1P0HA

Crystal structure of rv0819 from mycobacterium tuberculosis mshd-mycothiol synthase coenzyme a complex
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
308
structure length
290
Chain Sequence
ALDWRSALTADEQRSVRALVTATTAVDGVAPVGEQVLRELGQQRTEHLLVAGSRPGGPIIGYLNLSPPGGAMAELVVHPQSRRRGIGTAMARAALAKTAGRNQFWAHGTLDPARATASALGLVGVRELIQMRRPLRDIPEPTIPDGVVIRTYAGTSDDAELLRVNNAAFAGHPEQGGWTAVQLAERRGEAWFDPDGLILAFGDGRLLGFHWTKVHPDHPGLGEVYVLGVDPAAQRRGLGQMLTSIGIVSLARRLVEPAVLLYVESDNVAAVRTYQSLGFTTYSVDTAYAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords hypothetical protein Rv0819
publication title Crystal structure of mycothiol synthase (Rv0819) from Mycobacterium tuberculosis shows structural homology to the GNAT family of N-acetyltransferases.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase
total genus 83
structure length 290
sequence length 308
ec nomenclature ec 2.3.1.189: Mycothiol synthase.
pdb deposition date 2003-04-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 1p0hA00
5J8FA 3VWEA 2J8RA 4KOYA 2FXFA 1PU9A 2B4DA 5KTCA 1TIQA 2CNMA 1MJBA 4JLYA 2PSWA 2PC1A 3TE4A 2ARHA 3GY9A 1CJWA 2Z11A 2CNTA 4DNCA 2ZW6A 4AVBA 4MY0A 4UA3A 4R9MA 4LUAA 3S6HA 3RYOA 4E2AA 4QVTA 3FB3A 1Z4EA 2P6FA 4QC6A 5DWNA 2CNSA 4NF1A 3SXNA 2A4NA 4KVOE 4KLVA 2JEVA 2QMLA 4H6ZA 3TTHA 2ZPAA 5EC4A 2JLMA 4YGOA 3T9YA 4Y49B 3FXTA 4OADA 4CRYB 2Y0MA 2PQ8A 1M4GA 4AB7A 2C27A 4KOSA 2JDDA 4GS4A 3D2PA 2J8MA 2ZXVA 3JVNA 3TOAA 4H6UA 3D2MA 3JUWA 4QB9A 5GCNA 1M4DA 4HNWB 3UY5A 5E96A 2Q44A 4KOXA 3PP9A 3FIXA 1U6MA 5ISVA 1VHSA 2EVNA 2R8VA 4I49A 5IB0A 2DXQA 4YRHA 1P0HA 4F6AA 3FRMA 1YREA 3G8WA 1S3ZA 5J8CA 2JDCA 2VI7A 2BEIA 2B5GA 3NE7A 2PR1A 3IGRA 1WK4A 1P4NA 5KTDA 2Z10A 2AJ6A 5F47A 3T90A 1NE9A 1SQHA 1BOBA 4XPDC 2GE3A 1S7NA 2FIAA 3TO7A 4B5PB 1M4IA 1B6BA 4K30A 3MGDA 5IV0A 2NMTA 2Q0YA 3DNSA 1NMTA 3V8IA 3G3SA 1WWZA 3TCVA 3PGPA 4MBUA 3OWCA 1MK4A 4F0YA 1KUXA 2PDOA 2GIVA 3W91A 4MJ8A 4R87A 1CM0A 3VWDA 3EY5A 5H84A 1J4JA 3DR6A 4R57A 2B4DB 3TOBA 2VXKA 4II9A 1PUAA 1IIDA 4XPLA 4ZBGA 2B4BA 1K4JA 1YLEA 2QIRA 4KOVA 3GYAA 1QSMA 2O28A 4ONUA 4JXQA 3TT2A 1S7FA 4ORFA 4KORA 1QSOA 2Q7BA 2OB0A 2VQYA 1YVOA 2R7HA 3TO6A 1NSLA 4KZTA 3CXQA 3EO4A 4KOWA 2HQYA 4FD5A 1V0CA 4FD4A 4PK3A 3LODA 1Y9KA 3PZJA 3S6KA 2Q04A 2VZYA 4QUSA 1Q2DA 4CAWA 3BLNA 3F8KA 3TO9A 3B8GA 3DSBA 3F5BA 2PRBA 1BO4A 2FSRA 2Q4YA 3W6XA 2G3TA 5JQ4A 1YGHA 2FIWA 2OH1A 2OZUA 3S6GA 3IWGA 2J8NA 4PSXA 2G3AA 2FE7A 3K9UA 4CRZB 1IB1E 3WR7A 3R9EA 1XF8A 3N7ZA 1XE4A 4AVAA 4YFJA 4LX9A 4IUSA 1YX0A 1KUYA 3ZZIA 5EBVA 2B58A 3DR8A 4U9ZA 1KUVA 2F5IA 3C26A 4FD6A 4AG9A 5F46A 1XIXA 5DWMA 5JPHA 4J3GA 3P2HA 5HH1A 3W6SA 3SXOA 5F48A 2I79A 4U5YA 3LD2A 5I0CA 1RXTA 5C82A 1XEBA 2ATRA 4OAEA 1L0CA 1Y9WA 4CAVA 4NEXA 4KOUA 5IX3A 3FYNA 4E0AA 5CNPA 2RC4A 3F0AA 4CAXA 2ZW5A 4OLLA 4UWIA 2OU2A 3QAHA 3I3GA 2EUIA 4CS0B 4L8AA 4Y49C 3EC4A 1VKCA 1QSNA 1R57A 2OZGA 3R96A 1LRZA 2HUZA 3S6FA 4AG7A 4KVXA 4MY3A 2P6EA 4R3LA 2G0BA 1M1DA 1QSTA 4R3KA 3DDDA 1M44A 3CXPA 4M3SA 1OZPA 2AE6A 4MHDA 5C88A 2FT0A 4UWJA 2ZW7A 2WPXA 2I00A 1N71A 3QB8A 4BMHA 2B3UA 4RS2A 3P2FA 4PK2A 4U9YA 5H86A 3TFYA 2REFA 1YVKA 4IF5A 1I21A 2GANA 1XMTA 4XPDB 1S5KA 2VEZA 2BUEA 1IYKA 4KVME 2REEA 1I12A 3I9SA 3R1KA 3R9FA 2X7BA 4HNXB 3KKWA 2D4PA 4KUBA 1GHEA 2R98A 4JWPA 4L89A 3GKRA 1ON0A 2H5MA 2FS5A 2OZHA 4QBJA 4HNYB 2WPWA 3EFAA 1YK3A 4XPKA 3E0KA 5KTAA 2P0WA 4KUAA 4XNHC 1Q2YA 4PV6A 3R95A 4JXRA 4JD6A 1KZFA 4AVCA 2CY2A 1Q2CA 5F49A 2B5GB 3FBUA 1IICA 4JJXA 3ZJ0A 2Z0ZA 4KOTA 2D4OA 5FVJA 4E8OA 4X5KA 4HKFA 2K5TA 2PR8A 1RO5A 4EVYA 1MJ9A 2FL4A 1S7LA 1IYLA 4KLWA 1S7KA 2HV2A 2P6GA 4NSQA 2IL4A 2VZZA 4B5OA 4RI1A 4M85A 4PSWA 4UBRA 2B3VA 3EXNA 1B87A 3CXSA 3H4QA 1Y7RA 5HMNA 1UFHA 1S60A 2QECA 1FY7A 2ZW4A 2BSWA 3FNCA 2FCKA 2Q4VA 2R1IA 1MJAA 3BJ7A 2KCWA 1Z9UA 3R9GA 3D8PA 4B5PA 1YR0A 3D3SA 2BL1A 3SHPA 4XNHB 4MI4A 3BJ8A 4NCZA 2VBQA 1QSRA 1I1DA 4NXYA 4FD7A 4H89A 1Z4RA
chains in the Genus database with same CATH superfamily
1ZG9A 4P10A 5J8FA 3VWEA 2Z3PA 3FMCA 8CPAA 2WYRA 2J8RA 4KOYA 2FXFA 1PU9A 2B4DA 5KTCA 1TIQA 2CNMA 5EMIA 4ZY1A 2EWBA 4X3RA 4UCMA 1MJBA 4JLYA 2PSWA 1DE4C 2PC1A 3CPAA 4ZX8A 3TE4A 2ARHA 3PB7X 3GY9A 1CJWA 5LRGA 1YW4A 2Z11A 4UF4A 2CNTA 3D68A 4DNCA 4PXEA 4MRIA 4PQAA 5ELYA 2Z3KA 2ZW6A 4AVBA 4MY0A 4UA3A 4PXBA 5LYLA 3BI0A 1LAMA 2PJ2A 4LUAA 4R9MA 3H8EA 3S6HA 3JRUA 3RYOA 2EO8A 1IGBA 3LMSA 4E2AA 4NJRA 4QVTA 2RB7A 2EK8A 2AFUA 3FB3A 1Z4EA 2IQ6A 2P6FA 4QC6A 4RN7A 5AG6A 5HXDA 3SI1A 2NSMA 5DWNA 2PJCA 2CNSA 4NF1A 3SXNA 2WZNA 3PRTA 2A4NA 4KVOE 4DJLA 4KLVA 3S9NA 2JEVA 2QMLA 4H6ZA 1F57A 3V38A 1TKFA 3TTHA 2ZPAA 3VH9A 1Z8LA 3D66A 5AGEA 3IJ3A 5EC4A 2JLMA 4YGOA 3T9YA 4Y49B 4OC5A 3FXTA 3KQZA 2ZEEA 4OADA 4CRYB 1BPMA 2Y0MA 2PQ8A 3NH4A 1CG2A 2AFWA 1M4GA 2V8VA 4KSFA 4NGMA 2C27A 4KOSA 4AB7A 2JDDA 3D4UA 4NGSA 4GS4A 3D2PA 2J8MA 2ZXVA 4ZYQA 3JVNA 3TOAA 2C1CA 4H6UA 4CGLA 3D2MA 3JUWA 5K8NA 4C7HA 4O23A 4QB9A 5GCNA 1M4DA 4HNWB 3UY5A 5E96A 2Q44A 1F2OA 2ZEDA 3B3SA 3K9TA 4KOXA 3PP9A 3FIXA 4CGPA 5LRKA 4R8FA 1U6MA 2PJ1A 2GLJA 3FF3A 2J9AA 2CXAA 5LYDA 4M6HA 5ISVA 1LFWA 3D7HA 1VHSA 2EVNA 4TWEA 5JGFA 2R8VA 4I49A 3NE8A 5IB0A 2DXQA 4YWYA 4YRHA 1XOVA 5JM6A 1P0HA 4C68A 4F6AA 3FRMA 1YREA 3G8WA 4OKOA 4LQGA 1S3ZA 1YMEA 4OC2A 5J8CA 3NH8A 2JDCA 4JYWA 2O4HA 2VI7A 2Q43A 4DUKA 1LANA 1Z8WA 2BEIA 2PCUA 2B5GA 3A9LA 1ELLP 3NE7A 2PR1A 4CGNA 3IGRA 1WK4A 1P4NA 5K8MA 5KTDA 5LYFA 1R3NA 1YW6A 2QVPA 2Z10A 2AJ6A 5F47A 4ZY0A 2PVVA 4CPAA 5I4MA 3SJFA 3T90A 4PXCA 1NE9A 1SQHA 2XEIA 3FH4A 1EE3P 5K8PA 1BOBA 4XPDC 2GE3A 3QNVA 1S7NA 2FIAA 3SJGA 5IB9A 1YQEA 3T8WA 4CAFA 3TO7A 4B5PB 1M4IA 2Q7SA 3PBBA 2EBJA 1B6BA 2ZEHA 2GLFA 3PEIA 4K30A 4ONWA 3MGDA 5A27A 5IV0A 2IJZA 4UFXA 2WUUA 1DTDA 2NMTA 3I1UA 3IWWA 2Q0YA 3DNSA 1NMTA 2PJ5A 3V8IA 1FNOA 2ZEMA 4W9YA 4B12A 4IAVA 3G3SA 1WWZA 4MXUA 1CX8A 3TCVA 4CAEA 4WJBA 1ZLIA 3PGPA 4MFQA 3B3WA 4MBUA 5DS0A 3OWCA 2ZEPA 1MK4A 2PIYA 4P6YA 3DGVA 4F0YA 1KUXA 4JZ0A 2AFXA 2PDOA 2GIVA 3W91A 4MJ8A 4R87A 3PFEA 1CM0A 3VWDA 3EY5A 5H84A 1J4JA 4OIDA 3DR6A 4R57A 2B4DB 2JBJA 2YGWA 3TOBA 2VXKA 3NFZA 4II9A 3LWUA 2ZOFA 4MHNA 4A30A 1PUAA 1IIDA 4XPLA 4MMOA 4ZBGA 2B4BA 1K4JA 1YLEA 1YLOA 2QIRA 4KOVA 3GYAA 3IFEA 4X2TA 4A32A 1QSMA 2PRQA 2O28A 4ONUA 4JXQA 3TT2A 1S7FA 4ORFA 3RZAA 4KORA 4B14A 2PJBA 1QSOA 1Z8TA 2OB0A 2Q7BA 4KS9A 2ANPA 1YVOA 1JWQA 2VQYA 3KR5A 4H2KA 1IOFA 3BXMA 1ARLA 2R7HA 3TO6A 2EK9A 4MHPA 1NSLA 1BPNA 4F0XA 3CXQA 4KZTA 4PXDA 4B11A 3EO4A 4KOWA 4UEFA 2HQYA 2Z3LA 4FD5A 4C2XA 2QJ8A 3IEHA 2CTBA 1V0CA 4YU9A 4B13A 3B7IA 2ABZA 2DPSA 2PJAA 4FD4A 4OP4A 3LODA 4PK3A 1IOIA 4X8IA 2ZOGA 1VHEA 4P4JA 2YNDA 1Y9KA 3PZJA 3S6KA 4UCPA 2PJ4A 3KASA 2Q04A 2VZYA 4IK2A 4QUSA 4MCSA 1Q2DA 3LACA 4CAWA 3BLNA 1AMPA 3TC8A 3F8KA 3TO9A 3B8GA 2PJ7A 3DSBA 3F5BA 2PRBA 4UIAA 3B3CA 1BO4A 3VARA 2FSRA 1LAPA 4MFKA 4A2ZA 4A33A 2Q4YA 3SJEA 4NGPA 3W6XA 2DEAA 2G3TA 1IY7A 3D7DA 4EMEA 5JQ4A 4CGOA 1M4LA 1YGHA 2FIWA 5G1ZA 3WC6A 2IMOA 2OH1A 2OZUA 3S6GA 2HC9A 3IWGA 2J8NA 2C6GA 2XEFA 3CPXA 3FECA 4PSXA 4R76A 2G3AA 4OC0A 5G21A 7CPAA 5K8OA 2FE7A 3K9UA 4CRZB 1IB1E 3ISZA 5CBMA 3WR7A 3SJXA 3R9EA 3IU2A 4ZGYB 2CTCA 1XF8A 1Z5RA 1XE4A 3FVLA 3N7ZA 4A39A 4MFZA 3IC1A 4GM5A 1ZG8A 4OC1A 4AVAA 4YFJA 3B35A 4OC3A 4LX9A 4IUSA 2F8HA 1YX0A 1KUYA 4EWTA 3ZZIA 1R43A 2B58A 5EBVA 3H8GA 4MHZA 3DR8A 4MFJA 3NA6A 3FEEA 3PB8X 3FX6A 1NSAA 4U9ZA 1ELMP 1UWYA 2ODFA 3PB4X 4C2ZA 1KUVA 6CPAA 1YSJA 2F5IA 3C26A 4FD6A 4AG9A 4HPSA 5F46A 1XIXA 3S9LA 5DWMA 3CT9A 4J3GA 3P2HA 5HH1A 5JPHA 1HDUA 3SXOA 3W6SA 5F48A 3RBUA 4B6ZA 4OMEA 2BO9A 1JQGA 1PYTB 2I79A 2PJ0A 2PJ3A 2BCOA 1CPSA 4U5YA 3IO1A 3LD2A 4NFRA 5I0CA 4A37A 3WT4A 3D67A 3PBEA 1RXTA 3KZWA 5C82A 1XEBA 1H8LA 2ATRA 4OAEA 5THWA 4IHMA 1L0CA 1Y9WA 4CAVA 1QMUA 4NEXA 3JTKA 2PJ8A 4KOUA 3IWEA 4FWUA 5IX3A 3FYNA 4Z65A 2RFHA 4MCRA 4E0AA 3V7ZA 1F2PA 2AFMA 5CNPA 3KL9A 2RC4A 2I3CA 1XRYA 3F0AA 4CAXA 2ZW5A 4OLLA 4UWIA 2OU2A 2OOTA 4G1PA 3D7GA 3QAHA 3I3GA 2G9DA 1Y0YA 2EUIA 2OR4A 4CS0B 4L8AA 1HEEA 4P44A 4Y49C 3EC4A 1VKCA 4DYOA 4CYOA 1QSNA 1CPXA 1R57A 2F7VA 1LOKA 2PJ6A 2OZGA 3R96A 4A95A 2XEGA 3D7FA 1LRZA 1QQ9A 1TKJA 2HUZA 2JBKA 3S6FA 3S9MA 1VHOA 4AG7A 4KVXA 3WC7A 4FBEA 3GUXA 4MY3A 4MHYA 2Q4ZA 2BOAA 2P6EA 4R3LA 2YNEA 2G0BA 4A31A 2YNCA 2Z3OA 3RAMA 1M1DA 2PJ9A 1QSTA 4R3KA 3DDDA 3IIBA 1M44A 3CXPA 4M3SA 1OZPA 4Q7AA 4UFVA 2AE6A 4MHDA 5C88A 4BINA 1BAVA 3B2YA 1BLLE 2FT0A 2NYQA 4UWJA 2ZW7A 2WPXA 4MCQA 3PB6X 2POKA 2I00A 4TNUA 1N71A 3DLJA 3QB8A 1XJOA 4BMHA 3WABA 3NH5A 5CPAA 4CGMA 1X10A 2B3UA 2ZENA 3MRUA 4RS2A 1HDQA 3P2FA 4PK2A 4LQ6A 4U9YA 4UFWA 5H86A 2REFA 3TFYA 1RTQA 1YVKA 4M6IA 4C2YA 2ZELA 2PE3A 4IF5A 1I21A 2GANA 1XMTA 3SI0A 4XPDB 1S5KA 2VEZA 3HLPA 2BUEA 1IYKA 2C6PA 4KVME 2REEA 5G20A 4P45A 2Z3MA 4PPZA 3MN8A 1GYTA 2V8DA 1I12A 3B3VA 3I9SA 3R1KA 4P4EA 3R9FA 2X7BA 4HNXB 4UEZA 3KKWA 2D4PA 4KUBA 2AFZA 1GHEA 4C7IA 2R98A 4JWPA 2QYVA 4OC4A 3QAYA 4KSAA 4L89A 3GKRA 4RUHA 3TX8A 1ON0A 2H5MA 2FS5A 4NJQA 5AG4A 5JH9A 1Z2LA 2OZHA 4QBJA 1AUGA 4OIWA 4HNYB 1TKHA 3KQXA 2WPWA 3L2NA 2YNCC 4FAIA 3FJUA 4KSIA 4R6TA 1A2ZA 3EFAA 2CIJA 3K2KA 4UEEA 1YK3A 4M6GA 4XPKA 3KHZA 4FUUA 1VGYA 5J1QA 3E0KA 4Q38A 5KTAA 5A28A 2P0WA 4KUAA 4XNHC 1Y0RA 1Q2YA 4NGTA 4PV6A 2JEWA 4NGNA 4JXRA 5LRJA 3KHXA 1X12A 3R95A 1Y7EA 4JD6A 3ISXA 1KZFA 2PIZA 3IU1A 4AVCA 2CY2A 1Q2CA 5F49A 1XMBA 2B5GB 3GLJA 3FBUA 1IICA 3FEDA 4JJXA 3CZXA 3ZJ0A 3PFOA 2FVGA 2Z0ZA 4KOTA 4CYNA 5AG7A 5D29A 2D4OA 2ZEFA 3BHXA 4P4IA 5FVJA 4BD9A 4E8OA 4X5KA 2Z3NA 2Q51A 4ZI6A 4HKFA 2C6CA 4P4BA 1Q7LA 1VIXA 1IU8A 2K5TA 2PR8A 1RO5A 2V77A 1MJ9A 4B10A 4EVYA 3N5FA 2FL4A 5HVHA 4WWVA 4GXHA 1S7LA 1IYLA 4KLWA 4BBHA 4NGRA 1S7KA 1ZO0A 2HV2A 5HVFA 2P6GA 4F9UA 4NSQA 1OBRA 2IL4A 2VZZA 4B5OA 4RI1A 4M85A 4PSWA 1TF8A 2B3VA 4UBRA 3RO0A 3EXNA 3H8FA 1CP7A 4A38A 2V8GA 1XFOA 4CYQA 1TXRA 1XBUA 2V8HA 2HB6A 1B87A 4K3NA 5AG5A 5G22A 3CXSA 3KR4A 2O53A 2XEJA 3H4QA 1Y7RA 5HMNA 4R7MA 1CP6A 1UFHA 2GREA 1S60A 1PCAA 2GU2A 3SI2A 4ZX9A 5HVGA 2QECA 1FY7A 2ZW4A 2BSWA 2ZEOA 3FNCA 2DF5A 1ZG7A 1ZLHA 1LCPA 4A94A 1TF9A 3CDXA 3KGQA 1ARMA 3HUVA 2FCKA 1CBXA 2Q4VA 2R1IA 3RNZA 4CYPA 4F8ZA 1MJAA 2PVWA 5BWAB 4P4FA 4EFDA 3BJ7A 3H5ZA 2KCWA 3B3TA 1FT7A 2ZEGA 4NGQA 4AXVA 1AYEA 1Z9UA 5LYIA 4UCNA 2DPTA 3D8PA 3R9GA 4B5PA 4P4DA 1YR0A 4UIBA 2GFQA 1KWMA 3D3SA 2BL1A 3BI1A 3SHPA 4ZY2A 4XNHB 4MI4A 2AFSA 3PB9X 2WSAA 4MFLA 2CF4A 4MFPA 4MCPA 1Z8XA 3BJ8A 4Q36A 5D8NA 3GIUA 5F09A 4NCZA 2VL1A 2VBQA 4F9VA 1QSRA 1I1DA 3GB0A 4NXYA 3VATA 4FD7A 4H89A 3WC5A 1Z4RA 2AFOA 3KI9A
chains in the Genus database with same CATH topology
5J8FA 3VWEA 2Z3PA 2J8RA 4KOYA 2FXFA 1PU9A 2B4DA 5KTCA 1TIQA 2CNMA 4UCMA 1MJBA 4JLYA 2PSWA 2PC1A 3TE4A 2ARHA 3GY9A 1CJWA 2Z11A 2CNTA 4DNCA 2Z3KA 2ZW6A 4AVBA 4MY0A 4UA3A 4R9MA 4LUAA 3S6HA 3RYOA 4E2AA 4QVTA 3FB3A 1Z4EA 2P6FA 4QC6A 5AG6A 5DWNA 2CNSA 4NF1A 3SXNA 2A4NA 4KVOE 4KLVA 2JEVA 2QMLA 4H6ZA 3TTHA 2ZPAA 5AGEA 5EC4A 2JLMA 4YGOA 3T9YA 4Y49B 3FXTA 4OADA 4CRYB 2Y0MA 2PQ8A 1M4GA 4KSFA 4AB7A 2C27A 4KOSA 2JDDA 4GS4A 3D2PA 2J8MA 2ZXVA 3JVNA 3TOAA 4H6UA 4CGLA 3D2MA 3JUWA 4C7HA 4QB9A 5GCNA 1M4DA 4HNWB 3UY5A 5E96A 2Q44A 4KOXA 3PP9A 3FIXA 4CGPA 1U6MA 2CXAA 5ISVA 1VHSA 2EVNA 2R8VA 4I49A 5IB0A 2DXQA 4YRHA 1P0HA 4C68A 4F6AA 3FRMA 1YREA 3G8WA 1S3ZA 5J8CA 2JDCA 2VI7A 2BEIA 2B5GA 3A9LA 3NE7A 2PR1A 4CGNA 3IGRA 1WK4A 1P4NA 5KTDA 2Z10A 2AJ6A 5F47A 3T90A 1NE9A 1SQHA 1BOBA 4XPDC 2GE3A 1S7NA 2FIAA 4CAFA 3TO7A 4B5PB 1M4IA 1B6BA 4K30A 3MGDA 5A27A 5IV0A 4UFXA 2WUUA 2NMTA 2Q0YA 3DNSA 1NMTA 3V8IA 4B12A 3G3SA 1WWZA 3TCVA 4CAEA 4MFQA 3PGPA 4MBUA 3OWCA 1MK4A 4F0YA 1KUXA 2PDOA 2GIVA 3W91A 4MJ8A 4R87A 1CM0A 3VWDA 3EY5A 5H84A 1J4JA 3DR6A 4R57A 2B4DB 3TOBA 2YGWA 2VXKA 4II9A 4A30A 1PUAA 1IIDA 4XPLA 4ZBGA 2B4BA 1K4JA 1YLEA 2QIRA 4KOVA 3GYAA 4A32A 1QSMA 2O28A 4ONUA 4JXQA 3TT2A 1S7FA 4ORFA 4KORA 4B14A 1QSOA 2Q7BA 2OB0A 4KS9A 2VQYA 1YVOA 2R7HA 3TO6A 1NSLA 4F0XA 3CXQA 4KZTA 4B11A 3EO4A 4KOWA 2HQYA 2Z3LA 4FD5A 4C2XA 1V0CA 4B13A 4FD4A 2DPSA 4PK3A 3LODA 2YNDA 1Y9KA 3PZJA 3S6KA 4UCPA 2Q04A 2VZYA 4QUSA 1Q2DA 4CAWA 3BLNA 3F8KA 3TO9A 3B8GA 3DSBA 3F5BA 2PRBA 1BO4A 2FSRA 4MFKA 4A2ZA 4A33A 2Q4YA 3W6XA 2G3TA 5JQ4A 4CGOA 1YGHA 2FIWA 5G1ZA 2OH1A 2OZUA 3S6GA 3IWGA 2J8NA 4PSXA 2G3AA 5G21A 2FE7A 3K9UA 4CRZB 1IB1E 3WR7A 3R9EA 3IU2A 4ZGYB 1XF8A 3N7ZA 1XE4A 4MFZA 4AVAA 4YFJA 4LX9A 4IUSA 1YX0A 1KUYA 3ZZIA 5EBVA 2B58A 3DR8A 4MFJA 4U9ZA 4C2ZA 1KUVA 2F5IA 3C26A 4FD6A 4AG9A 5F46A 1XIXA 5DWMA 5JPHA 4J3GA 3P2HA 5HH1A 3W6SA 3SXOA 5F48A 2I79A 4U5YA 3LD2A 5I0CA 1RXTA 5C82A 1XEBA 2ATRA 4OAEA 1L0CA 1Y9WA 4CAVA 4NEXA 3JTKA 4KOUA 3IWEA 5IX3A 3FYNA 4E0AA 5CNPA 2RC4A 3F0AA 4CAXA 2ZW5A 4OLLA 4UWIA 2OU2A 3QAHA 3I3GA 2EUIA 4CS0B 4L8AA 4Y49C 3EC4A 1VKCA 4CYOA 1QSNA 1R57A 2OZGA 3R96A 4A95A 1LRZA 2HUZA 3S6FA 4AG7A 4KVXA 4MY3A 2P6EA 4R3LA 2YNEA 2G0BA 4A31A 2YNCA 2Z3OA 1M1DA 1QSTA 4R3KA 3DDDA 1M44A 3CXPA 4M3SA 1OZPA 4UFVA 2AE6A 4MHDA 5C88A 2FT0A 4UWJA 2ZW7A 2WPXA 2I00A 1N71A 3QB8A 4CGMA 4BMHA 2B3UA 4RS2A 3P2FA 4PK2A 4U9YA 4UFWA 5H86A 3TFYA 2REFA 1YVKA 4C2YA 4IF5A 1I21A 2GANA 1XMTA 4XPDB 1S5KA 2VEZA 2BUEA 1IYKA 4KVME 2REEA 5G20A 2Z3MA 1I12A 3I9SA 3R1KA 3R9FA 2X7BA 4HNXB 3KKWA 2D4PA 4KUBA 4C7IA 1GHEA 2R98A 4JWPA 4KSAA 4L89A 3GKRA 1ON0A 2H5MA 2FS5A 5AG4A 2OZHA 4QBJA 4HNYB 2WPWA 2YNCC 3EFAA 1YK3A 4XPKA 3E0KA 4Q38A 5KTAA 5A28A 2P0WA 4KUAA 4XNHC 1Q2YA 4PV6A 3R95A 4JXRA 4JD6A 1KZFA 3IU1A 4AVCA 2CY2A 1Q2CA 5F49A 2B5GB 3FBUA 1IICA 4JJXA 3ZJ0A 2Z0ZA 4KOTA 4CYNA 5AG7A 2D4OA 5FVJA 4E8OA 4X5KA 2Z3NA 4HKFA 2K5TA 2PR8A 1RO5A 4B10A 1MJ9A 4EVYA 2FL4A 1S7LA 1IYLA 4KLWA 4BBHA 1S7KA 1ZO0A 2HV2A 2P6GA 4NSQA 2IL4A 2VZZA 4B5OA 4RI1A 4M85A 4PSWA 4UBRA 2B3VA 3EXNA 4CYQA 5G22A 1B87A 5AG5A 3CXSA 3H4QA 1Y7RA 5HMNA 1UFHA 1S60A 2QECA 1FY7A 2ZW4A 2BSWA 3FNCA 2FCKA 2Q4VA 2R1IA 4CYPA 5BWAB 1MJAA 3BJ7A 3H5ZA 2KCWA 1Z9UA 4UCNA 2DPTA 3D8PA 3R9GA 4B5PA 1YR0A 3D3SA 2BL1A 3SHPA 4XNHB 4MI4A 2WSAA 4MFLA 4MFPA 3BJ8A 4Q36A 4NCZA 2VBQA 1QSRA 1I1DA 4NXYA 4FD7A 4H89A 1Z4RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5J8F A;  3VWE A;  2J8R A;  4KOY A;  2FXF A;  1PU9 A;  2B4D A;  5KTC A;  1TIQ A;  2CNM A;  1MJB A;  4JLY A;  2PSW A;  2PC1 A;  3TE4 A;  2ARH A;  3GY9 A;  1CJW A;  2Z11 A;  2CNT A;  4DNC A;  2ZW6 A;  4AVB A;  4MY0 A;  4UA3 A;  4R9M A;  4LUA A;  3S6H A;  3RYO A;  4E2A A;  4QVT A;  3FB3 A;  1Z4E A;  2P6F A;  4QC6 A;  5DWN A;  2CNS A;  4NF1 A;  3SXN A;  2A4N A;  4KVO E;  4KLV A;  2JEV A;  2QML A;  4H6Z A;  3TTH A;  2ZPA A;  5EC4 A;  2JLM A;  4YGO A;  3T9Y A;  4Y49 B;  3FXT A;  4OAD A;  4CRY B;  2Y0M A;  2PQ8 A;  1M4G A;  4AB7 A;  2C27 A;  4KOS A;  2JDD A;  4GS4 A;  3D2P A;  2J8M A;  2ZXV A;  3JVN A;  3TOA A;  4H6U A;  3D2M A;  3JUW A;  4QB9 A;  5GCN A;  1M4D A;  4HNW B;  3UY5 A;  5E96 A;  2Q44 A;  4KOX A;  3PP9 A;  3FIX A;  1U6M A;  5ISV A;  1VHS A;  2EVN A;  2R8V A;  4I49 A;  5IB0 A;  2DXQ A;  4YRH A;  1P0H A;  4F6A A;  3FRM A;  1YRE A;  3G8W A;  1S3Z A;  5J8C A;  2JDC A;  2VI7 A;  2BEI A;  2B5G A;  3NE7 A;  2PR1 A;  3IGR A;  1WK4 A;  1P4N A;  5KTD A;  2Z10 A;  2AJ6 A;  5F47 A;  3T90 A;  1NE9 A;  1SQH A;  1BOB A;  4XPD C;  2GE3 A;  1S7N A;  2FIA A;  3TO7 A;  4B5P B;  1M4I A;  1B6B A;  4K30 A;  3MGD A;  5IV0 A;  2NMT A;  2Q0Y A;  3DNS A;  1NMT A;  3V8I A;  3G3S A;  1WWZ A;  3TCV A;  3PGP A;  4MBU A;  3OWC A;  1MK4 A;  4F0Y A;  1KUX A;  2PDO A;  2GIV A;  3W91 A;  4MJ8 A;  4R87 A;  1CM0 A;  3VWD A;  3EY5 A;  5H84 A;  1J4J A;  3DR6 A;  4R57 A;  2B4D B;  3TOB A;  2VXK A;  4II9 A;  1PUA A;  1IID A;  4XPL A;  4ZBG A;  2B4B A;  1K4J A;  1YLE A;  2QIR A;  4KOV A;  3GYA A;  1QSM A;  2O28 A;  4ONU A;  4JXQ A;  3TT2 A;  1S7F A;  4ORF A;  4KOR A;  1QSO A;  2Q7B A;  2OB0 A;  2VQY A;  1YVO A;  2R7H A;  3TO6 A;  1NSL A;  4KZT A;  3CXQ A;  3EO4 A;  4KOW A;  2HQY A;  4FD5 A;  1V0C A;  4FD4 A;  4PK3 A;  3LOD A;  1Y9K A;  3PZJ A;  3S6K A;  2Q04 A;  2VZY A;  4QUS A;  1Q2D A;  4CAW A;  3BLN A;  3F8K A;  3TO9 A;  3B8G A;  3DSB A;  3F5B A;  2PRB A;  1BO4 A;  2FSR A;  2Q4Y A;  3W6X A;  2G3T A;  5JQ4 A;  1YGH A;  2FIW A;  2OH1 A;  2OZU A;  3S6G A;  3IWG A;  2J8N A;  4PSX A;  2G3A A;  2FE7 A;  3K9U A;  4CRZ B;  1IB1 E;  3WR7 A;  3R9E A;  1XF8 A;  3N7Z A;  1XE4 A;  4AVA A;  4YFJ A;  4LX9 A;  4IUS A;  1YX0 A;  1KUY A;  3ZZI A;  5EBV A;  2B58 A;  3DR8 A;  4U9Z A;  1KUV A;  2F5I A;  3C26 A;  4FD6 A;  4AG9 A;  5F46 A;  1XIX A;  5DWM A;  5JPH A;  4J3G A;  3P2H A;  5HH1 A;  3W6S A;  3SXO A;  5F48 A;  2I79 A;  4U5Y A;  3LD2 A;  5I0C A;  1RXT A;  5C82 A;  1XEB A;  2ATR A;  4OAE A;  1L0C A;  1Y9W A;  4CAV A;  4NEX A;  4KOU A;  5IX3 A;  3FYN A;  4E0A A;  5CNP A;  2RC4 A;  3F0A A;  4CAX A;  2ZW5 A;  4OLL A;  4UWI A;  2OU2 A;  3QAH A;  3I3G A;  2EUI A;  4CS0 B;  4L8A A;  4Y49 C;  3EC4 A;  1VKC A;  1QSN A;  1R57 A;  2OZG A;  3R96 A;  1LRZ A;  2HUZ A;  3S6F A;  4AG7 A;  4KVX A;  4MY3 A;  2P6E A;  4R3L A;  2G0B A;  1M1D A;  1QST A;  4R3K A;  3DDD A;  1M44 A;  3CXP A;  4M3S A;  1OZP A;  2AE6 A;  4MHD A;  5C88 A;  2FT0 A;  4UWJ A;  2ZW7 A;  2WPX A;  2I00 A;  1N71 A;  3QB8 A;  4BMH A;  2B3U A;  4RS2 A;  3P2F A;  4PK2 A;  4U9Y A;  5H86 A;  3TFY A;  2REF A;  1YVK A;  4IF5 A;  1I21 A;  2GAN A;  1XMT A;  4XPD B;  1S5K A;  2VEZ A;  2BUE A;  1IYK A;  4KVM E;  2REE A;  1I12 A;  3I9S A;  3R1K A;  3R9F A;  2X7B A;  4HNX B;  3KKW A;  2D4P A;  4KUB A;  1GHE A;  2R98 A;  4JWP A;  4L89 A;  3GKR A;  1ON0 A;  2H5M A;  2FS5 A;  2OZH A;  4QBJ A;  4HNY B;  2WPW A;  3EFA A;  1YK3 A;  4XPK A;  3E0K A;  5KTA A;  2P0W A;  4KUA A;  4XNH C;  1Q2Y A;  4PV6 A;  3R95 A;  4JXR A;  4JD6 A;  1KZF A;  4AVC A;  2CY2 A;  1Q2C A;  5F49 A;  2B5G B;  3FBU A;  1IIC A;  4JJX A;  3ZJ0 A;  2Z0Z A;  4KOT A;  2D4O A;  5FVJ A;  4E8O A;  4X5K A;  4HKF A;  2K5T A;  2PR8 A;  1RO5 A;  4EVY A;  1MJ9 A;  2FL4 A;  1S7L A;  1IYL A;  4KLW A;  1S7K A;  2HV2 A;  2P6G A;  4NSQ A;  2IL4 A;  2VZZ A;  4B5O A;  4RI1 A;  4M85 A;  4PSW A;  4UBR A;  2B3V A;  3EXN A;  1B87 A;  3CXS A;  3H4Q A;  1Y7R A;  5HMN A;  1UFH A;  1S60 A;  2QEC A;  1FY7 A;  2ZW4 A;  2BSW A;  3FNC A;  2FCK A;  2Q4V A;  2R1I A;  1MJA A;  3BJ7 A;  2KCW A;  1Z9U A;  3R9G A;  3D8P A;  4B5P A;  1YR0 A;  3D3S A;  2BL1 A;  3SHP A;  4XNH B;  4MI4 A;  3BJ8 A;  4NCZ A;  2VBQ A;  1QSR A;  1I1D A;  4NXY A;  4FD7 A;  4H89 A;  1Z4R A; 
#chains in the Genus database with same CATH topology
 1ZG9 A;  4P10 A;  5J8F A;  3VWE A;  2Z3P A;  3FMC A;  8CPA A;  2WYR A;  2J8R A;  4KOY A;  2FXF A;  1PU9 A;  2B4D A;  5KTC A;  1TIQ A;  2CNM A;  5EMI A;  4ZY1 A;  2EWB A;  4X3R A;  4UCM A;  1MJB A;  4JLY A;  2PSW A;  1DE4 C;  2PC1 A;  3CPA A;  4ZX8 A;  3TE4 A;  2ARH A;  3PB7 X;  3GY9 A;  1CJW A;  5LRG A;  1YW4 A;  2Z11 A;  4UF4 A;  2CNT A;  3D68 A;  4DNC A;  4PXE A;  4MRI A;  4PQA A;  5ELY A;  2Z3K A;  2ZW6 A;  4AVB A;  4MY0 A;  4UA3 A;  4PXB A;  5LYL A;  3BI0 A;  1LAM A;  2PJ2 A;  4LUA A;  4R9M A;  3H8E A;  3S6H A;  3JRU A;  3RYO A;  2EO8 A;  1IGB A;  3LMS A;  4E2A A;  4NJR A;  4QVT A;  2RB7 A;  2EK8 A;  2AFU A;  3FB3 A;  1Z4E A;  2IQ6 A;  2P6F A;  4QC6 A;  4RN7 A;  5AG6 A;  5HXD A;  3SI1 A;  2NSM A;  5DWN A;  2PJC A;  2CNS A;  4NF1 A;  3SXN A;  2WZN A;  3PRT A;  2A4N A;  4KVO E;  4DJL A;  4KLV A;  3S9N A;  2JEV A;  2QML A;  4H6Z A;  1F57 A;  3V38 A;  1TKF A;  3TTH A;  2ZPA A;  3VH9 A;  1Z8L A;  3D66 A;  5AGE A;  3IJ3 A;  5EC4 A;  2JLM A;  4YGO A;  3T9Y A;  4Y49 B;  4OC5 A;  3FXT A;  3KQZ A;  2ZEE A;  4OAD A;  4CRY B;  1BPM A;  2Y0M A;  2PQ8 A;  3NH4 A;  1CG2 A;  2AFW A;  1M4G A;  2V8V A;  4KSF A;  4NGM A;  2C27 A;  4KOS A;  4AB7 A;  2JDD A;  3D4U A;  4NGS A;  4GS4 A;  3D2P A;  2J8M A;  2ZXV A;  4ZYQ A;  3JVN A;  3TOA A;  2C1C A;  4H6U A;  4CGL A;  3D2M A;  3JUW A;  5K8N A;  4C7H A;  4O23 A;  4QB9 A;  5GCN A;  1M4D A;  4HNW B;  3UY5 A;  5E96 A;  2Q44 A;  1F2O A;  2ZED A;  3B3S A;  3K9T A;  4KOX A;  3PP9 A;  3FIX A;  4CGP A;  5LRK A;  4R8F A;  1U6M A;  2PJ1 A;  2GLJ A;  3FF3 A;  2J9A A;  2CXA A;  5LYD A;  4M6H A;  5ISV A;  1LFW A;  3D7H A;  1VHS A;  2EVN A;  4TWE A;  5JGF A;  2R8V A;  4I49 A;  3NE8 A;  5IB0 A;  2DXQ A;  4YWY A;  4YRH A;  1XOV A;  5JM6 A;  1P0H A;  4C68 A;  4F6A A;  3FRM A;  1YRE A;  3G8W A;  4OKO A;  4LQG A;  1S3Z A;  1YME A;  4OC2 A;  5J8C A;  3NH8 A;  2JDC A;  4JYW A;  2O4H A;  2VI7 A;  2Q43 A;  4DUK A;  1LAN A;  1Z8W A;  2BEI A;  2PCU A;  2B5G A;  3A9L A;  1ELL P;  3NE7 A;  2PR1 A;  4CGN A;  3IGR A;  1WK4 A;  1P4N A;  5K8M A;  5KTD A;  5LYF A;  1R3N A;  1YW6 A;  2QVP A;  2Z10 A;  2AJ6 A;  5F47 A;  4ZY0 A;  2PVV A;  4CPA A;  5I4M A;  3SJF A;  3T90 A;  4PXC A;  1NE9 A;  1SQH A;  2XEI A;  3FH4 A;  1EE3 P;  5K8P A;  1BOB A;  4XPD C;  2GE3 A;  3QNV A;  1S7N A;  2FIA A;  3SJG A;  5IB9 A;  1YQE A;  3T8W A;  4CAF A;  3TO7 A;  4B5P B;  1M4I A;  2Q7S A;  3PBB A;  2EBJ A;  1B6B A;  2ZEH A;  2GLF A;  3PEI A;  4K30 A;  4ONW A;  3MGD A;  5A27 A;  5IV0 A;  2IJZ A;  4UFX A;  2WUU A;  1DTD A;  2NMT A;  3I1U A;  3IWW A;  2Q0Y A;  3DNS A;  1NMT A;  2PJ5 A;  3V8I A;  1FNO A;  2ZEM A;  4W9Y A;  4B12 A;  4IAV A;  3G3S A;  1WWZ A;  4MXU A;  1CX8 A;  3TCV A;  4CAE A;  4WJB A;  1ZLI A;  3PGP A;  4MFQ A;  3B3W A;  4MBU A;  5DS0 A;  3OWC A;  2ZEP A;  1MK4 A;  2PIY A;  4P6Y A;  3DGV A;  4F0Y A;  1KUX A;  4JZ0 A;  2AFX A;  2PDO A;  2GIV A;  3W91 A;  4MJ8 A;  4R87 A;  3PFE A;  1CM0 A;  3VWD A;  3EY5 A;  5H84 A;  1J4J A;  4OID A;  3DR6 A;  4R57 A;  2B4D B;  2JBJ A;  2YGW A;  3TOB A;  2VXK A;  3NFZ A;  4II9 A;  3LWU A;  2ZOF A;  4MHN A;  4A30 A;  1PUA A;  1IID A;  4XPL A;  4MMO A;  4ZBG A;  2B4B A;  1K4J A;  1YLE A;  1YLO A;  2QIR A;  4KOV A;  3GYA A;  3IFE A;  4X2T A;  4A32 A;  1QSM A;  2PRQ A;  2O28 A;  4ONU A;  4JXQ A;  3TT2 A;  1S7F A;  4ORF A;  3RZA A;  4KOR A;  4B14 A;  2PJB A;  1QSO A;  1Z8T A;  2OB0 A;  2Q7B A;  4KS9 A;  2ANP A;  1YVO A;  1JWQ A;  2VQY A;  3KR5 A;  4H2K A;  1IOF A;  3BXM A;  1ARL A;  2R7H A;  3TO6 A;  2EK9 A;  4MHP A;  1NSL A;  1BPN A;  4F0X A;  3CXQ A;  4KZT A;  4PXD A;  4B11 A;  3EO4 A;  4KOW A;  4UEF A;  2HQY A;  2Z3L A;  4FD5 A;  4C2X A;  2QJ8 A;  3IEH A;  2CTB A;  1V0C A;  4YU9 A;  4B13 A;  3B7I A;  2ABZ A;  2DPS A;  2PJA A;  4FD4 A;  4OP4 A;  3LOD A;  4PK3 A;  1IOI A;  4X8I A;  2ZOG A;  1VHE A;  4P4J A;  2YND A;  1Y9K A;  3PZJ A;  3S6K A;  4UCP A;  2PJ4 A;  3KAS A;  2Q04 A;  2VZY A;  4IK2 A;  4QUS A;  4MCS A;  1Q2D A;  3LAC A;  4CAW A;  3BLN A;  1AMP A;  3TC8 A;  3F8K A;  3TO9 A;  3B8G A;  2PJ7 A;  3DSB A;  3F5B A;  2PRB A;  4UIA A;  3B3C A;  1BO4 A;  3VAR A;  2FSR A;  1LAP A;  4MFK A;  4A2Z A;  4A33 A;  2Q4Y A;  3SJE A;  4NGP A;  3W6X A;  2DEA A;  2G3T A;  1IY7 A;  3D7D A;  4EME A;  5JQ4 A;  4CGO A;  1M4L A;  1YGH A;  2FIW A;  5G1Z A;  3WC6 A;  2IMO A;  2OH1 A;  2OZU A;  3S6G A;  2HC9 A;  3IWG A;  2J8N A;  2C6G A;  2XEF A;  3CPX A;  3FEC A;  4PSX A;  4R76 A;  2G3A A;  4OC0 A;  5G21 A;  7CPA A;  5K8O A;  2FE7 A;  3K9U A;  4CRZ B;  1IB1 E;  3ISZ A;  5CBM A;  3WR7 A;  3SJX A;  3R9E A;  3IU2 A;  4ZGY B;  2CTC A;  1XF8 A;  1Z5R A;  1XE4 A;  3FVL A;  3N7Z A;  4A39 A;  4MFZ A;  3IC1 A;  4GM5 A;  1ZG8 A;  4OC1 A;  4AVA A;  4YFJ A;  3B35 A;  4OC3 A;  4LX9 A;  4IUS A;  2F8H A;  1YX0 A;  1KUY A;  4EWT A;  3ZZI A;  1R43 A;  2B58 A;  5EBV A;  3H8G A;  4MHZ A;  3DR8 A;  4MFJ A;  3NA6 A;  3FEE A;  3PB8 X;  3FX6 A;  1NSA A;  4U9Z A;  1ELM P;  1UWY A;  2ODF A;  3PB4 X;  4C2Z A;  1KUV A;  6CPA A;  1YSJ A;  2F5I A;  3C26 A;  4FD6 A;  4AG9 A;  4HPS A;  5F46 A;  1XIX A;  3S9L A;  5DWM A;  3CT9 A;  4J3G A;  3P2H A;  5HH1 A;  5JPH A;  1HDU A;  3SXO A;  3W6S A;  5F48 A;  3RBU A;  4B6Z A;  4OME A;  2BO9 A;  1JQG A;  1PYT B;  2I79 A;  2PJ0 A;  2PJ3 A;  2BCO A;  1CPS A;  4U5Y A;  3IO1 A;  3LD2 A;  4NFR A;  5I0C A;  4A37 A;  3WT4 A;  3D67 A;  3PBE A;  1RXT A;  3KZW A;  5C82 A;  1XEB A;  1H8L A;  2ATR A;  4OAE A;  5THW A;  4IHM A;  1L0C A;  1Y9W A;  4CAV A;  1QMU A;  4NEX A;  3JTK A;  2PJ8 A;  4KOU A;  3IWE A;  4FWU A;  5IX3 A;  3FYN A;  4Z65 A;  2RFH A;  4MCR A;  4E0A A;  3V7Z A;  1F2P A;  2AFM A;  5CNP A;  3KL9 A;  2RC4 A;  2I3C A;  1XRY A;  3F0A A;  4CAX A;  2ZW5 A;  4OLL A;  4UWI A;  2OU2 A;  2OOT A;  4G1P A;  3D7G A;  3QAH A;  3I3G A;  2G9D A;  1Y0Y A;  2EUI A;  2OR4 A;  4CS0 B;  4L8A A;  1HEE A;  4P44 A;  4Y49 C;  3EC4 A;  1VKC A;  4DYO A;  4CYO A;  1QSN A;  1CPX A;  1R57 A;  2F7V A;  1LOK A;  2PJ6 A;  2OZG A;  3R96 A;  4A95 A;  2XEG A;  3D7F A;  1LRZ A;  1QQ9 A;  1TKJ A;  2HUZ A;  2JBK A;  3S6F A;  3S9M A;  1VHO A;  4AG7 A;  4KVX A;  3WC7 A;  4FBE A;  3GUX A;  4MY3 A;  4MHY A;  2Q4Z A;  2BOA A;  2P6E A;  4R3L A;  2YNE A;  2G0B A;  4A31 A;  2YNC A;  2Z3O A;  3RAM A;  1M1D A;  2PJ9 A;  1QST A;  4R3K A;  3DDD A;  3IIB A;  1M44 A;  3CXP A;  4M3S A;  1OZP A;  4Q7A A;  4UFV A;  2AE6 A;  4MHD A;  5C88 A;  4BIN A;  1BAV A;  3B2Y A;  1BLL E;  2FT0 A;  2NYQ A;  4UWJ A;  2ZW7 A;  2WPX A;  4MCQ A;  3PB6 X;  2POK A;  2I00 A;  4TNU A;  1N71 A;  3DLJ A;  3QB8 A;  1XJO A;  4BMH A;  3WAB A;  3NH5 A;  5CPA A;  4CGM A;  1X10 A;  2B3U A;  2ZEN A;  3MRU A;  4RS2 A;  1HDQ A;  3P2F A;  4PK2 A;  4LQ6 A;  4U9Y A;  4UFW A;  5H86 A;  2REF A;  3TFY A;  1RTQ A;  1YVK A;  4M6I A;  4C2Y A;  2ZEL A;  2PE3 A;  4IF5 A;  1I21 A;  2GAN A;  1XMT A;  3SI0 A;  4XPD B;  1S5K A;  2VEZ A;  3HLP A;  2BUE A;  1IYK A;  2C6P A;  4KVM E;  2REE A;  5G20 A;  4P45 A;  2Z3M A;  4PPZ A;  3MN8 A;  1GYT A;  2V8D A;  1I12 A;  3B3V A;  3I9S A;  3R1K A;  4P4E A;  3R9F A;  2X7B A;  4HNX B;  4UEZ A;  3KKW A;  2D4P A;  4KUB A;  2AFZ A;  1GHE A;  4C7I A;  2R98 A;  4JWP A;  2QYV A;  4OC4 A;  3QAY A;  4KSA A;  4L89 A;  3GKR A;  4RUH A;  3TX8 A;  1ON0 A;  2H5M A;  2FS5 A;  4NJQ A;  5AG4 A;  5JH9 A;  1Z2L A;  2OZH A;  4QBJ A;  1AUG A;  4OIW A;  4HNY B;  1TKH A;  3KQX A;  2WPW A;  3L2N A;  2YNC C;  4FAI A;  3FJU A;  4KSI A;  4R6T A;  1A2Z A;  3EFA A;  2CIJ A;  3K2K A;  4UEE A;  1YK3 A;  4M6G A;  4XPK A;  3KHZ A;  4FUU A;  1VGY A;  5J1Q A;  3E0K A;  4Q38 A;  5KTA A;  5A28 A;  2P0W A;  4KUA A;  4XNH C;  1Y0R A;  1Q2Y A;  4NGT A;  4PV6 A;  2JEW A;  4NGN A;  4JXR A;  5LRJ A;  3KHX A;  1X12 A;  3R95 A;  1Y7E A;  4JD6 A;  3ISX A;  1KZF A;  2PIZ A;  3IU1 A;  4AVC A;  2CY2 A;  1Q2C A;  5F49 A;  1XMB A;  2B5G B;  3GLJ A;  3FBU A;  1IIC A;  3FED A;  4JJX A;  3CZX A;  3ZJ0 A;  3PFO A;  2FVG A;  2Z0Z A;  4KOT A;  4CYN A;  5AG7 A;  5D29 A;  2D4O A;  2ZEF A;  3BHX A;  4P4I A;  5FVJ A;  4BD9 A;  4E8O A;  4X5K A;  2Z3N A;  2Q51 A;  4ZI6 A;  4HKF A;  2C6C A;  4P4B A;  1Q7L A;  1VIX A;  1IU8 A;  2K5T A;  2PR8 A;  1RO5 A;  2V77 A;  1MJ9 A;  4B10 A;  4EVY A;  3N5F A;  2FL4 A;  5HVH A;  4WWV A;  4GXH A;  1S7L A;  1IYL A;  4KLW A;  4BBH A;  4NGR A;  1S7K A;  1ZO0 A;  2HV2 A;  5HVF A;  2P6G A;  4F9U A;  4NSQ A;  1OBR A;  2IL4 A;  2VZZ A;  4B5O A;  4RI1 A;  4M85 A;  4PSW A;  1TF8 A;  2B3V A;  4UBR A;  3RO0 A;  3EXN A;  3H8F A;  1CP7 A;  4A38 A;  2V8G A;  1XFO A;  4CYQ A;  1TXR A;  1XBU A;  2V8H A;  2HB6 A;  1B87 A;  4K3N A;  5AG5 A;  5G22 A;  3CXS A;  3KR4 A;  2O53 A;  2XEJ A;  3H4Q A;  1Y7R A;  5HMN A;  4R7M A;  1CP6 A;  1UFH A;  2GRE A;  1S60 A;  1PCA A;  2GU2 A;  3SI2 A;  4ZX9 A;  5HVG A;  2QEC A;  1FY7 A;  2ZW4 A;  2BSW A;  2ZEO A;  3FNC A;  2DF5 A;  1ZG7 A;  1ZLH A;  1LCP A;  4A94 A;  1TF9 A;  3CDX A;  3KGQ A;  1ARM A;  3HUV A;  2FCK A;  1CBX A;  2Q4V A;  2R1I A;  3RNZ A;  4CYP A;  4F8Z A;  1MJA A;  2PVW A;  5BWA B;  4P4F A;  4EFD A;  3BJ7 A;  3H5Z A;  2KCW A;  3B3T A;  1FT7 A;  2ZEG A;  4NGQ A;  4AXV A;  1AYE A;  1Z9U A;  5LYI A;  4UCN A;  2DPT A;  3D8P A;  3R9G A;  4B5P A;  4P4D A;  1YR0 A;  4UIB A;  2GFQ A;  1KWM A;  3D3S A;  2BL1 A;  3BI1 A;  3SHP A;  4ZY2 A;  4XNH B;  4MI4 A;  2AFS A;  3PB9 X;  2WSA A;  4MFL A;  2CF4 A;  4MFP A;  4MCP A;  1Z8X A;  3BJ8 A;  4Q36 A;  5D8N A;  3GIU A;  5F09 A;  4NCZ A;  2VL1 A;  2VBQ A;  4F9V A;  1QSR A;  1I1D A;  3GB0 A;  4NXY A;  3VAT A;  4FD7 A;  4H89 A;  3WC5 A;  1Z4R A;  2AFO A;  3KI9 A; 
#chains in the Genus database with same CATH homology
 5J8F A;  3VWE A;  2Z3P A;  2J8R A;  4KOY A;  2FXF A;  1PU9 A;  2B4D A;  5KTC A;  1TIQ A;  2CNM A;  4UCM A;  1MJB A;  4JLY A;  2PSW A;  2PC1 A;  3TE4 A;  2ARH A;  3GY9 A;  1CJW A;  2Z11 A;  2CNT A;  4DNC A;  2Z3K A;  2ZW6 A;  4AVB A;  4MY0 A;  4UA3 A;  4R9M A;  4LUA A;  3S6H A;  3RYO A;  4E2A A;  4QVT A;  3FB3 A;  1Z4E A;  2P6F A;  4QC6 A;  5AG6 A;  5DWN A;  2CNS A;  4NF1 A;  3SXN A;  2A4N A;  4KVO E;  4KLV A;  2JEV A;  2QML A;  4H6Z A;  3TTH A;  2ZPA A;  5AGE A;  5EC4 A;  2JLM A;  4YGO A;  3T9Y A;  4Y49 B;  3FXT A;  4OAD A;  4CRY B;  2Y0M A;  2PQ8 A;  1M4G A;  4KSF A;  4AB7 A;  2C27 A;  4KOS A;  2JDD A;  4GS4 A;  3D2P A;  2J8M A;  2ZXV A;  3JVN A;  3TOA A;  4H6U A;  4CGL A;  3D2M A;  3JUW A;  4C7H A;  4QB9 A;  5GCN A;  1M4D A;  4HNW B;  3UY5 A;  5E96 A;  2Q44 A;  4KOX A;  3PP9 A;  3FIX A;  4CGP A;  1U6M A;  2CXA A;  5ISV A;  1VHS A;  2EVN A;  2R8V A;  4I49 A;  5IB0 A;  2DXQ A;  4YRH A;  1P0H A;  4C68 A;  4F6A A;  3FRM A;  1YRE A;  3G8W A;  1S3Z A;  5J8C A;  2JDC A;  2VI7 A;  2BEI A;  2B5G A;  3A9L A;  3NE7 A;  2PR1 A;  4CGN A;  3IGR A;  1WK4 A;  1P4N A;  5KTD A;  2Z10 A;  2AJ6 A;  5F47 A;  3T90 A;  1NE9 A;  1SQH A;  1BOB A;  4XPD C;  2GE3 A;  1S7N A;  2FIA A;  4CAF A;  3TO7 A;  4B5P B;  1M4I A;  1B6B A;  4K30 A;  3MGD A;  5A27 A;  5IV0 A;  4UFX A;  2WUU A;  2NMT A;  2Q0Y A;  3DNS A;  1NMT A;  3V8I A;  4B12 A;  3G3S A;  1WWZ A;  3TCV A;  4CAE A;  4MFQ A;  3PGP A;  4MBU A;  3OWC A;  1MK4 A;  4F0Y A;  1KUX A;  2PDO A;  2GIV A;  3W91 A;  4MJ8 A;  4R87 A;  1CM0 A;  3VWD A;  3EY5 A;  5H84 A;  1J4J A;  3DR6 A;  4R57 A;  2B4D B;  3TOB A;  2YGW A;  2VXK A;  4II9 A;  4A30 A;  1PUA A;  1IID A;  4XPL A;  4ZBG A;  2B4B A;  1K4J A;  1YLE A;  2QIR A;  4KOV A;  3GYA A;  4A32 A;  1QSM A;  2O28 A;  4ONU A;  4JXQ A;  3TT2 A;  1S7F A;  4ORF A;  4KOR A;  4B14 A;  1QSO A;  2Q7B A;  2OB0 A;  4KS9 A;  2VQY A;  1YVO A;  2R7H A;  3TO6 A;  1NSL A;  4F0X A;  3CXQ A;  4KZT A;  4B11 A;  3EO4 A;  4KOW A;  2HQY A;  2Z3L A;  4FD5 A;  4C2X A;  1V0C A;  4B13 A;  4FD4 A;  2DPS A;  4PK3 A;  3LOD A;  2YND A;  1Y9K A;  3PZJ A;  3S6K A;  4UCP A;  2Q04 A;  2VZY A;  4QUS A;  1Q2D A;  4CAW A;  3BLN A;  3F8K A;  3TO9 A;  3B8G A;  3DSB A;  3F5B A;  2PRB A;  1BO4 A;  2FSR A;  4MFK A;  4A2Z A;  4A33 A;  2Q4Y A;  3W6X A;  2G3T A;  5JQ4 A;  4CGO A;  1YGH A;  2FIW A;  5G1Z A;  2OH1 A;  2OZU A;  3S6G A;  3IWG A;  2J8N A;  4PSX A;  2G3A A;  5G21 A;  2FE7 A;  3K9U A;  4CRZ B;  1IB1 E;  3WR7 A;  3R9E A;  3IU2 A;  4ZGY B;  1XF8 A;  3N7Z A;  1XE4 A;  4MFZ A;  4AVA A;  4YFJ A;  4LX9 A;  4IUS A;  1YX0 A;  1KUY A;  3ZZI A;  5EBV A;  2B58 A;  3DR8 A;  4MFJ A;  4U9Z A;  4C2Z A;  1KUV A;  2F5I A;  3C26 A;  4FD6 A;  4AG9 A;  5F46 A;  1XIX A;  5DWM A;  5JPH A;  4J3G A;  3P2H A;  5HH1 A;  3W6S A;  3SXO A;  5F48 A;  2I79 A;  4U5Y A;  3LD2 A;  5I0C A;  1RXT A;  5C82 A;  1XEB A;  2ATR A;  4OAE A;  1L0C A;  1Y9W A;  4CAV A;  4NEX A;  3JTK A;  4KOU A;  3IWE A;  5IX3 A;  3FYN A;  4E0A A;  5CNP A;  2RC4 A;  3F0A A;  4CAX A;  2ZW5 A;  4OLL A;  4UWI A;  2OU2 A;  3QAH A;  3I3G A;  2EUI A;  4CS0 B;  4L8A A;  4Y49 C;  3EC4 A;  1VKC A;  4CYO A;  1QSN A;  1R57 A;  2OZG A;  3R96 A;  4A95 A;  1LRZ A;  2HUZ A;  3S6F A;  4AG7 A;  4KVX A;  4MY3 A;  2P6E A;  4R3L A;  2YNE A;  2G0B A;  4A31 A;  2YNC A;  2Z3O A;  1M1D A;  1QST A;  4R3K A;  3DDD A;  1M44 A;  3CXP A;  4M3S A;  1OZP A;  4UFV A;  2AE6 A;  4MHD A;  5C88 A;  2FT0 A;  4UWJ A;  2ZW7 A;  2WPX A;  2I00 A;  1N71 A;  3QB8 A;  4CGM A;  4BMH A;  2B3U A;  4RS2 A;  3P2F A;  4PK2 A;  4U9Y A;  4UFW A;  5H86 A;  3TFY A;  2REF A;  1YVK A;  4C2Y A;  4IF5 A;  1I21 A;  2GAN A;  1XMT A;  4XPD B;  1S5K A;  2VEZ A;  2BUE A;  1IYK A;  4KVM E;  2REE A;  5G20 A;  2Z3M A;  1I12 A;  3I9S A;  3R1K A;  3R9F A;  2X7B A;  4HNX B;  3KKW A;  2D4P A;  4KUB A;  4C7I A;  1GHE A;  2R98 A;  4JWP A;  4KSA A;  4L89 A;  3GKR A;  1ON0 A;  2H5M A;  2FS5 A;  5AG4 A;  2OZH A;  4QBJ A;  4HNY B;  2WPW A;  2YNC C;  3EFA A;  1YK3 A;  4XPK A;  3E0K A;  4Q38 A;  5KTA A;  5A28 A;  2P0W A;  4KUA A;  4XNH C;  1Q2Y A;  4PV6 A;  3R95 A;  4JXR A;  4JD6 A;  1KZF A;  3IU1 A;  4AVC A;  2CY2 A;  1Q2C A;  5F49 A;  2B5G B;  3FBU A;  1IIC A;  4JJX A;  3ZJ0 A;  2Z0Z A;  4KOT A;  4CYN A;  5AG7 A;  2D4O A;  5FVJ A;  4E8O A;  4X5K A;  2Z3N A;  4HKF A;  2K5T A;  2PR8 A;  1RO5 A;  4B10 A;  1MJ9 A;  4EVY A;  2FL4 A;  1S7L A;  1IYL A;  4KLW A;  4BBH A;  1S7K A;  1ZO0 A;  2HV2 A;  2P6G A;  4NSQ A;  2IL4 A;  2VZZ A;  4B5O A;  4RI1 A;  4M85 A;  4PSW A;  4UBR A;  2B3V A;  3EXN A;  4CYQ A;  5G22 A;  1B87 A;  5AG5 A;  3CXS A;  3H4Q A;  1Y7R A;  5HMN A;  1UFH A;  1S60 A;  2QEC A;  1FY7 A;  2ZW4 A;  2BSW A;  3FNC A;  2FCK A;  2Q4V A;  2R1I A;  4CYP A;  5BWA B;  1MJA A;  3BJ7 A;  3H5Z A;  2KCW A;  1Z9U A;  4UCN A;  2DPT A;  3D8P A;  3R9G A;  4B5P A;  1YR0 A;  3D3S A;  2BL1 A;  3SHP A;  4XNH B;  4MI4 A;  2WSA A;  4MFL A;  4MFP A;  3BJ8 A;  4Q36 A;  4NCZ A;  2VBQ A;  1QSR A;  1I1D A;  4NXY A;  4FD7 A;  4H89 A;  1Z4R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...