3R95A

Crystal structure of microcin c7 self immunity acetyltransferase mcce in complex with acetyl-coa
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
180
structure length
180
Chain Sequence
DVSLTPSGIKVNDEITLLYPALKYAEELYLLINQNKINFIKSMAWPAFVNNISDSVSFIEQSMIDNQNEKALILFIKYKTKIAGVVSFNIIDHANKTAYIGYWLGANFQGKGIVTNAINKLIQEYGDSGVIKRFVIKCIVDNKKSNATALRCGFTLEGVLQKAEILNGVSYDQNIYSKVI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MccE protein
publication title Structural Basis for Microcin C7 Inactivation by the MccE Acetyltransferase.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
total genus 56
structure length 180
sequence length 180
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-03-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 3r95A00
3F8KA 5C82A 3W6XA 4R57A 4Y49C 3T90A 2ZXVA 2DXQA 2ZW6A 3G8WA 1P4NA 3BJ8A 4PSXA 3GYAA 2C27A 4QB9A 4UWIA 4JLYA 4AVBA 3R96A 1XE4A 1Z9UA 1PU9A 2B3UA 5KTCA 1QSMA 2EUIA 1S7NA 1MJ9A 5HMNA 4ORFA 4KLVA 3TO9A 4KVOE 3BJ7A 2J8RA 4KOWA 4KVME 5KTAA 1B6BA 1M4IA 4NEXA 4AB7A 2AE6A 3W91A 4Y49B 3IGRA 1QSTA 3DSBA 2X7BA 1KUVA 1XMTA 2CNTA 1S7FA 4U5YA 5IV0A 2FIAA 1KUYA 1V0CA 2PDOA 2VBQA 1L0CA 4X5KA 5EC4A 2Y0MA 2BL1A 4XPLA 3FNCA 3D3SA 4E2AA 3ZJ0A 2OB0A 1J4JA 3EY5A 2VQYA 3EC4A 3T9YA 4ONUA 2QIRA 2Z10A 3TT2A 4H6UA 2R8VA 2B5GB 4AVCA 4JXRA 2I00A 4GS4A 1IYKA 2VXKA 3FB3A 4KOYA 2B4BA 2P6FA 3S6FA 5H86A 1R57A 5I0CA 2J8NA 1NE9A 2NMTA 1S7KA 3RYOA 5ISVA 1MJBA 2RC4A 2Z11A 2P6GA 4E0AA 4AVAA 1YLEA 2J8MA 2VZYA 1GHEA 4UBRA 3FXTA 4IUSA 4KVXA 4NF1A 1PUAA 4MY3A 3D8PA 4LX9A 4YGOA 5F48A 4JJXA 3SXNA 4CAXA 1CM0A 3DDDA 1N71A 1XEBA 3GKRA 2PRBA 4XPDC 3CXSA 4CS0B 4E8OA 2B3VA 1IYLA 2VEZA 1P0HA 4H89A 4UA3A 2BSWA 4OADA 4CAWA 2WPWA 1S60A 4MI4A 2G3AA 2JLMA 4KLWA 3JVNA 2BEIA 2OZGA 1RO5A 1KZFA 3JUWA 5FVJA 4FD4A 2OZHA 1MK4A 3PP9A 4JWPA 2JEVA 5F46A 1Y9WA 4QVTA 4B5PA 1IB1E 1WWZA 1NSLA 2FL4A 3S6GA 4KOSA 4XPKA 2K5TA 2Q0YA 1YX0A 2F5IA 3K9UA 3TO7A 4ZBGA 1KUXA 5J8FA 4II9A 5F49A 3S6KA 4HNXB 4KZTA 2R7HA 3D2MA 3FYNA 4KORA 2CNMA 2ZW7A 3E0KA 5EBVA 3UY5A 1S3ZA 4M3SA 2ARHA 1XF8A 1TIQA 4HKFA 1S7LA 4MJ8A 3OWCA 2WPXA 1XIXA 3PZJA 3R1KA 3V8IA 2B58A 2G3TA 2B4DB 1K4JA 4LUAA 2FSRA 1BOBA 2I79A 2QMLA 1CJWA 3R9FA 5IB0A 3VWEA 1VKCA 3LD2A 3SXOA 2P0WA 4MBUA 4HNWB 2FIWA 2PR1A 3ZZIA 2VI7A 4KUAA 1I12A 3EXNA 5F47A 2PC1A 4J3GA 3EO4A 4AG9A 4AG7A 2GANA 2HUZA 3TCVA 2CY2A 4OLLA 3R95A 2Q04A 1NMTA 2JDCA 4FD5A 4R3LA 1YVKA 3KKWA 5KTDA 2EVNA 4L89A 4PK2A 4B5OA 4F0YA 3BLNA 2D4PA 1QSRA 1B87A 3WR7A 4NCZA 4M85A 4F6AA 3CXQA 3F0AA 3W6SA 2KCWA 4BMHA 2HV2A 1M4GA 2JDDA 1M1DA 4YFJA 1VHSA 4KUBA 4H6ZA 3EFAA 2Q4VA 4QUSA 2B5GA 3DR6A 3FRMA 5GCNA 3DR8A 3FBUA 4XPDB 5E96A 1Z4RA 1Y7RA 3SHPA 3TTHA 3QAHA 2ZW4A 1BO4A 5C88A 2PQ8A 4QBJA 2ATRA 2D4OA 2HQYA 4UWJA 2FCKA 3D2PA 2IL4A 3B8GA 1Q2CA 1UFHA 2Q4YA 3LODA 4JXQA 2AJ6A 4XNHC 4PV6A 2Z0ZA 5JQ4A 2R1IA 1S5KA 3GY9A 2FT0A 1Q2YA 2BUEA 2VZZA 1QSOA 3TFYA 4QC6A 1YK3A 2REEA 4OAEA 3VWDA 1SQHA 4IF5A 2FE7A 4MY0A 1YVOA 2ZPAA 2GE3A 1I21A 2GIVA 4XNHB 2CNSA 4DNCA 1MJAA 1YR0A 3PGPA 2Q7BA 3R9EA 1Y9KA 4KOXA 1FY7A 3FIXA 3P2HA 1IICA 3TOAA 2PSWA 1Q2DA 5CNPA 3N7ZA 1YREA 5IX3A 5DWMA 2A4NA 4U9YA 4FD7A 3C26A 4PSWA 5DWNA 3I3GA 2FXFA 4R87A 3TE4A 2OH1A 4B5PB 3DNSA 4U9ZA 5JPHA 5H84A 1OZPA 3P2FA 4KOUA 4RI1A 3R9GA 4L8AA 4RS2A 1U6MA 4R9MA 3F5BA 4KOVA 2H5MA 2OU2A 1IIDA 4MHDA 2G0BA 3H4QA 3CXPA 4HNYB 3QB8A 4KOTA 4CAVA 5J8CA 3TO6A 3TOBA 4CRZB 1LRZA 4NSQA 1Z4EA 2R98A 1M44A 1I1DA 1M4DA 4NXYA 3MGDA 4YRHA 1WK4A 3IWGA 4R3KA 2FS5A 2B4DA 1YGHA 4PK3A 4CRYB 1RXTA 3S6HA 4JD6A 2Q44A 2O28A 4FD6A 3NE7A 2REFA 4K30A 5HH1A 2QECA 3G3SA 1ON0A 2OZUA 4EVYA 2PR8A 3I9SA 2ZW5A 4I49A 1QSNA 2P6EA
chains in the Genus database with same CATH superfamily
1LOKA 1BAVA 1XFOA 3CPAA 1HDUA 4C2XA 3F8KA 5C82A 4CGNA 3W6XA 4MFLA 3D7HA 3D67A 4R57A 4Y49C 3T90A 5HVFA 2ZXVA 4M6HA 1X12A 2PJ7A 3WC5A 2DXQA 3PBEA 4PXBA 5LYDA 2ZW6A 3G8WA 1P4NA 3BJ8A 4PSXA 3GYAA 1IGBA 1H8LA 2BOAA 3KL9A 2C27A 4QB9A 3V38A 4UWIA 4UFVA 2V77A 4JLYA 4AVBA 2NSMA 1XE4A 1Z9UA 2CXAA 4FWUA 3R96A 3TC8A 1PU9A 2B3UA 5KTCA 3QNVA 1QSMA 2EUIA 2Q4ZA 2JEWA 1S7NA 2BCOA 4NJQA 1Z2LA 4MHPA 1MJ9A 4CGPA 5HMNA 4ORFA 1Q7LA 4KLVA 4NJRA 4ZI6A 5K8NA 3TO9A 4KVOE 3BJ7A 3S9MA 2J8RA 4KOWA 4KVME 4UFXA 1B6BA 3PFEA 1M4IA 3IIBA 1PYTB 4NEXA 3IU2A 4AB7A 5AG4A 2AE6A 2PIZA 2OOTA 3W91A 7CPAA 3KR5A 4MCPA 4Y49B 1HDQA 3IGRA 1QSTA 3DSBA 4P6YA 1ZLHA 2X7BA 4EMEA 1KUVA 4DJLA 1XMTA 2CNTA 1S7FA 2ODFA 4U5YA 4ZX9A 5IV0A 1BPNA 1BLLE 2FIAA 2RFHA 1KUYA 4UEEA 1V0CA 2Z3PA 4R76A 4A32A 3IJ3A 3IU1A 2PDOA 3GIUA 4C68A 4C7IA 4RN7A 1LANA 2EBJA 2VBQA 1L0CA 2ZEOA 4IAVA 4IHMA 4X5KA 2J9AA 5EC4A 4BBHA 2Y0MA 2BL1A 4KS9A 2CIJA 4XPLA 3FNCA 3D3SA 2PIYA 4E2AA 2G9DA 2PVVA 2C6PA 2V8GA 2OB0A 1J4JA 3ZJ0A 3EY5A 2VQYA 3D68A 3EC4A 3T9YA 4ONUA 5K8PA 2QIRA 2Z10A 3VH9A 2YNCA 3TT2A 4H6UA 2R8VA 2B5GB 4AVCA 4JXRA 2I00A 3N5FA 2Z3LA 1Z8TA 3KZWA 4GS4A 1VGYA 1IYKA 1R43A 2VXKA 3FB3A 4KOYA 2B4BA 3IWWA 2P6FA 4WJBA 3S6FA 5F09A 5H86A 1X10A 2EK9A 1R57A 5I0CA 3B3SA 2J8NA 4FBEA 1NE9A 5LYFA 1FT7A 2NMTA 1S7KA 1LAMA 3RYOA 5ISVA 1MJBA 4NGMA 5CBMA 1ZG8A 4FAIA 2RC4A 3WC6A 1LAPA 2Z11A 2P6GA 4P4IA 4E0AA 2ZEEA 4AVAA 2QYVA 3D4UA 3PB9X 1YLEA 2J8MA 2VZYA 1Y7EA 1GHEA 1ZG7A 4UBRA 3FXTA 4IUSA 1YW4A 2C6CA 2GU2A 4H2KA 3CT9A 3IEHA 2PJ4A 4KVXA 4NF1A 4NGNA 1PUAA 1FNOA 4MY3A 3CDXA 3D8PA 4LX9A 4YGOA 2CTBA 5F48A 3K2KA 4JJXA 3SXNA 3B7IA 4CAXA 4NGSA 1CM0A 3I1UA 2BO9A 3DDDA 5EMIA 1N71A 1XEBA 3SJEA 2PJ5A 3GKRA 4OC4A 2PRBA 4XPDC 3CXSA 4CS0B 4A31A 4E8OA 2O53A 2V8HA 4OIWA 1CP6A 2B3VA 2O4HA 1A2ZA 1IU8A 1IYLA 4ONWA 5DS0A 1CG2A 1YLOA 2VEZA 2EWBA 1P0HA 4H89A 4UA3A 2BSWA 3DGVA 4OADA 4UIBA 5G1ZA 4CAWA 4UCMA 1NSAA 2WPWA 3L2NA 4NGRA 5BWAB 1S60A 4MI4A 4X3RA 2G3AA 2JLMA 5K8MA 4KLWA 3JVNA 2BEIA 1AUGA 3KHZA 4LQ6A 1QMUA 3PB4X 3FEDA 4ZGYB 1BPMA 4MHZA 3WABA 4MFZA 2OZGA 1RO5A 5IB9A 1KZFA 3JUWA 5FVJA 5A27A 1F57A 4FD4A 2ZOFA 1XBUA 2ABZA 4HPSA 2OZHA 1MK4A 3PP9A 1Z8LA 4JWPA 2JEVA 4A30A 5F46A 1Y9WA 4ZY2A 4QVTA 4B5PA 3B35A 3BI1A 4A33A 2EK8A 2Z3MA 1IB1E 3K9TA 1WWZA 2YNEA 4G1PA 2FL4A 4TNUA 1NSLA 4A95A 3S6GA 4A94A 4KOSA 4XPKA 5G22A 2K5TA 3PBBA 2Q0YA 1YX0A 1XMBA 2F5IA 1RTQA 2JBJA 3K9UA 4X2TA 3TO7A 2I3CA 3SI2A 3V7ZA 4EFDA 1CP7A 1TF9A 1VHEA 4TWEA 4ZBGA 5JH9A 4OC5A 1KUXA 5G20A 4OIDA 4UFWA 4OC0A 1ZLIA 5THWA 5J8FA 4II9A 5LRKA 5F49A 3S6KA 3WC7A 4HNXB 4KZTA 4OC3A 2R7HA 3D2MA 1QQ9A 3FYNA 4KORA 2CNMA 4NGQA 1Y0YA 2ZW7A 3E0KA 2XEFA 5EBVA 3UY5A 2AFMA 1S3ZA 4UIAA 4B6ZA 4M3SA 2ZELA 2ARHA 1XF8A 1TIQA 4CGMA 4HKFA 1Z8XA 4P4FA 1S7LA 4MJ8A 3OWCA 2WPXA 1XOVA 4C2YA 1XIXA 3PZJA 3R1KA 3V8IA 3FEEA 1YSJA 4CPAA 2B58A 2AFSA 4CYQA 2G3TA 4EWTA 4R8FA 2B4DB 1K4JA 4LUAA 2FSRA 1BOBA 3A9LA 3GUXA 2I79A 2PJ1A 4NGPA 2QMLA 1CJWA 1IY7A 2ZEMA 5CPAA 2YGWA 3KR4A 3R9FA 5IB0A 3IWEA 3VWEA 1VKCA 3LD2A 3NE8A 1HEEA 5LRGA 4IK2A 1TXRA 4UEZA 1ZO0A 3PB6X 3SXOA 2P0WA 4MBUA 2WZNA 4PXDA 4HNWB 2ZEGA 4UF4A 2FIWA 4F0XA 2PR1A 3B2YA 5LRJA 4PXEA 3SJGA 3ZZIA 3T8WA 2VI7A 4Q36A 4KSFA 2HC9A 4KUAA 4YU9A 1I12A 3EXNA 2ZEPA 5F47A 2PC1A 1CBXA 4J3GA 3D7FA 2POKA 4X8IA 1YQEA 2FVGA 3EO4A 4AG9A 3B3TA 4W9YA 4UCNA 1F2PA 2AFWA 4PQAA 4Q7AA 3RZAA 4AG7A 4MHYA 2Z3KA 4FUUA 4Q38A 4KSAA 1R3NA 2GANA 2DPSA 3IC1A 2AFZA 4MCSA 4C2ZA 5HVGA 2HUZA 3KQXA 3TCVA 1ZG9A 2CY2A 2GREA 4OLLA 3NH8A 1LFWA 4K3NA 3R95A 2Q04A 3H8FA 5D29A 4MFQA 5HXDA 5A28A 1NMTA 2JDCA 4FD5A 1JQGA 4R3LA 4B11A 3RO0A 1YVKA 3KKWA 3JTKA 2EVNA 3PFOA 5KTDA 4KSIA 1TKHA 4P4BA 4L89A 4PK2A 1Y0RA 2ZEHA 2Z3NA 5JGFA 3FJUA 4B5OA 1GYTA 3CPXA 2ZEFA 2PJ9A 3BLNA 4F0YA 1DTDA 1ELLP 1VIXA 2F7VA 3PB8X 4OC2A 3CZXA 5G21A 2D4PA 1QSRA 3FF3A 4BINA 2ZOGA 3S9LA 4UCPA 1B87A 2Q7SA 3WR7A 4NCZA 2YNCC 4M85A 4NGTA 3RAMA 4F6AA 3CXQA 3F0AA 5HVHA 3HLPA 3W6SA 2PCUA 2KCWA 4BMHA 1TKFA 2HV2A 1M4GA 2JDDA 5AG6A 1AMPA 1M1DA 2VL1A 2ANPA 4YFJA 1VHSA 4KUBA 5LYLA 4H6ZA 2PJ8A 4PPZA 3EFAA 4MFPA 3B3VA 2Q4VA 3D66A 4QUSA 2B5GA 3DR6A 4MCRA 2PJBA 3GLJA 3FRMA 3H8EA 3HUVA 5GCNA 3DR8A 3FBUA 4XPDB 5E96A 1Z4RA 1Y7RA 3SHPA 4DYOA 3FX6A 4UEFA 2PJCA 2AFUA 2ZENA 3ISZA 2ZW4A 1BO4A 3QAHA 3TTHA 3LACA 2CTCA 3BI0A 2GFQA 1YW6A 4CAFA 2GLFA 5C88A 2PQ8A 1ARMA 4ZY0A 4QBJA 5I4MA 1Z8WA 2RB7A 2ATRA 2C6GA 4DUKA 2D4OA 4MRIA 4OMEA 1CPXA 2HQYA 4CGOA 1ELMP 4NFRA 5AGEA 4UWJA 1XJOA 3D7DA 2FCKA 1AYEA 4F9UA 3D2PA 2PJ2A 4ZYQA 2IL4A 2PJ3A 2IMOA 3B8GA 4A39A 4B13A 1Q2CA 1VHOA 4MFJA 1UFHA 2Q4YA 8CPAA 5J1QA 1UWYA 3LODA 4JXQA 4O23A 2QJ8A 2AJ6A 1ARLA 3BHXA 2DEAA 2YNDA 2V8DA 2NYQA 4A38A 4OC1A 3FH4A 4XNHC 4PV6A 4JZ0A 2QVPA 2Z0ZA 3KHXA 2R1IA 1EE3P 2OR4A 5JQ4A 2CF4A 4CYPA 3PEIA 4B10A 1S5KA 2DPTA 2PJ0A 3NA6A 2IQ6A 1Q2YA 1OBRA 2FT0A 1M4LA 2Z3OA 3GY9A 2BUEA 3JRUA 3LWUA 1CX8A 4M6GA 5AG7A 2VZZA 3KI9A 4A37A 1QSOA 3TFYA 5LYIA 4Z65A 2EO8A 4JYWA 1IOIA 4QC6A 1YK3A 5JM6A 1XRYA 2REEA 4OAEA 1KWMA 3VWDA 1LCPA 4P4EA 3ISXA 4BD9A 4CGLA 2XEGA 3SJXA 1SQHA 4IF5A 2FE7A 4MY0A 4RUHA 3IFEA 1YVOA 2Q43A 2ZPAA 2GE3A 1F2OA 1I21A 1IOFA 4P4JA 3SJFA 2GIVA 2WUUA 2XEIA 4B14A 2ZEDA 4XNHB 2C1CA 2CNSA 4MMOA 4DNCA 1MJAA 4MHNA 4OP4A 3VARA 3TX8A 4R6TA 1YR0A 4B12A 3PGPA 2Q7BA 3R9EA 1PCAA 1Y9KA 2Q51A 4KOXA 3DLJA 4ZY1A 1FY7A 3FIXA 4CYOA 4P4DA 4LQGA 4C7HA 3P2HA 1IICA 3S9NA 3TOAA 2PJ6A 2PSWA 1Q2DA 3KASA 5CNPA 3FMCA 1DE4C 1YREA 3MN8A 3N7ZA 2A4NA 3NH5A 5DWMA 4U9YA 4A2ZA 6CPAA 5IX3A 2AFXA 4FD7A 3B3CA 3C26A 4PSWA 5DWNA 4YWYA 4AXVA 3SI0A 3PB7X 3I3GA 1CPSA 2FXFA 4R87A 3TE4A 2OH1A 4B5PB 2F8HA 1TKJA 3DNSA 3QAYA 3GB0A 2PRQA 4F9VA 5KTAA 2JBKA 4U9ZA 5JPHA 2DF5A 4MFKA 5H84A 1JWQA 1Z5RA 2HB6A 1OZPA 3P2FA 4PXCA 3D7GA 2PJAA 3VATA 4KOUA 4RI1A 3R9GA 3NH4A 4CYNA 3B3WA 3H5ZA 4GM5A 4L8AA 1U6MA 4R9MA 4RS2A 3F5BA 4KOVA 2H5MA 3PRTA 3FVLA 2OU2A 4P45A 3WT4A 1IIDA 4MHDA 2V8VA 2G0BA 4MCQA 3H4QA 3RNZA 4ZX8A 3CXPA 4HNYB 2GLJA 3QB8A 4KOTA 4CAVA 5J8CA 3TO6A 3TOBA 4WWVA 4OKOA 1TF8A 4P10A 1LRZA 2WSAA 1Z4EA 4NSQA 2WYRA 2R98A 4CRZB 1M44A 4R7MA 1I1DA 1M4DA 2PE3A 4NXYA 4M6IA 3MGDA 4YRHA 1WK4A 4GXHA 3IWGA 4R3KA 2FS5A 2B4DA 2XEJA 3LMSA 3NFZA 5K8OA 4CAEA 3SI1A 1YGHA 2AFOA 4PK3A 4CRYB 1RXTA 2PVWA 5D8NA 3S6HA 4JD6A 5AG5A 5ELYA 3KGQA 3IO1A 2Q44A 4F8ZA 2O28A 4FD6A 3BXMA 3NE7A 3RBUA 3FECA 2REFA 4K30A 5HH1A 2QECA 3KQZA 3G3SA 2IJZA 1ON0A 2OZUA 4EVYA 2PR8A 3I9SA 2ZW5A 4I49A 1QSNA 3MRUA 4P44A 1YMEA 2P6EA 4MXUA 3H8GA
chains in the Genus database with same CATH topology
4C2XA 3F8KA 5C82A 4CGNA 3W6XA 4MFLA 4R57A 4Y49C 3T90A 2ZXVA 2DXQA 2ZW6A 3G8WA 1P4NA 3BJ8A 4PSXA 3GYAA 2C27A 4QB9A 4UWIA 4UFVA 4JLYA 4AVBA 3R96A 1XE4A 1Z9UA 2CXAA 1PU9A 2B3UA 5KTCA 1QSMA 2EUIA 1S7NA 1MJ9A 4CGPA 5HMNA 4ORFA 4KLVA 3TO9A 4KVOE 3BJ7A 2J8RA 4KOWA 4KVME 4UFXA 1B6BA 5KTAA 1M4IA 4NEXA 5AG4A 3IU2A 4AB7A 2AE6A 3W91A 4Y49B 3IGRA 1QSTA 3DSBA 2X7BA 1KUVA 1XMTA 2CNTA 1S7FA 4U5YA 5IV0A 2FIAA 1KUYA 1V0CA 2Z3PA 4A32A 3IU1A 2PDOA 4C7IA 4C68A 2VBQA 1L0CA 4X5KA 4BBHA 5EC4A 2Y0MA 2BL1A 4KS9A 4XPLA 3FNCA 3D3SA 4E2AA 3ZJ0A 2OB0A 1J4JA 3EY5A 2VQYA 3EC4A 3T9YA 4ONUA 2QIRA 2Z10A 2YNCA 3TT2A 4H6UA 2R8VA 2B5GB 4AVCA 4JXRA 2I00A 2Z3LA 4GS4A 1IYKA 2VXKA 3FB3A 4KOYA 2B4BA 2P6FA 3S6FA 5H86A 1R57A 5I0CA 2J8NA 1NE9A 2NMTA 1S7KA 3RYOA 5ISVA 1MJBA 2RC4A 2Z11A 2P6GA 4E0AA 4AVAA 1YLEA 2J8MA 2VZYA 1GHEA 4UBRA 3FXTA 4IUSA 4KVXA 4NF1A 1PUAA 4MY3A 3D8PA 4LX9A 4YGOA 5F48A 4JJXA 3SXNA 4CAXA 1CM0A 3DDDA 1N71A 1XEBA 3GKRA 2PRBA 4XPDC 3CXSA 4CS0B 4A31A 4E8OA 2B3VA 1IYLA 2VEZA 1P0HA 4H89A 4UA3A 2BSWA 4OADA 5G1ZA 4CAWA 4UCMA 2WPWA 5BWAB 1S60A 4MI4A 2G3AA 2JLMA 4KLWA 3JVNA 2BEIA 4ZGYB 4MFZA 2OZGA 1RO5A 1KZFA 3JUWA 5FVJA 5A27A 4FD4A 2OZHA 1MK4A 3PP9A 4JWPA 2JEVA 4A30A 5F46A 1Y9WA 4QVTA 4B5PA 4A33A 2Z3MA 1IB1E 4A95A 1WWZA 2YNEA 1NSLA 2FL4A 3S6GA 4KOSA 4XPKA 5G22A 2K5TA 2Q0YA 1YX0A 2F5IA 3K9UA 3TO7A 4ZBGA 1KUXA 5G20A 4UFWA 5J8FA 4II9A 5F49A 3S6KA 4HNXB 4KZTA 2R7HA 3D2MA 3FYNA 4KORA 2CNMA 2ZW7A 3E0KA 5EBVA 3UY5A 1S3ZA 4M3SA 2ARHA 1XF8A 1TIQA 4CGMA 4HKFA 1S7LA 4MJ8A 3OWCA 2WPXA 4C2YA 1XIXA 3PZJA 3R1KA 3V8IA 2B58A 4CYQA 2G3TA 2B4DB 1K4JA 4LUAA 2FSRA 1BOBA 3A9LA 2I79A 2QMLA 1CJWA 2YGWA 3R9FA 5IB0A 3IWEA 3VWEA 1VKCA 3LD2A 1ZO0A 3SXOA 2P0WA 4MBUA 4HNWB 2FIWA 4F0XA 2PR1A 3ZZIA 2VI7A 4Q36A 4KSFA 4KUAA 1I12A 3EXNA 5F47A 2PC1A 4J3GA 3EO4A 4AG9A 4UCNA 4AG7A 2Z3KA 4Q38A 4KSAA 2GANA 2DPSA 4C2ZA 2HUZA 3TCVA 2CY2A 4OLLA 3R95A 2Q04A 4MFQA 5A28A 1NMTA 2JDCA 4FD5A 4R3LA 4B11A 1YVKA 3KKWA 3JTKA 2EVNA 5KTDA 4L89A 4PK2A 2Z3NA 4B5OA 4F0YA 3BLNA 5G21A 2D4PA 1QSRA 4UCPA 1B87A 3WR7A 4NCZA 2YNCC 4M85A 4F6AA 3CXQA 3F0AA 3W6SA 2KCWA 4BMHA 2HV2A 1M4GA 2JDDA 5AG6A 1M1DA 4YFJA 1VHSA 4KUBA 4H6ZA 3EFAA 4MFPA 2Q4VA 4QUSA 2B5GA 3DR6A 3FRMA 5GCNA 3DR8A 3FBUA 4XPDB 5E96A 1Z4RA 1Y7RA 3SHPA 3TTHA 3QAHA 2ZW4A 1BO4A 4CAFA 5C88A 2PQ8A 4QBJA 2ATRA 2D4OA 4CGOA 2HQYA 5AGEA 4UWJA 2FCKA 3D2PA 2IL4A 3B8GA 4B13A 1Q2CA 4MFJA 1UFHA 2Q4YA 3LODA 4JXQA 2AJ6A 2YNDA 4XNHC 4PV6A 2Z0ZA 5JQ4A 2R1IA 4CYPA 4B10A 1S5KA 2DPTA 3GY9A 2FT0A 1Q2YA 2Z3OA 5AG7A 2BUEA 2VZZA 1QSOA 3TFYA 4QC6A 1YK3A 2REEA 4OAEA 3VWDA 4CGLA 1SQHA 4IF5A 2FE7A 4MY0A 1YVOA 2ZPAA 2GE3A 1I21A 2GIVA 2WUUA 4B14A 4XNHB 2CNSA 4DNCA 1MJAA 4B12A 1YR0A 3PGPA 2Q7BA 3R9EA 1Y9KA 4KOXA 1FY7A 3FIXA 4CYOA 4C7HA 3P2HA 1IICA 3TOAA 2PSWA 1Q2DA 5CNPA 3N7ZA 1YREA 5IX3A 5DWMA 2A4NA 4A2ZA 4U9YA 4FD7A 3C26A 4PSWA 5DWNA 3I3GA 2FXFA 4R87A 3TE4A 2OH1A 4B5PB 3DNSA 4U9ZA 5JPHA 4MFKA 5H84A 1OZPA 3P2FA 4KOUA 4RI1A 3R9GA 4CYNA 3H5ZA 4L8AA 4RS2A 1U6MA 4R9MA 3F5BA 4KOVA 2H5MA 2OU2A 1IIDA 4MHDA 2G0BA 3H4QA 3CXPA 4HNYB 3QB8A 4KOTA 4CAVA 5J8CA 3TO6A 3TOBA 4CRZB 1LRZA 2WSAA 1Z4EA 4NSQA 2R98A 1M44A 1I1DA 1M4DA 4NXYA 3MGDA 4YRHA 1WK4A 3IWGA 4R3KA 2FS5A 2B4DA 4CAEA 1YGHA 4PK3A 4CRYB 1RXTA 3S6HA 4JD6A 5AG5A 2Q44A 2O28A 4FD6A 3NE7A 2REFA 4K30A 5HH1A 2QECA 3G3SA 1ON0A 2OZUA 4EVYA 2PR8A 3I9SA 2ZW5A 4I49A 1QSNA 2P6EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3F8K A;  5C82 A;  3W6X A;  4R57 A;  4Y49 C;  3T90 A;  2ZXV A;  2DXQ A;  2ZW6 A;  3G8W A;  1P4N A;  3BJ8 A;  4PSX A;  3GYA A;  2C27 A;  4QB9 A;  4UWI A;  4JLY A;  4AVB A;  3R96 A;  1XE4 A;  1Z9U A;  1PU9 A;  2B3U A;  5KTC A;  1QSM A;  2EUI A;  1S7N A;  1MJ9 A;  5HMN A;  4ORF A;  4KLV A;  3TO9 A;  4KVO E;  3BJ7 A;  2J8R A;  4KOW A;  4KVM E;  5KTA A;  1B6B A;  1M4I A;  4NEX A;  4AB7 A;  2AE6 A;  3W91 A;  4Y49 B;  3IGR A;  1QST A;  3DSB A;  2X7B A;  1KUV A;  1XMT A;  2CNT A;  1S7F A;  4U5Y A;  5IV0 A;  2FIA A;  1KUY A;  1V0C A;  2PDO A;  2VBQ A;  1L0C A;  4X5K A;  5EC4 A;  2Y0M A;  2BL1 A;  4XPL A;  3FNC A;  3D3S A;  4E2A A;  3ZJ0 A;  2OB0 A;  1J4J A;  3EY5 A;  2VQY A;  3EC4 A;  3T9Y A;  4ONU A;  2QIR A;  2Z10 A;  3TT2 A;  4H6U A;  2R8V A;  2B5G B;  4AVC A;  4JXR A;  2I00 A;  4GS4 A;  1IYK A;  2VXK A;  3FB3 A;  4KOY A;  2B4B A;  2P6F A;  3S6F A;  5H86 A;  1R57 A;  5I0C A;  2J8N A;  1NE9 A;  2NMT A;  1S7K A;  3RYO A;  5ISV A;  1MJB A;  2RC4 A;  2Z11 A;  2P6G A;  4E0A A;  4AVA A;  1YLE A;  2J8M A;  2VZY A;  1GHE A;  4UBR A;  3FXT A;  4IUS A;  4KVX A;  4NF1 A;  1PUA A;  4MY3 A;  3D8P A;  4LX9 A;  4YGO A;  5F48 A;  4JJX A;  3SXN A;  4CAX A;  1CM0 A;  3DDD A;  1N71 A;  1XEB A;  3GKR A;  2PRB A;  4XPD C;  3CXS A;  4CS0 B;  4E8O A;  2B3V A;  1IYL A;  2VEZ A;  1P0H A;  4H89 A;  4UA3 A;  2BSW A;  4OAD A;  4CAW A;  2WPW A;  1S60 A;  4MI4 A;  2G3A A;  2JLM A;  4KLW A;  3JVN A;  2BEI A;  2OZG A;  1RO5 A;  1KZF A;  3JUW A;  5FVJ A;  4FD4 A;  2OZH A;  1MK4 A;  3PP9 A;  4JWP A;  2JEV A;  5F46 A;  1Y9W A;  4QVT A;  4B5P A;  1IB1 E;  1WWZ A;  1NSL A;  2FL4 A;  3S6G A;  4KOS A;  4XPK A;  2K5T A;  2Q0Y A;  1YX0 A;  2F5I A;  3K9U A;  3TO7 A;  4ZBG A;  1KUX A;  5J8F A;  4II9 A;  5F49 A;  3S6K A;  4HNX B;  4KZT A;  2R7H A;  3D2M A;  3FYN A;  4KOR A;  2CNM A;  2ZW7 A;  3E0K A;  5EBV A;  3UY5 A;  1S3Z A;  4M3S A;  2ARH A;  1XF8 A;  1TIQ A;  4HKF A;  1S7L A;  4MJ8 A;  3OWC A;  2WPX A;  1XIX A;  3PZJ A;  3R1K A;  3V8I A;  2B58 A;  2G3T A;  2B4D B;  1K4J A;  4LUA A;  2FSR A;  1BOB A;  2I79 A;  2QML A;  1CJW A;  3R9F A;  5IB0 A;  3VWE A;  1VKC A;  3LD2 A;  3SXO A;  2P0W A;  4MBU A;  4HNW B;  2FIW A;  2PR1 A;  3ZZI A;  2VI7 A;  4KUA A;  1I12 A;  3EXN A;  5F47 A;  2PC1 A;  4J3G A;  3EO4 A;  4AG9 A;  4AG7 A;  2GAN A;  2HUZ A;  3TCV A;  2CY2 A;  4OLL A;  3R95 A;  2Q04 A;  1NMT A;  2JDC A;  4FD5 A;  4R3L A;  1YVK A;  3KKW A;  5KTD A;  2EVN A;  4L89 A;  4PK2 A;  4B5O A;  4F0Y A;  3BLN A;  2D4P A;  1QSR A;  1B87 A;  3WR7 A;  4NCZ A;  4M85 A;  4F6A A;  3CXQ A;  3F0A A;  3W6S A;  2KCW A;  4BMH A;  2HV2 A;  1M4G A;  2JDD A;  1M1D A;  4YFJ A;  1VHS A;  4KUB A;  4H6Z A;  3EFA A;  2Q4V A;  4QUS A;  2B5G A;  3DR6 A;  3FRM A;  5GCN A;  3DR8 A;  3FBU A;  4XPD B;  5E96 A;  1Z4R A;  1Y7R A;  3SHP A;  3TTH A;  3QAH A;  2ZW4 A;  1BO4 A;  5C88 A;  2PQ8 A;  4QBJ A;  2ATR A;  2D4O A;  2HQY A;  4UWJ A;  2FCK A;  3D2P A;  2IL4 A;  3B8G A;  1Q2C A;  1UFH A;  2Q4Y A;  3LOD A;  4JXQ A;  2AJ6 A;  4XNH C;  4PV6 A;  2Z0Z A;  5JQ4 A;  2R1I A;  1S5K A;  3GY9 A;  2FT0 A;  1Q2Y A;  2BUE A;  2VZZ A;  1QSO A;  3TFY A;  4QC6 A;  1YK3 A;  2REE A;  4OAE A;  3VWD A;  1SQH A;  4IF5 A;  2FE7 A;  4MY0 A;  1YVO A;  2ZPA A;  2GE3 A;  1I21 A;  2GIV A;  4XNH B;  2CNS A;  4DNC A;  1MJA A;  1YR0 A;  3PGP A;  2Q7B A;  3R9E A;  1Y9K A;  4KOX A;  1FY7 A;  3FIX A;  3P2H A;  1IIC A;  3TOA A;  2PSW A;  1Q2D A;  5CNP A;  3N7Z A;  1YRE A;  5IX3 A;  5DWM A;  2A4N A;  4U9Y A;  4FD7 A;  3C26 A;  4PSW A;  5DWN A;  3I3G A;  2FXF A;  4R87 A;  3TE4 A;  2OH1 A;  4B5P B;  3DNS A;  4U9Z A;  5JPH A;  5H84 A;  1OZP A;  3P2F A;  4KOU A;  4RI1 A;  3R9G A;  4L8A A;  4RS2 A;  1U6M A;  4R9M A;  3F5B A;  4KOV A;  2H5M A;  2OU2 A;  1IID A;  4MHD A;  2G0B A;  3H4Q A;  3CXP A;  4HNY B;  3QB8 A;  4KOT A;  4CAV A;  5J8C A;  3TO6 A;  3TOB A;  4CRZ B;  1LRZ A;  4NSQ A;  1Z4E A;  2R98 A;  1M44 A;  1I1D A;  1M4D A;  4NXY A;  3MGD A;  4YRH A;  1WK4 A;  3IWG A;  4R3K A;  2FS5 A;  2B4D A;  1YGH A;  4PK3 A;  4CRY B;  1RXT A;  3S6H A;  4JD6 A;  2Q44 A;  2O28 A;  4FD6 A;  3NE7 A;  2REF A;  4K30 A;  5HH1 A;  2QEC A;  3G3S A;  1ON0 A;  2OZU A;  4EVY A;  2PR8 A;  3I9S A;  2ZW5 A;  4I49 A;  1QSN A;  2P6E A; 
#chains in the Genus database with same CATH topology
 1LOK A;  1BAV A;  1XFO A;  3CPA A;  1HDU A;  4C2X A;  3F8K A;  5C82 A;  4CGN A;  3W6X A;  4MFL A;  3D7H A;  3D67 A;  4R57 A;  4Y49 C;  3T90 A;  5HVF A;  2ZXV A;  4M6H A;  1X12 A;  2PJ7 A;  3WC5 A;  2DXQ A;  3PBE A;  4PXB A;  5LYD A;  2ZW6 A;  3G8W A;  1P4N A;  3BJ8 A;  4PSX A;  3GYA A;  1IGB A;  1H8L A;  2BOA A;  3KL9 A;  2C27 A;  4QB9 A;  3V38 A;  4UWI A;  4UFV A;  2V77 A;  4JLY A;  4AVB A;  2NSM A;  1XE4 A;  1Z9U A;  2CXA A;  4FWU A;  3R96 A;  3TC8 A;  1PU9 A;  2B3U A;  5KTC A;  3QNV A;  1QSM A;  2EUI A;  2Q4Z A;  2JEW A;  1S7N A;  2BCO A;  4NJQ A;  1Z2L A;  4MHP A;  1MJ9 A;  4CGP A;  5HMN A;  4ORF A;  1Q7L A;  4KLV A;  4NJR A;  4ZI6 A;  5K8N A;  3TO9 A;  4KVO E;  3BJ7 A;  3S9M A;  2J8R A;  4KOW A;  4KVM E;  4UFX A;  1B6B A;  3PFE A;  1M4I A;  3IIB A;  1PYT B;  4NEX A;  3IU2 A;  4AB7 A;  5AG4 A;  2AE6 A;  2PIZ A;  2OOT A;  3W91 A;  7CPA A;  3KR5 A;  4MCP A;  4Y49 B;  1HDQ A;  3IGR A;  1QST A;  3DSB A;  4P6Y A;  1ZLH A;  2X7B A;  4EME A;  1KUV A;  4DJL A;  1XMT A;  2CNT A;  1S7F A;  2ODF A;  4U5Y A;  4ZX9 A;  5IV0 A;  1BPN A;  1BLL E;  2FIA A;  2RFH A;  1KUY A;  4UEE A;  1V0C A;  2Z3P A;  4R76 A;  4A32 A;  3IJ3 A;  3IU1 A;  2PDO A;  3GIU A;  4C68 A;  4C7I A;  4RN7 A;  1LAN A;  2EBJ A;  2VBQ A;  1L0C A;  2ZEO A;  4IAV A;  4IHM A;  4X5K A;  2J9A A;  5EC4 A;  4BBH A;  2Y0M A;  2BL1 A;  4KS9 A;  2CIJ A;  4XPL A;  3FNC A;  3D3S A;  2PIY A;  4E2A A;  2G9D A;  2PVV A;  2C6P A;  2V8G A;  2OB0 A;  1J4J A;  3ZJ0 A;  3EY5 A;  2VQY A;  3D68 A;  3EC4 A;  3T9Y A;  4ONU A;  5K8P A;  2QIR A;  2Z10 A;  3VH9 A;  2YNC A;  3TT2 A;  4H6U A;  2R8V A;  2B5G B;  4AVC A;  4JXR A;  2I00 A;  3N5F A;  2Z3L A;  1Z8T A;  3KZW A;  4GS4 A;  1VGY A;  1IYK A;  1R43 A;  2VXK A;  3FB3 A;  4KOY A;  2B4B A;  3IWW A;  2P6F A;  4WJB A;  3S6F A;  5F09 A;  5H86 A;  1X10 A;  2EK9 A;  1R57 A;  5I0C A;  3B3S A;  2J8N A;  4FBE A;  1NE9 A;  5LYF A;  1FT7 A;  2NMT A;  1S7K A;  1LAM A;  3RYO A;  5ISV A;  1MJB A;  4NGM A;  5CBM A;  1ZG8 A;  4FAI A;  2RC4 A;  3WC6 A;  1LAP A;  2Z11 A;  2P6G A;  4P4I A;  4E0A A;  2ZEE A;  4AVA A;  2QYV A;  3D4U A;  3PB9 X;  1YLE A;  2J8M A;  2VZY A;  1Y7E A;  1GHE A;  1ZG7 A;  4UBR A;  3FXT A;  4IUS A;  1YW4 A;  2C6C A;  2GU2 A;  4H2K A;  3CT9 A;  3IEH A;  2PJ4 A;  4KVX A;  4NF1 A;  4NGN A;  1PUA A;  1FNO A;  4MY3 A;  3CDX A;  3D8P A;  4LX9 A;  4YGO A;  2CTB A;  5F48 A;  3K2K A;  4JJX A;  3SXN A;  3B7I A;  4CAX A;  4NGS A;  1CM0 A;  3I1U A;  2BO9 A;  3DDD A;  5EMI A;  1N71 A;  1XEB A;  3SJE A;  2PJ5 A;  3GKR A;  4OC4 A;  2PRB A;  4XPD C;  3CXS A;  4CS0 B;  4A31 A;  4E8O A;  2O53 A;  2V8H A;  4OIW A;  1CP6 A;  2B3V A;  2O4H A;  1A2Z A;  1IU8 A;  1IYL A;  4ONW A;  5DS0 A;  1CG2 A;  1YLO A;  2VEZ A;  2EWB A;  1P0H A;  4H89 A;  4UA3 A;  2BSW A;  3DGV A;  4OAD A;  4UIB A;  5G1Z A;  4CAW A;  4UCM A;  1NSA A;  2WPW A;  3L2N A;  4NGR A;  5BWA B;  1S60 A;  4MI4 A;  4X3R A;  2G3A A;  2JLM A;  5K8M A;  4KLW A;  3JVN A;  2BEI A;  1AUG A;  3KHZ A;  4LQ6 A;  1QMU A;  3PB4 X;  3FED A;  4ZGY B;  1BPM A;  4MHZ A;  3WAB A;  4MFZ A;  2OZG A;  1RO5 A;  5IB9 A;  1KZF A;  3JUW A;  5FVJ A;  5A27 A;  1F57 A;  4FD4 A;  2ZOF A;  1XBU A;  2ABZ A;  4HPS A;  2OZH A;  1MK4 A;  3PP9 A;  1Z8L A;  4JWP A;  2JEV A;  4A30 A;  5F46 A;  1Y9W A;  4ZY2 A;  4QVT A;  4B5P A;  3B35 A;  3BI1 A;  4A33 A;  2EK8 A;  2Z3M A;  1IB1 E;  3K9T A;  1WWZ A;  2YNE A;  4G1P A;  2FL4 A;  4TNU A;  1NSL A;  4A95 A;  3S6G A;  4A94 A;  4KOS A;  4XPK A;  5G22 A;  2K5T A;  3PBB A;  2Q0Y A;  1YX0 A;  1XMB A;  2F5I A;  1RTQ A;  2JBJ A;  3K9U A;  4X2T A;  3TO7 A;  2I3C A;  3SI2 A;  3V7Z A;  4EFD A;  1CP7 A;  1TF9 A;  1VHE A;  4TWE A;  4ZBG A;  5JH9 A;  4OC5 A;  1KUX A;  5G20 A;  4OID A;  4UFW A;  4OC0 A;  1ZLI A;  5THW A;  5J8F A;  4II9 A;  5LRK A;  5F49 A;  3S6K A;  3WC7 A;  4HNX B;  4KZT A;  4OC3 A;  2R7H A;  3D2M A;  1QQ9 A;  3FYN A;  4KOR A;  2CNM A;  4NGQ A;  1Y0Y A;  2ZW7 A;  3E0K A;  2XEF A;  5EBV A;  3UY5 A;  2AFM A;  1S3Z A;  4UIA A;  4B6Z A;  4M3S A;  2ZEL A;  2ARH A;  1XF8 A;  1TIQ A;  4CGM A;  4HKF A;  1Z8X A;  4P4F A;  1S7L A;  4MJ8 A;  3OWC A;  2WPX A;  1XOV A;  4C2Y A;  1XIX A;  3PZJ A;  3R1K A;  3V8I A;  3FEE A;  1YSJ A;  4CPA A;  2B58 A;  2AFS A;  4CYQ A;  2G3T A;  4EWT A;  4R8F A;  2B4D B;  1K4J A;  4LUA A;  2FSR A;  1BOB A;  3A9L A;  3GUX A;  2I79 A;  2PJ1 A;  4NGP A;  2QML A;  1CJW A;  1IY7 A;  2ZEM A;  5CPA A;  2YGW A;  3KR4 A;  3R9F A;  5IB0 A;  3IWE A;  3VWE A;  1VKC A;  3LD2 A;  3NE8 A;  1HEE A;  5LRG A;  4IK2 A;  1TXR A;  4UEZ A;  1ZO0 A;  3PB6 X;  3SXO A;  2P0W A;  4MBU A;  2WZN A;  4PXD A;  4HNW B;  2ZEG A;  4UF4 A;  2FIW A;  4F0X A;  2PR1 A;  3B2Y A;  5LRJ A;  4PXE A;  3SJG A;  3ZZI A;  3T8W A;  2VI7 A;  4Q36 A;  4KSF A;  2HC9 A;  4KUA A;  4YU9 A;  1I12 A;  3EXN A;  2ZEP A;  5F47 A;  2PC1 A;  1CBX A;  4J3G A;  3D7F A;  2POK A;  4X8I A;  1YQE A;  2FVG A;  3EO4 A;  4AG9 A;  3B3T A;  4W9Y A;  4UCN A;  1F2P A;  2AFW A;  4PQA A;  4Q7A A;  3RZA A;  4AG7 A;  4MHY A;  2Z3K A;  4FUU A;  4Q38 A;  4KSA A;  1R3N A;  2GAN A;  2DPS A;  3IC1 A;  2AFZ A;  4MCS A;  4C2Z A;  5HVG A;  2HUZ A;  3KQX A;  3TCV A;  1ZG9 A;  2CY2 A;  2GRE A;  4OLL A;  3NH8 A;  1LFW A;  4K3N A;  3R95 A;  2Q04 A;  3H8F A;  5D29 A;  4MFQ A;  5HXD A;  5A28 A;  1NMT A;  2JDC A;  4FD5 A;  1JQG A;  4R3L A;  4B11 A;  3RO0 A;  1YVK A;  3KKW A;  3JTK A;  2EVN A;  3PFO A;  5KTD A;  4KSI A;  1TKH A;  4P4B A;  4L89 A;  4PK2 A;  1Y0R A;  2ZEH A;  2Z3N A;  5JGF A;  3FJU A;  4B5O A;  1GYT A;  3CPX A;  2ZEF A;  2PJ9 A;  3BLN A;  4F0Y A;  1DTD A;  1ELL P;  1VIX A;  2F7V A;  3PB8 X;  4OC2 A;  3CZX A;  5G21 A;  2D4P A;  1QSR A;  3FF3 A;  4BIN A;  2ZOG A;  3S9L A;  4UCP A;  1B87 A;  2Q7S A;  3WR7 A;  4NCZ A;  2YNC C;  4M85 A;  4NGT A;  3RAM A;  4F6A A;  3CXQ A;  3F0A A;  5HVH A;  3HLP A;  3W6S A;  2PCU A;  2KCW A;  4BMH A;  1TKF A;  2HV2 A;  1M4G A;  2JDD A;  5AG6 A;  1AMP A;  1M1D A;  2VL1 A;  2ANP A;  4YFJ A;  1VHS A;  4KUB A;  5LYL A;  4H6Z A;  2PJ8 A;  4PPZ A;  3EFA A;  4MFP A;  3B3V A;  2Q4V A;  3D66 A;  4QUS A;  2B5G A;  3DR6 A;  4MCR A;  2PJB A;  3GLJ A;  3FRM A;  3H8E A;  3HUV A;  5GCN A;  3DR8 A;  3FBU A;  4XPD B;  5E96 A;  1Z4R A;  1Y7R A;  3SHP A;  4DYO A;  3FX6 A;  4UEF A;  2PJC A;  2AFU A;  2ZEN A;  3ISZ A;  2ZW4 A;  1BO4 A;  3QAH A;  3TTH A;  3LAC A;  2CTC A;  3BI0 A;  2GFQ A;  1YW6 A;  4CAF A;  2GLF A;  5C88 A;  2PQ8 A;  1ARM A;  4ZY0 A;  4QBJ A;  5I4M A;  1Z8W A;  2RB7 A;  2ATR A;  2C6G A;  4DUK A;  2D4O A;  4MRI A;  4OME A;  1CPX A;  2HQY A;  4CGO A;  1ELM P;  4NFR A;  5AGE A;  4UWJ A;  1XJO A;  3D7D A;  2FCK A;  1AYE A;  4F9U A;  3D2P A;  2PJ2 A;  4ZYQ A;  2IL4 A;  2PJ3 A;  2IMO A;  3B8G A;  4A39 A;  4B13 A;  1Q2C A;  1VHO A;  4MFJ A;  1UFH A;  2Q4Y A;  8CPA A;  5J1Q A;  1UWY A;  3LOD A;  4JXQ A;  4O23 A;  2QJ8 A;  2AJ6 A;  1ARL A;  3BHX A;  2DEA A;  2YND A;  2V8D A;  2NYQ A;  4A38 A;  4OC1 A;  3FH4 A;  4XNH C;  4PV6 A;  4JZ0 A;  2QVP A;  2Z0Z A;  3KHX A;  2R1I A;  1EE3 P;  2OR4 A;  5JQ4 A;  2CF4 A;  4CYP A;  3PEI A;  4B10 A;  1S5K A;  2DPT A;  2PJ0 A;  3NA6 A;  2IQ6 A;  1Q2Y A;  1OBR A;  2FT0 A;  1M4L A;  2Z3O A;  3GY9 A;  2BUE A;  3JRU A;  3LWU A;  1CX8 A;  4M6G A;  5AG7 A;  2VZZ A;  3KI9 A;  4A37 A;  1QSO A;  3TFY A;  5LYI A;  4Z65 A;  2EO8 A;  4JYW A;  1IOI A;  4QC6 A;  1YK3 A;  5JM6 A;  1XRY A;  2REE A;  4OAE A;  1KWM A;  3VWD A;  1LCP A;  4P4E A;  3ISX A;  4BD9 A;  4CGL A;  2XEG A;  3SJX A;  1SQH A;  4IF5 A;  2FE7 A;  4MY0 A;  4RUH A;  3IFE A;  1YVO A;  2Q43 A;  2ZPA A;  2GE3 A;  1F2O A;  1I21 A;  1IOF A;  4P4J A;  3SJF A;  2GIV A;  2WUU A;  2XEI A;  4B14 A;  2ZED A;  4XNH B;  2C1C A;  2CNS A;  4MMO A;  4DNC A;  1MJA A;  4MHN A;  4OP4 A;  3VAR A;  3TX8 A;  4R6T A;  1YR0 A;  4B12 A;  3PGP A;  2Q7B A;  3R9E A;  1PCA A;  1Y9K A;  2Q51 A;  4KOX A;  3DLJ A;  4ZY1 A;  1FY7 A;  3FIX A;  4CYO A;  4P4D A;  4LQG A;  4C7H A;  3P2H A;  1IIC A;  3S9N A;  3TOA A;  2PJ6 A;  2PSW A;  1Q2D A;  3KAS A;  5CNP A;  3FMC A;  1DE4 C;  1YRE A;  3MN8 A;  3N7Z A;  2A4N A;  3NH5 A;  5DWM A;  4U9Y A;  4A2Z A;  6CPA A;  5IX3 A;  2AFX A;  4FD7 A;  3B3C A;  3C26 A;  4PSW A;  5DWN A;  4YWY A;  4AXV A;  3SI0 A;  3PB7 X;  3I3G A;  1CPS A;  2FXF A;  4R87 A;  3TE4 A;  2OH1 A;  4B5P B;  2F8H A;  1TKJ A;  3DNS A;  3QAY A;  3GB0 A;  2PRQ A;  4F9V A;  5KTA A;  2JBK A;  4U9Z A;  5JPH A;  2DF5 A;  4MFK A;  5H84 A;  1JWQ A;  1Z5R A;  2HB6 A;  1OZP A;  3P2F A;  4PXC A;  3D7G A;  2PJA A;  3VAT A;  4KOU A;  4RI1 A;  3R9G A;  3NH4 A;  4CYN A;  3B3W A;  3H5Z A;  4GM5 A;  4L8A A;  1U6M A;  4R9M A;  4RS2 A;  3F5B A;  4KOV A;  2H5M A;  3PRT A;  3FVL A;  2OU2 A;  4P45 A;  3WT4 A;  1IID A;  4MHD A;  2V8V A;  2G0B A;  4MCQ A;  3H4Q A;  3RNZ A;  4ZX8 A;  3CXP A;  4HNY B;  2GLJ A;  3QB8 A;  4KOT A;  4CAV A;  5J8C A;  3TO6 A;  3TOB A;  4WWV A;  4OKO A;  1TF8 A;  4P10 A;  1LRZ A;  2WSA A;  1Z4E A;  4NSQ A;  2WYR A;  2R98 A;  4CRZ B;  1M44 A;  4R7M A;  1I1D A;  1M4D A;  2PE3 A;  4NXY A;  4M6I A;  3MGD A;  4YRH A;  1WK4 A;  4GXH A;  3IWG A;  4R3K A;  2FS5 A;  2B4D A;  2XEJ A;  3LMS A;  3NFZ A;  5K8O A;  4CAE A;  3SI1 A;  1YGH A;  2AFO A;  4PK3 A;  4CRY B;  1RXT A;  2PVW A;  5D8N A;  3S6H A;  4JD6 A;  5AG5 A;  5ELY A;  3KGQ A;  3IO1 A;  2Q44 A;  4F8Z A;  2O28 A;  4FD6 A;  3BXM A;  3NE7 A;  3RBU A;  3FEC A;  2REF A;  4K30 A;  5HH1 A;  2QEC A;  3KQZ A;  3G3S A;  2IJZ A;  1ON0 A;  2OZU A;  4EVY A;  2PR8 A;  3I9S A;  2ZW5 A;  4I49 A;  1QSN A;  3MRU A;  4P44 A;  1YME A;  2P6E A;  4MXU A;  3H8G A; 
#chains in the Genus database with same CATH homology
 4C2X A;  3F8K A;  5C82 A;  4CGN A;  3W6X A;  4MFL A;  4R57 A;  4Y49 C;  3T90 A;  2ZXV A;  2DXQ A;  2ZW6 A;  3G8W A;  1P4N A;  3BJ8 A;  4PSX A;  3GYA A;  2C27 A;  4QB9 A;  4UWI A;  4UFV A;  4JLY A;  4AVB A;  3R96 A;  1XE4 A;  1Z9U A;  2CXA A;  1PU9 A;  2B3U A;  5KTC A;  1QSM A;  2EUI A;  1S7N A;  1MJ9 A;  4CGP A;  5HMN A;  4ORF A;  4KLV A;  3TO9 A;  4KVO E;  3BJ7 A;  2J8R A;  4KOW A;  4KVM E;  4UFX A;  1B6B A;  5KTA A;  1M4I A;  4NEX A;  5AG4 A;  3IU2 A;  4AB7 A;  2AE6 A;  3W91 A;  4Y49 B;  3IGR A;  1QST A;  3DSB A;  2X7B A;  1KUV A;  1XMT A;  2CNT A;  1S7F A;  4U5Y A;  5IV0 A;  2FIA A;  1KUY A;  1V0C A;  2Z3P A;  4A32 A;  3IU1 A;  2PDO A;  4C7I A;  4C68 A;  2VBQ A;  1L0C A;  4X5K A;  4BBH A;  5EC4 A;  2Y0M A;  2BL1 A;  4KS9 A;  4XPL A;  3FNC A;  3D3S A;  4E2A A;  3ZJ0 A;  2OB0 A;  1J4J A;  3EY5 A;  2VQY A;  3EC4 A;  3T9Y A;  4ONU A;  2QIR A;  2Z10 A;  2YNC A;  3TT2 A;  4H6U A;  2R8V A;  2B5G B;  4AVC A;  4JXR A;  2I00 A;  2Z3L A;  4GS4 A;  1IYK A;  2VXK A;  3FB3 A;  4KOY A;  2B4B A;  2P6F A;  3S6F A;  5H86 A;  1R57 A;  5I0C A;  2J8N A;  1NE9 A;  2NMT A;  1S7K A;  3RYO A;  5ISV A;  1MJB A;  2RC4 A;  2Z11 A;  2P6G A;  4E0A A;  4AVA A;  1YLE A;  2J8M A;  2VZY A;  1GHE A;  4UBR A;  3FXT A;  4IUS A;  4KVX A;  4NF1 A;  1PUA A;  4MY3 A;  3D8P A;  4LX9 A;  4YGO A;  5F48 A;  4JJX A;  3SXN A;  4CAX A;  1CM0 A;  3DDD A;  1N71 A;  1XEB A;  3GKR A;  2PRB A;  4XPD C;  3CXS A;  4CS0 B;  4A31 A;  4E8O A;  2B3V A;  1IYL A;  2VEZ A;  1P0H A;  4H89 A;  4UA3 A;  2BSW A;  4OAD A;  5G1Z A;  4CAW A;  4UCM A;  2WPW A;  5BWA B;  1S60 A;  4MI4 A;  2G3A A;  2JLM A;  4KLW A;  3JVN A;  2BEI A;  4ZGY B;  4MFZ A;  2OZG A;  1RO5 A;  1KZF A;  3JUW A;  5FVJ A;  5A27 A;  4FD4 A;  2OZH A;  1MK4 A;  3PP9 A;  4JWP A;  2JEV A;  4A30 A;  5F46 A;  1Y9W A;  4QVT A;  4B5P A;  4A33 A;  2Z3M A;  1IB1 E;  4A95 A;  1WWZ A;  2YNE A;  1NSL A;  2FL4 A;  3S6G A;  4KOS A;  4XPK A;  5G22 A;  2K5T A;  2Q0Y A;  1YX0 A;  2F5I A;  3K9U A;  3TO7 A;  4ZBG A;  1KUX A;  5G20 A;  4UFW A;  5J8F A;  4II9 A;  5F49 A;  3S6K A;  4HNX B;  4KZT A;  2R7H A;  3D2M A;  3FYN A;  4KOR A;  2CNM A;  2ZW7 A;  3E0K A;  5EBV A;  3UY5 A;  1S3Z A;  4M3S A;  2ARH A;  1XF8 A;  1TIQ A;  4CGM A;  4HKF A;  1S7L A;  4MJ8 A;  3OWC A;  2WPX A;  4C2Y A;  1XIX A;  3PZJ A;  3R1K A;  3V8I A;  2B58 A;  4CYQ A;  2G3T A;  2B4D B;  1K4J A;  4LUA A;  2FSR A;  1BOB A;  3A9L A;  2I79 A;  2QML A;  1CJW A;  2YGW A;  3R9F A;  5IB0 A;  3IWE A;  3VWE A;  1VKC A;  3LD2 A;  1ZO0 A;  3SXO A;  2P0W A;  4MBU A;  4HNW B;  2FIW A;  4F0X A;  2PR1 A;  3ZZI A;  2VI7 A;  4Q36 A;  4KSF A;  4KUA A;  1I12 A;  3EXN A;  5F47 A;  2PC1 A;  4J3G A;  3EO4 A;  4AG9 A;  4UCN A;  4AG7 A;  2Z3K A;  4Q38 A;  4KSA A;  2GAN A;  2DPS A;  4C2Z A;  2HUZ A;  3TCV A;  2CY2 A;  4OLL A;  3R95 A;  2Q04 A;  4MFQ A;  5A28 A;  1NMT A;  2JDC A;  4FD5 A;  4R3L A;  4B11 A;  1YVK A;  3KKW A;  3JTK A;  2EVN A;  5KTD A;  4L89 A;  4PK2 A;  2Z3N A;  4B5O A;  4F0Y A;  3BLN A;  5G21 A;  2D4P A;  1QSR A;  4UCP A;  1B87 A;  3WR7 A;  4NCZ A;  2YNC C;  4M85 A;  4F6A A;  3CXQ A;  3F0A A;  3W6S A;  2KCW A;  4BMH A;  2HV2 A;  1M4G A;  2JDD A;  5AG6 A;  1M1D A;  4YFJ A;  1VHS A;  4KUB A;  4H6Z A;  3EFA A;  4MFP A;  2Q4V A;  4QUS A;  2B5G A;  3DR6 A;  3FRM A;  5GCN A;  3DR8 A;  3FBU A;  4XPD B;  5E96 A;  1Z4R A;  1Y7R A;  3SHP A;  3TTH A;  3QAH A;  2ZW4 A;  1BO4 A;  4CAF A;  5C88 A;  2PQ8 A;  4QBJ A;  2ATR A;  2D4O A;  4CGO A;  2HQY A;  5AGE A;  4UWJ A;  2FCK A;  3D2P A;  2IL4 A;  3B8G A;  4B13 A;  1Q2C A;  4MFJ A;  1UFH A;  2Q4Y A;  3LOD A;  4JXQ A;  2AJ6 A;  2YND A;  4XNH C;  4PV6 A;  2Z0Z A;  5JQ4 A;  2R1I A;  4CYP A;  4B10 A;  1S5K A;  2DPT A;  3GY9 A;  2FT0 A;  1Q2Y A;  2Z3O A;  5AG7 A;  2BUE A;  2VZZ A;  1QSO A;  3TFY A;  4QC6 A;  1YK3 A;  2REE A;  4OAE A;  3VWD A;  4CGL A;  1SQH A;  4IF5 A;  2FE7 A;  4MY0 A;  1YVO A;  2ZPA A;  2GE3 A;  1I21 A;  2GIV A;  2WUU A;  4B14 A;  4XNH B;  2CNS A;  4DNC A;  1MJA A;  4B12 A;  1YR0 A;  3PGP A;  2Q7B A;  3R9E A;  1Y9K A;  4KOX A;  1FY7 A;  3FIX A;  4CYO A;  4C7H A;  3P2H A;  1IIC A;  3TOA A;  2PSW A;  1Q2D A;  5CNP A;  3N7Z A;  1YRE A;  5IX3 A;  5DWM A;  2A4N A;  4A2Z A;  4U9Y A;  4FD7 A;  3C26 A;  4PSW A;  5DWN A;  3I3G A;  2FXF A;  4R87 A;  3TE4 A;  2OH1 A;  4B5P B;  3DNS A;  4U9Z A;  5JPH A;  4MFK A;  5H84 A;  1OZP A;  3P2F A;  4KOU A;  4RI1 A;  3R9G A;  4CYN A;  3H5Z A;  4L8A A;  4RS2 A;  1U6M A;  4R9M A;  3F5B A;  4KOV A;  2H5M A;  2OU2 A;  1IID A;  4MHD A;  2G0B A;  3H4Q A;  3CXP A;  4HNY B;  3QB8 A;  4KOT A;  4CAV A;  5J8C A;  3TO6 A;  3TOB A;  4CRZ B;  1LRZ A;  2WSA A;  1Z4E A;  4NSQ A;  2R98 A;  1M44 A;  1I1D A;  1M4D A;  4NXY A;  3MGD A;  4YRH A;  1WK4 A;  3IWG A;  4R3K A;  2FS5 A;  2B4D A;  4CAE A;  1YGH A;  4PK3 A;  4CRY B;  1RXT A;  3S6H A;  4JD6 A;  5AG5 A;  2Q44 A;  2O28 A;  4FD6 A;  3NE7 A;  2REF A;  4K30 A;  5HH1 A;  2QEC A;  3G3S A;  1ON0 A;  2OZU A;  4EVY A;  2PR8 A;  3I9S A;  2ZW5 A;  4I49 A;  1QSN A;  2P6E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...