1P0HA

Crystal structure of rv0819 from mycobacterium tuberculosis mshd-mycothiol synthase coenzyme a complex
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
308
structure length
290
Chain Sequence
ALDWRSALTADEQRSVRALVTATTAVDGVAPVGEQVLRELGQQRTEHLLVAGSRPGGPIIGYLNLSPPGGAMAELVVHPQSRRRGIGTAMARAALAKTAGRNQFWAHGTLDPARATASALGLVGVRELIQMRRPLRDIPEPTIPDGVVIRTYAGTSDDAELLRVNNAAFAGHPEQGGWTAVQLAERRGEAWFDPDGLILAFGDGRLLGFHWTKVHPDHPGLGEVYVLGVDPAAQRRGLGQMLTSIGIVSLARRLVEPAVLLYVESDNVAAVRTYQSLGFTTYSVDTAYAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of mycothiol synthase (Rv0819) from Mycobacterium tuberculosis shows structural homology to the GNAT family of N-acetyltransferases.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase
molecule keywords hypothetical protein Rv0819
total genus 83
structure length 290
sequence length 308
ec nomenclature ec 2.3.1.189: Mycothiol synthase.
pdb deposition date 2003-04-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 1p0hA00
1IYKA 2CNSA 2Q4YA 2J8RA 1N71A 4PK3A 1Z4RA 4J3GA 1I21A 3S6KA 1L0CA 4K30A 3BJ7A 3S6FA 3FXTA 1MJBA 3TCVA 2JLMA 3TO9A 3UY5A 5FVJA 3SXNA 3TO6A 2Q0YA 4ONUA 4UWJA 5F48A 4UBRA 3PP9A 4FD6A 2ATRA 4QB9A 4B5OA 4OLLA 1RXTA 4E0AA 3TOBA 4M85A 2B3UA 2GIVA 2B5GA 4MJ8A 3G8WA 1S7NA 4XNHC 4YRHA 1Y7RA 2VEZA 1KUVA 2C27A 4KUAA 2VQYA 2WPWA 2ZW4A 3GKRA 2QMLA 1NE9A 4CAVA 3FIXA 4XPKA 1FY7A 2GANA 2ZXVA 2R98A 4ZBGA 2HUZA 2NMTA 2VZZA 4L8AA 2O28A 4U5YA 4X5KA 4YFJA 1S3ZA 1XE4A 3DR6A 4AVAA 2CNTA 3TO7A 3OWCA 4R3LA 1M1DA 2FT0A 3EY5A 4HNXB 1Y9WA 1CM0A 5GCNA 3FBUA 2G0BA 3FB3A 2OZUA 2Z0ZA 5KTAA 2ZPAA 4KOUA 4Y49B 4U9YA 4BMHA 4CRYB 1SQHA 3ZZIA 2VBQA 4I49A 3SXOA 3CXSA 4E2AA 1PU9A 3R95A 2PDOA 5IX3A 4QVTA 1KZFA 4JLYA 2EUIA 1M4GA 4Y49C 2OH1A 5EC4A 2ARHA 3DSBA 2JDCA 2CNMA 4CAXA 2Q4VA 2AJ6A 3I9SA 1YVKA 4KUBA 2P6EA 2PC1A 3F0AA 4HNWB 3EFAA 4HNYB 1B6BA 2QECA 3K9UA 4UWIA 5J8FA 4L89A 4KOWA 2VXKA 3DR8A 2FE7A 2PSWA 1BO4A 2QIRA 3EC4A 1P4NA 4MHDA 4NSQA 1I12A 1YK3A 2OZGA 1Q2DA 3VWDA 2G3TA 3N7ZA 3FYNA 3H4QA 4KVXA 4H6UA 4KVOE 1KUYA 1K4JA 1XEBA 4XPDB 2JDDA 1QSMA 2FCKA 4E8OA 2DXQA 2PQ8A 5IB0A 1XF8A 5F47A 3W6SA 3IWGA 2F5IA 4F6AA 1UFHA 2Q04A 1J4JA 2G3AA 2Z11A 1Z4EA 2PRBA 3D2MA 2B4DB 3TTHA 1YVOA 4AG9A 2R8VA 4KLVA 3MGDA 4CRZB 1I1DA 1YR0A 3WR7A 4AVBA 4R57A 4MBUA 3VWEA 1IYLA 2FIWA 4B5PB 2BSWA 1XIXA 3DNSA 4GS4A 5I0CA 5F49A 3JUWA 4AB7A 3C26A 3I3GA 4KOYA 3G3SA 5KTCA 2REEA 4MY0A 3S6GA 2OU2A 3GY9A 1R57A 4H6ZA 4RS2A 4PK2A 1GHEA 1MK4A 3E0KA 5IV0A 3ZJ0A 1U6MA 4AG7A 3S6HA 3SHPA 3B8GA 1IIDA 4PSXA 2FIAA 4FD4A 4NF1A 4FD7A 4B5PA 2P6GA 2RC4A 1S7FA 2Z10A 5DWMA 1MJAA 3R1KA 4YGOA 2Q7BA 2B4DA 1YREA 3R9EA 4LX9A 4R3KA 1TIQA 2IL4A 3F5BA 4NCZA 4RI1A 3W91A 4KOXA 4QC6A 3PGPA 3KKWA 4U9ZA 2R1IA 2ZW5A 5F46A 3PZJA 4NEXA 2FS5A 1QSOA 3R9GA 5JPHA 1M4DA 4JWPA 1V0CA 4EVYA 4PSWA 2FSRA 3P2HA 3IGRA 1P0HA 1S7LA 2PR8A 1QSNA 4KVME 2REFA 4KLWA 5C88A 1Z9UA 3FNCA 2PR1A 2CY2A 2Y0MA 3QAHA 3R96A 4KOSA 2EVNA 2B3VA 2R7HA 1YLEA 3TE4A 4KOVA 3EO4A 3W6XA 2VI7A 4IUSA 4M3SA 1MJ9A 2ZW7A 1VKCA 4XNHB 1XMTA 2P0WA 2BUEA 3LD2A 4IF5A 3BJ8A 4H89A 1YGHA 2FL4A 3GYAA 1IICA 2K5TA 1RO5A 4DNCA 1Y9KA 4QBJA 4OADA 2FXFA 4PV6A 4XPLA 4XPDC 4KOTA 5KTDA 5E96A 1Q2CA 1YX0A 4OAEA 2WPXA 1PUAA 5HMNA 1QSRA 4KORA 4UA3A 4MY3A 2I00A 2J8MA 5J8CA 3D3SA 5JQ4A 1WWZA 2D4OA 1ON0A 3RYOA 2HQYA 2ZW6A 5EBVA 5ISVA 4LUAA 2B5GB 4QUSA 1WK4A 3TOAA 5HH1A 2J8NA 3CXPA 3F8KA 1CJWA 3TT2A 1M4IA 4JXQA 4II9A 3FRMA 1S60A 4NXYA 3V8IA 2I79A 5DWNA 3LODA 2Q44A 2A4NA 2AE6A 3R9FA 2HV2A 4R9MA 1NSLA 4JXRA 1QSTA 1Q2YA 4R87A 1M44A 2D4PA 2OZHA 3DDDA 3QB8A 4AVCA 2BL1A 2H5MA 3NE7A 3JVNA 2JEVA 1S7KA 2GE3A 5C82A 1IB1E 4ORFA 1OZPA 2P6FA 4JJXA 3D8PA 1B87A 4FD5A 2KCWA 1VHSA 3CXQA 4HKFA 2B4BA 2B58A 3EXNA 1KUXA 2BEIA 3P2FA 3BLNA 5H86A 4JD6A 4F0YA 2X7BA 4CAWA 3T9YA 3D2PA 1BOBA 4KZTA 3TFYA 2OB0A 1LRZA 1NMTA 2VZYA 4MI4A 1S5KA 4CS0B 5CNPA 5H84A 3T90A
chains in the Genus database with same CATH superfamily
1IYKA 2CNSA 2Q4YA 3CZXA 3IC1A 1F2PA 1X10A 2J8RA 1N71A 1DTDA 5D29A 4PK3A 1Z4RA 4J3GA 1I21A 4UFXA 2AFZA 2Q51A 4OC5A 3S6KA 1L0CA 4K30A 3BJ7A 4UCNA 3S6FA 1YW6A 3FXTA 3NH5A 1MJBA 3TCVA 3KHXA 2JLMA 3TO9A 3UY5A 5FVJA 5F09A 3SXNA 3TO6A 3BXMA 2J9AA 4NJQA 2Q0YA 1ARMA 4ONUA 3JTKA 4UWJA 3PFOA 5F48A 4R6TA 4TNUA 4UBRA 3PP9A 4UFVA 4A31A 4FD6A 1ZLIA 1ZLHA 2ATRA 2ZOFA 2C6GA 3KHZA 4UIBA 5LYLA 4QB9A 1AYEA 4OLLA 1RXTA 4B5OA 3TOBA 4E0AA 4M85A 2B3UA 2GIVA 1QMUA 2B5GA 4MJ8A 3G8WA 1LCPA 1S7NA 4XNHC 4YRHA 3KI9A 1Y7RA 4KSIA 2VEZA 3D68A 4OC1A 1KUVA 3GUXA 1CP6A 2C27A 2ZEOA 4KUAA 5AGEA 2VQYA 2WPWA 2ZW4A 3PB4X 3GKRA 2QMLA 3DGVA 1NE9A 3RAMA 3D4UA 3PBBA 4NGTA 4CAVA 3FIXA 4XPKA 4P4EA 1FY7A 2GANA 3H8FA 1Z8XA 2ZXVA 3ISXA 5CPAA 2R98A 3B3TA 2Z3OA 4EFDA 4ZBGA 4CYNA 2HUZA 4MHYA 2NMTA 2VZZA 4L8AA 3GIUA 2PJCA 2O28A 4U5YA 2CXAA 1CX8A 4X5KA 1PCAA 3FEDA 2CTCA 2V8VA 4KSAA 4YFJA 1CPXA 1S3ZA 1XE4A 3DR6A 1BPMA 4M6GA 2VL1A 4AVAA 2CNTA 4UCMA 1LANA 1Z8LA 3D67A 3TO7A 2PJ2A 3OWCA 4UEZA 4MFKA 3SJXA 1M1DA 2FT0A 3IIBA 3EY5A 4HNXB 4R3LA 4X2TA 4CGOA 1Y9WA 5D8NA 3D7HA 1CM0A 3K9TA 5GCNA 2IJZA 4DJLA 1Y7EA 3FBUA 2G0BA 3SJFA 3FB3A 2OZUA 2Z0ZA 3B3CA 4OC4A 4A94A 5KTAA 5EMIA 4FUUA 2ZPAA 4KOUA 2YNDA 2ZEPA 1LAMA 2EK9A 4P4FA 4Y49B 4WJBA 4ZY2A 4UEFA 4U9YA 2PJ7A 4BMHA 2C1CA 4CRYB 2OR4A 3QNVA 4Q36A 3HUVA 4F9UA 1SQHA 3ZZIA 4MFZA 2GFQA 1XRYA 3PBEA 2VBQA 2CF4A 1VHEA 2XEGA 4I49A 3SXOA 3CXSA 3T8WA 4E2AA 3ISZA 3H8GA 2ODFA 1ELMP 4O23A 4B6ZA 2Z3LA 1PU9A 5HVFA 2QVPA 4C2XA 3R95A 3LMSA 2JBJA 2PDOA 5IX3A 3KGQA 4QVTA 1KZFA 4JLYA 2EUIA 1H8LA 1M4GA 4Y49C 2OH1A 5EC4A 4WWVA 2ARHA 3DSBA 2JDCA 2ZEGA 2CNMA 4R7MA 3L2NA 5G22A 4NFRA 4CAXA 4JYWA 1F2OA 2Q4VA 4MRIA 4F8ZA 2AJ6A 3I9SA 3S9LA 1YVKA 4KUBA 2P6EA 5IB9A 2PC1A 1ZG7A 3F0AA 2AFMA 2ZEDA 1TKHA 4HNWB 3EFAA 2CIJA 4X8IA 4GXHA 4HNYB 1KWMA 2PJ8A 3RZAA 7CPAA 1B6BA 1IGBA 4B14A 1OBRA 3S9NA 1NSAA 4OC2A 5G20A 1EE3P 2PJBA 3H8EA 2QECA 3GB0A 3K9UA 1VHOA 3WABA 1F57A 3FVLA 4UWIA 5LRJA 4L89A 4CYOA 4Z65A 5J8FA 4KOWA 3I1UA 2Q43A 4OMEA 2VXKA 2FVGA 3DR8A 1JQGA 2FE7A 3BI1A 2PSWA 1BO4A 3SI1A 4B13A 2QIRA 3EC4A 4MCPA 2V8GA 4OC3A 1P4NA 4MHDA 2ZOGA 4NSQA 1I12A 1YK3A 2OZGA 1Q2DA 4CGMA 3VWDA 2G3TA 5JM6A 3N7ZA 3FYNA 3H4QA 3IFEA 4KVXA 4H6UA 4CAEA 4KVOE 1KUYA 3WC6A 4A37A 1K4JA 4ONWA 1XEBA 3NE8A 4R8FA 4XPDB 2JDDA 1QSMA 2FCKA 4PXEA 4E8OA 2DXQA 1TKJA 1Q7LA 1VIXA 4MFPA 4CYQA 2PQ8A 5IB0A 1TF9A 1XF8A 5F47A 3NH4A 4P6YA 3HLPA 3KL9A 5AG5A 3W6SA 4BD9A 2C6PA 3IWGA 1BLLE 2F5IA 2PJAA 2BO9A 5A28A 2Z3PA 3B3VA 4F6AA 1CG2A 1UFHA 1J4JA 2G3AA 2Q04A 2Z11A 5LRGA 1Z4EA 4FBEA 1IU8A 2PRBA 1HEEA 2PJ6A 3D2MA 3KR5A 4MCRA 5I4MA 5JH9A 2B4DB 4MCQA 3TTHA 1YVOA 4AG9A 2R8VA 4R76A 2HC9A 4KLVA 4EMEA 3MGDA 4CRZB 4ZX8A 1LAPA 1I1DA 1YR0A 3B3WA 5LRKA 3WR7A 2POKA 4AVBA 4TWEA 1XFOA 2EO8A 4MBUA 4OIWA 4R57A 3VWEA 1IYLA 2FIWA 3D7FA 2BSWA 3V7ZA 4B5PB 3GLJA 1CBXA 4UCPA 4ZY0A 2NYQA 1XIXA 4A30A 4LQ6A 2EWBA 3DNSA 4GS4A 5I0CA 1GYTA 5F49A 3JUWA 4AB7A 3C26A 3I3GA 4Q38A 4KOYA 4CGNA 3G3SA 1YSJA 4UF4A 5KTCA 2Z3MA 3PRTA 2PJ9A 2REEA 2ZEFA 1UWYA 4MY0A 3D7GA 3S6GA 2OU2A 3GY9A 5K8OA 4PPZA 4FAIA 1R57A 3D7DA 4H6ZA 3FECA 1ZG9A 4RS2A 4PK2A 4CPAA 3VATA 1GHEA 2PVWA 6CPAA 1ARLA 4NGRA 4F0XA 4B11A 4X3RA 1MK4A 3E0KA 4OKOA 5IV0A 3KQXA 2O4HA 3LWUA 1U6MA 3KASA 3ZJ0A 3VH9A 2DF5A 3S6HA 4AG7A 5K8MA 3SHPA 3B8GA 1XJOA 3TC8A 3IJ3A 1R3NA 1IIDA 2PCUA 3FMCA 3PB8X 4PSXA 4IHMA 3H5ZA 2FIAA 2PRQA 4FD4A 3PEIA 4NF1A 4JZ0A 4LQGA 1CPSA 3IU2A 4FD7A 3CPXA 4P45A 4B5PA 2P6GA 2RFHA 2RC4A 1S7FA 2GLFA 2WSAA 2Z10A 5DWMA 5A27A 1Z5RA 5LYFA 3B2YA 1A2ZA 1MJAA 3CT9A 3R1KA 2PJ5A 4YGOA 2Z3NA 4IAVA 2NSMA 2Q7BA 2XEFA 4CGLA 2B4DA 1YREA 4PXDA 1Y0YA 5AG6A 3R9EA 5AG4A 2XEJA 5JGFA 4LX9A 1ZG8A 3B7IA 4UEEA 3D66A 1TIQA 2IL4A 3F5BA 4R3KA 4NCZA 4RI1A 3W91A 3FF3A 4KOXA 2ABZA 2AFXA 3FJUA 4QC6A 2GLJA 2EBJA 3KKWA 3PGPA 4P4DA 2YGWA 4U9ZA 2R1IA 2ZW5A 4MFJA 5F46A 3IWWA 3PZJA 4DYOA 4EWTA 4NEXA 2FS5A 4NGPA 2GU2A 1QSOA 3MRUA 3R9GA 5HVGA 1QQ9A 1JWQA 2DPSA 5JPHA 1M4DA 4C2YA 3PB9X 2JEWA 4JWPA 1HDQA 1V0CA 4EVYA 4PSWA 2FSRA 3P2HA 3IGRA 1P0HA 4OIDA 1TKFA 4RN7A 1S7LA 2WYRA 4G1PA 4PXBA 2PR8A 2OOTA 1QSNA 1XOVA 3KQZA 4KVME 2REFA 2YNCA 4KLWA 4BINA 3JRUA 5G1ZA 1Z9UA 5C88A 1M4LA 3KZWA 2EK8A 4C2ZA 3IO1A 3FNCA 3CPAA 2GREA 2PR1A 2CY2A 2QJ8A 2V77A 2CTBA 3CDXA 2Y0MA 2WZNA 4B12A 4MHPA 3QAHA 3R96A 4IK2A 3RNZA 1X12A 3FX6A 4KOSA 4RUHA 4MHNA 2QYVA 2EVNA 2B3VA 5J1QA 2PE3A 2R7HA 1TF8A 1YLEA 3TE4A 3RBUA 4H2KA 4KOVA 4MXUA 1Z2LA 4NGMA 3EO4A 1DE4C 3W6XA 4GM5A 2VI7A 2RB7A 3IU1A 4IUSA 2AFSA 4M3SA 4M6IA 1MJ9A 2ZW7A 1VKCA 3PB7X 2PJ4A 4XNHB 1XMTA 2P0WA 2I3CA 5BWAB 2JBKA 2AFWA 2BUEA 3LD2A 4IF5A 5DS0A 2AFOA 5THWA 4BBHA 3BJ8A 4A33A 4H89A 2YNCC 1YGHA 2FL4A 2Q4ZA 3GYAA 1IICA 2F8HA 4P44A 3SI0A 2K5TA 4W9YA 1RO5A 2V8HA 2PIZA 3PB6X 4CGPA 4DNCA 4AXVA 1Y9KA 4QBJA 4OADA 2FXFA 4C68A 4PV6A 4XPLA 5AG7A 3RO0A 4XPDC 4KOTA 3S9MA 5KTDA 1VGYA 2PJ0A 3NA6A 3TX8A 2ANPA 5E96A 5HVHA 1Q2CA 1YX0A 2IQ6A 4OAEA 2WPXA 2PIYA 1PUAA 3IWEA 1QSRA 4MMOA 3V38A 1PYTB 5HMNA 4KORA 4UA3A 4YU9A 1IOFA 2BCOA 4A38A 4PQAA 1AMPA 1BAVA 4MY3A 1YMEA 2I00A 3N5FA 5LYDA 3SI2A 2J8MA 2Q7SA 5J8CA 3D3SA 1AUGA 5JQ4A 2ZEMA 1WWZA 2D4OA 2V8DA 1ON0A 2G9DA 1YLOA 4P10A 3RYOA 1ZO0A 4YWYA 2F7VA 4P4JA 2HQYA 2ZW6A 5EBVA 4UIAA 4DUKA 2O53A 2PJ1A 2DEAA 5ISVA 4LUAA 4K3NA 3B3SA 3FH4A 2B5GB 4NGSA 4NJRA 3QAYA 2IMOA 1WK4A 4QUSA 4ZYQA 3TOAA 5HH1A 3IEHA 2ZELA 1LOKA 2J8NA 4CAFA 3CXPA 5K8PA 3F8KA 2Z3KA 2PJ3A 2XEIA 1CJWA 3TT2A 1M4IA 4C7IA 4A32A 4JXQA 4II9A 3FRMA 4Q7AA 1S60A 4NXYA 3V8IA 4ZY1A 4OC0A 2I79A 1FNOA 5DWNA 3LODA 2Q44A 2A4NA 2AE6A 3R9FA 2HV2A 4P4BA 4R9MA 1NSLA 4JXRA 1QSTA 2ZEHA 4PXCA 1ELLP 3A9LA 4CYPA 1Q2YA 1XMBA 1M44A 4MFQA 4R87A 3B35A 3PFEA 1Z8WA 1XBUA 2D4PA 2OZHA 3WC7A 1HDUA 3DDDA 5CBMA 2DPTA 4KS9A 1RTQA 3QB8A 4MFLA 4P4IA 3DLJA 1YQEA 4AVCA 5K8NA 2BL1A 2WUUA 3BI0A 2HB6A 4MHZA 3K2KA 2H5MA 3NFZA 4C7HA 3NE7A 3JVNA 2JEVA 2YNEA 4UFWA 4B10A 1BPNA 1S7KA 4ZI6A 2GE3A 5C82A 1IB1E 4ORFA 3SJGA 1OZPA 2P6FA 4JJXA 5LYIA 3D8PA 1B87A 2BOAA 1TXRA 4FD5A 3SJEA 4NGNA 8CPAA 2KCWA 1VHSA 3CXQA 3BHXA 4HKFA 2B4BA 1LFWA 2B58A 4MCSA 1Y0RA 2ZEEA 4KSFA 3EXNA 4ZGYB 1KUXA 4NGQA 2BEIA 3P2FA 5G21A 4A2ZA 3BLNA 5H86A 4M6HA 1FT7A 4OP4A 2ZENA 4JD6A 4F0YA 2X7BA 4CAWA 1R43A 3WT4A 2C6CA 3T9YA 3D2PA 3WC5A 1BOBA 4KZTA 1IY7A 1Z8TA 3TFYA 5ELYA 2OB0A 4A39A 1LRZA 3LACA 1YW4A 1NMTA 3KR4A 1IOIA 2VZYA 3NH8A 4ZX9A 5HXDA 4FWUA 4F9VA 2AFUA 4MI4A 1S5KA 4CS0B 3VARA 1CP7A 3MN8A 5CNPA 4A95A 5H84A 4HPSA 2PVVA 3T90A 3FEEA
chains in the Genus database with same CATH topology
1IYKA 2CNSA 2Q4YA 2J8RA 1N71A 4PK3A 1Z4RA 4J3GA 1I21A 4UFXA 3S6KA 1L0CA 4K30A 3BJ7A 4UCNA 3S6FA 3FXTA 1MJBA 3TCVA 2JLMA 3TO9A 3UY5A 5FVJA 3SXNA 3TO6A 2Q0YA 4ONUA 3JTKA 4UWJA 5F48A 4UBRA 3PP9A 4UFVA 4A31A 4FD6A 2ATRA 4QB9A 4B5OA 4OLLA 1RXTA 4E0AA 3TOBA 4M85A 2B3UA 2GIVA 2B5GA 4MJ8A 3G8WA 1S7NA 4XNHC 4YRHA 1Y7RA 2VEZA 1KUVA 2C27A 4KUAA 5AGEA 2VQYA 2WPWA 2ZW4A 3GKRA 2QMLA 1NE9A 4CAVA 3FIXA 4XPKA 1FY7A 2GANA 4CYNA 2ZXVA 2R98A 2Z3OA 4ZBGA 2HUZA 2NMTA 2VZZA 4L8AA 2O28A 4U5YA 2CXAA 4X5KA 4YFJA 4KSAA 1S3ZA 1XE4A 3DR6A 4AVAA 2CNTA 4UCMA 3TO7A 3OWCA 4MFKA 1M1DA 2FT0A 4HNXB 3EY5A 4R3LA 4CGOA 1Y9WA 1CM0A 5GCNA 3FBUA 2G0BA 3FB3A 2OZUA 2Z0ZA 5KTAA 2ZPAA 4KOUA 2YNDA 4Y49B 4U9YA 4BMHA 4CRYB 4Q36A 1SQHA 3ZZIA 4MFZA 2VBQA 4I49A 3SXOA 3CXSA 4E2AA 2Z3LA 1PU9A 4C2XA 3R95A 2PDOA 5IX3A 4QVTA 1KZFA 4JLYA 2EUIA 1M4GA 4Y49C 2OH1A 5EC4A 2ARHA 3DSBA 2JDCA 2CNMA 5G22A 4CAXA 2Q4VA 2AJ6A 3I9SA 1YVKA 4KUBA 2P6EA 2PC1A 3F0AA 4HNWB 3EFAA 4HNYB 1B6BA 4B14A 5G20A 2QECA 3K9UA 4UWIA 4CYOA 5J8FA 4L89A 4KOWA 2VXKA 3DR8A 2FE7A 2PSWA 1BO4A 4B13A 2QIRA 3EC4A 1P4NA 4MHDA 4NSQA 1I12A 1YK3A 2OZGA 1Q2DA 4CGMA 3VWDA 2G3TA 3N7ZA 3FYNA 3H4QA 4KVXA 4H6UA 4CAEA 4KVOE 1KUYA 1K4JA 1XEBA 4XPDB 2JDDA 1QSMA 2FCKA 4E8OA 2DXQA 4MFPA 4CYQA 2PQ8A 5IB0A 1XF8A 5F47A 5AG5A 3W6SA 3IWGA 2F5IA 5A28A 2Z3PA 4F6AA 1UFHA 2Q04A 1J4JA 2G3AA 2Z11A 1Z4EA 2PRBA 3D2MA 2B4DB 3TTHA 1YVOA 4AG9A 2R8VA 4KLVA 3MGDA 4CRZB 1I1DA 1YR0A 3WR7A 4AVBA 4R57A 4MBUA 3VWEA 1IYLA 2FIWA 4B5PB 2BSWA 4UCPA 1XIXA 4A30A 3DNSA 4GS4A 5I0CA 5F49A 3JUWA 4AB7A 3C26A 3I3GA 4Q38A 4KOYA 4CGNA 3G3SA 5KTCA 2Z3MA 2REEA 4MY0A 3S6GA 2OU2A 3GY9A 1R57A 4H6ZA 4RS2A 4PK2A 1GHEA 4F0XA 4B11A 1MK4A 3E0KA 5IV0A 3ZJ0A 1U6MA 4AG7A 3S6HA 3SHPA 3B8GA 1IIDA 4PSXA 3H5ZA 2FIAA 4FD4A 4NF1A 3IU2A 4FD7A 4B5PA 2P6GA 2RC4A 1S7FA 2WSAA 2Z10A 5DWMA 5A27A 1MJAA 3R1KA 4YGOA 2Z3NA 2Q7BA 4CGLA 2B4DA 1YREA 5AG6A 3R9EA 5AG4A 4LX9A 1TIQA 2IL4A 3F5BA 4R3KA 4NCZA 4RI1A 3W91A 4KOXA 4QC6A 3PGPA 3KKWA 2YGWA 4U9ZA 4MFJA 2R1IA 2ZW5A 5F46A 3PZJA 4NEXA 2FS5A 1QSOA 3R9GA 5JPHA 2DPSA 1M4DA 4C2YA 4JWPA 1V0CA 4EVYA 4PSWA 2FSRA 3P2HA 3IGRA 1P0HA 1S7LA 2PR8A 1QSNA 4KVME 2REFA 2YNCA 4KLWA 5G1ZA 5C88A 1Z9UA 4C2ZA 3FNCA 2PR1A 2CY2A 4B12A 2Y0MA 3QAHA 3R96A 4KOSA 2EVNA 2B3VA 2R7HA 1YLEA 3TE4A 4KOVA 3EO4A 3W6XA 2VI7A 3IU1A 4IUSA 4M3SA 1MJ9A 2ZW7A 1VKCA 4XNHB 1XMTA 2P0WA 5BWAB 2BUEA 3LD2A 4IF5A 4BBHA 3BJ8A 4A33A 4H89A 2YNCC 1YGHA 2FL4A 3GYAA 1IICA 2K5TA 1RO5A 4CGPA 4DNCA 1Y9KA 4QBJA 4OADA 2FXFA 4C68A 4PV6A 4XPLA 5AG7A 4XPDC 4KOTA 5KTDA 5E96A 1Q2CA 1YX0A 4OAEA 2WPXA 3IWEA 1PUAA 5HMNA 1QSRA 4KORA 4UA3A 4MY3A 2I00A 2J8MA 5J8CA 3D3SA 5JQ4A 1WWZA 2D4OA 1ON0A 3RYOA 1ZO0A 2HQYA 2ZW6A 5EBVA 5ISVA 4LUAA 2B5GB 4QUSA 1WK4A 3TOAA 5HH1A 4CAFA 2J8NA 3CXPA 3F8KA 2Z3KA 1CJWA 3TT2A 1M4IA 4C7IA 4A32A 4JXQA 4II9A 3FRMA 1S60A 4NXYA 3V8IA 2I79A 5DWNA 3LODA 2Q44A 2A4NA 2AE6A 3R9FA 2HV2A 4R9MA 1NSLA 4JXRA 1QSTA 3A9LA 4CYPA 1Q2YA 4MFQA 1M44A 4R87A 2D4PA 2OZHA 3DDDA 2DPTA 4KS9A 3QB8A 4MFLA 4AVCA 2BL1A 2WUUA 2H5MA 4C7HA 3NE7A 3JVNA 2JEVA 2YNEA 4UFWA 4B10A 1S7KA 2GE3A 5C82A 1IB1E 4ORFA 1OZPA 2P6FA 4JJXA 3D8PA 1B87A 4FD5A 2KCWA 1VHSA 3CXQA 4HKFA 2B4BA 2B58A 4ZGYB 4KSFA 3EXNA 1KUXA 5G21A 2BEIA 3P2FA 4A2ZA 3BLNA 5H86A 4JD6A 4F0YA 2X7BA 4CAWA 3T9YA 3D2PA 1BOBA 4KZTA 3TFYA 2OB0A 1LRZA 1NMTA 2VZYA 4MI4A 1S5KA 4CS0B 4A95A 5CNPA 5H84A 3T90A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IYK A;  2CNS A;  2Q4Y A;  2J8R A;  1N71 A;  4PK3 A;  1Z4R A;  4J3G A;  1I21 A;  3S6K A;  1L0C A;  4K30 A;  3BJ7 A;  3S6F A;  3FXT A;  1MJB A;  3TCV A;  2JLM A;  3TO9 A;  3UY5 A;  5FVJ A;  3SXN A;  3TO6 A;  2Q0Y A;  4ONU A;  4UWJ A;  5F48 A;  4UBR A;  3PP9 A;  4FD6 A;  2ATR A;  4QB9 A;  4B5O A;  4OLL A;  1RXT A;  4E0A A;  3TOB A;  4M85 A;  2B3U A;  2GIV A;  2B5G A;  4MJ8 A;  3G8W A;  1S7N A;  4XNH C;  4YRH A;  1Y7R A;  2VEZ A;  1KUV A;  2C27 A;  4KUA A;  2VQY A;  2WPW A;  2ZW4 A;  3GKR A;  2QML A;  1NE9 A;  4CAV A;  3FIX A;  4XPK A;  1FY7 A;  2GAN A;  2ZXV A;  2R98 A;  4ZBG A;  2HUZ A;  2NMT A;  2VZZ A;  4L8A A;  2O28 A;  4U5Y A;  4X5K A;  4YFJ A;  1S3Z A;  1XE4 A;  3DR6 A;  4AVA A;  2CNT A;  3TO7 A;  3OWC A;  4R3L A;  1M1D A;  2FT0 A;  3EY5 A;  4HNX B;  1Y9W A;  1CM0 A;  5GCN A;  3FBU A;  2G0B A;  3FB3 A;  2OZU A;  2Z0Z A;  5KTA A;  2ZPA A;  4KOU A;  4Y49 B;  4U9Y A;  4BMH A;  4CRY B;  1SQH A;  3ZZI A;  2VBQ A;  4I49 A;  3SXO A;  3CXS A;  4E2A A;  1PU9 A;  3R95 A;  2PDO A;  5IX3 A;  4QVT A;  1KZF A;  4JLY A;  2EUI A;  1M4G A;  4Y49 C;  2OH1 A;  5EC4 A;  2ARH A;  3DSB A;  2JDC A;  2CNM A;  4CAX A;  2Q4V A;  2AJ6 A;  3I9S A;  1YVK A;  4KUB A;  2P6E A;  2PC1 A;  3F0A A;  4HNW B;  3EFA A;  4HNY B;  1B6B A;  2QEC A;  3K9U A;  4UWI A;  5J8F A;  4L89 A;  4KOW A;  2VXK A;  3DR8 A;  2FE7 A;  2PSW A;  1BO4 A;  2QIR A;  3EC4 A;  1P4N A;  4MHD A;  4NSQ A;  1I12 A;  1YK3 A;  2OZG A;  1Q2D A;  3VWD A;  2G3T A;  3N7Z A;  3FYN A;  3H4Q A;  4KVX A;  4H6U A;  4KVO E;  1KUY A;  1K4J A;  1XEB A;  4XPD B;  2JDD A;  1QSM A;  2FCK A;  4E8O A;  2DXQ A;  2PQ8 A;  5IB0 A;  1XF8 A;  5F47 A;  3W6S A;  3IWG A;  2F5I A;  4F6A A;  1UFH A;  2Q04 A;  1J4J A;  2G3A A;  2Z11 A;  1Z4E A;  2PRB A;  3D2M A;  2B4D B;  3TTH A;  1YVO A;  4AG9 A;  2R8V A;  4KLV A;  3MGD A;  4CRZ B;  1I1D A;  1YR0 A;  3WR7 A;  4AVB A;  4R57 A;  4MBU A;  3VWE A;  1IYL A;  2FIW A;  4B5P B;  2BSW A;  1XIX A;  3DNS A;  4GS4 A;  5I0C A;  5F49 A;  3JUW A;  4AB7 A;  3C26 A;  3I3G A;  4KOY A;  3G3S A;  5KTC A;  2REE A;  4MY0 A;  3S6G A;  2OU2 A;  3GY9 A;  1R57 A;  4H6Z A;  4RS2 A;  4PK2 A;  1GHE A;  1MK4 A;  3E0K A;  5IV0 A;  3ZJ0 A;  1U6M A;  4AG7 A;  3S6H A;  3SHP A;  3B8G A;  1IID A;  4PSX A;  2FIA A;  4FD4 A;  4NF1 A;  4FD7 A;  4B5P A;  2P6G A;  2RC4 A;  1S7F A;  2Z10 A;  5DWM A;  1MJA A;  3R1K A;  4YGO A;  2Q7B A;  2B4D A;  1YRE A;  3R9E A;  4LX9 A;  4R3K A;  1TIQ A;  2IL4 A;  3F5B A;  4NCZ A;  4RI1 A;  3W91 A;  4KOX A;  4QC6 A;  3PGP A;  3KKW A;  4U9Z A;  2R1I A;  2ZW5 A;  5F46 A;  3PZJ A;  4NEX A;  2FS5 A;  1QSO A;  3R9G A;  5JPH A;  1M4D A;  4JWP A;  1V0C A;  4EVY A;  4PSW A;  2FSR A;  3P2H A;  3IGR A;  1P0H A;  1S7L A;  2PR8 A;  1QSN A;  4KVM E;  2REF A;  4KLW A;  5C88 A;  1Z9U A;  3FNC A;  2PR1 A;  2CY2 A;  2Y0M A;  3QAH A;  3R96 A;  4KOS A;  2EVN A;  2B3V A;  2R7H A;  1YLE A;  3TE4 A;  4KOV A;  3EO4 A;  3W6X A;  2VI7 A;  4IUS A;  4M3S A;  1MJ9 A;  2ZW7 A;  1VKC A;  4XNH B;  1XMT A;  2P0W A;  2BUE A;  3LD2 A;  4IF5 A;  3BJ8 A;  4H89 A;  1YGH A;  2FL4 A;  3GYA A;  1IIC A;  2K5T A;  1RO5 A;  4DNC A;  1Y9K A;  4QBJ A;  4OAD A;  2FXF A;  4PV6 A;  4XPL A;  4XPD C;  4KOT A;  5KTD A;  5E96 A;  1Q2C A;  1YX0 A;  4OAE A;  2WPX A;  1PUA A;  5HMN A;  1QSR A;  4KOR A;  4UA3 A;  4MY3 A;  2I00 A;  2J8M A;  5J8C A;  3D3S A;  5JQ4 A;  1WWZ A;  2D4O A;  1ON0 A;  3RYO A;  2HQY A;  2ZW6 A;  5EBV A;  5ISV A;  4LUA A;  2B5G B;  4QUS A;  1WK4 A;  3TOA A;  5HH1 A;  2J8N A;  3CXP A;  3F8K A;  1CJW A;  3TT2 A;  1M4I A;  4JXQ A;  4II9 A;  3FRM A;  1S60 A;  4NXY A;  3V8I A;  2I79 A;  5DWN A;  3LOD A;  2Q44 A;  2A4N A;  2AE6 A;  3R9F A;  2HV2 A;  4R9M A;  1NSL A;  4JXR A;  1QST A;  1Q2Y A;  4R87 A;  1M44 A;  2D4P A;  2OZH A;  3DDD A;  3QB8 A;  4AVC A;  2BL1 A;  2H5M A;  3NE7 A;  3JVN A;  2JEV A;  1S7K A;  2GE3 A;  5C82 A;  1IB1 E;  4ORF A;  1OZP A;  2P6F A;  4JJX A;  3D8P A;  1B87 A;  4FD5 A;  2KCW A;  1VHS A;  3CXQ A;  4HKF A;  2B4B A;  2B58 A;  3EXN A;  1KUX A;  2BEI A;  3P2F A;  3BLN A;  5H86 A;  4JD6 A;  4F0Y A;  2X7B A;  4CAW A;  3T9Y A;  3D2P A;  1BOB A;  4KZT A;  3TFY A;  2OB0 A;  1LRZ A;  1NMT A;  2VZY A;  4MI4 A;  1S5K A;  4CS0 B;  5CNP A;  5H84 A;  3T90 A; 
#chains in the Genus database with same CATH topology
 1IYK A;  2CNS A;  2Q4Y A;  3CZX A;  3IC1 A;  1F2P A;  1X10 A;  2J8R A;  1N71 A;  1DTD A;  5D29 A;  4PK3 A;  1Z4R A;  4J3G A;  1I21 A;  4UFX A;  2AFZ A;  2Q51 A;  4OC5 A;  3S6K A;  1L0C A;  4K30 A;  3BJ7 A;  4UCN A;  3S6F A;  1YW6 A;  3FXT A;  3NH5 A;  1MJB A;  3TCV A;  3KHX A;  2JLM A;  3TO9 A;  3UY5 A;  5FVJ A;  5F09 A;  3SXN A;  3TO6 A;  3BXM A;  2J9A A;  4NJQ A;  2Q0Y A;  1ARM A;  4ONU A;  3JTK A;  4UWJ A;  3PFO A;  5F48 A;  4R6T A;  4TNU A;  4UBR A;  3PP9 A;  4UFV A;  4A31 A;  4FD6 A;  1ZLI A;  1ZLH A;  2ATR A;  2ZOF A;  2C6G A;  3KHZ A;  4UIB A;  5LYL A;  4QB9 A;  1AYE A;  4OLL A;  1RXT A;  4B5O A;  3TOB A;  4E0A A;  4M85 A;  2B3U A;  2GIV A;  1QMU A;  2B5G A;  4MJ8 A;  3G8W A;  1LCP A;  1S7N A;  4XNH C;  4YRH A;  3KI9 A;  1Y7R A;  4KSI A;  2VEZ A;  3D68 A;  4OC1 A;  1KUV A;  3GUX A;  1CP6 A;  2C27 A;  2ZEO A;  4KUA A;  5AGE A;  2VQY A;  2WPW A;  2ZW4 A;  3PB4 X;  3GKR A;  2QML A;  3DGV A;  1NE9 A;  3RAM A;  3D4U A;  3PBB A;  4NGT A;  4CAV A;  3FIX A;  4XPK A;  4P4E A;  1FY7 A;  2GAN A;  3H8F A;  1Z8X A;  2ZXV A;  3ISX A;  5CPA A;  2R98 A;  3B3T A;  2Z3O A;  4EFD A;  4ZBG A;  4CYN A;  2HUZ A;  4MHY A;  2NMT A;  2VZZ A;  4L8A A;  3GIU A;  2PJC A;  2O28 A;  4U5Y A;  2CXA A;  1CX8 A;  4X5K A;  1PCA A;  3FED A;  2CTC A;  2V8V A;  4KSA A;  4YFJ A;  1CPX A;  1S3Z A;  1XE4 A;  3DR6 A;  1BPM A;  4M6G A;  2VL1 A;  4AVA A;  2CNT A;  4UCM A;  1LAN A;  1Z8L A;  3D67 A;  3TO7 A;  2PJ2 A;  3OWC A;  4UEZ A;  4MFK A;  3SJX A;  1M1D A;  2FT0 A;  3IIB A;  3EY5 A;  4HNX B;  4R3L A;  4X2T A;  4CGO A;  1Y9W A;  5D8N A;  3D7H A;  1CM0 A;  3K9T A;  5GCN A;  2IJZ A;  4DJL A;  1Y7E A;  3FBU A;  2G0B A;  3SJF A;  3FB3 A;  2OZU A;  2Z0Z A;  3B3C A;  4OC4 A;  4A94 A;  5KTA A;  5EMI A;  4FUU A;  2ZPA A;  4KOU A;  2YND A;  2ZEP A;  1LAM A;  2EK9 A;  4P4F A;  4Y49 B;  4WJB A;  4ZY2 A;  4UEF A;  4U9Y A;  2PJ7 A;  4BMH A;  2C1C A;  4CRY B;  2OR4 A;  3QNV A;  4Q36 A;  3HUV A;  4F9U A;  1SQH A;  3ZZI A;  4MFZ A;  2GFQ A;  1XRY A;  3PBE A;  2VBQ A;  2CF4 A;  1VHE A;  2XEG A;  4I49 A;  3SXO A;  3CXS A;  3T8W A;  4E2A A;  3ISZ A;  3H8G A;  2ODF A;  1ELM P;  4O23 A;  4B6Z A;  2Z3L A;  1PU9 A;  5HVF A;  2QVP A;  4C2X A;  3R95 A;  3LMS A;  2JBJ A;  2PDO A;  5IX3 A;  3KGQ A;  4QVT A;  1KZF A;  4JLY A;  2EUI A;  1H8L A;  1M4G A;  4Y49 C;  2OH1 A;  5EC4 A;  4WWV A;  2ARH A;  3DSB A;  2JDC A;  2ZEG A;  2CNM A;  4R7M A;  3L2N A;  5G22 A;  4NFR A;  4CAX A;  4JYW A;  1F2O A;  2Q4V A;  4MRI A;  4F8Z A;  2AJ6 A;  3I9S A;  3S9L A;  1YVK A;  4KUB A;  2P6E A;  5IB9 A;  2PC1 A;  1ZG7 A;  3F0A A;  2AFM A;  2ZED A;  1TKH A;  4HNW B;  3EFA A;  2CIJ A;  4X8I A;  4GXH A;  4HNY B;  1KWM A;  2PJ8 A;  3RZA A;  7CPA A;  1B6B A;  1IGB A;  4B14 A;  1OBR A;  3S9N A;  1NSA A;  4OC2 A;  5G20 A;  1EE3 P;  2PJB A;  3H8E A;  2QEC A;  3GB0 A;  3K9U A;  1VHO A;  3WAB A;  1F57 A;  3FVL A;  4UWI A;  5LRJ A;  4L89 A;  4CYO A;  4Z65 A;  5J8F A;  4KOW A;  3I1U A;  2Q43 A;  4OME A;  2VXK A;  2FVG A;  3DR8 A;  1JQG A;  2FE7 A;  3BI1 A;  2PSW A;  1BO4 A;  3SI1 A;  4B13 A;  2QIR A;  3EC4 A;  4MCP A;  2V8G A;  4OC3 A;  1P4N A;  4MHD A;  2ZOG A;  4NSQ A;  1I12 A;  1YK3 A;  2OZG A;  1Q2D A;  4CGM A;  3VWD A;  2G3T A;  5JM6 A;  3N7Z A;  3FYN A;  3H4Q A;  3IFE A;  4KVX A;  4H6U A;  4CAE A;  4KVO E;  1KUY A;  3WC6 A;  4A37 A;  1K4J A;  4ONW A;  1XEB A;  3NE8 A;  4R8F A;  4XPD B;  2JDD A;  1QSM A;  2FCK A;  4PXE A;  4E8O A;  2DXQ A;  1TKJ A;  1Q7L A;  1VIX A;  4MFP A;  4CYQ A;  2PQ8 A;  5IB0 A;  1TF9 A;  1XF8 A;  5F47 A;  3NH4 A;  4P6Y A;  3HLP A;  3KL9 A;  5AG5 A;  3W6S A;  4BD9 A;  2C6P A;  3IWG A;  1BLL E;  2F5I A;  2PJA A;  2BO9 A;  5A28 A;  2Z3P A;  3B3V A;  4F6A A;  1CG2 A;  1UFH A;  1J4J A;  2G3A A;  2Q04 A;  2Z11 A;  5LRG A;  1Z4E A;  4FBE A;  1IU8 A;  2PRB A;  1HEE A;  2PJ6 A;  3D2M A;  3KR5 A;  4MCR A;  5I4M A;  5JH9 A;  2B4D B;  4MCQ A;  3TTH A;  1YVO A;  4AG9 A;  2R8V A;  4R76 A;  2HC9 A;  4KLV A;  4EME A;  3MGD A;  4CRZ B;  4ZX8 A;  1LAP A;  1I1D A;  1YR0 A;  3B3W A;  5LRK A;  3WR7 A;  2POK A;  4AVB A;  4TWE A;  1XFO A;  2EO8 A;  4MBU A;  4OIW A;  4R57 A;  3VWE A;  1IYL A;  2FIW A;  3D7F A;  2BSW A;  3V7Z A;  4B5P B;  3GLJ A;  1CBX A;  4UCP A;  4ZY0 A;  2NYQ A;  1XIX A;  4A30 A;  4LQ6 A;  2EWB A;  3DNS A;  4GS4 A;  5I0C A;  1GYT A;  5F49 A;  3JUW A;  4AB7 A;  3C26 A;  3I3G A;  4Q38 A;  4KOY A;  4CGN A;  3G3S A;  1YSJ A;  4UF4 A;  5KTC A;  2Z3M A;  3PRT A;  2PJ9 A;  2REE A;  2ZEF A;  1UWY A;  4MY0 A;  3D7G A;  3S6G A;  2OU2 A;  3GY9 A;  5K8O A;  4PPZ A;  4FAI A;  1R57 A;  3D7D A;  4H6Z A;  3FEC A;  1ZG9 A;  4RS2 A;  4PK2 A;  4CPA A;  3VAT A;  1GHE A;  2PVW A;  6CPA A;  1ARL A;  4NGR A;  4F0X A;  4B11 A;  4X3R A;  1MK4 A;  3E0K A;  4OKO A;  5IV0 A;  3KQX A;  2O4H A;  3LWU A;  1U6M A;  3KAS A;  3ZJ0 A;  3VH9 A;  2DF5 A;  3S6H A;  4AG7 A;  5K8M A;  3SHP A;  3B8G A;  1XJO A;  3TC8 A;  3IJ3 A;  1R3N A;  1IID A;  2PCU A;  3FMC A;  3PB8 X;  4PSX A;  4IHM A;  3H5Z A;  2FIA A;  2PRQ A;  4FD4 A;  3PEI A;  4NF1 A;  4JZ0 A;  4LQG A;  1CPS A;  3IU2 A;  4FD7 A;  3CPX A;  4P45 A;  4B5P A;  2P6G A;  2RFH A;  2RC4 A;  1S7F A;  2GLF A;  2WSA A;  2Z10 A;  5DWM A;  5A27 A;  1Z5R A;  5LYF A;  3B2Y A;  1A2Z A;  1MJA A;  3CT9 A;  3R1K A;  2PJ5 A;  4YGO A;  2Z3N A;  4IAV A;  2NSM A;  2Q7B A;  2XEF A;  4CGL A;  2B4D A;  1YRE A;  4PXD A;  1Y0Y A;  5AG6 A;  3R9E A;  5AG4 A;  2XEJ A;  5JGF A;  4LX9 A;  1ZG8 A;  3B7I A;  4UEE A;  3D66 A;  1TIQ A;  2IL4 A;  3F5B A;  4R3K A;  4NCZ A;  4RI1 A;  3W91 A;  3FF3 A;  4KOX A;  2ABZ A;  2AFX A;  3FJU A;  4QC6 A;  2GLJ A;  2EBJ A;  3KKW A;  3PGP A;  4P4D A;  2YGW A;  4U9Z A;  2R1I A;  2ZW5 A;  4MFJ A;  5F46 A;  3IWW A;  3PZJ A;  4DYO A;  4EWT A;  4NEX A;  2FS5 A;  4NGP A;  2GU2 A;  1QSO A;  3MRU A;  3R9G A;  5HVG A;  1QQ9 A;  1JWQ A;  2DPS A;  5JPH A;  1M4D A;  4C2Y A;  3PB9 X;  2JEW A;  4JWP A;  1HDQ A;  1V0C A;  4EVY A;  4PSW A;  2FSR A;  3P2H A;  3IGR A;  1P0H A;  4OID A;  1TKF A;  4RN7 A;  1S7L A;  2WYR A;  4G1P A;  4PXB A;  2PR8 A;  2OOT A;  1QSN A;  1XOV A;  3KQZ A;  4KVM E;  2REF A;  2YNC A;  4KLW A;  4BIN A;  3JRU A;  5G1Z A;  1Z9U A;  5C88 A;  1M4L A;  3KZW A;  2EK8 A;  4C2Z A;  3IO1 A;  3FNC A;  3CPA A;  2GRE A;  2PR1 A;  2CY2 A;  2QJ8 A;  2V77 A;  2CTB A;  3CDX A;  2Y0M A;  2WZN A;  4B12 A;  4MHP A;  3QAH A;  3R96 A;  4IK2 A;  3RNZ A;  1X12 A;  3FX6 A;  4KOS A;  4RUH A;  4MHN A;  2QYV A;  2EVN A;  2B3V A;  5J1Q A;  2PE3 A;  2R7H A;  1TF8 A;  1YLE A;  3TE4 A;  3RBU A;  4H2K A;  4KOV A;  4MXU A;  1Z2L A;  4NGM A;  3EO4 A;  1DE4 C;  3W6X A;  4GM5 A;  2VI7 A;  2RB7 A;  3IU1 A;  4IUS A;  2AFS A;  4M3S A;  4M6I A;  1MJ9 A;  2ZW7 A;  1VKC A;  3PB7 X;  2PJ4 A;  4XNH B;  1XMT A;  2P0W A;  2I3C A;  5BWA B;  2JBK A;  2AFW A;  2BUE A;  3LD2 A;  4IF5 A;  5DS0 A;  2AFO A;  5THW A;  4BBH A;  3BJ8 A;  4A33 A;  4H89 A;  2YNC C;  1YGH A;  2FL4 A;  2Q4Z A;  3GYA A;  1IIC A;  2F8H A;  4P44 A;  3SI0 A;  2K5T A;  4W9Y A;  1RO5 A;  2V8H A;  2PIZ A;  3PB6 X;  4CGP A;  4DNC A;  4AXV A;  1Y9K A;  4QBJ A;  4OAD A;  2FXF A;  4C68 A;  4PV6 A;  4XPL A;  5AG7 A;  3RO0 A;  4XPD C;  4KOT A;  3S9M A;  5KTD A;  1VGY A;  2PJ0 A;  3NA6 A;  3TX8 A;  2ANP A;  5E96 A;  5HVH A;  1Q2C A;  1YX0 A;  2IQ6 A;  4OAE A;  2WPX A;  2PIY A;  1PUA A;  3IWE A;  1QSR A;  4MMO A;  3V38 A;  1PYT B;  5HMN A;  4KOR A;  4UA3 A;  4YU9 A;  1IOF A;  2BCO A;  4A38 A;  4PQA A;  1AMP A;  1BAV A;  4MY3 A;  1YME A;  2I00 A;  3N5F A;  5LYD A;  3SI2 A;  2J8M A;  2Q7S A;  5J8C A;  3D3S A;  1AUG A;  5JQ4 A;  2ZEM A;  1WWZ A;  2D4O A;  2V8D A;  1ON0 A;  2G9D A;  1YLO A;  4P10 A;  3RYO A;  1ZO0 A;  4YWY A;  2F7V A;  4P4J A;  2HQY A;  2ZW6 A;  5EBV A;  4UIA A;  4DUK A;  2O53 A;  2PJ1 A;  2DEA A;  5ISV A;  4LUA A;  4K3N A;  3B3S A;  3FH4 A;  2B5G B;  4NGS A;  4NJR A;  3QAY A;  2IMO A;  1WK4 A;  4QUS A;  4ZYQ A;  3TOA A;  5HH1 A;  3IEH A;  2ZEL A;  1LOK A;  2J8N A;  4CAF A;  3CXP A;  5K8P A;  3F8K A;  2Z3K A;  2PJ3 A;  2XEI A;  1CJW A;  3TT2 A;  1M4I A;  4C7I A;  4A32 A;  4JXQ A;  4II9 A;  3FRM A;  4Q7A A;  1S60 A;  4NXY A;  3V8I A;  4ZY1 A;  4OC0 A;  2I79 A;  1FNO A;  5DWN A;  3LOD A;  2Q44 A;  2A4N A;  2AE6 A;  3R9F A;  2HV2 A;  4P4B A;  4R9M A;  1NSL A;  4JXR A;  1QST A;  2ZEH A;  4PXC A;  1ELL P;  3A9L A;  4CYP A;  1Q2Y A;  1XMB A;  1M44 A;  4MFQ A;  4R87 A;  3B35 A;  3PFE A;  1Z8W A;  1XBU A;  2D4P A;  2OZH A;  3WC7 A;  1HDU A;  3DDD A;  5CBM A;  2DPT A;  4KS9 A;  1RTQ A;  3QB8 A;  4MFL A;  4P4I A;  3DLJ A;  1YQE A;  4AVC A;  5K8N A;  2BL1 A;  2WUU A;  3BI0 A;  2HB6 A;  4MHZ A;  3K2K A;  2H5M A;  3NFZ A;  4C7H A;  3NE7 A;  3JVN A;  2JEV A;  2YNE A;  4UFW A;  4B10 A;  1BPN A;  1S7K A;  4ZI6 A;  2GE3 A;  5C82 A;  1IB1 E;  4ORF A;  3SJG A;  1OZP A;  2P6F A;  4JJX A;  5LYI A;  3D8P A;  1B87 A;  2BOA A;  1TXR A;  4FD5 A;  3SJE A;  4NGN A;  8CPA A;  2KCW A;  1VHS A;  3CXQ A;  3BHX A;  4HKF A;  2B4B A;  1LFW A;  2B58 A;  4MCS A;  1Y0R A;  2ZEE A;  4KSF A;  3EXN A;  4ZGY B;  1KUX A;  4NGQ A;  2BEI A;  3P2F A;  5G21 A;  4A2Z A;  3BLN A;  5H86 A;  4M6H A;  1FT7 A;  4OP4 A;  2ZEN A;  4JD6 A;  4F0Y A;  2X7B A;  4CAW A;  1R43 A;  3WT4 A;  2C6C A;  3T9Y A;  3D2P A;  3WC5 A;  1BOB A;  4KZT A;  1IY7 A;  1Z8T A;  3TFY A;  5ELY A;  2OB0 A;  4A39 A;  1LRZ A;  3LAC A;  1YW4 A;  1NMT A;  3KR4 A;  1IOI A;  2VZY A;  3NH8 A;  4ZX9 A;  5HXD A;  4FWU A;  4F9V A;  2AFU A;  4MI4 A;  1S5K A;  4CS0 B;  3VAR A;  1CP7 A;  3MN8 A;  5CNP A;  4A95 A;  5H84 A;  4HPS A;  2PVV A;  3T90 A;  3FEE A; 
#chains in the Genus database with same CATH homology
 1IYK A;  2CNS A;  2Q4Y A;  2J8R A;  1N71 A;  4PK3 A;  1Z4R A;  4J3G A;  1I21 A;  4UFX A;  3S6K A;  1L0C A;  4K30 A;  3BJ7 A;  4UCN A;  3S6F A;  3FXT A;  1MJB A;  3TCV A;  2JLM A;  3TO9 A;  3UY5 A;  5FVJ A;  3SXN A;  3TO6 A;  2Q0Y A;  4ONU A;  3JTK A;  4UWJ A;  5F48 A;  4UBR A;  3PP9 A;  4UFV A;  4A31 A;  4FD6 A;  2ATR A;  4QB9 A;  4B5O A;  4OLL A;  1RXT A;  4E0A A;  3TOB A;  4M85 A;  2B3U A;  2GIV A;  2B5G A;  4MJ8 A;  3G8W A;  1S7N A;  4XNH C;  4YRH A;  1Y7R A;  2VEZ A;  1KUV A;  2C27 A;  4KUA A;  5AGE A;  2VQY A;  2WPW A;  2ZW4 A;  3GKR A;  2QML A;  1NE9 A;  4CAV A;  3FIX A;  4XPK A;  1FY7 A;  2GAN A;  4CYN A;  2ZXV A;  2R98 A;  2Z3O A;  4ZBG A;  2HUZ A;  2NMT A;  2VZZ A;  4L8A A;  2O28 A;  4U5Y A;  2CXA A;  4X5K A;  4YFJ A;  4KSA A;  1S3Z A;  1XE4 A;  3DR6 A;  4AVA A;  2CNT A;  4UCM A;  3TO7 A;  3OWC A;  4MFK A;  1M1D A;  2FT0 A;  4HNX B;  3EY5 A;  4R3L A;  4CGO A;  1Y9W A;  1CM0 A;  5GCN A;  3FBU A;  2G0B A;  3FB3 A;  2OZU A;  2Z0Z A;  5KTA A;  2ZPA A;  4KOU A;  2YND A;  4Y49 B;  4U9Y A;  4BMH A;  4CRY B;  4Q36 A;  1SQH A;  3ZZI A;  4MFZ A;  2VBQ A;  4I49 A;  3SXO A;  3CXS A;  4E2A A;  2Z3L A;  1PU9 A;  4C2X A;  3R95 A;  2PDO A;  5IX3 A;  4QVT A;  1KZF A;  4JLY A;  2EUI A;  1M4G A;  4Y49 C;  2OH1 A;  5EC4 A;  2ARH A;  3DSB A;  2JDC A;  2CNM A;  5G22 A;  4CAX A;  2Q4V A;  2AJ6 A;  3I9S A;  1YVK A;  4KUB A;  2P6E A;  2PC1 A;  3F0A A;  4HNW B;  3EFA A;  4HNY B;  1B6B A;  4B14 A;  5G20 A;  2QEC A;  3K9U A;  4UWI A;  4CYO A;  5J8F A;  4L89 A;  4KOW A;  2VXK A;  3DR8 A;  2FE7 A;  2PSW A;  1BO4 A;  4B13 A;  2QIR A;  3EC4 A;  1P4N A;  4MHD A;  4NSQ A;  1I12 A;  1YK3 A;  2OZG A;  1Q2D A;  4CGM A;  3VWD A;  2G3T A;  3N7Z A;  3FYN A;  3H4Q A;  4KVX A;  4H6U A;  4CAE A;  4KVO E;  1KUY A;  1K4J A;  1XEB A;  4XPD B;  2JDD A;  1QSM A;  2FCK A;  4E8O A;  2DXQ A;  4MFP A;  4CYQ A;  2PQ8 A;  5IB0 A;  1XF8 A;  5F47 A;  5AG5 A;  3W6S A;  3IWG A;  2F5I A;  5A28 A;  2Z3P A;  4F6A A;  1UFH A;  2Q04 A;  1J4J A;  2G3A A;  2Z11 A;  1Z4E A;  2PRB A;  3D2M A;  2B4D B;  3TTH A;  1YVO A;  4AG9 A;  2R8V A;  4KLV A;  3MGD A;  4CRZ B;  1I1D A;  1YR0 A;  3WR7 A;  4AVB A;  4R57 A;  4MBU A;  3VWE A;  1IYL A;  2FIW A;  4B5P B;  2BSW A;  4UCP A;  1XIX A;  4A30 A;  3DNS A;  4GS4 A;  5I0C A;  5F49 A;  3JUW A;  4AB7 A;  3C26 A;  3I3G A;  4Q38 A;  4KOY A;  4CGN A;  3G3S A;  5KTC A;  2Z3M A;  2REE A;  4MY0 A;  3S6G A;  2OU2 A;  3GY9 A;  1R57 A;  4H6Z A;  4RS2 A;  4PK2 A;  1GHE A;  4F0X A;  4B11 A;  1MK4 A;  3E0K A;  5IV0 A;  3ZJ0 A;  1U6M A;  4AG7 A;  3S6H A;  3SHP A;  3B8G A;  1IID A;  4PSX A;  3H5Z A;  2FIA A;  4FD4 A;  4NF1 A;  3IU2 A;  4FD7 A;  4B5P A;  2P6G A;  2RC4 A;  1S7F A;  2WSA A;  2Z10 A;  5DWM A;  5A27 A;  1MJA A;  3R1K A;  4YGO A;  2Z3N A;  2Q7B A;  4CGL A;  2B4D A;  1YRE A;  5AG6 A;  3R9E A;  5AG4 A;  4LX9 A;  1TIQ A;  2IL4 A;  3F5B A;  4R3K A;  4NCZ A;  4RI1 A;  3W91 A;  4KOX A;  4QC6 A;  3PGP A;  3KKW A;  2YGW A;  4U9Z A;  4MFJ A;  2R1I A;  2ZW5 A;  5F46 A;  3PZJ A;  4NEX A;  2FS5 A;  1QSO A;  3R9G A;  5JPH A;  2DPS A;  1M4D A;  4C2Y A;  4JWP A;  1V0C A;  4EVY A;  4PSW A;  2FSR A;  3P2H A;  3IGR A;  1P0H A;  1S7L A;  2PR8 A;  1QSN A;  4KVM E;  2REF A;  2YNC A;  4KLW A;  5G1Z A;  5C88 A;  1Z9U A;  4C2Z A;  3FNC A;  2PR1 A;  2CY2 A;  4B12 A;  2Y0M A;  3QAH A;  3R96 A;  4KOS A;  2EVN A;  2B3V A;  2R7H A;  1YLE A;  3TE4 A;  4KOV A;  3EO4 A;  3W6X A;  2VI7 A;  3IU1 A;  4IUS A;  4M3S A;  1MJ9 A;  2ZW7 A;  1VKC A;  4XNH B;  1XMT A;  2P0W A;  5BWA B;  2BUE A;  3LD2 A;  4IF5 A;  4BBH A;  3BJ8 A;  4A33 A;  4H89 A;  2YNC C;  1YGH A;  2FL4 A;  3GYA A;  1IIC A;  2K5T A;  1RO5 A;  4CGP A;  4DNC A;  1Y9K A;  4QBJ A;  4OAD A;  2FXF A;  4C68 A;  4PV6 A;  4XPL A;  5AG7 A;  4XPD C;  4KOT A;  5KTD A;  5E96 A;  1Q2C A;  1YX0 A;  4OAE A;  2WPX A;  3IWE A;  1PUA A;  5HMN A;  1QSR A;  4KOR A;  4UA3 A;  4MY3 A;  2I00 A;  2J8M A;  5J8C A;  3D3S A;  5JQ4 A;  1WWZ A;  2D4O A;  1ON0 A;  3RYO A;  1ZO0 A;  2HQY A;  2ZW6 A;  5EBV A;  5ISV A;  4LUA A;  2B5G B;  4QUS A;  1WK4 A;  3TOA A;  5HH1 A;  4CAF A;  2J8N A;  3CXP A;  3F8K A;  2Z3K A;  1CJW A;  3TT2 A;  1M4I A;  4C7I A;  4A32 A;  4JXQ A;  4II9 A;  3FRM A;  1S60 A;  4NXY A;  3V8I A;  2I79 A;  5DWN A;  3LOD A;  2Q44 A;  2A4N A;  2AE6 A;  3R9F A;  2HV2 A;  4R9M A;  1NSL A;  4JXR A;  1QST A;  3A9L A;  4CYP A;  1Q2Y A;  4MFQ A;  1M44 A;  4R87 A;  2D4P A;  2OZH A;  3DDD A;  2DPT A;  4KS9 A;  3QB8 A;  4MFL A;  4AVC A;  2BL1 A;  2WUU A;  2H5M A;  4C7H A;  3NE7 A;  3JVN A;  2JEV A;  2YNE A;  4UFW A;  4B10 A;  1S7K A;  2GE3 A;  5C82 A;  1IB1 E;  4ORF A;  1OZP A;  2P6F A;  4JJX A;  3D8P A;  1B87 A;  4FD5 A;  2KCW A;  1VHS A;  3CXQ A;  4HKF A;  2B4B A;  2B58 A;  4ZGY B;  4KSF A;  3EXN A;  1KUX A;  5G21 A;  2BEI A;  3P2F A;  4A2Z A;  3BLN A;  5H86 A;  4JD6 A;  4F0Y A;  2X7B A;  4CAW A;  3T9Y A;  3D2P A;  1BOB A;  4KZT A;  3TFY A;  2OB0 A;  1LRZ A;  1NMT A;  2VZY A;  4MI4 A;  1S5K A;  4CS0 B;  4A95 A;  5CNP A;  5H84 A;  3T90 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...