 2WPXA 1IIDA 1MJ9A 2BEIA 5HMNA 1LRZA 4U9YA 4IUSA 1K4JA 4R87A 3BLNA 5I0CA 2WUUA 4KSAA 3FXTA 2YNCA 5AGEA 4LUAA 4Q38A 5F49A 2Q44A 4ZGYB 1QSOA 4KVME 3IU1A 2J8MA 1KUXA 5A28A 4KS9A 1YR0A 2IL4A 1RXTA 3H4QA 5G20A 3TO9A 5KTAA 5F47A 4A30A 3GKRA 2HUZA 4KOYA 4R9MA 5J8FA 3DR8A 3FYNA 2B4DB 5H86A 1QSNA 4KOVA 3TFYA 2NMTA 2I00A 3PZJA 5IV0A 2Q0YA 2B5GA 4PSWA 4NSQA 2Q4YA 4QBJA 4MFPA 2ATRA 5EC4A 2R8VA 4A31A 2AJ6A 4KSFA 2G3TA 3I3GA 4C7HA 4JJXA 3TT2A 1Z9UA 5A27A 4L8AA 1UFHA 1WWZA 3DR6A 1Y7RA 1SQHA 3TCVA 3JVNA 4H89A 4XNHC 3E0KA 1I21A 1M4IA 4CYPA 1RO5A 3R9GA 1IYKA 4A2ZA 3FIXA 2PDOA 4MI4A 2BSWA 4MFLA 2FCKA 4UFVA 5EBVA 4CGLA 2ZPAA 3BJ7A 1Q2DA 2REEA 2G3AA 4F0YA 2C27A 2R7HA 4XPDC 4KORA 1GHEA 5G1ZA 2EUIA 1S7NA 3G8WA 2VEZA 4ORFA 4A33A 4CGMA 3SHPA 2A4NA 2YNCC 4MFZA 1ZO0A 4UCMA 2Z3PA 5GCNA 1IB1E 3EO4A 2HQYA 3A9LA 4A95A 4XNHB 2P6FA 2HV2A 2PQ8A 2PR8A 4MY3A 2ZW5A 2BUEA 4E2AA 4KOXA 4AVCA 2QMLA 4OADA 4R57A 4E8OA 1U6MA 3TO7A 2FIWA 3QAHA 3S6GA 1FY7A 4XPDB 3R9FA 3TO6A 2D4PA 1M1DA 1MJAA 4OLLA 3EXNA 4CGNA 3W91A 4YFJA 4B11A 1PUAA 4CAWA 1BO4A 1M44A 4B10A 4MFQA 3TOAA 4PV6A 3PP9A 1KZFA 3DSBA 2FXFA 4L89A 2B3UA 5E96A 2JLMA 2Z3MA 2Z3KA 1TIQA 4KLWA 3W6XA 2AE6A 4DNCA 2OH1A 1YK3A 5JPHA 5F46A 2JDCA 2Y0MA 1S3ZA 4B5PA 1XE4A 3G3SA 2B5GB 4M3SA 4R3LA 4FD6A 5KTCA 2DXQA 3LODA 4UFXA 1XEBA 1S60A 2J8RA 2OZGA 1YREA 1YVKA 4AVBA 2D4OA 1M4GA 2R1IA 4QUSA 5AG5A 2P6EA 2YNDA 4R3KA 3QB8A 4RI1A 4JXQA 4MY0A 2H5MA 5J8CA 1YVOA 2VQYA 1I1DA 5F48A 2ARHA 2VXKA 3T9YA 3JTKA 1CJWA 1P4NA 1QSMA 4KVOE 4Y49B 3S6KA 3KKWA 3S6FA 1XF8A 2X7BA 3D8PA 4UCPA 3P2FA 5AG4A 2VZYA 1IYLA 2Q04A 4AVAA 1V0CA 2REFA 3T90A 3F0AA 2VI7A 4CGOA 4BBHA 3CXQA 4X5KA 3MGDA 2JDDA 2CXAA 2I79A 2OZUA 3D2PA 1NE9A 4CRZB 1Q2CA 5CNPA 4HKFA 3R95A 2YNEA 2CY2A 5DWMA 2DPSA 3EY5A 4II9A 4KLVA 2YGWA 2CNTA 4AG9A 3R96A 3CXSA 2FSRA 4B13A 4CRYB 3FRMA 4PSXA 3F8KA 4GS4A 4EVYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MFP A;  4Q36 A;  4MFQ A;  4Q38 A;  4MFJ A;  4MFZ A;  4MFL A;  4MFK A; 
#chains in the Genus database with same CATH topology
 3V7Z A;  3S9L A;  1TKJ A;  5G22 A;  1N71 A;  2G9D A;  4P4J A;  4NEX A;  5CPA A;  3MN8 A;  4FWU A;  4TWE A;  3BHX A;  4B6Z A;  4XPK A;  2J8N A;  1LOK A;  4JLY A;  4MFK A;  3B3C A;  4Q36 A;  3B3W A;  1Y0Y A;  1KUV A;  5HVG A;  1OZP A;  2ODF A;  2RFH A;  1J4J A;  1B87 A;  1YGH A;  4QVT A;  2Z10 A;  3LMS A;  4UEZ A;  4UWI A;  2ZEN A;  1S7F A;  5DWN A;  4WJB A;  4EWT A;  2PRB A;  1GYT A;  2DPT A;  4IF5 A;  2GE3 A;  3IWE A;  3K9T A;  3EFA A;  3NH5 A;  4ONU A;  4IK2 A;  2G0B A;  2PJ9 A;  4HNX B;  4PXC A;  4R8F A;  5HVF A;  5C88 A;  2B3V A;  4PK2 A;  3TOB A;  4UEE A;  2Z3O A;  4UBR A;  1A2Z A;  4KOU A;  2QEC A;  2C6P A;  2WPW A;  3HLP A;  4CYO A;  3NA6 A;  5FVJ A;  3S6H A;  2DEA A;  3CPX A;  4B5P B;  1ZG9 A;  3BI1 A;  2GLF A;  3PB4 X;  4MHY A;  4PXE A;  4CAE A;  1DTD A;  3SJF A;  1ON0 A;  4E0A A;  3SXN A;  1LFW A;  3TTH A;  3PB7 X;  4OID A;  1WK4 A;  1IY7 A;  1KUY A;  3IU2 A;  5J1Q A;  3B3S A;  1R3N A;  2KCW A;  1CBX A;  3P2H A;  2NSM A;  1S7L A;  3VWE A;  1QQ9 A;  3H5Z A;  3OWC A;  4M85 A;  4TNU A;  3B8G A;  3KHX A;  4M6I A;  4X2T A;  2R98 A;  2Z3N A;  2ZEF A;  1P0H A;  3N7Z A;  3IWG A;  1NMT A;  2V8G A;  4H6Z A;  4KOT A;  1HDQ A;  3D3S A;  1FT7 A;  3FEC A;  3JUW A;  4KUA A;  1TXR A;  4UA3 A;  4Y49 C;  2IMO A;  1QST A;  4CAF A;  2HC9 A;  1VKC A;  2Z11 A;  3KI9 A;  2PR1 A;  4YGO A;  3V38 A;  3PGP A;  4RUH A;  4P4E A;  1BPN A;  1Z4R A;  2EVN A;  1YX0 A;  3IGR A;  4NJR A;  1Y9K A;  2VZZ A;  5I4M A;  2Z0Z A;  3JRU A;  2PJC A;  2Z3L A;  1IIC A;  2ZW7 A;  4MRI A;  2C6C A;  1VGY A;  4NXY A;  1IOF A;  2ZEL A;  3WR7 A;  5AG7 A;  1HEE A;  4ZBG A;  1PU9 A;  5LRJ A;  2WYR A;  2PCU A;  4UIA A;  4B12 A;  1NSL A;  2DF5 A;  3V8I A;  3UY5 A;  4PK3 A;  5JGF A;  2FL4 A;  1PYT B;  4UFW A;  2JBJ A;  2OB0 A;  3BJ8 A;  3N5F A;  5C82 A;  4MHD A;  4CS0 B;  4PQA A;  1BOB A;  2VBQ A;  2OZH A;  2V77 A;  3PFE A;  4AB7 A;  2Q4V A;  4GM5 A;  4C2Z A;  2GAN A;  3IWW A;  2HB6 A;  2PJ2 A;  4P6Y A;  4F6A A;  4OC2 A;  1H8L A;  1M4L A;  4F0X A;  3I9S A;  4NGT A;  4CYQ A;  4PXD A;  4CAV A;  1ZG8 A;  1PCA A;  2BOA A;  4F8Z A;  1RTQ A;  2WSA A;  2PIY A;  4XPL A;  3RNZ A;  3D2M A;  4CAX A;  1Z8X A;  2PSW A;  4MJ8 A;  7CPA A;  4HNW B;  1DE4 C;  1I12 A;  2B4B A;  2F5I A;  2FT0 A;  4K30 A;  4AG7 A;  4HNY B;  1MK4 A;  6CPA A;  2FE7 A;  2GIV A;  4G1P A;  5IB0 A;  2P6G A;  1Y7E A;  2PE3 A;  2AFS A;  4NGP A;  2K5T A;  1B6B A;  5H84 A;  1LAP A;  2CTB A;  1YLE A;  3CXP A;  4KZT A;  2JEV A;  4JWP A;  4JZ0 A;  3GY9 A;  4P4F A;  4W9Y A;  3WAB A;  4FUU A;  4A32 A;  3SXO A;  1Z5R A;  4CYN A;  2PJ0 A;  3FB3 A;  1F57 A;  2RC4 A;  1Z4E A;  2B4D A;  4FD4 A;  1KWM A;  1Z8T A;  3PB8 X;  4KOS A;  4YRH A;  3KL9 A;  3PB6 X;  4FD7 A;  1CM0 A;  1TKF A;  1Y9W A;  3D7F A;  3ZZI A;  3FF3 A;  1CPX A;  2P0W A;  2PC1 A;  4R76 A;  2FS5 A;  3GIU A;  3QAY A;  4A39 A;  5ISV A;  4R7M A;  4U9Z A;  3KQX A;  3R9E A;  5BWA B;  3LD2 A;  4OIW A;  1FNO A;  3NE7 A;  2OOT A;  4BMH A;  3HUV A;  4F9U A;  4K3N A;  4MCR A;  1OBR A;  2QVP A;  4ZY2 A;  4F9V A;  2ZOF A;  4M6H A;  4MCP A;  4RN7 A;  3S9N A;  3RYO A;  1QSR A;  4MCS A;  4UIB A;  2ZXV A;  2GLJ A;  3ZJ0 A;  3NH8 A;  3C26 A;  4OC1 A;  5HH1 A;  2EBJ A;  4LX9 A;  2V8V A;  4B14 A;  2IQ6 A;  4R6T A;  4AXV A;  4C2X A;  4Q7A A;  4OC0 A;  2ZED A;  3DDD A;  1XJO A;  4MBU A;  5G21 A;  3KR5 A;  3VWD A;  4EFD A;  2OU2 A;  3IIB A;  4LQ6 A;  1BLL E;  4NCZ A;  4NF1 A;  4C2Y A;  2Q7B A;  5IX3 A;  5LYL A;  3TE4 A;  1R57 A;  1R43 A;  1XFO A;  4UWJ A;  1M4D A;  2CNM A;  2CTC A;  4J3G A;  2ZW4 A;  5KTD A;  3F5B A;  1VHS A;  4OKO A;  1S7K A;  2FIA A;  1Z8L A;  3FED A;  3PBE A;  4QC6 A;  1CG2 A;  3KGQ A;  4QB9 A;  2JEW A;  4FAI A;  4KOW A;  2XEG A;  4M6G A;  4KUB A;  4O23 A;  4H6U A;  4C7I A;  2CNS A;  4NGR A;  2O28 A;  3B7I A;  1L0C A;  3FX6 A;  1TKH A;  1BAV A;  2PJ8 A;  3GB0 A;  5JQ4 A;  4CGP A;  3GYA A;  2QIR A;  3ISX A;  3BXM A;  1F2O A;  1Q2Y A;  4JXR A;  4U5Y A;  2EO8 A;  2C1C A;  1ARL A;  1CP6 A;  1S5K A;  2BL1 A;  3FBU A;  2B58 A;  1HDU A;  3SJX A;  3EC4 A;  4Z65 A;  3W6S A;  4NGN A;  2PJ3 A;  2ZW6 A;  1XIX A;  3R1K A;  4PPZ A;  4C68 A;  4KVX A;  3K9U A;  1LCP A;  4DUK A;  4JD6 A;  2EK8 A;  3IJ3 A;  3CZX A;  3FNC A;  5JH9 A;  3IEH A;  3VAR A;  2XEF A;  1YLO A;  4FD5 A;  5LRG A;  1MJB A;  3S9M A;  3DNS A;  2BCO A;  2QYV A;  4OAE A;  1XMT A;  5AG6 A;  4B5O A;  2CF4 A;  2ZEM A;  3D67 A;  3D68 A;  4X8I A;  2Q43 A;  1JWQ A;  4MFJ A;  4RS2 A;  5LYD A;  4I49 A;  3LWU A;  4UCN A;  2WPX A;  2NYQ A;  1IID A;  1ARM A;  2GFQ A;  1MJ9 A;  2BEI A;  2AFM A;  5HMN A;  1LRZ A;  4U9Y A;  4IUS A;  1K4J A;  4R87 A;  3BLN A;  4UF4 A;  5I0C A;  2WUU A;  4KSA A;  4ONW A;  3FXT A;  4IHM A;  3SJE A;  2YNC A;  1VHE A;  5AGE A;  4LUA A;  4Q38 A;  4A37 A;  5F49 A;  2Q44 A;  3SI2 A;  4ZGY B;  1QSO A;  5HVH A;  3IC1 A;  1IU8 A;  4KVM E;  3IU1 A;  2J8M A;  1KUX A;  1TF9 A;  4KS9 A;  2POK A;  1YR0 A;  2IL4 A;  3RO0 A;  2JBK A;  5A28 A;  1RXT A;  4HPS A;  4UEF A;  3H4Q A;  5G20 A;  4MCQ A;  3TO9 A;  5KTA A;  5F47 A;  4A30 A;  3GKR A;  5LYF A;  2HUZ A;  3FEE A;  4KOY A;  4GXH A;  1IGB A;  4R9M A;  1X12 A;  3CPA A;  3WC5 A;  5J8F A;  3DR8 A;  3FYN A;  2B4D B;  3L2N A;  3DLJ A;  5H86 A;  4H2K A;  1QSN A;  3K2K A;  2PRQ A;  4P45 A;  4KOV A;  4A94 A;  2Q51 A;  3TFY A;  2NMT A;  2AFW A;  2I00 A;  1XOV A;  5D8N A;  3PZJ A;  4CPA A;  5IV0 A;  2Q0Y A;  2B5G A;  3ISZ A;  4NSQ A;  2Q4Y A;  4PSW A;  2XEI A;  3D7H A;  4QBJ A;  2PIZ A;  4MFP A;  2ATR A;  5EC4 A;  2R8V A;  4A31 A;  2AJ6 A;  4KSF A;  1UWY A;  2G3T A;  3MRU A;  3I3G A;  4OC4 A;  2AFX A;  3VAT A;  4JJX A;  3TT2 A;  4C7H A;  1Z9U A;  5A27 A;  4L8A A;  3PEI A;  4KSI A;  1YW6 A;  2WZN A;  1UFH A;  4NGQ A;  1WWZ A;  3DR6 A;  4PXB A;  1Y7R A;  3SI0 A;  8CPA A;  2IJZ A;  4P4B A;  3VH9 A;  1YSJ A;  4X3R A;  3RAM A;  1SQH A;  2F8H A;  3TCV A;  3WC7 A;  3JVN A;  4H89 A;  4ZY1 A;  3B35 A;  4XNH C;  1I21 A;  3E0K A;  1ZLI A;  1M4I A;  4CYP A;  1RO5 A;  3PRT A;  3R9G A;  1IYK A;  2PJA A;  1Z8W A;  4WWV A;  4A2Z A;  2PVW A;  2PDO A;  3FIX A;  3NE8 A;  4MI4 A;  4MHZ A;  2BSW A;  4P4D A;  4MFL A;  1ZG7 A;  2FCK A;  4UFV A;  5D29 A;  3DGV A;  3PB9 X;  5EBV A;  4CGL A;  2ZPA A;  3BJ7 A;  1Q2D A;  2REE A;  2G3A A;  4F0Y A;  2C27 A;  2R7H A;  4XPD C;  4KOR A;  1GHE A;  2O4H A;  5G1Z A;  2EUI A;  3BI0 A;  1S7N A;  3G8W A;  3PFO A;  5DS0 A;  3FMC A;  2VEZ A;  3D4U A;  4ORF A;  4A33 A;  3PBB A;  3B3T A;  1LAN A;  1LAM A;  4CGM A;  3SHP A;  2A4N A;  2YNC C;  3B2Y A;  4MFZ A;  1ZO0 A;  3SI1 A;  2Q7S A;  4UCM A;  4ZI6 A;  2Z3P A;  5GCN A;  1IB1 E;  3EO4 A;  2HQY A;  2VL1 A;  1VHO A;  2ZOG A;  3A9L A;  4A95 A;  4XNH B;  2P6F A;  2HV2 A;  2PQ8 A;  2PR8 A;  2QJ8 A;  4OC5 A;  3TC8 A;  4MY3 A;  2ZW5 A;  3H8G A;  2BUE A;  1Z2L A;  3I1U A;  4E2A A;  4KOX A;  4AVC A;  2ZEO A;  1ZLH A;  3KHZ A;  1CP7 A;  3CDX A;  2QML A;  2RB7 A;  2EWB A;  4OAD A;  4R57 A;  4E8O A;  2FVG A;  1U6M A;  3TO7 A;  2FIW A;  3QAH A;  3S6G A;  1FY7 A;  2PVV A;  4XPD B;  3R9F A;  3TO6 A;  2D4P A;  1M1D A;  1MJA A;  1XBU A;  2PJ1 A;  3EXN A;  4OLL A;  4A38 A;  1X10 A;  4OP4 A;  5EMI A;  3WT4 A;  3W91 A;  4CGN A;  4YFJ A;  2O53 A;  5K8P A;  3NFZ A;  2J9A A;  4B11 A;  1PUA A;  3SJG A;  4CAW A;  3B3V A;  1BO4 A;  4NJQ A;  1M44 A;  4B10 A;  1ELM P;  3D7G A;  4MFQ A;  5LYI A;  2Q4Z A;  5K8O A;  3TOA A;  1IOI A;  4PV6 A;  2AFZ A;  3FVL A;  3PP9 A;  1QMU A;  3RBU A;  1KZF A;  4ZX8 A;  3DSB A;  2FXF A;  3D7D A;  4L89 A;  3FH4 A;  5ELY A;  2B3U A;  4DJL A;  5E96 A;  2BO9 A;  5JM6 A;  2JLM A;  2Z3M A;  2Z3K A;  4YWY A;  1TIQ A;  2I3C A;  1XRY A;  4KLW A;  3WC6 A;  4BD9 A;  3W6X A;  2AE6 A;  4DNC A;  2OH1 A;  1YK3 A;  5JPH A;  5F46 A;  5K8M A;  2ABZ A;  2JDC A;  2Y0M A;  1BPM A;  1S3Z A;  4B5P A;  4EME A;  1Q7L A;  4NFR A;  3GLJ A;  4NGS A;  1XE4 A;  3G3S A;  2B5G B;  4M3S A;  2PJ7 A;  4LQG A;  4R3L A;  4FD6 A;  4MMO A;  2CIJ A;  5KTC A;  3KR4 A;  2OR4 A;  2XEJ A;  1XMB A;  2C6G A;  2DXQ A;  3LOD A;  1F2P A;  3KQZ A;  1XEB A;  1S60 A;  2J8R A;  2OZG A;  1YRE A;  1YVK A;  3NH4 A;  2ZEH A;  4UFX A;  3FJU A;  1YME A;  2D4O A;  2PJ6 A;  1M4G A;  4AVB A;  2R1I A;  3GUX A;  4NGM A;  2ANP A;  2PJB A;  2V8D A;  4QUS A;  4IAV A;  5AG5 A;  4BIN A;  5K8N A;  1AMP A;  1AUG A;  2P6E A;  2YND A;  1CX8 A;  3QB8 A;  4R3K A;  4RI1 A;  4JXQ A;  4MY0 A;  2H5M A;  5J8C A;  3H8F A;  1YVO A;  2F7V A;  4ZYQ A;  2V8H A;  4YU9 A;  2VQY A;  1AYE A;  1I1D A;  5F48 A;  3LAC A;  1YW4 A;  2ARH A;  2VXK A;  3T9Y A;  3JTK A;  3T8W A;  1CJW A;  1P4N A;  1QSM A;  4KVO E;  5CBM A;  4Y49 B;  1YQE A;  4P44 A;  3S6K A;  3KKW A;  4OC3 A;  1CPS A;  4P4I A;  4ZX9 A;  3S6F A;  1XF8 A;  2X7B A;  3D8P A;  4MXU A;  4UCP A;  3P2F A;  3D66 A;  5AG4 A;  4MHN A;  2VZY A;  1IYL A;  1VIX A;  2Q04 A;  4AVA A;  1V0C A;  2REF A;  5HXD A;  1NSA A;  3T90 A;  3RZA A;  3F0A A;  3IFE A;  4OME A;  2VI7 A;  4CGO A;  2GU2 A;  4JYW A;  2PJ5 A;  4BBH A;  3CXQ A;  2ZEE A;  4X5K A;  3MGD A;  2JDD A;  2CXA A;  2I79 A;  2OZU A;  3D2P A;  3QNV A;  1NE9 A;  4CRZ B;  3TX8 A;  5THW A;  4DYO A;  1EE3 P;  1Q2C A;  4MHP A;  5IB9 A;  3H8E A;  5CNP A;  4HKF A;  3R95 A;  4FBE A;  5F09 A;  2YNE A;  1JQG A;  2CY2 A;  1Y0R A;  2GRE A;  5DWM A;  2DPS A;  3EY5 A;  3IO1 A;  4II9 A;  3KZW A;  4KLV A;  2YGW A;  2CNT A;  4P10 A;  1TF8 A;  3R96 A;  4AG9 A;  1ELL P;  3CXS A;  2ZEG A;  2EK9 A;  5LRK A;  2PJ4 A;  2ZEP A;  2FSR A;  4B13 A;  2AFU A;  4CRY B;  2AFO A;  3CT9 A;  3FRM A;  4PSX A;  3F8K A;  4GS4 A;  4ZY0 A;  4EVY A;  3KAS A; 
#chains in the Genus database with same CATH homology
 5G22 A;  1N71 A;  4NEX A;  4XPK A;  2J8N A;  4JLY A;  4MFK A;  4Q36 A;  1KUV A;  1OZP A;  1J4J A;  1B87 A;  1YGH A;  4QVT A;  2Z10 A;  4UWI A;  5DWN A;  1S7F A;  2PRB A;  2DPT A;  4IF5 A;  2GE3 A;  3IWE A;  3EFA A;  4ONU A;  2G0B A;  4HNX B;  5C88 A;  2B3V A;  4PK2 A;  3TOB A;  2Z3O A;  4UBR A;  4KOU A;  2QEC A;  2WPW A;  4CYO A;  5FVJ A;  3S6H A;  4B5P B;  4CAE A;  1ON0 A;  4E0A A;  3SXN A;  3TTH A;  1WK4 A;  1KUY A;  3IU2 A;  2KCW A;  3P2H A;  1S7L A;  3VWE A;  3H5Z A;  3OWC A;  4M85 A;  3B8G A;  2R98 A;  2Z3N A;  3N7Z A;  1P0H A;  4KOT A;  3IWG A;  1NMT A;  4H6Z A;  3D3S A;  3JUW A;  4KUA A;  4UA3 A;  4Y49 C;  4CAF A;  1QST A;  1VKC A;  2Z11 A;  2PR1 A;  4YGO A;  3PGP A;  1Z4R A;  2EVN A;  1YX0 A;  3IGR A;  1Y9K A;  2VZZ A;  2Z0Z A;  2Z3L A;  1IIC A;  2ZW7 A;  4NXY A;  3WR7 A;  5AG7 A;  4ZBG A;  1PU9 A;  4B12 A;  1NSL A;  3V8I A;  3UY5 A;  4PK3 A;  2FL4 A;  4UFW A;  2OB0 A;  3BJ8 A;  5C82 A;  4MHD A;  4CS0 B;  1BOB A;  2VBQ A;  2OZH A;  4AB7 A;  2Q4V A;  4C2Z A;  2GAN A;  4F6A A;  4F0X A;  3I9S A;  4CYQ A;  4CAV A;  2WSA A;  4XPL A;  3D2M A;  4CAX A;  2PSW A;  4MJ8 A;  4HNW B;  1I12 A;  2B4B A;  2F5I A;  2FT0 A;  4K30 A;  4AG7 A;  4HNY B;  1MK4 A;  2FE7 A;  2GIV A;  5IB0 A;  2P6G A;  2K5T A;  1B6B A;  5H84 A;  3CXP A;  1YLE A;  4KZT A;  2JEV A;  4JWP A;  3GY9 A;  4A32 A;  3SXO A;  4CYN A;  3FB3 A;  2RC4 A;  1Z4E A;  2B4D A;  4FD4 A;  4KOS A;  4YRH A;  4FD7 A;  1CM0 A;  1Y9W A;  3ZZI A;  2PC1 A;  2P0W A;  5ISV A;  2FS5 A;  4U9Z A;  3R9E A;  5BWA B;  3LD2 A;  3NE7 A;  4BMH A;  3RYO A;  1QSR A;  2ZXV A;  3ZJ0 A;  3C26 A;  5HH1 A;  4LX9 A;  4B14 A;  4C2X A;  3DDD A;  4MBU A;  5G21 A;  3VWD A;  2OU2 A;  4NF1 A;  4NCZ A;  4C2Y A;  2Q7B A;  5IX3 A;  3TE4 A;  1R57 A;  4UWJ A;  1M4D A;  2CNM A;  4J3G A;  2ZW4 A;  5KTD A;  3F5B A;  1VHS A;  1S7K A;  2FIA A;  4QC6 A;  4QB9 A;  4KOW A;  4KUB A;  4H6U A;  4C7I A;  2CNS A;  2O28 A;  1L0C A;  5JQ4 A;  4CGP A;  3GYA A;  2QIR A;  1Q2Y A;  4JXR A;  4U5Y A;  1S5K A;  2BL1 A;  3FBU A;  2B58 A;  3EC4 A;  3W6S A;  2ZW6 A;  1XIX A;  3R1K A;  4C68 A;  4KVX A;  3K9U A;  4JD6 A;  3FNC A;  4FD5 A;  1MJB A;  3DNS A;  4OAE A;  1XMT A;  5AG6 A;  4B5O A;  4MFJ A;  4RS2 A;  4I49 A;  4UCN A;  2WPX A;  1IID A;  1MJ9 A;  2BEI A;  5HMN A;  1LRZ A;  4U9Y A;  4IUS A;  1K4J A;  4R87 A;  3BLN A;  5I0C A;  2WUU A;  4KSA A;  3FXT A;  2YNC A;  5AGE A;  4LUA A;  4Q38 A;  5F49 A;  2Q44 A;  4ZGY B;  1QSO A;  4KVM E;  3IU1 A;  2J8M A;  1KUX A;  5A28 A;  4KS9 A;  1YR0 A;  2IL4 A;  1RXT A;  3H4Q A;  5G20 A;  3TO9 A;  5KTA A;  5F47 A;  4A30 A;  3GKR A;  2HUZ A;  4KOY A;  4R9M A;  5J8F A;  3DR8 A;  3FYN A;  2B4D B;  5H86 A;  1QSN A;  4KOV A;  3TFY A;  2NMT A;  2I00 A;  3PZJ A;  5IV0 A;  2Q0Y A;  2B5G A;  4PSW A;  4NSQ A;  2Q4Y A;  4QBJ A;  4MFP A;  2ATR A;  5EC4 A;  2R8V A;  4A31 A;  2AJ6 A;  4KSF A;  2G3T A;  3I3G A;  4C7H A;  4JJX A;  3TT2 A;  1Z9U A;  5A27 A;  4L8A A;  1UFH A;  1WWZ A;  3DR6 A;  1Y7R A;  1SQH A;  3TCV A;  3JVN A;  4H89 A;  4XNH C;  3E0K A;  1I21 A;  1M4I A;  4CYP A;  1RO5 A;  3R9G A;  1IYK A;  4A2Z A;  3FIX A;  2PDO A;  4MI4 A;  2BSW A;  4MFL A;  2FCK A;  4UFV A;  5EBV A;  4CGL A;  2ZPA A;  3BJ7 A;  1Q2D A;  2REE A;  2G3A A;  4F0Y A;  2C27 A;  2R7H A;  4XPD C;  4KOR A;  1GHE A;  5G1Z A;  2EUI A;  1S7N A;  3G8W A;  2VEZ A;  4ORF A;  4A33 A;  4CGM A;  3SHP A;  2A4N A;  2YNC C;  4MFZ A;  1ZO0 A;  4UCM A;  2Z3P A;  5GCN A;  1IB1 E;  3EO4 A;  2HQY A;  3A9L A;  4A95 A;  4XNH B;  2P6F A;  2HV2 A;  2PQ8 A;  2PR8 A;  4MY3 A;  2ZW5 A;  2BUE A;  4E2A A;  4KOX A;  4AVC A;  2QML A;  4OAD A;  4R57 A;  4E8O A;  1U6M A;  3TO7 A;  2FIW A;  3QAH A;  3S6G A;  1FY7 A;  4XPD B;  3R9F A;  3TO6 A;  2D4P A;  1M1D A;  1MJA A;  4OLL A;  3EXN A;  4CGN A;  3W91 A;  4YFJ A;  4B11 A;  1PUA A;  4CAW A;  1BO4 A;  1M44 A;  4B10 A;  4MFQ A;  3TOA A;  4PV6 A;  3PP9 A;  1KZF A;  3DSB A;  2FXF A;  4L89 A;  2B3U A;  5E96 A;  2JLM A;  2Z3M A;  2Z3K A;  1TIQ A;  4KLW A;  3W6X A;  2AE6 A;  4DNC A;  2OH1 A;  1YK3 A;  5JPH A;  5F46 A;  2JDC A;  2Y0M A;  1S3Z A;  4B5P A;  1XE4 A;  3G3S A;  2B5G B;  4M3S A;  4R3L A;  4FD6 A;  5KTC A;  2DXQ A;  3LOD A;  4UFX A;  1XEB A;  1S60 A;  2J8R A;  2OZG A;  1YRE A;  1YVK A;  4AVB A;  2D4O A;  1M4G A;  2R1I A;  4QUS A;  5AG5 A;  2P6E A;  2YND A;  4R3K A;  3QB8 A;  4RI1 A;  4JXQ A;  4MY0 A;  2H5M A;  5J8C A;  1YVO A;  2VQY A;  1I1D A;  5F48 A;  2ARH A;  2VXK A;  3T9Y A;  3JTK A;  1CJW A;  1P4N A;  1QSM A;  4KVO E;  4Y49 B;  3S6K A;  3KKW A;  3S6F A;  1XF8 A;  2X7B A;  3D8P A;  4UCP A;  3P2F A;  5AG4 A;  2VZY A;  1IYL A;  2Q04 A;  4AVA A;  1V0C A;  2REF A;  3T90 A;  3F0A A;  2VI7 A;  4CGO A;  4BBH A;  3CXQ A;  4X5K A;  3MGD A;  2JDD A;  2CXA A;  2I79 A;  2OZU A;  3D2P A;  1NE9 A;  4CRZ B;  1Q2C A;  5CNP A;  4HKF A;  3R95 A;  2YNE A;  2CY2 A;  5DWM A;  2DPS A;  3EY5 A;  4II9 A;  4KLV A;  2YGW A;  2CNT A;  4AG9 A;  3R96 A;  3CXS A;  2FSR A;  4B13 A;  4CRY B;  3FRM A;  4PSX A;  3F8K A;  4GS4 A;  4EVY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...