3R95A

Crystal structure of microcin c7 self immunity acetyltransferase mcce in complex with acetyl-coa
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
180
structure length
180
Chain Sequence
DVSLTPSGIKVNDEITLLYPALKYAEELYLLINQNKINFIKSMAWPAFVNNISDSVSFIEQSMIDNQNEKALILFIKYKTKIAGVVSFNIIDHANKTAYIGYWLGANFQGKGIVTNAINKLIQEYGDSGVIKRFVIKCIVDNKKSNATALRCGFTLEGVLQKAEILNGVSYDQNIYSKVI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords MccE protein
publication title Structural Basis for Microcin C7 Inactivation by the MccE Acetyltransferase.
pubmed doi rcsb
source organism Escherichia coli
total genus 56
structure length 180
sequence length 180
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-03-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 3r95A00
2AE6A 2B4BA 1BO4A 4XPLA 2FIAA 2P6FA 3C26A 1S7FA 5ISVA 1GHEA 3G3SA 2QIRA 1KZFA 2JDDA 4R87A 1S3ZA 1PU9A 1YR0A 2ZPAA 5IX3A 4XNHB 2HV2A 5J8FA 3SXNA 2FSRA 4R57A 1L0CA 3TO9A 3PZJA 1SQHA 1Z4EA 2PR8A 3EXNA 3P2HA 5KTDA 3FNCA 2D4PA 3LD2A 5C88A 2OZUA 2VEZA 5C82A 1NE9A 4CRZB 4LUAA 4XPKA 1KUVA 3FXTA 2I79A 2ZW4A 3F0AA 2J8RA 3TE4A 2Y0MA 3D8PA 3D2MA 3FBUA 3PGPA 4I49A 4UWIA 1CJWA 4RS2A 4ZBGA 3TTHA 4QB9A 2VZZA 1S7NA 3BLNA 5KTCA 3D2PA 3TFYA 4AVAA 2J8MA 4FD4A 2A4NA 2FE7A 2J8NA 5H86A 1XE4A 3E0KA 2VXKA 4CRYB 3RYOA 4BMHA 2HUZA 3S6GA 5KTAA 4KUAA 2CNMA 3MGDA 2I00A 2PRBA 2VI7A 5F47A 5IB0A 5EBVA 3P2FA 4MJ8A 2B3VA 2REFA 1IICA 2R8VA 1Q2DA 3CXPA 1MJBA 3FRMA 4AG9A 3DR6A 2Q4YA 1KUXA 3NE7A 4KZTA 1FY7A 1PUAA 3DSBA 2OZGA 4NCZA 2BSWA 2GANA 1QSTA 1BOBA 2P0WA 4NF1A 4IUSA 2CNTA 2CNSA 3EFAA 1RXTA 3TO7A 3TCVA 2Q44A 2B4DB 4HNYB 3CXSA 4EVYA 4KLWA 4UBRA 4PV6A 4B5OA 4U5YA 1NSLA 3WR7A 1S5KA 2AJ6A 4OAEA 4KOUA 3TOBA 1Q2CA 5HH1A 4YRHA 2ARHA 1N71A 4H89A 1I21A 4HNXB 2Z10A 4NEXA 2JLMA 4DNCA 2Q4VA 1Q2YA 2FXFA 1Y7RA 2FL4A 3PP9A 4AB7A 2BEIA 1TIQA 3LODA 2B58A 4H6ZA 1IIDA 4HKFA 5DWNA 2KCWA 3EY5A 3OWCA 5CNPA 4X5KA 5F49A 4CAXA 4MHDA 1K4JA 4YFJA 4KOVA 4J3GA 4KORA 4KUBA 5F46A 1WWZA 3SXOA 1QSNA 2R1IA 1YVKA 1YREA 5JPHA 4QVTA 3W91A 4F6AA 4II9A 1KUYA 2F5IA 4F0YA 4B5PA 1M44A 4RI1A 4JD6A 3EO4A 4NSQA 4QBJA 1UFHA 4M85A 2RC4A 4KVOE 2BL1A 5EC4A 4KOTA 4Y49B 1QSRA 4KOWA 2QECA 1VKCA 2JDCA 1P4NA 2JEVA 1B87A 3T9YA 3R95A 3H4QA 4XNHC 3B8GA 3IWGA 4QC6A 1QSMA 4KVXA 4XPDB 2WPWA 3GYAA 1XEBA 4NXYA 2DXQA 4R3LA 2K5TA 4K30A 4PSXA 4JLYA 2B5GA 1YK3A 2FS5A 4CAVA 3EC4A 1YVOA 1Y9WA 4YGOA 2ZW5A 2ZW7A 4JXRA 3S6KA 4U9YA 1XF8A 3N7ZA 2GE3A 4L89A 1J4JA 3QAHA 4Y49C 1IYKA 4JJXA 3DNSA 3GY9A 4UWJA 3VWEA 4L8AA 3DR8A 1VHSA 4H6UA 2P6EA 2ATRA 2IL4A 4M3SA 3FIXA 4PK3A 1M4IA 1WK4A 4KLVA 2FIWA 4CAWA 2CY2A 5FVJA 4IF5A 4MY3A 1XMTA 4AG7A 2WPXA 4MI4A 4JXQA 5JQ4A 2G3AA 3QB8A 1XIXA 2Z11A 1YX0A 2Q04A 4U9ZA 2FT0A 2PQ8A 3I3GA 5HMNA 4E0AA 1M1DA 4AVCA 2OB0A 4CS0B 4KOYA 3ZJ0A 1IYLA 3TO6A 2PC1A 2VZYA 3T90A 3TOAA 2GIVA 1Y9KA 2EUIA 2VBQA 3FB3A 3DDDA 3D3SA 2OH1A 3TT2A 4FD7A 3R9FA 4PK2A 2O28A 4ONUA 4B5PB 4KVME 2P6GA 1LRZA 2G0BA 2R98A 2Z0ZA 2PSWA 4E2AA 4ORFA 5GCNA 3ZZIA 3BJ7A 4HNWB 4R3KA 4PSWA 2EVNA 1Z4RA 2X7BA 4JWPA 2HQYA 3F8KA 2Q7BA 3K9UA 2PR1A 1S60A 3JVNA 4MBUA 3R9EA 4AVBA 5DWMA 4FD6A 3I9SA 2B5GB 3GKRA 2ZXVA 5I0CA 2OU2A 1IB1E 4E8OA 5J8CA 4LX9A 3IGRA 3R96A 4QUSA 3R9GA 3W6SA 1I1DA 2D4OA 1M4DA 2REEA 3F5BA 1S7LA 3KKWA 5IV0A 1YLEA 3JUWA 1U6MA 3VWDA 1OZPA 1B6BA 2NMTA 1MJAA 1CM0A 2PDOA 1V0CA 2G3TA 3G8WA 1MK4A 1ON0A 2Q0YA 4KOSA 1I12A 4FD5A 4XPDC 4R9MA 4MY0A 2B3UA 2H5MA 2VQYA 4KOXA 1RO5A 1R57A 2OZHA 2ZW6A 3R1KA 3V8IA 3W6XA 3BJ8A 4OADA 1P0HA 4GS4A 1YGHA 5H84A 5E96A 3S6HA 2FCKA 4OLLA 1QSOA 3UY5A 5F48A 1M4GA 2B4DA 3FYNA 2QMLA 3S6FA 1NMTA 1MJ9A 3SHPA 1Z9UA 2R7HA 3CXQA 4UA3A 2BUEA 1S7KA 2C27A
chains in the Genus database with same CATH superfamily
2YNCC 4BBHA 4NGRA 3IO1A 2AE6A 4DUKA 2B4BA 1F2PA 2J9AA 2Z3NA 1LFWA 1BO4A 3CPAA 2PJ0A 4NGTA 4XPLA 1QQ9A 2FIAA 2P6FA 2ZEOA 4X8IA 3PB8X 2XEIA 3C26A 1S7FA 1ZG7A 3SJXA 3KQXA 5ISVA 3K2KA 1GHEA 4WWVA 4B6ZA 3IWWA 3G3SA 3ISXA 2QIRA 3KL9A 1KZFA 1IGBA 2BOAA 2JDDA 4F9VA 4C7IA 3IC1A 4R87A 3VARA 5JH9A 4A2ZA 1S3ZA 4P6YA 2Z3KA 4CAEA 1PU9A 1Z8XA 3GUXA 1CBXA 1X10A 1YR0A 2ZPAA 5IX3A 2O53A 4UEZA 4XNHB 2HV2A 1Z8WA 4C2XA 3NH4A 5J8FA 4A30A 2PJ4A 2PJ9A 3SXNA 2FSRA 4R57A 4RN7A 3QNVA 1L0CA 3B2YA 3IIBA 2Q4ZA 3PB9X 3PZJA 5ELYA 3TC8A 3TO9A 2F7VA 1SQHA 1Z4EA 2PR8A 3EXNA 3P2HA 5KTDA 3FEEA 3FNCA 3KR4A 5BWAB 2D4PA 3LD2A 1R3NA 3DGVA 2EWBA 3S9LA 1ARMA 2AFXA 2OZUA 4EMEA 5C88A 2VEZA 5C82A 4MHPA 2PJ2A 1NE9A 3HLPA 4OKOA 4LUAA 2XEJA 4R6TA 4B12A 4A32A 4CRZB 1VHOA 4XPKA 3VATA 3SI1A 1KUVA 2PJBA 1ZLIA 2ZEMA 3FXTA 2I79A 2ZW4A 4OC4A 7CPAA 3D7DA 3F0AA 2J8RA 3TE4A 1TXRA 2Y0MA 2ABZA 4FBEA 3D8PA 3D2MA 3FBUA 3PGPA 4I49A 3S6HA 3GB0A 4UWIA 1CJWA 1Q7LA 4RS2A 4ZBGA 4FAIA 3KI9A 4ZI6A 2AFMA 3TTHA 2PJ8A 3B35A 4QB9A 1HEEA 2VZZA 1S7NA 4A95A 3BLNA 2PRQA 3KZWA 2HC9A 5KTCA 3D2PA 4X3RA 4M6GA 1GYTA 4AVAA 2J8MA 4CGOA 3TFYA 4FD4A 2A4NA 2FE7A 4PQAA 2ZEDA 2J8NA 4EFDA 5H86A 1XE4A 1YW4A 5LYLA 2HB6A 3E0KA 2WZNA 4CYPA 5HVHA 2VXKA 4CRYB 1XBUA 3RYOA 1TF9A 2OOTA 4BMHA 2HUZA 4MFJA 3S6GA 5KTAA 4KUAA 2IJZA 2CNMA 3MGDA 2I00A 1ZG8A 4JZ0A 2PRBA 2VI7A 4MCQA 5F47A 5IB0A 1CP6A 2POKA 4R76A 5EBVA 1LCPA 2XEFA 1YLOA 2C6PA 3P2FA 4MJ8A 3NFZA 4IAVA 4OC3A 2B3VA 3PB4X 5G22A 2IQ6A 2REFA 3T8WA 1IICA 2R8VA 1Q2DA 5DS0A 1VGYA 3CXPA 1MJBA 3RNZA 3FRMA 2WSAA 3NH8A 4MHZA 1A2ZA 3WT4A 3DR6A 4OIDA 4AG9A 2EBJA 2Q4YA 1KUXA 2ZOGA 3BI1A 1NSAA 3NE7A 4KZTA 1F2OA 3IJ3A 4NGQA 4OMEA 3SI0A 1FY7A 5AG4A 5K8NA 1PUAA 3DSBA 1CP7A 2OZGA 3FMCA 3I1UA 2BSWA 2GANA 4NCZA 1QSTA 1BOBA 1Z2LA 3IU1A 3LACA 2P0WA 4NFRA 2VL1A 4NF1A 4IUSA 1JQGA 2CNTA 2CNSA 2YNCA 4MFPA 3LWUA 4MCPA 3EFAA 4A31A 3B3TA 1RXTA 4NGNA 4OP4A 3TO7A 5A28A 4F9UA 1TKJA 3TCVA 1VHEA 2Q44A 4UFVA 2B4DB 2ZENA 4HNYB 1VIXA 2V8DA 3CXSA 1CX8A 4MFZA 4EVYA 4KLWA 4UBRA 4PV6A 4TWEA 4ZX8A 2BCOA 4B5OA 4U5YA 1NSLA 3WR7A 1S5KA 2AJ6A 4OAEA 4KOUA 3KASA 4ZY2A 3TOBA 1YSJA 1Q2CA 2GU2A 2JBJA 5HH1A 4YRHA 2ARHA 5AGEA 1N71A 4H89A 1FNOA 1I21A 4AXVA 1FT7A 3FECA 1ELLP 3FH4A 4LQGA 4HNXB 2Z10A 4NEXA 4MHNA 2JLMA 4K3NA 4FWUA 4DNCA 2Q4VA 1Q2YA 4MFKA 4O23A 5EMIA 4C2ZA 4P10A 2G9DA 2FXFA 1Z8TA 3WC7A 2WUUA 1Y7RA 5K8PA 2DEAA 1OBRA 2FL4A 3PP9A 4AB7A 3BHXA 4RUHA 3CPXA 3KQZA 2JBKA 2BEIA 1TIQA 3LODA 2PJ5A 2B58A 4H6ZA 1IIDA 4HKFA 5DWNA 2KCWA 2AFWA 1XOVA 3FJUA 6CPAA 3EY5A 3FX6A 3OWCA 3PBEA 5CNPA 4PXDA 4X5KA 1H8LA 5F49A 4CAXA 2CTCA 4YU9A 4R8FA 3MN8A 4M6IA 4MHDA 4UEEA 1K4JA 4UIAA 4YFJA 4B10A 4KOVA 4J3GA 3KHXA 4KORA 2PJ7A 2AFUA 2RB7A 1WWZA 4KUBA 5HVFA 5LRJA 5F46A 3SXOA 1QSNA 3NH5A 4KSAA 3WC5A 2C6CA 2R1IA 5THWA 5HVGA 1YVKA 2GFQA 3PB6X 1CPXA 1YREA 3D66A 5JPHA 4QVTA 5AG7A 3W91A 4F6AA 4II9A 1KUYA 2F5IA 2Z3LA 4F0YA 3D67A 4B5PA 1M44A 4RI1A 4JD6A 1R43A 5CBMA 4ZX9A 3EO4A 3L2NA 4NSQA 4QBJA 1UFHA 4M85A 2PJ6A 2RC4A 4KVOE 2BL1A 1IOFA 4OC0A 5EC4A 4KOTA 4Y49B 2EK9A 1QSRA 4MCRA 3WC6A 4KOWA 2QECA 3IU2A 1VKCA 2JDCA 5D29A 1P4NA 2JEVA 5G21A 1B87A 1BAVA 3GIUA 1XRYA 3N5FA 3PBBA 4CGNA 2ZEEA 4H2KA 3SJFA 3RZAA 3T9YA 5LYIA 3R95A 3H4QA 4XNHC 4A39A 3B8GA 3H8GA 1XFOA 4MXUA 3IWGA 4QC6A 1BLLE 1QMUA 2CTBA 1QSMA 2Q51A 4KVXA 1M4LA 4XPDB 2WPWA 4DYOA 3GYAA 1XEBA 2ZEPA 4NGPA 4NXYA 5AG6A 3GLJA 1IOIA 2DXQA 4R3LA 4F0XA 2K5TA 4CAFA 4K30A 4KSIA 2PIYA 5IB9A 1ZLHA 4PSXA 1X12A 4JLYA 2B5GA 3D7FA 4Q38A 1YK3A 4A33A 4P4JA 3TX8A 2FS5A 4CAVA 3EC4A 1YVOA 1Y9WA 3HUVA 4YGOA 2ZW5A 2ZW7A 4JXRA 3S6KA 4EWTA 4M6HA 4BINA 1F57A 1XF8A 2Z3PA 1Z5RA 3N7ZA 2GE3A 4U9YA 2PVWA 4L89A 2NYQA 1J4JA 4PXEA 1EE3P 3QAHA 1HDQA 4Y49C 1HDUA 1IYKA 3SI2A 3CT9A 2QYVA 2ODFA 4NJRA 4JJXA 4W9YA 4GXHA 3PB7X 3DNSA 4Z65A 1LAMA 1XMBA 3GY9A 4UWJA 2AFSA 4MRIA 3VWEA 4CYQA 4L8AA 3DR8A 4PXBA 1VHSA 1Y7EA 3CDXA 4P4BA 4H6UA 1YQEA 2P6EA 3S9NA 2ATRA 2FVGA 2IL4A 3D7GA 4CYOA 4M3SA 1XJOA 3FIXA 4IHMA 4PK3A 3D4UA 1M4IA 5LYDA 4B13A 1UWYA 3IEHA 1CG2A 1Z8LA 1WK4A 2F8HA 3PFOA 4FUUA 4KLVA 2FIWA 1LOKA 5K8MA 3CZXA 2JEWA 4CAWA 2CY2A 5FVJA 3WABA 4IF5A 4MY3A 1XMTA 3B3SA 4AG7A 2WPXA 2IMOA 4MI4A 2V8VA 4JXQA 5JQ4A 2G3AA 1TF8A 3BXMA 3IFEA 3QB8A 4KSFA 4OC1A 4C68A 4Q36A 1XIXA 2Z11A 5F09A 2XEGA 4NGMA 4UCMA 1YX0A 2Q04A 3SJGA 4U9ZA 2FT0A 2PQ8A 1DTDA 4NJQA 3I3GA 5HMNA 2C6GA 4E0AA 2QJ8A 4UCNA 1M1DA 3VH9A 4AVCA 2ANPA 2I3CA 2OB0A 4CS0B 3JRUA 4KOYA 3ZJ0A 1IYLA 3RO0A 3A9LA 3TO6A 3B3CA 2PC1A 3B3WA 3FF3A 2VZYA 1JWQA 2ZEHA 4PXCA 3T90A 2GIVA 3TOAA 1Y9KA 2EUIA 2VBQA 1ELMP 3LMSA 4TNUA 3FB3A 4P45A 2CF4A 1AYEA 4MFLA 3DDDA 5I4MA 4UCPA 3D3SA 4WJBA 1AMPA 2OH1A 3TT2A 4CGLA 4FD7A 3R9FA 4LQ6A 2V77A 4ZY0A 4MMOA 2WYRA 4PPZA 4F8ZA 2PVVA 3V38A 2PJ1A 2Z3MA 4PK2A 2O28A 4ONUA 4B5PB 4KVME 1KWMA 2EO8A 2P6GA 5JM6A 1LRZA 1TKHA 2G0BA 2R98A 1CPSA 2Z0ZA 2PSWA 3ISZA 3H8EA 4E2AA 1TKFA 2DPTA 4ORFA 4OIWA 4MFQA 3D68A 3JTKA 5GCNA 3ZZIA 3BJ7A 4HNWB 4B11A 5LRKA 4R3KA 2NSMA 3FEDA 2GLFA 4PSWA 2EVNA 5JGFA 1Z4RA 2X7BA 1LANA 2DPSA 2ZELA 4GM5A 2PJCA 4G1PA 2HQYA 4JWPA 4UIBA 3F8KA 1ARLA 5LYFA 3PFEA 2EK8A 4HPSA 2Q7BA 1BPMA 2OR4A 5AG5A 4YWYA 1Y0YA 2AFZA 3K9UA 2CXAA 4ONWA 4NGSA 3FVLA 2PR1A 1S60A 4KS9A 1ZG9A 2ZOFA 1ZO0A 2GLJA 4C7HA 2CIJA 4P4IA 5K8OA 3JVNA 4MBUA 4ZY1A 3R9EA 4A38A 4A94A 5DWMA 3DLJA 4AVBA 4FD6A 4BD9A 1PCAA 4R7MA 3I9SA 2B5GB 4A37A 3GKRA 3V7ZA 5G20A 2ZXVA 4UEFA 4ZGYB 4OC5A 5I0CA 2O4HA 1PYTB 2ZEFA 2GREA 2OU2A 1IB1E 1IY7A 4E8OA 5J8CA 4LX9A 3IGRA 3SJEA 5A27A 4IK2A 3R96A 4QUSA 3B3VA 4MHYA 3R9GA 3B7IA 3W6SA 1I1DA 2D4OA 1M4DA 2REEA 3F5BA 3RBUA 1LAPA 4DJLA 1S7LA 4CGPA 3KKWA 5IV0A 1YLEA 4OC2A 3JUWA 2YNDA 4P44A 1U6MA 4C2YA 3VWDA 1BPNA 2PJ3A 4UF4A 1OZPA 1Y0RA 1B6BA 2NMTA 4CPAA 1MJAA 1CM0A 4Q7AA 2PDOA 1V0CA 2G3TA 3G8WA 4CGMA 3BI0A 1MK4A 2PE3A 3H8FA 2RFHA 1ON0A 3H5ZA 2Q0YA 1IU8A 4KOSA 3KGQA 4JYWA 4UFXA 1I12A 3NA6A 4FD5A 4XPDC 3QAYA 5J1QA 1AUGA 4R9MA 4MY0A 3IWEA 2B3UA 2H5MA 2VQYA 1DE4C 4P4EA 4X2TA 3RAMA 4KOXA 8CPAA 1RO5A 2Q43A 2ZEGA 5HXDA 2YGWA 3S9MA 1R57A 2Z3OA 2OZHA 3PEIA 3PRTA 2ZW6A 3NE8A 3R1KA 4CYNA 2YNEA 5CPAA 3V8IA 2V8GA 3W6XA 3BJ8A 4OADA 4P4FA 5D8NA 1P0HA 1YW6A 2QVPA 2PIZA 3KR5A 4ZYQA 4B14A 4GS4A 1YGHA 5H84A 5E96A 2C1CA 2FCKA 2V8HA 4OLLA 5G1ZA 3MRUA 1QSOA 5LRGA 3UY5A 2Q7SA 5F48A 1M4GA 1RTQA 2PJAA 3K9TA 4MCSA 2B4DA 3FYNA 2QMLA 2PCUA 4P4DA 3S6FA 1NMTA 1MJ9A 1YMEA 3SHPA 1Z9UA 3KHZA 2AFOA 2R7HA 3D7HA 3CXQA 4UA3A 2BUEA 2DF5A 1S7KA 4UFWA 2BO9A 2C27A
chains in the Genus database with same CATH topology
2YNCC 4BBHA 2AE6A 2B4BA 2Z3NA 1BO4A 4XPLA 2FIAA 2P6FA 3C26A 1S7FA 5ISVA 1GHEA 3G3SA 2QIRA 1KZFA 2JDDA 4C7IA 4R87A 4A2ZA 1S3ZA 4CAEA 2Z3KA 1PU9A 1YR0A 2ZPAA 5IX3A 4XNHB 2HV2A 4C2XA 5J8FA 4A30A 3SXNA 2FSRA 4R57A 1L0CA 3TO9A 3PZJA 1SQHA 1Z4EA 2PR8A 3EXNA 3P2HA 5KTDA 3FNCA 5BWAB 2D4PA 3LD2A 5C88A 2OZUA 2VEZA 5C82A 1NE9A 4B12A 4CRZB 4LUAA 4A32A 4XPKA 1KUVA 3FXTA 2I79A 2ZW4A 3F0AA 2J8RA 3TE4A 2Y0MA 3D8PA 3D2MA 3FBUA 3PGPA 4I49A 4UWIA 1CJWA 4RS2A 4ZBGA 3TTHA 4QB9A 2VZZA 1S7NA 4A95A 3BLNA 5KTCA 3D2PA 3TFYA 4AVAA 2J8MA 4CGOA 4FD4A 2A4NA 2FE7A 2J8NA 5H86A 1XE4A 3E0KA 4CYPA 2VXKA 4CRYB 3RYOA 4BMHA 2HUZA 4MFJA 3S6GA 5KTAA 4KUAA 2CNMA 3MGDA 2I00A 2PRBA 2VI7A 5F47A 5IB0A 5EBVA 3P2FA 4MJ8A 2B3VA 5G22A 2REFA 1IICA 2R8VA 1Q2DA 3CXPA 1MJBA 3FRMA 2WSAA 4AG9A 3DR6A 2Q4YA 1KUXA 3NE7A 4KZTA 5AG4A 1FY7A 1PUAA 3DSBA 2OZGA 4NCZA 2BSWA 2GANA 1QSTA 1BOBA 3IU1A 2P0WA 4NF1A 4IUSA 2CNTA 2CNSA 2YNCA 4MFPA 3EFAA 4A31A 1RXTA 3TO7A 5A28A 3TCVA 2Q44A 4UFVA 2B4DB 4HNYB 3CXSA 4MFZA 4EVYA 4KLWA 4UBRA 4PV6A 4B5OA 4U5YA 1NSLA 3WR7A 1S5KA 2AJ6A 4OAEA 4KOUA 3TOBA 1Q2CA 5HH1A 4YRHA 2ARHA 5AGEA 1N71A 4H89A 1I21A 4HNXB 2Z10A 4NEXA 2JLMA 4DNCA 2Q4VA 1Q2YA 4MFKA 4C2ZA 2FXFA 2WUUA 1Y7RA 2FL4A 3PP9A 4AB7A 2BEIA 1TIQA 3LODA 2B58A 4H6ZA 1IIDA 4HKFA 5DWNA 2KCWA 3EY5A 3OWCA 5CNPA 4X5KA 5F49A 4CAXA 4MHDA 1K4JA 4YFJA 4B10A 4KOVA 4J3GA 4KORA 4KUBA 5F46A 1WWZA 3SXOA 1QSNA 4KSAA 2R1IA 1YVKA 1YREA 5JPHA 4QVTA 5AG7A 3W91A 4F6AA 4II9A 1KUYA 2F5IA 2Z3LA 4F0YA 4B5PA 1M44A 4RI1A 4JD6A 3EO4A 4NSQA 4QBJA 1UFHA 4M85A 2RC4A 4KVOE 2BL1A 5EC4A 4KOTA 4Y49B 1QSRA 4KOWA 2QECA 3IU2A 1VKCA 2JDCA 1P4NA 2JEVA 5G21A 1B87A 4CGNA 3T9YA 3R95A 3H4QA 4XNHC 3B8GA 3IWGA 4QC6A 1QSMA 4KVXA 4XPDB 2WPWA 3GYAA 1XEBA 5AG6A 4NXYA 2DXQA 4R3LA 4F0XA 2K5TA 4CAFA 4K30A 4PSXA 4JLYA 2B5GA 4Q38A 1YK3A 4A33A 2FS5A 4CAVA 3EC4A 1YVOA 1Y9WA 4YGOA 2ZW5A 2ZW7A 4JXRA 3S6KA 4U9YA 1XF8A 2Z3PA 3N7ZA 2GE3A 4L89A 1J4JA 3QAHA 4Y49C 1IYKA 4JJXA 3DNSA 3GY9A 4UWJA 3VWEA 4CYQA 4L8AA 3DR8A 1VHSA 4H6UA 2P6EA 2ATRA 2IL4A 4CYOA 4M3SA 3FIXA 4B13A 4PK3A 1M4IA 1WK4A 4KLVA 2FIWA 4CAWA 2CY2A 5FVJA 4IF5A 4MY3A 1XMTA 4AG7A 2WPXA 4MI4A 4JXQA 5JQ4A 2G3AA 3QB8A 4C68A 4KSFA 4Q36A 1XIXA 2Z11A 4UCMA 1YX0A 2Q04A 4U9ZA 2FT0A 2PQ8A 3I3GA 5HMNA 4E0AA 4UCNA 1M1DA 4AVCA 2OB0A 4CS0B 4KOYA 3ZJ0A 1IYLA 3A9LA 3TO6A 2PC1A 2VZYA 3T90A 3TOAA 2GIVA 1Y9KA 2EUIA 2VBQA 3FB3A 4MFLA 3DDDA 4UCPA 3D3SA 2OH1A 3TT2A 4CGLA 4FD7A 3R9FA 2Z3MA 4PK2A 2O28A 4ONUA 4B5PB 4KVME 2P6GA 1LRZA 2G0BA 2R98A 2Z0ZA 2PSWA 4E2AA 2DPTA 4ORFA 4MFQA 3JTKA 5GCNA 3ZZIA 3BJ7A 4HNWB 4B11A 4R3KA 4PSWA 2EVNA 1Z4RA 2X7BA 2DPSA 4JWPA 2HQYA 3F8KA 2Q7BA 5AG5A 3K9UA 2CXAA 2PR1A 1S60A 4KS9A 1ZO0A 4C7HA 3JVNA 4MBUA 3R9EA 4AVBA 5DWMA 4FD6A 3I9SA 2B5GB 3GKRA 5G20A 2ZXVA 4ZGYB 5I0CA 2OU2A 1IB1E 4E8OA 5J8CA 4LX9A 3IGRA 5A27A 3R96A 4QUSA 3R9GA 3W6SA 1I1DA 2D4OA 1M4DA 2REEA 3F5BA 1S7LA 4CGPA 3KKWA 5IV0A 1YLEA 3JUWA 2YNDA 1U6MA 4C2YA 3VWDA 1OZPA 1B6BA 2NMTA 1MJAA 1CM0A 2PDOA 1V0CA 2G3TA 3G8WA 4CGMA 1MK4A 1ON0A 3H5ZA 2Q0YA 4KOSA 4UFXA 1I12A 4FD5A 4XPDC 4R9MA 4MY0A 3IWEA 2B3UA 2H5MA 2VQYA 4KOXA 1RO5A 2YGWA 1R57A 2Z3OA 2OZHA 2ZW6A 3R1KA 4CYNA 2YNEA 3V8IA 3W6XA 3BJ8A 4OADA 1P0HA 4B14A 4GS4A 1YGHA 5H84A 5E96A 5G1ZA 2FCKA 4OLLA 3S6HA 1QSOA 3UY5A 5F48A 1M4GA 2B4DA 3FYNA 2QMLA 3S6FA 1NMTA 1MJ9A 3SHPA 1Z9UA 2R7HA 3CXQA 4UA3A 2BUEA 1S7KA 4UFWA 2C27A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AE6 A;  2B4B A;  1BO4 A;  4XPL A;  2FIA A;  2P6F A;  3C26 A;  1S7F A;  5ISV A;  1GHE A;  3G3S A;  2QIR A;  1KZF A;  2JDD A;  4R87 A;  1S3Z A;  1PU9 A;  1YR0 A;  2ZPA A;  5IX3 A;  4XNH B;  2HV2 A;  5J8F A;  3SXN A;  2FSR A;  4R57 A;  1L0C A;  3TO9 A;  3PZJ A;  1SQH A;  1Z4E A;  2PR8 A;  3EXN A;  3P2H A;  5KTD A;  3FNC A;  2D4P A;  3LD2 A;  5C88 A;  2OZU A;  2VEZ A;  5C82 A;  1NE9 A;  4CRZ B;  4LUA A;  4XPK A;  1KUV A;  3FXT A;  2I79 A;  2ZW4 A;  3F0A A;  2J8R A;  3TE4 A;  2Y0M A;  3D8P A;  3D2M A;  3FBU A;  3PGP A;  4I49 A;  4UWI A;  1CJW A;  4RS2 A;  4ZBG A;  3TTH A;  4QB9 A;  2VZZ A;  1S7N A;  3BLN A;  5KTC A;  3D2P A;  3TFY A;  4AVA A;  2J8M A;  4FD4 A;  2A4N A;  2FE7 A;  2J8N A;  5H86 A;  1XE4 A;  3E0K A;  2VXK A;  4CRY B;  3RYO A;  4BMH A;  2HUZ A;  3S6G A;  5KTA A;  4KUA A;  2CNM A;  3MGD A;  2I00 A;  2PRB A;  2VI7 A;  5F47 A;  5IB0 A;  5EBV A;  3P2F A;  4MJ8 A;  2B3V A;  2REF A;  1IIC A;  2R8V A;  1Q2D A;  3CXP A;  1MJB A;  3FRM A;  4AG9 A;  3DR6 A;  2Q4Y A;  1KUX A;  3NE7 A;  4KZT A;  1FY7 A;  1PUA A;  3DSB A;  2OZG A;  4NCZ A;  2BSW A;  2GAN A;  1QST A;  1BOB A;  2P0W A;  4NF1 A;  4IUS A;  2CNT A;  2CNS A;  3EFA A;  1RXT A;  3TO7 A;  3TCV A;  2Q44 A;  2B4D B;  4HNY B;  3CXS A;  4EVY A;  4KLW A;  4UBR A;  4PV6 A;  4B5O A;  4U5Y A;  1NSL A;  3WR7 A;  1S5K A;  2AJ6 A;  4OAE A;  4KOU A;  3TOB A;  1Q2C A;  5HH1 A;  4YRH A;  2ARH A;  1N71 A;  4H89 A;  1I21 A;  4HNX B;  2Z10 A;  4NEX A;  2JLM A;  4DNC A;  2Q4V A;  1Q2Y A;  2FXF A;  1Y7R A;  2FL4 A;  3PP9 A;  4AB7 A;  2BEI A;  1TIQ A;  3LOD A;  2B58 A;  4H6Z A;  1IID A;  4HKF A;  5DWN A;  2KCW A;  3EY5 A;  3OWC A;  5CNP A;  4X5K A;  5F49 A;  4CAX A;  4MHD A;  1K4J A;  4YFJ A;  4KOV A;  4J3G A;  4KOR A;  4KUB A;  5F46 A;  1WWZ A;  3SXO A;  1QSN A;  2R1I A;  1YVK A;  1YRE A;  5JPH A;  4QVT A;  3W91 A;  4F6A A;  4II9 A;  1KUY A;  2F5I A;  4F0Y A;  4B5P A;  1M44 A;  4RI1 A;  4JD6 A;  3EO4 A;  4NSQ A;  4QBJ A;  1UFH A;  4M85 A;  2RC4 A;  4KVO E;  2BL1 A;  5EC4 A;  4KOT A;  4Y49 B;  1QSR A;  4KOW A;  2QEC A;  1VKC A;  2JDC A;  1P4N A;  2JEV A;  1B87 A;  3T9Y A;  3R95 A;  3H4Q A;  4XNH C;  3B8G A;  3IWG A;  4QC6 A;  1QSM A;  4KVX A;  4XPD B;  2WPW A;  3GYA A;  1XEB A;  4NXY A;  2DXQ A;  4R3L A;  2K5T A;  4K30 A;  4PSX A;  4JLY A;  2B5G A;  1YK3 A;  2FS5 A;  4CAV A;  3EC4 A;  1YVO A;  1Y9W A;  4YGO A;  2ZW5 A;  2ZW7 A;  4JXR A;  3S6K A;  4U9Y A;  1XF8 A;  3N7Z A;  2GE3 A;  4L89 A;  1J4J A;  3QAH A;  4Y49 C;  1IYK A;  4JJX A;  3DNS A;  3GY9 A;  4UWJ A;  3VWE A;  4L8A A;  3DR8 A;  1VHS A;  4H6U A;  2P6E A;  2ATR A;  2IL4 A;  4M3S A;  3FIX A;  4PK3 A;  1M4I A;  1WK4 A;  4KLV A;  2FIW A;  4CAW A;  2CY2 A;  5FVJ A;  4IF5 A;  4MY3 A;  1XMT A;  4AG7 A;  2WPX A;  4MI4 A;  4JXQ A;  5JQ4 A;  2G3A A;  3QB8 A;  1XIX A;  2Z11 A;  1YX0 A;  2Q04 A;  4U9Z A;  2FT0 A;  2PQ8 A;  3I3G A;  5HMN A;  4E0A A;  1M1D A;  4AVC A;  2OB0 A;  4CS0 B;  4KOY A;  3ZJ0 A;  1IYL A;  3TO6 A;  2PC1 A;  2VZY A;  3T90 A;  3TOA A;  2GIV A;  1Y9K A;  2EUI A;  2VBQ A;  3FB3 A;  3DDD A;  3D3S A;  2OH1 A;  3TT2 A;  4FD7 A;  3R9F A;  4PK2 A;  2O28 A;  4ONU A;  4B5P B;  4KVM E;  2P6G A;  1LRZ A;  2G0B A;  2R98 A;  2Z0Z A;  2PSW A;  4E2A A;  4ORF A;  5GCN A;  3ZZI A;  3BJ7 A;  4HNW B;  4R3K A;  4PSW A;  2EVN A;  1Z4R A;  2X7B A;  4JWP A;  2HQY A;  3F8K A;  2Q7B A;  3K9U A;  2PR1 A;  1S60 A;  3JVN A;  4MBU A;  3R9E A;  4AVB A;  5DWM A;  4FD6 A;  3I9S A;  2B5G B;  3GKR A;  2ZXV A;  5I0C A;  2OU2 A;  1IB1 E;  4E8O A;  5J8C A;  4LX9 A;  3IGR A;  3R96 A;  4QUS A;  3R9G A;  3W6S A;  1I1D A;  2D4O A;  1M4D A;  2REE A;  3F5B A;  1S7L A;  3KKW A;  5IV0 A;  1YLE A;  3JUW A;  1U6M A;  3VWD A;  1OZP A;  1B6B A;  2NMT A;  1MJA A;  1CM0 A;  2PDO A;  1V0C A;  2G3T A;  3G8W A;  1MK4 A;  1ON0 A;  2Q0Y A;  4KOS A;  1I12 A;  4FD5 A;  4XPD C;  4R9M A;  4MY0 A;  2B3U A;  2H5M A;  2VQY A;  4KOX A;  1RO5 A;  1R57 A;  2OZH A;  2ZW6 A;  3R1K A;  3V8I A;  3W6X A;  3BJ8 A;  4OAD A;  1P0H A;  4GS4 A;  1YGH A;  5H84 A;  5E96 A;  3S6H A;  2FCK A;  4OLL A;  1QSO A;  3UY5 A;  5F48 A;  1M4G A;  2B4D A;  3FYN A;  2QML A;  3S6F A;  1NMT A;  1MJ9 A;  3SHP A;  1Z9U A;  2R7H A;  3CXQ A;  4UA3 A;  2BUE A;  1S7K A;  2C27 A; 
#chains in the Genus database with same CATH topology
 2YNC C;  4BBH A;  4NGR A;  3IO1 A;  2AE6 A;  4DUK A;  2B4B A;  1F2P A;  2J9A A;  2Z3N A;  1LFW A;  1BO4 A;  3CPA A;  2PJ0 A;  4NGT A;  4XPL A;  1QQ9 A;  2FIA A;  2P6F A;  2ZEO A;  4X8I A;  3PB8 X;  2XEI A;  3C26 A;  1S7F A;  1ZG7 A;  3SJX A;  3KQX A;  5ISV A;  3K2K A;  1GHE A;  4WWV A;  4B6Z A;  3IWW A;  3G3S A;  3ISX A;  2QIR A;  3KL9 A;  1KZF A;  1IGB A;  2BOA A;  2JDD A;  4F9V A;  4C7I A;  3IC1 A;  4R87 A;  3VAR A;  5JH9 A;  4A2Z A;  1S3Z A;  4P6Y A;  2Z3K A;  4CAE A;  1PU9 A;  1Z8X A;  3GUX A;  1CBX A;  1X10 A;  1YR0 A;  2ZPA A;  5IX3 A;  2O53 A;  4UEZ A;  4XNH B;  2HV2 A;  1Z8W A;  4C2X A;  3NH4 A;  5J8F A;  4A30 A;  2PJ4 A;  2PJ9 A;  3SXN A;  2FSR A;  4R57 A;  4RN7 A;  3QNV A;  1L0C A;  3B2Y A;  3IIB A;  2Q4Z A;  3PB9 X;  3PZJ A;  5ELY A;  3TC8 A;  3TO9 A;  2F7V A;  1SQH A;  1Z4E A;  2PR8 A;  3EXN A;  3P2H A;  5KTD A;  3FEE A;  3FNC A;  3KR4 A;  5BWA B;  2D4P A;  3LD2 A;  1R3N A;  3DGV A;  2EWB A;  3S9L A;  1ARM A;  2AFX A;  2OZU A;  4EME A;  5C88 A;  2VEZ A;  5C82 A;  4MHP A;  2PJ2 A;  1NE9 A;  3HLP A;  4OKO A;  4LUA A;  2XEJ A;  4R6T A;  4B12 A;  4A32 A;  4CRZ B;  1VHO A;  4XPK A;  3VAT A;  3SI1 A;  1KUV A;  2PJB A;  1ZLI A;  2ZEM A;  3FXT A;  2I79 A;  2ZW4 A;  4OC4 A;  7CPA A;  3D7D A;  3F0A A;  2J8R A;  3TE4 A;  1TXR A;  2Y0M A;  2ABZ A;  4FBE A;  3D8P A;  3D2M A;  3FBU A;  3PGP A;  4I49 A;  3S6H A;  3GB0 A;  4UWI A;  1CJW A;  1Q7L A;  4RS2 A;  4ZBG A;  4FAI A;  3KI9 A;  4ZI6 A;  2AFM A;  3TTH A;  2PJ8 A;  3B35 A;  4QB9 A;  1HEE A;  2VZZ A;  1S7N A;  4A95 A;  3BLN A;  2PRQ A;  3KZW A;  2HC9 A;  5KTC A;  3D2P A;  4X3R A;  4M6G A;  1GYT A;  4AVA A;  2J8M A;  4CGO A;  3TFY A;  4FD4 A;  2A4N A;  2FE7 A;  4PQA A;  2ZED A;  2J8N A;  4EFD A;  5H86 A;  1XE4 A;  1YW4 A;  5LYL A;  2HB6 A;  3E0K A;  2WZN A;  4CYP A;  5HVH A;  2VXK A;  4CRY B;  1XBU A;  3RYO A;  1TF9 A;  2OOT A;  4BMH A;  2HUZ A;  4MFJ A;  3S6G A;  5KTA A;  4KUA A;  2IJZ A;  2CNM A;  3MGD A;  2I00 A;  1ZG8 A;  4JZ0 A;  2PRB A;  2VI7 A;  4MCQ A;  5F47 A;  5IB0 A;  1CP6 A;  2POK A;  4R76 A;  5EBV A;  1LCP A;  2XEF A;  1YLO A;  2C6P A;  3P2F A;  4MJ8 A;  3NFZ A;  4IAV A;  4OC3 A;  2B3V A;  3PB4 X;  5G22 A;  2IQ6 A;  2REF A;  3T8W A;  1IIC A;  2R8V A;  1Q2D A;  5DS0 A;  1VGY A;  3CXP A;  1MJB A;  3RNZ A;  3FRM A;  2WSA A;  3NH8 A;  4MHZ A;  1A2Z A;  3WT4 A;  3DR6 A;  4OID A;  4AG9 A;  2EBJ A;  2Q4Y A;  1KUX A;  2ZOG A;  3BI1 A;  1NSA A;  3NE7 A;  4KZT A;  1F2O A;  3IJ3 A;  4NGQ A;  4OME A;  3SI0 A;  1FY7 A;  5AG4 A;  5K8N A;  1PUA A;  3DSB A;  1CP7 A;  2OZG A;  3FMC A;  3I1U A;  2BSW A;  2GAN A;  4NCZ A;  1QST A;  1BOB A;  1Z2L A;  3IU1 A;  3LAC A;  2P0W A;  4NFR A;  2VL1 A;  4NF1 A;  4IUS A;  1JQG A;  2CNT A;  2CNS A;  2YNC A;  4MFP A;  3LWU A;  4MCP A;  3EFA A;  4A31 A;  3B3T A;  1RXT A;  4NGN A;  4OP4 A;  3TO7 A;  5A28 A;  4F9U A;  1TKJ A;  3TCV A;  1VHE A;  2Q44 A;  4UFV A;  2B4D B;  2ZEN A;  4HNY B;  1VIX A;  2V8D A;  3CXS A;  1CX8 A;  4MFZ A;  4EVY A;  4KLW A;  4UBR A;  4PV6 A;  4TWE A;  4ZX8 A;  2BCO A;  4B5O A;  4U5Y A;  1NSL A;  3WR7 A;  1S5K A;  2AJ6 A;  4OAE A;  4KOU A;  3KAS A;  4ZY2 A;  3TOB A;  1YSJ A;  1Q2C A;  2GU2 A;  2JBJ A;  5HH1 A;  4YRH A;  2ARH A;  5AGE A;  1N71 A;  4H89 A;  1FNO A;  1I21 A;  4AXV A;  1FT7 A;  3FEC A;  1ELL P;  3FH4 A;  4LQG A;  4HNX B;  2Z10 A;  4NEX A;  4MHN A;  2JLM A;  4K3N A;  4FWU A;  4DNC A;  2Q4V A;  1Q2Y A;  4MFK A;  4O23 A;  5EMI A;  4C2Z A;  4P10 A;  2G9D A;  2FXF A;  1Z8T A;  3WC7 A;  2WUU A;  1Y7R A;  5K8P A;  2DEA A;  1OBR A;  2FL4 A;  3PP9 A;  4AB7 A;  3BHX A;  4RUH A;  3CPX A;  3KQZ A;  2JBK A;  2BEI A;  1TIQ A;  3LOD A;  2PJ5 A;  2B58 A;  4H6Z A;  1IID A;  4HKF A;  5DWN A;  2KCW A;  2AFW A;  1XOV A;  3FJU A;  6CPA A;  3EY5 A;  3FX6 A;  3OWC A;  3PBE A;  5CNP A;  4PXD A;  4X5K A;  1H8L A;  5F49 A;  4CAX A;  2CTC A;  4YU9 A;  4R8F A;  3MN8 A;  4M6I A;  4MHD A;  4UEE A;  1K4J A;  4UIA A;  4YFJ A;  4B10 A;  4KOV A;  4J3G A;  3KHX A;  4KOR A;  2PJ7 A;  2AFU A;  2RB7 A;  1WWZ A;  4KUB A;  5HVF A;  5LRJ A;  5F46 A;  3SXO A;  1QSN A;  3NH5 A;  4KSA A;  3WC5 A;  2C6C A;  2R1I A;  5THW A;  5HVG A;  1YVK A;  2GFQ A;  3PB6 X;  1CPX A;  1YRE A;  3D66 A;  5JPH A;  4QVT A;  5AG7 A;  3W91 A;  4F6A A;  4II9 A;  1KUY A;  2F5I A;  2Z3L A;  4F0Y A;  3D67 A;  4B5P A;  1M44 A;  4RI1 A;  4JD6 A;  1R43 A;  5CBM A;  4ZX9 A;  3EO4 A;  3L2N A;  4NSQ A;  4QBJ A;  1UFH A;  4M85 A;  2PJ6 A;  2RC4 A;  4KVO E;  2BL1 A;  1IOF A;  4OC0 A;  5EC4 A;  4KOT A;  4Y49 B;  2EK9 A;  1QSR A;  4MCR A;  3WC6 A;  4KOW A;  2QEC A;  3IU2 A;  1VKC A;  2JDC A;  5D29 A;  1P4N A;  2JEV A;  5G21 A;  1B87 A;  1BAV A;  3GIU A;  1XRY A;  3N5F A;  3PBB A;  4CGN A;  2ZEE A;  4H2K A;  3SJF A;  3RZA A;  3T9Y A;  5LYI A;  3R95 A;  3H4Q A;  4XNH C;  4A39 A;  3B8G A;  3H8G A;  1XFO A;  4MXU A;  3IWG A;  4QC6 A;  1BLL E;  1QMU A;  2CTB A;  1QSM A;  2Q51 A;  4KVX A;  1M4L A;  4XPD B;  2WPW A;  4DYO A;  3GYA A;  1XEB A;  2ZEP A;  4NGP A;  4NXY A;  5AG6 A;  3GLJ A;  1IOI A;  2DXQ A;  4R3L A;  4F0X A;  2K5T A;  4CAF A;  4K30 A;  4KSI A;  2PIY A;  5IB9 A;  1ZLH A;  4PSX A;  1X12 A;  4JLY A;  2B5G A;  3D7F A;  4Q38 A;  1YK3 A;  4A33 A;  4P4J A;  3TX8 A;  2FS5 A;  4CAV A;  3EC4 A;  1YVO A;  1Y9W A;  3HUV A;  4YGO A;  2ZW5 A;  2ZW7 A;  4JXR A;  3S6K A;  4EWT A;  4M6H A;  4BIN A;  1F57 A;  1XF8 A;  2Z3P A;  1Z5R A;  3N7Z A;  2GE3 A;  4U9Y A;  2PVW A;  4L89 A;  2NYQ A;  1J4J A;  4PXE A;  1EE3 P;  3QAH A;  1HDQ A;  4Y49 C;  1HDU A;  1IYK A;  3SI2 A;  3CT9 A;  2QYV A;  2ODF A;  4NJR A;  4JJX A;  4W9Y A;  4GXH A;  3PB7 X;  3DNS A;  4Z65 A;  1LAM A;  1XMB A;  3GY9 A;  4UWJ A;  2AFS A;  4MRI A;  3VWE A;  4CYQ A;  4L8A A;  3DR8 A;  4PXB A;  1VHS A;  1Y7E A;  3CDX A;  4P4B A;  4H6U A;  1YQE A;  2P6E A;  3S9N A;  2ATR A;  2FVG A;  2IL4 A;  3D7G A;  4CYO A;  4M3S A;  1XJO A;  3FIX A;  4IHM A;  4PK3 A;  3D4U A;  1M4I A;  5LYD A;  4B13 A;  1UWY A;  3IEH A;  1CG2 A;  1Z8L A;  1WK4 A;  2F8H A;  3PFO A;  4FUU A;  4KLV A;  2FIW A;  1LOK A;  5K8M A;  3CZX A;  2JEW A;  4CAW A;  2CY2 A;  5FVJ A;  3WAB A;  4IF5 A;  4MY3 A;  1XMT A;  3B3S A;  4AG7 A;  2WPX A;  2IMO A;  4MI4 A;  2V8V A;  4JXQ A;  5JQ4 A;  2G3A A;  1TF8 A;  3BXM A;  3IFE A;  3QB8 A;  4KSF A;  4OC1 A;  4C68 A;  4Q36 A;  1XIX A;  2Z11 A;  5F09 A;  2XEG A;  4NGM A;  4UCM A;  1YX0 A;  2Q04 A;  3SJG A;  4U9Z A;  2FT0 A;  2PQ8 A;  1DTD A;  4NJQ A;  3I3G A;  5HMN A;  2C6G A;  4E0A A;  2QJ8 A;  4UCN A;  1M1D A;  3VH9 A;  4AVC A;  2ANP A;  2I3C A;  2OB0 A;  4CS0 B;  3JRU A;  4KOY A;  3ZJ0 A;  1IYL A;  3RO0 A;  3A9L A;  3TO6 A;  3B3C A;  2PC1 A;  3B3W A;  3FF3 A;  2VZY A;  1JWQ A;  2ZEH A;  4PXC A;  3T90 A;  2GIV A;  3TOA A;  1Y9K A;  2EUI A;  2VBQ A;  1ELM P;  3LMS A;  4TNU A;  3FB3 A;  4P45 A;  2CF4 A;  1AYE A;  4MFL A;  3DDD A;  5I4M A;  4UCP A;  3D3S A;  4WJB A;  1AMP A;  2OH1 A;  3TT2 A;  4CGL A;  4FD7 A;  3R9F A;  4LQ6 A;  2V77 A;  4ZY0 A;  4MMO A;  2WYR A;  4PPZ A;  4F8Z A;  2PVV A;  3V38 A;  2PJ1 A;  2Z3M A;  4PK2 A;  2O28 A;  4ONU A;  4B5P B;  4KVM E;  1KWM A;  2EO8 A;  2P6G A;  5JM6 A;  1LRZ A;  1TKH A;  2G0B A;  2R98 A;  1CPS A;  2Z0Z A;  2PSW A;  3ISZ A;  3H8E A;  4E2A A;  1TKF A;  2DPT A;  4ORF A;  4OIW A;  4MFQ A;  3D68 A;  3JTK A;  5GCN A;  3ZZI A;  3BJ7 A;  4HNW B;  4B11 A;  5LRK A;  4R3K A;  2NSM A;  3FED A;  2GLF A;  4PSW A;  2EVN A;  5JGF A;  1Z4R A;  2X7B A;  1LAN A;  2DPS A;  2ZEL A;  4GM5 A;  2PJC A;  4G1P A;  2HQY A;  4JWP A;  4UIB A;  3F8K A;  1ARL A;  5LYF A;  3PFE A;  2EK8 A;  4HPS A;  2Q7B A;  1BPM A;  2OR4 A;  5AG5 A;  4YWY A;  1Y0Y A;  2AFZ A;  3K9U A;  2CXA A;  4ONW A;  4NGS A;  3FVL A;  2PR1 A;  1S60 A;  4KS9 A;  1ZG9 A;  2ZOF A;  1ZO0 A;  2GLJ A;  4C7H A;  2CIJ A;  4P4I A;  5K8O A;  3JVN A;  4MBU A;  4ZY1 A;  3R9E A;  4A38 A;  4A94 A;  5DWM A;  3DLJ A;  4AVB A;  4FD6 A;  4BD9 A;  1PCA A;  4R7M A;  3I9S A;  2B5G B;  4A37 A;  3GKR A;  3V7Z A;  5G20 A;  2ZXV A;  4UEF A;  4ZGY B;  4OC5 A;  5I0C A;  2O4H A;  1PYT B;  2ZEF A;  2GRE A;  2OU2 A;  1IB1 E;  1IY7 A;  4E8O A;  5J8C A;  4LX9 A;  3IGR A;  3SJE A;  5A27 A;  4IK2 A;  3R96 A;  4QUS A;  3B3V A;  4MHY A;  3R9G A;  3B7I A;  3W6S A;  1I1D A;  2D4O A;  1M4D A;  2REE A;  3F5B A;  3RBU A;  1LAP A;  4DJL A;  1S7L A;  4CGP A;  3KKW A;  5IV0 A;  1YLE A;  4OC2 A;  3JUW A;  2YND A;  4P44 A;  1U6M A;  4C2Y A;  3VWD A;  1BPN A;  2PJ3 A;  4UF4 A;  1OZP A;  1Y0R A;  1B6B A;  2NMT A;  4CPA A;  1MJA A;  1CM0 A;  4Q7A A;  2PDO A;  1V0C A;  2G3T A;  3G8W A;  4CGM A;  3BI0 A;  1MK4 A;  2PE3 A;  3H8F A;  2RFH A;  1ON0 A;  3H5Z A;  2Q0Y A;  1IU8 A;  4KOS A;  3KGQ A;  4JYW A;  4UFX A;  1I12 A;  3NA6 A;  4FD5 A;  4XPD C;  3QAY A;  5J1Q A;  1AUG A;  4R9M A;  4MY0 A;  3IWE A;  2B3U A;  2H5M A;  2VQY A;  1DE4 C;  4P4E A;  4X2T A;  3RAM A;  4KOX A;  8CPA A;  1RO5 A;  2Q43 A;  2ZEG A;  5HXD A;  2YGW A;  3S9M A;  1R57 A;  2Z3O A;  2OZH A;  3PEI A;  3PRT A;  2ZW6 A;  3NE8 A;  3R1K A;  4CYN A;  2YNE A;  5CPA A;  3V8I A;  2V8G A;  3W6X A;  3BJ8 A;  4OAD A;  4P4F A;  5D8N A;  1P0H A;  1YW6 A;  2QVP A;  2PIZ A;  3KR5 A;  4ZYQ A;  4B14 A;  4GS4 A;  1YGH A;  5H84 A;  5E96 A;  2C1C A;  2FCK A;  2V8H A;  4OLL A;  5G1Z A;  3MRU A;  1QSO A;  5LRG A;  3UY5 A;  2Q7S A;  5F48 A;  1M4G A;  1RTQ A;  2PJA A;  3K9T A;  4MCS A;  2B4D A;  3FYN A;  2QML A;  2PCU A;  4P4D A;  3S6F A;  1NMT A;  1MJ9 A;  1YME A;  3SHP A;  1Z9U A;  3KHZ A;  2AFO A;  2R7H A;  3D7H A;  3CXQ A;  4UA3 A;  2BUE A;  2DF5 A;  1S7K A;  4UFW A;  2BO9 A;  2C27 A; 
#chains in the Genus database with same CATH homology
 2YNC C;  4BBH A;  2AE6 A;  2B4B A;  2Z3N A;  1BO4 A;  4XPL A;  2FIA A;  2P6F A;  3C26 A;  1S7F A;  5ISV A;  1GHE A;  3G3S A;  2QIR A;  1KZF A;  2JDD A;  4C7I A;  4R87 A;  4A2Z A;  1S3Z A;  4CAE A;  2Z3K A;  1PU9 A;  1YR0 A;  2ZPA A;  5IX3 A;  4XNH B;  2HV2 A;  4C2X A;  5J8F A;  4A30 A;  3SXN A;  2FSR A;  4R57 A;  1L0C A;  3TO9 A;  3PZJ A;  1SQH A;  1Z4E A;  2PR8 A;  3EXN A;  3P2H A;  5KTD A;  3FNC A;  5BWA B;  2D4P A;  3LD2 A;  5C88 A;  2OZU A;  2VEZ A;  5C82 A;  1NE9 A;  4B12 A;  4CRZ B;  4LUA A;  4A32 A;  4XPK A;  1KUV A;  3FXT A;  2I79 A;  2ZW4 A;  3F0A A;  2J8R A;  3TE4 A;  2Y0M A;  3D8P A;  3D2M A;  3FBU A;  3PGP A;  4I49 A;  4UWI A;  1CJW A;  4RS2 A;  4ZBG A;  3TTH A;  4QB9 A;  2VZZ A;  1S7N A;  4A95 A;  3BLN A;  5KTC A;  3D2P A;  3TFY A;  4AVA A;  2J8M A;  4CGO A;  4FD4 A;  2A4N A;  2FE7 A;  2J8N A;  5H86 A;  1XE4 A;  3E0K A;  4CYP A;  2VXK A;  4CRY B;  3RYO A;  4BMH A;  2HUZ A;  4MFJ A;  3S6G A;  5KTA A;  4KUA A;  2CNM A;  3MGD A;  2I00 A;  2PRB A;  2VI7 A;  5F47 A;  5IB0 A;  5EBV A;  3P2F A;  4MJ8 A;  2B3V A;  5G22 A;  2REF A;  1IIC A;  2R8V A;  1Q2D A;  3CXP A;  1MJB A;  3FRM A;  2WSA A;  4AG9 A;  3DR6 A;  2Q4Y A;  1KUX A;  3NE7 A;  4KZT A;  5AG4 A;  1FY7 A;  1PUA A;  3DSB A;  2OZG A;  4NCZ A;  2BSW A;  2GAN A;  1QST A;  1BOB A;  3IU1 A;  2P0W A;  4NF1 A;  4IUS A;  2CNT A;  2CNS A;  2YNC A;  4MFP A;  3EFA A;  4A31 A;  1RXT A;  3TO7 A;  5A28 A;  3TCV A;  2Q44 A;  4UFV A;  2B4D B;  4HNY B;  3CXS A;  4MFZ A;  4EVY A;  4KLW A;  4UBR A;  4PV6 A;  4B5O A;  4U5Y A;  1NSL A;  3WR7 A;  1S5K A;  2AJ6 A;  4OAE A;  4KOU A;  3TOB A;  1Q2C A;  5HH1 A;  4YRH A;  2ARH A;  5AGE A;  1N71 A;  4H89 A;  1I21 A;  4HNX B;  2Z10 A;  4NEX A;  2JLM A;  4DNC A;  2Q4V A;  1Q2Y A;  4MFK A;  4C2Z A;  2FXF A;  2WUU A;  1Y7R A;  2FL4 A;  3PP9 A;  4AB7 A;  2BEI A;  1TIQ A;  3LOD A;  2B58 A;  4H6Z A;  1IID A;  4HKF A;  5DWN A;  2KCW A;  3EY5 A;  3OWC A;  5CNP A;  4X5K A;  5F49 A;  4CAX A;  4MHD A;  1K4J A;  4YFJ A;  4B10 A;  4KOV A;  4J3G A;  4KOR A;  4KUB A;  5F46 A;  1WWZ A;  3SXO A;  1QSN A;  4KSA A;  2R1I A;  1YVK A;  1YRE A;  5JPH A;  4QVT A;  5AG7 A;  3W91 A;  4F6A A;  4II9 A;  1KUY A;  2F5I A;  2Z3L A;  4F0Y A;  4B5P A;  1M44 A;  4RI1 A;  4JD6 A;  3EO4 A;  4NSQ A;  4QBJ A;  1UFH A;  4M85 A;  2RC4 A;  4KVO E;  2BL1 A;  5EC4 A;  4KOT A;  4Y49 B;  1QSR A;  4KOW A;  2QEC A;  3IU2 A;  1VKC A;  2JDC A;  1P4N A;  2JEV A;  5G21 A;  1B87 A;  4CGN A;  3T9Y A;  3R95 A;  3H4Q A;  4XNH C;  3B8G A;  3IWG A;  4QC6 A;  1QSM A;  4KVX A;  4XPD B;  2WPW A;  3GYA A;  1XEB A;  5AG6 A;  4NXY A;  2DXQ A;  4R3L A;  4F0X A;  2K5T A;  4CAF A;  4K30 A;  4PSX A;  4JLY A;  2B5G A;  4Q38 A;  1YK3 A;  4A33 A;  2FS5 A;  4CAV A;  3EC4 A;  1YVO A;  1Y9W A;  4YGO A;  2ZW5 A;  2ZW7 A;  4JXR A;  3S6K A;  4U9Y A;  1XF8 A;  2Z3P A;  3N7Z A;  2GE3 A;  4L89 A;  1J4J A;  3QAH A;  4Y49 C;  1IYK A;  4JJX A;  3DNS A;  3GY9 A;  4UWJ A;  3VWE A;  4CYQ A;  4L8A A;  3DR8 A;  1VHS A;  4H6U A;  2P6E A;  2ATR A;  2IL4 A;  4CYO A;  4M3S A;  3FIX A;  4B13 A;  4PK3 A;  1M4I A;  1WK4 A;  4KLV A;  2FIW A;  4CAW A;  2CY2 A;  5FVJ A;  4IF5 A;  4MY3 A;  1XMT A;  4AG7 A;  2WPX A;  4MI4 A;  4JXQ A;  5JQ4 A;  2G3A A;  3QB8 A;  4C68 A;  4KSF A;  4Q36 A;  1XIX A;  2Z11 A;  4UCM A;  1YX0 A;  2Q04 A;  4U9Z A;  2FT0 A;  2PQ8 A;  3I3G A;  5HMN A;  4E0A A;  4UCN A;  1M1D A;  4AVC A;  2OB0 A;  4CS0 B;  4KOY A;  3ZJ0 A;  1IYL A;  3A9L A;  3TO6 A;  2PC1 A;  2VZY A;  3T90 A;  3TOA A;  2GIV A;  1Y9K A;  2EUI A;  2VBQ A;  3FB3 A;  4MFL A;  3DDD A;  4UCP A;  3D3S A;  2OH1 A;  3TT2 A;  4CGL A;  4FD7 A;  3R9F A;  2Z3M A;  4PK2 A;  2O28 A;  4ONU A;  4B5P B;  4KVM E;  2P6G A;  1LRZ A;  2G0B A;  2R98 A;  2Z0Z A;  2PSW A;  4E2A A;  2DPT A;  4ORF A;  4MFQ A;  3JTK A;  5GCN A;  3ZZI A;  3BJ7 A;  4HNW B;  4B11 A;  4R3K A;  4PSW A;  2EVN A;  1Z4R A;  2X7B A;  2DPS A;  4JWP A;  2HQY A;  3F8K A;  2Q7B A;  5AG5 A;  3K9U A;  2CXA A;  2PR1 A;  1S60 A;  4KS9 A;  1ZO0 A;  4C7H A;  3JVN A;  4MBU A;  3R9E A;  4AVB A;  5DWM A;  4FD6 A;  3I9S A;  2B5G B;  3GKR A;  5G20 A;  2ZXV A;  4ZGY B;  5I0C A;  2OU2 A;  1IB1 E;  4E8O A;  5J8C A;  4LX9 A;  3IGR A;  5A27 A;  3R96 A;  4QUS A;  3R9G A;  3W6S A;  1I1D A;  2D4O A;  1M4D A;  2REE A;  3F5B A;  1S7L A;  4CGP A;  3KKW A;  5IV0 A;  1YLE A;  3JUW A;  2YND A;  1U6M A;  4C2Y A;  3VWD A;  1OZP A;  1B6B A;  2NMT A;  1MJA A;  1CM0 A;  2PDO A;  1V0C A;  2G3T A;  3G8W A;  4CGM A;  1MK4 A;  1ON0 A;  3H5Z A;  2Q0Y A;  4KOS A;  4UFX A;  1I12 A;  4FD5 A;  4XPD C;  4R9M A;  4MY0 A;  3IWE A;  2B3U A;  2H5M A;  2VQY A;  4KOX A;  1RO5 A;  2YGW A;  1R57 A;  2Z3O A;  2OZH A;  2ZW6 A;  3R1K A;  4CYN A;  2YNE A;  3V8I A;  3W6X A;  3BJ8 A;  4OAD A;  1P0H A;  4B14 A;  4GS4 A;  1YGH A;  5H84 A;  5E96 A;  5G1Z A;  2FCK A;  4OLL A;  3S6H A;  1QSO A;  3UY5 A;  5F48 A;  1M4G A;  2B4D A;  3FYN A;  2QML A;  3S6F A;  1NMT A;  1MJ9 A;  3SHP A;  1Z9U A;  2R7H A;  3CXQ A;  4UA3 A;  2BUE A;  1S7K A;  4UFW A;  2C27 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...