1P0HA

Crystal structure of rv0819 from mycobacterium tuberculosis mshd-mycothiol synthase coenzyme a complex
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
308
structure length
290
Chain Sequence
ALDWRSALTADEQRSVRALVTATTAVDGVAPVGEQVLRELGQQRTEHLLVAGSRPGGPIIGYLNLSPPGGAMAELVVHPQSRRRGIGTAMARAALAKTAGRNQFWAHGTLDPARATASALGLVGVRELIQMRRPLRDIPEPTIPDGVVIRTYAGTSDDAELLRVNNAAFAGHPEQGGWTAVQLAERRGEAWFDPDGLILAFGDGRLLGFHWTKVHPDHPGLGEVYVLGVDPAAQRRGLGQMLTSIGIVSLARRLVEPAVLLYVESDNVAAVRTYQSLGFTTYSVDTAYAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords hypothetical protein Rv0819
publication title Crystal structure of mycothiol synthase (Rv0819) from Mycobacterium tuberculosis shows structural homology to the GNAT family of N-acetyltransferases.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
total genus 83
structure length 290
sequence length 308
ec nomenclature ec 2.3.1.189: Mycothiol synthase.
pdb deposition date 2003-04-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 1p0hA00
4UBRA 2Q4VA 4E8OA 5JQ4A 2OZGA 2P0WA 1YR0A 3D3SA 2D4PA 4XPDC 3ZZIA 4JJXA 2KCWA 3C26A 5KTCA 2GIVA 4PSXA 4ORFA 4L89A 2BEIA 3R95A 4EVYA 2REFA 3PP9A 4U5YA 3W6SA 2I79A 3G8WA 3DSBA 5H84A 3EFAA 2PR1A 3SHPA 2Z11A 5F46A 4XPLA 4H6UA 4KORA 2PR8A 5F49A 2ZW6A 1XIXA 3SXOA 1J4JA 1SQHA 3D8PA 1B87A 1Q2YA 1S7KA 3D2MA 4F0YA 4AG7A 2F5IA 3GYAA 4U9YA 2J8MA 4KUBA 2CNSA 2FL4A 1P0HA 1YLEA 2PC1A 2HV2A 1Y9KA 4MI4A 2JDCA 4R3KA 1M1DA 2OB0A 2VEZA 4R87A 1M4IA 4NXYA 1M4DA 1QSOA 1S7LA 1N71A 3R9EA 1U6MA 5JPHA 4MBUA 1P4NA 1S5KA 2BUEA 5IV0A 3E0KA 3T90A 4UA3A 3DNSA 4PK2A 3T9YA 2O28A 3B8GA 5EC4A 3FIXA 2B5GA 2ZW5A 3FXTA 4IUSA 2CNTA 4I49A 3TFYA 4OLLA 4YGOA 3TO6A 2D4OA 2Q7BA 2P6EA 5E96A 3R9FA 4H6ZA 2Z10A 1MJ9A 3FNCA 4MJ8A 4PK3A 1B6BA 3UY5A 1YVKA 2FE7A 4XNHB 2B4BA 4FD5A 2PDOA 1WK4A 4UWIA 2JDDA 3DR6A 2BL1A 1KZFA 4OADA 2C27A 5DWNA 4Y49B 4NCZA 4OAEA 3RYOA 2H5MA 4CAXA 1Y7RA 4NF1A 3BLNA 3EO4A 5H86A 4AG9A 3W6XA 1BOBA 1L0CA 3TOBA 2VXKA 2PSWA 1S60A 5IX3A 4MHDA 4DNCA 2PRBA 4FD6A 4KVXA 1Q2CA 4QBJA 3R96A 4E0AA 4LX9A 1CM0A 4KLVA 3GKRA 4PSWA 4B5PA 4CS0B 4CAVA 1YX0A 3LD2A 1CJWA 2ZW7A 1YGHA 3I3GA 2FXFA 1YVOA 3VWDA 1QSRA 4JD6A 2QMLA 1PUAA 1Z4EA 1XE4A 5I0CA 2NMTA 4B5OA 4XPKA 1KUYA 2IL4A 4KOXA 3TO9A 4FD7A 3FBUA 4RS2A 4JXRA 3JVNA 1UFHA 2GANA 4XPDB 3EC4A 1Z9UA 2REEA 4ONUA 4F6AA 1OZPA 3TT2A 1Z4RA 4E2AA 4HNYB 2OZUA 2B4DA 1IICA 2FCKA 1IIDA 3N7ZA 4KZTA 4PV6A 1MJAA 4R9MA 4CRYB 2G0BA 4YFJA 3I9SA 5C88A 5EBVA 3QB8A 3VWEA 5ISVA 4R57A 2JLMA 1V0CA 2P6FA 4KVME 2OH1A 4M85A 4L8AA 4MY3A 3G3SA 1KUXA 2B5GB 3FRMA 3IWGA 3TO7A 3CXPA 5IB0A 1VKCA 1S7NA 2WPWA 2QIRA 3H4QA 4KLWA 4BMHA 1M4GA 5J8FA 3F5BA 2ZW4A 4HNWB 1TIQA 4AVCA 1ON0A 1VHSA 5GCNA 2ZPAA 3PGPA 4H89A 1S7FA 1I12A 5F48A 1K4JA 1MK4A 2X7BA 3P2HA 2DXQA 1IYKA 3R9GA 1BO4A 5FVJA 2B3UA 2VZZA 2R7HA 1I21A 3R1KA 3KKWA 2VBQA 4NEXA 1QSMA 2GE3A 2Q4YA 3D2PA 3TE4A 4QVTA 2OZHA 2R1IA 3P2FA 1M44A 5J8CA 3GY9A 3DDDA 5C82A 4B5PB 1NE9A 2VI7A 2R8VA 2OU2A 2EVNA 2AE6A 3DR8A 3IGRA 3PZJA 3WR7A 1LRZA 3FYNA 4CAWA 1FY7A 3S6HA 3CXSA 3FB3A 4NSQA 3ZJ0A 3QAHA 1IYLA 1KUVA 4KOSA 4LUAA 3MGDA 4CRZB 2Z0ZA 2Q04A 3EXNA 1QSTA 4QUSA 4AB7A 1Y9WA 2Y0MA 2EUIA 2K5TA 3V8IA 5HMNA 5CNPA 2Q44A 3OWCA 4ZBGA 4HNXB 3S6GA 3SXNA 2B4DB 3LODA 1MJBA 3CXQA 1IB1E 4KOTA 2FS5A 3TOAA 3BJ8A 4HKFA 1QSNA 2B3VA 3K9UA 2A4NA 4M3SA 4QB9A 1RXTA 1XEBA 1RO5A 3F0AA 4II9A 5KTDA 2ARHA 5F47A 1NMTA 1R57A 4YRHA 2R98A 4XNHC 4KOUA 1I1DA 4AVBA 4K30A 4Y49C 1NSLA 2HUZA 4KOYA 2G3TA 3BJ7A 5HH1A 3TCVA 4KVOE 3S6KA 4JXQA 4KOWA 2PQ8A 3S6FA 2FT0A 2G3AA 4U9ZA 3F8KA 2FIAA 4MY0A 2B58A 2FIWA 4AVAA 3W91A 2AJ6A 1YK3A 4QC6A 2I00A 2HQYA 4FD4A 3EY5A 1GHEA 2J8RA 3NE7A 4GS4A 4RI1A 4KOVA 1XF8A 2JEVA 1YREA 2BSWA 2WPXA 1Q2DA 1XMTA 4IF5A 4KUAA 2FSRA 5KTAA 2P6GA 4J3GA 1S3ZA 2J8NA 2ATRA 2Q0YA 4JWPA 1WWZA 4JLYA 2RC4A 2VZYA 2VQYA 2ZXVA 5DWMA 4R3LA 4UWJA 3TTHA 3JUWA 2CY2A 2CNMA 2QECA 4X5KA 1PU9A
chains in the Genus database with same CATH superfamily
1H8LA 4UBRA 4R6TA 2Q4VA 4E8OA 1TF8A 5I4MA 2OZGA 5JQ4A 1LAPA 1ZG8A 2AFMA 2CTCA 6CPAA 5HXDA 2P0WA 2PVWA 3KZWA 1YR0A 2XEGA 2ZEMA 3D3SA 2D4PA 4GXHA 4XPDC 3ZZIA 1IY7A 4NGNA 3IWEA 4JJXA 4NGRA 2KCWA 3C26A 5K8NA 2V8GA 4TWEA 5KTCA 2GIVA 4PSXA 1UWYA 4A37A 1Z2LA 2ZEPA 1HDQA 4ORFA 2V8HA 4L89A 1QQ9A 2BEIA 3H8GA 3R95A 2REFA 4EVYA 3PP9A 4U5YA 3W6SA 2I79A 2JBKA 3G8WA 5JH9A 4G1PA 2CIJA 3DSBA 5H84A 3EFAA 1Y0RA 2PR1A 3SHPA 2Z11A 2PJ2A 4RUHA 4CYQA 5F46A 4XPLA 4H6UA 3B7IA 4KORA 2PR8A 2Q51A 2ZW6A 1XIXA 5F49A 1J4JA 1SQHA 3D8PA 3NE8A 3SXOA 1B87A 3FF3A 4CAFA 1Q2YA 2HC9A 3K9TA 3KR4A 1S7KA 3D7GA 1LCPA 3D2MA 4F0YA 2ZEHA 5K8MA 4AG7A 1IOFA 2F5IA 3GYAA 4U9YA 2J8MA 4KUBA 2CNSA 2CTBA 1AUGA 3L2NA 3FX6A 3S9NA 2FL4A 1HEEA 1P0HA 4PQAA 4ZX8A 1ARMA 4UF4A 4B13A 1YLEA 2PC1A 2HV2A 1Y9KA 1XFOA 1CP7A 3GLJA 4MI4A 5LYFA 2ZEDA 4NGQA 2JDCA 4R3KA 3WC6A 3KR5A 1M1DA 2OB0A 2VEZA 4R87A 1M4IA 4NXYA 2PIZA 1M4DA 1QSOA 1S7LA 1N71A 3R9EA 1U6MA 2EO8A 5IB9A 4MBUA 5JPHA 1P4NA 1S5KA 2BUEA 5IV0A 5HVFA 3E0KA 4P4BA 4ZY2A 4UA3A 3DNSA 4PK2A 2F7VA 3T9YA 3FEDA 3H8EA 3T90A 2O28A 3B8GA 5EC4A 2I3CA 3FIXA 5K8PA 2PJCA 2DF5A 4K3NA 1FT7A 4NJQA 2B5GA 2ZW5A 3KHZA 3FXTA 3N5FA 2CNTA 4IUSA 4OIWA 4I49A 3TFYA 3MRUA 4BBHA 4OLLA 4YGOA 4LQGA 3TO6A 2D4OA 1M4LA 3FH4A 2Q7BA 4A39A 2P6EA 5E96A 3R9FA 4CAEA 2WZNA 4H6ZA 1DTDA 1A2ZA 2Z10A 2C6PA 3KI9A 1MJ9A 3FNCA 3LACA 4MJ8A 5G21A 4EMEA 4PK3A 2ZEOA 2NSMA 4RN7A 1TKHA 1B6BA 3UY5A 2YNEA 1YVKA 2FE7A 4XNHB 2B4BA 2VL1A 4FD5A 3QNVA 4H2KA 2PDOA 1WK4A 4UWIA 4OC0A 1PCAA 2JDDA 2JEWA 3DR6A 4F9VA 2BL1A 1KZFA 2XEIA 3H8FA 4KSFA 2C27A 4OADA 5DWNA 4Y49B 2AFWA 4NCZA 4UIBA 4O23A 4OAEA 4UFXA 3RYOA 4A2ZA 2JBJA 3TX8A 2EK9A 5D8NA 3LWUA 2H5MA 2XEJA 4CAXA 3IC1A 1XJOA 1Y7RA 3BLNA 4NF1A 4ZGYB 4C68A 2EBJA 3EO4A 5H86A 4PPZA 2AFXA 4HPSA 3PFEA 4AG9A 3B3SA 3W6XA 1BOBA 1L0CA 3TOBA 2VXKA 1ZG9A 2PSWA 3DGVA 1S60A 2RB7A 5IX3A 4MHDA 4DNCA 5HVGA 2PRBA 4MXUA 4FD6A 4KVXA 4A32A 1CG2A 1Q2CA 2Q4ZA 4GM5A 4P4FA 4X8IA 4QBJA 4M6IA 3R96A 3IJ3A 4E0AA 4LX9A 1CM0A 2AFUA 4KLVA 2AFOA 3GKRA 5AG4A 2V8DA 4PSWA 4B5PA 1AMPA 3KGQA 3RZAA 4UCNA 3HLPA 2ZEGA 4OMEA 4CS0B 4CAVA 1YX0A 2DPTA 4UEEA 3LD2A 3FEEA 4UIAA 3VATA 1CJWA 2CF4A 2ZW7A 1YGHA 3B2YA 2AFZA 4MFQA 3I3GA 2FXFA 1YVOA 2DPSA 1CPXA 3VWDA 1QSRA 4PXDA 1F2PA 3GUXA 4ONWA 3KL9A 4JD6A 4NGMA 5EMIA 4ZX9A 2QMLA 1PUAA 4UCPA 5JM6A 3LMSA 4P4IA 2GREA 1Z4EA 1BLLE 2AFSA 3B3VA 3KQXA 3HUVA 5A28A 1XE4A 4UFWA 1EE3P 2NMTA 5I0CA 2ANPA 2PVVA 4B5OA 4XPKA 2GFQA 1KUYA 5G22A 3NH8A 2IL4A 2G9DA 4KOXA 3TO9A 4FD7A 3FBUA 4RS2A 5CPAA 3RNZA 3VH9A 4JXRA 3JVNA 3RO0A 1VHOA 2GANA 1UFHA 7CPAA 3PBBA 2EWBA 4XPDB 2Z3PA 1IU8A 3EC4A 4A38A 4DUKA 1Z9UA 2REEA 4ONUA 4F6AA 4Q7AA 2GLFA 3WC7A 1YW6A 4MFPA 1OZPA 4ZYQA 3TT2A 2C6CA 1Z4RA 4E2AA 4HNYB 2OZUA 2PJ9A 3PB8X 2B4DA 2PJ5A 1IICA 4ZI6A 2FCKA 1IIDA 1LFWA 1IGBA 2PJ7A 2ZELA 3B3CA 3N7ZA 1MJAA 4IHMA 4KZTA 4PV6A 4R9MA 2DEAA 2FVGA 4C7HA 4CRYB 2G0BA 4YFJA 2V77A 4P44A 3I9SA 4ZY1A 5C88A 5F09A 1YSJA 3QAYA 3VARA 4OC4A 3MN8A 3CPXA 1FNOA 4MRIA 5EBVA 1VHEA 4KSAA 3QB8A 4MMOA 4CYPA 4X2TA 3VWEA 1NSAA 2ABZA 1CBXA 4P10A 4BD9A 5ISVA 4MCQA 4R57A 3SJXA 2JLMA 1V0CA 2P6FA 4MHPA 2PJ4A 2PJ1A 4KVME 2WUUA 2OH1A 4Z65A 4M85A 3FMCA 4Q36A 4L8AA 4MY3A 3G3SA 1HDUA 2F8HA 1KUXA 2B5GB 3FRMA 3IWGA 1IOIA 4A95A 3TO7A 3CXPA 2Q43A 3WABA 5IB0A 3B3WA 1VKCA 3WT4A 1CPSA 1S7NA 4P4JA 3PB9X 1ARLA 3DLJA 4WJBA 2WPWA 1CP6A 2QIRA 3S9MA 3H4QA 1Y7EA 3D4UA 4KLWA 4BMHA 1TF9A 1M4GA 2PE3A 4UEFA 5J8FA 1JWQA 4OC1A 3SJGA 4B14A 3F5BA 4C7IA 1BPMA 4NGSA 3CT9A 2PRQA 4MFZA 2ODFA 2ZW4A 4HNWB 5G1ZA 2BCOA 1ELLP 1TIQA 4OC5A 4AVCA 1XBUA 2HB6A 5C82A 1ON0A 1VHSA 4YWYA 1F57A 5GCNA 3IIBA 2PCUA 4UEZA 3PFOA 2ZPAA 3PGPA 4MFKA 4H89A 2IQ6A 4MHYA 4P6YA 4PXCA 3V7ZA 2QYVA 1S7FA 2C6GA 1I12A 4WWVA 1YMEA 5F48A 1K4JA 1MK4A 2X7BA 3P2HA 2DXQA 1IYKA 3R9GA 4C2ZA 1BO4A 3RAMA 5FVJA 1ZLHA 1Y0YA 1XOVA 4C2YA 4IK2A 5AG6A 3BI0A 5A27A 2B3UA 4B11A 2VZZA 3FECA 2R7HA 1I21A 3IEHA 3H5ZA 1LOKA 3R1KA 4M6GA 4C2XA 3KKWA 2PIYA 2VBQA 5CBMA 4W9YA 1AYEA 4NEXA 4OP4A 1QSMA 4KS9A 2GE3A 2Q4YA 3BXMA 3D2PA 4FAIA 3TE4A 4QVTA 5LRKA 2OZHA 2R1IA 3A9LA 2Z3KA 3GB0A 3P2FA 1M44A 1VGYA 5J8CA 2GU2A 1Z8WA 3GY9A 2Z3LA 4JZ0A 3PB7X 4P45A 1ZG7A 1ZO0A 3DDDA 4TNUA 4X3RA 1NE9A 2VI7A 3I1UA 3KQZA 3PEIA 4B5PB 3TC8A 3FJUA 3PBEA 1LAMA 2IMOA 2QVPA 2R8VA 5D29A 4A33A 2OU2A 1R43A 2AE6A 2EVNA 3DR8A 3IGRA 3SJEA 1F2OA 3PZJA 5DS0A 3WR7A 1LRZA 4B10A 1VIXA 3FYNA 1FY7A 3IO1A 1LANA 3S6HA 4CAWA 3CXSA 4MFLA 3FB3A 2CXAA 4NSQA 3D7FA 4EWTA 1XMBA 3BHXA 3ZJ0A 3QAHA 4OIDA 2RFHA 2QJ8A 3T8WA 4PXBA 4DJLA 1IYLA 1KUVA 4KOSA 2Z3OA 2NYQA 3KHXA 1X10A 4LUAA 3MGDA 1YLOA 4CRZB 2Z0ZA 4Q38A 5J1QA 1Z8LA 3IU1A 2Q04A 4B6ZA 3EXNA 1X12A 3K2KA 3KASA 8CPAA 3NH4A 4JYWA 2C1CA 2BO9A 1QSTA 4QUSA 4CYNA 4ZY0A 4AB7A 5K8OA 1Y9WA 2Y0MA 4UFVA 2EUIA 2K5TA 2BOAA 2ZEEA 3V8IA 4AXVA 2PJ8A 2OOTA 4LQ6A 5HMNA 4R8FA 5CNPA 3SI0A 1Z8XA 2Q44A 3OWCA 4MHNA 3SJFA 1TXRA 4MHZA 4ZBGA 4HNXB 3S6GA 3SXNA 2PJ0A 1ELMP 2B4DB 2YNCC 4CGMA 3LODA 1MJBA 3CXQA 1IB1E 3B35A 4R76A 2POKA 4KOTA 5LYDA 2FS5A 3TOAA 4MCSA 4DYOA 4CYOA 4NFRA 3D7HA 1JQGA 3BJ8A 2PJBA 3IU2A 3PB4X 2ZOFA 2GLJA 4IAVA 4HKFA 1QSNA 2B3VA 1TKFA 4NGTA 3K9UA 5AG5A 2ZENA 5HVHA 2A4NA 2Z3NA 1Z8TA 4M3SA 4QB9A 1RXTA 1XEBA 1RO5A 3F0AA 4MFJA 2PJAA 2ZOGA 5G20A 3WC5A 5KTDA 4II9A 4NJRA 3D68A 2ARHA 2YNCA 1OBRA 5F47A 4A94A 3JRUA 4CGLA 4B12A 1NMTA 1DE4C 1R57A 4YRHA 5LRGA 2R98A 5THWA 4F0XA 3CZXA 1Q7LA 3ISZA 4XNHC 4PXEA 4BINA 2WSAA 3D67A 5LYLA 4F9UA 4KOUA 3NFZA 1I1DA 4OC2A 4OC3A 4AVBA 4K30A 4Y49C 1YQEA 4CGNA 3V38A 2IJZA 1NSLA 2HUZA 1BAVA 2G3TA 3BJ7A 4KOYA 5HH1A 3TCVA 4CPAA 4KVOE 3S6KA 4FWUA 4JXQA 5JGFA 4KOWA 2PQ8A 5LYIA 3NH5A 5ELYA 3S6FA 3RBUA 2FT0A 2G3AA 4U9ZA 2ZEFA 3F8KA 3JTKA 1TKJA 2FIAA 2O4HA 2WYRA 4MY0A 2B58A 2FIWA 3CDXA 3PRTA 3D66A 3NA6A 2OR4A 4UCMA 3D7DA 3W91A 1XRYA 1YK3A 2AJ6A 4QC6A 3SI1A 2V8VA 2I00A 3PB6X 1YW4A 1GYTA 4AVAA 2J9AA 3IWWA 1KWMA 2HQYA 1RTQA 1PYTB 1ZLIA 4FD4A 4P4EA 4YU9A 1BPNA 4MCRA 3BI1A 1CX8A 4CGOA 5BWAB 3S9LA 4R7MA 3EY5A 2EK8A 2PJ6A 4OKOA 3IFEA 1GHEA 2J8RA 4P4DA 5LRJA 3NE7A 3CPAA 2YNDA 4FUUA 4GS4A 3B3TA 2XEFA 4RI1A 4KOVA 4NGPA 1XF8A 2JEVA 1YREA 2PJ3A 2BSWA 2WPXA 1R3NA 1Q2DA 1XMTA 4IF5A 4KUAA 3SI2A 4CGPA 2FSRA 4MCPA 4F8ZA 5KTAA 4A31A 4KSIA 2P6GA 4J3GA 1S3ZA 3GIUA 2J8NA 2ATRA 2O53A 2Q7SA 4M6HA 1Z5RA 2Q0YA 1WWZA 4JWPA 2Z3MA 3ISXA 4JLYA 2RC4A 5AGEA 4EFDA 5AG7A 2VZYA 2VQYA 2ZXVA 5DWMA 4R3LA 1QMUA 2YGWA 4UWJA 3TTHA 3FVLA 3JUWA 2CY2A 4A30A 4FBEA 2CNMA 2QECA 4X5KA 1PU9A
chains in the Genus database with same CATH topology
4UBRA 2Q4VA 4E8OA 5JQ4A 2OZGA 2P0WA 1YR0A 3D3SA 2D4PA 4XPDC 3ZZIA 3IWEA 4JJXA 2KCWA 3C26A 5KTCA 2GIVA 4PSXA 4ORFA 4L89A 2BEIA 3R95A 4EVYA 2REFA 3PP9A 4U5YA 3W6SA 2I79A 3G8WA 3DSBA 5H84A 3EFAA 2PR1A 3SHPA 2Z11A 4CYQA 5F46A 4XPLA 4H6UA 4KORA 2PR8A 5F49A 2ZW6A 1XIXA 3SXOA 1J4JA 1SQHA 3D8PA 1B87A 4CAFA 1Q2YA 1S7KA 3D2MA 4F0YA 4AG7A 2F5IA 3GYAA 4U9YA 2J8MA 4KUBA 2CNSA 2FL4A 1P0HA 4B13A 1YLEA 2PC1A 2HV2A 1Y9KA 4MI4A 2JDCA 4R3KA 1M1DA 2OB0A 2VEZA 4R87A 1M4IA 4NXYA 1M4DA 1QSOA 1S7LA 1N71A 3R9EA 1U6MA 5JPHA 4MBUA 1P4NA 1S5KA 2BUEA 5IV0A 3E0KA 3T90A 4UA3A 3DNSA 4PK2A 3T9YA 2O28A 3B8GA 5EC4A 3FIXA 2B5GA 2ZW5A 3FXTA 4IUSA 2CNTA 4I49A 3TFYA 4BBHA 4OLLA 4YGOA 3TO6A 2D4OA 2Q7BA 2P6EA 5E96A 3R9FA 4CAEA 4H6ZA 2Z10A 1MJ9A 3FNCA 4MJ8A 5G21A 4PK3A 1B6BA 3UY5A 2YNEA 1YVKA 2FE7A 4XNHB 2B4BA 4FD5A 2PDOA 1WK4A 4UWIA 2JDDA 3DR6A 2BL1A 1KZFA 4KSFA 4OADA 2C27A 5DWNA 4Y49B 4NCZA 4OAEA 4UFXA 3RYOA 4A2ZA 2H5MA 4CAXA 1Y7RA 4NF1A 3BLNA 4ZGYB 4C68A 3EO4A 5H86A 4AG9A 3W6XA 1BOBA 1L0CA 3TOBA 2VXKA 2PSWA 1S60A 5IX3A 4MHDA 4DNCA 2PRBA 4FD6A 4KVXA 4A32A 1Q2CA 4QBJA 3R96A 4E0AA 4LX9A 1CM0A 4KLVA 3GKRA 5AG4A 4PSWA 4B5PA 4UCNA 4CS0B 4CAVA 1YX0A 2DPTA 3LD2A 1CJWA 2ZW7A 1YGHA 4MFQA 3I3GA 2FXFA 1YVOA 2DPSA 3VWDA 1QSRA 4JD6A 2QMLA 1PUAA 4UCPA 1Z4EA 5A28A 1XE4A 4UFWA 5I0CA 2NMTA 4B5OA 4XPKA 1KUYA 5G22A 2IL4A 4KOXA 3TO9A 4FD7A 3FBUA 4RS2A 4JXRA 3JVNA 1UFHA 2GANA 4XPDB 2Z3PA 3EC4A 1Z9UA 2REEA 4ONUA 4F6AA 4MFPA 1OZPA 3TT2A 1Z4RA 4E2AA 4HNYB 2OZUA 2B4DA 1IICA 2FCKA 1IIDA 3N7ZA 4KZTA 4PV6A 1MJAA 4R9MA 4C7HA 4CRYB 2G0BA 4YFJA 3I9SA 5C88A 5EBVA 4KSAA 3QB8A 4CYPA 3VWEA 5ISVA 4R57A 2JLMA 1V0CA 2P6FA 4KVME 2WUUA 2OH1A 4M85A 4Q36A 4L8AA 4MY3A 3G3SA 1KUXA 2B5GB 3FRMA 3IWGA 4A95A 3TO7A 3CXPA 5IB0A 1VKCA 1S7NA 2WPWA 2QIRA 3H4QA 4KLWA 4BMHA 1M4GA 5J8FA 4B14A 3F5BA 4C7IA 4MFZA 2ZW4A 4HNWB 5G1ZA 1TIQA 4AVCA 1ON0A 1VHSA 5GCNA 2ZPAA 3PGPA 4MFKA 4H89A 1S7FA 1I12A 5F48A 1K4JA 1MK4A 2X7BA 3P2HA 2DXQA 1IYKA 3R9GA 4C2ZA 1BO4A 5FVJA 4C2YA 5AG6A 5A27A 2B3UA 4B11A 2VZZA 2R7HA 1I21A 3H5ZA 3R1KA 4C2XA 3KKWA 2VBQA 4NEXA 1QSMA 4KS9A 2GE3A 2Q4YA 3D2PA 3TE4A 4QVTA 2OZHA 2R1IA 3A9LA 2Z3KA 3P2FA 1M44A 5J8CA 3GY9A 2Z3LA 1ZO0A 3DDDA 5C82A 4B5PB 1NE9A 2VI7A 2R8VA 4A33A 2OU2A 2EVNA 2AE6A 3DR8A 3IGRA 3PZJA 4B10A 3WR7A 1LRZA 3FYNA 4CAWA 1FY7A 3S6HA 3CXSA 4MFLA 3FB3A 2CXAA 4NSQA 3ZJ0A 3QAHA 1IYLA 1KUVA 4KOSA 2Z3OA 4LUAA 3MGDA 4CRZB 2Z0ZA 4Q38A 3IU1A 2Q04A 3EXNA 1QSTA 4QUSA 4CYNA 4AB7A 1Y9WA 2Y0MA 4UFVA 2EUIA 2K5TA 3V8IA 5HMNA 5CNPA 2Q44A 3OWCA 4ZBGA 4HNXB 3S6GA 3SXNA 2B4DB 2YNCC 4CGMA 3LODA 1MJBA 3CXQA 1IB1E 4KOTA 2FS5A 3TOAA 4CYOA 3BJ8A 3IU2A 4HKFA 1QSNA 2B3VA 3K9UA 5AG5A 2A4NA 2Z3NA 4M3SA 4QB9A 1RXTA 1XEBA 1RO5A 3F0AA 4MFJA 5G20A 5KTDA 4II9A 2ARHA 2YNCA 5F47A 4CGLA 4B12A 1NMTA 1R57A 4YRHA 2R98A 4F0XA 4XNHC 2WSAA 4KOUA 1I1DA 4AVBA 4K30A 4Y49C 4CGNA 1NSLA 2HUZA 4KOYA 2G3TA 3BJ7A 5HH1A 3TCVA 4KVOE 3S6KA 4JXQA 4KOWA 2PQ8A 3S6FA 2FT0A 2G3AA 4U9ZA 3F8KA 3JTKA 2FIAA 4MY0A 2B58A 2FIWA 4UCMA 3W91A 4AVAA 2AJ6A 1YK3A 4QC6A 2I00A 2HQYA 4FD4A 4CGOA 5BWAB 3EY5A 1GHEA 2J8RA 3NE7A 4GS4A 2YNDA 4RI1A 4KOVA 1XF8A 2JEVA 1YREA 2BSWA 2WPXA 1Q2DA 1XMTA 4IF5A 4KUAA 4CGPA 2FSRA 5KTAA 4A31A 2P6GA 4J3GA 1S3ZA 2J8NA 2ATRA 5AGEA 2Q0YA 4JWPA 1WWZA 2Z3MA 4JLYA 2RC4A 5AG7A 2VZYA 2VQYA 2ZXVA 5DWMA 4R3LA 2YGWA 4UWJA 3TTHA 3JUWA 2CY2A 4A30A 2CNMA 2QECA 4X5KA 1PU9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4UBR A;  2Q4V A;  4E8O A;  5JQ4 A;  2OZG A;  2P0W A;  1YR0 A;  3D3S A;  2D4P A;  4XPD C;  3ZZI A;  4JJX A;  2KCW A;  3C26 A;  5KTC A;  2GIV A;  4PSX A;  4ORF A;  4L89 A;  2BEI A;  3R95 A;  4EVY A;  2REF A;  3PP9 A;  4U5Y A;  3W6S A;  2I79 A;  3G8W A;  3DSB A;  5H84 A;  3EFA A;  2PR1 A;  3SHP A;  2Z11 A;  5F46 A;  4XPL A;  4H6U A;  4KOR A;  2PR8 A;  5F49 A;  2ZW6 A;  1XIX A;  3SXO A;  1J4J A;  1SQH A;  3D8P A;  1B87 A;  1Q2Y A;  1S7K A;  3D2M A;  4F0Y A;  4AG7 A;  2F5I A;  3GYA A;  4U9Y A;  2J8M A;  4KUB A;  2CNS A;  2FL4 A;  1P0H A;  1YLE A;  2PC1 A;  2HV2 A;  1Y9K A;  4MI4 A;  2JDC A;  4R3K A;  1M1D A;  2OB0 A;  2VEZ A;  4R87 A;  1M4I A;  4NXY A;  1M4D A;  1QSO A;  1S7L A;  1N71 A;  3R9E A;  1U6M A;  5JPH A;  4MBU A;  1P4N A;  1S5K A;  2BUE A;  5IV0 A;  3E0K A;  3T90 A;  4UA3 A;  3DNS A;  4PK2 A;  3T9Y A;  2O28 A;  3B8G A;  5EC4 A;  3FIX A;  2B5G A;  2ZW5 A;  3FXT A;  4IUS A;  2CNT A;  4I49 A;  3TFY A;  4OLL A;  4YGO A;  3TO6 A;  2D4O A;  2Q7B A;  2P6E A;  5E96 A;  3R9F A;  4H6Z A;  2Z10 A;  1MJ9 A;  3FNC A;  4MJ8 A;  4PK3 A;  1B6B A;  3UY5 A;  1YVK A;  2FE7 A;  4XNH B;  2B4B A;  4FD5 A;  2PDO A;  1WK4 A;  4UWI A;  2JDD A;  3DR6 A;  2BL1 A;  1KZF A;  4OAD A;  2C27 A;  5DWN A;  4Y49 B;  4NCZ A;  4OAE A;  3RYO A;  2H5M A;  4CAX A;  1Y7R A;  4NF1 A;  3BLN A;  3EO4 A;  5H86 A;  4AG9 A;  3W6X A;  1BOB A;  1L0C A;  3TOB A;  2VXK A;  2PSW A;  1S60 A;  5IX3 A;  4MHD A;  4DNC A;  2PRB A;  4FD6 A;  4KVX A;  1Q2C A;  4QBJ A;  3R96 A;  4E0A A;  4LX9 A;  1CM0 A;  4KLV A;  3GKR A;  4PSW A;  4B5P A;  4CS0 B;  4CAV A;  1YX0 A;  3LD2 A;  1CJW A;  2ZW7 A;  1YGH A;  3I3G A;  2FXF A;  1YVO A;  3VWD A;  1QSR A;  4JD6 A;  2QML A;  1PUA A;  1Z4E A;  1XE4 A;  5I0C A;  2NMT A;  4B5O A;  4XPK A;  1KUY A;  2IL4 A;  4KOX A;  3TO9 A;  4FD7 A;  3FBU A;  4RS2 A;  4JXR A;  3JVN A;  1UFH A;  2GAN A;  4XPD B;  3EC4 A;  1Z9U A;  2REE A;  4ONU A;  4F6A A;  1OZP A;  3TT2 A;  1Z4R A;  4E2A A;  4HNY B;  2OZU A;  2B4D A;  1IIC A;  2FCK A;  1IID A;  3N7Z A;  4KZT A;  4PV6 A;  1MJA A;  4R9M A;  4CRY B;  2G0B A;  4YFJ A;  3I9S A;  5C88 A;  5EBV A;  3QB8 A;  3VWE A;  5ISV A;  4R57 A;  2JLM A;  1V0C A;  2P6F A;  4KVM E;  2OH1 A;  4M85 A;  4L8A A;  4MY3 A;  3G3S A;  1KUX A;  2B5G B;  3FRM A;  3IWG A;  3TO7 A;  3CXP A;  5IB0 A;  1VKC A;  1S7N A;  2WPW A;  2QIR A;  3H4Q A;  4KLW A;  4BMH A;  1M4G A;  5J8F A;  3F5B A;  2ZW4 A;  4HNW B;  1TIQ A;  4AVC A;  1ON0 A;  1VHS A;  5GCN A;  2ZPA A;  3PGP A;  4H89 A;  1S7F A;  1I12 A;  5F48 A;  1K4J A;  1MK4 A;  2X7B A;  3P2H A;  2DXQ A;  1IYK A;  3R9G A;  1BO4 A;  5FVJ A;  2B3U A;  2VZZ A;  2R7H A;  1I21 A;  3R1K A;  3KKW A;  2VBQ A;  4NEX A;  1QSM A;  2GE3 A;  2Q4Y A;  3D2P A;  3TE4 A;  4QVT A;  2OZH A;  2R1I A;  3P2F A;  1M44 A;  5J8C A;  3GY9 A;  3DDD A;  5C82 A;  4B5P B;  1NE9 A;  2VI7 A;  2R8V A;  2OU2 A;  2EVN A;  2AE6 A;  3DR8 A;  3IGR A;  3PZJ A;  3WR7 A;  1LRZ A;  3FYN A;  4CAW A;  1FY7 A;  3S6H A;  3CXS A;  3FB3 A;  4NSQ A;  3ZJ0 A;  3QAH A;  1IYL A;  1KUV A;  4KOS A;  4LUA A;  3MGD A;  4CRZ B;  2Z0Z A;  2Q04 A;  3EXN A;  1QST A;  4QUS A;  4AB7 A;  1Y9W A;  2Y0M A;  2EUI A;  2K5T A;  3V8I A;  5HMN A;  5CNP A;  2Q44 A;  3OWC A;  4ZBG A;  4HNX B;  3S6G A;  3SXN A;  2B4D B;  3LOD A;  1MJB A;  3CXQ A;  1IB1 E;  4KOT A;  2FS5 A;  3TOA A;  3BJ8 A;  4HKF A;  1QSN A;  2B3V A;  3K9U A;  2A4N A;  4M3S A;  4QB9 A;  1RXT A;  1XEB A;  1RO5 A;  3F0A A;  4II9 A;  5KTD A;  2ARH A;  5F47 A;  1NMT A;  1R57 A;  4YRH A;  2R98 A;  4XNH C;  4KOU A;  1I1D A;  4AVB A;  4K30 A;  4Y49 C;  1NSL A;  2HUZ A;  4KOY A;  2G3T A;  3BJ7 A;  5HH1 A;  3TCV A;  4KVO E;  3S6K A;  4JXQ A;  4KOW A;  2PQ8 A;  3S6F A;  2FT0 A;  2G3A A;  4U9Z A;  3F8K A;  2FIA A;  4MY0 A;  2B58 A;  2FIW A;  4AVA A;  3W91 A;  2AJ6 A;  1YK3 A;  4QC6 A;  2I00 A;  2HQY A;  4FD4 A;  3EY5 A;  1GHE A;  2J8R A;  3NE7 A;  4GS4 A;  4RI1 A;  4KOV A;  1XF8 A;  2JEV A;  1YRE A;  2BSW A;  2WPX A;  1Q2D A;  1XMT A;  4IF5 A;  4KUA A;  2FSR A;  5KTA A;  2P6G A;  4J3G A;  1S3Z A;  2J8N A;  2ATR A;  2Q0Y A;  4JWP A;  1WWZ A;  4JLY A;  2RC4 A;  2VZY A;  2VQY A;  2ZXV A;  5DWM A;  4R3L A;  4UWJ A;  3TTH A;  3JUW A;  2CY2 A;  2CNM A;  2QEC A;  4X5K A;  1PU9 A; 
#chains in the Genus database with same CATH topology
 1H8L A;  4UBR A;  4R6T A;  2Q4V A;  4E8O A;  1TF8 A;  5I4M A;  2OZG A;  5JQ4 A;  1LAP A;  1ZG8 A;  2AFM A;  2CTC A;  6CPA A;  5HXD A;  2P0W A;  2PVW A;  3KZW A;  1YR0 A;  2XEG A;  2ZEM A;  3D3S A;  2D4P A;  4GXH A;  4XPD C;  3ZZI A;  1IY7 A;  4NGN A;  3IWE A;  4JJX A;  4NGR A;  2KCW A;  3C26 A;  5K8N A;  2V8G A;  4TWE A;  5KTC A;  2GIV A;  4PSX A;  1UWY A;  4A37 A;  1Z2L A;  2ZEP A;  1HDQ A;  4ORF A;  2V8H A;  4L89 A;  1QQ9 A;  2BEI A;  3H8G A;  3R95 A;  2REF A;  4EVY A;  3PP9 A;  4U5Y A;  3W6S A;  2I79 A;  2JBK A;  3G8W A;  5JH9 A;  4G1P A;  2CIJ A;  3DSB A;  5H84 A;  3EFA A;  1Y0R A;  2PR1 A;  3SHP A;  2Z11 A;  2PJ2 A;  4RUH A;  4CYQ A;  5F46 A;  4XPL A;  4H6U A;  3B7I A;  4KOR A;  2PR8 A;  2Q51 A;  2ZW6 A;  1XIX A;  5F49 A;  1J4J A;  1SQH A;  3D8P A;  3NE8 A;  3SXO A;  1B87 A;  3FF3 A;  4CAF A;  1Q2Y A;  2HC9 A;  3K9T A;  3KR4 A;  1S7K A;  3D7G A;  1LCP A;  3D2M A;  4F0Y A;  2ZEH A;  5K8M A;  4AG7 A;  1IOF A;  2F5I A;  3GYA A;  4U9Y A;  2J8M A;  4KUB A;  2CNS A;  2CTB A;  1AUG A;  3L2N A;  3FX6 A;  3S9N A;  2FL4 A;  1HEE A;  1P0H A;  4PQA A;  4ZX8 A;  1ARM A;  4UF4 A;  4B13 A;  1YLE A;  2PC1 A;  2HV2 A;  1Y9K A;  1XFO A;  1CP7 A;  3GLJ A;  4MI4 A;  5LYF A;  2ZED A;  4NGQ A;  2JDC A;  4R3K A;  3WC6 A;  3KR5 A;  1M1D A;  2OB0 A;  2VEZ A;  4R87 A;  1M4I A;  4NXY A;  2PIZ A;  1M4D A;  1QSO A;  1S7L A;  1N71 A;  3R9E A;  1U6M A;  2EO8 A;  5IB9 A;  4MBU A;  5JPH A;  1P4N A;  1S5K A;  2BUE A;  5IV0 A;  5HVF A;  3E0K A;  4P4B A;  4ZY2 A;  4UA3 A;  3DNS A;  4PK2 A;  2F7V A;  3T9Y A;  3FED A;  3H8E A;  3T90 A;  2O28 A;  3B8G A;  5EC4 A;  2I3C A;  3FIX A;  5K8P A;  2PJC A;  2DF5 A;  4K3N A;  1FT7 A;  4NJQ A;  2B5G A;  2ZW5 A;  3KHZ A;  3FXT A;  3N5F A;  2CNT A;  4IUS A;  4OIW A;  4I49 A;  3TFY A;  3MRU A;  4BBH A;  4OLL A;  4YGO A;  4LQG A;  3TO6 A;  2D4O A;  1M4L A;  3FH4 A;  2Q7B A;  4A39 A;  2P6E A;  5E96 A;  3R9F A;  4CAE A;  2WZN A;  4H6Z A;  1DTD A;  1A2Z A;  2Z10 A;  2C6P A;  3KI9 A;  1MJ9 A;  3FNC A;  3LAC A;  4MJ8 A;  5G21 A;  4EME A;  4PK3 A;  2ZEO A;  2NSM A;  4RN7 A;  1TKH A;  1B6B A;  3UY5 A;  2YNE A;  1YVK A;  2FE7 A;  4XNH B;  2B4B A;  2VL1 A;  4FD5 A;  3QNV A;  4H2K A;  2PDO A;  1WK4 A;  4UWI A;  4OC0 A;  1PCA A;  2JDD A;  2JEW A;  3DR6 A;  4F9V A;  2BL1 A;  1KZF A;  2XEI A;  3H8F A;  4KSF A;  2C27 A;  4OAD A;  5DWN A;  4Y49 B;  2AFW A;  4NCZ A;  4UIB A;  4O23 A;  4OAE A;  4UFX A;  3RYO A;  4A2Z A;  2JBJ A;  3TX8 A;  2EK9 A;  5D8N A;  3LWU A;  2H5M A;  2XEJ A;  4CAX A;  3IC1 A;  1XJO A;  1Y7R A;  3BLN A;  4NF1 A;  4ZGY B;  4C68 A;  2EBJ A;  3EO4 A;  5H86 A;  4PPZ A;  2AFX A;  4HPS A;  3PFE A;  4AG9 A;  3B3S A;  3W6X A;  1BOB A;  1L0C A;  3TOB A;  2VXK A;  1ZG9 A;  2PSW A;  3DGV A;  1S60 A;  2RB7 A;  5IX3 A;  4MHD A;  4DNC A;  5HVG A;  2PRB A;  4MXU A;  4FD6 A;  4KVX A;  4A32 A;  1CG2 A;  1Q2C A;  2Q4Z A;  4GM5 A;  4P4F A;  4X8I A;  4QBJ A;  4M6I A;  3R96 A;  3IJ3 A;  4E0A A;  4LX9 A;  1CM0 A;  2AFU A;  4KLV A;  2AFO A;  3GKR A;  5AG4 A;  2V8D A;  4PSW A;  4B5P A;  1AMP A;  3KGQ A;  3RZA A;  4UCN A;  3HLP A;  2ZEG A;  4OME A;  4CS0 B;  4CAV A;  1YX0 A;  2DPT A;  4UEE A;  3LD2 A;  3FEE A;  4UIA A;  3VAT A;  1CJW A;  2CF4 A;  2ZW7 A;  1YGH A;  3B2Y A;  2AFZ A;  4MFQ A;  3I3G A;  2FXF A;  1YVO A;  2DPS A;  1CPX A;  3VWD A;  1QSR A;  4PXD A;  1F2P A;  3GUX A;  4ONW A;  3KL9 A;  4JD6 A;  4NGM A;  5EMI A;  4ZX9 A;  2QML A;  1PUA A;  4UCP A;  5JM6 A;  3LMS A;  4P4I A;  2GRE A;  1Z4E A;  1BLL E;  2AFS A;  3B3V A;  3KQX A;  3HUV A;  5A28 A;  1XE4 A;  4UFW A;  1EE3 P;  2NMT A;  5I0C A;  2ANP A;  2PVV A;  4B5O A;  4XPK A;  2GFQ A;  1KUY A;  5G22 A;  3NH8 A;  2IL4 A;  2G9D A;  4KOX A;  3TO9 A;  4FD7 A;  3FBU A;  4RS2 A;  5CPA A;  3RNZ A;  3VH9 A;  4JXR A;  3JVN A;  3RO0 A;  1VHO A;  2GAN A;  1UFH A;  7CPA A;  3PBB A;  2EWB A;  4XPD B;  2Z3P A;  1IU8 A;  3EC4 A;  4A38 A;  4DUK A;  1Z9U A;  2REE A;  4ONU A;  4F6A A;  4Q7A A;  2GLF A;  3WC7 A;  1YW6 A;  4MFP A;  1OZP A;  4ZYQ A;  3TT2 A;  2C6C A;  1Z4R A;  4E2A A;  4HNY B;  2OZU A;  2PJ9 A;  3PB8 X;  2B4D A;  2PJ5 A;  1IIC A;  4ZI6 A;  2FCK A;  1IID A;  1LFW A;  1IGB A;  2PJ7 A;  2ZEL A;  3B3C A;  3N7Z A;  1MJA A;  4IHM A;  4KZT A;  4PV6 A;  4R9M A;  2DEA A;  2FVG A;  4C7H A;  4CRY B;  2G0B A;  4YFJ A;  2V77 A;  4P44 A;  3I9S A;  4ZY1 A;  5C88 A;  5F09 A;  1YSJ A;  3QAY A;  3VAR A;  4OC4 A;  3MN8 A;  3CPX A;  1FNO A;  4MRI A;  5EBV A;  1VHE A;  4KSA A;  3QB8 A;  4MMO A;  4CYP A;  4X2T A;  3VWE A;  1NSA A;  2ABZ A;  1CBX A;  4P10 A;  4BD9 A;  5ISV A;  4MCQ A;  4R57 A;  3SJX A;  2JLM A;  1V0C A;  2P6F A;  4MHP A;  2PJ4 A;  2PJ1 A;  4KVM E;  2WUU A;  2OH1 A;  4Z65 A;  4M85 A;  3FMC A;  4Q36 A;  4L8A A;  4MY3 A;  3G3S A;  1HDU A;  2F8H A;  1KUX A;  2B5G B;  3FRM A;  3IWG A;  1IOI A;  4A95 A;  3TO7 A;  3CXP A;  2Q43 A;  3WAB A;  5IB0 A;  3B3W A;  1VKC A;  3WT4 A;  1CPS A;  1S7N A;  4P4J A;  3PB9 X;  1ARL A;  3DLJ A;  4WJB A;  2WPW A;  1CP6 A;  2QIR A;  3S9M A;  3H4Q A;  1Y7E A;  3D4U A;  4KLW A;  4BMH A;  1TF9 A;  1M4G A;  2PE3 A;  4UEF A;  5J8F A;  1JWQ A;  4OC1 A;  3SJG A;  4B14 A;  3F5B A;  4C7I A;  1BPM A;  4NGS A;  3CT9 A;  2PRQ A;  4MFZ A;  2ODF A;  2ZW4 A;  4HNW B;  5G1Z A;  2BCO A;  1ELL P;  1TIQ A;  4OC5 A;  4AVC A;  1XBU A;  2HB6 A;  5C82 A;  1ON0 A;  1VHS A;  4YWY A;  1F57 A;  5GCN A;  3IIB A;  2PCU A;  4UEZ A;  3PFO A;  2ZPA A;  3PGP A;  4MFK A;  4H89 A;  2IQ6 A;  4MHY A;  4P6Y A;  4PXC A;  3V7Z A;  2QYV A;  1S7F A;  2C6G A;  1I12 A;  4WWV A;  1YME A;  5F48 A;  1K4J A;  1MK4 A;  2X7B A;  3P2H A;  2DXQ A;  1IYK A;  3R9G A;  4C2Z A;  1BO4 A;  3RAM A;  5FVJ A;  1ZLH A;  1Y0Y A;  1XOV A;  4C2Y A;  4IK2 A;  5AG6 A;  3BI0 A;  5A27 A;  2B3U A;  4B11 A;  2VZZ A;  3FEC A;  2R7H A;  1I21 A;  3IEH A;  3H5Z A;  1LOK A;  3R1K A;  4M6G A;  4C2X A;  3KKW A;  2PIY A;  2VBQ A;  5CBM A;  4W9Y A;  1AYE A;  4NEX A;  4OP4 A;  1QSM A;  4KS9 A;  2GE3 A;  2Q4Y A;  3BXM A;  3D2P A;  4FAI A;  3TE4 A;  4QVT A;  5LRK A;  2OZH A;  2R1I A;  3A9L A;  2Z3K A;  3GB0 A;  3P2F A;  1M44 A;  1VGY A;  5J8C A;  2GU2 A;  1Z8W A;  3GY9 A;  2Z3L A;  4JZ0 A;  3PB7 X;  4P45 A;  1ZG7 A;  1ZO0 A;  3DDD A;  4TNU A;  4X3R A;  1NE9 A;  2VI7 A;  3I1U A;  3KQZ A;  3PEI A;  4B5P B;  3TC8 A;  3FJU A;  3PBE A;  1LAM A;  2IMO A;  2QVP A;  2R8V A;  5D29 A;  4A33 A;  2OU2 A;  1R43 A;  2AE6 A;  2EVN A;  3DR8 A;  3IGR A;  3SJE A;  1F2O A;  3PZJ A;  5DS0 A;  3WR7 A;  1LRZ A;  4B10 A;  1VIX A;  3FYN A;  1FY7 A;  3IO1 A;  1LAN A;  3S6H A;  4CAW A;  3CXS A;  4MFL A;  3FB3 A;  2CXA A;  4NSQ A;  3D7F A;  4EWT A;  1XMB A;  3BHX A;  3ZJ0 A;  3QAH A;  4OID A;  2RFH A;  2QJ8 A;  3T8W A;  4PXB A;  4DJL A;  1IYL A;  1KUV A;  4KOS A;  2Z3O A;  2NYQ A;  3KHX A;  1X10 A;  4LUA A;  3MGD A;  1YLO A;  4CRZ B;  2Z0Z A;  4Q38 A;  5J1Q A;  1Z8L A;  3IU1 A;  2Q04 A;  4B6Z A;  3EXN A;  1X12 A;  3K2K A;  3KAS A;  8CPA A;  3NH4 A;  4JYW A;  2C1C A;  2BO9 A;  1QST A;  4QUS A;  4CYN A;  4ZY0 A;  4AB7 A;  5K8O A;  1Y9W A;  2Y0M A;  4UFV A;  2EUI A;  2K5T A;  2BOA A;  2ZEE A;  3V8I A;  4AXV A;  2PJ8 A;  2OOT A;  4LQ6 A;  5HMN A;  4R8F A;  5CNP A;  3SI0 A;  1Z8X A;  2Q44 A;  3OWC A;  4MHN A;  3SJF A;  1TXR A;  4MHZ A;  4ZBG A;  4HNX B;  3S6G A;  3SXN A;  2PJ0 A;  1ELM P;  2B4D B;  2YNC C;  4CGM A;  3LOD A;  1MJB A;  3CXQ A;  1IB1 E;  3B35 A;  4R76 A;  2POK A;  4KOT A;  5LYD A;  2FS5 A;  3TOA A;  4MCS A;  4DYO A;  4CYO A;  4NFR A;  3D7H A;  1JQG A;  3BJ8 A;  2PJB A;  3IU2 A;  3PB4 X;  2ZOF A;  2GLJ A;  4IAV A;  4HKF A;  1QSN A;  2B3V A;  1TKF A;  4NGT A;  3K9U A;  5AG5 A;  2ZEN A;  5HVH A;  2A4N A;  2Z3N A;  1Z8T A;  4M3S A;  4QB9 A;  1RXT A;  1XEB A;  1RO5 A;  3F0A A;  4MFJ A;  2PJA A;  2ZOG A;  5G20 A;  3WC5 A;  5KTD A;  4II9 A;  4NJR A;  3D68 A;  2ARH A;  2YNC A;  1OBR A;  5F47 A;  4A94 A;  3JRU A;  4CGL A;  4B12 A;  1NMT A;  1DE4 C;  1R57 A;  4YRH A;  5LRG A;  2R98 A;  5THW A;  4F0X A;  3CZX A;  1Q7L A;  3ISZ A;  4XNH C;  4PXE A;  4BIN A;  2WSA A;  3D67 A;  5LYL A;  4F9U A;  4KOU A;  3NFZ A;  1I1D A;  4OC2 A;  4OC3 A;  4AVB A;  4K30 A;  4Y49 C;  1YQE A;  4CGN A;  3V38 A;  2IJZ A;  1NSL A;  2HUZ A;  1BAV A;  2G3T A;  3BJ7 A;  4KOY A;  5HH1 A;  3TCV A;  4CPA A;  4KVO E;  3S6K A;  4FWU A;  4JXQ A;  5JGF A;  4KOW A;  2PQ8 A;  5LYI A;  3NH5 A;  5ELY A;  3S6F A;  3RBU A;  2FT0 A;  2G3A A;  4U9Z A;  2ZEF A;  3F8K A;  3JTK A;  1TKJ A;  2FIA A;  2O4H A;  2WYR A;  4MY0 A;  2B58 A;  2FIW A;  3CDX A;  3PRT A;  3D66 A;  3NA6 A;  2OR4 A;  4UCM A;  3D7D A;  3W91 A;  1XRY A;  1YK3 A;  2AJ6 A;  4QC6 A;  3SI1 A;  2V8V A;  2I00 A;  3PB6 X;  1YW4 A;  1GYT A;  4AVA A;  2J9A A;  3IWW A;  1KWM A;  2HQY A;  1RTQ A;  1PYT B;  1ZLI A;  4FD4 A;  4P4E A;  4YU9 A;  1BPN A;  4MCR A;  3BI1 A;  1CX8 A;  4CGO A;  5BWA B;  3S9L A;  4R7M A;  3EY5 A;  2EK8 A;  2PJ6 A;  4OKO A;  3IFE A;  1GHE A;  2J8R A;  4P4D A;  5LRJ A;  3NE7 A;  3CPA A;  2YND A;  4FUU A;  4GS4 A;  3B3T A;  2XEF A;  4RI1 A;  4KOV A;  4NGP A;  1XF8 A;  2JEV A;  1YRE A;  2PJ3 A;  2BSW A;  2WPX A;  1R3N A;  1Q2D A;  1XMT A;  4IF5 A;  4KUA A;  3SI2 A;  4CGP A;  2FSR A;  4MCP A;  4F8Z A;  5KTA A;  4A31 A;  4KSI A;  2P6G A;  4J3G A;  1S3Z A;  3GIU A;  2J8N A;  2ATR A;  2O53 A;  2Q7S A;  4M6H A;  1Z5R A;  2Q0Y A;  1WWZ A;  4JWP A;  2Z3M A;  3ISX A;  4JLY A;  2RC4 A;  5AGE A;  4EFD A;  5AG7 A;  2VZY A;  2VQY A;  2ZXV A;  5DWM A;  4R3L A;  1QMU A;  2YGW A;  4UWJ A;  3TTH A;  3FVL A;  3JUW A;  2CY2 A;  4A30 A;  4FBE A;  2CNM A;  2QEC A;  4X5K A;  1PU9 A; 
#chains in the Genus database with same CATH homology
 4UBR A;  2Q4V A;  4E8O A;  5JQ4 A;  2OZG A;  2P0W A;  1YR0 A;  3D3S A;  2D4P A;  4XPD C;  3ZZI A;  3IWE A;  4JJX A;  2KCW A;  3C26 A;  5KTC A;  2GIV A;  4PSX A;  4ORF A;  4L89 A;  2BEI A;  3R95 A;  4EVY A;  2REF A;  3PP9 A;  4U5Y A;  3W6S A;  2I79 A;  3G8W A;  3DSB A;  5H84 A;  3EFA A;  2PR1 A;  3SHP A;  2Z11 A;  4CYQ A;  5F46 A;  4XPL A;  4H6U A;  4KOR A;  2PR8 A;  5F49 A;  2ZW6 A;  1XIX A;  3SXO A;  1J4J A;  1SQH A;  3D8P A;  1B87 A;  4CAF A;  1Q2Y A;  1S7K A;  3D2M A;  4F0Y A;  4AG7 A;  2F5I A;  3GYA A;  4U9Y A;  2J8M A;  4KUB A;  2CNS A;  2FL4 A;  1P0H A;  4B13 A;  1YLE A;  2PC1 A;  2HV2 A;  1Y9K A;  4MI4 A;  2JDC A;  4R3K A;  1M1D A;  2OB0 A;  2VEZ A;  4R87 A;  1M4I A;  4NXY A;  1M4D A;  1QSO A;  1S7L A;  1N71 A;  3R9E A;  1U6M A;  5JPH A;  4MBU A;  1P4N A;  1S5K A;  2BUE A;  5IV0 A;  3E0K A;  3T90 A;  4UA3 A;  3DNS A;  4PK2 A;  3T9Y A;  2O28 A;  3B8G A;  5EC4 A;  3FIX A;  2B5G A;  2ZW5 A;  3FXT A;  4IUS A;  2CNT A;  4I49 A;  3TFY A;  4BBH A;  4OLL A;  4YGO A;  3TO6 A;  2D4O A;  2Q7B A;  2P6E A;  5E96 A;  3R9F A;  4CAE A;  4H6Z A;  2Z10 A;  1MJ9 A;  3FNC A;  4MJ8 A;  5G21 A;  4PK3 A;  1B6B A;  3UY5 A;  2YNE A;  1YVK A;  2FE7 A;  4XNH B;  2B4B A;  4FD5 A;  2PDO A;  1WK4 A;  4UWI A;  2JDD A;  3DR6 A;  2BL1 A;  1KZF A;  4KSF A;  4OAD A;  2C27 A;  5DWN A;  4Y49 B;  4NCZ A;  4OAE A;  4UFX A;  3RYO A;  4A2Z A;  2H5M A;  4CAX A;  1Y7R A;  4NF1 A;  3BLN A;  4ZGY B;  4C68 A;  3EO4 A;  5H86 A;  4AG9 A;  3W6X A;  1BOB A;  1L0C A;  3TOB A;  2VXK A;  2PSW A;  1S60 A;  5IX3 A;  4MHD A;  4DNC A;  2PRB A;  4FD6 A;  4KVX A;  4A32 A;  1Q2C A;  4QBJ A;  3R96 A;  4E0A A;  4LX9 A;  1CM0 A;  4KLV A;  3GKR A;  5AG4 A;  4PSW A;  4B5P A;  4UCN A;  4CS0 B;  4CAV A;  1YX0 A;  2DPT A;  3LD2 A;  1CJW A;  2ZW7 A;  1YGH A;  4MFQ A;  3I3G A;  2FXF A;  1YVO A;  2DPS A;  3VWD A;  1QSR A;  4JD6 A;  2QML A;  1PUA A;  4UCP A;  1Z4E A;  5A28 A;  1XE4 A;  4UFW A;  5I0C A;  2NMT A;  4B5O A;  4XPK A;  1KUY A;  5G22 A;  2IL4 A;  4KOX A;  3TO9 A;  4FD7 A;  3FBU A;  4RS2 A;  4JXR A;  3JVN A;  1UFH A;  2GAN A;  4XPD B;  2Z3P A;  3EC4 A;  1Z9U A;  2REE A;  4ONU A;  4F6A A;  4MFP A;  1OZP A;  3TT2 A;  1Z4R A;  4E2A A;  4HNY B;  2OZU A;  2B4D A;  1IIC A;  2FCK A;  1IID A;  3N7Z A;  4KZT A;  4PV6 A;  1MJA A;  4R9M A;  4C7H A;  4CRY B;  2G0B A;  4YFJ A;  3I9S A;  5C88 A;  5EBV A;  4KSA A;  3QB8 A;  4CYP A;  3VWE A;  5ISV A;  4R57 A;  2JLM A;  1V0C A;  2P6F A;  4KVM E;  2WUU A;  2OH1 A;  4M85 A;  4Q36 A;  4L8A A;  4MY3 A;  3G3S A;  1KUX A;  2B5G B;  3FRM A;  3IWG A;  4A95 A;  3TO7 A;  3CXP A;  5IB0 A;  1VKC A;  1S7N A;  2WPW A;  2QIR A;  3H4Q A;  4KLW A;  4BMH A;  1M4G A;  5J8F A;  4B14 A;  3F5B A;  4C7I A;  4MFZ A;  2ZW4 A;  4HNW B;  5G1Z A;  1TIQ A;  4AVC A;  1ON0 A;  1VHS A;  5GCN A;  2ZPA A;  3PGP A;  4MFK A;  4H89 A;  1S7F A;  1I12 A;  5F48 A;  1K4J A;  1MK4 A;  2X7B A;  3P2H A;  2DXQ A;  1IYK A;  3R9G A;  4C2Z A;  1BO4 A;  5FVJ A;  4C2Y A;  5AG6 A;  5A27 A;  2B3U A;  4B11 A;  2VZZ A;  2R7H A;  1I21 A;  3H5Z A;  3R1K A;  4C2X A;  3KKW A;  2VBQ A;  4NEX A;  1QSM A;  4KS9 A;  2GE3 A;  2Q4Y A;  3D2P A;  3TE4 A;  4QVT A;  2OZH A;  2R1I A;  3A9L A;  2Z3K A;  3P2F A;  1M44 A;  5J8C A;  3GY9 A;  2Z3L A;  1ZO0 A;  3DDD A;  5C82 A;  4B5P B;  1NE9 A;  2VI7 A;  2R8V A;  4A33 A;  2OU2 A;  2EVN A;  2AE6 A;  3DR8 A;  3IGR A;  3PZJ A;  4B10 A;  3WR7 A;  1LRZ A;  3FYN A;  4CAW A;  1FY7 A;  3S6H A;  3CXS A;  4MFL A;  3FB3 A;  2CXA A;  4NSQ A;  3ZJ0 A;  3QAH A;  1IYL A;  1KUV A;  4KOS A;  2Z3O A;  4LUA A;  3MGD A;  4CRZ B;  2Z0Z A;  4Q38 A;  3IU1 A;  2Q04 A;  3EXN A;  1QST A;  4QUS A;  4CYN A;  4AB7 A;  1Y9W A;  2Y0M A;  4UFV A;  2EUI A;  2K5T A;  3V8I A;  5HMN A;  5CNP A;  2Q44 A;  3OWC A;  4ZBG A;  4HNX B;  3S6G A;  3SXN A;  2B4D B;  2YNC C;  4CGM A;  3LOD A;  1MJB A;  3CXQ A;  1IB1 E;  4KOT A;  2FS5 A;  3TOA A;  4CYO A;  3BJ8 A;  3IU2 A;  4HKF A;  1QSN A;  2B3V A;  3K9U A;  5AG5 A;  2A4N A;  2Z3N A;  4M3S A;  4QB9 A;  1RXT A;  1XEB A;  1RO5 A;  3F0A A;  4MFJ A;  5G20 A;  5KTD A;  4II9 A;  2ARH A;  2YNC A;  5F47 A;  4CGL A;  4B12 A;  1NMT A;  1R57 A;  4YRH A;  2R98 A;  4F0X A;  4XNH C;  2WSA A;  4KOU A;  1I1D A;  4AVB A;  4K30 A;  4Y49 C;  4CGN A;  1NSL A;  2HUZ A;  4KOY A;  2G3T A;  3BJ7 A;  5HH1 A;  3TCV A;  4KVO E;  3S6K A;  4JXQ A;  4KOW A;  2PQ8 A;  3S6F A;  2FT0 A;  2G3A A;  4U9Z A;  3F8K A;  3JTK A;  2FIA A;  4MY0 A;  2B58 A;  2FIW A;  4UCM A;  3W91 A;  4AVA A;  2AJ6 A;  1YK3 A;  4QC6 A;  2I00 A;  2HQY A;  4FD4 A;  4CGO A;  5BWA B;  3EY5 A;  1GHE A;  2J8R A;  3NE7 A;  4GS4 A;  2YND A;  4RI1 A;  4KOV A;  1XF8 A;  2JEV A;  1YRE A;  2BSW A;  2WPX A;  1Q2D A;  1XMT A;  4IF5 A;  4KUA A;  4CGP A;  2FSR A;  5KTA A;  4A31 A;  2P6G A;  4J3G A;  1S3Z A;  2J8N A;  2ATR A;  5AGE A;  2Q0Y A;  4JWP A;  1WWZ A;  2Z3M A;  4JLY A;  2RC4 A;  5AG7 A;  2VZY A;  2VQY A;  2ZXV A;  5DWM A;  4R3L A;  2YGW A;  4UWJ A;  3TTH A;  3JUW A;  2CY2 A;  4A30 A;  2CNM A;  2QEC A;  4X5K A;  1PU9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...