3VARA

Crystal structure of dnpep, znzn form
Total Genus 134
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
134
sequence length
469
structure length
414
Chain Sequence
GRARKEAVQAAARELLKFVNRSPSPFHAVAECRSRLLQAGFHELKETESWDIKPESKYFLTRNSSTIIAFAVGGQYVPGNGFSLIGAHTDSPCLRVKRSQVGFQQVGVETYGGGIWSTWFDRDLTLAGRVIVEQRLVHVDRPILRIPHLAIHLMEMHLVPILATSIQEELEKSVLTSLLCAHLGLSPEDILEMELCLADTQPAVLGGAYEEFIFAPRLDNLHSCFCALQALIDSCSAPASLAADPHVRMIALYDNEEVGSESAQGAQSLLTELVLRRISASPQHLTAFEEAIPKSYMISADMAHAVHPNYLRPLFHKGPVIKVNSKQRYASNAVSEALIREVASSVGVPLQDLTTIGPILASRLGLRVLDLGSPQLAMHSIRETACTTGVLQTITLFKGFFELFPSLSRSLLVD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Aspartyl aminopeptidase
publication title Insights into substrate specificity and metal activation of Mammalian tetrahedral aspartyl aminopeptidase.
pubmed doi rcsb
source organism Bos taurus
total genus 134
structure length 414
sequence length 469
ec nomenclature ec 3.4.11.21: Aspartyl aminopeptidase.
pdb deposition date 2011-12-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02127 Peptidase_M18 Aminopeptidase I zinc metalloprotease (M18)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.250.10 Mainly Beta Roll Aminopeptidase i, Domain 2 Aminopeptidase i, Domain 2 3varA02
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 3varA01
2NYQA 4OC4A 3N5FA 2C6GA 2CIJA 7CPAA 3KR4A 3MRUA 2PE3A 1Y0RA 5K8NA 2V8HA 1CPSA 2ZEOA 3V7ZA 3WC7A 4DJLA 2JBKA 2QJ8A 5JM6A 3KQXA 3FH4A 5D29A 1LOKA 3PRTA 3KQZA 3NH8A 4NGSA 4EFDA 3NFZA 2JBJA 4Q7AA 4PXBA 4ZX9A 3KHXA 4NJQA 2IQ6A 1LANA 3RBUA 4P4EA 8CPAA 2EWBA 2CF4A 3D4UA 2PJBA 3SJEA 1KWMA 4FAIA 1CG2A 2J9AA 4MRIA 1VHOA 1ZG7A 4PQAA 4F9VA 3MN8A 4OC3A 1LAMA 4BD9A 3BI0A 1F57A 4RUHA 3FF3A 1DTDA 2ZEMA 1PYTB 4X2TA 4B6ZA 2PIYA 3RZAA 4ONWA 1ZG8A 3NA6A 5LYLA 3S9LA 3H8FA 2CTBA 2CTCA 1H8LA 4IK2A 4OKOA 1CP6A 3B3CA 5HVGA 3WABA 1F2OA 5ELYA 1XJOA 3FJUA 2PJ4A 5I4MA 3NH5A 1Q7LA 2PJ2A 4K3NA 1F2PA 2PRQA 2RFHA 3ISXA 3PFEA 3FX6A 2ZELA 2PJ6A 2PJ9A 2PCUA 4X8IA 3PB6X 5LRKA 2HC9A 4NGNA 4NGQA 5LRGA 1BLLE 3B2YA 3B3SA 3H8GA 4MXUA 4JZ0A 1R3NA 1TKJA 1AMPA 2AFZA 1IGBA 3LWUA 3PB4X 2Q4ZA 3FEDA 4NGMA 3KI9A 4A37A 1M4LA 4R76A 4ZY0A 3L2NA 3B3VA 3D7HA 2PJ5A 4UEFA 4MCQA 2PJCA 4P44A 5F09A 4FUUA 4OC0A 2V8DA 1BPMA 3KR5A 3B7IA 3PBBA 2OOTA 1XRYA 3ISZA 2ZEDA 3LMSA 3D68A 2Q51A 2G9DA 4PXDA 2O4HA 2XEFA 1YSJA 5JGFA 2F7VA 1RTQA 4DYOA 2BCOA 4P4IA 4P45A 1CX8A 3TX8A 1ZG9A 2PIZA 2ZEFA 4IAVA 3KL9A 3BHXA 4PXCA 4X3RA 5HVFA 1BAVA 2V77A 2IJZA 1Y7EA 2ZOFA 2ZOGA 3T8WA 2HB6A 2I3CA 2AFXA 2BO9A 5J1QA 5THWA 4ZYQA 1ELLP 4GM5A 3IEHA 1ARMA 4OC2A 1VHEA 1YLOA 3I1UA 3BI1A 3D7GA 2C6PA 4P4BA 3TC8A 2BOAA 5HVHA 4JYWA 1HDQA 2ABZA 4TNUA 4F8ZA 3RAMA 4AXVA 1Z5RA 2ZENA 1Z8LA 4P6YA 4TWEA 3WC5A 3CT9A 1YW4A 1EE3P 3PFOA 1QMUA 3IC1A 1NSAA 3H8EA 4KSIA 3D66A 5LYIA 5HXDA 4NFRA 2NSMA 2QVPA 3CPXA 1VIXA 2Q43A 1PCAA 4PPZA 1HDUA 3VH9A 4PXEA 3D7DA 1GYTA 1TXRA 4ZX8A 4P10A 4UEEA 2IMOA 4OC5A 2PJ7A 5LYFA 4NGRA 2V8GA 2PJ0A 1LCPA 3SJGA 1FT7A 2EK9A 2OR4A 4MHZA 3PB9X 3SI0A 1OBRA 5K8OA 4MHPA 1VGYA 4MCPA 4ZY2A 5JH9A 6CPAA 4F9UA 3VATA 3GLJA 4YU9A 1XFOA 1HEEA 3DGVA 1DE4C 1BPNA 1ZLIA 4NGTA 2XEGA 1LAPA 3IIBA 4NJRA 3WC6A 1CPXA 3S9NA 5IB9A 3WT4A 4A38A 2V8VA 4DUKA 3DLJA 3D67A 4MHYA 3GUXA 3JRUA 3V38A 1TF9A 2AFWA 2PJ3A 1QQ9A 2PJ1A 2EK8A 1AYEA 2GU2A 4MCSA 2VL1A 1TKHA 3KGQA 1ELMP 4NGPA 4MCRA 4Z65A 2PJAA 3SJXA 2XEJA 4R6TA 2PVVA 5K8PA 2F8HA 2XEIA 4YWYA 4A94A 3HUVA 3B3WA 4R8FA 1ARLA 3CDXA 3K2KA 4FBEA 1CP7A 3D7FA 3K9TA 3VARA 3PB8X 4R7MA 1ZLHA 3BXMA 1XBUA 3QNVA 4MMOA 2ZEGA 4WJBA 4UIAA 4EWTA 1UWYA 3FVLA 5LRJA 3IJ3A 2ZEEA 4W9YA 4ZI6A 4P4JA 2C6CA 1IY7A 5CPAA 3NH4A 5CBMA 2DEAA 1YMEA 3SJFA 1R43A 4LQGA 3KASA 4G1PA 4FWUA 2GLJA 2C1CA 3HLPA 4MHNA 1JQGA 3GB0A 4CPAA 4H2KA 4UF4A 2POKA 3FECA 2AFUA 4UIBA 5D8NA 2AFMA 2RB7A 5DS0A 3PBEA 2PJ8A 3IWWA 3S9MA 4OP4A 4O23A 2WZNA 1CBXA 4OMEA 5K8MA 1XMBA 5LYDA 2GLFA 4P4DA 1Y0YA 3FEEA 4OIDA 3FMCA 3SI1A 4ZY1A 2ANPA 3PEIA 1FNOA 4OC1A 1Z2LA 3IO1A 2WYRA 2ZEPA 3KZWA 2ZEHA 4EMEA 3PB7X 4IHMA 4WWVA 3SI2A 1TF8A 3CPAA 2AFSA 4OIWA 4A39A 3IFEA 1YW6A 3B35A 2JEWA 2O53A 2AFOA 2QYVA 1LFWA 2GREA 3B3TA 3KHZA 4UEZA 2FVGA 1TKFA 2PVWA 4P4FA
chains in the Genus database with same CATH superfamily
5DWNA 2NYQA 1N71A 2YGWA 3N5FA 4OC4A 2C6GA 2CIJA 4FD7A 1IOIA 3N7ZA 7CPAA 2B4DA 3KR4A 2ZPAA 3MRUA 2PE3A 5F47A 1Y0RA 2KCWA 3TOBA 2VZZA 4EVYA 2DF5A 1CPSA 2V8HA 2ZEOA 3CXQA 3V7ZA 3WC7A 4DJLA 2JBKA 2QJ8A 2P6GA 1S3ZA 2Z10A 1NMTA 4OADA 5JM6A 4I49A 4CAFA 2H5MA 2R8VA 3KQXA 2FCKA 3FH4A 2VEZA 2PR1A 5D29A 3S6HA 1LOKA 3IU2A 3PRTA 1SQHA 3ZJ0A 4B11A 3KQZA 1Q2DA 3NH8A 4NGSA 4EFDA 3NFZA 2CNTA 2JBJA 4UCMA 4Q7AA 2Z3MA 3DDDA 4PXBA 4C2YA 4ZX9A 1A2ZA 1M1DA 4DNCA 3FYNA 3KHXA 4NJQA 2IQ6A 1S7LA 2FXFA 1LANA 4A2ZA 3RBUA 4AVCA 1WK4A 4HNWB 3TO7A 4P4EA 5H86A 1Z4RA 4H89A 4CS0B 8CPAA 2AE6A 2C27A 3NE8A 2EWBA 4B5PA 2CF4A 3D4UA 3H5ZA 1Q2CA 2PJBA 3SJEA 4L89A 1KWMA 4FAIA 1CG2A 4CYNA 2J9AA 4MRIA 1VHOA 1ZG7A 4PQAA 2B58A 3R9EA 4UWIA 1Z8WA 3E0KA 2VXKA 3MN8A 4OC3A 4JXQA 4F9VA 5K8NA 1LAMA 4BD9A 3BI0A 2R7HA 1F57A 4RUHA 4MFZA 3FF3A 4KOUA 1DTDA 4B5OA 4KOWA 1Z8XA 2ZEMA 4R9MA 1PYTB 1YLEA 2RC4A 4X2TA 2OZGA 4KS9A 4B6ZA 2PIYA 4C7IA 3RZAA 4ONWA 2PC1A 4NSQA 1ZG8A 4M6GA 3NA6A 2Z3OA 2ARHA 2PRBA 3H8FA 5LYLA 2B4DB 2CTBA 4KUBA 3S9LA 2CTCA 1H8LA 1MJAA 2B3VA 4IK2A 4M85A 4OKOA 5FVJA 4CGOA 3QAHA 1XIXA 2R1IA 1CP6A 2X7BA 3B3CA 3RNZA 1Q2YA 4NEXA 5JQ4A 2P6EA 3BLNA 4KOSA 3D2MA 4CGNA 5HVGA 4NXYA 1M4IA 4KLWA 3WABA 1F2OA 5ELYA 1XJOA 1U6MA 3FJUA 4QBJA 1X12A 2PJ4A 4GS4A 5I4MA 1XF8A 3NH5A 1KUYA 1Q7LA 5F46A 2PJ2A 2PRQA 1F2PA 2RFHA 4K3NA 4UCPA 3ISXA 3PFEA 1S5KA 3FX6A 5F49A 2ZELA 1QSRA 2DPTA 2GFQA 2PJ6A 2PJ9A 1R57A 2JEVA 2PCUA 4X8IA 2B4BA 4KUAA 2HV2A 3PGPA 4RS2A 4CYPA 4R3LA 4XPLA 3PB6X 5LRKA 1Y9WA 1FY7A 1GHEA 2HC9A 4NGNA 4PSWA 4Y49B 3D2PA 2OU2A 4NGQA 5LRGA 1BLLE 3B2YA 4KSFA 3B3SA 4RN7A 2EBJA 3UY5A 4AG9A 2J8NA 4MY0A 3H8GA 4JD6A 4MXUA 4A32A 5DWMA 4UWJA 4JZ0A 2DXQA 1R3NA 4GXHA 4CGLA 5AG6A 1TKJA 1AMPA 2AFZA 1IGBA 3LWUA 3PB4X 1M4GA 2Q4ZA 2EVNA 3FEDA 3KI9A 4NGMA 1M4LA 4QC6A 4A37A 3IWGA 3CZXA 1V0CA 4MFKA 4R76A 4A30A 4ZY0A 2Q04A 3L2NA 3IWEA 4YGOA 3B3VA 3D7HA 4FD5A 4KOTA 3R96A 2PJ5A 4UA3A 3GYAA 4UEFA 4MCQA 3I9SA 2PJCA 4P44A 1QSMA 3P2HA 3RO0A 4U9ZA 5F09A 3S6GA 4FUUA 2PDOA 4OC0A 4FD4A 2HQYA 2V8DA 1CJWA 1BPMA 3KR5A 1RXTA 2BSWA 4C2XA 4H6UA 3B7IA 3PBBA 2OOTA 1XRYA 3ISZA 2OZUA 2ZEDA 4C68A 3BJ7A 3LMSA 2ZW4A 1J4JA 3D68A 2Q51A 2G9DA 2Q4VA 4JWPA 5KTDA 3FNCA 4PXDA 2G3TA 5CNPA 5HMNA 2O4HA 4MFPA 2XEFA 1YSJA 4MFQA 5JGFA 1MJBA 4R3KA 2F7VA 1RTQA 4DYOA 2BCOA 1IYKA 4QB9A 4P4IA 4P45A 4XPDB 4NF1A 2FIAA 2FT0A 1CX8A 3PZJA 3TX8A 1ZG9A 4Y49C 4CRYB 2ATRA 3SXOA 3SI2A 2PIZA 2ZEFA 4IAVA 4M3SA 3KL9A 2D4PA 3BHXA 4PXCA 4U9YA 4X3RA 5HVFA 3EXNA 1YVOA 1BAVA 3FIXA 2V77A 2FSRA 1S7FA 4EWTA 2IJZA 1I21A 1Y7EA 2ZOFA 4KVXA 2ZOGA 3T8WA 3R9GA 4M6IA 2HB6A 2I3CA 2AFXA 3QB8A 2BO9A 5J1QA 1BOBA 2EUIA 5F48A 1KZFA 1IYLA 3R9FA 4CGPA 5THWA 4ZYQA 1ELLP 3TFYA 4GM5A 4MJ8A 1AUGA 3IEHA 1ARMA 4KOXA 3R1KA 4BINA 3GY9A 3LODA 4Q38A 4OC2A 1VHEA 3C26A 4BBHA 1YLOA 3I1UA 2OZHA 5AG5A 3ZZIA 4MBUA 4J3GA 4XNHB 1PU9A 2WUUA 3BI1A 4YRHA 3D7GA 2C6PA 4P4BA 1Y9KA 2BOAA 4ZBGA 3TC8A 5HVHA 2REEA 4JYWA 5G21A 2Q44A 1JWQA 1OZPA 1HDQA 2ABZA 3KKWA 4TNUA 2QIRA 3G8WA 4MFJA 4F8ZA 3RAMA 2QMLA 2FL4A 4AXVA 2Y0MA 1Z5RA 2J8RA 4AVBA 2Z3KA 3W6SA 2WPWA 2ZENA 5AG4A 1QSOA 1P4NA 1K4JA 1IOFA 1Z8LA 4AB7A 2FIWA 3W6XA 4P6YA 2Q7SA 4TWEA 3DSBA 3WC5A 4B14A 4CAWA 3CT9A 1YW4A 1EE3P 5AGEA 3PFOA 5I0CA 1QMUA 3IC1A 1NSAA 4XPDC 3H8EA 4LX9A 4KSIA 4ONUA 2B5GA 3D66A 2ZW7A 5LYIA 5HXDA 4NCZA 3SHPA 4NFRA 3CXPA 4PK2A 1L0CA 2YNCA 3TO6A 3V8IA 4FD6A 2NSMA 3WR7A 4C7HA 2QVPA 2OB0A 3CPXA 2Z11A 3K9UA 1VIXA 2Q43A 3S6FA 3TCVA 1PCAA 4PV6A 4PPZA 1MK4A 2JLMA 1HDUA 3VH9A 4PXEA 1RO5A 4R57A 3D7DA 5G1ZA 3R95A 1GYTA 1TXRA 1QSTA 4KSAA 4ZX8A 4A95A 2CY2A 4MI4A 4UBRA 4P10A 4UEEA 5EC4A 2AJ6A 2IMOA 4OC5A 4XPKA 4B5PB 2PJ7A 3I3GA 5AG7A 5LYFA 1IICA 4NGRA 2V8GA 2PJ0A 2WSAA 1LCPA 1WWZA 1NSLA 3SJGA 3T9YA 4XNHC 3TO9A 1S60A 1FT7A 4IF5A 2EK9A 2OR4A 5HH1A 5EMIA 4MHZA 1M44A 4M6HA 3PB9X 4UCNA 3DR6A 3SI0A 1OBRA 4CGMA 4H6ZA 2DPSA 2CNMA 2I79A 2VBQA 3EFAA 5K8OA 3A9LA 4MHPA 2IL4A 1VGYA 4MCPA 2JDCA 5G22A 5JH9A 4ZY2A 6CPAA 1YR0A 2Z3PA 4QUSA 4F9UA 4E0AA 3VATA 2BEIA 4HNYB 5C88A 3JTKA 3GLJA 2D4OA 3PP9A 4YU9A 2YNDA 4CAVA 1XFOA 1Y7RA 1KUVA 4HKFA 1HEEA 1YK3A 3DGVA 1CM0A 1DE4C 4KVOE 1VKCA 3EO4A 2VQYA 5KTAA 1MJ9A 3F8KA 3FRMA 2F5IA 1BPNA 1ZLIA 4NGTA 2XEGA 5G20A 1LAPA 3IIBA 4NJRA 4MHDA 2ZW6A 2R98A 3WC6A 1CPXA 3NE7A 3S9NA 5IB9A 2PQ8A 4PSXA 2ZXVA 5A27A 3WT4A 5IV0A 3P2FA 2B5GB 4KZTA 5GCNA 1Z8TA 4A38A 2V8VA 4U5YA 4AVAA 4CAXA 2QECA 3DLJA 4DUKA 3DNSA 3LD2A 3D67A 1ON0A 4MHYA 1B6BA 3GUXA 3JRUA 3V38A 1VHSA 2EO8A 1TF9A 4A31A 2AFWA 3T90A 4B13A 2PJ3A 1QQ9A 2PJ1A 2Z0ZA 3EY5A 2EK8A 1AYEA 2GU2A 4MCSA 5KTCA 4KOYA 2VL1A 1TIQA 1TKHA 3GKRA 3KGQA 1S7KA 4CYOA 1ELMP 4NGPA 4MCRA 4Z65A 2PJAA 3SJXA 3LACA 5JPHA 2A4NA 2XEJA 4R6TA 2PVVA 3TOAA 5K8PA 3FXTA 2F8HA 2XEIA 4YWYA 4A94A 3HUVA 2PR8A 3B3WA 4F0XA 3G3SA 4R8FA 3DR8A 1ARLA 2GANA 3CDXA 1P0HA 3K2KA 2P6FA 2BL1A 4K30A 4FBEA 1CP7A 2PSWA 3D7FA 3VARA 3K9TA 4KVME 3PB8X 2OH1A 4R7MA 1ZLHA 3BXMA 1UFHA 1QSNA 1XBUA 3QNVA 4KOVA 4HNXB 4MY3A 5E96A 3TE4A 3OWCA 4MMOA 4A33A 2ZEGA 5ISVA 4WJBA 3JUWA 4PK3A 3TT2A 1M4DA 4UIAA 1BO4A 4KORA 1UWYA 4ORFA 3FVLA 5LRJA 3S6KA 2Q4YA 4LQ6A 3IJ3A 4MFLA 2ZEEA 1I12A 2JDDA 1IU8A 4CYQA 4B10A 4W9YA 1IIDA 1Z9UA 3F0AA 4F6AA 4KLVA 4CRZB 4ZI6A 2FS5A 2I00A 1I1DA 3IGRA 4P4JA 2Q7BA 2C6CA 1IY7A 5CPAA 2FE7A 4JXRA 4HPSA 3NH4A 2Z3NA 5CBMA 2VI7A 3EC4A 3MGDA 4RI1A 2DEAA 5EBVA 5J8FA 2YNCC 1ZO0A 1YMEA 3SJFA 3SXNA 1R43A 3CXSA 4LQGA 2CXAA 4R87A 1YVKA 3KASA 4G1PA 1YGHA 5C82A 4CAEA 3QAYA 2GLJA 2C1CA 2ODFA 3HLPA 4FWUA 4MHNA 1JQGA 3GB0A 4CPAA 4H2KA 5A28A 4QVTA 2NMTA 2POKA 3IU1A 3FECA 4OLLA 2AFUA 4UF4A 5BWAB 1NE9A 2Q0YA 1XE4A 2Z3LA 4UIBA 2G3AA 5D8NA 4BMHA 2AFMA 1IB1E 2RB7A 5DS0A 3VWEA 3W91A 3PBEA 2GIVA 2PJ8A 2K5TA 1XEBA 3IWWA 4LUAA 4OP4A 4UFWA 3S9MA 4O23A 4L8AA 1XOVA 2J8MA 2YNEA 3F5BA 2WZNA 1CBXA 4OMEA 3H4QA 3D8PA 4JJXA 5K8MA 1XMBA 1Z4EA 5LYDA 4YFJA 4ZGYB 2GLFA 2CNSA 4P4DA 1PUAA 1Y0YA 2VZYA 4E8OA 4F0YA 3FBUA 4UFVA 4X5KA 3FEEA 1YQEA 4OIDA 3JVNA 3FMCA 3SI1A 4ZY1A 1YREA 2ANPA 3BJ8A 3PEIA 4C2ZA 1FNOA 4OC1A 2WPXA 1X10A 1Z2LA 4IUSA 3IO1A 4OAEA 3VWDA 2WYRA 1KUXA 2G0BA 1S7NA 3RYOA 5J8CA 2ZEPA 2REFA 2O28A 3KZWA 4JLYA 2GE3A 2ZEHA 4EMEA 3PB7X 4IHMA 3B8GA 4WWVA 1LRZA 2P0WA 2BUEA 3GIUA 1TF8A 4UFXA 4E2AA 5IB0A 4II9A 3CPAA 3D3SA 1XMTA 2AFSA 2HUZA 5IX3A 4OIWA 4A39A 1B87A 1YW6A 2B3UA 2JEWA 1YX0A 3B35A 3IFEA 3TTHA 4AG7A 5H84A 2O53A 2AFOA 2QYVA 4B12A 4Q36A 1LFWA 2GREA 3B3TA 3KHZA 4UEZA 2FVGA 1TKFA 2ZW5A 3FB3A 2PVWA 4P4FA
chains in the Genus database with same CATH topology
2NYQA 4OC4A 3N5FA 2C6GA 2CIJA 7CPAA 3KR4A 3MRUA 2PE3A 1Y0RA 5K8NA 2V8HA 1CPSA 2ZEOA 3V7ZA 3WC7A 4DJLA 2JBKA 2QJ8A 5JM6A 3KQXA 3FH4A 5D29A 1LOKA 3PRTA 3KQZA 3NH8A 4NGSA 4EFDA 3NFZA 2JBJA 4Q7AA 4PXBA 4ZX9A 3KHXA 4NJQA 2IQ6A 1LANA 3RBUA 4P4EA 8CPAA 2EWBA 2CF4A 3D4UA 2PJBA 3SJEA 1KWMA 4FAIA 1CG2A 2J9AA 4MRIA 1VHOA 1ZG7A 4PQAA 4F9VA 3MN8A 4OC3A 1LAMA 4BD9A 3BI0A 1F57A 4RUHA 3FF3A 1DTDA 2ZEMA 1PYTB 4X2TA 4B6ZA 2PIYA 3RZAA 4ONWA 1ZG8A 3NA6A 5LYLA 3S9LA 3H8FA 2CTBA 2CTCA 1H8LA 4IK2A 4OKOA 1CP6A 3B3CA 5HVGA 3WABA 1F2OA 5ELYA 1XJOA 3FJUA 2PJ4A 5I4MA 3NH5A 1Q7LA 2PJ2A 4K3NA 1F2PA 2PRQA 2RFHA 3ISXA 3PFEA 3FX6A 2ZELA 2PJ6A 2PJ9A 2PCUA 4X8IA 3PB6X 5LRKA 2HC9A 4NGNA 4NGQA 5LRGA 1BLLE 3B2YA 3B3SA 3H8GA 4MXUA 4JZ0A 1R3NA 1TKJA 1AMPA 2AFZA 1IGBA 3LWUA 3PB4X 2Q4ZA 3FEDA 4NGMA 3KI9A 4A37A 1M4LA 4R76A 4ZY0A 3L2NA 3B3VA 3D7HA 2PJ5A 4UEFA 4MCQA 2PJCA 4P44A 5F09A 4FUUA 4OC0A 2V8DA 1BPMA 3KR5A 3B7IA 3PBBA 2OOTA 1XRYA 3ISZA 2ZEDA 3LMSA 3D68A 2Q51A 2G9DA 4PXDA 2O4HA 2XEFA 1YSJA 5JGFA 2F7VA 1RTQA 4DYOA 2BCOA 4P4IA 4P45A 1CX8A 3TX8A 1ZG9A 2PIZA 2ZEFA 4IAVA 3KL9A 3BHXA 4PXCA 4X3RA 5HVFA 1BAVA 2V77A 2IJZA 1Y7EA 2ZOFA 2ZOGA 3T8WA 2HB6A 2I3CA 2AFXA 2BO9A 5J1QA 5THWA 4ZYQA 1ELLP 4GM5A 3IEHA 1ARMA 4OC2A 1VHEA 1YLOA 3I1UA 3BI1A 3D7GA 2C6PA 4P4BA 3TC8A 2BOAA 5HVHA 4JYWA 1HDQA 2ABZA 4TNUA 4F8ZA 3RAMA 4AXVA 1Z5RA 2ZENA 1Z8LA 4P6YA 4TWEA 3WC5A 3CT9A 1YW4A 1EE3P 3PFOA 1QMUA 3IC1A 1NSAA 3H8EA 4KSIA 3D66A 5LYIA 5HXDA 4NFRA 2NSMA 2QVPA 3CPXA 1VIXA 2Q43A 1PCAA 4PPZA 1HDUA 3VH9A 4PXEA 3D7DA 1GYTA 1TXRA 4ZX8A 4P10A 4UEEA 2IMOA 4OC5A 2PJ7A 5LYFA 4NGRA 2V8GA 2PJ0A 1LCPA 3SJGA 1FT7A 2EK9A 2OR4A 4MHZA 3PB9X 3SI0A 1OBRA 5K8OA 4MHPA 1VGYA 4MCPA 4ZY2A 5JH9A 6CPAA 4F9UA 3VATA 3GLJA 4YU9A 1XFOA 1HEEA 3DGVA 1DE4C 1BPNA 1ZLIA 4NGTA 2XEGA 1LAPA 3IIBA 4NJRA 3WC6A 1CPXA 3S9NA 5IB9A 3WT4A 4A38A 2V8VA 4DUKA 3DLJA 3D67A 4MHYA 3GUXA 3JRUA 3V38A 1TF9A 2AFWA 2PJ3A 1QQ9A 2PJ1A 2EK8A 1AYEA 2GU2A 4MCSA 2VL1A 1TKHA 3KGQA 1ELMP 4NGPA 4MCRA 4Z65A 2PJAA 3SJXA 2XEJA 4R6TA 2PVVA 5K8PA 2F8HA 2XEIA 4YWYA 4A94A 3HUVA 3B3WA 4R8FA 1ARLA 3CDXA 3K2KA 4FBEA 1CP7A 3D7FA 3K9TA 3VARA 3PB8X 4R7MA 1ZLHA 3BXMA 1XBUA 3QNVA 4MMOA 2ZEGA 4WJBA 4UIAA 4EWTA 1UWYA 3FVLA 5LRJA 3IJ3A 2ZEEA 4W9YA 4ZI6A 4P4JA 2C6CA 1IY7A 5CPAA 3NH4A 5CBMA 2DEAA 1YMEA 3SJFA 1R43A 4LQGA 3KASA 4G1PA 4FWUA 2GLJA 2C1CA 3HLPA 4MHNA 1JQGA 3GB0A 4CPAA 4H2KA 4UF4A 2POKA 3FECA 2AFUA 4UIBA 5D8NA 2AFMA 2RB7A 5DS0A 3PBEA 2PJ8A 3IWWA 3S9MA 4OP4A 4O23A 2WZNA 1CBXA 4OMEA 5K8MA 1XMBA 5LYDA 2GLFA 4P4DA 1Y0YA 3FEEA 4OIDA 3FMCA 3SI1A 4ZY1A 2ANPA 3PEIA 1FNOA 4OC1A 1Z2LA 3IO1A 2WYRA 2ZEPA 3KZWA 2ZEHA 4EMEA 3PB7X 4IHMA 4WWVA 3SI2A 1TF8A 3CPAA 2AFSA 4OIWA 4A39A 3IFEA 1YW6A 3B35A 2JEWA 2O53A 2AFOA 2QYVA 1LFWA 2GREA 3B3TA 3KHZA 4UEZA 2FVGA 1TKFA 2PVWA 4P4FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NYQ A;  4OC4 A;  3N5F A;  2C6G A;  2CIJ A;  7CPA A;  3KR4 A;  3MRU A;  2PE3 A;  1Y0R A;  5K8N A;  2V8H A;  1CPS A;  2ZEO A;  3V7Z A;  3WC7 A;  4DJL A;  2JBK A;  2QJ8 A;  5JM6 A;  3KQX A;  3FH4 A;  5D29 A;  1LOK A;  3PRT A;  3KQZ A;  3NH8 A;  4NGS A;  4EFD A;  3NFZ A;  2JBJ A;  4Q7A A;  4PXB A;  4ZX9 A;  3KHX A;  4NJQ A;  2IQ6 A;  1LAN A;  3RBU A;  4P4E A;  8CPA A;  2EWB A;  2CF4 A;  3D4U A;  2PJB A;  3SJE A;  1KWM A;  4FAI A;  1CG2 A;  2J9A A;  4MRI A;  1VHO A;  1ZG7 A;  4PQA A;  4F9V A;  3MN8 A;  4OC3 A;  1LAM A;  4BD9 A;  3BI0 A;  1F57 A;  4RUH A;  3FF3 A;  1DTD A;  2ZEM A;  1PYT B;  4X2T A;  4B6Z A;  2PIY A;  3RZA A;  4ONW A;  1ZG8 A;  3NA6 A;  5LYL A;  3S9L A;  3H8F A;  2CTB A;  2CTC A;  1H8L A;  4IK2 A;  4OKO A;  1CP6 A;  3B3C A;  5HVG A;  3WAB A;  1F2O A;  5ELY A;  1XJO A;  3FJU A;  2PJ4 A;  5I4M A;  3NH5 A;  1Q7L A;  2PJ2 A;  4K3N A;  1F2P A;  2PRQ A;  2RFH A;  3ISX A;  3PFE A;  3FX6 A;  2ZEL A;  2PJ6 A;  2PJ9 A;  2PCU A;  4X8I A;  3PB6 X;  5LRK A;  2HC9 A;  4NGN A;  4NGQ A;  5LRG A;  1BLL E;  3B2Y A;  3B3S A;  3H8G A;  4MXU A;  4JZ0 A;  1R3N A;  1TKJ A;  1AMP A;  2AFZ A;  1IGB A;  3LWU A;  3PB4 X;  2Q4Z A;  3FED A;  4NGM A;  3KI9 A;  4A37 A;  1M4L A;  4R76 A;  4ZY0 A;  3L2N A;  3B3V A;  3D7H A;  2PJ5 A;  4UEF A;  4MCQ A;  2PJC A;  4P44 A;  5F09 A;  4FUU A;  4OC0 A;  2V8D A;  1BPM A;  3KR5 A;  3B7I A;  3PBB A;  2OOT A;  1XRY A;  3ISZ A;  2ZED A;  3LMS A;  3D68 A;  2Q51 A;  2G9D A;  4PXD A;  2O4H A;  2XEF A;  1YSJ A;  5JGF A;  2F7V A;  1RTQ A;  4DYO A;  2BCO A;  4P4I A;  4P45 A;  1CX8 A;  3TX8 A;  1ZG9 A;  2PIZ A;  2ZEF A;  4IAV A;  3KL9 A;  3BHX A;  4PXC A;  4X3R A;  5HVF A;  1BAV A;  2V77 A;  2IJZ A;  1Y7E A;  2ZOF A;  2ZOG A;  3T8W A;  2HB6 A;  2I3C A;  2AFX A;  2BO9 A;  5J1Q A;  5THW A;  4ZYQ A;  1ELL P;  4GM5 A;  3IEH A;  1ARM A;  4OC2 A;  1VHE A;  1YLO A;  3I1U A;  3BI1 A;  3D7G A;  2C6P A;  4P4B A;  3TC8 A;  2BOA A;  5HVH A;  4JYW A;  1HDQ A;  2ABZ A;  4TNU A;  4F8Z A;  3RAM A;  4AXV A;  1Z5R A;  2ZEN A;  1Z8L A;  4P6Y A;  4TWE A;  3WC5 A;  3CT9 A;  1YW4 A;  1EE3 P;  3PFO A;  1QMU A;  3IC1 A;  1NSA A;  3H8E A;  4KSI A;  3D66 A;  5LYI A;  5HXD A;  4NFR A;  2NSM A;  2QVP A;  3CPX A;  1VIX A;  2Q43 A;  1PCA A;  4PPZ A;  1HDU A;  3VH9 A;  4PXE A;  3D7D A;  1GYT A;  1TXR A;  4ZX8 A;  4P10 A;  4UEE A;  2IMO A;  4OC5 A;  2PJ7 A;  5LYF A;  4NGR A;  2V8G A;  2PJ0 A;  1LCP A;  3SJG A;  1FT7 A;  2EK9 A;  2OR4 A;  4MHZ A;  3PB9 X;  3SI0 A;  1OBR A;  5K8O A;  4MHP A;  1VGY A;  4MCP A;  4ZY2 A;  5JH9 A;  6CPA A;  4F9U A;  3VAT A;  3GLJ A;  4YU9 A;  1XFO A;  1HEE A;  3DGV A;  1DE4 C;  1BPN A;  1ZLI A;  4NGT A;  2XEG A;  1LAP A;  3IIB A;  4NJR A;  3WC6 A;  1CPX A;  3S9N A;  5IB9 A;  3WT4 A;  4A38 A;  2V8V A;  4DUK A;  3DLJ A;  3D67 A;  4MHY A;  3GUX A;  3JRU A;  3V38 A;  1TF9 A;  2AFW A;  2PJ3 A;  1QQ9 A;  2PJ1 A;  2EK8 A;  1AYE A;  2GU2 A;  4MCS A;  2VL1 A;  1TKH A;  3KGQ A;  1ELM P;  4NGP A;  4MCR A;  4Z65 A;  2PJA A;  3SJX A;  2XEJ A;  4R6T A;  2PVV A;  5K8P A;  2F8H A;  2XEI A;  4YWY A;  4A94 A;  3HUV A;  3B3W A;  4R8F A;  1ARL A;  3CDX A;  3K2K A;  4FBE A;  1CP7 A;  3D7F A;  3K9T A;  3VAR A;  3PB8 X;  4R7M A;  1ZLH A;  3BXM A;  1XBU A;  3QNV A;  4MMO A;  2ZEG A;  4WJB A;  4UIA A;  4EWT A;  1UWY A;  3FVL A;  5LRJ A;  3IJ3 A;  2ZEE A;  4W9Y A;  4ZI6 A;  4P4J A;  2C6C A;  1IY7 A;  5CPA A;  3NH4 A;  5CBM A;  2DEA A;  1YME A;  3SJF A;  1R43 A;  4LQG A;  3KAS A;  4G1P A;  4FWU A;  2GLJ A;  2C1C A;  3HLP A;  4MHN A;  1JQG A;  3GB0 A;  4CPA A;  4H2K A;  4UF4 A;  2POK A;  3FEC A;  2AFU A;  4UIB A;  5D8N A;  2AFM A;  2RB7 A;  5DS0 A;  3PBE A;  2PJ8 A;  3IWW A;  3S9M A;  4OP4 A;  4O23 A;  2WZN A;  1CBX A;  4OME A;  5K8M A;  1XMB A;  5LYD A;  2GLF A;  4P4D A;  1Y0Y A;  3FEE A;  4OID A;  3FMC A;  3SI1 A;  4ZY1 A;  2ANP A;  3PEI A;  1FNO A;  4OC1 A;  1Z2L A;  3IO1 A;  2WYR A;  2ZEP A;  3KZW A;  2ZEH A;  4EME A;  3PB7 X;  4IHM A;  4WWV A;  3SI2 A;  1TF8 A;  3CPA A;  2AFS A;  4OIW A;  4A39 A;  3IFE A;  1YW6 A;  3B35 A;  2JEW A;  2O53 A;  2AFO A;  2QYV A;  1LFW A;  2GRE A;  3B3T A;  3KHZ A;  4UEZ A;  2FVG A;  1TKF A;  2PVW A;  4P4F A; 
#chains in the Genus database with same CATH topology
 5DWN A;  2NYQ A;  1N71 A;  2YGW A;  3N5F A;  4OC4 A;  2C6G A;  2CIJ A;  4FD7 A;  1IOI A;  3N7Z A;  7CPA A;  2B4D A;  3KR4 A;  2ZPA A;  3MRU A;  2PE3 A;  5F47 A;  1Y0R A;  2KCW A;  3TOB A;  2VZZ A;  4EVY A;  2DF5 A;  1CPS A;  2V8H A;  2ZEO A;  3CXQ A;  3V7Z A;  3WC7 A;  4DJL A;  2JBK A;  2QJ8 A;  2P6G A;  1S3Z A;  2Z10 A;  1NMT A;  4OAD A;  5JM6 A;  4I49 A;  4CAF A;  2H5M A;  2R8V A;  3KQX A;  2FCK A;  3FH4 A;  2VEZ A;  2PR1 A;  5D29 A;  3S6H A;  1LOK A;  3IU2 A;  3PRT A;  1SQH A;  3ZJ0 A;  4B11 A;  3KQZ A;  1Q2D A;  3NH8 A;  4NGS A;  4EFD A;  3NFZ A;  2CNT A;  2JBJ A;  4UCM A;  4Q7A A;  2Z3M A;  3DDD A;  4PXB A;  4C2Y A;  4ZX9 A;  1A2Z A;  1M1D A;  4DNC A;  3FYN A;  3KHX A;  4NJQ A;  2IQ6 A;  1S7L A;  2FXF A;  1LAN A;  4A2Z A;  3RBU A;  4AVC A;  1WK4 A;  4HNW B;  3TO7 A;  4P4E A;  5H86 A;  1Z4R A;  4H89 A;  4CS0 B;  8CPA A;  2AE6 A;  2C27 A;  3NE8 A;  2EWB A;  4B5P A;  2CF4 A;  3D4U A;  3H5Z A;  1Q2C A;  2PJB A;  3SJE A;  4L89 A;  1KWM A;  4FAI A;  1CG2 A;  4CYN A;  2J9A A;  4MRI A;  1VHO A;  1ZG7 A;  4PQA A;  2B58 A;  3R9E A;  4UWI A;  1Z8W A;  3E0K A;  2VXK A;  3MN8 A;  4OC3 A;  4JXQ A;  4F9V A;  5K8N A;  1LAM A;  4BD9 A;  3BI0 A;  2R7H A;  1F57 A;  4RUH A;  4MFZ A;  3FF3 A;  4KOU A;  1DTD A;  4B5O A;  4KOW A;  1Z8X A;  2ZEM A;  4R9M A;  1PYT B;  1YLE A;  2RC4 A;  4X2T A;  2OZG A;  4KS9 A;  4B6Z A;  2PIY A;  4C7I A;  3RZA A;  4ONW A;  2PC1 A;  4NSQ A;  1ZG8 A;  4M6G A;  3NA6 A;  2Z3O A;  2ARH A;  2PRB A;  3H8F A;  5LYL A;  2B4D B;  2CTB A;  4KUB A;  3S9L A;  2CTC A;  1H8L A;  1MJA A;  2B3V A;  4IK2 A;  4M85 A;  4OKO A;  5FVJ A;  4CGO A;  3QAH A;  1XIX A;  2R1I A;  1CP6 A;  2X7B A;  3B3C A;  3RNZ A;  1Q2Y A;  4NEX A;  5JQ4 A;  2P6E A;  3BLN A;  4KOS A;  3D2M A;  4CGN A;  5HVG A;  4NXY A;  1M4I A;  4KLW A;  3WAB A;  1F2O A;  5ELY A;  1XJO A;  1U6M A;  3FJU A;  4QBJ A;  1X12 A;  2PJ4 A;  4GS4 A;  5I4M A;  1XF8 A;  3NH5 A;  1KUY A;  1Q7L A;  5F46 A;  2PJ2 A;  2PRQ A;  1F2P A;  2RFH A;  4K3N A;  4UCP A;  3ISX A;  3PFE A;  1S5K A;  3FX6 A;  5F49 A;  2ZEL A;  1QSR A;  2DPT A;  2GFQ A;  2PJ6 A;  2PJ9 A;  1R57 A;  2JEV A;  2PCU A;  4X8I A;  2B4B A;  4KUA A;  2HV2 A;  3PGP A;  4RS2 A;  4CYP A;  4R3L A;  4XPL A;  3PB6 X;  5LRK A;  1Y9W A;  1FY7 A;  1GHE A;  2HC9 A;  4NGN A;  4PSW A;  4Y49 B;  3D2P A;  2OU2 A;  4NGQ A;  5LRG A;  1BLL E;  3B2Y A;  4KSF A;  3B3S A;  4RN7 A;  2EBJ A;  3UY5 A;  4AG9 A;  2J8N A;  4MY0 A;  3H8G A;  4JD6 A;  4MXU A;  4A32 A;  5DWM A;  4UWJ A;  4JZ0 A;  2DXQ A;  1R3N A;  4GXH A;  4CGL A;  5AG6 A;  1TKJ A;  1AMP A;  2AFZ A;  1IGB A;  3LWU A;  3PB4 X;  1M4G A;  2Q4Z A;  2EVN A;  3FED A;  3KI9 A;  4NGM A;  1M4L A;  4QC6 A;  4A37 A;  3IWG A;  3CZX A;  1V0C A;  4MFK A;  4R76 A;  4A30 A;  4ZY0 A;  2Q04 A;  3L2N A;  3IWE A;  4YGO A;  3B3V A;  3D7H A;  4FD5 A;  4KOT A;  3R96 A;  2PJ5 A;  4UA3 A;  3GYA A;  4UEF A;  4MCQ A;  3I9S A;  2PJC A;  4P44 A;  1QSM A;  3P2H A;  3RO0 A;  4U9Z A;  5F09 A;  3S6G A;  4FUU A;  2PDO A;  4OC0 A;  4FD4 A;  2HQY A;  2V8D A;  1CJW A;  1BPM A;  3KR5 A;  1RXT A;  2BSW A;  4C2X A;  4H6U A;  3B7I A;  3PBB A;  2OOT A;  1XRY A;  3ISZ A;  2OZU A;  2ZED A;  4C68 A;  3BJ7 A;  3LMS A;  2ZW4 A;  1J4J A;  3D68 A;  2Q51 A;  2G9D A;  2Q4V A;  4JWP A;  5KTD A;  3FNC A;  4PXD A;  2G3T A;  5CNP A;  5HMN A;  2O4H A;  4MFP A;  2XEF A;  1YSJ A;  4MFQ A;  5JGF A;  1MJB A;  4R3K A;  2F7V A;  1RTQ A;  4DYO A;  2BCO A;  1IYK A;  4QB9 A;  4P4I A;  4P45 A;  4XPD B;  4NF1 A;  2FIA A;  2FT0 A;  1CX8 A;  3PZJ A;  3TX8 A;  1ZG9 A;  4Y49 C;  4CRY B;  2ATR A;  3SXO A;  3SI2 A;  2PIZ A;  2ZEF A;  4IAV A;  4M3S A;  3KL9 A;  2D4P A;  3BHX A;  4PXC A;  4U9Y A;  4X3R A;  5HVF A;  3EXN A;  1YVO A;  1BAV A;  3FIX A;  2V77 A;  2FSR A;  1S7F A;  4EWT A;  2IJZ A;  1I21 A;  1Y7E A;  2ZOF A;  4KVX A;  2ZOG A;  3T8W A;  3R9G A;  4M6I A;  2HB6 A;  2I3C A;  2AFX A;  3QB8 A;  2BO9 A;  5J1Q A;  1BOB A;  2EUI A;  5F48 A;  1KZF A;  1IYL A;  3R9F A;  4CGP A;  5THW A;  4ZYQ A;  1ELL P;  3TFY A;  4GM5 A;  4MJ8 A;  1AUG A;  3IEH A;  1ARM A;  4KOX A;  3R1K A;  4BIN A;  3GY9 A;  3LOD A;  4Q38 A;  4OC2 A;  1VHE A;  3C26 A;  4BBH A;  1YLO A;  3I1U A;  2OZH A;  5AG5 A;  3ZZI A;  4MBU A;  4J3G A;  4XNH B;  1PU9 A;  2WUU A;  3BI1 A;  4YRH A;  3D7G A;  2C6P A;  4P4B A;  1Y9K A;  2BOA A;  4ZBG A;  3TC8 A;  5HVH A;  2REE A;  4JYW A;  5G21 A;  2Q44 A;  1JWQ A;  1OZP A;  1HDQ A;  2ABZ A;  3KKW A;  4TNU A;  2QIR A;  3G8W A;  4MFJ A;  4F8Z A;  3RAM A;  2QML A;  2FL4 A;  4AXV A;  2Y0M A;  1Z5R A;  2J8R A;  4AVB A;  2Z3K A;  3W6S A;  2WPW A;  2ZEN A;  5AG4 A;  1QSO A;  1P4N A;  1K4J A;  1IOF A;  1Z8L A;  4AB7 A;  2FIW A;  3W6X A;  4P6Y A;  2Q7S A;  4TWE A;  3DSB A;  3WC5 A;  4B14 A;  4CAW A;  3CT9 A;  1YW4 A;  1EE3 P;  5AGE A;  3PFO A;  5I0C A;  1QMU A;  3IC1 A;  1NSA A;  4XPD C;  3H8E A;  4LX9 A;  4KSI A;  4ONU A;  2B5G A;  3D66 A;  2ZW7 A;  5LYI A;  5HXD A;  4NCZ A;  3SHP A;  4NFR A;  3CXP A;  4PK2 A;  1L0C A;  2YNC A;  3TO6 A;  3V8I A;  4FD6 A;  2NSM A;  3WR7 A;  4C7H A;  2QVP A;  2OB0 A;  3CPX A;  2Z11 A;  3K9U A;  1VIX A;  2Q43 A;  3S6F A;  3TCV A;  1PCA A;  4PV6 A;  4PPZ A;  1MK4 A;  2JLM A;  1HDU A;  3VH9 A;  4PXE A;  1RO5 A;  4R57 A;  3D7D A;  5G1Z A;  3R95 A;  1GYT A;  1TXR A;  1QST A;  4KSA A;  4ZX8 A;  4A95 A;  2CY2 A;  4MI4 A;  4UBR A;  4P10 A;  4UEE A;  5EC4 A;  2AJ6 A;  2IMO A;  4OC5 A;  4XPK A;  4B5P B;  2PJ7 A;  3I3G A;  5AG7 A;  5LYF A;  1IIC A;  4NGR A;  2V8G A;  2PJ0 A;  2WSA A;  1LCP A;  1WWZ A;  1NSL A;  3SJG A;  3T9Y A;  4XNH C;  3TO9 A;  1S60 A;  1FT7 A;  4IF5 A;  2EK9 A;  2OR4 A;  5HH1 A;  5EMI A;  4MHZ A;  1M44 A;  4M6H A;  3PB9 X;  4UCN A;  3DR6 A;  3SI0 A;  1OBR A;  4CGM A;  4H6Z A;  2DPS A;  2CNM A;  2I79 A;  2VBQ A;  3EFA A;  5K8O A;  3A9L A;  4MHP A;  2IL4 A;  1VGY A;  4MCP A;  2JDC A;  5G22 A;  5JH9 A;  4ZY2 A;  6CPA A;  1YR0 A;  2Z3P A;  4QUS A;  4F9U A;  4E0A A;  3VAT A;  2BEI A;  4HNY B;  5C88 A;  3JTK A;  3GLJ A;  2D4O A;  3PP9 A;  4YU9 A;  2YND A;  4CAV A;  1XFO A;  1Y7R A;  1KUV A;  4HKF A;  1HEE A;  1YK3 A;  3DGV A;  1CM0 A;  1DE4 C;  4KVO E;  1VKC A;  3EO4 A;  2VQY A;  5KTA A;  1MJ9 A;  3F8K A;  3FRM A;  2F5I A;  1BPN A;  1ZLI A;  4NGT A;  2XEG A;  5G20 A;  1LAP A;  3IIB A;  4NJR A;  4MHD A;  2ZW6 A;  2R98 A;  3WC6 A;  1CPX A;  3NE7 A;  3S9N A;  5IB9 A;  2PQ8 A;  4PSX A;  2ZXV A;  5A27 A;  3WT4 A;  5IV0 A;  3P2F A;  2B5G B;  4KZT A;  5GCN A;  1Z8T A;  4A38 A;  2V8V A;  4U5Y A;  4AVA A;  4CAX A;  2QEC A;  3DLJ A;  4DUK A;  3DNS A;  3LD2 A;  3D67 A;  1ON0 A;  4MHY A;  1B6B A;  3GUX A;  3JRU A;  3V38 A;  1VHS A;  2EO8 A;  1TF9 A;  4A31 A;  2AFW A;  3T90 A;  4B13 A;  2PJ3 A;  1QQ9 A;  2PJ1 A;  2Z0Z A;  3EY5 A;  2EK8 A;  1AYE A;  2GU2 A;  4MCS A;  5KTC A;  4KOY A;  2VL1 A;  1TIQ A;  1TKH A;  3GKR A;  3KGQ A;  1S7K A;  4CYO A;  1ELM P;  4NGP A;  4MCR A;  4Z65 A;  2PJA A;  3SJX A;  3LAC A;  5JPH A;  2A4N A;  2XEJ A;  4R6T A;  2PVV A;  3TOA A;  5K8P A;  3FXT A;  2F8H A;  2XEI A;  4YWY A;  4A94 A;  3HUV A;  2PR8 A;  3B3W A;  4F0X A;  3G3S A;  4R8F A;  3DR8 A;  1ARL A;  2GAN A;  3CDX A;  1P0H A;  3K2K A;  2P6F A;  2BL1 A;  4K30 A;  4FBE A;  1CP7 A;  2PSW A;  3D7F A;  3VAR A;  3K9T A;  4KVM E;  3PB8 X;  2OH1 A;  4R7M A;  1ZLH A;  3BXM A;  1UFH A;  1QSN A;  1XBU A;  3QNV A;  4KOV A;  4HNX B;  4MY3 A;  5E96 A;  3TE4 A;  3OWC A;  4MMO A;  4A33 A;  2ZEG A;  5ISV A;  4WJB A;  3JUW A;  4PK3 A;  3TT2 A;  1M4D A;  4UIA A;  1BO4 A;  4KOR A;  1UWY A;  4ORF A;  3FVL A;  5LRJ A;  3S6K A;  2Q4Y A;  4LQ6 A;  3IJ3 A;  4MFL A;  2ZEE A;  1I12 A;  2JDD A;  1IU8 A;  4CYQ A;  4B10 A;  4W9Y A;  1IID A;  1Z9U A;  3F0A A;  4F6A A;  4KLV A;  4CRZ B;  4ZI6 A;  2FS5 A;  2I00 A;  1I1D A;  3IGR A;  4P4J A;  2Q7B A;  2C6C A;  1IY7 A;  5CPA A;  2FE7 A;  4JXR A;  4HPS A;  3NH4 A;  2Z3N A;  5CBM A;  2VI7 A;  3EC4 A;  3MGD A;  4RI1 A;  2DEA A;  5EBV A;  5J8F A;  2YNC C;  1ZO0 A;  1YME A;  3SJF A;  3SXN A;  1R43 A;  3CXS A;  4LQG A;  2CXA A;  4R87 A;  1YVK A;  3KAS A;  4G1P A;  1YGH A;  5C82 A;  4CAE A;  3QAY A;  2GLJ A;  2C1C A;  2ODF A;  3HLP A;  4FWU A;  4MHN A;  1JQG A;  3GB0 A;  4CPA A;  4H2K A;  5A28 A;  4QVT A;  2NMT A;  2POK A;  3IU1 A;  3FEC A;  4OLL A;  2AFU A;  4UF4 A;  5BWA B;  1NE9 A;  2Q0Y A;  1XE4 A;  2Z3L A;  4UIB A;  2G3A A;  5D8N A;  4BMH A;  2AFM A;  1IB1 E;  2RB7 A;  5DS0 A;  3VWE A;  3W91 A;  3PBE A;  2GIV A;  2PJ8 A;  2K5T A;  1XEB A;  3IWW A;  4LUA A;  4OP4 A;  4UFW A;  3S9M A;  4O23 A;  4L8A A;  1XOV A;  2J8M A;  2YNE A;  3F5B A;  2WZN A;  1CBX A;  4OME A;  3H4Q A;  3D8P A;  4JJX A;  5K8M A;  1XMB A;  1Z4E A;  5LYD A;  4YFJ A;  4ZGY B;  2GLF A;  2CNS A;  4P4D A;  1PUA A;  1Y0Y A;  2VZY A;  4E8O A;  4F0Y A;  3FBU A;  4UFV A;  4X5K A;  3FEE A;  1YQE A;  4OID A;  3JVN A;  3FMC A;  3SI1 A;  4ZY1 A;  1YRE A;  2ANP A;  3BJ8 A;  3PEI A;  4C2Z A;  1FNO A;  4OC1 A;  2WPX A;  1X10 A;  1Z2L A;  4IUS A;  3IO1 A;  4OAE A;  3VWD A;  2WYR A;  1KUX A;  2G0B A;  1S7N A;  3RYO A;  5J8C A;  2ZEP A;  2REF A;  2O28 A;  3KZW A;  4JLY A;  2GE3 A;  2ZEH A;  4EME A;  3PB7 X;  4IHM A;  3B8G A;  4WWV A;  1LRZ A;  2P0W A;  2BUE A;  3GIU A;  1TF8 A;  4UFX A;  4E2A A;  5IB0 A;  4II9 A;  3CPA A;  3D3S A;  1XMT A;  2AFS A;  2HUZ A;  5IX3 A;  4OIW A;  4A39 A;  1B87 A;  1YW6 A;  2B3U A;  2JEW A;  1YX0 A;  3B35 A;  3IFE A;  3TTH A;  4AG7 A;  5H84 A;  2O53 A;  2AFO A;  2QYV A;  4B12 A;  4Q36 A;  1LFW A;  2GRE A;  3B3T A;  3KHZ A;  4UEZ A;  2FVG A;  1TKF A;  2ZW5 A;  3FB3 A;  2PVW A;  4P4F A; 
#chains in the Genus database with same CATH homology
 2NYQ A;  4OC4 A;  3N5F A;  2C6G A;  2CIJ A;  7CPA A;  3KR4 A;  3MRU A;  2PE3 A;  1Y0R A;  5K8N A;  2V8H A;  1CPS A;  2ZEO A;  3V7Z A;  3WC7 A;  4DJL A;  2JBK A;  2QJ8 A;  5JM6 A;  3KQX A;  3FH4 A;  5D29 A;  1LOK A;  3PRT A;  3KQZ A;  3NH8 A;  4NGS A;  4EFD A;  3NFZ A;  2JBJ A;  4Q7A A;  4PXB A;  4ZX9 A;  3KHX A;  4NJQ A;  2IQ6 A;  1LAN A;  3RBU A;  4P4E A;  8CPA A;  2EWB A;  2CF4 A;  3D4U A;  2PJB A;  3SJE A;  1KWM A;  4FAI A;  1CG2 A;  2J9A A;  4MRI A;  1VHO A;  1ZG7 A;  4PQA A;  4F9V A;  3MN8 A;  4OC3 A;  1LAM A;  4BD9 A;  3BI0 A;  1F57 A;  4RUH A;  3FF3 A;  1DTD A;  2ZEM A;  1PYT B;  4X2T A;  4B6Z A;  2PIY A;  3RZA A;  4ONW A;  1ZG8 A;  3NA6 A;  5LYL A;  3S9L A;  3H8F A;  2CTB A;  2CTC A;  1H8L A;  4IK2 A;  4OKO A;  1CP6 A;  3B3C A;  5HVG A;  3WAB A;  1F2O A;  5ELY A;  1XJO A;  3FJU A;  2PJ4 A;  5I4M A;  3NH5 A;  1Q7L A;  2PJ2 A;  4K3N A;  1F2P A;  2PRQ A;  2RFH A;  3ISX A;  3PFE A;  3FX6 A;  2ZEL A;  2PJ6 A;  2PJ9 A;  2PCU A;  4X8I A;  3PB6 X;  5LRK A;  2HC9 A;  4NGN A;  4NGQ A;  5LRG A;  1BLL E;  3B2Y A;  3B3S A;  3H8G A;  4MXU A;  4JZ0 A;  1R3N A;  1TKJ A;  1AMP A;  2AFZ A;  1IGB A;  3LWU A;  3PB4 X;  2Q4Z A;  3FED A;  4NGM A;  3KI9 A;  4A37 A;  1M4L A;  4R76 A;  4ZY0 A;  3L2N A;  3B3V A;  3D7H A;  2PJ5 A;  4UEF A;  4MCQ A;  2PJC A;  4P44 A;  5F09 A;  4FUU A;  4OC0 A;  2V8D A;  1BPM A;  3KR5 A;  3B7I A;  3PBB A;  2OOT A;  1XRY A;  3ISZ A;  2ZED A;  3LMS A;  3D68 A;  2Q51 A;  2G9D A;  4PXD A;  2O4H A;  2XEF A;  1YSJ A;  5JGF A;  2F7V A;  1RTQ A;  4DYO A;  2BCO A;  4P4I A;  4P45 A;  1CX8 A;  3TX8 A;  1ZG9 A;  2PIZ A;  2ZEF A;  4IAV A;  3KL9 A;  3BHX A;  4PXC A;  4X3R A;  5HVF A;  1BAV A;  2V77 A;  2IJZ A;  1Y7E A;  2ZOF A;  2ZOG A;  3T8W A;  2HB6 A;  2I3C A;  2AFX A;  2BO9 A;  5J1Q A;  5THW A;  4ZYQ A;  1ELL P;  4GM5 A;  3IEH A;  1ARM A;  4OC2 A;  1VHE A;  1YLO A;  3I1U A;  3BI1 A;  3D7G A;  2C6P A;  4P4B A;  3TC8 A;  2BOA A;  5HVH A;  4JYW A;  1HDQ A;  2ABZ A;  4TNU A;  4F8Z A;  3RAM A;  4AXV A;  1Z5R A;  2ZEN A;  1Z8L A;  4P6Y A;  4TWE A;  3WC5 A;  3CT9 A;  1YW4 A;  1EE3 P;  3PFO A;  1QMU A;  3IC1 A;  1NSA A;  3H8E A;  4KSI A;  3D66 A;  5LYI A;  5HXD A;  4NFR A;  2NSM A;  2QVP A;  3CPX A;  1VIX A;  2Q43 A;  1PCA A;  4PPZ A;  1HDU A;  3VH9 A;  4PXE A;  3D7D A;  1GYT A;  1TXR A;  4ZX8 A;  4P10 A;  4UEE A;  2IMO A;  4OC5 A;  2PJ7 A;  5LYF A;  4NGR A;  2V8G A;  2PJ0 A;  1LCP A;  3SJG A;  1FT7 A;  2EK9 A;  2OR4 A;  4MHZ A;  3PB9 X;  3SI0 A;  1OBR A;  5K8O A;  4MHP A;  1VGY A;  4MCP A;  4ZY2 A;  5JH9 A;  6CPA A;  4F9U A;  3VAT A;  3GLJ A;  4YU9 A;  1XFO A;  1HEE A;  3DGV A;  1DE4 C;  1BPN A;  1ZLI A;  4NGT A;  2XEG A;  1LAP A;  3IIB A;  4NJR A;  3WC6 A;  1CPX A;  3S9N A;  5IB9 A;  3WT4 A;  4A38 A;  2V8V A;  4DUK A;  3DLJ A;  3D67 A;  4MHY A;  3GUX A;  3JRU A;  3V38 A;  1TF9 A;  2AFW A;  2PJ3 A;  1QQ9 A;  2PJ1 A;  2EK8 A;  1AYE A;  2GU2 A;  4MCS A;  2VL1 A;  1TKH A;  3KGQ A;  1ELM P;  4NGP A;  4MCR A;  4Z65 A;  2PJA A;  3SJX A;  2XEJ A;  4R6T A;  2PVV A;  5K8P A;  2F8H A;  2XEI A;  4YWY A;  4A94 A;  3HUV A;  3B3W A;  4R8F A;  1ARL A;  3CDX A;  3K2K A;  4FBE A;  1CP7 A;  3D7F A;  3K9T A;  3VAR A;  3PB8 X;  4R7M A;  1ZLH A;  3BXM A;  1XBU A;  3QNV A;  4MMO A;  2ZEG A;  4WJB A;  4UIA A;  4EWT A;  1UWY A;  3FVL A;  5LRJ A;  3IJ3 A;  2ZEE A;  4W9Y A;  4ZI6 A;  4P4J A;  2C6C A;  1IY7 A;  5CPA A;  3NH4 A;  5CBM A;  2DEA A;  1YME A;  3SJF A;  1R43 A;  4LQG A;  3KAS A;  4G1P A;  4FWU A;  2GLJ A;  2C1C A;  3HLP A;  4MHN A;  1JQG A;  3GB0 A;  4CPA A;  4H2K A;  4UF4 A;  2POK A;  3FEC A;  2AFU A;  4UIB A;  5D8N A;  2AFM A;  2RB7 A;  5DS0 A;  3PBE A;  2PJ8 A;  3IWW A;  3S9M A;  4OP4 A;  4O23 A;  2WZN A;  1CBX A;  4OME A;  5K8M A;  1XMB A;  5LYD A;  2GLF A;  4P4D A;  1Y0Y A;  3FEE A;  4OID A;  3FMC A;  3SI1 A;  4ZY1 A;  2ANP A;  3PEI A;  1FNO A;  4OC1 A;  1Z2L A;  3IO1 A;  2WYR A;  2ZEP A;  3KZW A;  2ZEH A;  4EME A;  3PB7 X;  4IHM A;  4WWV A;  3SI2 A;  1TF8 A;  3CPA A;  2AFS A;  4OIW A;  4A39 A;  3IFE A;  1YW6 A;  3B35 A;  2JEW A;  2O53 A;  2AFO A;  2QYV A;  1LFW A;  2GRE A;  3B3T A;  3KHZ A;  4UEZ A;  2FVG A;  1TKF A;  2PVW A;  4P4F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...