4MFJA

The crystal structure of acyltransferase
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
328
structure length
328
Chain Sequence
b'GSHMMMDPETVRIALGLEERTAAWLTELDELGPPAEPVRLPRGEEARDLLRRLEVPELDAEEIVAAAPDPDRDPALWWLLERTHHAIVRHMGDHRAKPRGGPPLPYEGGAAARYFHVYVFLATVPAVRRFHAERGIPDEVGWETLTQLGELVAIHRRKYGQGGMNMQWWTTYHLRGILYRLGRLQFSLATGKDGTPHLGLHVPEWGGPLLPKAYDESLHRARPFFDRHFPEHGARVAWGSSWMLDPQLEEYLTEDSNIIQLARFWTLTDSAPEPGNADGDSSILEFVFRYNGQPLDELPQRSSLERAVIAHLKAGRHWHMRTGFVKLP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative uncharacterized protein tcp24
molecule tags Transferase
source organism Actinoplanes teichomyceticus
publication title Multiple complexes of long aliphatic N-acyltransferases lead to synthesis of 2,6-diacylated/2-acyl-substituted glycopeptide antibiotics, effectively killing vancomycin-resistant enterococcus
pubmed doi rcsb
total genus 97
structure length 328
sequence length 328
ec nomenclature ec 2.3.1.-:
pdb deposition date 2013-08-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18082 DUF5596 Domain of unknown function (DUF5596)
A PF18164 GNAT_C GNAT-like C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.120 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4mfjA02
4MFLA 4MFPA 4MFJA 4Q36A 4Q38A 4MFKA 4MFQA 4MFZA
chains in the Genus database with same CATH superfamily
3W6XA 3TFYA 4OC1A 1VGYA 1IB1E 2JEVA 4CAVA 2F8HA 3T8WA 2Q04A 1LCPA 5LYDA 2I3CA 2PIZA 3B35A 4QUSA 3FNCA 2VI7A 1XMBA 4F0XA 2G3AA 3KI9A 4LX9A 3R9EA 3RBUA 3FIXA 3PB8X 5DWNA 2ZW7A 5CNPA 2GE3A 4CYNA 1FY7A 2Q0YA 3BHXA 3T9YA 3VWDA 1FNOA 4R9MA 2ZPAA 5F47A 4AG9A 2CTCA 4PXDA 4W9YA 1EE3P 1XIXA 3I1UA 4R8FA 1BAVA 2B5GB 2Q7BA 2HC9A 3H8GA 1M4LA 3IWGA 3LACA 4BINA 4C2ZA 3S6FA 2ZEPA 4MY0A 3RYOA 4CYPA 5AG6A 2V8GA 2K5TA 1QSRA 2ANPA 4G1PA 4P4JA 2B4BA 3FBUA 3IWEA 1YGHA 3D2MA 4C2XA 3D67A 2A4NA 2VEZA 4FD5A 2JDDA 2FE7A 3I3GA 4UEZA 2PJ7A 3G8WA 3EY5A 5HH1A 4XNHB 5LRGA 3S9MA 1U6MA 2QECA 3D68A 4UEFA 3SXOA 2ZOFA 3JTKA 3ZZIA 4KOXA 4MFLA 4ZBGA 3W91A 1F57A 2J8MA 2B4DA 2HUZA 2G3TA 1F2OA 5GCNA 3W6SA 3VARA 5AG4A 4WWVA 5J1QA 2NYQA 3PB4X 2VBQA 4OADA 3NFZA 4UF4A 4E2AA 1Y9KA 3WC5A 1PUAA 2PJBA 1CPSA 2B4DB 4A32A 1XF8A 3D7GA 3IU1A 2Z3PA 2XEGA 4C68A 3TO7A 2POKA 5HVGA 4I49A 4KSIA 1OBRA 1YK3A 3C26A 3IIBA 3PB6X 4R57A 2I00A 4UIBA 5HVFA 4L8AA 2CNTA 2YNCA 4B11A 4GS4A 3FB3A 1Z8LA 4PSWA 1XOVA 1XE4A 4MCRA 4UBRA 4M6HA 4U9YA 3PZJA 5JPHA 5C82A 3D7FA 1YVKA 4A37A 4C7HA 2PJ2A 4P6YA 4F9UA 3BJ7A 5AGEA 3NE7A 1ELMP 4YFJA 1IIDA 3PFEA 4OC4A 1UWYA 1I21A 3VH9A 3CZXA 2AFMA 1NSLA 1S7KA 4PXBA 1Z2LA 1PYTB 4CYQA 4CYOA 2Z3OA 3NH8A 4NGTA 3H8FA 2J9AA 1MJ9A 3LWUA 1VIXA 2FCKA 2Z3LA 4H2KA 2IL4A 4UFXA 5JQ4A 2O4HA 3DNSA 4FUUA 4P4BA 4R87A 3FXTA 4NGSA 1M4GA 1KWMA 4CS0B 2BOAA 2VXKA 3A9LA 4RI1A 2ZEFA 3V38A 1JQGA 4K3NA 4RS2A 4AXVA 4OC0A 4H6ZA 4P4FA 4NF1A 2GLFA 2V8DA 2JBJA 3D7HA 3RNZA 3ISZA 3D3SA 1ELLP 5G22A 1LRZA 4BD9A 2FS5A 4U9ZA 1VHSA 3IFEA 2J8NA 4ZX9A 1QSMA 4MFKA 3GKRA 2DPSA 5KTAA 1QSNA 2GFQA 5IX3A 1CPXA 4PQAA 4CGLA 2AFZA 4MFJA 3NH4A 2OOTA 4QBJA 1Y0YA 4A33A 2CXAA 3SJGA 4KS9A 4AB7A 4ZI6A 2DPTA 4B12A 3TO9A 4F6AA 3KR5A 3WC7A 2PC1A 1Q2YA 3B8GA 2H5MA 4FD4A 4Y49C 4H89A 1AUGA 4UWIA 1IU8A 1Z8WA 4KOVA 3B2YA 2Z10A 3D66A 4OAEA 3S9NA 5JH9A 4F8ZA 1R3NA 1AMPA 1LAPA 4KVXA 4HPSA 4MHDA 2D4OA 2VZZA 1B87A 1IOIA 2EO8A 5G20A 4OIWA 4M6IA 3CPAA 3GYAA 4A31A 1Z5RA 3HLPA 3H4QA 3QAYA 2PJ6A 2PJ4A 3NH5A 3PP9A 5ISVA 4FWUA 4RUHA 3LODA 1IOFA 1HDQA 5DS0A 5G1ZA 1HEEA 1YMEA 5AG5A 2AFUA 1ZG9A 4EMEA 2PRBA 2YGWA 2PJCA 5LRJA 2REEA 4NSQA 3V8IA 4R6TA 2PE3A 4CAXA 2F5IA 3FEDA 2QIRA 5F48A 4CAEA 2JEWA 4EVYA 4KORA 4MFPA 3GB0A 4IUSA 3WC6A 2WSAA 4XPLA 1RO5A 1TKFA 1ZG7A 3RZAA 3UY5A 4EWTA 3KR4A 2NSMA 4M85A 1P0HA 5H86A 4B5PA 1KZFA 1XMTA 2BO9A 4Q36A 3NE8A 4P10A 4MJ8A 2WPXA 1NMTA 1NE9A 3DR6A 4IF5A 4OMEA 4HNYB 3IGRA 4J3GA 3PRTA 4NGNA 1H8LA 1ARMA 2ABZA 4YWYA 2ZEMA 2PVVA 2FT0A 4NFRA 4IAVA 4KOSA 3F0AA 4X5KA 2OU2A 2FXFA 4CAFA 5EMIA 2IJZA 2O53A 3TC8A 1TKHA 4MMOA 1DTDA 4KZTA 3B3CA 5F49A 1RXTA 1S7NA 2PRQA 3GIUA 1Z4RA 4P44A 3S6KA 5HMNA 4HNWB 4P4EA 3R9FA 4ZGYB 5J8CA 1VHEA 2OB0A 4DYOA 3NA6A 4MFZA 1JWQA 3DSBA 2NMTA 3H8EA 1CBXA 1M1DA 4JXRA 2P0WA 1YSJA 4M3SA 2V8VA 3B3TA 3SJFA 4JLYA 4XNHC 2REFA 2JDCA 3FECA 1M44A 2CTBA 4KLVA 2GREA 2PJ3A 1CP6A 1Q2CA 3ZJ0A 2Q4ZA 4UFWA 4AVAA 1WWZA 3FJUA 4B6ZA 3WT4A 2PJ9A 1CM0A 2G0BA 2B3VA 2FIWA 3L2NA 2GU2A 4MRIA 1QSTA 3EO4A 4MFQA 3FRMA 3PB9X 3GUXA 4UIAA 3D4UA 4X3RA 3MGDA 4OP4A 2J8RA 4MXUA 3JUWA 5JGFA 1GHEA 1QMUA 1A2ZA 2YNCC 1LFWA 4JZ0A 4IHMA 3KHZA 5K8PA 2VQYA 3KQZA 2ZW6A 3G3SA 4B5PB 1ZO0A 3FMCA 1XFOA 5KTDA 3K2KA 4JJXA 4MHNA 4UCPA 2V8HA 3TO6A 2RFHA 2FIAA 4IK2A 4HKFA 2D4PA 5ELYA 3B7IA 5HXDA 4AG7A 3TX8A 4K30A 2PJ8A 3TE4A 4NGPA 4UCMA 1R57A 1XBUA 4R7MA 5EBVA 2P6GA 3SXNA 2IQ6A 2OZGA 3B3SA 5CPAA 3EXNA 4CGPA 2GANA 2JLMA 4LQGA 2B3UA 8CPAA 1LOKA 4U5YA 3K9UA 2ARHA 3F5BA 1MK4A 3IEHA 3S9LA 4XPDC 4FD6A 3DR8A 3EC4A 3KHXA 2ODFA 4P4IA 5AG7A 5LRKA 5HVHA 1Y9WA 3JRUA 4KOUA 3TOAA 4A30A 5F46A 4UFVA 3WR7A 1K4JA 2EK9A 1NSAA 3TT2A 4MCSA 1TKJA 1Q7LA 1BPMA 1P4NA 3D8PA 3WABA 2FSRA 3MRUA 4Q38A 1LAMA 2ZEDA 4MBUA 1PCAA 1BPNA 2DXQA 4OKOA 1L0CA 1CJWA 4NJQA 4UA3A 5BWAB 2RC4A 3N5FA 1ZLIA 3CPXA 3MN8A 4ZY2A 1IICA 1CG2A 3K9TA 1IGBA 3PBBA 2XEIA 1CX8A 1Q2DA 3RAMA 2C6CA 4QVTA 4A2ZA 2ZOGA 2JBKA 1SQHA 2C1CA 1AYEA 4MY3A 3LMSA 4QC6A 1Z9UA 5K8NA 3FVLA 1B6BA 4KOWA 2EVNA 4CGOA 1KUYA 3R9GA 3HUVA 4PK3A 4UEEA 6CPAA 1OZPA 2PIYA 3EFAA 1F2PA 2R1IA 4LQ6A 5LYIA 3DDDA 3R1KA 3QB8A 2O28A 4JD6A 4OC5A 3FH4A 5E96A 2DEAA 2PSWA 3V7ZA 4EFDA 3E0KA 2B58A 1YX0A 2FVGA 2Q7SA 4UWJA 4AVCA 4ZY1A 1MJAA 2Q43A 5FVJA 2PJ0A 4MCQA 4MI4A 3I9SA 4NGQA 3S6GA 1YLOA 4PSXA 4PV6A 4KVOE 2R7HA 4CRZB 2AFWA 1LANA 2Y0MA 4PPZA 4CAWA 2ZW4A 1YREA 2PJAA 2HV2A 2ZELA 2C6PA 3R96A 4F9VA 4X8IA 2OZUA 3BXMA 4BBHA 3B3WA 2Z0ZA 4P4DA 5IB9A 1X10A 1ZLHA 2GIVA 5I4MA 5LYFA 1CP7A 1QSOA 1Y0RA 4MCPA 3IC1A 4FAIA 1VKCA 2F7VA 2BSWA 5A28A 3QNVA 3CXPA 1S7LA 4ZYQA 3DGVA 2YNDA 3P2HA 4Q7AA 2CY2A 2Q44A 2HB6A 4JXQA 2ZEEA 4JWPA 3VATA 2AFXA 4PK2A 3IU2A 1PU9A 1XJOA 3IO1A 2XEFA 3CXQA 4NXYA 4OIDA 5I0CA 3N7ZA 4L89A 4F0YA 1TF9A 1S3ZA 2EK8A 2I79A 4WJBA 3SJEA 1WK4A 1M4IA 2C27A 3KGQA 4A38A 5J8FA 4UCNA 5KTCA 4A94A 3SI2A 1VHOA 4KVME 4LUAA 4ZX8A 3PFOA 2WPWA 5G21A 1KUXA 1XRYA 2AE6A 3CDXA 4H6UA 3KZWA 1Y7EA 4YGOA 4Y49B 3SHPA 2CF4A 2P6FA 5F09A 2PR1A 2PVWA 4HNXB 4R76A 1BO4A 2XEJA 4ONWA 4R3LA 2BEIA 1YQEA 2CNMA 3TCVA 3TTHA 4C7IA 1TIQA 4M6GA 1TF8A 1Z8TA 3BI0A 5C88A 4R3KA 4KSFA 2VZYA 3KASA 4FBEA 5CBMA 1BOBA 4OC2A 3BLNA 3D2PA 1FT7A 3FX6A 2FL4A 1RTQA 2BL1A 3BJ8A 3BI1A 4NJRA 2AFOA 2WZNA 2ZXVA 4Z65A 2OZHA 2KCWA 2WYRA 3QAHA 4B14A 4YRHA 1Z8XA 4II9A 2GLJA 1TXRA 5A27A 4JYWA 2PQ8A 4CRYB 1N71A 4QB9A 4B13A 1S60A 4E8OA 3IJ3A 3T90A 2AFSA 1IY7A 2G9DA 3FYNA 2RB7A 4KUBA 4KSAA 4A39A 4ZY0A 1BLLE 2ZEOA 3JVNA 2Q51A 3KL9A 1Z4EA 1J4JA 1I1DA 4OLLA 4CGMA 2EBJA 4MHYA 3H5ZA 1KUVA 4NGRA 4P45A 4CPAA 4KLWA 2EUIA 2BUEA 2B5GA 1I12A 2PCUA 3D7DA 4X2TA 5K8OA 1YLEA 3CT9A 5IV0A 4B10A 4NGMA 4MHZA 1ON0A 4KOTA 2VL1A 1YVOA 2WUUA 2Z3MA 3GLJA 5H84A 4CGNA 4E0AA 4FD7A 4OC3A 4XPDB 5IB0A 4BMHA 5DWMA 2ZW5A 2OH1A 3DLJA 4NEXA 2AJ6A 3KQXA 4XPKA 2V77A 4MHPA 3B3VA 3VWEA 4NCZA 3S6HA 2PJ1A 3P2FA 2ATRA 2C6GA 2YNEA 1QQ9A 4DUKA 1ARLA 5THWA 3TOBA 3F8KA 1S7FA 3SJXA 3KKWA 4ONUA 4GM5A 5EC4A 2ZEHA 1Y7RA 1ZG8A 2CIJA 2QJ8A 4KUAA 3SI1A 1R43A 2PR8A 3ISXA 1X12A 4TNUA 2CNSA 1IYLA 2PJ5A 4B5OA 4O23A 4TWEA 4DNCA 5K8MA 2HQYA 4C2YA 4ORFA 3LD2A 3R95A 2R8VA 3PBEA 2QYVA 4KOYA 3FF3A 3PEIA 5JM6A 4AVBA 2P6EA 2ZEGA 1UFHA 1YR0A 1YW4A 1DE4C 2Q4YA 2Z3KA 4GXHA 1IYKA 2Z11A 2QVPA 1YW6A 2ZENA 4PXCA 2Z3NA 4RN7A 1GYTA 2R98A 4DJLA 2QMLA 1M4DA 2EWBA 3CXSA 2X7BA 2BCOA 1XEBA 4PXEA 4A95A 7CPAA 5D29A 3RO0A 1V0CA 3PGPA 2Q4VA 2OR4A 1S5KA 5D8NA 1MJBA 2PDOA 5LYLA 3OWCA 1HDUA 3PB7X 2IMOA 3IWWA 2DF5A 3GY9A 3SI0A 3FEEA 4YU9A
chains in the Genus database with same CATH topology
3W6XA 3TFYA 1IB1E 2JEVA 4CAVA 2Q04A 4QUSA 3FNCA 2VI7A 4F0XA 2G3AA 4LX9A 3R9EA 3FIXA 5DWNA 2ZW7A 5CNPA 2GE3A 4CYNA 1FY7A 2Q0YA 3T9YA 3VWDA 4R9MA 2ZPAA 5F47A 4AG9A 1XIXA 2Q7BA 2B5GB 3IWGA 4C2ZA 3S6FA 4MY0A 3RYOA 4CYPA 5AG6A 2K5TA 1QSRA 2B4BA 3FBUA 3IWEA 1YGHA 3D2MA 4C2XA 2A4NA 2VEZA 4FD5A 2JDDA 2FE7A 3I3GA 3G8WA 3EY5A 5HH1A 4XNHB 1U6MA 2QECA 3SXOA 3JTKA 3ZZIA 4KOXA 4MFLA 4ZBGA 3W91A 2J8MA 2B4DA 2HUZA 2G3TA 5GCNA 3W6SA 5AG4A 2VBQA 4OADA 4E2AA 1Y9KA 1PUAA 2B4DB 4A32A 1XF8A 3IU1A 2Z3PA 4C68A 3TO7A 4I49A 1YK3A 3C26A 4B11A 4R57A 2I00A 4L8AA 2CNTA 2YNCA 4GS4A 3FB3A 4PSWA 1XE4A 4UBRA 4U9YA 3PZJA 5JPHA 5C82A 1YVKA 4C7HA 3BJ7A 5AGEA 3NE7A 4YFJA 1IIDA 1I21A 1NSLA 1S7KA 4CYQA 4CYOA 2Z3OA 1MJ9A 2FCKA 4UFXA 2Z3LA 2IL4A 5JQ4A 3DNSA 4R87A 3FXTA 1M4GA 4CS0B 2VXKA 3A9LA 4RI1A 4RS2A 4H6ZA 4NF1A 3D3SA 5G22A 1LRZA 2FS5A 4U9ZA 1VHSA 2J8NA 4MFKA 1QSMA 3GKRA 2DPSA 5KTAA 1QSNA 5IX3A 4CGLA 4MFJA 4QBJA 4A33A 2CXAA 4KS9A 4AB7A 2DPTA 4B12A 3TO9A 4F6AA 2PC1A 1Q2YA 3B8GA 2H5MA 4FD4A 4Y49C 4H89A 4UWIA 4KOVA 2Z10A 4OAEA 4MHDA 4KVXA 2D4OA 2VZZA 1B87A 5G20A 4A31A 3GYAA 3H4QA 3PP9A 5ISVA 3LODA 5G1ZA 5AG5A 2PRBA 2YGWA 2REEA 4NSQA 3V8IA 4CAXA 2F5IA 2QIRA 5F48A 4CAEA 4EVYA 4KORA 4MFPA 4IUSA 2WSAA 4XPLA 1RO5A 3UY5A 4M85A 1P0HA 5H86A 4B5PA 1KZFA 1XMTA 4Q36A 4MJ8A 2WPXA 1NMTA 1NE9A 3DR6A 4IF5A 4HNYB 3IGRA 4J3GA 2FT0A 4KOSA 3F0AA 4X5KA 2OU2A 2FXFA 4CAFA 4KZTA 5F49A 1RXTA 1S7NA 1Z4RA 3S6KA 5HMNA 4HNWB 3R9FA 4ZGYB 5J8CA 2OB0A 4MFZA 3DSBA 2NMTA 1M1DA 4JXRA 2P0WA 4M3SA 4JLYA 4XNHC 2REFA 2JDCA 4KLVA 1M44A 1Q2CA 3ZJ0A 4UFWA 4AVAA 1WWZA 1CM0A 2G0BA 2B3VA 2FIWA 1QSTA 3EO4A 4MFQA 3FRMA 3MGDA 2J8RA 3JUWA 1GHEA 2YNCC 2VQYA 3G3SA 2ZW6A 4B5PB 1ZO0A 5KTDA 4JJXA 4UCPA 3TO6A 2FIAA 4HKFA 2D4PA 4AG7A 4K30A 3TE4A 4UCMA 1R57A 5EBVA 2P6GA 3SXNA 2OZGA 3EXNA 4CGPA 2GANA 2JLMA 2B3UA 4U5YA 3K9UA 2ARHA 3F5BA 1MK4A 4XPDC 4FD6A 3DR8A 3EC4A 5AG7A 1Y9WA 4KOUA 3TOAA 4A30A 5F46A 4UFVA 3WR7A 1K4JA 3TT2A 1P4NA 3D8PA 2FSRA 4Q38A 4MBUA 2DXQA 1L0CA 1CJWA 4UA3A 5BWAB 2RC4A 1IICA 1Q2DA 4QVTA 4A2ZA 1SQHA 4MY3A 4QC6A 1Z9UA 1B6BA 4KOWA 2EVNA 4CGOA 1KUYA 3R9GA 4PK3A 1OZPA 3EFAA 2R1IA 3DDDA 3R1KA 3QB8A 2O28A 4JD6A 5E96A 2PSWA 3E0KA 2B58A 1YX0A 4AVCA 4UWJA 1MJAA 5FVJA 4MI4A 3I9SA 3S6GA 4PSXA 4PV6A 4KVOE 2R7HA 4CRZB 2Y0MA 4CAWA 2ZW4A 1YREA 2HV2A 3R96A 2OZUA 4BBHA 2Z0ZA 2GIVA 1QSOA 1VKCA 2BSWA 5A28A 3CXPA 1S7LA 2YNDA 3P2HA 2CY2A 2Q44A 4JXQA 4JWPA 4PK2A 3IU2A 1PU9A 5I0CA 3CXQA 4NXYA 3N7ZA 4L89A 4F0YA 1S3ZA 2I79A 1WK4A 1M4IA 2C27A 5J8FA 4UCNA 5KTCA 4KVME 4LUAA 2WPWA 5G21A 1KUXA 4H6UA 2AE6A 4YGOA 4Y49B 3SHPA 2P6FA 2PR1A 4HNXB 1BO4A 4R3LA 2BEIA 2CNMA 3TCVA 3TTHA 4C7IA 1TIQA 5C88A 4R3KA 4KSFA 2VZYA 1BOBA 3BLNA 3D2PA 2FL4A 2BL1A 3BJ8A 2ZXVA 2OZHA 2KCWA 3QAHA 4B14A 4YRHA 4II9A 5A27A 2PQ8A 4CRYB 1N71A 4QB9A 4B13A 1S60A 4E8OA 3T90A 3FYNA 4KUBA 4KSAA 3JVNA 1Z4EA 1J4JA 1I1DA 4OLLA 4CGMA 3H5ZA 1KUVA 4KLWA 2EUIA 2BUEA 2B5GA 1I12A 1YLEA 5IV0A 4B10A 1ON0A 4KOTA 2WUUA 1YVOA 2Z3MA 5H84A 4CGNA 4E0AA 5IB0A 4FD7A 4XPDB 4BMHA 5DWMA 2ZW5A 2OH1A 4NEXA 2AJ6A 4XPKA 3VWEA 4NCZA 3S6HA 3P2FA 2ATRA 2YNEA 3TOBA 3F8KA 1S7FA 3KKWA 4ONUA 5EC4A 1Y7RA 4KUAA 2PR8A 2CNSA 1IYLA 4B5OA 4DNCA 2HQYA 4C2YA 4ORFA 3LD2A 3R95A 2R8VA 4KOYA 4AVBA 2P6EA 1UFHA 1YR0A 2Z3KA 2Q4YA 1IYKA 2Z11A 2Z3NA 2R98A 2QMLA 1M4DA 3CXSA 2X7BA 1XEBA 4A95A 1V0CA 3PGPA 2Q4VA 1S5KA 1MJBA 2PDOA 3OWCA 3GY9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MFL A;  4MFP A;  4MFJ A;  4Q36 A;  4Q38 A;  4MFK A;  4MFQ A;  4MFZ A; 
#chains in the Genus database with same CATH topology
 3W6X A;  3TFY A;  4OC1 A;  1VGY A;  1IB1 E;  2JEV A;  4CAV A;  2F8H A;  3T8W A;  2Q04 A;  1LCP A;  5LYD A;  2I3C A;  2PIZ A;  3B35 A;  4QUS A;  3FNC A;  2VI7 A;  1XMB A;  4F0X A;  2G3A A;  3KI9 A;  4LX9 A;  3R9E A;  3RBU A;  3FIX A;  3PB8 X;  5DWN A;  2ZW7 A;  5CNP A;  2GE3 A;  4CYN A;  1FY7 A;  2Q0Y A;  3BHX A;  3T9Y A;  3VWD A;  1FNO A;  4R9M A;  2ZPA A;  5F47 A;  4AG9 A;  2CTC A;  4PXD A;  4W9Y A;  1EE3 P;  1XIX A;  3I1U A;  4R8F A;  1BAV A;  2B5G B;  2Q7B A;  2HC9 A;  3H8G A;  1M4L A;  3IWG A;  3LAC A;  4BIN A;  4C2Z A;  3S6F A;  2ZEP A;  4MY0 A;  3RYO A;  4CYP A;  5AG6 A;  2V8G A;  2K5T A;  1QSR A;  2ANP A;  4G1P A;  4P4J A;  2B4B A;  3FBU A;  3IWE A;  1YGH A;  3D2M A;  4C2X A;  3D67 A;  2A4N A;  2VEZ A;  4FD5 A;  2JDD A;  2FE7 A;  3I3G A;  4UEZ A;  2PJ7 A;  3G8W A;  3EY5 A;  5HH1 A;  4XNH B;  5LRG A;  3S9M A;  1U6M A;  2QEC A;  3D68 A;  4UEF A;  3SXO A;  2ZOF A;  3JTK A;  3ZZI A;  4KOX A;  4MFL A;  4ZBG A;  3W91 A;  1F57 A;  2J8M A;  2B4D A;  2HUZ A;  2G3T A;  1F2O A;  5GCN A;  3W6S A;  3VAR A;  5AG4 A;  4WWV A;  5J1Q A;  2NYQ A;  3PB4 X;  2VBQ A;  4OAD A;  3NFZ A;  4UF4 A;  4E2A A;  1Y9K A;  3WC5 A;  1PUA A;  2PJB A;  1CPS A;  2B4D B;  4A32 A;  1XF8 A;  3D7G A;  3IU1 A;  2Z3P A;  2XEG A;  4C68 A;  3TO7 A;  2POK A;  5HVG A;  4I49 A;  4KSI A;  1OBR A;  1YK3 A;  3C26 A;  3IIB A;  3PB6 X;  4R57 A;  2I00 A;  4UIB A;  5HVF A;  4L8A A;  2CNT A;  2YNC A;  4B11 A;  4GS4 A;  3FB3 A;  1Z8L A;  4PSW A;  1XOV A;  1XE4 A;  4MCR A;  4UBR A;  4M6H A;  4U9Y A;  3PZJ A;  5JPH A;  5C82 A;  3D7F A;  1YVK A;  4A37 A;  4C7H A;  2PJ2 A;  4P6Y A;  4F9U A;  3BJ7 A;  5AGE A;  3NE7 A;  1ELM P;  4YFJ A;  1IID A;  3PFE A;  4OC4 A;  1UWY A;  1I21 A;  3VH9 A;  3CZX A;  2AFM A;  1NSL A;  1S7K A;  4PXB A;  1Z2L A;  1PYT B;  4CYQ A;  4CYO A;  2Z3O A;  3NH8 A;  4NGT A;  3H8F A;  2J9A A;  1MJ9 A;  3LWU A;  1VIX A;  2FCK A;  2Z3L A;  4H2K A;  2IL4 A;  4UFX A;  5JQ4 A;  2O4H A;  3DNS A;  4FUU A;  4P4B A;  4R87 A;  3FXT A;  4NGS A;  1M4G A;  1KWM A;  4CS0 B;  2BOA A;  2VXK A;  3A9L A;  4RI1 A;  2ZEF A;  3V38 A;  1JQG A;  4K3N A;  4RS2 A;  4AXV A;  4OC0 A;  4H6Z A;  4P4F A;  4NF1 A;  2GLF A;  2V8D A;  2JBJ A;  3D7H A;  3RNZ A;  3ISZ A;  3D3S A;  1ELL P;  5G22 A;  1LRZ A;  4BD9 A;  2FS5 A;  4U9Z A;  1VHS A;  3IFE A;  2J8N A;  4ZX9 A;  1QSM A;  4MFK A;  3GKR A;  2DPS A;  5KTA A;  1QSN A;  2GFQ A;  5IX3 A;  1CPX A;  4PQA A;  4CGL A;  2AFZ A;  4MFJ A;  3NH4 A;  2OOT A;  4QBJ A;  1Y0Y A;  4A33 A;  2CXA A;  3SJG A;  4KS9 A;  4AB7 A;  4ZI6 A;  2DPT A;  4B12 A;  3TO9 A;  4F6A A;  3KR5 A;  3WC7 A;  2PC1 A;  1Q2Y A;  3B8G A;  2H5M A;  4FD4 A;  4Y49 C;  4H89 A;  1AUG A;  4UWI A;  1IU8 A;  1Z8W A;  4KOV A;  3B2Y A;  2Z10 A;  3D66 A;  4OAE A;  3S9N A;  5JH9 A;  4F8Z A;  1R3N A;  1AMP A;  1LAP A;  4KVX A;  4HPS A;  4MHD A;  2D4O A;  2VZZ A;  1B87 A;  1IOI A;  2EO8 A;  5G20 A;  4OIW A;  4M6I A;  3CPA A;  3GYA A;  4A31 A;  1Z5R A;  3HLP A;  3H4Q A;  3QAY A;  2PJ6 A;  2PJ4 A;  3NH5 A;  3PP9 A;  5ISV A;  4FWU A;  4RUH A;  3LOD A;  1IOF A;  1HDQ A;  5DS0 A;  5G1Z A;  1HEE A;  1YME A;  5AG5 A;  2AFU A;  1ZG9 A;  4EME A;  2PRB A;  2YGW A;  2PJC A;  5LRJ A;  2REE A;  4NSQ A;  3V8I A;  4R6T A;  2PE3 A;  4CAX A;  2F5I A;  3FED A;  2QIR A;  5F48 A;  4CAE A;  2JEW A;  4EVY A;  4KOR A;  4MFP A;  3GB0 A;  4IUS A;  3WC6 A;  2WSA A;  4XPL A;  1RO5 A;  1TKF A;  1ZG7 A;  3RZA A;  3UY5 A;  4EWT A;  3KR4 A;  2NSM A;  4M85 A;  1P0H A;  5H86 A;  4B5P A;  1KZF A;  1XMT A;  2BO9 A;  4Q36 A;  3NE8 A;  4P10 A;  4MJ8 A;  2WPX A;  1NMT A;  1NE9 A;  3DR6 A;  4IF5 A;  4OME A;  4HNY B;  3IGR A;  4J3G A;  3PRT A;  4NGN A;  1H8L A;  1ARM A;  2ABZ A;  4YWY A;  2ZEM A;  2PVV A;  2FT0 A;  4NFR A;  4IAV A;  4KOS A;  3F0A A;  4X5K A;  2OU2 A;  2FXF A;  4CAF A;  5EMI A;  2IJZ A;  2O53 A;  3TC8 A;  1TKH A;  4MMO A;  1DTD A;  4KZT A;  3B3C A;  5F49 A;  1RXT A;  1S7N A;  2PRQ A;  3GIU A;  1Z4R A;  4P44 A;  3S6K A;  5HMN A;  4HNW B;  4P4E A;  3R9F A;  4ZGY B;  5J8C A;  1VHE A;  2OB0 A;  4DYO A;  3NA6 A;  4MFZ A;  1JWQ A;  3DSB A;  2NMT A;  3H8E A;  1CBX A;  1M1D A;  4JXR A;  2P0W A;  1YSJ A;  4M3S A;  2V8V A;  3B3T A;  3SJF A;  4JLY A;  4XNH C;  2REF A;  2JDC A;  3FEC A;  1M44 A;  2CTB A;  4KLV A;  2GRE A;  2PJ3 A;  1CP6 A;  1Q2C A;  3ZJ0 A;  2Q4Z A;  4UFW A;  4AVA A;  1WWZ A;  3FJU A;  4B6Z A;  3WT4 A;  2PJ9 A;  1CM0 A;  2G0B A;  2B3V A;  2FIW A;  3L2N A;  2GU2 A;  4MRI A;  1QST A;  3EO4 A;  4MFQ A;  3FRM A;  3PB9 X;  3GUX A;  4UIA A;  3D4U A;  4X3R A;  3MGD A;  4OP4 A;  2J8R A;  4MXU A;  3JUW A;  5JGF A;  1GHE A;  1QMU A;  1A2Z A;  2YNC C;  1LFW A;  4JZ0 A;  4IHM A;  3KHZ A;  5K8P A;  2VQY A;  3KQZ A;  2ZW6 A;  3G3S A;  4B5P B;  1ZO0 A;  3FMC A;  1XFO A;  5KTD A;  3K2K A;  4JJX A;  4MHN A;  4UCP A;  2V8H A;  3TO6 A;  2RFH A;  2FIA A;  4IK2 A;  4HKF A;  2D4P A;  5ELY A;  3B7I A;  5HXD A;  4AG7 A;  3TX8 A;  4K30 A;  2PJ8 A;  3TE4 A;  4NGP A;  4UCM A;  1R57 A;  1XBU A;  4R7M A;  5EBV A;  2P6G A;  3SXN A;  2IQ6 A;  2OZG A;  3B3S A;  5CPA A;  3EXN A;  4CGP A;  2GAN A;  2JLM A;  4LQG A;  2B3U A;  8CPA A;  1LOK A;  4U5Y A;  3K9U A;  2ARH A;  3F5B A;  1MK4 A;  3IEH A;  3S9L A;  4XPD C;  4FD6 A;  3DR8 A;  3EC4 A;  3KHX A;  2ODF A;  4P4I A;  5AG7 A;  5LRK A;  5HVH A;  1Y9W A;  3JRU A;  4KOU A;  3TOA A;  4A30 A;  5F46 A;  4UFV A;  3WR7 A;  1K4J A;  2EK9 A;  1NSA A;  3TT2 A;  4MCS A;  1TKJ A;  1Q7L A;  1BPM A;  1P4N A;  3D8P A;  3WAB A;  2FSR A;  3MRU A;  4Q38 A;  1LAM A;  2ZED A;  4MBU A;  1PCA A;  1BPN A;  2DXQ A;  4OKO A;  1L0C A;  1CJW A;  4NJQ A;  4UA3 A;  5BWA B;  2RC4 A;  3N5F A;  1ZLI A;  3CPX A;  3MN8 A;  4ZY2 A;  1IIC A;  1CG2 A;  3K9T A;  1IGB A;  3PBB A;  2XEI A;  1CX8 A;  1Q2D A;  3RAM A;  2C6C A;  4QVT A;  4A2Z A;  2ZOG A;  2JBK A;  1SQH A;  2C1C A;  1AYE A;  4MY3 A;  3LMS A;  4QC6 A;  1Z9U A;  5K8N A;  3FVL A;  1B6B A;  4KOW A;  2EVN A;  4CGO A;  1KUY A;  3R9G A;  3HUV A;  4PK3 A;  4UEE A;  6CPA A;  1OZP A;  2PIY A;  3EFA A;  1F2P A;  2R1I A;  4LQ6 A;  5LYI A;  3DDD A;  3R1K A;  3QB8 A;  2O28 A;  4JD6 A;  4OC5 A;  3FH4 A;  5E96 A;  2DEA A;  2PSW A;  3V7Z A;  4EFD A;  3E0K A;  2B58 A;  1YX0 A;  2FVG A;  2Q7S A;  4UWJ A;  4AVC A;  4ZY1 A;  1MJA A;  2Q43 A;  5FVJ A;  2PJ0 A;  4MCQ A;  4MI4 A;  3I9S A;  4NGQ A;  3S6G A;  1YLO A;  4PSX A;  4PV6 A;  4KVO E;  2R7H A;  4CRZ B;  2AFW A;  1LAN A;  2Y0M A;  4PPZ A;  4CAW A;  2ZW4 A;  1YRE A;  2PJA A;  2HV2 A;  2ZEL A;  2C6P A;  3R96 A;  4F9V A;  4X8I A;  2OZU A;  3BXM A;  4BBH A;  3B3W A;  2Z0Z A;  4P4D A;  5IB9 A;  1X10 A;  1ZLH A;  2GIV A;  5I4M A;  5LYF A;  1CP7 A;  1QSO A;  1Y0R A;  4MCP A;  3IC1 A;  4FAI A;  1VKC A;  2F7V A;  2BSW A;  5A28 A;  3QNV A;  3CXP A;  1S7L A;  4ZYQ A;  3DGV A;  2YND A;  3P2H A;  4Q7A A;  2CY2 A;  2Q44 A;  2HB6 A;  4JXQ A;  2ZEE A;  4JWP A;  3VAT A;  2AFX A;  4PK2 A;  3IU2 A;  1PU9 A;  1XJO A;  3IO1 A;  2XEF A;  3CXQ A;  4NXY A;  4OID A;  5I0C A;  3N7Z A;  4L89 A;  4F0Y A;  1TF9 A;  1S3Z A;  2EK8 A;  2I79 A;  4WJB A;  3SJE A;  1WK4 A;  1M4I A;  2C27 A;  3KGQ A;  4A38 A;  5J8F A;  4UCN A;  5KTC A;  4A94 A;  3SI2 A;  1VHO A;  4KVM E;  4LUA A;  4ZX8 A;  3PFO A;  2WPW A;  5G21 A;  1KUX A;  1XRY A;  2AE6 A;  3CDX A;  4H6U A;  3KZW A;  1Y7E A;  4YGO A;  4Y49 B;  3SHP A;  2CF4 A;  2P6F A;  5F09 A;  2PR1 A;  2PVW A;  4HNX B;  4R76 A;  1BO4 A;  2XEJ A;  4ONW A;  4R3L A;  2BEI A;  1YQE A;  2CNM A;  3TCV A;  3TTH A;  4C7I A;  1TIQ A;  4M6G A;  1TF8 A;  1Z8T A;  3BI0 A;  5C88 A;  4R3K A;  4KSF A;  2VZY A;  3KAS A;  4FBE A;  5CBM A;  1BOB A;  4OC2 A;  3BLN A;  3D2P A;  1FT7 A;  3FX6 A;  2FL4 A;  1RTQ A;  2BL1 A;  3BJ8 A;  3BI1 A;  4NJR A;  2AFO A;  2WZN A;  2ZXV A;  4Z65 A;  2OZH A;  2KCW A;  2WYR A;  3QAH A;  4B14 A;  4YRH A;  1Z8X A;  4II9 A;  2GLJ A;  1TXR A;  5A27 A;  4JYW A;  2PQ8 A;  4CRY B;  1N71 A;  4QB9 A;  4B13 A;  1S60 A;  4E8O A;  3IJ3 A;  3T90 A;  2AFS A;  1IY7 A;  2G9D A;  3FYN A;  2RB7 A;  4KUB A;  4KSA A;  4A39 A;  4ZY0 A;  1BLL E;  2ZEO A;  3JVN A;  2Q51 A;  3KL9 A;  1Z4E A;  1J4J A;  1I1D A;  4OLL A;  4CGM A;  2EBJ A;  4MHY A;  3H5Z A;  1KUV A;  4NGR A;  4P45 A;  4CPA A;  4KLW A;  2EUI A;  2BUE A;  2B5G A;  1I12 A;  2PCU A;  3D7D A;  4X2T A;  5K8O A;  1YLE A;  3CT9 A;  5IV0 A;  4B10 A;  4NGM A;  4MHZ A;  1ON0 A;  4KOT A;  2VL1 A;  1YVO A;  2WUU A;  2Z3M A;  3GLJ A;  5H84 A;  4CGN A;  4E0A A;  4FD7 A;  4OC3 A;  4XPD B;  5IB0 A;  4BMH A;  5DWM A;  2ZW5 A;  2OH1 A;  3DLJ A;  4NEX A;  2AJ6 A;  3KQX A;  4XPK A;  2V77 A;  4MHP A;  3B3V A;  3VWE A;  4NCZ A;  3S6H A;  2PJ1 A;  3P2F A;  2ATR A;  2C6G A;  2YNE A;  1QQ9 A;  4DUK A;  1ARL A;  5THW A;  3TOB A;  3F8K A;  1S7F A;  3SJX A;  3KKW A;  4ONU A;  4GM5 A;  5EC4 A;  2ZEH A;  1Y7R A;  1ZG8 A;  2CIJ A;  2QJ8 A;  4KUA A;  3SI1 A;  1R43 A;  2PR8 A;  3ISX A;  1X12 A;  4TNU A;  2CNS A;  1IYL A;  2PJ5 A;  4B5O A;  4O23 A;  4TWE A;  4DNC A;  5K8M A;  2HQY A;  4C2Y A;  4ORF A;  3LD2 A;  3R95 A;  2R8V A;  3PBE A;  2QYV A;  4KOY A;  3FF3 A;  3PEI A;  5JM6 A;  4AVB A;  2P6E A;  2ZEG A;  1UFH A;  1YR0 A;  1YW4 A;  1DE4 C;  2Q4Y A;  2Z3K A;  4GXH A;  1IYK A;  2Z11 A;  2QVP A;  1YW6 A;  2ZEN A;  4PXC A;  2Z3N A;  4RN7 A;  1GYT A;  2R98 A;  4DJL A;  2QML A;  1M4D A;  2EWB A;  3CXS A;  2X7B A;  2BCO A;  1XEB A;  4PXE A;  4A95 A;  7CPA A;  5D29 A;  3RO0 A;  1V0C A;  3PGP A;  2Q4V A;  2OR4 A;  1S5K A;  5D8N A;  1MJB A;  2PDO A;  5LYL A;  3OWC A;  1HDU A;  3PB7 X;  2IMO A;  3IWW A;  2DF5 A;  3GY9 A;  3SI0 A;  3FEE A;  4YU9 A; 
#chains in the Genus database with same CATH homology
 3W6X A;  3TFY A;  1IB1 E;  2JEV A;  4CAV A;  2Q04 A;  4QUS A;  3FNC A;  2VI7 A;  4F0X A;  2G3A A;  4LX9 A;  3R9E A;  3FIX A;  5DWN A;  2ZW7 A;  5CNP A;  2GE3 A;  4CYN A;  1FY7 A;  2Q0Y A;  3T9Y A;  3VWD A;  4R9M A;  2ZPA A;  5F47 A;  4AG9 A;  1XIX A;  2Q7B A;  2B5G B;  3IWG A;  4C2Z A;  3S6F A;  4MY0 A;  3RYO A;  4CYP A;  5AG6 A;  2K5T A;  1QSR A;  2B4B A;  3FBU A;  3IWE A;  1YGH A;  3D2M A;  4C2X A;  2A4N A;  2VEZ A;  4FD5 A;  2JDD A;  2FE7 A;  3I3G A;  3G8W A;  3EY5 A;  5HH1 A;  4XNH B;  1U6M A;  2QEC A;  3SXO A;  3JTK A;  3ZZI A;  4KOX A;  4MFL A;  4ZBG A;  3W91 A;  2J8M A;  2B4D A;  2HUZ A;  2G3T A;  5GCN A;  3W6S A;  5AG4 A;  2VBQ A;  4OAD A;  4E2A A;  1Y9K A;  1PUA A;  2B4D B;  4A32 A;  1XF8 A;  3IU1 A;  2Z3P A;  4C68 A;  3TO7 A;  4I49 A;  1YK3 A;  3C26 A;  4B11 A;  4R57 A;  2I00 A;  4L8A A;  2CNT A;  2YNC A;  4GS4 A;  3FB3 A;  4PSW A;  1XE4 A;  4UBR A;  4U9Y A;  3PZJ A;  5JPH A;  5C82 A;  1YVK A;  4C7H A;  3BJ7 A;  5AGE A;  3NE7 A;  4YFJ A;  1IID A;  1I21 A;  1NSL A;  1S7K A;  4CYQ A;  4CYO A;  2Z3O A;  1MJ9 A;  2FCK A;  4UFX A;  2Z3L A;  2IL4 A;  5JQ4 A;  3DNS A;  4R87 A;  3FXT A;  1M4G A;  4CS0 B;  2VXK A;  3A9L A;  4RI1 A;  4RS2 A;  4H6Z A;  4NF1 A;  3D3S A;  5G22 A;  1LRZ A;  2FS5 A;  4U9Z A;  1VHS A;  2J8N A;  4MFK A;  1QSM A;  3GKR A;  2DPS A;  5KTA A;  1QSN A;  5IX3 A;  4CGL A;  4MFJ A;  4QBJ A;  4A33 A;  2CXA A;  4KS9 A;  4AB7 A;  2DPT A;  4B12 A;  3TO9 A;  4F6A A;  2PC1 A;  1Q2Y A;  3B8G A;  2H5M A;  4FD4 A;  4Y49 C;  4H89 A;  4UWI A;  4KOV A;  2Z10 A;  4OAE A;  4MHD A;  4KVX A;  2D4O A;  2VZZ A;  1B87 A;  5G20 A;  4A31 A;  3GYA A;  3H4Q A;  3PP9 A;  5ISV A;  3LOD A;  5G1Z A;  5AG5 A;  2PRB A;  2YGW A;  2REE A;  4NSQ A;  3V8I A;  4CAX A;  2F5I A;  2QIR A;  5F48 A;  4CAE A;  4EVY A;  4KOR A;  4MFP A;  4IUS A;  2WSA A;  4XPL A;  1RO5 A;  3UY5 A;  4M85 A;  1P0H A;  5H86 A;  4B5P A;  1KZF A;  1XMT A;  4Q36 A;  4MJ8 A;  2WPX A;  1NMT A;  1NE9 A;  3DR6 A;  4IF5 A;  4HNY B;  3IGR A;  4J3G A;  2FT0 A;  4KOS A;  3F0A A;  4X5K A;  2OU2 A;  2FXF A;  4CAF A;  4KZT A;  5F49 A;  1RXT A;  1S7N A;  1Z4R A;  3S6K A;  5HMN A;  4HNW B;  3R9F A;  4ZGY B;  5J8C A;  2OB0 A;  4MFZ A;  3DSB A;  2NMT A;  1M1D A;  4JXR A;  2P0W A;  4M3S A;  4JLY A;  4XNH C;  2REF A;  2JDC A;  4KLV A;  1M44 A;  1Q2C A;  3ZJ0 A;  4UFW A;  4AVA A;  1WWZ A;  1CM0 A;  2G0B A;  2B3V A;  2FIW A;  1QST A;  3EO4 A;  4MFQ A;  3FRM A;  3MGD A;  2J8R A;  3JUW A;  1GHE A;  2YNC C;  2VQY A;  3G3S A;  2ZW6 A;  4B5P B;  1ZO0 A;  5KTD A;  4JJX A;  4UCP A;  3TO6 A;  2FIA A;  4HKF A;  2D4P A;  4AG7 A;  4K30 A;  3TE4 A;  4UCM A;  1R57 A;  5EBV A;  2P6G A;  3SXN A;  2OZG A;  3EXN A;  4CGP A;  2GAN A;  2JLM A;  2B3U A;  4U5Y A;  3K9U A;  2ARH A;  3F5B A;  1MK4 A;  4XPD C;  4FD6 A;  3DR8 A;  3EC4 A;  5AG7 A;  1Y9W A;  4KOU A;  3TOA A;  4A30 A;  5F46 A;  4UFV A;  3WR7 A;  1K4J A;  3TT2 A;  1P4N A;  3D8P A;  2FSR A;  4Q38 A;  4MBU A;  2DXQ A;  1L0C A;  1CJW A;  4UA3 A;  5BWA B;  2RC4 A;  1IIC A;  1Q2D A;  4QVT A;  4A2Z A;  1SQH A;  4MY3 A;  4QC6 A;  1Z9U A;  1B6B A;  4KOW A;  2EVN A;  4CGO A;  1KUY A;  3R9G A;  4PK3 A;  1OZP A;  3EFA A;  2R1I A;  3DDD A;  3R1K A;  3QB8 A;  2O28 A;  4JD6 A;  5E96 A;  2PSW A;  3E0K A;  2B58 A;  1YX0 A;  4AVC A;  4UWJ A;  1MJA A;  5FVJ A;  4MI4 A;  3I9S A;  3S6G A;  4PSX A;  4PV6 A;  4KVO E;  2R7H A;  4CRZ B;  2Y0M A;  4CAW A;  2ZW4 A;  1YRE A;  2HV2 A;  3R96 A;  2OZU A;  4BBH A;  2Z0Z A;  2GIV A;  1QSO A;  1VKC A;  2BSW A;  5A28 A;  3CXP A;  1S7L A;  2YND A;  3P2H A;  2CY2 A;  2Q44 A;  4JXQ A;  4JWP A;  4PK2 A;  3IU2 A;  1PU9 A;  5I0C A;  3CXQ A;  4NXY A;  3N7Z A;  4L89 A;  4F0Y A;  1S3Z A;  2I79 A;  1WK4 A;  1M4I A;  2C27 A;  5J8F A;  4UCN A;  5KTC A;  4KVM E;  4LUA A;  2WPW A;  5G21 A;  1KUX A;  4H6U A;  2AE6 A;  4YGO A;  4Y49 B;  3SHP A;  2P6F A;  2PR1 A;  4HNX B;  1BO4 A;  4R3L A;  2BEI A;  2CNM A;  3TCV A;  3TTH A;  4C7I A;  1TIQ A;  5C88 A;  4R3K A;  4KSF A;  2VZY A;  1BOB A;  3BLN A;  3D2P A;  2FL4 A;  2BL1 A;  3BJ8 A;  2ZXV A;  2OZH A;  2KCW A;  3QAH A;  4B14 A;  4YRH A;  4II9 A;  5A27 A;  2PQ8 A;  4CRY B;  1N71 A;  4QB9 A;  4B13 A;  1S60 A;  4E8O A;  3T90 A;  3FYN A;  4KUB A;  4KSA A;  3JVN A;  1Z4E A;  1J4J A;  1I1D A;  4OLL A;  4CGM A;  3H5Z A;  1KUV A;  4KLW A;  2EUI A;  2BUE A;  2B5G A;  1I12 A;  1YLE A;  5IV0 A;  4B10 A;  1ON0 A;  4KOT A;  2WUU A;  1YVO A;  2Z3M A;  5H84 A;  4CGN A;  4E0A A;  5IB0 A;  4FD7 A;  4XPD B;  4BMH A;  5DWM A;  2ZW5 A;  2OH1 A;  4NEX A;  2AJ6 A;  4XPK A;  3VWE A;  4NCZ A;  3S6H A;  3P2F A;  2ATR A;  2YNE A;  3TOB A;  3F8K A;  1S7F A;  3KKW A;  4ONU A;  5EC4 A;  1Y7R A;  4KUA A;  2PR8 A;  2CNS A;  1IYL A;  4B5O A;  4DNC A;  2HQY A;  4C2Y A;  4ORF A;  3LD2 A;  3R95 A;  2R8V A;  4KOY A;  4AVB A;  2P6E A;  1UFH A;  1YR0 A;  2Z3K A;  2Q4Y A;  1IYK A;  2Z11 A;  2Z3N A;  2R98 A;  2QML A;  1M4D A;  3CXS A;  2X7B A;  1XEB A;  4A95 A;  1V0C A;  3PGP A;  2Q4V A;  1S5K A;  1MJB A;  2PDO A;  3OWC A;  3GY9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...