3R95A

Crystal structure of microcin c7 self immunity acetyltransferase mcce in complex with acetyl-coa
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
180
structure length
180
Chain Sequence
DVSLTPSGIKVNDEITLLYPALKYAEELYLLINQNKINFIKSMAWPAFVNNISDSVSFIEQSMIDNQNEKALILFIKYKTKIAGVVSFNIIDHANKTAYIGYWLGANFQGKGIVTNAINKLIQEYGDSGVIKRFVIKCIVDNKKSNATALRCGFTLEGVLQKAEILNGVSYDQNIYSKVI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MccE protein
publication title Structural Basis for Microcin C7 Inactivation by the MccE Acetyltransferase.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
total genus 56
structure length 180
sequence length 180
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-03-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 3r95A00
2P6FA 4CAWA 3JVNA 1XMTA 2NMTA 1PU9A 3GY9A 1LRZA 3TOAA 4CRZB 4CS0B 3IWGA 4ONUA 3R96A 4HNWB 2X7BA 4ORFA 2DXQA 1XEBA 5HH1A 4PSWA 4JXQA 4NCZA 4NF1A 3DDDA 2J8RA 4PK3A 1M44A 2JLMA 1I1DA 1M4DA 2CNMA 3R95A 3V8IA 4NSQA 1IYKA 1NMTA 2BEIA 4M3SA 2CNSA 2KCWA 1YLEA 1I21A 2K5TA 3C26A 2C27A 3FRMA 3CXSA 3P2FA 1M4GA 2GIVA 1KUXA 4KVOE 4QC6A 4XNHB 4OLLA 2F5IA 4KLVA 1PUAA 3TT2A 1Y9WA 4AG9A 3LD2A 4JJXA 4L8AA 4XNHC 1Y9KA 2FCKA 3T9YA 5H84A 2EVNA 4FD5A 5DWNA 4R3LA 2Z0ZA 4KOWA 3FNCA 4MY3A 2VBQA 2Z11A 4F6AA 2Q0YA 1B87A 1YVOA 4XPDB 4KZTA 2Q04A 2ZPAA 5GCNA 2OH1A 1J4JA 1K4JA 1NSLA 4XPDC 5EC4A 4AVAA 3T90A 2OZHA 4B5PA 1WK4A 5IV0A 4U9YA 1CM0A 4AB7A 3S6HA 4U9ZA 5J8FA 4YFJA 4JWPA 3EXNA 4XPKA 1MJBA 2A4NA 2WPWA 1BO4A 4RI1A 1VKCA 1ON0A 1B6BA 2G3TA 5EBVA 4Y49C 4CAVA 4CRYB 1OZPA 5JQ4A 1YK3A 2ZXVA 3TCVA 2FE7A 2FS5A 3GKRA 4H6ZA 4YGOA 5IX3A 3E0KA 2GANA 2B4DA 2JEVA 4B5OA 4CAXA 5F46A 5C82A 1Q2YA 3R9FA 1YVKA 4YRHA 4LX9A 4OAEA 3QB8A 4AVCA 4PV6A 1U6MA 4MJ8A 1MK4A 3FYNA 2R8VA 2Q7BA 2OU2A 2PR8A 1KZFA 1VHSA 1Q2CA 4MY0A 1KUYA 3TOBA 4QVTA 2VI7A 1M4IA 4NXYA 2R7HA 4H89A 2REFA 4HNYB 4I49A 2D4OA 2ZW7A 4E0AA 1Z4RA 1R57A 1Q2DA 4JLYA 4FD4A 4M85A 1Y7RA 4XPLA 4K30A 4KVME 3TO6A 2B3UA 3DSBA 4JXRA 2G3AA 4ZBGA 1S60A 4U5YA 1IYLA 2HUZA 1S5KA 1QSTA 3W6XA 4IUSA 4AG7A 5JPHA 5CNPA 4E8OA 2JDDA 2Q4VA 2HQYA 2PSWA 3W91A 4QB9A 3MGDA 1YX0A 2ZW5A 2CY2A 2FSRA 1SQHA 4R9MA 2VXKA 3ZJ0A 3QAHA 4R87A 1CJWA 2FXFA 3FXTA 2B5GB 4QUSA 2J8MA 1RO5A 2IL4A 3EFAA 4BMHA 4KUAA 3W6SA 2VZZA 3I9SA 5I0CA 3TFYA 1TIQA 1UFHA 3SXOA 2Q44A 3SXNA 1N71A 2ZW4A 3TO9A 1YREA 2GE3A 3DR6A 4FD7A 1XE4A 3BJ8A 3TTHA 2OB0A 4KOXA 1I12A 1V0CA 1Z9UA 1GHEA 4KLWA 4KOVA 4MI4A 1WWZA 3BJ7A 1QSOA 2R98A 3F5BA 1XF8A 3EO4A 1QSNA 4J3GA 4IF5A 3TE4A 3ZZIA 1P0HA 5F49A 3F0AA 1Z4EA 4KOTA 5KTCA 3D2PA 3PGPA 2PR1A 3D3SA 2BSWA 3I3GA 4PK2A 3JUWA 2CNTA 3RYOA 4KOUA 2JDCA 5E96A 3G8WA 4KOYA 2P6EA 3DNSA 3S6GA 5ISVA 2B3VA 3K9UA 3BLNA 1XIXA 4MBUA 4X5KA 2O28A 5KTDA 2HV2A 1QSRA 4F0YA 4II9A 3IGRA 1S7NA 3H4QA 1IB1E 5DWMA 4UWIA 1RXTA 2PRBA 1BOBA 5J8CA 4NEXA 3PP9A 3PZJA 2PC1A 3FB3A 3D8PA 2OZGA 4FD6A 4KOSA 2J8NA 4LUAA 4E2AA 1YGHA 1MJ9A 5IB0A 2FIWA 5F48A 2VZYA 2QECA 4QBJA 2I00A 4R3KA 4B5PB 3NE7A 3TO7A 3R1KA 1FY7A 2FIAA 4UA3A 2BL1A 2FT0A 3CXQA 3FIXA 2I79A 3P2HA 2D4PA 3S6FA 1S3ZA 2EUIA 2OZUA 1KUVA 2REEA 2RC4A 2VQYA 4KUBA 1IIDA 2P0WA 2QIRA 3GYAA 4H6UA 3CXPA 4UWJA 2FL4A 3VWEA 1YR0A 4R57A 4MHDA 2B4DB 4RS2A 1MJAA 3DR8A 3EY5A 2ATRA 1QSMA 2QMLA 2Z10A 3S6KA 5HMNA 3OWCA 4DNCA 5H86A 1S7KA 1S7FA 3UY5A 1IICA 2PDOA 2G0BA 5F47A 3WR7A 3N7ZA 2VEZA 2H5MA 1S7LA 2WPXA 4KVXA 2R1IA 2Y0MA 3VWDA 3R9EA 2AE6A 4OADA 1NE9A 2Q4YA 5KTAA 3LODA 2P6GA 4HKFA 4Y49B 2AJ6A 2ZW6A 2PQ8A 4PSXA 2ARHA 4JD6A 2B58A 4GS4A 3SHPA 4KORA 2BUEA 5C88A 4L89A 5FVJA 2B4BA 4AVBA 3EC4A 4HNXB 2B5GA 3D2MA 3KKWA 4UBRA 4EVYA 1L0CA 3B8GA 1P4NA 3FBUA 3F8KA 3R9GA 1M1DA 3G3SA
chains in the Genus database with same CATH superfamily
4MCSA 2P6FA 3B3CA 4PPZA 1RTQA 2O53A 4CAWA 3JVNA 1XMTA 1YSJA 2NMTA 1PU9A 1Z5RA 1LRZA 2RFHA 3GY9A 3TOAA 4CRZB 4CS0B 3FF3A 2GFQA 3IWGA 2OOTA 4ONUA 4B13A 4P4EA 3R96A 4MCQA 4HNWB 2X7BA 3KI9A 3PFOA 3IWEA 4ORFA 4WJBA 3TC8A 1Z8XA 4F0XA 2DXQA 1XEBA 5I4MA 5HH1A 4PSWA 4JXQA 4NCZA 4NF1A 3DDDA 5HVGA 4MFPA 2YNDA 2J8RA 4PK3A 5K8MA 3S9LA 1M44A 2JLMA 4OC4A 4PXCA 5K8NA 1I1DA 4MFJA 3VARA 1M4DA 2AFWA 2CNMA 3H5ZA 4TWEA 3R95A 3V8IA 7CPAA 1CPXA 1IYKA 4NSQA 5LRJA 1NMTA 3RNZA 1QMUA 2BEIA 2GLJA 4M3SA 4A2ZA 2CNSA 4KSIA 2KCWA 1IOIA 1YLEA 2K5TA 1I21A 3C26A 2C27A 3FRMA 4B10A 1LOKA 3CXSA 2DEAA 3P2FA 4PXDA 1IGBA 1M4GA 3CPXA 2GIVA 3B35A 1KUXA 3D7FA 2PCUA 4MCRA 3SJEA 4KVOE 3D67A 3GLJA 4UCPA 3CPAA 3WC6A 4QC6A 1HDUA 2YNEA 4XNHB 4OLLA 2F5IA 4KLVA 1PUAA 3D7HA 3TT2A 3LWUA 2AFXA 3NH8A 1Y9WA 3KR4A 3L2NA 4ZI6A 4AG9A 2PJ5A 2EO8A 3LD2A 4JJXA 4L8AA 4XNHC 1Y7EA 4NGRA 2RB7A 3SJXA 4A95A 1Y9KA 4NGMA 2FCKA 1XRYA 1ZLIA 3QAYA 3T9YA 5KTDA 4PXEA 5H84A 5LYLA 2EVNA 1TF8A 4CYPA 2I3CA 3WABA 1HDQA 4FD5A 5DWNA 4R3LA 3SI2A 3WT4A 3ISZA 4NGNA 2Z0ZA 1GYTA 4KOWA 4NJRA 3B3VA 1FNOA 3B3TA 3FNCA 3IWWA 2VBQA 4MY3A 4UF4A 1Z8WA 2POKA 2Z11A 4OC0A 4F6AA 2Q0YA 2WSAA 1B87A 1YVOA 1CG2A 4XPDB 4KZTA 1PYTB 1Z8LA 2Q04A 2ZPAA 4P45A 4Q7AA 4RN7A 4M6IA 5GCNA 2OH1A 1J4JA 1K4JA 3H8FA 3V38A 3NFZA 2XEJA 1NSLA 4XPDC 4M6HA 4B14A 2ODFA 3PB9X 4R76A 2EK8A 5EC4A 3RO0A 4ZX9A 4AVAA 3T90A 4CYOA 2BOAA 2OZHA 4B5PA 4CGMA 1WK4A 1ARMA 5IV0A 4OC5A 3LMSA 1CM0A 4M6GA 4U9YA 4AB7A 3S6HA 4UIAA 4R7MA 4MHZA 4U9ZA 3G3SA 5J8FA 4YFJA 1NSAA 4JWPA 4GM5A 1CBXA 4UIBA 2PJ8A 3FMCA 3EXNA 1Z2LA 4A37A 4ZX8A 4XPKA 3IC1A 3KZWA 3CDXA 1MJBA 2A4NA 2WPWA 3KASA 1BO4A 4RI1A 5LRKA 1VKCA 1ON0A 1B6BA 2G3TA 3DLJA 3GUXA 5EBVA 4A94A 4Y49C 2ZEMA 2Z3MA 4CAVA 4CRYB 2XEFA 3KL9A 1OZPA 3KHZA 4R6TA 4EWTA 5JQ4A 2PJCA 1YK3A 4NFRA 4MFKA 2ZXVA 3TCVA 4YU9A 2FE7A 3H8GA 3KHXA 1YW6A 2FS5A 2CF4A 2DPTA 4UEZA 3GIUA 1CP6A 3GKRA 4IK2A 4H6ZA 4YGOA 5K8PA 2ZEEA 5IX3A 4BD9A 3E0KA 1Z8TA 2GANA 2B4DA 2JEVA 4F8ZA 4MHYA 2Z3PA 4OC2A 4B5OA 4CAXA 3A9LA 5F46A 2PIYA 1Q2YA 3R9FA 1YVKA 5C82A 2ZEFA 3PRTA 4YRHA 4OMEA 4IAVA 5JM6A 1XJOA 4LX9A 2AFOA 4OAEA 3QB8A 4AVCA 2C6GA 3N5FA 4PV6A 5G21A 1U6MA 4MJ8A 4A39A 1MK4A 1VGYA 3VATA 4FAIA 3FYNA 3JRUA 2R8VA 2PIZA 2OU2A 2PR8A 1F2PA 3IFEA 3PBEA 1KZFA 4H2KA 2Q7BA 5LRGA 1VHSA 1Q2CA 2ABZA 4MY0A 1KUYA 1AYEA 3T8WA 3TOBA 4QVTA 2VI7A 1M4IA 4NXYA 5LYDA 5JGFA 1HEEA 2R7HA 3NH4A 2ZOFA 3NH5A 3RBUA 2GU2A 4OC1A 2CTBA 4H89A 2REFA 4C2YA 2ZEHA 2V8GA 4OP4A 4F9UA 4HNYB 4I49A 4GXHA 2D4OA 1R43A 2ZW7A 4O23A 2V8VA 4E0AA 4CGPA 1Z4RA 1R57A 1Q2DA 2C6CA 4JLYA 4FD4A 4M85A 1Y7RA 2PVVA 3CZXA 4XPLA 4K30A 4KVME 3TO6A 3BXMA 4G1PA 2B3UA 1LAMA 3DSBA 2BCOA 2NSMA 1LANA 4YWYA 4UFWA 1BPMA 2V77A 4JXRA 2G3AA 4ZBGA 1S60A 4U5YA 1IYLA 4NGTA 2HUZA 1S5KA 4P4JA 3S9NA 1QSTA 3W6XA 4IUSA 4AG7A 5JPHA 1ZO0A 5CNPA 4E8OA 2JDDA 2Q4VA 4FWUA 4P6YA 2HQYA 3WC5A 2DPSA 2PSWA 2VL1A 3W91A 1R3NA 3DGVA 3K9TA 4QB9A 4C68A 2ZEOA 2Q43A 3SJGA 1LCPA 3MGDA 2V8HA 1YX0A 2ZW5A 1X10A 2CY2A 2FSRA 3V7ZA 1SQHA 4UFXA 4UEEA 4W9YA 4UCNA 4R9MA 2IMOA 2VXKA 5DS0A 1ZLHA 2QYVA 3PEIA 3ZJ0A 3QAHA 4R87A 1CJWA 2FXFA 3D7GA 2B5GB 3FXTA 2J8MA 4QUSA 3D4UA 3PB8X 4ZY0A 1RO5A 2IL4A 3EFAA 5G22A 1DTDA 4BMHA 4MFZA 3RAMA 4KUAA 3W6SA 4CYNA 2VZZA 3I9SA 3HUVA 5I0CA 3TFYA 1QQ9A 1TIQA 4A33A 4X2TA 3JTKA 3K2KA 1UFHA 3SXOA 2Q44A 4PXBA 3SXNA 2PRQA 1EE3P 1N71A 4OIDA 2ZW4A 3TO9A 2AFSA 5LYFA 1YREA 2GE3A 2WZNA 3DR6A 3IO1A 1BPNA 3CT9A 4FD7A 1XE4A 2ANPA 2CXAA 2OR4A 4NJQA 4TNUA 1CP7A 5D29A 4MFLA 4CGLA 2O4HA 3BJ8A 3TTHA 2OB0A 4A38A 4KOXA 1I12A 1V0CA 1Z9UA 3BI1A 1GHEA 3RZAA 2JBJA 2AFUA 4CAFA 4KSAA 4MXUA 1IU8A 3NE8A 1ELLP 1JQGA 5AG7A 5A27A 2ZELA 4KLWA 2PJ3A 4KOVA 4MI4A 4C7HA 1WWZA 4AXVA 4FBEA 2QJ8A 3BJ7A 1QSOA 2R98A 3F5BA 4X8IA 1XF8A 4ZYQA 3EO4A 2F8HA 1QSNA 2BO9A 4P44A 4Q36A 4J3GA 5AG4A 3GB0A 4OIWA 2PJAA 4IF5A 3TE4A 3ZZIA 1P0HA 5F49A 3F0AA 1Z4EA 3SI1A 2DF5A 4KOTA 3D7DA 4WWVA 5EMIA 3D2PA 5KTCA 3PGPA 4K3NA 2PR1A 2C6PA 4CYQA 1LAPA 2C1CA 1TKJA 1IOFA 2BSWA 2Z3OA 3D3SA 1FT7A 3I3GA 3IJ3A 2ZOGA 4PK2A 3JUWA 2CNTA 4R8FA 3RYOA 4NGPA 1JWQA 4Q38A 3SJFA 5A28A 4KOUA 5JH9A 1H8LA 4LQ6A 5HVFA 2XEIA 1M4LA 2IQ6A 2JDCA 3B7IA 3G8WA 5E96A 4CGOA 4DUKA 4KOYA 5F09A 2P6EA 2FVGA 3DNSA 2ZEPA 4P4FA 3S6GA 3FVLA 4P4DA 4MRIA 2V8DA 5ISVA 4BBHA 2B3VA 5D8NA 3K9UA 4CGNA 4B11A 3BLNA 5K8OA 1XIXA 2Z3KA 4MBUA 3KR5A 2O28A 4UCMA 2F7VA 2HV2A 1QSRA 4X5KA 4C7IA 3KGQA 4EFDA 4NGQA 4F0YA 4HPSA 4II9A 1CPSA 1TF9A 4A32A 5G20A 3IGRA 2EK9A 2PJ1A 1ELMP 5HVHA 1S7NA 4RUHA 3H4QA 2PJ2A 1IB1E 3B2YA 2Q7SA 5DWMA 3WC7A 4UWIA 3FEEA 1RXTA 2PRBA 4CPAA 2AFMA 4P10A 1BOBA 2PJ4A 3IU2A 1BLLE 5J8CA 4NEXA 2PJ0A 3PP9A 3PZJA 2PJ7A 2PC1A 3FB3A 3D8PA 2OZGA 4FD6A 4KOSA 1Y0YA 1TKHA 2J8NA 2Z3NA 1PCAA 4LUAA 1Y0RA 3PB7X 2QVPA 4X3RA 4B6ZA 4P4BA 4E2AA 1YGHA 1MJ9A 2WYRA 3KQXA 1CX8A 5IB0A 2YGWA 2EBJA 3IU1A 2FIWA 4PQAA 5F48A 2VZYA 3FECA 1Q7LA 2QECA 4LQGA 1ZG9A 4QBJA 4KS9A 2I00A 4R3KA 4B5PB 4ZY1A 2Z3LA 4DJLA 3NE7A 3SI0A 2PJBA 2IJZA 3TO7A 3R1KA 2NYQA 1FY7A 2GREA 2FIAA 2ZEGA 2Q4ZA 4UA3A 4NGSA 2BL1A 2JBKA 1AMPA 2FT0A 3CXQA 3FIXA 2I79A 3P2HA 3D66A 2D4PA 2Q51A 1TXRA 3I1UA 3S6FA 1S3ZA 1XOVA 2EUIA 2OZUA 3BHXA 3PBBA 1KUVA 5AG6A 5THWA 4A30A 1AUGA 2REEA 3HLPA 2RC4A 4OC3A 2ZENA 2VQYA 2ZEDA 4KUBA 4OKOA 2CIJA 2CTCA 3IIBA 1IIDA 2P0WA 2QIRA 5CBMA 3GYAA 1VIXA 4C2ZA 4Z65A 4CAEA 2JEWA 4H6UA 5IB9A 3FX6A 3B3WA 4FUUA 3VH9A 3CXPA 4UWJA 2FL4A 3MN8A 3VWEA 4ZGYB 3KQZA 1YR0A 4R57A 2WUUA 4MHDA 2B4DB 2AFZA 4RS2A 1MJAA 3DR8A 3EY5A 2ATRA 2XEGA 1QSMA 4ONWA 1ARLA 2QMLA 2Z10A 3S6KA 2PE3A 5G1ZA 2YNCC 5HMNA 3OWCA 1XFOA 2G9DA 4DNCA 5H86A 4EMEA 1S7KA 4B12A 4MHPA 1S7FA 2EWBA 1IICA 3UY5A 2PDOA 1YW4A 3PFEA 1X12A 1ZG7A 2G0BA 1VHOA 3NA6A 5F47A 3WR7A 1YQEA 4MMOA 3N7ZA 2VEZA 2H5MA 1S7LA 1XBUA 3BI0A 1IY7A 3PB4X 5CPAA 1YLOA 3S9MA 2WPXA 4KVXA 2R1IA 3IEHA 4IHMA 1VHEA 2Y0MA 1LFWA 3VWDA 3PB6X 3R9EA 2AE6A 1KWMA 1ZG8A 4KSFA 4ZY2A 3TX8A 3MRUA 4BINA 1BAVA 4OADA 1NE9A 4DYOA 1F57A 1A2ZA 3H8EA 2Q4YA 4MHNA 5HXDA 5KTAA 3LODA 3B3SA 1YMEA 1XMBA 2P6GA 5ELYA 3D68A 4A31A 1UWYA 4MFQA 4HKFA 3ISXA 4MCPA 4UFVA 4UEFA 3FEDA 4Y49B 2AJ6A 2GLFA 1DE4C 2ZW6A 2PQ8A 4PSXA 2ARHA 4JD6A 6CPAA 2B58A 4GS4A 1OBRA 5AG5A 3SHPA 3FJUA 4KORA 2BUEA 5C88A 4L89A 5J1QA 5FVJA 2B4BA 5AGEA 4AVBA 3EC4A 4HNXB 4C2XA 2B5GA 3FH4A 4JZ0A 4P4IA 2PJ6A 1F2OA 3D2MA 2HC9A 3KKWA 4UBRA 4EVYA 1L0CA 3B8GA 1P4NA 3FBUA 3LACA 5BWAB 3F8KA 3QNVA 5LYIA 2YNCA 4JYWA 2HB6A 1TKFA 3R9GA 1M1DA 2J9AA 4F9VA 8CPAA 2PVWA 2PJ9A
chains in the Genus database with same CATH topology
2P6FA 4CAWA 3JVNA 1XMTA 2NMTA 1PU9A 3GY9A 1LRZA 3TOAA 4CRZB 4CS0B 3IWGA 4ONUA 4B13A 3R96A 4HNWB 2X7BA 4ORFA 3IWEA 4F0XA 2DXQA 1XEBA 5HH1A 4PSWA 4JXQA 4NCZA 4NF1A 3DDDA 4MFPA 2YNDA 2J8RA 4PK3A 1M44A 2JLMA 1I1DA 4MFJA 1M4DA 2CNMA 3H5ZA 3R95A 3V8IA 4NSQA 1IYKA 1NMTA 2BEIA 4A2ZA 4M3SA 2CNSA 2KCWA 1YLEA 1I21A 2K5TA 3C26A 2C27A 3FRMA 4B10A 3CXSA 3P2FA 1M4GA 2GIVA 1KUXA 4KVOE 4UCPA 4QC6A 2YNEA 4XNHB 4OLLA 2F5IA 4KLVA 1PUAA 3TT2A 1Y9WA 4AG9A 3LD2A 4JJXA 4L8AA 4XNHC 4A95A 1Y9KA 2FCKA 3T9YA 5H84A 2EVNA 4CYPA 4FD5A 5DWNA 4R3LA 2Z0ZA 4KOWA 3FNCA 4MY3A 2VBQA 2Z11A 4F6AA 2Q0YA 2WSAA 1B87A 1YVOA 4XPDB 4KZTA 2Q04A 2ZPAA 5GCNA 2OH1A 1J4JA 1K4JA 1NSLA 4XPDC 4B14A 5EC4A 4AVAA 3T90A 4CYOA 2OZHA 4CGMA 4B5PA 1WK4A 5IV0A 4U9YA 1CM0A 4AB7A 3S6HA 4U9ZA 5J8FA 4YFJA 4JWPA 3EXNA 4XPKA 1MJBA 2A4NA 2WPWA 1BO4A 4RI1A 1VKCA 1ON0A 1B6BA 2G3TA 5EBVA 4Y49C 2Z3MA 4CAVA 4CRYB 1OZPA 5JQ4A 1YK3A 4MFKA 2ZXVA 3TCVA 2FE7A 2FS5A 2DPTA 3GKRA 4H6ZA 4YGOA 5IX3A 3E0KA 2GANA 2B4DA 2JEVA 2Z3PA 4B5OA 4CAXA 3A9LA 5F46A 5C82A 1Q2YA 3R9FA 1YVKA 4YRHA 4LX9A 4OAEA 3QB8A 4AVCA 4PV6A 5G21A 1U6MA 4MJ8A 1MK4A 3FYNA 2R8VA 2Q7BA 2OU2A 2PR8A 1KZFA 1VHSA 1Q2CA 4MY0A 1KUYA 3TOBA 4QVTA 2VI7A 1M4IA 4NXYA 2R7HA 4H89A 2REFA 4C2YA 4HNYB 4I49A 2D4OA 2ZW7A 4E0AA 4CGPA 1Z4RA 1R57A 1Q2DA 4JLYA 4FD4A 4M85A 1Y7RA 4XPLA 4K30A 4KVME 3TO6A 2B3UA 3DSBA 4UFWA 4JXRA 2G3AA 4ZBGA 1S60A 4U5YA 1IYLA 2HUZA 1S5KA 1QSTA 3W6XA 4IUSA 4AG7A 5JPHA 1ZO0A 5CNPA 4E8OA 2JDDA 2Q4VA 2HQYA 2DPSA 2PSWA 3W91A 4C68A 4QB9A 3MGDA 1YX0A 2ZW5A 2CY2A 2FSRA 1SQHA 4UFXA 4UCNA 4R9MA 2VXKA 3ZJ0A 3QAHA 4R87A 1CJWA 2FXFA 3FXTA 2B5GB 4QUSA 2J8MA 1RO5A 2IL4A 3EFAA 5G22A 4BMHA 4MFZA 4CYNA 4KUAA 3W6SA 2VZZA 3I9SA 5I0CA 3TFYA 1TIQA 4A33A 3JTKA 1UFHA 3SXOA 2Q44A 3SXNA 1N71A 2ZW4A 3TO9A 1YREA 2GE3A 3DR6A 4FD7A 1XE4A 2CXAA 4MFLA 4CGLA 3BJ8A 3TTHA 2OB0A 4KOXA 1I12A 1V0CA 1Z9UA 1GHEA 4CAFA 4KSAA 5AG7A 5A27A 4KLWA 4KOVA 4MI4A 4C7HA 1WWZA 3BJ7A 1QSOA 2R98A 3F5BA 1XF8A 3EO4A 1QSNA 4Q36A 4J3GA 5AG4A 4IF5A 3TE4A 3ZZIA 1P0HA 5F49A 3F0AA 1Z4EA 4KOTA 5KTCA 3D2PA 3PGPA 2PR1A 4CYQA 2Z3OA 3D3SA 2BSWA 3I3GA 4PK2A 3JUWA 2CNTA 3RYOA 4Q38A 5A28A 4KOUA 2JDCA 5E96A 3G8WA 4CGOA 4KOYA 2P6EA 3DNSA 3S6GA 5ISVA 4BBHA 2B3VA 3K9UA 4CGNA 4B11A 3BLNA 1XIXA 2Z3KA 4MBUA 4X5KA 2O28A 4UCMA 5KTDA 2HV2A 1QSRA 4C7IA 4F0YA 4II9A 4A32A 5G20A 3IGRA 1S7NA 3H4QA 1IB1E 5DWMA 4UWIA 1RXTA 2PRBA 1BOBA 3IU2A 5J8CA 4NEXA 3PP9A 3PZJA 2PC1A 3FB3A 3D8PA 2OZGA 4FD6A 4KOSA 2J8NA 2Z3NA 4LUAA 4E2AA 1YGHA 1MJ9A 5IB0A 2YGWA 3IU1A 2FIWA 5F48A 2VZYA 2QECA 4QBJA 4KS9A 2I00A 4R3KA 4B5PB 2Z3LA 3NE7A 3TO7A 3R1KA 1FY7A 2FIAA 4UA3A 2BL1A 2FT0A 3CXQA 3FIXA 2I79A 3P2HA 2D4PA 3S6FA 1S3ZA 2EUIA 2OZUA 1KUVA 5AG6A 4A30A 2REEA 2RC4A 2VQYA 4KUBA 1IIDA 2P0WA 2QIRA 3GYAA 4C2ZA 4CAEA 4H6UA 3CXPA 4UWJA 2FL4A 3VWEA 4ZGYB 1YR0A 4R57A 2WUUA 4MHDA 2B4DB 4RS2A 1MJAA 3DR8A 3EY5A 2ATRA 1QSMA 2QMLA 2Z10A 3S6KA 5G1ZA 2YNCC 5HMNA 3OWCA 4DNCA 5H86A 1S7KA 4B12A 1S7FA 3UY5A 1IICA 2PDOA 2G0BA 5F47A 3WR7A 3N7ZA 2VEZA 2H5MA 1S7LA 2WPXA 4KVXA 2R1IA 2Y0MA 3VWDA 3R9EA 2AE6A 4KSFA 4OADA 1NE9A 2Q4YA 5KTAA 3LODA 2P6GA 4A31A 4MFQA 4HKFA 4UFVA 4Y49B 2AJ6A 2ZW6A 2PQ8A 4PSXA 2ARHA 4JD6A 2B58A 4GS4A 3SHPA 5AG5A 4KORA 2BUEA 5C88A 4L89A 5FVJA 2B4BA 5AGEA 4AVBA 3EC4A 4HNXB 4C2XA 2B5GA 3D2MA 3KKWA 4UBRA 4EVYA 1L0CA 3B8GA 1P4NA 3FBUA 5BWAB 3F8KA 2YNCA 3R9GA 1M1DA 3G3SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2P6F A;  4CAW A;  3JVN A;  1XMT A;  2NMT A;  1PU9 A;  3GY9 A;  1LRZ A;  3TOA A;  4CRZ B;  4CS0 B;  3IWG A;  4ONU A;  3R96 A;  4HNW B;  2X7B A;  4ORF A;  2DXQ A;  1XEB A;  5HH1 A;  4PSW A;  4JXQ A;  4NCZ A;  4NF1 A;  3DDD A;  2J8R A;  4PK3 A;  1M44 A;  2JLM A;  1I1D A;  1M4D A;  2CNM A;  3R95 A;  3V8I A;  4NSQ A;  1IYK A;  1NMT A;  2BEI A;  4M3S A;  2CNS A;  2KCW A;  1YLE A;  1I21 A;  2K5T A;  3C26 A;  2C27 A;  3FRM A;  3CXS A;  3P2F A;  1M4G A;  2GIV A;  1KUX A;  4KVO E;  4QC6 A;  4XNH B;  4OLL A;  2F5I A;  4KLV A;  1PUA A;  3TT2 A;  1Y9W A;  4AG9 A;  3LD2 A;  4JJX A;  4L8A A;  4XNH C;  1Y9K A;  2FCK A;  3T9Y A;  5H84 A;  2EVN A;  4FD5 A;  5DWN A;  4R3L A;  2Z0Z A;  4KOW A;  3FNC A;  4MY3 A;  2VBQ A;  2Z11 A;  4F6A A;  2Q0Y A;  1B87 A;  1YVO A;  4XPD B;  4KZT A;  2Q04 A;  2ZPA A;  5GCN A;  2OH1 A;  1J4J A;  1K4J A;  1NSL A;  4XPD C;  5EC4 A;  4AVA A;  3T90 A;  2OZH A;  4B5P A;  1WK4 A;  5IV0 A;  4U9Y A;  1CM0 A;  4AB7 A;  3S6H A;  4U9Z A;  5J8F A;  4YFJ A;  4JWP A;  3EXN A;  4XPK A;  1MJB A;  2A4N A;  2WPW A;  1BO4 A;  4RI1 A;  1VKC A;  1ON0 A;  1B6B A;  2G3T A;  5EBV A;  4Y49 C;  4CAV A;  4CRY B;  1OZP A;  5JQ4 A;  1YK3 A;  2ZXV A;  3TCV A;  2FE7 A;  2FS5 A;  3GKR A;  4H6Z A;  4YGO A;  5IX3 A;  3E0K A;  2GAN A;  2B4D A;  2JEV A;  4B5O A;  4CAX A;  5F46 A;  5C82 A;  1Q2Y A;  3R9F A;  1YVK A;  4YRH A;  4LX9 A;  4OAE A;  3QB8 A;  4AVC A;  4PV6 A;  1U6M A;  4MJ8 A;  1MK4 A;  3FYN A;  2R8V A;  2Q7B A;  2OU2 A;  2PR8 A;  1KZF A;  1VHS A;  1Q2C A;  4MY0 A;  1KUY A;  3TOB A;  4QVT A;  2VI7 A;  1M4I A;  4NXY A;  2R7H A;  4H89 A;  2REF A;  4HNY B;  4I49 A;  2D4O A;  2ZW7 A;  4E0A A;  1Z4R A;  1R57 A;  1Q2D A;  4JLY A;  4FD4 A;  4M85 A;  1Y7R A;  4XPL A;  4K30 A;  4KVM E;  3TO6 A;  2B3U A;  3DSB A;  4JXR A;  2G3A A;  4ZBG A;  1S60 A;  4U5Y A;  1IYL A;  2HUZ A;  1S5K A;  1QST A;  3W6X A;  4IUS A;  4AG7 A;  5JPH A;  5CNP A;  4E8O A;  2JDD A;  2Q4V A;  2HQY A;  2PSW A;  3W91 A;  4QB9 A;  3MGD A;  1YX0 A;  2ZW5 A;  2CY2 A;  2FSR A;  1SQH A;  4R9M A;  2VXK A;  3ZJ0 A;  3QAH A;  4R87 A;  1CJW A;  2FXF A;  3FXT A;  2B5G B;  4QUS A;  2J8M A;  1RO5 A;  2IL4 A;  3EFA A;  4BMH A;  4KUA A;  3W6S A;  2VZZ A;  3I9S A;  5I0C A;  3TFY A;  1TIQ A;  1UFH A;  3SXO A;  2Q44 A;  3SXN A;  1N71 A;  2ZW4 A;  3TO9 A;  1YRE A;  2GE3 A;  3DR6 A;  4FD7 A;  1XE4 A;  3BJ8 A;  3TTH A;  2OB0 A;  4KOX A;  1I12 A;  1V0C A;  1Z9U A;  1GHE A;  4KLW A;  4KOV A;  4MI4 A;  1WWZ A;  3BJ7 A;  1QSO A;  2R98 A;  3F5B A;  1XF8 A;  3EO4 A;  1QSN A;  4J3G A;  4IF5 A;  3TE4 A;  3ZZI A;  1P0H A;  5F49 A;  3F0A A;  1Z4E A;  4KOT A;  5KTC A;  3D2P A;  3PGP A;  2PR1 A;  3D3S A;  2BSW A;  3I3G A;  4PK2 A;  3JUW A;  2CNT A;  3RYO A;  4KOU A;  2JDC A;  5E96 A;  3G8W A;  4KOY A;  2P6E A;  3DNS A;  3S6G A;  5ISV A;  2B3V A;  3K9U A;  3BLN A;  1XIX A;  4MBU A;  4X5K A;  2O28 A;  5KTD A;  2HV2 A;  1QSR A;  4F0Y A;  4II9 A;  3IGR A;  1S7N A;  3H4Q A;  1IB1 E;  5DWM A;  4UWI A;  1RXT A;  2PRB A;  1BOB A;  5J8C A;  4NEX A;  3PP9 A;  3PZJ A;  2PC1 A;  3FB3 A;  3D8P A;  2OZG A;  4FD6 A;  4KOS A;  2J8N A;  4LUA A;  4E2A A;  1YGH A;  1MJ9 A;  5IB0 A;  2FIW A;  5F48 A;  2VZY A;  2QEC A;  4QBJ A;  2I00 A;  4R3K A;  4B5P B;  3NE7 A;  3TO7 A;  3R1K A;  1FY7 A;  2FIA A;  4UA3 A;  2BL1 A;  2FT0 A;  3CXQ A;  3FIX A;  2I79 A;  3P2H A;  2D4P A;  3S6F A;  1S3Z A;  2EUI A;  2OZU A;  1KUV A;  2REE A;  2RC4 A;  2VQY A;  4KUB A;  1IID A;  2P0W A;  2QIR A;  3GYA A;  4H6U A;  3CXP A;  4UWJ A;  2FL4 A;  3VWE A;  1YR0 A;  4R57 A;  4MHD A;  2B4D B;  4RS2 A;  1MJA A;  3DR8 A;  3EY5 A;  2ATR A;  1QSM A;  2QML A;  2Z10 A;  3S6K A;  5HMN A;  3OWC A;  4DNC A;  5H86 A;  1S7K A;  1S7F A;  3UY5 A;  1IIC A;  2PDO A;  2G0B A;  5F47 A;  3WR7 A;  3N7Z A;  2VEZ A;  2H5M A;  1S7L A;  2WPX A;  4KVX A;  2R1I A;  2Y0M A;  3VWD A;  3R9E A;  2AE6 A;  4OAD A;  1NE9 A;  2Q4Y A;  5KTA A;  3LOD A;  2P6G A;  4HKF A;  4Y49 B;  2AJ6 A;  2ZW6 A;  2PQ8 A;  4PSX A;  2ARH A;  4JD6 A;  2B58 A;  4GS4 A;  3SHP A;  4KOR A;  2BUE A;  5C88 A;  4L89 A;  5FVJ A;  2B4B A;  4AVB A;  3EC4 A;  4HNX B;  2B5G A;  3D2M A;  3KKW A;  4UBR A;  4EVY A;  1L0C A;  3B8G A;  1P4N A;  3FBU A;  3F8K A;  3R9G A;  1M1D A;  3G3S A; 
#chains in the Genus database with same CATH topology
 4MCS A;  2P6F A;  3B3C A;  4PPZ A;  1RTQ A;  2O53 A;  4CAW A;  3JVN A;  1XMT A;  1YSJ A;  2NMT A;  1PU9 A;  1Z5R A;  1LRZ A;  2RFH A;  3GY9 A;  3TOA A;  4CRZ B;  4CS0 B;  3FF3 A;  2GFQ A;  3IWG A;  2OOT A;  4ONU A;  4B13 A;  4P4E A;  3R96 A;  4MCQ A;  4HNW B;  2X7B A;  3KI9 A;  3PFO A;  3IWE A;  4ORF A;  4WJB A;  3TC8 A;  1Z8X A;  4F0X A;  2DXQ A;  1XEB A;  5I4M A;  5HH1 A;  4PSW A;  4JXQ A;  4NCZ A;  4NF1 A;  3DDD A;  5HVG A;  4MFP A;  2YND A;  2J8R A;  4PK3 A;  5K8M A;  3S9L A;  1M44 A;  2JLM A;  4OC4 A;  4PXC A;  5K8N A;  1I1D A;  4MFJ A;  3VAR A;  1M4D A;  2AFW A;  2CNM A;  3H5Z A;  4TWE A;  3R95 A;  3V8I A;  7CPA A;  1CPX A;  1IYK A;  4NSQ A;  5LRJ A;  1NMT A;  3RNZ A;  1QMU A;  2BEI A;  2GLJ A;  4M3S A;  4A2Z A;  2CNS A;  4KSI A;  2KCW A;  1IOI A;  1YLE A;  2K5T A;  1I21 A;  3C26 A;  2C27 A;  3FRM A;  4B10 A;  1LOK A;  3CXS A;  2DEA A;  3P2F A;  4PXD A;  1IGB A;  1M4G A;  3CPX A;  2GIV A;  3B35 A;  1KUX A;  3D7F A;  2PCU A;  4MCR A;  3SJE A;  4KVO E;  3D67 A;  3GLJ A;  4UCP A;  3CPA A;  3WC6 A;  4QC6 A;  1HDU A;  2YNE A;  4XNH B;  4OLL A;  2F5I A;  4KLV A;  1PUA A;  3D7H A;  3TT2 A;  3LWU A;  2AFX A;  3NH8 A;  1Y9W A;  3KR4 A;  3L2N A;  4ZI6 A;  4AG9 A;  2PJ5 A;  2EO8 A;  3LD2 A;  4JJX A;  4L8A A;  4XNH C;  1Y7E A;  4NGR A;  2RB7 A;  3SJX A;  4A95 A;  1Y9K A;  4NGM A;  2FCK A;  1XRY A;  1ZLI A;  3QAY A;  3T9Y A;  5KTD A;  4PXE A;  5H84 A;  5LYL A;  2EVN A;  1TF8 A;  4CYP A;  2I3C A;  3WAB A;  1HDQ A;  4FD5 A;  5DWN A;  4R3L A;  3SI2 A;  3WT4 A;  3ISZ A;  4NGN A;  2Z0Z A;  1GYT A;  4KOW A;  4NJR A;  3B3V A;  1FNO A;  3B3T A;  3FNC A;  3IWW A;  2VBQ A;  4MY3 A;  4UF4 A;  1Z8W A;  2POK A;  2Z11 A;  4OC0 A;  4F6A A;  2Q0Y A;  2WSA A;  1B87 A;  1YVO A;  1CG2 A;  4XPD B;  4KZT A;  1PYT B;  1Z8L A;  2Q04 A;  2ZPA A;  4P45 A;  4Q7A A;  4RN7 A;  4M6I A;  5GCN A;  2OH1 A;  1J4J A;  1K4J A;  3H8F A;  3V38 A;  3NFZ A;  2XEJ A;  1NSL A;  4XPD C;  4M6H A;  4B14 A;  2ODF A;  3PB9 X;  4R76 A;  2EK8 A;  5EC4 A;  3RO0 A;  4ZX9 A;  4AVA A;  3T90 A;  4CYO A;  2BOA A;  2OZH A;  4B5P A;  4CGM A;  1WK4 A;  1ARM A;  5IV0 A;  4OC5 A;  3LMS A;  1CM0 A;  4M6G A;  4U9Y A;  4AB7 A;  3S6H A;  4UIA A;  4R7M A;  4MHZ A;  4U9Z A;  3G3S A;  5J8F A;  4YFJ A;  1NSA A;  4JWP A;  4GM5 A;  1CBX A;  4UIB A;  2PJ8 A;  3FMC A;  3EXN A;  1Z2L A;  4A37 A;  4ZX8 A;  4XPK A;  3IC1 A;  3KZW A;  3CDX A;  1MJB A;  2A4N A;  2WPW A;  3KAS A;  1BO4 A;  4RI1 A;  5LRK A;  1VKC A;  1ON0 A;  1B6B A;  2G3T A;  3DLJ A;  3GUX A;  5EBV A;  4A94 A;  4Y49 C;  2ZEM A;  2Z3M A;  4CAV A;  4CRY B;  2XEF A;  3KL9 A;  1OZP A;  3KHZ A;  4R6T A;  4EWT A;  5JQ4 A;  2PJC A;  1YK3 A;  4NFR A;  4MFK A;  2ZXV A;  3TCV A;  4YU9 A;  2FE7 A;  3H8G A;  3KHX A;  1YW6 A;  2FS5 A;  2CF4 A;  2DPT A;  4UEZ A;  3GIU A;  1CP6 A;  3GKR A;  4IK2 A;  4H6Z A;  4YGO A;  5K8P A;  2ZEE A;  5IX3 A;  4BD9 A;  3E0K A;  1Z8T A;  2GAN A;  2B4D A;  2JEV A;  4F8Z A;  4MHY A;  2Z3P A;  4OC2 A;  4B5O A;  4CAX A;  3A9L A;  5F46 A;  2PIY A;  1Q2Y A;  3R9F A;  1YVK A;  5C82 A;  2ZEF A;  3PRT A;  4YRH A;  4OME A;  4IAV A;  5JM6 A;  1XJO A;  4LX9 A;  2AFO A;  4OAE A;  3QB8 A;  4AVC A;  2C6G A;  3N5F A;  4PV6 A;  5G21 A;  1U6M A;  4MJ8 A;  4A39 A;  1MK4 A;  1VGY A;  3VAT A;  4FAI A;  3FYN A;  3JRU A;  2R8V A;  2PIZ A;  2OU2 A;  2PR8 A;  1F2P A;  3IFE A;  3PBE A;  1KZF A;  4H2K A;  2Q7B A;  5LRG A;  1VHS A;  1Q2C A;  2ABZ A;  4MY0 A;  1KUY A;  1AYE A;  3T8W A;  3TOB A;  4QVT A;  2VI7 A;  1M4I A;  4NXY A;  5LYD A;  5JGF A;  1HEE A;  2R7H A;  3NH4 A;  2ZOF A;  3NH5 A;  3RBU A;  2GU2 A;  4OC1 A;  2CTB A;  4H89 A;  2REF A;  4C2Y A;  2ZEH A;  2V8G A;  4OP4 A;  4F9U A;  4HNY B;  4I49 A;  4GXH A;  2D4O A;  1R43 A;  2ZW7 A;  4O23 A;  2V8V A;  4E0A A;  4CGP A;  1Z4R A;  1R57 A;  1Q2D A;  2C6C A;  4JLY A;  4FD4 A;  4M85 A;  1Y7R A;  2PVV A;  3CZX A;  4XPL A;  4K30 A;  4KVM E;  3TO6 A;  3BXM A;  4G1P A;  2B3U A;  1LAM A;  3DSB A;  2BCO A;  2NSM A;  1LAN A;  4YWY A;  4UFW A;  1BPM A;  2V77 A;  4JXR A;  2G3A A;  4ZBG A;  1S60 A;  4U5Y A;  1IYL A;  4NGT A;  2HUZ A;  1S5K A;  4P4J A;  3S9N A;  1QST A;  3W6X A;  4IUS A;  4AG7 A;  5JPH A;  1ZO0 A;  5CNP A;  4E8O A;  2JDD A;  2Q4V A;  4FWU A;  4P6Y A;  2HQY A;  3WC5 A;  2DPS A;  2PSW A;  2VL1 A;  3W91 A;  1R3N A;  3DGV A;  3K9T A;  4QB9 A;  4C68 A;  2ZEO A;  2Q43 A;  3SJG A;  1LCP A;  3MGD A;  2V8H A;  1YX0 A;  2ZW5 A;  1X10 A;  2CY2 A;  2FSR A;  3V7Z A;  1SQH A;  4UFX A;  4UEE A;  4W9Y A;  4UCN A;  4R9M A;  2IMO A;  2VXK A;  5DS0 A;  1ZLH A;  2QYV A;  3PEI A;  3ZJ0 A;  3QAH A;  4R87 A;  1CJW A;  2FXF A;  3D7G A;  2B5G B;  3FXT A;  2J8M A;  4QUS A;  3D4U A;  3PB8 X;  4ZY0 A;  1RO5 A;  2IL4 A;  3EFA A;  5G22 A;  1DTD A;  4BMH A;  4MFZ A;  3RAM A;  4KUA A;  3W6S A;  4CYN A;  2VZZ A;  3I9S A;  3HUV A;  5I0C A;  3TFY A;  1QQ9 A;  1TIQ A;  4A33 A;  4X2T A;  3JTK A;  3K2K A;  1UFH A;  3SXO A;  2Q44 A;  4PXB A;  3SXN A;  2PRQ A;  1EE3 P;  1N71 A;  4OID A;  2ZW4 A;  3TO9 A;  2AFS A;  5LYF A;  1YRE A;  2GE3 A;  2WZN A;  3DR6 A;  3IO1 A;  1BPN A;  3CT9 A;  4FD7 A;  1XE4 A;  2ANP A;  2CXA A;  2OR4 A;  4NJQ A;  4TNU A;  1CP7 A;  5D29 A;  4MFL A;  4CGL A;  2O4H A;  3BJ8 A;  3TTH A;  2OB0 A;  4A38 A;  4KOX A;  1I12 A;  1V0C A;  1Z9U A;  3BI1 A;  1GHE A;  3RZA A;  2JBJ A;  2AFU A;  4CAF A;  4KSA A;  4MXU A;  1IU8 A;  3NE8 A;  1ELL P;  1JQG A;  5AG7 A;  5A27 A;  2ZEL A;  4KLW A;  2PJ3 A;  4KOV A;  4MI4 A;  4C7H A;  1WWZ A;  4AXV A;  4FBE A;  2QJ8 A;  3BJ7 A;  1QSO A;  2R98 A;  3F5B A;  4X8I A;  1XF8 A;  4ZYQ A;  3EO4 A;  2F8H A;  1QSN A;  2BO9 A;  4P44 A;  4Q36 A;  4J3G A;  5AG4 A;  3GB0 A;  4OIW A;  2PJA A;  4IF5 A;  3TE4 A;  3ZZI A;  1P0H A;  5F49 A;  3F0A A;  1Z4E A;  3SI1 A;  2DF5 A;  4KOT A;  3D7D A;  4WWV A;  5EMI A;  3D2P A;  5KTC A;  3PGP A;  4K3N A;  2PR1 A;  2C6P A;  4CYQ A;  1LAP A;  2C1C A;  1TKJ A;  1IOF A;  2BSW A;  2Z3O A;  3D3S A;  1FT7 A;  3I3G A;  3IJ3 A;  2ZOG A;  4PK2 A;  3JUW A;  2CNT A;  4R8F A;  3RYO A;  4NGP A;  1JWQ A;  4Q38 A;  3SJF A;  5A28 A;  4KOU A;  5JH9 A;  1H8L A;  4LQ6 A;  5HVF A;  2XEI A;  1M4L A;  2IQ6 A;  2JDC A;  3B7I A;  3G8W A;  5E96 A;  4CGO A;  4DUK A;  4KOY A;  5F09 A;  2P6E A;  2FVG A;  3DNS A;  2ZEP A;  4P4F A;  3S6G A;  3FVL A;  4P4D A;  4MRI A;  2V8D A;  5ISV A;  4BBH A;  2B3V A;  5D8N A;  3K9U A;  4CGN A;  4B11 A;  3BLN A;  5K8O A;  1XIX A;  2Z3K A;  4MBU A;  3KR5 A;  2O28 A;  4UCM A;  2F7V A;  2HV2 A;  1QSR A;  4X5K A;  4C7I A;  3KGQ A;  4EFD A;  4NGQ A;  4F0Y A;  4HPS A;  4II9 A;  1CPS A;  1TF9 A;  4A32 A;  5G20 A;  3IGR A;  2EK9 A;  2PJ1 A;  1ELM P;  5HVH A;  1S7N A;  4RUH A;  3H4Q A;  2PJ2 A;  1IB1 E;  3B2Y A;  2Q7S A;  5DWM A;  3WC7 A;  4UWI A;  3FEE A;  1RXT A;  2PRB A;  4CPA A;  2AFM A;  4P10 A;  1BOB A;  2PJ4 A;  3IU2 A;  1BLL E;  5J8C A;  4NEX A;  2PJ0 A;  3PP9 A;  3PZJ A;  2PJ7 A;  2PC1 A;  3FB3 A;  3D8P A;  2OZG A;  4FD6 A;  4KOS A;  1Y0Y A;  1TKH A;  2J8N A;  2Z3N A;  1PCA A;  4LUA A;  1Y0R A;  3PB7 X;  2QVP A;  4X3R A;  4B6Z A;  4P4B A;  4E2A A;  1YGH A;  1MJ9 A;  2WYR A;  3KQX A;  1CX8 A;  5IB0 A;  2YGW A;  2EBJ A;  3IU1 A;  2FIW A;  4PQA A;  5F48 A;  2VZY A;  3FEC A;  1Q7L A;  2QEC A;  4LQG A;  1ZG9 A;  4QBJ A;  4KS9 A;  2I00 A;  4R3K A;  4B5P B;  4ZY1 A;  2Z3L A;  4DJL A;  3NE7 A;  3SI0 A;  2PJB A;  2IJZ A;  3TO7 A;  3R1K A;  2NYQ A;  1FY7 A;  2GRE A;  2FIA A;  2ZEG A;  2Q4Z A;  4UA3 A;  4NGS A;  2BL1 A;  2JBK A;  1AMP A;  2FT0 A;  3CXQ A;  3FIX A;  2I79 A;  3P2H A;  3D66 A;  2D4P A;  2Q51 A;  1TXR A;  3I1U A;  3S6F A;  1S3Z A;  1XOV A;  2EUI A;  2OZU A;  3BHX A;  3PBB A;  1KUV A;  5AG6 A;  5THW A;  4A30 A;  1AUG A;  2REE A;  3HLP A;  2RC4 A;  4OC3 A;  2ZEN A;  2VQY A;  2ZED A;  4KUB A;  4OKO A;  2CIJ A;  2CTC A;  3IIB A;  1IID A;  2P0W A;  2QIR A;  5CBM A;  3GYA A;  1VIX A;  4C2Z A;  4Z65 A;  4CAE A;  2JEW A;  4H6U A;  5IB9 A;  3FX6 A;  3B3W A;  4FUU A;  3VH9 A;  3CXP A;  4UWJ A;  2FL4 A;  3MN8 A;  3VWE A;  4ZGY B;  3KQZ A;  1YR0 A;  4R57 A;  2WUU A;  4MHD A;  2B4D B;  2AFZ A;  4RS2 A;  1MJA A;  3DR8 A;  3EY5 A;  2ATR A;  2XEG A;  1QSM A;  4ONW A;  1ARL A;  2QML A;  2Z10 A;  3S6K A;  2PE3 A;  5G1Z A;  2YNC C;  5HMN A;  3OWC A;  1XFO A;  2G9D A;  4DNC A;  5H86 A;  4EME A;  1S7K A;  4B12 A;  4MHP A;  1S7F A;  2EWB A;  1IIC A;  3UY5 A;  2PDO A;  1YW4 A;  3PFE A;  1X12 A;  1ZG7 A;  2G0B A;  1VHO A;  3NA6 A;  5F47 A;  3WR7 A;  1YQE A;  4MMO A;  3N7Z A;  2VEZ A;  2H5M A;  1S7L A;  1XBU A;  3BI0 A;  1IY7 A;  3PB4 X;  5CPA A;  1YLO A;  3S9M A;  2WPX A;  4KVX A;  2R1I A;  3IEH A;  4IHM A;  1VHE A;  2Y0M A;  1LFW A;  3VWD A;  3PB6 X;  3R9E A;  2AE6 A;  1KWM A;  1ZG8 A;  4KSF A;  4ZY2 A;  3TX8 A;  3MRU A;  4BIN A;  1BAV A;  4OAD A;  1NE9 A;  4DYO A;  1F57 A;  1A2Z A;  3H8E A;  2Q4Y A;  4MHN A;  5HXD A;  5KTA A;  3LOD A;  3B3S A;  1YME A;  1XMB A;  2P6G A;  5ELY A;  3D68 A;  4A31 A;  1UWY A;  4MFQ A;  4HKF A;  3ISX A;  4MCP A;  4UFV A;  4UEF A;  3FED A;  4Y49 B;  2AJ6 A;  2GLF A;  1DE4 C;  2ZW6 A;  2PQ8 A;  4PSX A;  2ARH A;  4JD6 A;  6CPA A;  2B58 A;  4GS4 A;  1OBR A;  5AG5 A;  3SHP A;  3FJU A;  4KOR A;  2BUE A;  5C88 A;  4L89 A;  5J1Q A;  5FVJ A;  2B4B A;  5AGE A;  4AVB A;  3EC4 A;  4HNX B;  4C2X A;  2B5G A;  3FH4 A;  4JZ0 A;  4P4I A;  2PJ6 A;  1F2O A;  3D2M A;  2HC9 A;  3KKW A;  4UBR A;  4EVY A;  1L0C A;  3B8G A;  1P4N A;  3FBU A;  3LAC A;  5BWA B;  3F8K A;  3QNV A;  5LYI A;  2YNC A;  4JYW A;  2HB6 A;  1TKF A;  3R9G A;  1M1D A;  2J9A A;  4F9V A;  8CPA A;  2PVW A;  2PJ9 A; 
#chains in the Genus database with same CATH homology
 2P6F A;  4CAW A;  3JVN A;  1XMT A;  2NMT A;  1PU9 A;  3GY9 A;  1LRZ A;  3TOA A;  4CRZ B;  4CS0 B;  3IWG A;  4ONU A;  4B13 A;  3R96 A;  4HNW B;  2X7B A;  4ORF A;  3IWE A;  4F0X A;  2DXQ A;  1XEB A;  5HH1 A;  4PSW A;  4JXQ A;  4NCZ A;  4NF1 A;  3DDD A;  4MFP A;  2YND A;  2J8R A;  4PK3 A;  1M44 A;  2JLM A;  1I1D A;  4MFJ A;  1M4D A;  2CNM A;  3H5Z A;  3R95 A;  3V8I A;  4NSQ A;  1IYK A;  1NMT A;  2BEI A;  4A2Z A;  4M3S A;  2CNS A;  2KCW A;  1YLE A;  1I21 A;  2K5T A;  3C26 A;  2C27 A;  3FRM A;  4B10 A;  3CXS A;  3P2F A;  1M4G A;  2GIV A;  1KUX A;  4KVO E;  4UCP A;  4QC6 A;  2YNE A;  4XNH B;  4OLL A;  2F5I A;  4KLV A;  1PUA A;  3TT2 A;  1Y9W A;  4AG9 A;  3LD2 A;  4JJX A;  4L8A A;  4XNH C;  4A95 A;  1Y9K A;  2FCK A;  3T9Y A;  5H84 A;  2EVN A;  4CYP A;  4FD5 A;  5DWN A;  4R3L A;  2Z0Z A;  4KOW A;  3FNC A;  4MY3 A;  2VBQ A;  2Z11 A;  4F6A A;  2Q0Y A;  2WSA A;  1B87 A;  1YVO A;  4XPD B;  4KZT A;  2Q04 A;  2ZPA A;  5GCN A;  2OH1 A;  1J4J A;  1K4J A;  1NSL A;  4XPD C;  4B14 A;  5EC4 A;  4AVA A;  3T90 A;  4CYO A;  2OZH A;  4CGM A;  4B5P A;  1WK4 A;  5IV0 A;  4U9Y A;  1CM0 A;  4AB7 A;  3S6H A;  4U9Z A;  5J8F A;  4YFJ A;  4JWP A;  3EXN A;  4XPK A;  1MJB A;  2A4N A;  2WPW A;  1BO4 A;  4RI1 A;  1VKC A;  1ON0 A;  1B6B A;  2G3T A;  5EBV A;  4Y49 C;  2Z3M A;  4CAV A;  4CRY B;  1OZP A;  5JQ4 A;  1YK3 A;  4MFK A;  2ZXV A;  3TCV A;  2FE7 A;  2FS5 A;  2DPT A;  3GKR A;  4H6Z A;  4YGO A;  5IX3 A;  3E0K A;  2GAN A;  2B4D A;  2JEV A;  2Z3P A;  4B5O A;  4CAX A;  3A9L A;  5F46 A;  5C82 A;  1Q2Y A;  3R9F A;  1YVK A;  4YRH A;  4LX9 A;  4OAE A;  3QB8 A;  4AVC A;  4PV6 A;  5G21 A;  1U6M A;  4MJ8 A;  1MK4 A;  3FYN A;  2R8V A;  2Q7B A;  2OU2 A;  2PR8 A;  1KZF A;  1VHS A;  1Q2C A;  4MY0 A;  1KUY A;  3TOB A;  4QVT A;  2VI7 A;  1M4I A;  4NXY A;  2R7H A;  4H89 A;  2REF A;  4C2Y A;  4HNY B;  4I49 A;  2D4O A;  2ZW7 A;  4E0A A;  4CGP A;  1Z4R A;  1R57 A;  1Q2D A;  4JLY A;  4FD4 A;  4M85 A;  1Y7R A;  4XPL A;  4K30 A;  4KVM E;  3TO6 A;  2B3U A;  3DSB A;  4UFW A;  4JXR A;  2G3A A;  4ZBG A;  1S60 A;  4U5Y A;  1IYL A;  2HUZ A;  1S5K A;  1QST A;  3W6X A;  4IUS A;  4AG7 A;  5JPH A;  1ZO0 A;  5CNP A;  4E8O A;  2JDD A;  2Q4V A;  2HQY A;  2DPS A;  2PSW A;  3W91 A;  4C68 A;  4QB9 A;  3MGD A;  1YX0 A;  2ZW5 A;  2CY2 A;  2FSR A;  1SQH A;  4UFX A;  4UCN A;  4R9M A;  2VXK A;  3ZJ0 A;  3QAH A;  4R87 A;  1CJW A;  2FXF A;  3FXT A;  2B5G B;  4QUS A;  2J8M A;  1RO5 A;  2IL4 A;  3EFA A;  5G22 A;  4BMH A;  4MFZ A;  4CYN A;  4KUA A;  3W6S A;  2VZZ A;  3I9S A;  5I0C A;  3TFY A;  1TIQ A;  4A33 A;  3JTK A;  1UFH A;  3SXO A;  2Q44 A;  3SXN A;  1N71 A;  2ZW4 A;  3TO9 A;  1YRE A;  2GE3 A;  3DR6 A;  4FD7 A;  1XE4 A;  2CXA A;  4MFL A;  4CGL A;  3BJ8 A;  3TTH A;  2OB0 A;  4KOX A;  1I12 A;  1V0C A;  1Z9U A;  1GHE A;  4CAF A;  4KSA A;  5AG7 A;  5A27 A;  4KLW A;  4KOV A;  4MI4 A;  4C7H A;  1WWZ A;  3BJ7 A;  1QSO A;  2R98 A;  3F5B A;  1XF8 A;  3EO4 A;  1QSN A;  4Q36 A;  4J3G A;  5AG4 A;  4IF5 A;  3TE4 A;  3ZZI A;  1P0H A;  5F49 A;  3F0A A;  1Z4E A;  4KOT A;  5KTC A;  3D2P A;  3PGP A;  2PR1 A;  4CYQ A;  2Z3O A;  3D3S A;  2BSW A;  3I3G A;  4PK2 A;  3JUW A;  2CNT A;  3RYO A;  4Q38 A;  5A28 A;  4KOU A;  2JDC A;  5E96 A;  3G8W A;  4CGO A;  4KOY A;  2P6E A;  3DNS A;  3S6G A;  5ISV A;  4BBH A;  2B3V A;  3K9U A;  4CGN A;  4B11 A;  3BLN A;  1XIX A;  2Z3K A;  4MBU A;  4X5K A;  2O28 A;  4UCM A;  5KTD A;  2HV2 A;  1QSR A;  4C7I A;  4F0Y A;  4II9 A;  4A32 A;  5G20 A;  3IGR A;  1S7N A;  3H4Q A;  1IB1 E;  5DWM A;  4UWI A;  1RXT A;  2PRB A;  1BOB A;  3IU2 A;  5J8C A;  4NEX A;  3PP9 A;  3PZJ A;  2PC1 A;  3FB3 A;  3D8P A;  2OZG A;  4FD6 A;  4KOS A;  2J8N A;  2Z3N A;  4LUA A;  4E2A A;  1YGH A;  1MJ9 A;  5IB0 A;  2YGW A;  3IU1 A;  2FIW A;  5F48 A;  2VZY A;  2QEC A;  4QBJ A;  4KS9 A;  2I00 A;  4R3K A;  4B5P B;  2Z3L A;  3NE7 A;  3TO7 A;  3R1K A;  1FY7 A;  2FIA A;  4UA3 A;  2BL1 A;  2FT0 A;  3CXQ A;  3FIX A;  2I79 A;  3P2H A;  2D4P A;  3S6F A;  1S3Z A;  2EUI A;  2OZU A;  1KUV A;  5AG6 A;  4A30 A;  2REE A;  2RC4 A;  2VQY A;  4KUB A;  1IID A;  2P0W A;  2QIR A;  3GYA A;  4C2Z A;  4CAE A;  4H6U A;  3CXP A;  4UWJ A;  2FL4 A;  3VWE A;  4ZGY B;  1YR0 A;  4R57 A;  2WUU A;  4MHD A;  2B4D B;  4RS2 A;  1MJA A;  3DR8 A;  3EY5 A;  2ATR A;  1QSM A;  2QML A;  2Z10 A;  3S6K A;  5G1Z A;  2YNC C;  5HMN A;  3OWC A;  4DNC A;  5H86 A;  1S7K A;  4B12 A;  1S7F A;  3UY5 A;  1IIC A;  2PDO A;  2G0B A;  5F47 A;  3WR7 A;  3N7Z A;  2VEZ A;  2H5M A;  1S7L A;  2WPX A;  4KVX A;  2R1I A;  2Y0M A;  3VWD A;  3R9E A;  2AE6 A;  4KSF A;  4OAD A;  1NE9 A;  2Q4Y A;  5KTA A;  3LOD A;  2P6G A;  4A31 A;  4MFQ A;  4HKF A;  4UFV A;  4Y49 B;  2AJ6 A;  2ZW6 A;  2PQ8 A;  4PSX A;  2ARH A;  4JD6 A;  2B58 A;  4GS4 A;  3SHP A;  5AG5 A;  4KOR A;  2BUE A;  5C88 A;  4L89 A;  5FVJ A;  2B4B A;  5AGE A;  4AVB A;  3EC4 A;  4HNX B;  4C2X A;  2B5G A;  3D2M A;  3KKW A;  4UBR A;  4EVY A;  1L0C A;  3B8G A;  1P4N A;  3FBU A;  5BWA B;  3F8K A;  2YNC A;  3R9G A;  1M1D A;  3G3S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...