3VARA

Crystal structure of dnpep, znzn form
Total Genus 134
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
134
sequence length
469
structure length
414
Chain Sequence
GRARKEAVQAAARELLKFVNRSPSPFHAVAECRSRLLQAGFHELKETESWDIKPESKYFLTRNSSTIIAFAVGGQYVPGNGFSLIGAHTDSPCLRVKRSQVGFQQVGVETYGGGIWSTWFDRDLTLAGRVIVEQRLVHVDRPILRIPHLAIHLMEMHLVPILATSIQEELEKSVLTSLLCAHLGLSPEDILEMELCLADTQPAVLGGAYEEFIFAPRLDNLHSCFCALQALIDSCSAPASLAADPHVRMIALYDNEEVGSESAQGAQSLLTELVLRRISASPQHLTAFEEAIPKSYMISADMAHAVHPNYLRPLFHKGPVIKVNSKQRYASNAVSEALIREVASSVGVPLQDLTTIGPILASRLGLRVLDLGSPQLAMHSIRETACTTGVLQTITLFKGFFELFPSLSRSLLVD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aspartyl aminopeptidase
publication title Insights into substrate specificity and metal activation of Mammalian tetrahedral aspartyl aminopeptidase.
pubmed doi rcsb
source organism Bos taurus
molecule tags Hydrolase
total genus 134
structure length 414
sequence length 469
ec nomenclature ec 3.4.11.21: Aspartyl aminopeptidase.
pdb deposition date 2011-12-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02127 Peptidase_M18 Aminopeptidase I zinc metalloprotease (M18)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.250.10 Mainly Beta Roll Aminopeptidase i, Domain 2 Aminopeptidase i, Domain 2 3varA02
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 3varA01
5K8OA 3B35A 4OIDA 4PPZA 4EMEA 1IGBA 3FVLA 4P10A 1OBRA 3JRUA 2IQ6A 4FWUA 5K8PA 4PQAA 1F2PA 4PXCA 4ZX8A 4A37A 2PVVA 3D67A 3PB4X 1DE4C 2FVGA 3B3CA 4AXVA 3V7ZA 3S9LA 5JM6A 4UIBA 4NGNA 7CPAA 2BOAA 4OIWA 2C6CA 3PFOA 4DUKA 4OC5A 4MHPA 1LAPA 3H8FA 4Z65A 3LMSA 1CX8A 4A38A 3B2YA 1F2OA 2AFWA 1HDQA 1XMBA 3CT9A 4P45A 1ARMA 2PE3A 3PFEA 1CP7A 4MHZA 4P4EA 3MN8A 3NA6A 3FH4A 4P4BA 2OR4A 2JEWA 3SJGA 2PCUA 2DEAA 4NGRA 4P44A 1YMEA 3PB6X 2ZEFA 5ELYA 2ZEGA 1GYTA 3IC1A 5CBMA 4KSIA 3FJUA 4G1PA 4BD9A 2ZEHA 1YSJA 2V8DA 4YWYA 4Q7AA 3N5FA 4F9UA 1BPMA 3WABA 3D7GA 5LRJA 5F09A 2PJ9A 1ARLA 1Y7EA 3CDXA 2F8HA 4MHYA 2NSMA 4UF4A 2CIJA 2CF4A 2AFMA 4EFDA 2C6PA 4NGTA 4OP4A 2HC9A 4YU9A 2C6GA 1TKFA 1CPXA 3B3SA 4PXBA 1XJOA 4MMOA 3HUVA 4CPAA 2PJ6A 2GREA 2V8HA 2O4HA 1F57A 5J1QA 4MCQA 4OC1A 4W9YA 5D29A 3D4UA 3FECA 1ZG9A 4JYWA 4F9VA 1AMPA 2PJ4A 2JBKA 3DLJA 4RUHA 4WWVA 1ELLP 4ZY1A 2C1CA 3SI0A 1YW6A 3FEDA 5HVGA 2POKA 5LYDA 5JGFA 1BPNA 2G9DA 1R3NA 3I1UA 3KGQA 1LFWA 3S9MA 4R6TA 3VARA 2BCOA 3IEHA 4NGSA 2NYQA 1H8LA 5CPAA 1ELMP 2PJ2A 3CPXA 3IO1A 2EWBA 1TXRA 4MCRA 1PYTB 2ZELA 2ZEMA 1BAVA 3IFEA 1Y0RA 1LCPA 4MRIA 2Q4ZA 1CBXA 1TF9A 2PJ5A 1YLOA 2HB6A 1LOKA 3WC5A 3H8EA 3D7FA 2AFZA 4P4FA 2Q43A 3RZAA 3SJXA 4X3RA 5LRGA 4OC2A 1PCAA 2ABZA 4A39A 2IJZA 2J9AA 2Q51A 2PJ1A 3FEEA 4UEFA 3B3VA 1QQ9A 1TKJA 8CPAA 1HDUA 2ZEPA 2ZEOA 2CTBA 4EWTA 3PBEA 4MCSA 3WC7A 4NJQA 5LYIA 2CTCA 2PRQA 1CP6A 4P4IA 1Z5RA 3QNVA 2PJCA 3IWWA 2PJ0A 4ZY2A 2AFXA 3VATA 3GLJA 5HVFA 3VH9A 3SJFA 4NGPA 1DTDA 3TX8A 1NSAA 3WT4A 3IJ3A 2XEJA 3DGVA 1ZLHA 2PJBA 3RAMA 2GLFA 2PIZA 3MRUA 5I4MA 4MXUA 2PVWA 1AYEA 2AFOA 2I3CA 5K8NA 5LYFA 4P4JA 1UWYA 3D68A 2PIYA 2ANPA 2RFHA 3SI1A 6CPAA 4UEZA 1TKHA 2O53A 3D66A 4LQGA 4WJBA 4MHNA 5LRKA 3KI9A 4OMEA 2OOTA 4X2TA 3PBBA 4P6YA 4OKOA 3TC8A 3WC6A 2WYRA 3KASA 4R76A 1Q7LA 4IK2A 2ZOFA 3K2KA 3NH8A 2V77A 4TWEA 1Z8LA 4IHMA 3BXMA 2JBJA 4NGQA 3B3WA 1VHOA 1VHEA 4NGMA 4PXDA 4R8FA 2PJAA 1ZG8A 3GUXA 4B6ZA 3S9NA 3B7IA 1CPSA 4FBEA 3IIBA 1BLLE 4TNUA 1M4LA 5LYLA 3H8GA 2RB7A 3KR4A 4MCPA 3HLPA 4P4DA 2QVPA 3PEIA 2WZNA 2QYVA 1RTQA 4O23A 3NFZA 4DYOA 1Z2LA 2AFSA 1CG2A 2F7VA 3FX6A 4FAIA 2EK8A 2GU2A 4ZX9A 2AFUA 4OC0A 3RBUA 4ZY0A 3ISXA 1FT7A 3PB9X 3KHZA 4IAVA 4F8ZA 3D7DA 1XRYA 2XEIA 4DJLA 1FNOA 4ZI6A 3PB7X 2ZOGA 1EE3P 1TF8A 2ZEDA 4FUUA 3KQXA 2PJ8A 2BO9A 4X8IA 1XBUA 3BHXA 3NH4A 2IMOA 1JQGA 4A94A 4OC4A 3BI0A 5K8MA 5DS0A 5HVHA 5IB9A 1LANA 3T8WA 4PXEA 4ONWA 4K3NA 3D7HA 2V8VA 3LWUA 4ZYQA 3PRTA 2ZEEA 4UEEA 5THWA 1VIXA 3BI1A 3V38A 1IY7A 1VGYA 4JZ0A 2XEGA 5HXDA 3FMCA 1Y0YA 5D8NA 3PB8X 4R7MA 3KZWA 4OC3A 2VL1A 2EK9A 3CPAA 4UIAA 4NFRA 2ZENA 3FF3A 4GM5A 1KWMA 1ZLIA 1R43A 1YW4A 5JH9A 3KL9A 3NH5A 3GB0A 2V8GA 1ZG7A 4H2KA 3KR5A 3B3TA 3K9TA 3SI2A 4NJRA 1QMUA 2PJ7A 1XFOA 2QJ8A 3L2NA 1LAMA 3KQZA 2XEFA 2PJ3A 1HEEA 3SJEA 3KHXA 2GLJA 3ISZA
chains in the Genus database with same CATH superfamily
2HQYA 2X7BA 5K8OA 3TT2A 3B35A 4OIDA 4PPZA 4EMEA 2GIVA 4YGOA 2R7HA 1KZFA 1IGBA 3FVLA 4P10A 3RO0A 4F0XA 1OBRA 3JRUA 2JLMA 3F0AA 3P2FA 2IQ6A 4FWUA 4HNWB 2EVNA 5EC4A 1U6MA 5K8PA 4C7HA 4FD6A 4AVBA 3DR8A 1F2PA 4PQAA 4PXCA 4ZX8A 4A37A 2PVVA 3D67A 3PB4X 3LODA 5BWAB 4HKFA 1DE4C 2FVGA 3B3CA 1FY7A 4AXVA 4B5PB 4KUAA 2O28A 3V7ZA 3S9LA 5JM6A 4CGMA 4UIBA 4NGNA 3TO6A 7CPAA 1Q2DA 2BOAA 4OIWA 2C6CA 3PFOA 4IF5A 2JDCA 4DUKA 2Z11A 4OC5A 4MHPA 1LAPA 3FB3A 3H8FA 4Z65A 3LMSA 1OZPA 1CX8A 4A38A 1YGHA 3B2YA 4MFKA 5AG6A 1F2OA 3C26A 2AFWA 4B5OA 1HDQA 1XMBA 3CT9A 1YR0A 4P45A 1ARMA 2PE3A 3PFEA 4JWPA 4UCMA 5AG7A 4CAVA 4B10A 5H86A 1CP7A 4MHZA 1V0CA 4P4EA 3MN8A 3NA6A 3FH4A 4Q36A 4CYNA 1I1DA 1Q2YA 4P4BA 1S60A 2OR4A 2JEWA 5G1ZA 3SJGA 2PCUA 2DEAA 4NGRA 4P44A 3LD2A 2KCWA 3CXPA 4UA3A 4XPLA 1YMEA 2JDDA 3PB6X 3S6GA 3W91A 1YK3A 3TO7A 3DDDA 4KOYA 2ZEFA 1IB1E 5ELYA 2ZEGA 4GXHA 1GYTA 5CNPA 3IC1A 3IWEA 4QVTA 4R87A 2OH1A 3I9SA 2BSWA 2Q4VA 4MHDA 2DXQA 5CBMA 4KSIA 3FJUA 1M4GA 4G1PA 3BLNA 4NSQA 4QB9A 4M6IA 4BD9A 2ZEHA 1YSJA 2V8DA 3V8IA 4JXQA 3D2PA 5HH1A 4YWYA 4Q7AA 4IUSA 5EBVA 3FIXA 4CYPA 3N5FA 1XE4A 4F9UA 1BPMA 3WABA 3D7GA 5LRJA 2Q7BA 3W6XA 2FL4A 5F09A 2Q04A 2PJ9A 2Q0YA 1ARLA 2FSRA 2GE3A 1Y7EA 1WK4A 4FD7A 3CDXA 2Z0ZA 1ZO0A 1Z8TA 4K30A 2P0WA 3GKRA 2F8HA 3TE4A 3FNCA 2I00A 4MHYA 2Z3PA 2R98A 2NSMA 4UF4A 1RXTA 2CF4A 2CIJA 2AFMA 4EFDA 2C6PA 4NGTA 4CAXA 2IL4A 5F46A 3EO4A 4MBUA 4OP4A 2D4OA 3EY5A 2HC9A 1N71A 4JLYA 2C6GA 1TKFA 4YU9A 1CPXA 4CYOA 1MJ9A 1UFHA 1XIXA 3B3SA 4KOVA 4PXBA 4AG7A 1VKCA 4GS4A 1XJOA 4MMOA 4QC6A 3GIUA 3HUVA 4MY3A 3ZJ0A 1IOIA 2VZZA 4CS0B 5G20A 2I79A 2PJ6A 1IYLA 1VHSA 2Z3OA 4KZTA 2GREA 4CPAA 5J8CA 2V8HA 2O4HA 3VWDA 1Z8XA 4HPSA 1F57A 1M4DA 4H6ZA 4MCQA 5J1QA 4KOXA 3BJ7A 5J8FA 1LRZA 2Z3KA 2J8MA 5F48A 2B3UA 4PV6A 4OC1A 4W9YA 1IU8A 4KVME 5D29A 4U9ZA 3H4QA 3D4UA 3FECA 1ZG9A 1B87A 3LACA 4JYWA 1AMPA 1IYKA 4F9VA 4M3SA 2PJ4A 2JBKA 4C68A 4U9YA 3DLJA 2ODFA 1Y9WA 4RUHA 3S6KA 4C2ZA 1S7FA 2P6GA 3N7ZA 4WWVA 3VWEA 1QSRA 3JTKA 1XF8A 1ELLP 2HUZA 5HMNA 3W6SA 2ZW5A 4ZY1A 1YVKA 1JWQA 2C1CA 2FIWA 3SI0A 1YW6A 3FEDA 4I49A 4L89A 1IIDA 1S5KA 2CNTA 2VEZA 5G21A 5HVGA 4PSWA 1QSMA 3T90A 2VZYA 2POKA 5LYDA 5JGFA 4B13A 5H84A 4UCNA 1BPNA 2G9DA 1R3NA 3I1UA 2CNSA 1TIQA 2Z10A 3KGQA 4CAFA 1LFWA 2PQ8A 3S9MA 4CRYB 2Z3MA 1KUYA 4R6TA 3VARA 3RNZA 2BCOA 3IEHA 4NGSA 2NYQA 4MJ8A 1H8LA 4R57A 1Z9UA 5CPAA 4UFWA 1ELMP 4MFLA 4YRHA 2EBJA 2PJ2A 3CPXA 4A31A 1Z4EA 4AB7A 4C7IA 2P6FA 2YNEA 3IO1A 4B12A 1NMTA 4CGNA 2EWBA 1TXRA 4MCRA 1KUVA 1PYTB 4Y49C 2FS5A 2ZELA 4XPDC 3A9LA 4OAEA 2ZEMA 1BAVA 2PC1A 3IFEA 5JPHA 1Y0RA 2GANA 1LCPA 1L0CA 4J3GA 4MRIA 2Q4ZA 1CBXA 2YNCA 5F47A 3SXOA 4CGPA 1TF9A 4DNCA 2PJ5A 1YLOA 4MY0A 4F0YA 2HB6A 1LOKA 3F5BA 3FBUA 3WC5A 2OZHA 3H8EA 3ISZA 5E96A 3PGPA 3D7FA 2AFZA 1K4JA 4P4FA 2R8VA 2Q43A 3RZAA 4HNXB 4X3RA 5LRGA 3SJXA 4BMHA 4OC2A 2REFA 1S7NA 2FIAA 1S7LA 1CM0A 1PCAA 2PR1A 3NE8A 4AG9A 4KUBA 4PK3A 2ABZA 4A39A 2IJZA 2J9AA 2Q4YA 4JXRA 2WSAA 2Q51A 2B4DA 3R9EA 4LQ6A 3DSBA 1KUXA 2PJ1A 3JVNA 1YVOA 3FEEA 4UEFA 3B3VA 3CZXA 4UFVA 1QQ9A 4MFQA 1TKJA 4A32A 3S6FA 8CPAA 1I12A 4F6AA 2J8NA 1HDUA 4II9A 2ZEPA 2ZEOA 1QSOA 3EC4A 2ZW4A 1S3ZA 5IB0A 1AUGA 2CXAA 4XNHC 2CTBA 4EWTA 2Q7SA 3PBEA 4MCSA 3WC7A 4NJQA 3CXQA 5LYIA 2CTCA 1X10A 2PRQA 1A2ZA 4H6UA 1YREA 4CGOA 1CP6A 4P4IA 1Z5RA 2EO8A 4CAEA 3QNVA 2PJCA 3UY5A 3IU2A 3IWWA 1ON0A 1P4NA 2PJ0A 2Z3LA 4KOSA 1Y9KA 1B6BA 1MJAA 4ZY2A 4FD5A 2AFXA 1WWZA 3VATA 2F5IA 5G22A 3GLJA 3PP9A 4MFJA 2P6EA 1S7KA 5HVFA 3VH9A 4C2XA 3SJFA 2OZUA 4NGPA 1DTDA 1SQHA 1NSAA 3TX8A 3WT4A 2BEIA 1QSTA 3T9YA 4CAWA 3KKWA 5DWMA 3IJ3A 2XEJA 4NXYA 3DGVA 1ZLHA 2PJBA 4ORFA 3RAMA 2GLFA 2PIZA 3MRUA 4RS2A 5AGEA 5I4MA 4KLWA 4MXUA 2RC4A 1QSNA 2PVWA 3IU1A 3PZJA 1MJBA 4MFZA 1AYEA 2AFOA 1NE9A 4Q38A 2AE6A 3FYNA 2J8RA 2I3CA 5K8NA 5JQ4A 5LYFA 4P4JA 3E0KA 2YGWA 1UWYA 3D68A 2PIYA 2ANPA 2RFHA 3SI1A 4KVOE 4RI1A 3TFYA 4PK2A 6CPAA 3BJ8A 4UEZA 1TKHA 2O53A 3D66A 4LQGA 4WJBA 2ATRA 4MHNA 2HV2A 5LRKA 3KI9A 4OMEA 2OOTA 4KSAA 3ZZIA 4X2TA 4CYQA 3PBBA 4MI4A 4P6YA 2ZXVA 4OKOA 3I3GA 3SXNA 3TC8A 3WC6A 4BBHA 4M6HA 2JEVA 2B4DB 2QIRA 2WYRA 3QAHA 4R9MA 5KTDA 4KORA 3KASA 2DPSA 4R76A 1XEBA 2VI7A 1Q7LA 4IK2A 4B14A 2ZOFA 4YFJA 5F49A 2ZW7A 4KOTA 3SHPA 2BL1A 4R3LA 3K2KA 3NH8A 4KSFA 4UFXA 4CRZB 4KLVA 2A4NA 2YNDA 2V77A 4TWEA 4H89A 1YLEA 3P2HA 2REEA 1Z8LA 1Z4RA 2OB0A 4IHMA 1PU9A 4NF1A 3F8KA 3BXMA 2JBJA 4NGQA 3S6HA 3B3WA 3QB8A 4C2YA 4E2AA 5A27A 1VHOA 1VHEA 2VQYA 4QUSA 4OADA 2B5GA 3TOAA 1RO5A 2D4PA 4NGMA 4PXDA 2FE7A 4R8FA 2PJAA 4EVYA 1ZG8A 4B11A 5KTCA 3GUXA 4A2ZA 4B6ZA 3S9NA 1YX0A 3B7IA 2G3AA 1CPSA 4M85A 4NEXA 1M4IA 4A33A 4FBEA 2G0BA 4Y49B 2GFQA 3QAYA 3IIBA 4XPDB 1BLLE 3K9UA 4JJXA 1M4LA 4TNUA 5LYLA 3H8GA 2FXFA 2RB7A 4KS9A 2WPWA 4BINA 3KR4A 4JD6A 4L8AA 1Q2CA 4MCPA 3HLPA 1P0HA 2QVPA 4P4DA 4A30A 3TOBA 2H5MA 3PEIA 2WZNA 2QYVA 1RTQA 4O23A 2PR8A 3GY9A 3GYAA 3NFZA 4LX9A 4DYOA 2AJ6A 1Z2LA 2AFSA 1CG2A 2F7VA 2PRBA 3FX6A 2EK8A 2GU2A 4FAIA 4ZX9A 2AFUA 2DPTA 4OC0A 4AVAA 3RBUA 4ZY0A 3ISXA 2R1IA 1BOBA 1FT7A 2ZPAA 3PB9X 3KHZA 4IAVA 1CJWA 4M6GA 4XPKA 4F8ZA 3D7DA 1XRYA 2XEIA 2NMTA 3MGDA 1Z8WA 5C88A 4ONUA 4DJLA 2K5TA 1FNOA 4FD4A 2PDOA 3PB7X 4ZI6A 5KTAA 4LUAA 2ZOGA 3TTHA 3B8GA 5AG4A 1EE3P 1TF8A 2CY2A 2ZEDA 1I21A 3KQXA 4FUUA 2PJ8A 3R95A 1X12A 5A28A 2BO9A 2ZW6A 1IICA 3DNSA 2CNMA 4X8IA 3FXTA 1XBUA 5I0CA 3BHXA 3NH4A 4XNHB 2IMOA 1JQGA 3D2MA 4A94A 3IWGA 3R1KA 4OC4A 4PSXA 1NSLA 3TCVA 1GHEA 3H5ZA 3D8PA 3BI0A 5K8MA 3OWCA 4UWIA 4UCPA 1J4JA 4KOWA 5DS0A 5HVHA 3TO9A 5IB9A 2VXKA 1BO4A 1LANA 5ISVA 4A95A 2C27A 2FT0A 3FRMA 5EMIA 3T8WA 4PXEA 4ONWA 4B5PA 4K3NA 3D7HA 3NE7A 1MK4A 2V8VA 2WUUA 3LWUA 5IX3A 2B5GB 3PRTA 4ZYQA 2ZEEA 2VBQA 4UEEA 3R9GA 5THWA 5C82A 3R9FA 3CXSA 3R96A 1PUAA 1VIXA 3BI1A 2G3TA 2PSWA 2Z3NA 4U5YA 4CGLA 2BUEA 4E8OA 3V38A 1IY7A 5DWNA 5FVJA 2Q44A 1VGYA 4JZ0A 3D3SA 2XEGA 3RYOA 2OZGA 2YNCC 3FMCA 5HXDA 4QBJA 1Y0YA 5D8NA 1IOFA 1M1DA 4ZGYB 3PB8X 4R7MA 3EXNA 3KZWA 4KOUA 5IV0A 4OC3A 2VL1A 2EK9A 2OU2A 3CPAA 4UIAA 4NFRA 2ZENA 3FF3A 4UBRA 4GM5A 1KWMA 1ZLIA 4NCZA 1R43A 5AG5A 1YW4A 1Y7RA 5JH9A 2B4BA 3KL9A 1XOVA 4KVXA 4X5KA 3NH5A 4HNYB 3GB0A 4ZBGA 4AVCA 2Y0MA 3WR7A 4MFPA 2V8GA 1ZG7A 4H2KA 1YQEA 3KR5A 2B58A 3IGRA 3EFAA 2ARHA 3G3SA 3B3TA 3DR6A 2EUIA 3K9TA 4R3KA 3SI2A 3JUWA 4NJRA 1QMUA 2PJ7A 1XFOA 2QJ8A 3G8WA 1XMTA 2B3VA 4E0AA 3L2NA 1LAMA 1R57A 4UWJA 5GCNA 2FCKA 1M44A 2WPXA 3KQZA 2XEFA 2PJ3A 1HEEA 4RN7A 2DF5A 2QECA 3SJEA 3KHXA 4OLLA 2GLJA 2QMLA
chains in the Genus database with same CATH topology
5K8OA 3B35A 4OIDA 4PPZA 4EMEA 1IGBA 3FVLA 4P10A 1OBRA 3JRUA 2IQ6A 4FWUA 5K8PA 4PQAA 1F2PA 4PXCA 4ZX8A 4A37A 2PVVA 3D67A 3PB4X 1DE4C 2FVGA 3B3CA 4AXVA 3V7ZA 3S9LA 5JM6A 4UIBA 4NGNA 7CPAA 2BOAA 4OIWA 2C6CA 3PFOA 4DUKA 4OC5A 4MHPA 1LAPA 3H8FA 4Z65A 3LMSA 1CX8A 4A38A 3B2YA 1F2OA 2AFWA 1HDQA 1XMBA 3CT9A 4P45A 1ARMA 2PE3A 3PFEA 1CP7A 4MHZA 4P4EA 3MN8A 3NA6A 3FH4A 4P4BA 2OR4A 2JEWA 3SJGA 2PCUA 2DEAA 4NGRA 4P44A 1YMEA 3PB6X 2ZEFA 5ELYA 2ZEGA 1GYTA 3IC1A 5CBMA 4KSIA 3FJUA 4G1PA 4BD9A 2ZEHA 1YSJA 2V8DA 4YWYA 4Q7AA 3N5FA 4F9UA 1BPMA 3WABA 3D7GA 5LRJA 5F09A 2PJ9A 1ARLA 1Y7EA 3CDXA 2F8HA 4MHYA 2NSMA 4UF4A 2CIJA 2CF4A 2AFMA 4EFDA 2C6PA 4NGTA 4OP4A 2HC9A 4YU9A 2C6GA 1TKFA 1CPXA 3B3SA 4PXBA 1XJOA 4MMOA 3HUVA 4CPAA 2PJ6A 2GREA 2V8HA 2O4HA 1F57A 5J1QA 4MCQA 4OC1A 4W9YA 5D29A 3D4UA 3FECA 1ZG9A 4JYWA 4F9VA 1AMPA 2PJ4A 2JBKA 3DLJA 4RUHA 4WWVA 1ELLP 4ZY1A 2C1CA 3SI0A 1YW6A 3FEDA 5HVGA 2POKA 5LYDA 5JGFA 1BPNA 2G9DA 1R3NA 3I1UA 3KGQA 1LFWA 3S9MA 4R6TA 3VARA 2BCOA 3IEHA 4NGSA 2NYQA 1H8LA 5CPAA 1ELMP 2PJ2A 3CPXA 3IO1A 2EWBA 1TXRA 4MCRA 1PYTB 2ZELA 2ZEMA 1BAVA 3IFEA 1Y0RA 1LCPA 4MRIA 2Q4ZA 1CBXA 1TF9A 2PJ5A 1YLOA 2HB6A 1LOKA 3WC5A 3H8EA 3D7FA 2AFZA 4P4FA 2Q43A 3RZAA 3SJXA 4X3RA 5LRGA 4OC2A 1PCAA 2ABZA 4A39A 2IJZA 2J9AA 2Q51A 2PJ1A 3FEEA 4UEFA 3B3VA 1QQ9A 1TKJA 8CPAA 1HDUA 2ZEPA 2ZEOA 2CTBA 4EWTA 3PBEA 4MCSA 3WC7A 4NJQA 5LYIA 2CTCA 2PRQA 1CP6A 4P4IA 1Z5RA 3QNVA 2PJCA 3IWWA 2PJ0A 4ZY2A 2AFXA 3VATA 3GLJA 5HVFA 3VH9A 3SJFA 4NGPA 1DTDA 3TX8A 1NSAA 3WT4A 3IJ3A 2XEJA 3DGVA 1ZLHA 2PJBA 3RAMA 2GLFA 2PIZA 3MRUA 5I4MA 4MXUA 2PVWA 1AYEA 2AFOA 2I3CA 5K8NA 5LYFA 4P4JA 1UWYA 3D68A 2PIYA 2ANPA 2RFHA 3SI1A 6CPAA 4UEZA 1TKHA 2O53A 3D66A 4LQGA 4WJBA 4MHNA 5LRKA 3KI9A 4OMEA 2OOTA 4X2TA 3PBBA 4P6YA 4OKOA 3TC8A 3WC6A 2WYRA 3KASA 4R76A 1Q7LA 4IK2A 2ZOFA 3K2KA 3NH8A 2V77A 4TWEA 1Z8LA 4IHMA 3BXMA 2JBJA 4NGQA 3B3WA 1VHOA 1VHEA 4NGMA 4PXDA 4R8FA 2PJAA 1ZG8A 3GUXA 4B6ZA 3S9NA 3B7IA 1CPSA 4FBEA 3IIBA 1BLLE 4TNUA 1M4LA 5LYLA 3H8GA 2RB7A 3KR4A 4MCPA 3HLPA 4P4DA 2QVPA 3PEIA 2WZNA 2QYVA 1RTQA 4O23A 3NFZA 4DYOA 1Z2LA 2AFSA 1CG2A 2F7VA 3FX6A 4FAIA 2EK8A 2GU2A 4ZX9A 2AFUA 4OC0A 3RBUA 4ZY0A 3ISXA 1FT7A 3PB9X 3KHZA 4IAVA 4F8ZA 3D7DA 1XRYA 2XEIA 4DJLA 1FNOA 4ZI6A 3PB7X 2ZOGA 1EE3P 1TF8A 2ZEDA 4FUUA 3KQXA 2PJ8A 2BO9A 4X8IA 1XBUA 3BHXA 3NH4A 2IMOA 1JQGA 4A94A 4OC4A 3BI0A 5K8MA 5DS0A 5HVHA 5IB9A 1LANA 3T8WA 4PXEA 4ONWA 4K3NA 3D7HA 2V8VA 3LWUA 4ZYQA 3PRTA 2ZEEA 4UEEA 5THWA 1VIXA 3BI1A 3V38A 1IY7A 1VGYA 4JZ0A 2XEGA 5HXDA 3FMCA 1Y0YA 5D8NA 3PB8X 4R7MA 3KZWA 4OC3A 2VL1A 2EK9A 3CPAA 4UIAA 4NFRA 2ZENA 3FF3A 4GM5A 1KWMA 1ZLIA 1R43A 1YW4A 5JH9A 3KL9A 3NH5A 3GB0A 2V8GA 1ZG7A 4H2KA 3KR5A 3B3TA 3K9TA 3SI2A 4NJRA 1QMUA 2PJ7A 1XFOA 2QJ8A 3L2NA 1LAMA 3KQZA 2XEFA 2PJ3A 1HEEA 3SJEA 3KHXA 2GLJA 3ISZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5K8O A;  3B35 A;  4OID A;  4PPZ A;  4EME A;  1IGB A;  3FVL A;  4P10 A;  1OBR A;  3JRU A;  2IQ6 A;  4FWU A;  5K8P A;  4PQA A;  1F2P A;  4PXC A;  4ZX8 A;  4A37 A;  2PVV A;  3D67 A;  3PB4 X;  1DE4 C;  2FVG A;  3B3C A;  4AXV A;  3V7Z A;  3S9L A;  5JM6 A;  4UIB A;  4NGN A;  7CPA A;  2BOA A;  4OIW A;  2C6C A;  3PFO A;  4DUK A;  4OC5 A;  4MHP A;  1LAP A;  3H8F A;  4Z65 A;  3LMS A;  1CX8 A;  4A38 A;  3B2Y A;  1F2O A;  2AFW A;  1HDQ A;  1XMB A;  3CT9 A;  4P45 A;  1ARM A;  2PE3 A;  3PFE A;  1CP7 A;  4MHZ A;  4P4E A;  3MN8 A;  3NA6 A;  3FH4 A;  4P4B A;  2OR4 A;  2JEW A;  3SJG A;  2PCU A;  2DEA A;  4NGR A;  4P44 A;  1YME A;  3PB6 X;  2ZEF A;  5ELY A;  2ZEG A;  1GYT A;  3IC1 A;  5CBM A;  4KSI A;  3FJU A;  4G1P A;  4BD9 A;  2ZEH A;  1YSJ A;  2V8D A;  4YWY A;  4Q7A A;  3N5F A;  4F9U A;  1BPM A;  3WAB A;  3D7G A;  5LRJ A;  5F09 A;  2PJ9 A;  1ARL A;  1Y7E A;  3CDX A;  2F8H A;  4MHY A;  2NSM A;  4UF4 A;  2CIJ A;  2CF4 A;  2AFM A;  4EFD A;  2C6P A;  4NGT A;  4OP4 A;  2HC9 A;  4YU9 A;  2C6G A;  1TKF A;  1CPX A;  3B3S A;  4PXB A;  1XJO A;  4MMO A;  3HUV A;  4CPA A;  2PJ6 A;  2GRE A;  2V8H A;  2O4H A;  1F57 A;  5J1Q A;  4MCQ A;  4OC1 A;  4W9Y A;  5D29 A;  3D4U A;  3FEC A;  1ZG9 A;  4JYW A;  4F9V A;  1AMP A;  2PJ4 A;  2JBK A;  3DLJ A;  4RUH A;  4WWV A;  1ELL P;  4ZY1 A;  2C1C A;  3SI0 A;  1YW6 A;  3FED A;  5HVG A;  2POK A;  5LYD A;  5JGF A;  1BPN A;  2G9D A;  1R3N A;  3I1U A;  3KGQ A;  1LFW A;  3S9M A;  4R6T A;  3VAR A;  2BCO A;  3IEH A;  4NGS A;  2NYQ A;  1H8L A;  5CPA A;  1ELM P;  2PJ2 A;  3CPX A;  3IO1 A;  2EWB A;  1TXR A;  4MCR A;  1PYT B;  2ZEL A;  2ZEM A;  1BAV A;  3IFE A;  1Y0R A;  1LCP A;  4MRI A;  2Q4Z A;  1CBX A;  1TF9 A;  2PJ5 A;  1YLO A;  2HB6 A;  1LOK A;  3WC5 A;  3H8E A;  3D7F A;  2AFZ A;  4P4F A;  2Q43 A;  3RZA A;  3SJX A;  4X3R A;  5LRG A;  4OC2 A;  1PCA A;  2ABZ A;  4A39 A;  2IJZ A;  2J9A A;  2Q51 A;  2PJ1 A;  3FEE A;  4UEF A;  3B3V A;  1QQ9 A;  1TKJ A;  8CPA A;  1HDU A;  2ZEP A;  2ZEO A;  2CTB A;  4EWT A;  3PBE A;  4MCS A;  3WC7 A;  4NJQ A;  5LYI A;  2CTC A;  2PRQ A;  1CP6 A;  4P4I A;  1Z5R A;  3QNV A;  2PJC A;  3IWW A;  2PJ0 A;  4ZY2 A;  2AFX A;  3VAT A;  3GLJ A;  5HVF A;  3VH9 A;  3SJF A;  4NGP A;  1DTD A;  3TX8 A;  1NSA A;  3WT4 A;  3IJ3 A;  2XEJ A;  3DGV A;  1ZLH A;  2PJB A;  3RAM A;  2GLF A;  2PIZ A;  3MRU A;  5I4M A;  4MXU A;  2PVW A;  1AYE A;  2AFO A;  2I3C A;  5K8N A;  5LYF A;  4P4J A;  1UWY A;  3D68 A;  2PIY A;  2ANP A;  2RFH A;  3SI1 A;  6CPA A;  4UEZ A;  1TKH A;  2O53 A;  3D66 A;  4LQG A;  4WJB A;  4MHN A;  5LRK A;  3KI9 A;  4OME A;  2OOT A;  4X2T A;  3PBB A;  4P6Y A;  4OKO A;  3TC8 A;  3WC6 A;  2WYR A;  3KAS A;  4R76 A;  1Q7L A;  4IK2 A;  2ZOF A;  3K2K A;  3NH8 A;  2V77 A;  4TWE A;  1Z8L A;  4IHM A;  3BXM A;  2JBJ A;  4NGQ A;  3B3W A;  1VHO A;  1VHE A;  4NGM A;  4PXD A;  4R8F A;  2PJA A;  1ZG8 A;  3GUX A;  4B6Z A;  3S9N A;  3B7I A;  1CPS A;  4FBE A;  3IIB A;  1BLL E;  4TNU A;  1M4L A;  5LYL A;  3H8G A;  2RB7 A;  3KR4 A;  4MCP A;  3HLP A;  4P4D A;  2QVP A;  3PEI A;  2WZN A;  2QYV A;  1RTQ A;  4O23 A;  3NFZ A;  4DYO A;  1Z2L A;  2AFS A;  1CG2 A;  2F7V A;  3FX6 A;  4FAI A;  2EK8 A;  2GU2 A;  4ZX9 A;  2AFU A;  4OC0 A;  3RBU A;  4ZY0 A;  3ISX A;  1FT7 A;  3PB9 X;  3KHZ A;  4IAV A;  4F8Z A;  3D7D A;  1XRY A;  2XEI A;  4DJL A;  1FNO A;  4ZI6 A;  3PB7 X;  2ZOG A;  1EE3 P;  1TF8 A;  2ZED A;  4FUU A;  3KQX A;  2PJ8 A;  2BO9 A;  4X8I A;  1XBU A;  3BHX A;  3NH4 A;  2IMO A;  1JQG A;  4A94 A;  4OC4 A;  3BI0 A;  5K8M A;  5DS0 A;  5HVH A;  5IB9 A;  1LAN A;  3T8W A;  4PXE A;  4ONW A;  4K3N A;  3D7H A;  2V8V A;  3LWU A;  4ZYQ A;  3PRT A;  2ZEE A;  4UEE A;  5THW A;  1VIX A;  3BI1 A;  3V38 A;  1IY7 A;  1VGY A;  4JZ0 A;  2XEG A;  5HXD A;  3FMC A;  1Y0Y A;  5D8N A;  3PB8 X;  4R7M A;  3KZW A;  4OC3 A;  2VL1 A;  2EK9 A;  3CPA A;  4UIA A;  4NFR A;  2ZEN A;  3FF3 A;  4GM5 A;  1KWM A;  1ZLI A;  1R43 A;  1YW4 A;  5JH9 A;  3KL9 A;  3NH5 A;  3GB0 A;  2V8G A;  1ZG7 A;  4H2K A;  3KR5 A;  3B3T A;  3K9T A;  3SI2 A;  4NJR A;  1QMU A;  2PJ7 A;  1XFO A;  2QJ8 A;  3L2N A;  1LAM A;  3KQZ A;  2XEF A;  2PJ3 A;  1HEE A;  3SJE A;  3KHX A;  2GLJ A;  3ISZ A; 
#chains in the Genus database with same CATH topology
 2HQY A;  2X7B A;  5K8O A;  3TT2 A;  3B35 A;  4OID A;  4PPZ A;  4EME A;  2GIV A;  4YGO A;  2R7H A;  1KZF A;  1IGB A;  3FVL A;  4P10 A;  3RO0 A;  4F0X A;  1OBR A;  3JRU A;  2JLM A;  3F0A A;  3P2F A;  2IQ6 A;  4FWU A;  4HNW B;  2EVN A;  5EC4 A;  1U6M A;  5K8P A;  4C7H A;  4FD6 A;  4AVB A;  3DR8 A;  1F2P A;  4PQA A;  4PXC A;  4ZX8 A;  4A37 A;  2PVV A;  3D67 A;  3PB4 X;  3LOD A;  5BWA B;  4HKF A;  1DE4 C;  2FVG A;  3B3C A;  1FY7 A;  4AXV A;  4B5P B;  4KUA A;  2O28 A;  3V7Z A;  3S9L A;  5JM6 A;  4CGM A;  4UIB A;  4NGN A;  3TO6 A;  7CPA A;  1Q2D A;  2BOA A;  4OIW A;  2C6C A;  3PFO A;  4IF5 A;  2JDC A;  4DUK A;  2Z11 A;  4OC5 A;  4MHP A;  1LAP A;  3FB3 A;  3H8F A;  4Z65 A;  3LMS A;  1OZP A;  1CX8 A;  4A38 A;  1YGH A;  3B2Y A;  4MFK A;  5AG6 A;  1F2O A;  3C26 A;  2AFW A;  4B5O A;  1HDQ A;  1XMB A;  3CT9 A;  1YR0 A;  4P45 A;  1ARM A;  2PE3 A;  3PFE A;  4JWP A;  4UCM A;  5AG7 A;  4CAV A;  4B10 A;  5H86 A;  1CP7 A;  4MHZ A;  1V0C A;  4P4E A;  3MN8 A;  3NA6 A;  3FH4 A;  4Q36 A;  4CYN A;  1I1D A;  1Q2Y A;  4P4B A;  1S60 A;  2OR4 A;  2JEW A;  5G1Z A;  3SJG A;  2PCU A;  2DEA A;  4NGR A;  4P44 A;  3LD2 A;  2KCW A;  3CXP A;  4UA3 A;  4XPL A;  1YME A;  2JDD A;  3PB6 X;  3S6G A;  3W91 A;  1YK3 A;  3TO7 A;  3DDD A;  4KOY A;  2ZEF A;  1IB1 E;  5ELY A;  2ZEG A;  4GXH A;  1GYT A;  5CNP A;  3IC1 A;  3IWE A;  4QVT A;  4R87 A;  2OH1 A;  3I9S A;  2BSW A;  2Q4V A;  4MHD A;  2DXQ A;  5CBM A;  4KSI A;  3FJU A;  1M4G A;  4G1P A;  3BLN A;  4NSQ A;  4QB9 A;  4M6I A;  4BD9 A;  2ZEH A;  1YSJ A;  2V8D A;  3V8I A;  4JXQ A;  3D2P A;  5HH1 A;  4YWY A;  4Q7A A;  4IUS A;  5EBV A;  3FIX A;  4CYP A;  3N5F A;  1XE4 A;  4F9U A;  1BPM A;  3WAB A;  3D7G A;  5LRJ A;  2Q7B A;  3W6X A;  2FL4 A;  5F09 A;  2Q04 A;  2PJ9 A;  2Q0Y A;  1ARL A;  2FSR A;  2GE3 A;  1Y7E A;  1WK4 A;  4FD7 A;  3CDX A;  2Z0Z A;  1ZO0 A;  1Z8T A;  4K30 A;  2P0W A;  3GKR A;  2F8H A;  3TE4 A;  3FNC A;  2I00 A;  4MHY A;  2Z3P A;  2R98 A;  2NSM A;  4UF4 A;  1RXT A;  2CF4 A;  2CIJ A;  2AFM A;  4EFD A;  2C6P A;  4NGT A;  4CAX A;  2IL4 A;  5F46 A;  3EO4 A;  4MBU A;  4OP4 A;  2D4O A;  3EY5 A;  2HC9 A;  1N71 A;  4JLY A;  2C6G A;  1TKF A;  4YU9 A;  1CPX A;  4CYO A;  1MJ9 A;  1UFH A;  1XIX A;  3B3S A;  4KOV A;  4PXB A;  4AG7 A;  1VKC A;  4GS4 A;  1XJO A;  4MMO A;  4QC6 A;  3GIU A;  3HUV A;  4MY3 A;  3ZJ0 A;  1IOI A;  2VZZ A;  4CS0 B;  5G20 A;  2I79 A;  2PJ6 A;  1IYL A;  1VHS A;  2Z3O A;  4KZT A;  2GRE A;  4CPA A;  5J8C A;  2V8H A;  2O4H A;  3VWD A;  1Z8X A;  4HPS A;  1F57 A;  1M4D A;  4H6Z A;  4MCQ A;  5J1Q A;  4KOX A;  3BJ7 A;  5J8F A;  1LRZ A;  2Z3K A;  2J8M A;  5F48 A;  2B3U A;  4PV6 A;  4OC1 A;  4W9Y A;  1IU8 A;  4KVM E;  5D29 A;  4U9Z A;  3H4Q A;  3D4U A;  3FEC A;  1ZG9 A;  1B87 A;  3LAC A;  4JYW A;  1AMP A;  1IYK A;  4F9V A;  4M3S A;  2PJ4 A;  2JBK A;  4C68 A;  4U9Y A;  3DLJ A;  2ODF A;  1Y9W A;  4RUH A;  3S6K A;  4C2Z A;  1S7F A;  2P6G A;  3N7Z A;  4WWV A;  3VWE A;  1QSR A;  3JTK A;  1XF8 A;  1ELL P;  2HUZ A;  5HMN A;  3W6S A;  2ZW5 A;  4ZY1 A;  1YVK A;  1JWQ A;  2C1C A;  2FIW A;  3SI0 A;  1YW6 A;  3FED A;  4I49 A;  4L89 A;  1IID A;  1S5K A;  2CNT A;  2VEZ A;  5G21 A;  5HVG A;  4PSW A;  1QSM A;  3T90 A;  2VZY A;  2POK A;  5LYD A;  5JGF A;  4B13 A;  5H84 A;  4UCN A;  1BPN A;  2G9D A;  1R3N A;  3I1U A;  2CNS A;  1TIQ A;  2Z10 A;  3KGQ A;  4CAF A;  1LFW A;  2PQ8 A;  3S9M A;  4CRY B;  2Z3M A;  1KUY A;  4R6T A;  3VAR A;  3RNZ A;  2BCO A;  3IEH A;  4NGS A;  2NYQ A;  4MJ8 A;  1H8L A;  4R57 A;  1Z9U A;  5CPA A;  4UFW A;  1ELM P;  4MFL A;  4YRH A;  2EBJ A;  2PJ2 A;  3CPX A;  4A31 A;  1Z4E A;  4AB7 A;  4C7I A;  2P6F A;  2YNE A;  3IO1 A;  4B12 A;  1NMT A;  4CGN A;  2EWB A;  1TXR A;  4MCR A;  1KUV A;  1PYT B;  4Y49 C;  2FS5 A;  2ZEL A;  4XPD C;  3A9L A;  4OAE A;  2ZEM A;  1BAV A;  2PC1 A;  3IFE A;  5JPH A;  1Y0R A;  2GAN A;  1LCP A;  1L0C A;  4J3G A;  4MRI A;  2Q4Z A;  1CBX A;  2YNC A;  5F47 A;  3SXO A;  4CGP A;  1TF9 A;  4DNC A;  2PJ5 A;  1YLO A;  4MY0 A;  4F0Y A;  2HB6 A;  1LOK A;  3F5B A;  3FBU A;  3WC5 A;  2OZH A;  3H8E A;  3ISZ A;  5E96 A;  3PGP A;  3D7F A;  2AFZ A;  1K4J A;  4P4F A;  2R8V A;  2Q43 A;  3RZA A;  4HNX B;  4X3R A;  5LRG A;  3SJX A;  4BMH A;  4OC2 A;  2REF A;  1S7N A;  2FIA A;  1S7L A;  1CM0 A;  1PCA A;  2PR1 A;  3NE8 A;  4AG9 A;  4KUB A;  4PK3 A;  2ABZ A;  4A39 A;  2IJZ A;  2J9A A;  2Q4Y A;  4JXR A;  2WSA A;  2Q51 A;  2B4D A;  3R9E A;  4LQ6 A;  3DSB A;  1KUX A;  2PJ1 A;  3JVN A;  1YVO A;  3FEE A;  4UEF A;  3B3V A;  3CZX A;  4UFV A;  1QQ9 A;  4MFQ A;  1TKJ A;  4A32 A;  3S6F A;  8CPA A;  1I12 A;  4F6A A;  2J8N A;  1HDU A;  4II9 A;  2ZEP A;  2ZEO A;  1QSO A;  3EC4 A;  2ZW4 A;  1S3Z A;  5IB0 A;  1AUG A;  2CXA A;  4XNH C;  2CTB A;  4EWT A;  2Q7S A;  3PBE A;  4MCS A;  3WC7 A;  4NJQ A;  3CXQ A;  5LYI A;  2CTC A;  1X10 A;  2PRQ A;  1A2Z A;  4H6U A;  1YRE A;  4CGO A;  1CP6 A;  4P4I A;  1Z5R A;  2EO8 A;  4CAE A;  3QNV A;  2PJC A;  3UY5 A;  3IU2 A;  3IWW A;  1ON0 A;  1P4N A;  2PJ0 A;  2Z3L A;  4KOS A;  1Y9K A;  1B6B A;  1MJA A;  4ZY2 A;  4FD5 A;  2AFX A;  1WWZ A;  3VAT A;  2F5I A;  5G22 A;  3GLJ A;  3PP9 A;  4MFJ A;  2P6E A;  1S7K A;  5HVF A;  3VH9 A;  4C2X A;  3SJF A;  2OZU A;  4NGP A;  1DTD A;  1SQH A;  1NSA A;  3TX8 A;  3WT4 A;  2BEI A;  1QST A;  3T9Y A;  4CAW A;  3KKW A;  5DWM A;  3IJ3 A;  2XEJ A;  4NXY A;  3DGV A;  1ZLH A;  2PJB A;  4ORF A;  3RAM A;  2GLF A;  2PIZ A;  3MRU A;  4RS2 A;  5AGE A;  5I4M A;  4KLW A;  4MXU A;  2RC4 A;  1QSN A;  2PVW A;  3IU1 A;  3PZJ A;  1MJB A;  4MFZ A;  1AYE A;  2AFO A;  1NE9 A;  4Q38 A;  2AE6 A;  3FYN A;  2J8R A;  2I3C A;  5K8N A;  5JQ4 A;  5LYF A;  4P4J A;  3E0K A;  2YGW A;  1UWY A;  3D68 A;  2PIY A;  2ANP A;  2RFH A;  3SI1 A;  4KVO E;  4RI1 A;  3TFY A;  4PK2 A;  6CPA A;  3BJ8 A;  4UEZ A;  1TKH A;  2O53 A;  3D66 A;  4LQG A;  4WJB A;  2ATR A;  4MHN A;  2HV2 A;  5LRK A;  3KI9 A;  4OME A;  2OOT A;  4KSA A;  3ZZI A;  4X2T A;  4CYQ A;  3PBB A;  4MI4 A;  4P6Y A;  2ZXV A;  4OKO A;  3I3G A;  3SXN A;  3TC8 A;  3WC6 A;  4BBH A;  4M6H A;  2JEV A;  2B4D B;  2QIR A;  2WYR A;  3QAH A;  4R9M A;  5KTD A;  4KOR A;  3KAS A;  2DPS A;  4R76 A;  1XEB A;  2VI7 A;  1Q7L A;  4IK2 A;  4B14 A;  2ZOF A;  4YFJ A;  5F49 A;  2ZW7 A;  4KOT A;  3SHP A;  2BL1 A;  4R3L A;  3K2K A;  3NH8 A;  4KSF A;  4UFX A;  4CRZ B;  4KLV A;  2A4N A;  2YND A;  2V77 A;  4TWE A;  4H89 A;  1YLE A;  3P2H A;  2REE A;  1Z8L A;  1Z4R A;  2OB0 A;  4IHM A;  1PU9 A;  4NF1 A;  3F8K A;  3BXM A;  2JBJ A;  4NGQ A;  3S6H A;  3B3W A;  3QB8 A;  4C2Y A;  4E2A A;  5A27 A;  1VHO A;  1VHE A;  2VQY A;  4QUS A;  4OAD A;  2B5G A;  3TOA A;  1RO5 A;  2D4P A;  4NGM A;  4PXD A;  2FE7 A;  4R8F A;  2PJA A;  4EVY A;  1ZG8 A;  4B11 A;  5KTC A;  3GUX A;  4A2Z A;  4B6Z A;  3S9N A;  1YX0 A;  3B7I A;  2G3A A;  1CPS A;  4M85 A;  4NEX A;  1M4I A;  4A33 A;  4FBE A;  2G0B A;  4Y49 B;  2GFQ A;  3QAY A;  3IIB A;  4XPD B;  1BLL E;  3K9U A;  4JJX A;  1M4L A;  4TNU A;  5LYL A;  3H8G A;  2FXF A;  2RB7 A;  4KS9 A;  2WPW A;  4BIN A;  3KR4 A;  4JD6 A;  4L8A A;  1Q2C A;  4MCP A;  3HLP A;  1P0H A;  2QVP A;  4P4D A;  4A30 A;  3TOB A;  2H5M A;  3PEI A;  2WZN A;  2QYV A;  1RTQ A;  4O23 A;  2PR8 A;  3GY9 A;  3GYA A;  3NFZ A;  4LX9 A;  4DYO A;  2AJ6 A;  1Z2L A;  2AFS A;  1CG2 A;  2F7V A;  2PRB A;  3FX6 A;  2EK8 A;  2GU2 A;  4FAI A;  4ZX9 A;  2AFU A;  2DPT A;  4OC0 A;  4AVA A;  3RBU A;  4ZY0 A;  3ISX A;  2R1I A;  1BOB A;  1FT7 A;  2ZPA A;  3PB9 X;  3KHZ A;  4IAV A;  1CJW A;  4M6G A;  4XPK A;  4F8Z A;  3D7D A;  1XRY A;  2XEI A;  2NMT A;  3MGD A;  1Z8W A;  5C88 A;  4ONU A;  4DJL A;  2K5T A;  1FNO A;  4FD4 A;  2PDO A;  3PB7 X;  4ZI6 A;  5KTA A;  4LUA A;  2ZOG A;  3TTH A;  3B8G A;  5AG4 A;  1EE3 P;  1TF8 A;  2CY2 A;  2ZED A;  1I21 A;  3KQX A;  4FUU A;  2PJ8 A;  3R95 A;  1X12 A;  5A28 A;  2BO9 A;  2ZW6 A;  1IIC A;  3DNS A;  2CNM A;  4X8I A;  3FXT A;  1XBU A;  5I0C A;  3BHX A;  3NH4 A;  4XNH B;  2IMO A;  1JQG A;  3D2M A;  4A94 A;  3IWG A;  3R1K A;  4OC4 A;  4PSX A;  1NSL A;  3TCV A;  1GHE A;  3H5Z A;  3D8P A;  3BI0 A;  5K8M A;  3OWC A;  4UWI A;  4UCP A;  1J4J A;  4KOW A;  5DS0 A;  5HVH A;  3TO9 A;  5IB9 A;  2VXK A;  1BO4 A;  1LAN A;  5ISV A;  4A95 A;  2C27 A;  2FT0 A;  3FRM A;  5EMI A;  3T8W A;  4PXE A;  4ONW A;  4B5P A;  4K3N A;  3D7H A;  3NE7 A;  1MK4 A;  2V8V A;  2WUU A;  3LWU A;  5IX3 A;  2B5G B;  3PRT A;  4ZYQ A;  2ZEE A;  2VBQ A;  4UEE A;  3R9G A;  5THW A;  5C82 A;  3R9F A;  3CXS A;  3R96 A;  1PUA A;  1VIX A;  3BI1 A;  2G3T A;  2PSW A;  2Z3N A;  4U5Y A;  4CGL A;  2BUE A;  4E8O A;  3V38 A;  1IY7 A;  5DWN A;  5FVJ A;  2Q44 A;  1VGY A;  4JZ0 A;  3D3S A;  2XEG A;  3RYO A;  2OZG A;  2YNC C;  3FMC A;  5HXD A;  4QBJ A;  1Y0Y A;  5D8N A;  1IOF A;  1M1D A;  4ZGY B;  3PB8 X;  4R7M A;  3EXN A;  3KZW A;  4KOU A;  5IV0 A;  4OC3 A;  2VL1 A;  2EK9 A;  2OU2 A;  3CPA A;  4UIA A;  4NFR A;  2ZEN A;  3FF3 A;  4UBR A;  4GM5 A;  1KWM A;  1ZLI A;  4NCZ A;  1R43 A;  5AG5 A;  1YW4 A;  1Y7R A;  5JH9 A;  2B4B A;  3KL9 A;  1XOV A;  4KVX A;  4X5K A;  3NH5 A;  4HNY B;  3GB0 A;  4ZBG A;  4AVC A;  2Y0M A;  3WR7 A;  4MFP A;  2V8G A;  1ZG7 A;  4H2K A;  1YQE A;  3KR5 A;  2B58 A;  3IGR A;  3EFA A;  2ARH A;  3G3S A;  3B3T A;  3DR6 A;  2EUI A;  3K9T A;  4R3K A;  3SI2 A;  3JUW A;  4NJR A;  1QMU A;  2PJ7 A;  1XFO A;  2QJ8 A;  3G8W A;  1XMT A;  2B3V A;  4E0A A;  3L2N A;  1LAM A;  1R57 A;  4UWJ A;  5GCN A;  2FCK A;  1M44 A;  2WPX A;  3KQZ A;  2XEF A;  2PJ3 A;  1HEE A;  4RN7 A;  2DF5 A;  2QEC A;  3SJE A;  3KHX A;  4OLL A;  2GLJ A;  2QML A; 
#chains in the Genus database with same CATH homology
 5K8O A;  3B35 A;  4OID A;  4PPZ A;  4EME A;  1IGB A;  3FVL A;  4P10 A;  1OBR A;  3JRU A;  2IQ6 A;  4FWU A;  5K8P A;  4PQA A;  1F2P A;  4PXC A;  4ZX8 A;  4A37 A;  2PVV A;  3D67 A;  3PB4 X;  1DE4 C;  2FVG A;  3B3C A;  4AXV A;  3V7Z A;  3S9L A;  5JM6 A;  4UIB A;  4NGN A;  7CPA A;  2BOA A;  4OIW A;  2C6C A;  3PFO A;  4DUK A;  4OC5 A;  4MHP A;  1LAP A;  3H8F A;  4Z65 A;  3LMS A;  1CX8 A;  4A38 A;  3B2Y A;  1F2O A;  2AFW A;  1HDQ A;  1XMB A;  3CT9 A;  4P45 A;  1ARM A;  2PE3 A;  3PFE A;  1CP7 A;  4MHZ A;  4P4E A;  3MN8 A;  3NA6 A;  3FH4 A;  4P4B A;  2OR4 A;  2JEW A;  3SJG A;  2PCU A;  2DEA A;  4NGR A;  4P44 A;  1YME A;  3PB6 X;  2ZEF A;  5ELY A;  2ZEG A;  1GYT A;  3IC1 A;  5CBM A;  4KSI A;  3FJU A;  4G1P A;  4BD9 A;  2ZEH A;  1YSJ A;  2V8D A;  4YWY A;  4Q7A A;  3N5F A;  4F9U A;  1BPM A;  3WAB A;  3D7G A;  5LRJ A;  5F09 A;  2PJ9 A;  1ARL A;  1Y7E A;  3CDX A;  2F8H A;  4MHY A;  2NSM A;  4UF4 A;  2CIJ A;  2CF4 A;  2AFM A;  4EFD A;  2C6P A;  4NGT A;  4OP4 A;  2HC9 A;  4YU9 A;  2C6G A;  1TKF A;  1CPX A;  3B3S A;  4PXB A;  1XJO A;  4MMO A;  3HUV A;  4CPA A;  2PJ6 A;  2GRE A;  2V8H A;  2O4H A;  1F57 A;  5J1Q A;  4MCQ A;  4OC1 A;  4W9Y A;  5D29 A;  3D4U A;  3FEC A;  1ZG9 A;  4JYW A;  4F9V A;  1AMP A;  2PJ4 A;  2JBK A;  3DLJ A;  4RUH A;  4WWV A;  1ELL P;  4ZY1 A;  2C1C A;  3SI0 A;  1YW6 A;  3FED A;  5HVG A;  2POK A;  5LYD A;  5JGF A;  1BPN A;  2G9D A;  1R3N A;  3I1U A;  3KGQ A;  1LFW A;  3S9M A;  4R6T A;  3VAR A;  2BCO A;  3IEH A;  4NGS A;  2NYQ A;  1H8L A;  5CPA A;  1ELM P;  2PJ2 A;  3CPX A;  3IO1 A;  2EWB A;  1TXR A;  4MCR A;  1PYT B;  2ZEL A;  2ZEM A;  1BAV A;  3IFE A;  1Y0R A;  1LCP A;  4MRI A;  2Q4Z A;  1CBX A;  1TF9 A;  2PJ5 A;  1YLO A;  2HB6 A;  1LOK A;  3WC5 A;  3H8E A;  3D7F A;  2AFZ A;  4P4F A;  2Q43 A;  3RZA A;  3SJX A;  4X3R A;  5LRG A;  4OC2 A;  1PCA A;  2ABZ A;  4A39 A;  2IJZ A;  2J9A A;  2Q51 A;  2PJ1 A;  3FEE A;  4UEF A;  3B3V A;  1QQ9 A;  1TKJ A;  8CPA A;  1HDU A;  2ZEP A;  2ZEO A;  2CTB A;  4EWT A;  3PBE A;  4MCS A;  3WC7 A;  4NJQ A;  5LYI A;  2CTC A;  2PRQ A;  1CP6 A;  4P4I A;  1Z5R A;  3QNV A;  2PJC A;  3IWW A;  2PJ0 A;  4ZY2 A;  2AFX A;  3VAT A;  3GLJ A;  5HVF A;  3VH9 A;  3SJF A;  4NGP A;  1DTD A;  3TX8 A;  1NSA A;  3WT4 A;  3IJ3 A;  2XEJ A;  3DGV A;  1ZLH A;  2PJB A;  3RAM A;  2GLF A;  2PIZ A;  3MRU A;  5I4M A;  4MXU A;  2PVW A;  1AYE A;  2AFO A;  2I3C A;  5K8N A;  5LYF A;  4P4J A;  1UWY A;  3D68 A;  2PIY A;  2ANP A;  2RFH A;  3SI1 A;  6CPA A;  4UEZ A;  1TKH A;  2O53 A;  3D66 A;  4LQG A;  4WJB A;  4MHN A;  5LRK A;  3KI9 A;  4OME A;  2OOT A;  4X2T A;  3PBB A;  4P6Y A;  4OKO A;  3TC8 A;  3WC6 A;  2WYR A;  3KAS A;  4R76 A;  1Q7L A;  4IK2 A;  2ZOF A;  3K2K A;  3NH8 A;  2V77 A;  4TWE A;  1Z8L A;  4IHM A;  3BXM A;  2JBJ A;  4NGQ A;  3B3W A;  1VHO A;  1VHE A;  4NGM A;  4PXD A;  4R8F A;  2PJA A;  1ZG8 A;  3GUX A;  4B6Z A;  3S9N A;  3B7I A;  1CPS A;  4FBE A;  3IIB A;  1BLL E;  4TNU A;  1M4L A;  5LYL A;  3H8G A;  2RB7 A;  3KR4 A;  4MCP A;  3HLP A;  4P4D A;  2QVP A;  3PEI A;  2WZN A;  2QYV A;  1RTQ A;  4O23 A;  3NFZ A;  4DYO A;  1Z2L A;  2AFS A;  1CG2 A;  2F7V A;  3FX6 A;  4FAI A;  2EK8 A;  2GU2 A;  4ZX9 A;  2AFU A;  4OC0 A;  3RBU A;  4ZY0 A;  3ISX A;  1FT7 A;  3PB9 X;  3KHZ A;  4IAV A;  4F8Z A;  3D7D A;  1XRY A;  2XEI A;  4DJL A;  1FNO A;  4ZI6 A;  3PB7 X;  2ZOG A;  1EE3 P;  1TF8 A;  2ZED A;  4FUU A;  3KQX A;  2PJ8 A;  2BO9 A;  4X8I A;  1XBU A;  3BHX A;  3NH4 A;  2IMO A;  1JQG A;  4A94 A;  4OC4 A;  3BI0 A;  5K8M A;  5DS0 A;  5HVH A;  5IB9 A;  1LAN A;  3T8W A;  4PXE A;  4ONW A;  4K3N A;  3D7H A;  2V8V A;  3LWU A;  4ZYQ A;  3PRT A;  2ZEE A;  4UEE A;  5THW A;  1VIX A;  3BI1 A;  3V38 A;  1IY7 A;  1VGY A;  4JZ0 A;  2XEG A;  5HXD A;  3FMC A;  1Y0Y A;  5D8N A;  3PB8 X;  4R7M A;  3KZW A;  4OC3 A;  2VL1 A;  2EK9 A;  3CPA A;  4UIA A;  4NFR A;  2ZEN A;  3FF3 A;  4GM5 A;  1KWM A;  1ZLI A;  1R43 A;  1YW4 A;  5JH9 A;  3KL9 A;  3NH5 A;  3GB0 A;  2V8G A;  1ZG7 A;  4H2K A;  3KR5 A;  3B3T A;  3K9T A;  3SI2 A;  4NJR A;  1QMU A;  2PJ7 A;  1XFO A;  2QJ8 A;  3L2N A;  1LAM A;  3KQZ A;  2XEF A;  2PJ3 A;  1HEE A;  3SJE A;  3KHX A;  2GLJ A;  3ISZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...