4MFJA

The crystal structure of acyltransferase
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
328
structure length
328
Chain Sequence
GSHMMMDPETVRIALGLEERTAAWLTELDELGPPAEPVRLPRGEEARDLLRRLEVPELDAEEIVAAAPDPDRDPALWWLLERTHHAIVRHMGDHRAKPRGGPPLPYEGGAAARYFHVYVFLATVPAVRRFHAERGIPDEVGWETLTQLGELVAIHRRKYGQGGMNMQWWTTYHLRGILYRLGRLQFSLATGKDGTPHLGLHVPEWGGPLLPKAYDESLHRARPFFDRHFPEHGARVAWGSSWMLDPQLEEYLTEDSNIIQLARFWTLTDSAPEPGNADGDSSILEFVFRYNGQPLDELPQRSSLERAVIAHLKAGRHWHMRTGFVKLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative uncharacterized protein tcp24
publication title Multiple complexes of long aliphatic N-acyltransferases lead to synthesis of 2,6-diacylated/2-acyl-substituted glycopeptide antibiotics, effectively killing vancomycin-resistant enterococcus
pubmed doi rcsb
source organism Actinoplanes teichomyceticus
molecule tags Transferase
total genus 97
structure length 328
sequence length 328
ec nomenclature ec 2.3.1.-:
pdb deposition date 2013-08-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18082 DUF5596 Domain of unknown function (DUF5596)
A PF18164 GNAT_C GNAT-like C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.120 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4mfjA02
4MFZA 4MFLA 4MFKA 4MFJA 4Q38A 4Q36A 4MFPA 4MFQA
chains in the Genus database with same CATH superfamily
2PJCA 4CRYB 1KUVA 1QSRA 1XRYA 2B4BA 3FNCA 1Z8TA 2B5GB 3DSBA 3QNVA 1AMPA 4NSQA 4OLLA 3FEDA 3LWUA 2REEA 2Q43A 3KASA 4K30A 5JPHA 1X12A 3PB4X 4R3KA 4MRIA 4QC6A 5K8NA 3FMCA 2CY2A 4P10A 4TWEA 2V8GA 2FIAA 2ZW4A 1Z8WA 2ZW7A 2VL1A 3B3SA 4MFJA 3CXQA 3ZJ0A 2PIYA 2PR8A 3FVLA 2Z0ZA 3NE7A 3WC6A 4R6TA 1M4DA 4FD4A 2IL4A 2OZHA 3K9UA 4ONUA 1N71A 2AFSA 4BBHA 4U9YA 4UCNA 5G1ZA 3KQXA 1Z4RA 4MY3A 1S7FA 2I3CA 4KOXA 1UWYA 1Z5RA 3KR5A 2JEWA 2OR4A 4P4EA 4C2XA 4LQ6A 4C7IA 3PB6X 3ZZIA 2O4HA 1QMUA 2P6GA 1XJOA 5CNPA 2GU2A 1QSTA 4PSWA 3D3SA 4H2KA 4CAVA 4R57A 3IJ3A 3TO9A 3PEIA 1XMTA 2NYQA 4YRHA 4MCPA 5F46A 4KLWA 4Q38A 1CP6A 3K9TA 3EFAA 4FD6A 2VQYA 4AG9A 3NE8A 4RI1A 2G0BA 5K8PA 1IOFA 2PC1A 3GKRA 4MCRA 5H84A 2AFXA 4C7HA 1CBXA 2F5IA 4XNHC 2WPWA 2XEGA 2Y0MA 1Q2YA 3KZWA 5G20A 1YGHA 4CAXA 3ISXA 1BOBA 2B4DB 2F8HA 3DR8A 3IWWA 8CPAA 2DXQA 3VARA 2EK9A 4UCPA 1R43A 2F7VA 3KHXA 4OC1A 4A31A 3D7DA 2Z3PA 4ZY0A 2V77A 4UCMA 3B3TA 2CTCA 4DUKA 3B8GA 4UEZA 1Z4EA 4MHZA 4YGOA 1XBUA 4F8ZA 2V8HA 3NH5A 4B5OA 1BPNA 1TKHA 2ATRA 3JTKA 4G1PA 4PXEA 1IICA 3V7ZA 4R87A 3W6SA 2IJZA 4PQAA 4UIBA 1YVKA 4B6ZA 4Y49C 4MY0A 5LRJA 4EFDA 4XNHB 3KHZA 3F8KA 2R8VA 2ZEFA 4X3RA 1S60A 3VATA 2WSAA 4FAIA 4LX9A 5LRKA 4NGNA 4JLYA 4MCQA 4NCZA 1M1DA 4NF1A 1MJ9A 2GE3A 4JYWA 1Q2CA 2ODFA 2PJ7A 4FD5A 4OC0A 4X8IA 3IGRA 2OB0A 5I0CA 3D2MA 4P4IA 2JDDA 2PJ6A 2G3AA 4A39A 2ZOGA 3FJUA 2FXFA 3SI0A 2GREA 3C26A 3D7GA 4ZYQA 3ISZA 3A9LA 2Q4VA 2ZEOA 2GANA 4UFVA 2EUIA 1S5KA 3PZJA 5AGEA 4JD6A 3PP9A 2Z3OA 1FNOA 3CXPA 3CPAA 4A37A 1AYEA 2WZNA 5CBMA 3RYOA 4RN7A 1Z8XA 2JLMA 1ELMP 2ZPAA 4NGMA 4P4DA 4UEFA 3SJXA 5K8MA 4UFWA 5HVFA 5A27A 1DTDA 1L0CA 2OZGA 2PVVA 3B35A 4L89A 4CGOA 4CYQA 5C82A 2D4PA 1ARMA 2Z10A 3NFZA 4UEEA 1S7NA 3S9MA 3W91A 2P6FA 5EMIA 4O23A 4PV6A 4IAVA 4ZBGA 4LUAA 1KZFA 5E96A 4UIAA 2VZZA 3WT4A 3EXNA 1LOKA 2ZEMA 2QMLA 2B4DA 5F09A 3SJEA 1B6BA 3D4UA 3NA6A 4F9VA 2OOTA 7CPAA 2JBJA 2PJBA 2PE3A 4EVYA 2I00A 3G8WA 4CGMA 1JWQA 1MJBA 4YFJA 1Y0YA 4HPSA 2WPXA 1XOVA 2QJ8A 2EK8A 4MBUA 3FF3A 4NFRA 4R76A 4F0XA 5IB9A 1YMEA 2HC9A 1IYLA 1LCPA 2P6EA 2AFUA 1U6MA 4CAFA 1BPMA 3RNZA 2AFMA 3KKWA 4KOTA 4W9YA 5EBVA 4BMHA 2QYVA 2HUZA 3FX6A 4KSAA 4HKFA 1I12A 1ON0A 2PCUA 4MJ8A 3DLJA 2PJ8A 4E0AA 3JVNA 2DPSA 4KVOE 4A94A 2VXKA 2CTBA 1SQHA 3BHXA 3EY5A 4M6IA 1KWMA 4LQGA 3TO7A 3LMSA 3VH9A 3H5ZA 2YNCA 2VEZA 1IGBA 4MFLA 2FT0A 2O53A 1S7LA 3BLNA 3FB3A 4JXRA 4MHYA 2BUEA 4DNCA 1Y0RA 3D7HA 3KQZA 2ZENA 3QB8A 4ZY2A 4MFZA 2V8VA 1CPSA 4M6GA 3RAMA 2D4OA 3VWEA 2PJ3A 4AB7A 4QVTA 4KOSA 4FBEA 2H5MA 2O28A 4C2ZA 1LAPA 2VI7A 3D8PA 2BO9A 1YW6A 1OBRA 3T9YA 4B13A 4UWIA 4TNUA 4CGLA 4P6YA 3TC8A 4GS4A 4NGQA 1MK4A 1XF8A 2C6PA 3S6GA 3B3WA 5ISVA 5KTDA 4AXVA 3SXOA 3DGVA 4QUSA 3CPXA 5D8NA 1R3NA 1Y7EA 1YSJA 1TIQA 2YNEA 1MJAA 2REFA 4WJBA 2DF5A 2Q4ZA 2XEIA 4HNXB 2GLJA 4CGNA 2FE7A 2GIVA 2J8RA 4AVBA 5JH9A 3SI2A 1YK3A 1LFWA 3TFYA 2Q4YA 1Y9WA 4NGRA 1CM0A 4MFPA 2Z3NA 4P4JA 3FRMA 2VZYA 2Q7SA 3I9SA 1I21A 4UA3A 4KS9A 3PBBA 4A32A 1F2PA 2PDOA 4R3LA 5K8OA 2QIRA 2BEIA 3BI1A 3QAHA 3IU1A 2PR1A 2B5GA 4NXYA 3HLPA 4KSIA 1BLLE 1TF9A 4OC5A 1YLOA 3FBUA 2PJ2A 1XEBA 4R7MA 2PSWA 3IEHA 3SHPA 1FY7A 2HV2A 4UFXA 1EE3P 4KZTA 4J3GA 5HVHA 4KORA 4OADA 1QSMA 3KR4A 3WABA 4R8FA 1RTQA 1CG2A 4H89A 2OZUA 1KUYA 1VIXA 3SI1A 4HNYB 2ZW5A 3QAYA 1GYTA 1F2OA 2RB7A 4P44A 1VHSA 1VHOA 1HDQA 3OWCA 4F6AA 3TCVA 3K2KA 5HVGA 1YX0A 2IMOA 4ONWA 3FEEA 3VWDA 1PCAA 2B3UA 3DR6A 4OMEA 1IB1E 5DWNA 4Y49B 1CPXA 4KVXA 5EC4A 2FVGA 1K4JA 4HNWB 2J8MA 1R57A 3B3CA 2WYRA 4OP4A 3T8WA 1RO5A 5HXDA 5ELYA 4ZX9A 2EVNA 4B10A 3RZAA 5KTCA 2J8NA 2PIZA 2Z3LA 5AG7A 3BJ7A 4OC3A 4DYOA 2AFZA 4C68A 4UWJA 3S9NA 1CJWA 4H6ZA 4PK2A 3RO0A 4IK2A 4R9MA 4CAEA 2PJ4A 5LYFA 1TKFA 4NJRA 5JQ4A 2I79A 1Z8LA 3LODA 1PYTB 2X7BA 3NH4A 2PRBA 3LD2A 5JM6A 5A28A 4KVME 3D66A 1P0HA 1S3ZA 4MHPA 4XPDC 4GXHA 4MFKA 3FYNA 4QBJA 4X5KA 1M4GA 4JXQA 3GUXA 4IHMA 1OZPA 4KUBA 5I4MA 2EWBA 2EBJA 3H8EA 1TXRA 2P0WA 3WC5A 3WC7A 4M85A 2YGWA 3PB8X 4NGSA 3PFEA 1IY7A 3WR7A 5LYIA 3FXTA 3KGQA 2GLFA 5H86A 1XMBA 4A33A 1QQ9A 3NH8A 4ZGYB 3F0AA 1RXTA 1ZG7A 2JEVA 4P4FA 2JDCA 1NE9A 4BINA 4KOUA 2DPTA 3TX8A 4B5PB 3PB7X 2ZEHA 1A2ZA 4B14A 1Y9KA 3I3GA 5DS0A 1VGYA 2C6GA 3GLJA 4ZX8A 4XPDB 3TTHA 2ARHA 1YREA 4F0YA 2FL4A 4IUSA 4WWVA 4IF5A 5HH1A 3E0KA 4FUUA 2BSWA 2OH1A 1VHEA 2XEJA 2CXAA 2ZW6A 3KL9A 4PXDA 3R9EA 2R1IA 4U9ZA 2G3TA 3B2YA 4MXUA 3SXNA 4JZ0A 4BD9A 2ZELA 5JGFA 4A30A 1ZO0A 4YWYA 4X2TA 3BJ8A 1M4IA 2AFOA 2KCWA 5AG6A 2ANPA 3TT2A 3S6FA 2C1CA 3D2PA 2FCKA 4PPZA 1X10A 2WUUA 5AG5A 4A95A 4KOWA 5GCNA 4L8AA 4AG7A 1B87A 1ELLP 1LRZA 5IX3A 2ZEPA 5C88A 1LAMA 2B58A 1M44A 4XPLA 2C6CA 3G3SA 4DJLA 4PK3A 3S6HA 2IQ6A 1IIDA 1Q7LA 4AVCA 2GFQA 1IOIA 1XE4A 3V8IA 3MGDA 4FWUA 1BAVA 3S6KA 2CNTA 5G21A 1QSOA 3N5FA 1CP7A 3D67A 3IU2A 4MHDA 4QB9A 2FSRA 4ZI6A 4KOVA 2Q0YA 3R95A 3PB9X 2HB6A 4KSFA 6CPAA 4H6UA 4C2YA 3JUWA 2Z11A 5BWAB 3CT9A 3MN8A 1H8LA 3W6XA 3S9LA 2QVPA 4NGPA 1DE4C 2BL1A 1YQEA 2Q51A 4PSXA 3SJGA 4UBRA 4EWTA 3H8GA 3V38A 3DNSA 1HEEA 3GYAA 3D7FA 1ARLA 5KTAA 2AJ6A 2BCOA 3B7IA 2ZEEA 3L2NA 2B3VA 4A38A 3B3VA 3IIBA 2ABZA 4CGPA 5AG4A 2ZXVA 1VKCA 3CZXA 4KOYA 4CYNA 1Z9UA 3RBUA 3TE4A 5FVJA 2QECA 4PXBA 1PUAA 5HMNA 1XFOA 4K3NA 4P4BA 3R9GA 3UY5A 1I1DA 1P4NA 3D68A 5CPAA 1ZLHA 4P45A 5F48A 5LRGA 4B12A 1HDUA 2YNCC 1TKJA 4Q7AA 3TOBA 3SJFA 4B5PA 4E8OA 1J4JA 2ZEDA 4YU9A 4Q36A 4U5YA 3EC4A 1QSNA 2OU2A 1Z2LA 2EO8A 2PJ9A 2Z3MA 1GHEA 3IFEA 5J8CA 4AVAA 2PJ5A 3BI0A 2J9AA 3N7ZA 1JQGA 4MCSA 4FD7A 4OKOA 4OC2A 2CF4A 3KI9A 1LANA 4CS0B 4MHNA 5LYDA 2NMTA 4CPAA 2ZOFA 3GB0A 1NMTA 1NSAA 1ZG9A 3PFOA 3JRUA 3H4QA 4OC4A 4Z65A 2PJAA 2ZEGA 5LYLA 3MRUA 2AFWA 4KLVA 1PU9A 3F5BA 3I1UA 4OIWA 4GM5A 3EO4A 4RUHA 2HQYA 5IB0A 1XIXA 1IU8A 5G22A 3TO6A 4UF4A 2JBKA 4M3SA 3T90A 4F9UA 2R98A 2XEFA 4MI4A 3IC1A 3IO1A 2Z3KA 1V0CA 2K5TA 5THWA 2DEAA 5IV0A 4JWPA 2PVWA 4KUAA 5F47A 4XPKA 1ZG8A 1S7KA 3BXMA 3P2FA 3TOAA 1UFHA 2CNMA 2FS5A 3CDXA 2PRQA 4MFQA 4MMOA 5J8FA 2BOAA 3FH4A 3LACA 3PRTA 4EMEA 1YLEA 1KUXA 4CAWA 1BO4A 2PQ8A 1IYKA 3GY9A 4PXCA 4CRZB 5J1QA 4II9A 2YNDA 4ZY1A 4NEXA 3R1KA 5D29A 4NGTA 4CYPA 1TF8A 1Y7RA 2POKA 3R96A 2Q04A 3IWEA 1ZLIA 1YVOA 1YW4A 2FIWA 4B11A 2CNSA 4NJQA 1AUGA 1CX8A 2V8DA 1F57A 3DDDA 2PJ1A 3GIUA 4ORFA 3FECA 1WK4A 3FIXA 4OAEA 5F49A 3R9FA 5DWMA 2RFHA 1WWZA 3P2HA 3PBEA 4E2AA 1FT7A 4RS2A 1Q2DA 2Q7BA 1NSLA 4CYOA 3CXSA 1M4LA 3H8FA 4I49A 3HUVA 2G9DA 2R7HA 2RC4A 2NSMA 3PGPA 2PJ0A 4JJXA 4OIDA 4M6HA 2VBQA 1YR0A 4A2ZA 2C27A 2Q44A 3IWGA 2A4NA 2CIJA 2AE6A
chains in the Genus database with same CATH topology
4CRYB 1KUVA 1QSRA 2B4BA 3FNCA 3DSBA 2B5GB 4NSQA 4OLLA 2REEA 4K30A 5JPHA 4R3KA 4QC6A 2CY2A 2FIAA 2ZW4A 2ZW7A 4MFJA 3ZJ0A 3CXQA 2PR8A 2Z0ZA 3NE7A 1M4DA 4FD4A 2IL4A 2OZHA 3K9UA 4ONUA 1N71A 4BBHA 4U9YA 4UCNA 5G1ZA 1Z4RA 4MY3A 1S7FA 4KOXA 4C2XA 4C7IA 3ZZIA 2P6GA 5CNPA 1QSTA 4PSWA 3D3SA 4CAVA 4R57A 3TO9A 1XMTA 4YRHA 5F46A 4KLWA 4Q38A 3EFAA 4FD6A 2VQYA 4AG9A 4RI1A 2G0BA 2PC1A 3GKRA 5H84A 4C7HA 2F5IA 4XNHC 2WPWA 2Y0MA 1Q2YA 5G20A 1YGHA 4CAXA 1BOBA 2B4DB 3DR8A 2DXQA 4UCPA 4A31A 2Z3PA 4UCMA 3B8GA 1Z4EA 4YGOA 4B5OA 2ATRA 3JTKA 1IICA 4R87A 3W6SA 1YVKA 4Y49C 4MY0A 4XNHB 3F8KA 2R8VA 1S60A 2WSAA 4LX9A 4JLYA 4NCZA 1M1DA 4NF1A 1MJ9A 2GE3A 1Q2CA 4FD5A 5I0CA 3IGRA 2OB0A 3D2MA 2JDDA 2G3AA 2FXFA 3C26A 3A9LA 2Q4VA 2GANA 4UFVA 2EUIA 1S5KA 3PZJA 5AGEA 4JD6A 3PP9A 2Z3OA 3CXPA 3RYOA 2JLMA 2ZPAA 4UFWA 5A27A 2OZGA 1L0CA 4CYQA 4L89A 4CGOA 5C82A 2D4PA 2Z10A 1S7NA 3W91A 2P6FA 4PV6A 4ZBGA 4LUAA 1KZFA 5E96A 2VZZA 3EXNA 2QMLA 2B4DA 1B6BA 4EVYA 2I00A 3G8WA 4CGMA 1MJBA 4YFJA 2WPXA 4MBUA 4F0XA 1IYLA 2P6EA 1U6MA 4CAFA 3KKWA 4KOTA 5EBVA 4BMHA 2HUZA 4KSAA 4HKFA 1I12A 1ON0A 4MJ8A 4E0AA 3JVNA 2DPSA 4KVOE 2VXKA 1SQHA 3EY5A 3TO7A 3H5ZA 2YNCA 2VEZA 4MFLA 2FT0A 4JXRA 1S7LA 3BLNA 3FB3A 4DNCA 2BUEA 3QB8A 4MFZA 2D4OA 3VWEA 4AB7A 4QVTA 4KOSA 2H5MA 2O28A 4C2ZA 2VI7A 3D8PA 3T9YA 4B13A 4UWIA 4CGLA 4GS4A 1MK4A 1XF8A 3S6GA 5ISVA 5KTDA 3SXOA 4QUSA 1TIQA 2YNEA 1MJAA 2REFA 4HNXB 4CGNA 2FE7A 2GIVA 2J8RA 4AVBA 1YK3A 3TFYA 2Q4YA 1Y9WA 1CM0A 4MFPA 2Z3NA 3FRMA 3I9SA 2VZYA 4UA3A 1I21A 4KS9A 4A32A 2PDOA 4R3LA 2QIRA 2BEIA 3QAHA 3IU1A 2PR1A 2B5GA 4NXYA 3FBUA 1XEBA 2PSWA 3SHPA 1FY7A 2HV2A 4UFXA 4KZTA 4J3GA 4KORA 4OADA 1QSMA 4H89A 2OZUA 1KUYA 4HNYB 2ZW5A 1VHSA 3OWCA 4F6AA 3TCVA 1YX0A 3VWDA 2B3UA 3DR6A 1IB1E 5DWNA 4Y49B 4KVXA 5EC4A 1K4JA 4HNWB 2J8MA 1R57A 1RO5A 4B10A 2EVNA 5KTCA 2J8NA 2Z3LA 5AG7A 3BJ7A 4C68A 4UWJA 1CJWA 4H6ZA 4PK2A 4R9MA 4CAEA 5JQ4A 2I79A 3LODA 2X7BA 2PRBA 3LD2A 5A28A 4KVME 1P0HA 1S3ZA 4XPDC 4MFKA 3FYNA 4QBJA 4X5KA 1M4GA 4JXQA 1OZPA 4KUBA 2P0WA 4M85A 2YGWA 3WR7A 3FXTA 5H86A 4A33A 4ZGYB 3F0AA 1RXTA 2JEVA 2JDCA 1NE9A 4KOUA 2DPTA 4B5PB 4B14A 1Y9KA 3I3GA 4XPDB 3TTHA 2ARHA 1YREA 4F0YA 2FL4A 4IUSA 4IF5A 5HH1A 3E0KA 2BSWA 2OH1A 2ZW6A 2CXAA 3SXNA 3R9EA 2R1IA 4U9ZA 2G3TA 4A30A 1ZO0A 3BJ8A 1M4IA 2KCWA 5AG6A 3TT2A 3S6FA 3D2PA 2FCKA 5AG5A 2WUUA 4A95A 4KOWA 5GCNA 4L8AA 4AG7A 1B87A 1LRZA 5IX3A 5C88A 2B58A 1M44A 4XPLA 3G3SA 4PK3A 3S6HA 1IIDA 4AVCA 1XE4A 3V8IA 3MGDA 3S6KA 2CNTA 5G21A 1QSOA 3IU2A 4MHDA 4QB9A 2FSRA 4KOVA 2Q0YA 3R95A 4KSFA 4H6UA 4C2YA 3JUWA 2Z11A 5BWAB 3W6XA 2BL1A 4PSXA 4UBRA 3DNSA 3GYAA 5KTAA 2AJ6A 2B3VA 4CGPA 5AG4A 2ZXVA 1VKCA 4KOYA 4CYNA 1Z9UA 3TE4A 5FVJA 2QECA 1PUAA 5HMNA 3R9GA 3UY5A 1I1DA 1P4NA 5F48A 4B12A 2YNCC 3TOBA 4B5PA 4E8OA 1J4JA 4Q36A 4U5YA 3EC4A 1QSNA 2OU2A 2Z3MA 1GHEA 5J8CA 4AVAA 3N7ZA 4FD7A 4CS0B 2NMTA 1NMTA 3H4QA 4KLVA 1PU9A 3F5BA 3EO4A 2HQYA 5IB0A 1XIXA 5G22A 3TO6A 4M3SA 3T90A 2R98A 4MI4A 2Z3KA 1V0CA 2K5TA 5IV0A 4JWPA 4KUAA 5F47A 4XPKA 1S7KA 3TOAA 3P2FA 1UFHA 2CNMA 2FS5A 4MFQA 5J8FA 1YLEA 1KUXA 4CAWA 2PQ8A 3GY9A 1IYKA 1BO4A 4CRZB 4II9A 2YNDA 4NEXA 3R1KA 4CYPA 1Y7RA 3R96A 2Q04A 3IWEA 1YVOA 2FIWA 4B11A 2CNSA 3DDDA 4ORFA 4OAEA 1WK4A 3FIXA 5F49A 3R9FA 5DWMA 1WWZA 3P2HA 4E2AA 4RS2A 1Q2DA 2Q7BA 1NSLA 4CYOA 3CXSA 4I49A 2R7HA 3PGPA 2RC4A 4JJXA 2VBQA 1YR0A 4A2ZA 2C27A 2Q44A 3IWGA 2A4NA 2AE6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MFZ A;  4MFL A;  4MFK A;  4MFJ A;  4Q38 A;  4Q36 A;  4MFP A;  4MFQ A; 
#chains in the Genus database with same CATH topology
 2PJC A;  4CRY B;  1KUV A;  1QSR A;  1XRY A;  2B4B A;  3FNC A;  1Z8T A;  2B5G B;  3DSB A;  3QNV A;  1AMP A;  4NSQ A;  4OLL A;  3FED A;  3LWU A;  2REE A;  2Q43 A;  3KAS A;  4K30 A;  5JPH A;  1X12 A;  3PB4 X;  4R3K A;  4MRI A;  4QC6 A;  5K8N A;  3FMC A;  2CY2 A;  4P10 A;  4TWE A;  2V8G A;  2FIA A;  2ZW4 A;  1Z8W A;  2ZW7 A;  2VL1 A;  3B3S A;  4MFJ A;  3CXQ A;  3ZJ0 A;  2PIY A;  2PR8 A;  3FVL A;  2Z0Z A;  3NE7 A;  3WC6 A;  4R6T A;  1M4D A;  4FD4 A;  2IL4 A;  2OZH A;  3K9U A;  4ONU A;  1N71 A;  2AFS A;  4BBH A;  4U9Y A;  4UCN A;  5G1Z A;  3KQX A;  1Z4R A;  4MY3 A;  1S7F A;  2I3C A;  4KOX A;  1UWY A;  1Z5R A;  3KR5 A;  2JEW A;  2OR4 A;  4P4E A;  4C2X A;  4LQ6 A;  4C7I A;  3PB6 X;  3ZZI A;  2O4H A;  1QMU A;  2P6G A;  1XJO A;  5CNP A;  2GU2 A;  1QST A;  4PSW A;  3D3S A;  4H2K A;  4CAV A;  4R57 A;  3IJ3 A;  3TO9 A;  3PEI A;  1XMT A;  2NYQ A;  4YRH A;  4MCP A;  5F46 A;  4KLW A;  4Q38 A;  1CP6 A;  3K9T A;  3EFA A;  4FD6 A;  2VQY A;  4AG9 A;  3NE8 A;  4RI1 A;  2G0B A;  5K8P A;  1IOF A;  2PC1 A;  3GKR A;  4MCR A;  5H84 A;  2AFX A;  4C7H A;  1CBX A;  2F5I A;  4XNH C;  2WPW A;  2XEG A;  2Y0M A;  1Q2Y A;  3KZW A;  5G20 A;  1YGH A;  4CAX A;  3ISX A;  1BOB A;  2B4D B;  2F8H A;  3DR8 A;  3IWW A;  8CPA A;  2DXQ A;  3VAR A;  2EK9 A;  4UCP A;  1R43 A;  2F7V A;  3KHX A;  4OC1 A;  4A31 A;  3D7D A;  2Z3P A;  4ZY0 A;  2V77 A;  4UCM A;  3B3T A;  2CTC A;  4DUK A;  3B8G A;  4UEZ A;  1Z4E A;  4MHZ A;  4YGO A;  1XBU A;  4F8Z A;  2V8H A;  3NH5 A;  4B5O A;  1BPN A;  1TKH A;  2ATR A;  3JTK A;  4G1P A;  4PXE A;  1IIC A;  3V7Z A;  4R87 A;  3W6S A;  2IJZ A;  4PQA A;  4UIB A;  1YVK A;  4B6Z A;  4Y49 C;  4MY0 A;  5LRJ A;  4EFD A;  4XNH B;  3KHZ A;  3F8K A;  2R8V A;  2ZEF A;  4X3R A;  1S60 A;  3VAT A;  2WSA A;  4FAI A;  4LX9 A;  5LRK A;  4NGN A;  4JLY A;  4MCQ A;  4NCZ A;  1M1D A;  4NF1 A;  1MJ9 A;  2GE3 A;  4JYW A;  1Q2C A;  2ODF A;  2PJ7 A;  4FD5 A;  4OC0 A;  4X8I A;  3IGR A;  2OB0 A;  5I0C A;  3D2M A;  4P4I A;  2JDD A;  2PJ6 A;  2G3A A;  4A39 A;  2ZOG A;  3FJU A;  2FXF A;  3SI0 A;  2GRE A;  3C26 A;  3D7G A;  4ZYQ A;  3ISZ A;  3A9L A;  2Q4V A;  2ZEO A;  2GAN A;  4UFV A;  2EUI A;  1S5K A;  3PZJ A;  5AGE A;  4JD6 A;  3PP9 A;  2Z3O A;  1FNO A;  3CXP A;  3CPA A;  4A37 A;  1AYE A;  2WZN A;  5CBM A;  3RYO A;  4RN7 A;  1Z8X A;  2JLM A;  1ELM P;  2ZPA A;  4NGM A;  4P4D A;  4UEF A;  3SJX A;  5K8M A;  4UFW A;  5HVF A;  5A27 A;  1DTD A;  1L0C A;  2OZG A;  2PVV A;  3B35 A;  4L89 A;  4CGO A;  4CYQ A;  5C82 A;  2D4P A;  1ARM A;  2Z10 A;  3NFZ A;  4UEE A;  1S7N A;  3S9M A;  3W91 A;  2P6F A;  5EMI A;  4O23 A;  4PV6 A;  4IAV A;  4ZBG A;  4LUA A;  1KZF A;  5E96 A;  4UIA A;  2VZZ A;  3WT4 A;  3EXN A;  1LOK A;  2ZEM A;  2QML A;  2B4D A;  5F09 A;  3SJE A;  1B6B A;  3D4U A;  3NA6 A;  4F9V A;  2OOT A;  7CPA A;  2JBJ A;  2PJB A;  2PE3 A;  4EVY A;  2I00 A;  3G8W A;  4CGM A;  1JWQ A;  1MJB A;  4YFJ A;  1Y0Y A;  4HPS A;  2WPX A;  1XOV A;  2QJ8 A;  2EK8 A;  4MBU A;  3FF3 A;  4NFR A;  4R76 A;  4F0X A;  5IB9 A;  1YME A;  2HC9 A;  1IYL A;  1LCP A;  2P6E A;  2AFU A;  1U6M A;  4CAF A;  1BPM A;  3RNZ A;  2AFM A;  3KKW A;  4KOT A;  4W9Y A;  5EBV A;  4BMH A;  2QYV A;  2HUZ A;  3FX6 A;  4KSA A;  4HKF A;  1I12 A;  1ON0 A;  2PCU A;  4MJ8 A;  3DLJ A;  2PJ8 A;  4E0A A;  3JVN A;  2DPS A;  4KVO E;  4A94 A;  2VXK A;  2CTB A;  1SQH A;  3BHX A;  3EY5 A;  4M6I A;  1KWM A;  4LQG A;  3TO7 A;  3LMS A;  3VH9 A;  3H5Z A;  2YNC A;  2VEZ A;  1IGB A;  4MFL A;  2FT0 A;  2O53 A;  1S7L A;  3BLN A;  3FB3 A;  4JXR A;  4MHY A;  2BUE A;  4DNC A;  1Y0R A;  3D7H A;  3KQZ A;  2ZEN A;  3QB8 A;  4ZY2 A;  4MFZ A;  2V8V A;  1CPS A;  4M6G A;  3RAM A;  2D4O A;  3VWE A;  2PJ3 A;  4AB7 A;  4QVT A;  4KOS A;  4FBE A;  2H5M A;  2O28 A;  4C2Z A;  1LAP A;  2VI7 A;  3D8P A;  2BO9 A;  1YW6 A;  1OBR A;  3T9Y A;  4B13 A;  4UWI A;  4TNU A;  4CGL A;  4P6Y A;  3TC8 A;  4GS4 A;  4NGQ A;  1MK4 A;  1XF8 A;  2C6P A;  3S6G A;  3B3W A;  5ISV A;  5KTD A;  4AXV A;  3SXO A;  3DGV A;  4QUS A;  3CPX A;  5D8N A;  1R3N A;  1Y7E A;  1YSJ A;  1TIQ A;  2YNE A;  1MJA A;  2REF A;  4WJB A;  2DF5 A;  2Q4Z A;  2XEI A;  4HNX B;  2GLJ A;  4CGN A;  2FE7 A;  2GIV A;  2J8R A;  4AVB A;  5JH9 A;  3SI2 A;  1YK3 A;  1LFW A;  3TFY A;  2Q4Y A;  1Y9W A;  4NGR A;  1CM0 A;  4MFP A;  2Z3N A;  4P4J A;  3FRM A;  2VZY A;  2Q7S A;  3I9S A;  1I21 A;  4UA3 A;  4KS9 A;  3PBB A;  4A32 A;  1F2P A;  2PDO A;  4R3L A;  5K8O A;  2QIR A;  2BEI A;  3BI1 A;  3QAH A;  3IU1 A;  2PR1 A;  2B5G A;  4NXY A;  3HLP A;  4KSI A;  1BLL E;  1TF9 A;  4OC5 A;  1YLO A;  3FBU A;  2PJ2 A;  1XEB A;  4R7M A;  2PSW A;  3IEH A;  3SHP A;  1FY7 A;  2HV2 A;  4UFX A;  1EE3 P;  4KZT A;  4J3G A;  5HVH A;  4KOR A;  4OAD A;  1QSM A;  3KR4 A;  3WAB A;  4R8F A;  1RTQ A;  1CG2 A;  4H89 A;  2OZU A;  1KUY A;  1VIX A;  3SI1 A;  4HNY B;  2ZW5 A;  3QAY A;  1GYT A;  1F2O A;  2RB7 A;  4P44 A;  1VHS A;  1VHO A;  1HDQ A;  3OWC A;  4F6A A;  3TCV A;  3K2K A;  5HVG A;  1YX0 A;  2IMO A;  4ONW A;  3FEE A;  3VWD A;  1PCA A;  2B3U A;  3DR6 A;  4OME A;  1IB1 E;  5DWN A;  4Y49 B;  1CPX A;  4KVX A;  5EC4 A;  2FVG A;  1K4J A;  4HNW B;  2J8M A;  1R57 A;  3B3C A;  2WYR A;  4OP4 A;  3T8W A;  1RO5 A;  5HXD A;  5ELY A;  4ZX9 A;  2EVN A;  4B10 A;  3RZA A;  5KTC A;  2J8N A;  2PIZ A;  2Z3L A;  5AG7 A;  3BJ7 A;  4OC3 A;  4DYO A;  2AFZ A;  4C68 A;  4UWJ A;  3S9N A;  1CJW A;  4H6Z A;  4PK2 A;  3RO0 A;  4IK2 A;  4R9M A;  4CAE A;  2PJ4 A;  5LYF A;  1TKF A;  4NJR A;  5JQ4 A;  2I79 A;  1Z8L A;  3LOD A;  1PYT B;  2X7B A;  3NH4 A;  2PRB A;  3LD2 A;  5JM6 A;  5A28 A;  4KVM E;  3D66 A;  1P0H A;  1S3Z A;  4MHP A;  4XPD C;  4GXH A;  4MFK A;  3FYN A;  4QBJ A;  4X5K A;  1M4G A;  4JXQ A;  3GUX A;  4IHM A;  1OZP A;  4KUB A;  5I4M A;  2EWB A;  2EBJ A;  3H8E A;  1TXR A;  2P0W A;  3WC5 A;  3WC7 A;  4M85 A;  2YGW A;  3PB8 X;  4NGS A;  3PFE A;  1IY7 A;  3WR7 A;  5LYI A;  3FXT A;  3KGQ A;  2GLF A;  5H86 A;  1XMB A;  4A33 A;  1QQ9 A;  3NH8 A;  4ZGY B;  3F0A A;  1RXT A;  1ZG7 A;  2JEV A;  4P4F A;  2JDC A;  1NE9 A;  4BIN A;  4KOU A;  2DPT A;  3TX8 A;  4B5P B;  3PB7 X;  2ZEH A;  1A2Z A;  4B14 A;  1Y9K A;  3I3G A;  5DS0 A;  1VGY A;  2C6G A;  3GLJ A;  4ZX8 A;  4XPD B;  3TTH A;  2ARH A;  1YRE A;  4F0Y A;  2FL4 A;  4IUS A;  4WWV A;  4IF5 A;  5HH1 A;  3E0K A;  4FUU A;  2BSW A;  2OH1 A;  1VHE A;  2XEJ A;  2CXA A;  2ZW6 A;  3KL9 A;  4PXD A;  3R9E A;  2R1I A;  4U9Z A;  2G3T A;  3B2Y A;  4MXU A;  3SXN A;  4JZ0 A;  4BD9 A;  2ZEL A;  5JGF A;  4A30 A;  1ZO0 A;  4YWY A;  4X2T A;  3BJ8 A;  1M4I A;  2AFO A;  2KCW A;  5AG6 A;  2ANP A;  3TT2 A;  3S6F A;  2C1C A;  3D2P A;  2FCK A;  4PPZ A;  1X10 A;  2WUU A;  5AG5 A;  4A95 A;  4KOW A;  5GCN A;  4L8A A;  4AG7 A;  1B87 A;  1ELL P;  1LRZ A;  5IX3 A;  2ZEP A;  5C88 A;  1LAM A;  2B58 A;  1M44 A;  4XPL A;  2C6C A;  3G3S A;  4DJL A;  4PK3 A;  3S6H A;  2IQ6 A;  1IID A;  1Q7L A;  4AVC A;  2GFQ A;  1IOI A;  1XE4 A;  3V8I A;  3MGD A;  4FWU A;  1BAV A;  3S6K A;  2CNT A;  5G21 A;  1QSO A;  3N5F A;  1CP7 A;  3D67 A;  3IU2 A;  4MHD A;  4QB9 A;  2FSR A;  4ZI6 A;  4KOV A;  2Q0Y A;  3R95 A;  3PB9 X;  2HB6 A;  4KSF A;  6CPA A;  4H6U A;  4C2Y A;  3JUW A;  2Z11 A;  5BWA B;  3CT9 A;  3MN8 A;  1H8L A;  3W6X A;  3S9L A;  2QVP A;  4NGP A;  1DE4 C;  2BL1 A;  1YQE A;  2Q51 A;  4PSX A;  3SJG A;  4UBR A;  4EWT A;  3H8G A;  3V38 A;  3DNS A;  1HEE A;  3GYA A;  3D7F A;  1ARL A;  5KTA A;  2AJ6 A;  2BCO A;  3B7I A;  2ZEE A;  3L2N A;  2B3V A;  4A38 A;  3B3V A;  3IIB A;  2ABZ A;  4CGP A;  5AG4 A;  2ZXV A;  1VKC A;  3CZX A;  4KOY A;  4CYN A;  1Z9U A;  3RBU A;  3TE4 A;  5FVJ A;  2QEC A;  4PXB A;  1PUA A;  5HMN A;  1XFO A;  4K3N A;  4P4B A;  3R9G A;  3UY5 A;  1I1D A;  1P4N A;  3D68 A;  5CPA A;  1ZLH A;  4P45 A;  5F48 A;  5LRG A;  4B12 A;  1HDU A;  2YNC C;  1TKJ A;  4Q7A A;  3TOB A;  3SJF A;  4B5P A;  4E8O A;  1J4J A;  2ZED A;  4YU9 A;  4Q36 A;  4U5Y A;  3EC4 A;  1QSN A;  2OU2 A;  1Z2L A;  2EO8 A;  2PJ9 A;  2Z3M A;  1GHE A;  3IFE A;  5J8C A;  4AVA A;  2PJ5 A;  3BI0 A;  2J9A A;  3N7Z A;  1JQG A;  4MCS A;  4FD7 A;  4OKO A;  4OC2 A;  2CF4 A;  3KI9 A;  1LAN A;  4CS0 B;  4MHN A;  5LYD A;  2NMT A;  4CPA A;  2ZOF A;  3GB0 A;  1NMT A;  1NSA A;  1ZG9 A;  3PFO A;  3JRU A;  3H4Q A;  4OC4 A;  4Z65 A;  2PJA A;  2ZEG A;  5LYL A;  3MRU A;  2AFW A;  4KLV A;  1PU9 A;  3F5B A;  3I1U A;  4OIW A;  4GM5 A;  3EO4 A;  4RUH A;  2HQY A;  5IB0 A;  1XIX A;  1IU8 A;  5G22 A;  3TO6 A;  4UF4 A;  2JBK A;  4M3S A;  3T90 A;  4F9U A;  2R98 A;  2XEF A;  4MI4 A;  3IC1 A;  3IO1 A;  2Z3K A;  1V0C A;  2K5T A;  5THW A;  2DEA A;  5IV0 A;  4JWP A;  2PVW A;  4KUA A;  5F47 A;  4XPK A;  1ZG8 A;  1S7K A;  3BXM A;  3P2F A;  3TOA A;  1UFH A;  2CNM A;  2FS5 A;  3CDX A;  2PRQ A;  4MFQ A;  4MMO A;  5J8F A;  2BOA A;  3FH4 A;  3LAC A;  3PRT A;  4EME A;  1YLE A;  1KUX A;  4CAW A;  1BO4 A;  2PQ8 A;  1IYK A;  3GY9 A;  4PXC A;  4CRZ B;  5J1Q A;  4II9 A;  2YND A;  4ZY1 A;  4NEX A;  3R1K A;  5D29 A;  4NGT A;  4CYP A;  1TF8 A;  1Y7R A;  2POK A;  3R96 A;  2Q04 A;  3IWE A;  1ZLI A;  1YVO A;  1YW4 A;  2FIW A;  4B11 A;  2CNS A;  4NJQ A;  1AUG A;  1CX8 A;  2V8D A;  1F57 A;  3DDD A;  2PJ1 A;  3GIU A;  4ORF A;  3FEC A;  1WK4 A;  3FIX A;  4OAE A;  5F49 A;  3R9F A;  5DWM A;  2RFH A;  1WWZ A;  3P2H A;  3PBE A;  4E2A A;  1FT7 A;  4RS2 A;  1Q2D A;  2Q7B A;  1NSL A;  4CYO A;  3CXS A;  1M4L A;  3H8F A;  4I49 A;  3HUV A;  2G9D A;  2R7H A;  2RC4 A;  2NSM A;  3PGP A;  2PJ0 A;  4JJX A;  4OID A;  4M6H A;  2VBQ A;  1YR0 A;  4A2Z A;  2C27 A;  2Q44 A;  3IWG A;  2A4N A;  2CIJ A;  2AE6 A; 
#chains in the Genus database with same CATH homology
 4CRY B;  1KUV A;  1QSR A;  2B4B A;  3FNC A;  3DSB A;  2B5G B;  4NSQ A;  4OLL A;  2REE A;  4K30 A;  5JPH A;  4R3K A;  4QC6 A;  2CY2 A;  2FIA A;  2ZW4 A;  2ZW7 A;  4MFJ A;  3ZJ0 A;  3CXQ A;  2PR8 A;  2Z0Z A;  3NE7 A;  1M4D A;  4FD4 A;  2IL4 A;  2OZH A;  3K9U A;  4ONU A;  1N71 A;  4BBH A;  4U9Y A;  4UCN A;  5G1Z A;  1Z4R A;  4MY3 A;  1S7F A;  4KOX A;  4C2X A;  4C7I A;  3ZZI A;  2P6G A;  5CNP A;  1QST A;  4PSW A;  3D3S A;  4CAV A;  4R57 A;  3TO9 A;  1XMT A;  4YRH A;  5F46 A;  4KLW A;  4Q38 A;  3EFA A;  4FD6 A;  2VQY A;  4AG9 A;  4RI1 A;  2G0B A;  2PC1 A;  3GKR A;  5H84 A;  4C7H A;  2F5I A;  4XNH C;  2WPW A;  2Y0M A;  1Q2Y A;  5G20 A;  1YGH A;  4CAX A;  1BOB A;  2B4D B;  3DR8 A;  2DXQ A;  4UCP A;  4A31 A;  2Z3P A;  4UCM A;  3B8G A;  1Z4E A;  4YGO A;  4B5O A;  2ATR A;  3JTK A;  1IIC A;  4R87 A;  3W6S A;  1YVK A;  4Y49 C;  4MY0 A;  4XNH B;  3F8K A;  2R8V A;  1S60 A;  2WSA A;  4LX9 A;  4JLY A;  4NCZ A;  1M1D A;  4NF1 A;  1MJ9 A;  2GE3 A;  1Q2C A;  4FD5 A;  5I0C A;  3IGR A;  2OB0 A;  3D2M A;  2JDD A;  2G3A A;  2FXF A;  3C26 A;  3A9L A;  2Q4V A;  2GAN A;  4UFV A;  2EUI A;  1S5K A;  3PZJ A;  5AGE A;  4JD6 A;  3PP9 A;  2Z3O A;  3CXP A;  3RYO A;  2JLM A;  2ZPA A;  4UFW A;  5A27 A;  2OZG A;  1L0C A;  4CYQ A;  4L89 A;  4CGO A;  5C82 A;  2D4P A;  2Z10 A;  1S7N A;  3W91 A;  2P6F A;  4PV6 A;  4ZBG A;  4LUA A;  1KZF A;  5E96 A;  2VZZ A;  3EXN A;  2QML A;  2B4D A;  1B6B A;  4EVY A;  2I00 A;  3G8W A;  4CGM A;  1MJB A;  4YFJ A;  2WPX A;  4MBU A;  4F0X A;  1IYL A;  2P6E A;  1U6M A;  4CAF A;  3KKW A;  4KOT A;  5EBV A;  4BMH A;  2HUZ A;  4KSA A;  4HKF A;  1I12 A;  1ON0 A;  4MJ8 A;  4E0A A;  3JVN A;  2DPS A;  4KVO E;  2VXK A;  1SQH A;  3EY5 A;  3TO7 A;  3H5Z A;  2YNC A;  2VEZ A;  4MFL A;  2FT0 A;  4JXR A;  1S7L A;  3BLN A;  3FB3 A;  4DNC A;  2BUE A;  3QB8 A;  4MFZ A;  2D4O A;  3VWE A;  4AB7 A;  4QVT A;  4KOS A;  2H5M A;  2O28 A;  4C2Z A;  2VI7 A;  3D8P A;  3T9Y A;  4B13 A;  4UWI A;  4CGL A;  4GS4 A;  1MK4 A;  1XF8 A;  3S6G A;  5ISV A;  5KTD A;  3SXO A;  4QUS A;  1TIQ A;  2YNE A;  1MJA A;  2REF A;  4HNX B;  4CGN A;  2FE7 A;  2GIV A;  2J8R A;  4AVB A;  1YK3 A;  3TFY A;  2Q4Y A;  1Y9W A;  1CM0 A;  4MFP A;  2Z3N A;  3FRM A;  3I9S A;  2VZY A;  4UA3 A;  1I21 A;  4KS9 A;  4A32 A;  2PDO A;  4R3L A;  2QIR A;  2BEI A;  3QAH A;  3IU1 A;  2PR1 A;  2B5G A;  4NXY A;  3FBU A;  1XEB A;  2PSW A;  3SHP A;  1FY7 A;  2HV2 A;  4UFX A;  4KZT A;  4J3G A;  4KOR A;  4OAD A;  1QSM A;  4H89 A;  2OZU A;  1KUY A;  4HNY B;  2ZW5 A;  1VHS A;  3OWC A;  4F6A A;  3TCV A;  1YX0 A;  3VWD A;  2B3U A;  3DR6 A;  1IB1 E;  5DWN A;  4Y49 B;  4KVX A;  5EC4 A;  1K4J A;  4HNW B;  2J8M A;  1R57 A;  1RO5 A;  4B10 A;  2EVN A;  5KTC A;  2J8N A;  2Z3L A;  5AG7 A;  3BJ7 A;  4C68 A;  4UWJ A;  1CJW A;  4H6Z A;  4PK2 A;  4R9M A;  4CAE A;  5JQ4 A;  2I79 A;  3LOD A;  2X7B A;  2PRB A;  3LD2 A;  5A28 A;  4KVM E;  1P0H A;  1S3Z A;  4XPD C;  4MFK A;  3FYN A;  4QBJ A;  4X5K A;  1M4G A;  4JXQ A;  1OZP A;  4KUB A;  2P0W A;  4M85 A;  2YGW A;  3WR7 A;  3FXT A;  5H86 A;  4A33 A;  4ZGY B;  3F0A A;  1RXT A;  2JEV A;  2JDC A;  1NE9 A;  4KOU A;  2DPT A;  4B5P B;  4B14 A;  1Y9K A;  3I3G A;  4XPD B;  3TTH A;  2ARH A;  1YRE A;  4F0Y A;  2FL4 A;  4IUS A;  4IF5 A;  5HH1 A;  3E0K A;  2BSW A;  2OH1 A;  2ZW6 A;  2CXA A;  3SXN A;  3R9E A;  2R1I A;  4U9Z A;  2G3T A;  4A30 A;  1ZO0 A;  3BJ8 A;  1M4I A;  2KCW A;  5AG6 A;  3TT2 A;  3S6F A;  3D2P A;  2FCK A;  5AG5 A;  2WUU A;  4A95 A;  4KOW A;  5GCN A;  4L8A A;  4AG7 A;  1B87 A;  1LRZ A;  5IX3 A;  5C88 A;  2B58 A;  1M44 A;  4XPL A;  3G3S A;  4PK3 A;  3S6H A;  1IID A;  4AVC A;  1XE4 A;  3V8I A;  3MGD A;  3S6K A;  2CNT A;  5G21 A;  1QSO A;  3IU2 A;  4MHD A;  4QB9 A;  2FSR A;  4KOV A;  2Q0Y A;  3R95 A;  4KSF A;  4H6U A;  4C2Y A;  3JUW A;  2Z11 A;  5BWA B;  3W6X A;  2BL1 A;  4PSX A;  4UBR A;  3DNS A;  3GYA A;  5KTA A;  2AJ6 A;  2B3V A;  4CGP A;  5AG4 A;  2ZXV A;  1VKC A;  4KOY A;  4CYN A;  1Z9U A;  3TE4 A;  5FVJ A;  2QEC A;  1PUA A;  5HMN A;  3R9G A;  3UY5 A;  1I1D A;  1P4N A;  5F48 A;  4B12 A;  2YNC C;  3TOB A;  4B5P A;  4E8O A;  1J4J A;  4Q36 A;  4U5Y A;  3EC4 A;  1QSN A;  2OU2 A;  2Z3M A;  1GHE A;  5J8C A;  4AVA A;  3N7Z A;  4FD7 A;  4CS0 B;  2NMT A;  1NMT A;  3H4Q A;  4KLV A;  1PU9 A;  3F5B A;  3EO4 A;  2HQY A;  5IB0 A;  1XIX A;  5G22 A;  3TO6 A;  4M3S A;  3T90 A;  2R98 A;  4MI4 A;  2Z3K A;  1V0C A;  2K5T A;  5IV0 A;  4JWP A;  4KUA A;  5F47 A;  4XPK A;  1S7K A;  3TOA A;  3P2F A;  1UFH A;  2CNM A;  2FS5 A;  4MFQ A;  5J8F A;  1YLE A;  1KUX A;  4CAW A;  2PQ8 A;  3GY9 A;  1IYK A;  1BO4 A;  4CRZ B;  4II9 A;  2YND A;  4NEX A;  3R1K A;  4CYP A;  1Y7R A;  3R96 A;  2Q04 A;  3IWE A;  1YVO A;  2FIW A;  4B11 A;  2CNS A;  3DDD A;  4ORF A;  4OAE A;  1WK4 A;  3FIX A;  5F49 A;  3R9F A;  5DWM A;  1WWZ A;  3P2H A;  4E2A A;  4RS2 A;  1Q2D A;  2Q7B A;  1NSL A;  4CYO A;  3CXS A;  4I49 A;  2R7H A;  3PGP A;  2RC4 A;  4JJX A;  2VBQ A;  1YR0 A;  4A2Z A;  2C27 A;  2Q44 A;  3IWG A;  2A4N A;  2AE6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...