1CG2A

Carboxypeptidase g2
Total Genus 135
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
135
sequence length
389
structure length
389
Chain Sequence
QKRDNVLFQAATDEQPAVIKTLEKLVNIETGTGDAEGIAAAGNFLEAELKNLGFTVTRSKSAGLVVGDNIVGKIKGRGGKNLLLMSHMDTVYLKGILAKAPFRVEGDKAYGPGIADDKGGNAVILHTLKLLKEYGVRDYGTITVLFNTDEEKGSFGSRDLIQEEAKLADYVLSFEPTSAGDEKLSLGTSGIAYVQVNITGKASHAGAAPELGVNALVEASDLVLRTMNIDDKAKNLRFNWTIAKAGNVSNIIPASATLNADVRYARNEDFDAAMKTLEERAQQKKLPEADVKVIVTRGRPAFNAGEGGKKLVDKAVAYYKEAGGTLGVEERTGGGTDAAYAALSGKPVIESLGLPGFGYHSDKAEYVDISAIPRRLYMAARLIMDLGAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metallocarboxypeptidase
molecule keywords CARBOXYPEPTIDASE G2
publication title Crystal structure of carboxypeptidase G2, a bacterial enzyme with applications in cancer therapy.
pubmed doi rcsb
source organism Pseudomonas sp.
total genus 135
structure length 389
sequence length 389
chains with identical sequence B, C, D
ec nomenclature ec 3.4.17.11: Glutamate carboxypeptidase.
pdb deposition date 1996-12-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01546 Peptidase_M20 Peptidase family M20/M25/M40
A PF07687 M20_dimer Peptidase dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.360 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1cg2A02
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 1cg2A01
1ELMP 3WC7A 2AFMA 1VGYA 2ABZA 4PXEA 2Q51A 7CPAA 1HDUA 2Q4ZA 4PQAA 4A38A 2AFSA 2CF4A 3D7FA 2ZEGA 3FEDA 1FNOA 4WWVA 3IC1A 3BI0A 2IQ6A 1JQGA 2PJ5A 5K8OA 2AFWA 3KHZA 3H8EA 1CP6A 1BPNA 3GLJA 3B2YA 4NGNA 4WJBA 3ISXA 4PXCA 3PB6X 3WABA 3KI9A 1Z5RA 1M4LA 3IIBA 3B35A 5CBMA 1Z2LA 4ZYQA 3LWUA 1Z8LA 3PEIA 5LRGA 4O23A 4MXUA 5ELYA 2V8HA 3ISZA 2BCOA 4ZY0A 3PB9X 4A94A 2ZOFA 1EE3P 3SJFA 3PB7X 4EMEA 3NH4A 4NGMA 2Q43A 5JGFA 3TC8A 1PYTB 5LYIA 2QJ8A 3PB4X 2GLFA 1IGBA 2CIJA 2WZNA 2PJ4A 3D66A 4NGRA 3DLJA 2ZEHA 3NH5A 4R76A 3CDXA 1H8LA 2EK8A 4MHPA 1XBUA 1R3NA 4MCSA 4DJLA 2PJBA 3MN8A 1BLLE 4A39A 3PB8X 4MMOA 4AXVA 4X8IA 4H2KA 1LAPA 2ZENA 2OOTA 5LYLA 4UEFA 1YSJA 2NSMA 4F8ZA 4OKOA 5D29A 3K2KA 1VIXA 1ARMA 3FEEA 4DUKA 4MCPA 3BXMA 2ZELA 5D8NA 2F8HA 5HVFA 4LQGA 1F2OA 1Y0YA 1QQ9A 2AFZA 1TXRA 3BHXA 1F57A 4UIBA 3BI1A 4IAVA 4ZX8A 3FH4A 2C6CA 1R43A 3DGVA 2PJ0A 4ZI6A 3SI1A 1F2PA 4NJQA 3FMCA 4OC1A 4UIAA 1YLOA 1Y0RA 4P6YA 2O4HA 1YW6A 3FVLA 2CTCA 3KQZA 2JEWA 2F7VA 3FECA 5K8NA 3PFEA 1RTQA 2RB7A 2V8VA 2PVWA 3V7ZA 2WYRA 3H8GA 5DS0A 3B3SA 2POKA 1CPXA 4OIWA 4MHZA 3D68A 4OC2A 1OBRA 4P4BA 3PRTA 2V8GA 2PJ2A 3V38A 4P45A 3IFEA 4P4FA 5J1QA 1CBXA 3IWWA 3FJUA 2GU2A 3FF3A 4MCRA 4BD9A 3RAMA 2C6PA 4FAIA 3CT9A 3S9LA 3PFOA 2VL1A 2PVVA 3QNVA 4R6TA 1DTDA 6CPAA 1ZG7A 1CPSA 1HDQA 4DYOA 3D4UA 3KASA 1YMEA 3D67A 4IK2A 1PCAA 3WC6A 2ANPA 3B3TA 1VHOA 2DEAA 1UWYA 4OC5A 3IJ3A 3L2NA 2AFUA 4ZY1A 3H8FA 5K8PA 1XRYA 2O53A 2C1CA 2PE3A 5F09A 1YW4A 4A37A 3FX6A 4NGQA 4UF4A 4OC4A 3RZAA 2IMOA 4PPZA 1IY7A 3GB0A 4MCQA 2RFHA 3WT4A 1AYEA 3B3WA 5LRKA 4P4EA 1KWMA 1ZG8A 4EWTA 3HUVA 3CPXA 5CPAA 4MRIA 2JBJA 4F9UA 2BO9A 2ZEEA 5HVHA 2J9AA 2QYVA 5I4MA 4R8FA 2PJ7A 4ONWA 3S9MA 5HVGA 1AMPA 3PBEA 1BPMA 2PJ3A 3D7DA 2QVPA 5IB9A 4NGSA 4FUUA 3SJEA 4UEEA 1LANA 2PIZA 8CPAA 5LYFA 1CX8A 4IHMA 2CTBA 2HC9A 3S9NA 3VH9A 2JBKA 1CP7A 1TKHA 3I1UA 4PXBA 2PJ1A 2BOAA 3RBUA 4NGPA 2PJ8A 3N5FA 1VHEA 4OP4A 1TF9A 1XMBA 3KQXA 4ZX9A 1TKFA 4KSIA 1ZG9A 2PJAA 3SI2A 3GUXA 4G1PA 2PRQA 1QMUA 2PCUA 1HEEA 3KR5A 1LFWA 4P10A 4W9YA 2PJ6A 5LYDA 4P4DA 1Q7LA 3KZWA 4YU9A 2FVGA 2IJZA 3B7IA 2ZOGA 3VATA 3SJGA 1TF8A 1ZLIA 4OC3A 3IEHA 3IO1A 3TX8A 2GLJA 1ZLHA 4CPAA 2G9DA 2V77A 4P4JA 4B6ZA 3D7HA 2NYQA 2ZEMA 2EWBA 2AFOA 4R7MA 4F9VA 4K3NA 4OC0A 3SI0A 5THWA 4EFDA 3JRUA 4X3RA 4YWYA 2EK9A 1TKJA 2GREA 1LAMA 4FBEA 2ZEPA 4Z65A 5K8MA 4NJRA 4ZY2A 1DE4C 4GM5A 3K9TA 3MRUA 4TWEA 2ZEDA 1XJOA 2C6GA 4TNUA 3T8WA 4P44A 2V8DA 1ELLP 3HLPA 3KGQA 2XEJA 4P4IA 1FT7A 3D7GA 3LMSA 3VARA 1CG2A 4X2TA 1XFOA 3NA6A 4MHYA 1ARLA 4RUHA 3NH8A 3KL9A 3CPAA 5HXDA 2XEFA 2HB6A 2PIYA 1GYTA 3WC5A 3KHXA 4JZ0A 2XEIA 4JYWA 5JM6A 1LOKA 2XEGA 1NSAA 1BAVA 1Y7EA 2PJCA 3B3CA 2OR4A 3KR4A 3NFZA 3PBBA 3B3VA 4MHNA 4OIDA 4PXDA 2ZEFA 4UEZA 2AFXA 5JH9A 2PJ9A 5LRJA 4NFRA 4FWUA 2ZEOA 4Q7AA 2I3CA 3SJXA 1LCPA 4NGTA 4OMEA
chains in the Genus database with same CATH superfamily
3PX4A 3DSBA 1VQ9S 2KN4A 1VGYA 4B3RJ 2ABZA 2CG8A 3PX0A 5GAHI 3PM9A 2R2TA 4F04B 4HI1A 1WJ9A 3L7PA 4LBHA 1MJBA 3TAPA 3ISXA 1PJ5A 1L3VA 1W26A 3IGRA 1NJYA 3MCNA 4A8YA 1CQNA 4JV0A 2CAJA 3X1LB 3IIBA 3IRXA 4OZ1A 4X4NA 3G4SS 1Z8LA 2AJQA 1UFHA 1M5HA 2Y9HA 3M2UA 3K0JA 2QT7A 2ASYA 2V8HA 2JLFA 4ZY0A 4MIWA 3CXQA 3M8QB 3VZIA 4L74A 3ISND 4E8OA 3P3DA 3GFZA 2UUCF 3D3SA 5AGEA 2ATRA 2ACMA 2A3JA 1TL7B 4JYAF 4YRHA 4RBTA 3RR8A 2QV6A 3ADAC 2CDRB 4A39A 5KFEA 3TANA 4AXVA 2HBYB 1L5UA 1FDDA 1WC0A 3SZ2A 3PR5B 2VPYB 2J8NA 3DDNA 2IM3A 4DSIA 1DHMA 4KYZA 4J9SA 3VCDA 5D8NA 1UEKA 3G8WA 4Y0FA 4GRSA 1EQMA 4A46A 5A0YB 3UY5A 2UUCJ 2FE7A 2C3YA 4ECXA 5KG6A 2QIRA 2C6CA 2UZAA 4JYAJ 2RILA 2QL9B 4ID8A 4MBUA 1T05A 2H5IB 3OXGA 1Y0RA 1M90T 1RAGB 2V8VA 4KC5A 1U0HB 2XO7A 2Y1IA 3RRHA 3ZZPA 3MF5A 3PYGA 2C1EB 1UWBA 1KFDA 5A8KB 2GCFA 2E5GA 3G82A 3HT3A 4NLWA 2RC4A 4KOXA 1WK4A 4RU2A 3SV3A 2DK2A 4X4SA 2VH7A 4URQU 2H65B 1HNXF 2R98A 1X9WA 3S9LA 2VL1A 5D4NA 4MKVA 1ZG7A 1DBDA 5JQ4A 1SIZA 2NQPA 4K2XA 1NLKL 3E01B 1TKDA 2B4BA 2DGUA 1UWYA 4P74A 4KGZB 1S0VA 2YNCA 1D9DA 4KORA 4WWSA 3MUTP 1REGX 2C1CA 5FJ4A 3CB4A 4PABA 1NHVA 3T5LA 2PEHA 3MM9B 4DLGA 1HNXJ 2HWIA 4Y49C 3NY0A 1JJCB 1M4IA 3TVZA 2VQYA 3HPOA 2J0QD 1HQEA 3CWJA 4J90A 3CPXA 2QZ8A 4BINA 1LW0B 3PBEA 5BYRA 2ZJPQ 1NE9A 2CWKA 3I5BA 5CNPA 1X4EA 2Z3KA 3TUPA 3QBCA 1RISA 3IWGA 3LUYA 4DSEA 4YP3A 3ZO7A 4M63A 3ZFVA 3GG0A 4CWBA 3NCPA 4M5JA 5F0WA 5E3CA 2PJAA 2JEIA 2FLLA 4OI4A 1BQMB 2ZZMA 2ZKUA 1MG7A 5IWAF 2OD6A 1EB0A 2ZXVA 1JWQA 3GIMA 4NF1A 2ZH4A 4IOCQ 4ZVPB 2CVIA 1KNZA 2HFZA 1CJVB 3M8QA 4TYBA 1NKEA 3P2FA 1CC7A 3MR2A 4KGXB 5LMUF 4KH0B 4B6ZA 3IGVA 3OWCA 2VBXA 3KHHA 3DLHA 1S57A 2W4DA 4O3PA 5IWAJ 1PGZA 1S7LA 1WI8A 3SQOP 4GMKA 2DPSA 3JB9k 3WR7A 5HL7Q 2GREA 2HHSA 4GM5A 4TWEA 1YRUA 5LMUJ 1FEEA 5BXIA 1S10A 1FJEB 5A0YA 4PK3A 4LRFA 2HLTA 3KDOA 3TO7A 2G2OA 4M5NA 3THTA 2R7QA 2KKHA 3BGOP 5HXDA 1S0OA 3QWPA 2DGTA 4NMXA 1YZ6A 4P2SA 1Q5YA 3J80U 2CPYA 2JZ5A 4N56A 1U0HA 3KKWA 3MPWA 1IYLA 2BJDA 2LXIA 1WHVA 4OJ1A 3EJMA 4NEYA 4DS4A 4P52A 5E3AA 2HHXA 2LMIA 4ZS6A 1LCPA 2AKWB 5DQGA 3UNYA 3KOAA 5CD4H 3G71S 2DIUA 1I1GA 4LF1A 3NGUA 4KUAA 1HDUA 3BSOA 3BR9A 4IYQA 2MZ1A 5ADZA 4ECUA 2O3DA 4KR0B 4I67A 3OFGA 5L1LA 3DLKB 2GQQA 4I4BA 3D3CJ 2ZUGA 3QRRA 2DNPA 4ID5B 3MM9A 1HKAA 1ZAWA 3VVTA 2GHVC 2R7WA 1R27B 2HNZB 3D2MA 2XMVA 3BQ0A 3DI6B 3LGNA 2MZSA 3CDWA 4EMEA 4A4JA 2C2KB 5JGFA 1PYTB 2MSSA 2FTRA 2JWNA 1LW0A 2HQIA 2CNSA 4MK8A 4P2XA 1NK5A 2PEBA 3QSYB 1K1SA 4ITSA 2EFPA 4F50A 3J7YI 5IT9Y 1RAJA 2BR0A 4CLWA 1U1PA 4MFBB 4K4SA 4Y2CA 5C42A 2VG6A 2Z2ZA 2KJWA 2V69A 3H59A 2OFHX 3MN8A 3DLLQ 1JIHA 1NSLA 5LYLA 3CD0A 3RW6A 1YSJA 2ZH3A 3M30B 4LBPA 1KKHA 3WDOA 4Y2MA 4RW7B 4UOHA 1YGHA 4OJHA 3D7SB 1Q8KA 2Z3OA 3BHXA 4IOBA 2LEPA 3TEHB 3HMJG 3W8GA 1CJVA 4QWEA 4P2MA 2FD2A 4WP8A 2FVQA 4KOUA 1T9XA 1U47A 5HQ8A 1TK8A 2RDJA 3TVKA 3OTBA 2HRTA 1YJ9S 9ATCB 1NDLA 1YGYA 3O44A 2E7WA 1VHSA 5KFFA 4ANEA 1FKAF 3DKDA 4WTYA 1KEKA 3V6DB 4KJIA 3L95X 6CPAA 4CYUB 5KG3A 1RHJB 2ZEJA 1HW9A 4MAKA 1SB6A 3D5MA 2YWKA 2MQQA 1JLGB 3D0GE 5M2PA 3GJRB 1K9MT 3H8FA 1HBUA 4C4WA 2O53A 4ECQA 2JEJA 5FLXY 2E9ZA 1RYRA 2KRRA 3AJ2A 3F73A 2P6TA 3K7RA 1UP1A 2R7SA 2PN6A 1S6PA 4ZP7A 2XWYA 4CH7A 2QA2A 3Q8SB 4U67Q 1YG0A 1U1MA 5KFUA 1XR7A 3V6KA 2LA4A 2VFSA 1OS5A 3HZEA 2B51A 4QQBA 2IAJB 2VD3A 3S8SA 4YOEA 1UVJA 3FKBA 2DGVA 3D7DA 1V5IB 5IB9A 3ZNJ1 4ER8A 4OZ2A 4X4VA 5CD4A 3BBCA 4PPDA 2O1PA 3S9NA 1QAXA 3AY0A 1WKKA 1XMBA 1RXOB 3PW0A 4LR9A 5K5MA 2CZVC 4ZGYB 4K4WA 5M2UA 3MTJA 1RAEB 2XG8A 3SQGB 1KLNA 1FDAA 4YGOA 2MXYA 2W8KA 3DI6A 3P5TL 2F4FA 2ACYA 3CJ3A 4M5DB 2CQGA 3Q86A 1B64A 2OEJA 3T1HF 4FF2A 3LANA 3MM6B 3PHTA 1LQ9A 1OIAA 3PY8A 4C6AA 3L4BC 4DPXA 2MQLA 4WPAA 1Y4ZB 2AFOA 3NE7A 4C8OA 3MHYA 3A1YG 3IR7B 2HGLA 2CXEA 5KFXA 1T3NA 1MWQA 2GV1A 3OHBA 4U7UD 2KT3A 4Q2MA 1XMOF 3M30A 1JLBB 4DL7A 1TU0B 3KLIB 1B7FA 1HBMB 3T1HJ 4A48A 3Q8QB 4DQIA 3RBXA 3FFIB 2G2YA 3MEGB 2HBRB 2B6AB 3GYGA 4P4IA 1AB8A 5D0RA 1TL1B 5DETA 1NK8A 2A18A 4USHA 1SJRA 4HYKA 3UCGA 3KWMA 4R3KA 2CPIA 3I0RB 3OW2R 1XMOJ 3W7BA 1VC6A 2V2VA 2ZH9A 4MHNA 2OSRA 4FVMA 2DNRA 2G3AA 1KLMB 4H4MA 1V6HA 3RR7A 1ZAXA 1RAAB 4DPOA 3R5BA 4RS2A 1N5VA 4RUCA 3V6DA 2BX6A 2BJ8A 3VF0B 5GAHU 4C2ZA 2LQ9A 3GV7B 2OO4A 4F3QA 4J9VA 2N7YA 3OTOF 2AFSA 3SXLA 2ZEGA 3FEDA 1JLGA 3TW0A 2XM3A 5T7LB 3NAHA 1JQGA 4KE5A 6FDRA 1CP6A 2UXCF 2G4BA 3LAMA 3SXNA 3ZJ0A 2AT1B 4NGNA 3M2RB 5KG2A 4OL8A 4N8NA 1HD0A 2HVEA 1Z5RA 3GU0A 2KH9A 2HIYA 2FCKA 1N52B 4F25A 1UKUA 1RTIB 4X65F 3CC4S 3SSRA 3MZIA 4IH6A 5MAOA 3OUYB 2ZKTA 5D0HA 3VQTA 3FEYB 3R95A 3OTOJ 4KUBA 1YRTA 5HMZA 2IM1A 2VKZG 1I3OB 2IAJA 4CLUA 2F9JA 5CCMA 4MFLA 3DNCA 2RU9A 4TY8B 2IJNA 4M6HA 1Y00A 2F1FA 4RW8B 3HD2A 4R76A 4NPOA 1H8LA 4AVCA 2J9DA 2YNIB 3ENAA 4X65J 5ETMA 5HQLA 1BLLE 4OI3A 2E1MC 1FD2A 2OP5A 1Q2DA 4LF5F 1FRLA 1VJWA 2QFJA 3HSDA 2UUWA 3DDIA 1S1XB 3CW2C 3FVYA 1WTFA 3GJTB 3OSNA 1FVSA 3EPGA 5DLFA 2WVFA 5AE2A 2ZH1A 2VC0A 5KFHA 1QQ9A 2MQ8A 3SQGA 1RT2B 2E1AA 4PG5A 4M5DA 4ZX8A 1XJWB 1VQ4S 4N77A 1VS3A 3KG0A 2R42A 3FIXA 2QFIA 1F60B 4OC1A 3TT2A 2MMYA 1YLOA 4P6YA 2BXJA 3HVTA 2O4HA 2HG4A 4LF5J 2HZAA 1BE4A 4AB7A 4KSEB 5D6GA 3OQ2A 1MJAA 3GTYX 2U1AA 2FLNA 1T9VA 1W25A 3M1VB 2NUUG 2KCWA 3N9UC 4XPKA 2HS0A 1JLBA 3BSNA 3KLIA 3BS9A 2C6PA 2CNTA 4USVA 2PVVA 1HBMA 2RF2B 1FRMA 4M85A 4USKA 4F2RA 1P1LA 3FFIA 2IA6A 3MEGA 2B6AA 4F0YA 2CVEA 2DEAA 1FKPA 2C3PA 2AYGA 1TL1A 2AW0A 2KFZA 5EHHA 4U6PA 1TL3B 4F8RA 1UFLA 4DQPA 2ZW6A 1IKYB 2XHCA 3EICA 3I0RA 3SMZA 1XE4A 4F36A 3B82A 5IXUA 1IKVB 1RHMB 1Y3KA 5HATA 2ILYA 1T3OA 4TYAA 4BBHA 1V0CA 1PJ6A 1SXLA 1KLMA 4R8UB 3CDUA 2OPRB 3NP5A 2CQIA 4MRIA 3W5XA 4ZIWA 1ZTTA 4C7QA 4CNYA 2DPIA 1IBKF 2CPDA 2V6AA 2BVZA 3K9UA 2M8DB 1FXLA 2B4VA 2Z58B 3DU5A 2QEXS 4IUFA 4P6QA 1Q4RA 2KM8B 5B0DA 6AT1B 1LANA 3G6XA 3CJKA 3D6FB 3GZ7A 2IPOB 1CP7A 3BJ8A 5T7LA 4DFKA 2JSXA 2XS2A 5H84A 1TF9A 2HS3A 4ZX9A 1TKFA 3W66A 2VODA 3GUXA 1RT4B 1WEXA 3M2RA 5KTCA 2M9KA 3MD1A 2V2ZA 2YWFA 4RO0A 3M6WA 1WD6A 2AX0A 1FX4A 1ZO0A 2RQMA 3NCQA 2CZ4A 2NSBA 1ZM4A 1IBKJ 3PTWA 3OUYA 1SKSA 2W01A 3FC9A 3KZWA 2DXQA 3OL6A 3QGGA 3Q23A 5KFBA 4DPTA 3C19A 5A27A 3R5CA 3TX8A 1YDLA 2N4CA 2W24A 2NCKL 3HHLB 1EX8A 1P6TA 3W8PA 3GIKA 4CGNA 4TY8A 5DQIA 3DMJB 2ZM6F 1RADB 1QUVA 1WWZA 2JEFA 4FBTA 2BABA 3C6TB 2Q04A 5C25B 1FE4A 2WOMB 2YNIA 1NNDA 3A13A 1WOPA 4K4YA 3MM8B 4ILRA 4OFZA 2B5JA 1W2BR 1DQAA 1LAMA 2K1RB 2QG9B 3DLBA 2CPFA 4W92B 1ZAVA 3OFEA 1CJTB 3CO9A 1S1XA 1E6VB 3QFHA 2ZEDA 1XJOA 4TLQA 4C3KA 3WHIA 2BM1A 3VGUA 1D09B 4A2ZA 3OT9A 4WYWA 3S6KA 2X1BA 1RT2A 5A76A 3MOJB 4YQWA 1YITS 3SIPB 3P5BP 3PZPA 3K89A 4K50A 1T8EA 4ED2A 4ATNA 4OYPA 1FRIA 3RAQA 1NK7A 3KHXA 1IWAA 2GJFA 4QWCA 3VTIA 3THPA 3M6VA 2PJCA 5U47A 1OQ3A 3R7BB 3PBBA 3WC0A 2F65A 2ZH7A 4PXDA 2ZBIA 2RRNA 1U1KA 3M1VA 3TQ1A 2HPUA 3EVMA 1SJ3P 5LRJA 3HP6A 1UVNA 1S99A 4HNWB 1W2IA 3SJXA 1KR4A 4RBUA 1GT8A 2V8PA 3QRPA 3FMWA 2CPZA 4JD6A 3ZZTA 1NK4A 1FNMA 2O28A 3DFEA 4LF9F 2EKNA 3WC2A 1ON0A 4MFKA 5K8OA 4DR3F 2QMWA 1RO5A 1UTAA 1A0OB 1TL3A 5BWAB 4C2XA 4FD6A 1IKYA 3UPFA 3MAAB 3R1KA 5J2QB 4DL3A 4AG9A 3ZTOA 2CNKB 1IKVA 1SVDA 3SCLE 5AXNA 5T41A 4HLBA 3PEIA 3RNZA 2PT0A 2B9XA 1IQTA 3LACA 1KRPA 2DB1A 4R8UA 4A94A 3I9V9 1ZA1B 4DFMA 1X12A 2OPRA 2AIRB 3A9LA 4L75A 1WELA 4CYQA 4DR3J 4UCPA 3LQVA 2OFGX 4B9VA 3RTVA 4LR7A 2L41A 4JI6J 3J7YU 2M4MA 5D0EA 2DNHA 1C4AA 1M0SA 2VG5B 2PJBA 3PB8X 4MMOA 2EC0A 3SEOA 1HWLA 3CDBA 2WZ1A 3SI8A 1NZAA 3CMAS 1XOVA 3GSIA 3DLEB 4NE9C 4CAXA 2VHGA 1WNEA 2NSMA 5JVGQ 4OKOA 1S7HA 1RT4A 4MYUA 1VDHA 2QMLA 2ZZTA 4K5RA 2DNGA 4ILLA 2N4DA 1VIOA 1F2OA 2MLYA 2RUGA 1HWJA 3GR0A 3B4MA 2HQFA 4DV1F 1ZETA 1Z2ZA 3FEXB 3LTOA 1WF2A 3BI1A 1ROFA 2Q7SA 4UOGA 3IM8A 1RA7A 1B70B 1GXTA 2NXJA 2FHJA 4MKAA 2GS8A 4LQ3A 1TKXB 4ALZA 1L0CA 1AUDA 2H5MA 4I69A 3FVLA 1M1GA 3DMJA 2B5GB 5KFJA 4C3MA 2PVWA 5EC4A 4CTAB 1TK5A 3C6TA 4C11B 3F0NA 5C25A 1U2RA 2GANA 4YEAA 3D68A 1OBRA 1UJ4A 4OZLA 2G2ZA 3NWGA 2DISA 3MECB 4DV1J 2ZZNA 5J1QA 3CCLS 4CO0A 2A6OA 1X10A 1CJTA 2CDQA 4CI0B 4DX6A 4PQUB 1B87A 2W8LA 4LRCA 2J8AA 2O66A 4MY0A 4AD6A 2Q0YA 2EC2A 4AFFA 4IKAA 4CZCA 1FA0A 3L2NA 4JI5J 3H98A 5KAKA 2QC3A 2VC1A 4NZ6A 1M5SA 4FF4A 4AG7A 5L8RC 2Z30B 2IMOA 1M1HA 4L3KA 3GB0A 2IVFB 1B0TA 3ILOA 2RFHA 3FBBA 4NMLA 2C2DA 4WU3A 4M5MA 4O0IA 1KQGB 1R0AB 4OI6A 5KFGA 4HT7A 3S6HA 4EWTA 4F6AA 5K9FA 3QIPB 1KD1T 2DHHA 2PJ7A 4O4GB 5I0CA 2Z3NA 4ZVFA 2MKIA 3WQPA 3NGSA 2DGOA 2V5HG 3FNCA 2XCAA 4NXNF 4L6V3 3VH9A 3N28A 1TKHA 1X0FA 1EIYB 2R8HA 3O8WA 4DL0C 1KTVA 2WVBA 3RAXA 4OP4A 1VRQC 3IG1B 3H5XA 1L3KA 4NEXA 1JLCB 2QLFB 1NAQA 4XTTA 3DDKA 3MAAA 4LF2A 4IO1A 2PE8A 1RTJB 4JLYA 2CFXA 2LQ5A 2REEA 4AQYF 4JI2F 3SFGA 1FFGB 2C27A 2HWTA 1X4BA 1KVJA 3L9ZA 1ZLIA 5M2RA 2GLJA 1WTBA 4NXNJ 2Z10A 2V77A 3HKZD 1S0MA 3KK1B 3CULA 3ITHA 4J9MA 1YJ7A 3MCMA 1OY9A 2FC9A 4J7CA 2MKKA 5L1IA 2R2RA 2VG5A 3GFHA 4B9LA 5THWA 2GJIA 4AQYJ 3U02A 4JI2J 4XIUA 1NHUA 2ZEPA 3QNWB 4ZY2A 1DE4C 4HHJA 3TA1A 5IQ6A 2K5TA 3PJ9A 2H51B 2LQBA 3F0AA 3K5NA 4LMZA 1N33F 3RO0A 2DYAA 1FD8A 5J2MB 1UCNA 4BC7A 3K5MA 4U5YA 1RJJA 3BGRA 5IB0A 3SDEB 2NXEA 5B0BA 4DV4F 3FB3A 2KTQA 1VQ7S 2HNYB 2XI2A 5G4DA 3WX8A 1X31C 3S6GA 2XMKA 4K4VA 1TKXA 4FBUA 4N8OA 4IG0A 4USUA 1VQ5S 2AEFA 2B5GA 4X2BA 1OMSA 1TAUA 2UVUA 3R9LA 2AHOB 3K5LA 2WSFC 4F3MA 1VQOS 4C11A 2HZVA 2RJZA 1WC5A 1N33J 4M5IA 4KY3A 4XPCA 3MECA 4Y2KA 3FXTA 2VJVA 2KL8A 3EUNA 4M3SA 4DV4J 4PQUA 3R6GB 3C16B 2B58A 4QZVB 4QIFA 4URSA 3LP0B 2Q4ZA 2CF4A 1H2UX 2BANA 1G6BA 2DNLA 3VR1A 4AT1B 1M4GA 1P8GA 3D0IE 1P0HA 1IOIA 4PXCA 2G0CA 3OLBA 1GXUA 1VBZA 7FD1A 1IOFA 1M4LA 4LRBA 3UQSA 1RWPB 3OR2B 1Z2LA 4NCGB 2QN6B 5KFLA 4F0KA 5IT4A 4ZYQA 2I6WA 3MPYA 1FWLA 4K2JA 1J5OB 1AUGA 1SL0A 1OQ6A 2BCOA 5L39A 1R0AA 4CRZB 2AGOA 1JLAB 2ZOFA 3TZZA 3Q2SC 2AJ1A 2C42A 3M9OB 3T3FA 3QIPA 2G13A 1P27B 3HZGA 2C3MA 2CPEA 2HV2A 1FVQA 2JFDA 3EMTA 2UVVA 2RH3A 3O5TB 4WBFA 5F47A 1R8BA 3PYDA 3CDXA 3HO1A 2ATCB 4V19J 2ROGA 3IG1A 4EZ6A 2R8VA 1JLCA 2AEMA 4UQGA 3FZ2A 2OI2A 2EG1A 2EI5A 3MEEA 4KSAA 1RTJA 2XLJA 4LQGA 2IJFA 2Z57B 1SH2A 2MLXA 1RU2A 2R7HA 3CCRS 2PQ8A 3J7Z5 1IJFB 3C14B 4PG6A 2AGPA 4PV6A 3MCSA 3SI1A 3V6JA 1HHTP 5BR8F 4PWWA 3DRRB 3PX6A 3H42A 3FMCA 4YDDB 3KK1A 4HHUA 1U02A 3IS9A 3CD5A 5K8NA 4OYOA 5E3QA 4MHZA 5DZ6A 1U4BA 2WVCA 1DQ8A 4PYAA 4J9KA 2LVWA 1RYSA 2GE3A 3IWWA 2KVIA 4YB7A 2GU2A 1XC9A 3FCVA 5BR8J 3JQJA 5E33A 4DXLA 4WZMA 4IK2A 2FXFA 5RUBA 3PO4A 3GKRA 3OR1B 3S7RA 1XBWA 1M44A 4ZKAA 2RRAA 2HNYA 5AG7A 2HHQA 4CDIA 4NGQA 1XIXA 2LEAA 4OC4A 4ZBGA 4IFYB 1C0UA 2GX8A 1LV5A 3WT4A 1VKCA 3A8IA 5ETPA 1H7XA 3T90A 1GX6A 1RTDA 2XMTA 3CJ4A 1BLUA 5DM6Q 4EBCA 1Q95G 5HVHA 3OXFA 4Q8FA 3KXDA 2VEZA 4FPRA 4R8FA 4X66F 3PW4A 4IRKA 3R27A 1AMPA 1TUVA 3C16A 4HTIA 2M70A 1X9MA 3DR6A 3LP0A 2LDIA 1WSVA 4B3OB 5ETOA 3RRKA 4YN3B 2PJ1A 2FYXA 4C8LA 3RB3A 3N5FA 4WFAQ 3D9BA 2XMJA 1VQKS 3NL0A 2QECA 2DPTA 4USWA 4QBUA 1WEYA 4PG8A 2ZHOA 3P2HA 3OR2A 3L09A 4DG1B 4X66J 1J5OA 2DNYA 2VZZA 2WVDA 2V9WA 1N0VC 4V1Ak 3BN7A 4OLPA 5IC6B 2OH2A 1HW8A 5C7PA 3IO1A 1FEHA 3GFYA 3M8PA 4P2FA 1RT7A 2CY2A 1IKXB 3BDEA 2MGZB 2HHVA 1D8ZA 2FB0A 4R9MA 3NGDA 5KFVA 1IU8A 1SQHA 1FI4A 3AAWB 3J80Y 4K3NA 2B4PA 1EJ7L 2ZNYA 2C3OA 5DDQC 4LQ6A 2VKRA 4PWDB 3TUJC 1IXKA 2MJUA 2KFNA 3QLHB 1AZSA 1H74A 3L7UA 4ZLPA 1UJ5A 1H2TZ 2RS8A 3MRUA 2YKQA 3T8WA 4M5HA 3CE8A 2BW2A 5C82A 2FUG9 2PMHA 3KGQA 4QYZJ 4B9MA 2DXDA 3KUEA 3NMAA 3R6LB 2XSJB 5B0AA 4IO9Q 3LMSA 5DO2A 1TTHB 4X2TA 1N36F 2PFDA 4WCEQ 5L38A 1IBMJ 3BBFA 4M6IA 2QGFB 3DRRA 3V4IB 3KL9A 1S60A 2DVIA 1F9HA 4RLEA 1HBOB 4KGMA 3LAKA 1EETB 2JX2A 2ZH2A 3V81B 3TJ9A 1Q79A 2FHKA 3KR4A 2GO9A 1RCXB 1UZHA 2XMMA 2MDAA 4QU7A 4U7UK 2KJVA 4A31A 2I3CA 4CGOA 5KT2A 2ZD1A 4OHYA 3HT0A 1MN9A 1ELMP 2AGQA 3R7NB 1N36J 1F1BB 4PXEA 1Q0NA 3W60A 4Q36A 4ES2A 3JYTA 4PQAA 4OX9F 4DZDA 2XULA 1N5TA 1MK4A 4RW6B 4DX7A 1VR6A 1S9FA 3OR1A 1SJFA 7FDRA 2P2CB 5B0FA 3H8EA 3UE2A 4A8SA 5AT1B 3QO9B 5A6WA 4DCOB 5CYMB 2ZITA 5IFMA 2IJRA 4WIQA 2RT3A 3LALA 1F3VA 2CQDA 1RHRB 1BQXA 2J8SA 4BC9A 1XNQF 4WP9A 4IFYA 4NYOA 3FSXA 4G1QB 5CYQB 1V3ZA 2OPPB 4QBJA 2REFA 2GQCA 4ZPWR 2J7WA 3G86A 4DEZA 4OX9J 3OBIA 1C0TB 3MR6A 1YWXA 2UXDF 2R8JA 3CCWA 3H2LA 2IL4A 2GLFA 1XEZA 3DRPA 4C0HA 2J6TA 2YWHA 2FL4A 2X7BA 2V2QA 2HSEB 3FBEA 5A8RB 1RAFB 3TQEA 4A8QA 1N5SA 2W7PA 4B3OA 1XNQJ 4DR4F 4CLPA 3BH7B 4KO0B 1DLOA 1GMWA 2SXLA 2OOTA 4DR2F 1F5BA 2JDJA 4AVBA 3VAGA 2AD9A 1B7YB 3ZC4A 2UXDJ 2OPQA 5AJ3F 2YGWA 3FBCA 1H73A 4DPUA 3S01A 3DHXA 3W65A 2YKPA 4FYVB 4QUSA 3IXQA 1TMMA 2XCPA 1MWYA 5JXSA 4PG4A 4R5PB 4DR4J 5FVJA 4WYLA 2HK3A 4Y2IA 2DH9A 3ONQA 5I3QA 4KGVB 2MGZA 2V4RA 4RI1A 4DR2J 4OJGA 5L9NA 4RNFA 2AV5A 4DDFA 5J2PB 5AJ3J 1T9YA 3CSKA 4PWDA 1S9EA 2DGXA 4M1KA 5AXLA 2PJ2A 1OYEA 3QLHA 2D3UA 4D3HA 3FF3A 1KUYA 4QIEA 4F02A 1CS4B 4UCNA 3D1OA 3QB8A 3P6YC 1HA1A 3HVAA 2DGQA 1GQEA 3QAHA 5LM7E 4C7HA 4ZCMA 3QGIA 1Y7PA 2MZQA 4DSJA 1VHOA 2XSJA 1JJ4A 2IRXA 3IWNC 3NNAA 4ZY1A 3NS5A 4NZ0A 3W2WB 1OPIA 3V4IA 5F09A 3TVYA 3BB5A 4A37A 1HBOA 1N88A 4CYPA 2QSWA 2FJDB 1CVJA 4U9ZA 3EYZA 1EETA 4MCQA 1DJ0A 3V81A 2ZC4A 1LWEB 4MK9A 3PHEA 4ED0A 3KHRA 2PR8A 2DRDA 1NMTA 3X3UA 4RNMA 4Q0BB 1I5OB 1OZPA 4KPYA 2J9AA 2QYVA 1XMQF 2WK4A 1V9OA 3QRQA 4FUUA 1UVLA 2EO8A 4ZPTR 3I96A 2PIZA 3OTDA 2UU9F 2OIHA 4QR0A 4B11A 4RW6A 5G20A 1S9GB 4XAKA 4KOVA 1GTEA 3QO9A 1NPKA 5CYMA 1D0EA 1QSTA 3OV7A 4FNIA 2HYIB 4NLPA 4KFBA 5LSOA 2RSQA 4F4WA 4YR0A 2MJNA 3R8YA 1QVGR 4Q43A 5CYQA 5F9NA 2V9KA 4LUBA 5FIIA 4OZ5A 3B7IA 1Q8IA 2YNGA 5JMNA 3AD8C 2LECA 3VALA 2XLIA 2UU9J 3JVNA 4CPAA 1C0TA 1RUSA 2ZOMA 1E6YB 4FYXB 4F0MA 3HJVA 2EK6A 3BYRA 4WK3A 3MI7X 3EGZA 2YQ3A 1BY9A 2W9CA 4OC0A 5A8RA 4I2QB 4O3QA 2JFKA 2K7KA 4UFXA 3SI0A 2QL5B 2CQCA 1TKJA 2XS5A 2NR0A 2J0WA 2FIAA 3D1HA 4WFZA 1UA0A 1YJUA 5F8LA 3OL9A 1TQLA 3W5YA 1N4LA 2C6GA 2BJ9A 1GMUA 4OZJA 2FJAB 1SH0A 3BGLA 4W90B 3MR7A 1CJUB 5CH7B 4OMFG 2FVRA 4K7QA 2ZDOA 3VARA 3MWBA 3VVUA 3T1AA 3R5JB 1XFOA 1JLEA 4MHYA 1MLAA 1U2FA 2W9BB 4R5PA 1HR0F 2VZYA 1UETA 3K8VA 4RUAA 5F46A 5H9EJ 1Y11A 4Y00A 4F2SA 3G87A 1UVIA 2FGOA 2UP1A 3PCOB 5J2PA 2KT5A 1UMJA 2KU7A 5JH9A 1OY6A 3M32B 2VICA 3D28A 3R5GA 1CS4A 2X3GA 4PKDB 4G1IA 1O51A 5D4OA 1X5PA 1PAEX 3CIZA 4DLEA 1ULRA 3D7FA 2FSRA 2X1GA 1OYDA 4OADA 3D54A 1HI1A 5JJBA 3W9HA 1IBLF 3W2WA 4K8RA 2W2QP 4DN9A 1TFYA 3PB6X 4JI0F 4DX8H 3KI9A 2ZW7A 3OTCA 4Y65A 4B08A 5LRGA 4DU7A 4O23A 1LWEA 3LPEA 3TA0A 3JAMU 1GEHA 3EGNA 2YX1A 4UUWA 3H25A 3MMJA 1ACMB 1IQZA 3R5AA 4ECRA 1EE3P 4Q0BA 1FE0A 3FZBA 3M9NB 2JEGA 2N3LA 1NPPA 4NSQA 4NLUA 4A8FA 3PB4X 2DR8A 2OB0A 1OO0B 3AOAA 3MFHA 1IBLJ 3PW5A 4JV1A 5LT5A 3BV8A 3C46A 4DWIA 2YWGA 4X84A 4JI0J 4NGRA 1WC6A 2WW8A 3WIUA 3M2UB 2M2BA 5KOWA 1S9GA 5DG7A 4GVBB 3M4XA 3UW1A 2BKNA 1RGVA 1JXEA 3KK2B 4CAWA 4DF4A 2YKOA 4HI2A 2GGPA 5FD1A 3DOMB 3CCSS 3R9GA 5HVFA 4PEOA 2WRMA 5DWMA 1Y0YA 1FJCA 5F41A 4HH1A 4LFCF 4J9NA 3MR5A 5KG5A 2CPXA 3CC7S 3O3LA 1HPZA 2JOQA 2VJUA 4P7TA 2PJ0A 3DYAA 1KTQA 4M95A 4ZVGA 1E6YA 4IR1A 4BDPA 2MQOA 3PO5A 1SV5B 3DM2A 1T9TA 1Z4RA 4K59A 1MU2B 2BOPA 2R7VA 2E44A 2C2EA 4I2QA 4DSKA 3PW2A 1S97A 2X3DA 4LFCJ 3DN9A 5HANA 5HO4A 5D4PA 4L3NA 2JLMA 2H4YB 1FTRA 3RAMA 2GMLA 3JXOA 1Q5VA 1EP4B 1X9SA 1CPSA 4LF7F 2MSTA 3D4UA 4WFBQ 1CJUA 3EWGA 3WC6A 4ETXA 1N56A 4NCAA 1LKZA 4HL9A 3B4DA 1ZM9A 4OC5A 3FRZA 2XNRA 2MTLA 3W63A 4KQZA 1P9YA 3E8OA 1O6XA 3FQKA 4RN7A 5KT7A 2OMOA 5ISVA 2CIMA 1X4HA 3M8RA 3CNQP 3BKUA 2HQDA 3T9ZA 2QMXA 1K44A 4ILMA 4LF7J 4KVME 2QA4G 3EVOA 3OTEA 3MTKA 3LA0A 1ZPWX 4OYBA 1RZMA 4QWAA 3M32A 3PXGa 2NXCA 1FRXA 3LP2B 1PILA 5B7WA 2HBQB 4UEEA 3CCES 1RHQB 5LYFA 1NJWA 1IR0A 3CC2S 3TTHA 1JKHB 2RRBA 4WFYA 1WKJA 2DD8S 1NSKL 3A8EA 3CJTA 5ETQA 2PJ8A 4HACA 1HL6A 1MMLA 2XMWA 1TKTA 1ZG9A 2B9EA 4F67A 2E7XA 2LFVA 2N82B 2OPSB 5H86A 5B0CA 2P5VA 1J27A 1TP7A 4BWJA 1SJQA 1U25A 1X4GA 1FXRA 4YY3F 2M7SA 4ZCIA 2E29A 5E3PA 3GPAA 1F9EB 1TF8A 4ICLB 4Y6IA 2RMLA 1BGXT 3LWMA 4UOCA 4N47A 3BKFA 3SHPA 4UCMA 4CM2A 4PWUA 2O67A 4B9NA 1WHXA 3U1MA 3R3TA 3M8ZA 3NXZA 4FD4A 5MLCV 5F8NA 3U7JA 4X5KA 1R0CB 3M05A 3CUNA 3TZYA 3DHWC 4D3GA 2GO8A 4YY3J 1FX2A 2PI5A 3JRUA 2VU5A 2UUTA 4GVBA 2MB0B 3AOCA 3V8IA 3KK2A 3CJRA 4DR5F 1DZ5A 1YJVA 5A2QY 5A8WB 3BGUA 1HIYA 3DOMA 3H90A 3VGSA 2R2SA 1NK0A 1MSWD 1KVIA 1UAWA 2QO3A 1CPZA 2FHMA 2XZDB 4NLXA 2LYVA 1C1BA 1KQFB 4CGLA 4B5OA 2XLKA 1ARLA 2Y1LB 4H4KC 4GO5X 4MK7A 2QYGA 3I56S 2AX1A 5DG8A 2I00A 2Y0MA 3KLFA 3WC5A 4JZ0A 1S1WB 2HBZB 2HGMA 1SV5A 2V4QA 3ZZZA 4DR5J 1ICEB 2WSCC 5D15A 2GMJA 2GIFA 2R9LA 3NFZA 4NLRA 1MU2A 3WBZA 1VQ8S 3TE4A 2X1AA 1QJHA 4QPTA 3GONA 4TVAB 2DHXA 4CS0B 4NGTA 4X4OA 3BF4A 4LSZB 1NK9A 1R6VA 4NA3A 2AFMA 3OSPA 1Y0HA 1MN7A 1EP4A 3K58A 1S5ZA 2CQHA 2W7OA 1R8CA 2G0JA 1NRKA 2RDIA 2KM8C 3I82A 4LSNB 2QA4S 4OHVA 4CGPA 4N41A 5KT4A 3BH6B 1S4EA 1QE1B 2ADBA 1RP5A 3WABA 4MHDA 3Q8VA 4KVXA 5HBMB 4ED8A 3PYFA 5H9FJ 5KFRA 3RBDA 2V67A 1YR0A 2IDLA 4MXUA 2H3EB 2UXBF 4DCPB 1WDTA 2A1BA 4F4XA 2HWHA 3SJFA 3KFWX 3ICLA 4NGMA 2XYGB 2QSFA 1P4NA 5GMEA 2Y8YA 1X4CA 5E41A 3LP2A 3IWEA 2ZW4A 1VMBA 4J3GA 3H8YA 3UR0A 3HD1A 3LPYA 3D66A 4CCHA 3HHLC 3AD7C 1U6FA 3ZTPA 1NCLA 3NMRA 3OJSA 2OEKA 1P1TA 3HHNB 1HLWA 1R3NA 1JKHA 1UA1A 4FNHA 4DN0A 4RUBA 2CQ4A 5D77A 2BKOA 2RQCA 3TRGA 1TFWA 1YVKA 2VBZA 1N32F 3GIRA 3V2UC 4C2YA 2UXBJ 2G0BA 2AYEA 5F8IA 3AQOA 2OPSA 5J2NA 1WSRA 4MCPA 2FIUA 2JC1A 1VI7A 5EMIA 4ED7A 2XQCA 2AFZA 1AFIA 4A32A 1JLQB 2E1RA 3OFFA 4AUKA 2ASLA 1WEZA 5C42B 3FH4A 3VGVA 2VG6B 2IIHA 4ICLA 1R43A 3ET6B 4ZI6A 2VPXB 4F4ZA 1JNZB 3B8GA 3CZXA 2VBWA 1YW6A 3SCKE 4Y3CA 1N32J 1YLXA 2WHOA 1WORA 3R1LA 3LOUA 4LF4F 3BQ1A 3B3SA 1HARA 2RVJA 1RLCL 4CRYB 4LX9A 2J9DE 5IM0B 4QWDA 2HVZA 2OTLS 1X5TA 2HHTA 1FERA 1YBTA 5A8WA 3UWTA 5CCLA 4CNZA 2GC8A 2DH7A 1FY7A 3PRBA 1SIWB 2IVYA 3B3TA 1G2EA 2BJ3A 3IU1A 4DFJA 2DO4A 3W61A 4LF4J 3IJ3A 2OKQA 2R1IA 2PDAA 5KFQA 4ORFA 1WG5A 2C2OB 2P8IA 2YNHA 5EUHA 1S1WA 4UY85 3IAS9 1KSPA 4ZPDA 3PDNA 1AYEA 1NJZA 4EMDA 2GVDB 2ZHAA 4CT9A 2XEXA 4PG7A 3PKYA 1KP6A 3FYNA 4ZLJA 1AW0A 2W2OP 2DCUB 3HULA 2WBMA 3R97A 1HBUB 1UWAA 4ETZA 3S9MA 2VASA 4JXQA 1NM2A 2MEWA 1BPMA 2PJ3A 5ETLA 1WC1A 4B12A 1SKRA 3H4BA 4JI8F 2YKMB 2B43A 3BM7A 1VC0A 1S6PB 4ECYA 2JBKA 2PD1A 2VDIA 2IRUA 5CYJA 4LSNA 2XY6A 4NGPA 2DKOB 4JV5F 2CWXA 4UUXA 1RWWB 3ILLA 1QE1A 3TX0A 4WZQA 2LXFA 5C24B 3CDEA 2QRRA 5HBMA 2I1RA 2QTWA 3EZUA 1XR6A 3DXSX 3HFZB 5L9XA 4FD5A 5IV3A 2YVSA 1T03A 2EUIA 4JI8J 4CAVA 3LP1B 1NSPA 2B7CB 3BLNA 4HDHA 3POTB 4ECWA 4JV5J 3PKMA 4B13A 3SYZA 3FNNA 2O5DA 4O3RA 5DG9A 1U0SA 1FF2A 5HI7A 4URGA 3NNHA 2CRLA 4X3RA 3ZZUA 4NASA 5F3ZA 3IP0A 2LQJA 1U6ZA 2Z4PA 3D3BJ 3FMBA 1I94F 2B8QA 2IDEA 3M7VA 2BJ1A 4FXVA 3JSMB 4P44A 3FUYA 2RQ4A 1WC3A 1TMJA 5AE3A 2NZCA 1JLQA 2AJ2A 3G6ES 2Q4VA 3ET6A 1PAUB 4NLSA 3W1YC 4C97A 3UDEA 4JYWA 2AF6A 4Z37A 4OJ3A 2XEIA 1FWKA 1GMWD 1EKSA 3AB2B 4RNHA 1LOKA 3EXYA 3UI3A 2F4VF 2DXFA 1VOMA 1I94J 4CLSA 4KS9A 3A4TA 2XHWA 1DRZA 2D1CA 4TNOA 5C2GA 5IM0A 2ZEOA 1LXJA 4JI1F 1UW4A 3PJWA 4OI0A 2O01C 4MY3A 2DCLA 4OYXA 4Y34A 1ZZFA 4DQSA 2XMUA 3PG9A 2NMTA 3B8HA 1SKWA 2LU1A 4TN2A 2HQCA 4PCQA 2MHEA 3THVA 4ZPCA 2ZH8A 5B09A 5B0GA 1VK3A 4H4MB 1L3TA 4A95A 2VFRA 2QIFA 4HTJA 4E2FB 1GMVA 2FY8A 1H3DA 1LK5A 3N6MA 4JI1J 4V19X 2XB2D 3PNIA 4DUTA 5LJ5Y 3C26A 5E7OB 2GVDA 2KT2A 1I6JA 3JQMA 3I87A 1NMEB 4J5OA 2BZ2A 5BYQA 3TFYA 3RW7A 1YX0A 4C8ZA 5LSLA 5LXRA 1F3FA 2B0GA 4XPDB 4IH7A 2WZNA 4TQRA 3T6BA 1SH3A 2ZEHA 2YKMA 2BE7D 3DOKB 1G3OA 4LSLB 2CJXB 2PSWA 3TR5A 3TWZA 5ETRA 3FBFA 1NH8A 4K4XA 4B5PB 1O5JA 2DNOA 4Q45A 5KFSA 1NHKL 3FEEA 3MPVA 5C24A 1NZ8A 4I1TA 4FD7A 2GIRA 2ZFHA 2OZGA 1QSLA 1GHEA 4X4TA 3TEGA 5E2QA 3BPSP 3R5DA 1B0PA 3NBPB 4TLRA 3LP1A 1VQSA 2VIHA 4NLYA 4C2MA 2C2NA 4NJQA 2Z56B 1WOOA 5EWFA 3POTA 1S6QB 1VISA 2AJ6A 1IJEB 3PVXA 2R8IA 1VCTA 4UA3A 1RTQA 2KHDA 2RB7A 3SSSA 4A47A 3R9FA 3J7A1 1U8WA 4USJC 3H5YA 2CJBA 1RHKB 3VAMA 1SQFA 2DNMA 4K30A 1YRXA 3PRTA 3HI9A 2HVDA 4DL6A 3QGPA 3R96A 3QYYA 3FJUA 4QIWD 3JSYA 1S7KA 4BD9A 1WC4A 2BQRA 2LKZA 2W9AA 4XNHB 4B3MF 1R8PA 1ZPVA 3JSMA 3I9ZA 4FKXA 3HVTB 1NO8A 4WE1B 1SJ4P 1QSNA 3BGFA 4JUZA 1M5PC 3OL7A 1JLFB 1R7IA 3BN4A 5I42A 4ZPBA 2VV5A 3I6PA 2NS1B 1XF8A 2AJ4A 1YW4A 2I79A 1YX2A 2DO0A 3GJQB 1QUPA 2DHAA 1O0PA 3R7SB 1ZZNA 1WOSA 4WTOB 1ELOA 2E1CA 3VWEA 3KLGB 3IAM9 1BD6A 4A8WA 1CSJA 4KZTA 3J81U 5KFTA 3UDLA 4KV8B 1FKPB 2IRYA 5G0RB 3ETMA 4E8UA 4C68A 5HVGA 2BV3A 2NLWA 3G6VA 2RAQA 2QVPA 2XS7A 1BC6A 3GR1A 4HT5A 8CPAA 5IX3A 1UW9A 3WX4A 2BOAA 4YB6A 3C2PA 5HROB 5CA5A 2G1DA 3AT1B 4ED1A 4G1PA 1NKCA 5GMKa 4IF5A 3KJQB 4W9YA 1YBAA 1T95A 4KB7A 3FCWA 2GVZB 2BQUA 4DCJB 5HP1A 3CXSA 3KYLA 2FVGA 1RBLA 3VATA 3CJKB 2CZ9A 3FDSA 3ENVA 4ZJLA 3ELHA 4Y2AA 2BRKA 1K1QA 1QAYA 3JSRA 2VOPA 1X8DA 5KG4A 4PSXA 4DV0F 5G1ZA 2BACA 1GXLA 1SL2A 1QSMA 5HAOA 2ZEMA 3PR4A 2EWHA 3R9EA 2ARHA 3DOKA 4C8YA 1VQMS 4LSLA 1S1VB 2AU0A 2GIVA 3IMQJ 4EFDA 1VFJA 2ABYA 4CO1A 3H5ZA 2R8KA 4B5PA 4JBCA 1RT6B 5DZ7A 5D8HB 3K9TA 1NDCA 1BWEA 2JLEA 2HEKA 1IUJA 2ERRA 3Q89A 3MURP 2UXCJ 1WG4A 4M5GA 8AT1B 4DV0J 4NLTA 4OYAA 2HIQA 2BEIA 2PC6A 5E5NA 2RU3A 3NBPA 1KDNA 1U2CA 4M5LA 1Q53A 3CCUS 3UDVA 2B5JB 3S6EA 3T5HA 4FF1A 1S6QA 1Y7RA 3H2UB 5JM6A 2XEGA 1KZFA 4UZCA 3MMBB 1MJ9A 3BKTA 5DDOC 4U7CA 3G3SA 4E2AA 3QJJA 2RE1A 4ZP8A 4DV2F 3NGKA 2NPFA 2C22A 2KRBA 3IR6B 1FNXH 1URNA 2EKYA 4RWXA 2XMAA 1H0HB 2KG0A 4WE1A 2WTFA 4A38A 2I9SA 3EC4A 5HN0A 1QAJA 1YKWA 5BYSA 3KJVA 3CTRA 1J2VA 1VQYA 3EFAA 2EFQA 3N79A 2V94A 2B9YA 5KT6A 2E5JA 1IBCB 1JLFA 3ENQA 1HI0P 1HWKA 3QJLA 4C3LA 2FY1A 4WJBA 3VAFA 8RUCA 3Q8PB 2CPJA 3TA2A 2HVHA 3H2VE 4G3IA 1NPRA 4KHRA 2B4UA 3I32A 3I55S 3KLGA 5KFPA 4K4ZA 2B8PA 3G9CA 2J9EA 3PB7X 4KV8A 5G0RA 2VPWB 1SI9A 1HNWF 5KTQA 1RHUB 1H6KX 3TUZC 1WKLA 1B6BA 4OZNA 1D1UA 2OEMA 4ZP9A 2ZVIA 5H9FK 1IGBA 4P75A 4LREA 3IR5B 3M8SA 2KYXA 1K4JA 3DLJA 1S3ZA 1SC3B 1SQEA 2XYHB 1N34F 4DUYF 2AJFE 3UFCX 4NI2A 4NLVA 5HSPA 1XK8A 1KN6A 2OZUA 2GAGC 4DOZA 1VRTB 5HROA 3CVKA 3OL8A 3EDQB 3HFKA 3EX7B 1HNWJ 1L3SA 1RT1B 4NYZA 4KLWA 2GVZA 3CO0P 1H98A 3RJMB 1TXRA 2EVZA 3J7AN 2BM0A 5AG6A 3UD5A 3QT8A 2L08A 3AA9A 1JB0C 1N34J 4DUYJ 1RWMB 3LH2S 2R7TA 2QLWA 1BHNA 5F8MA 2JEWA 4M94A 2YXLA 1Q7YT 2XC9A 3KUGA 3G8QA 4KH1B 3HDSA 4OYWA 3FK4A 3BO4A 1S1VA 5DM7Q 4CRJA 3G2XA 2ASJA 2AYBA 2DF5A 2CNOB 4P4FA 1KQSR 2F5GA 1RT6A 1TR0A 4H89A 3BEGB 1RT3B 3TAMB 4ZLLA 1C4CA 3E3XA 4JV2A 1HDQA 4LIWA 3MEDA 2JLGA 4J37A 2MKCA 2ANPA 4XK8C 5KTAA 2M5YA 1SC4B 2ZC3A 3D2PA 3UN3A 2AFUA 4H6UA 2JVRA 4OYMA 2WONB 2ZH6A 4CM0A 1XRYA 2AWZA 5ETVA 3B6BA 4GKKF 1TIQA 2ZPAA 4DV5F 2P9GA 4Z7CA 3MMBA 3CGIA 5HMYA 4EU0A 2NREA 2DRBA 1R8AA 5HH1A 2V0NA 5LJ3Y 2ZM6J 2XGQA 1ZYQA 2WAQD 2JBJA 1NDPA 4YR3A 2AJ0A 3QT5A 1D9AA 1NB2A 1WG1A 4E0AA 5LXYA 2WW4A 5ETSA 2HKEA 2K3IA 2E7VA 2BQ3A 4GKKJ 4NX9A 4CLLA 3OD2A 4DV5J 3MPUB 2D3OR 2HQ3A 1DQ9A 4ZVEA 1U24A 1Q86T 2H54B 5L46A 3HFVA 2RIJA 5KT3A 3SI2A 1Z4UA 4QC6A 4KHPF 4DQRA 5A2QU 3KR5A 4OYZA 5DLGA 2XY5A 4OAEA 3IM9A 2I8EA 2C2ZB 2ZOGA 3JSBA 2VBYA 2XI3A 4FYDA 2FLOA 3NWRA 3KLEA 1VQPS 2FJBB 2MZJA 4NLDA 3QIDA 5K14A 3JTPA 1A9NB 4R7MA 1RBAA 4KHPJ 2LP4A 4FS2A 2IHR1 4F9VA 1X7VA 4PUOA 3TOAA 2H5EA 2ADCA 4TQSA 2W1BA 4A8MP 2ZW5A 4OZ0A 4Z7YA 4TXSA 5ETKA 2J7KA 1VRTA 2VOOA 1HNIB 4LF9J 1AFJA 4Y28C 3ZZYA 2JRSA 1UEVA 2BRLA 4B10A 2Z3PA 3T5KA 1RT1A 3JTOA 3ITHB 3FEZA 4Q38A 2D3O1 3HLPA 4WK1A 4MIBA 4YHHF 4GC7A 2HGNA 1YI2S 5F8JA 1SUQB 1TELA 2ZNZA 3R2CJ 1DAXA 2Z0ZA 3TOBA 1GYTA 4B3SF 4KIAA 2Z3LA 1RTHB 1DTTB 4OIDA 2J6SA 4UEZA 3JAMY 5GAGI 4FWUA 2DNQA 3BGRB 2OTJS 1RA6A 4YHHJ 4NA2A 1U1OA 1AROP 1KFSA 4A30A 4BS2A 1RT3A 3TAMA 4EVYA 2VB6A 1TK0A 3PIPQ 1J5EF 1RXTA 3C66A 3F5BA 4IG0B 2AZ1A 4B3SJ 2XSFA 2IM2A 3F41A 3E2EA 3HM9A 2IQ6A 4F4AA 3F44A 4ZA1A 3WZ0A 1CM0A 4FYYB 2WONA 3TZWA 4A33A 1K47A 2YNDA 1TL7A 4FXWA 2B9WA 2V34A 4ZCKA 4QPXA 2MKJA 2DR7A 2IA0A 2P6EA 1J5EJ 2XWXA 5I3PA 5CABA 4RU9A 2BANB 1HYSB 4BBYA 3LGHA 1X5OA 3IBWA 2RD5C 2H9ZA 3UD3P 2KFYA 1FXDA 2KYZA 2HHUA 2PJ4A 2QX0A 4B9TA 4W98A 2PMZD 4K5SA 3HHEA 4ENOA 4KAIA 4C48A 4Q44A 1EKRA 2ZWOA 2B4DB 4I6YA 3BQ2A 2CNMA 1XBUA 3W6SA 3UNGC 4JB8B 4DUZF 3TARA 3KTQA 4R0JA 4H2KA 3LODA 3C8YA 2GA7A 1PKUA 4BCAA 2Z2YB 2XTJP 1ITPA 2RHQB 4F7VA 2WPXA 3N0VA 2IFXA 4ZPVR 3K2YA 1VIXA 3Q8UA 2EPIA 1NJXA 5KFOA 2IYGA 2E5LF 1FTCA 4X4QA 4DX5A 4UOFA 1ZS6A 3D6MB 4DBQA 5A8KA 2ALYB 2YPZA 4E98A 2UV8A 5DQHA 4CLFA 4UIBA 4EZ9A 3ZNUA 1U1LA 1LK7A 2AQ4A 3OJUA 4RL1A 3N7ZA 2VZ9A 2OH1A 1XQIA 3CF5Q 3NCRA 1XN9A 2W7AA 4B17A 4OI2A 2JH3A 2LA6A 4DUZJ 2WSEC 2J0SD 3TO9A 4EO6A 4FN5A 2EFOA 1X60A 2CTCA 1X0PA 2UUBF 3E01A 2F7VA 4MYTA 1BMQB 3MEEB 4WXOA 4L72B 2E5LJ 4DZ6A 1Y10A 1N5QA 3IGNA 4P4BA 3BJYA 2XBPA 1SPBP 1Z8XA 4NL5A 3IFEA 2VF3A 3T9YA 2FPHX 5DJBA 1HNIA 3I4HX 5HMNA 3QNVA 3HHKA 2M3DA 3KLHB 1FHTA 1LRZA 4GVLA 1JJ2R 2PO4A 3IS9B 2CQBA 2EVNA 2UUBJ 4ELVA 4I2PB 2VPZB 4NRTA 4YUDA 1SUQA 3BZQA 3G96A 2KXHA 4UW2A 3VV2B 2FDNA 4YFUA 2Z11A 3CCMS 1UL3A 1EZZB 3Q83A 4HVZA 1LOUA 3GP9A 1SJ1A 5D0GA 3GYNA 2G1HA 1RLDA 1T0TV 2YQ1A 4CLYA 1RTHA 3CJ2A 1DTTA 2YNEA 2BJEA 3D1QA 2XZWA 2CADA 1BQMA 3BYPA 2DT9A 2ZEEA 3FSYA 1XNRF 4B14A 5IC4B 3M8YA 3HHDA 1RABB 3P4UB 4ECZA 3LO3A 4NGSA 4YS2A 2MY7A 5EN1A 2R4FA 4ZVRB 1C0UB 3CXCR 1K0VA 1URRA 4PXBA 4DPYA 1IB1E 3RBUA 2HS4A 1RTDB 2CQPA 1IN0A 4DHVA 4MFPA 1SC1B 3QZ8A 4P10A 2QL7B 5BJRA 4AYBD 3IWXA 4NRUA 4EI2A 1XNRJ 4AL6A 1NKBA 2DNKA 4FZVA 3VAKA 1NEEA 3MPDA 1M5VC 3TZXA 2J76E 1HYSA 1UJ6A 4RPFA 4YFJA 3KHLA 3G8SA 2UVRA 1CJWA 4I7FB 2EWBA 1RBOB 2FHOB 2B4DA 2DR5A 2ROEA 4ZCLA 1ZOTA 2MKYA 1YREA 3FQLA 1I12A 3JQKA 2EK9A 3ZZIA 3PRVA 5IQQA 2D9OA 3I0SB 4Z65A 2DY9A 3CPWR 4DJBA 3M8PB 4BWMA 4I6AA 1S7NA 1GK8A 1RT7B 2BL1A 2KDOA 2YKNB 4R0EA 2JL9A 3ILJA 2NUHA 4KBIA 5KFWA 3D7GA 4DNCA 1S6OA 4F4KA 3NA6A 1MWZA 3PEHA 3RYOA 4USTA 1B3TA 1Y9WA 2VBQA 1AZSB 2ALZA 4ZVSB 3K57A 2YKAA 1R89A 2VFTA 1BAVA 1S76D 5CZVA 1QD1A 3I5CA 3FJ2A 1RKJA 2AFXA 2QLBB 2Z2LA 3V6HA 2NYHA 4JP8A 3W9JA 2DR6A 1UPPA 5JPHA 2ROPA 1XR5A 3DLKA 2ZHBA 3DRSB 4NCZA 4L89A 4ID5A 3GFXA 5CQGA 2K3KA 3KLHA 2YNCC 3HSJA 3EXCX 4KOSA 4JI4F 2HK2A 2HNZA 2BEFA 1FT8A 1VRUB 3IC1A 3BI0A 1IR2A 4GO7X 1JWWA 4I2PA 4KPCA 1PYTA 2I5JB 1N48A 3QSIA 3R1HA 4BHQA 4WFNQ 2BYCA 3CXPA 2ZD1B 2CPHA 2OHDA 4MFBA 2D9PA 1CJKB 3CDAA 2CG4A 2WUUA 3JYTB 2PGCA 5HJXA 4JI4J 3D6TB 2N3OA 2FS5A 1BUXA 3NGTA 4RW7A 4HKFA 4U96A 5AXKA 4LIRA 4KKOB 4UWIA 5HQMA 2GQ2A 1U8SA 5DGBA 2J7UA 3W2VB 2DITA 1A7GE 5F48A 3LWLA 4UEFA 3Q2TC 1U1NA 3GILA 2FVSA 4EYHB 3K2KA 2FGCA 4UFVA 4MTPA 4QIVA 3BXMA 1KUXA 4GS4A 1RSCA 2Q6CA 2BBEA 3DRPB 1LEOA 1I21A 2YH0A 1CC8A 2ZJQQ 4LQ9A 4JJXA 5EWGA 2R7XA 1F57A 3NGRA 4ZIVA 1X4AA 2AMCB 4S0MA 1DLOB 3H40A 4CYUA 1F2PA 2YX4A 5J1EB 1B0VA 2CYYA 4QJVA 3TOQA 3W5ZA 3QJPA 2XZTB 1Q2YA 5FDLB 3NS6A 1I51B 3PACA 2J9CA 4I7FA 3FECA 4PRFA 2OPQB 1Q8BA 2EFVA 1CPXA 4OIWA 3CCQS 4OC2A 4XO0A 2F5IA 3UVJB 2CJKA 2E9RX 3V38A 1PC4A 4HNXB 3KKFA 4WXWA 3I0SA 2YNFB 3KDNA 1TL5A 3J7ZT 4JI3F 2PSZA 1OSCA 4ZLNA 2IVMA 2PR1A 2MYFA 2YKNA 4DSFA 4DYOA 1MROB 4JXRA 4QYRA 3BSAA 1S72S 1HWIA 1RKIA 1S9EB 3MUMP 4R87A 1Y9KA 2BA9A 2EFGA 1BO4A 1WF0A 4MH8A 3CCJS 3RZAA 2EW9A 4LRDA 4U8YA 4JI3J 1YQEA 3B3WA 2K2PA 4QR2A 1DURA 5LRKA 2YX7A 4U8VA 1KWMA 3TJAA 1FJGF 1EARA 2L3MA 3W64A 5CPAA 2IBKA 4GC6A 2R7UA 3AB4B 3DRSA 5DDRC 4ONWA 4HR2A 4PZVA 3RGIA 4ZJOA 1Z9UA 4C8NA 3Q0AA 3EO4A 1VRUA 2EBGA 2HURA 3MM6A 2Q6BA 1FDNA 2F8MA 2I5JA 2RKIB 3FGVA 4FYWB 2KVQE 2KHCA 4CO3A 1OY8A 3A12A 3ZXWA 1QMUA 4WU2A 2BE2B 3MM5B 4K0KF 1YJNS 1FJGJ 2J0XA 4Z2XA 2BKPA 2GHWA 3HF5A 1CJKA 3JTKA 1KHVA 1Q1KA 3QT7A 4R25A 3A8JA 5KFNA 4O0NA 2X51A 1DTQB 4OC3A 3L3CA 1F5CA 2Q4YA 1ZLHA 4CAEA 4O3NA 4KKOA 2CXAA 1R57A 3M8WA 3CJ5A 3QQCD 3V5RA 5JUMA 2XGPA 2CJQA 3OFHA 4KFBB 4K0KJ 2WBRA 4IFVB 4HEA9 1RAIB 2GAHC 2F9DA 3W2VA 1HHSA 5SZTA 4CLZA 2CKWA 3IBFB 3ILIA 1R31A 2F3JA 2ASDA 4H54A 2VUGA 2YNGB 3G8TA 3BPDA 1LWCB 3AXMA 5C5JA 2EG2A 1WUUA 1KONA 3FRYA 3FBUA 1ELLP 3BSCA 1F9FA 1H38A 2OLWA 4USIA 4GKJF 2MZRA 1JJHA 1WI6A 3LD2A 1N54B 1D3WA 2EBEA 1C1CB 3SCIE 1H7WA 4WIIA 1AT1B 2W9CB 4ZVOB 1PYOB 3UDCA 2ZDPA 3NOGA 5HMWA 1RWKB 3DLGB 3AXKA 2GFFA 2XEFA 2HB6A 1RI7A 1NDKA 5J1EA 5FDLA 1T7PA 1TV6B 2HNDB 2GMHA 3FSIA 4XDDA 3AFGA 3AOBA 2DHGA 2A6MA 3VQSA 4QB9A 4RWWA 2AEJA 4KTQA 4GKJJ 3KUHA 3UVJA 1B4SA 5GAGU 1N0UA 2YNFA 1M1KT 1JLEB 1RTIA 1Z8TA 5LSRA 5E0OA 2CUYA 4DV7F 1MROA 3K8WA 3N6NA 4EBEA 2E1PA 4WWVA 3QAEA 2V2KA 3EY5A 3MGJA 3I3GA 2PJ5A 2AFWA 4IOAQ 3KHZA 2JDCA 3LGMA 2NXNA 4DL5A 3US5A 1NBEB 1YBUA 4RW8A 4Y49B 1SBRA 3PZJA 2KXFA 1HQ2A 2DJWA 4DV7J 4NZ7A 5LOQA 3PB9X 3A3NB 2DEIA 1S12A 3MEKA 4OZ3A 4OIXA 4QU6A 3TC8A 3E51A 5LYIA 5GADI 3VGTA 2CIJA 2DGSA 2XO6A 3VAJA 2VONA 3NH5A 1HNZF 1SC6A 1TZ0A 2JJ4D 3EGWB 3RYLA 2Z8QA 4ZP6A 4MCSA 4NXMF 1ZA2B 2VFVA 4X8IA 2J6UA 2RKIA 3DOLB 3UN5A 3OHAA 2BE2A 3HCXA 3MM5A 2FQQB 5A28A 3AD9C 4TKTA 2PC1A 4IRCA 1S48A 3A3PB 2D3ZA 4MFQA 4LJMA 1S4FA 1DTQA 2LDYA 1S7IA 2OMLA 1HNZJ 3T41A 4ED4A 4NXMJ 2RF2A 5GAEI 2HVIA 4FXDA 3GY9A 3MUVP 2GGPB 3FCHA 1QM9A 1REVB 4IFVA 4ANDA 5G22A 4H4KA 4AXJA 4I56A 1XMQJ 4IQMA 1TVRB 4G65A 1KC8T 4P45A 2HFSA 4JI6F 3J81Y 4C98A 4NOHA 3T6JA 1Z1ZA 1HPZB 1LWCA 2J5AA 3DYAB 2PA8D 4FAIA 4U9YA 3NNCA 2RQKA 2L9WA 2YH1A 1SCJB 4I6WA 4YR2A 4CYOA 3DM2B 4QIGA 2KI2A 3Q24A 1VK8A 1C1CA 2A2CA 3KJFB 2P9CA 3HLUA 4J9RA 1M5KC 3FRMA 1FWPA 2Y0BB 2MQMA 3DLGA 1G7CB 3BBBA 3O1LA 4DU8A 1TV6A 4GXHA 2HNDA 3AH6A 4PPZA 3GMGA 3N5BA 1WACA 3NAIA 3NS7B 5JVHQ 2G0IA 5D4LA 4NLQA 1IWGA 2DIVA 3D2WA 2B7BB 2JVOA 4DF8A 1VBXA 2KZMA 2HLUA 2E5IA 2W2PP 3D8PA 4F9UA 3BR8A 1UVMA 3HX9A 5GCNA 3Q22A 9RUBA 5I4MA 4LFBF 1S6UA 3C15B 1RWNB 3TYTA 3S1TA 3KMSA 1CLFA 4WKRA 4XPDC 2Z0GA 3RBZA 2JDDA 1UPMB 1CX8A 2FJWA 2F40A 1R8HA 3CJQA 5KFZA 1VHEA 3HK2A 3HHLA 2XY7A 1R6YA 3RG6A 3VZHA 4KSIA 2NXUA 1U45A 5CAAA 5KTDA 4NLGA 2EBJA 2EK1A 2W25A 4DS5A 4QCLA 1H72C 4JI5F 3NG8A 2PJ6A 4TY9A 3M6UA 3DXBA 2WOMA 4XPEA 4LFBJ 3ZZOA 4ZN1A 1FRKA 3MM8A 4FS1A 1HR0J 5KG1A 2IJZA 4IUSA 2K1RA 3HXMA 1TL4A 4EFAC 2HHWA 1E6VA 2WB4A 1PSDA 4ZK7M 3MAQA 4HACB 4EGLA 2VA2A 4NCBA 4MFJA 4P4JA 1TKTB 2XYPB 2QJ3A 3U27A 3P96A 1UZDA 4RW4B 3T1YF 2B56A 1NH7A 1KVKA 4ZVHA 4X4UA 2Q1LA 3EM1A 3IBCB 4X4PA 2OGUA 4LUAA 4UFWA 1NJIT 1SKUB 5AG4A 1RQ0A 3D6HB 3DOLA 4LT6A 1YK3A 1NU4A 4LVNP 1Q82T 4IH5A 4J9QA 1PO6A 2BW7A 1PYSB 1S5KA 3IA0A 3IRWP 5AG5A 4TNUA 3EXNA 4IG3B 4F4YA 1D9FA 2HFNA 4XNHC 1WHWA 2APOA 1LNQA 2HFVA 2N7CA 1ZTWA 1IYKA 3M2VB 1B99A 3DR8A 2DXEA 1T9UA 1F0XA 4NA1A 4JWPA 4P7VA 2M8HA 2D69A 2DTJA 3T1YJ 2BUNA 2K7JA 1G1XA 5D78A 4RUHA 4Q2LA 4LF6F 3NH8A 5ETTA 4C0OC 2GNKA 1FESA 1HI8A 5KFCA 4ELUA 5AE1A 3B3CA 2CJ9A 1REVA 4ONUA 5ETNA 2ZEFA 5DWNA 4ECVA 2FC8A 2PJ9A 3W91A 1VQNS 1TVRA 5ITHA 3JTNA 1MMNA 1C1BB 4ZN3A 1RTZA 4IRDA 2R7OA 3N4WA 4N5SA 5J2QA 5KFMA 4ZDNA 4N7TA 5D3GB 4LF6J 4YB5A 2Q51A 3KLFB 7CPAA 1U09A 2P9EA 3CIMA 2LLZA 3PYEA 4ECTA 3SFUA 2IC3B 3GCWP 1FNOA 2X1FA 3H5SA 3SV4A 1N71A 5EGYA 3UR3C 3GLJA 1BPNA 1S79A 1S1TB 2P6GA 2OJ3A 3ZTQA 5KFKA 1JX4A 2CA9A 3B35A 2DNNA 3K17A 4H4OB 1OWXA 4QR1A 2D4OA 3ISZA 3DLEA 1HNVB 2Y8WA 8ATCB 4ZITA 4QOTA 4J9LA 3EDRB 1VBYA 4DMZA 2DRAA 1LWFB 1F5AA 2CJYB 4P71A 2Q44A 2QJ8A 3C15A 3P45B 4U95A 1IVZA 5J8FA 4KRWA 5DDPC 3AHPA 2HFUA 3WIVA 1PBAA 3SSQA 3QWUA 5LL6d 1K0TA 4CAFA 5C88A 1FK9B 1DARA 3AODA 4MHPA 2NSCA 4N76A 1HD1A 1PC5A 4CH0S 4AVAA 3AQPA 4KGKA 4F8ZA 2YBVA 4E0DA 2IY5B 1ARMA 2YTCA 4DUKA 4CTAA 2MLZA 2F8HA 2WCXA 2X7IA 4RNNA 5KT5A 3W3SA 4C7IA 1VHFA 2YQ0A 4C8KA 4WF9Q 4F3OA 3CJ8A 5IV0A 2ZBQA 4NXYA 3UD4P 3DNSA 3ZTRA 1R0BG 2BUEA 4AXIA 2L9NA 1ZH5A 2Y1JA 3CCVS 3DGPB 3MR3A 1EQ0A 1IIDA 3TP2A 2MKHA 2J8MA 4MI4A 2PIIA 1NXIA 2RNEA 3TO8A 1PU9A 4UIAA 2B3VA 3DRXA 3DDDA 5IT9U 4OX7A 2Y1RI 5J2NB 2FVCA 2UUAF 4RW4A 1IICA 2WYRA 3H8GA 4O3OA 2HMIB 2POKA 4DV3F 3MM7B 1VJQA 1YVFA 4X64F 3H5UA 2V8GA 4O4RA 4CO2A 4MJKA 3OVSA 3LW5C 3PEJA 3PFOA 1DTDA 3KHGA 2WB1D 4IG3A 3MDFA 5GMDA 3MOZA 3D67A 3M2VA 4P72A 3H4DA 3KMQA 3QGHA 5EDWA 4FPIA 3V4MA 2UUAJ 4QVTA 1XEBA 4O4GA 1PBUA 4DV3J 2QLXA 2BDPA 2PE3A 4OX8A 2HHPA 4PK2A 4OHWA 4YMEA 1M4DA 4X64J 1U49A 4OV1A 3A3OB 3R2DJ 3Q8RB 3D4JA 2VA3A 2YPYA 2CJAA 3NEKA 4CH1A 1QDUB 2J8RA 1M1DA 3K59A 5C2CA 4EUVA 4KOTA 1ZG8A 1NSQA 4UTGA 4TU7A 2MY8A 2B3UA 2BO9A 1CEZA 3BREA 1J4JA 1RWXB 1YIJS 1A6LA 3ZZ0A 1OSDA 1BOBA 2FJEB 2H4WB 2FJXA 1YVOA 4PYDA 5D3GA 2YNHB 4B02A 2IMWP 1ZM3A 3RB0A 1XWLA 1RACB 2Y3YA 4HHHA 4DR6F 3SJEA 2K8GA 2IC3A 4QW9A 1N6QB 2HAFA 4QYZK 4OI1A 4I0WA 2Q3PA 2OUGA 5L1JA 1CULB 3KQXA 5FLXU 3GCXP 4R3LA 1S1TA 1AA1B 1LFWA 1F2GA 4KT0C 3SXOA 5LYDA 4H4OA 5HMXA 4P4DA 1FO1A 1HMVB 1LW2B 1Y5IB 2W4PA 3GIIA 1HNVA 4AL7A 1GFWB 4DR6J 4KOWA 4DSLA 1DY3A 1JNRB 2G9OA 2PMWA 4R57A 2E66A 3PP9A 5HLFB 4MKYA 2KXNB 2G9DA 5K20B 4ZVUB 3LF0A 2CNNB 2BMBA 5HJYA 1LWFA 5L1KA 2FZCB 4HH0A 4UT4A 5J2MA 5KOXA 3SDEA 3O6QA 1CBKA 3K5PA 1FK9A 3M9MB 3U1LA 1FCAA 2GZOA 3KG1A 3EVWA 2DR9A 4YWYA 2HQGA 4B9SA 1T9WA 1FFWB 1RWUA 4FBEA 4OHXA 2HRUA 5K8MA 1T03B 2IYIA 1U1QA 1F2HA 2ZBRA 3TUIC 1QTMA 3QMQA 5IV4A 3L7OA 5IT0A 3CEDA 3I9SA 3NRBA 1O8BA 1RE1B 3VAIA 2H1YA 1RB0A 4AL5A 4B3TF 4FF3A 1QSSA 2B3TB 3DGPA 1IM4A 2BE9B 2HFOA 1QSYA 5F9LA 4LR8A 5KFAA 3ZZRA 3CPAA 1X5SA 1S1UB 2PIYA 2L48A 3K5OA 5B08A 4RNOA 3PJXA 1RDRA 2VI7A 1ZM2A 2FIWA 2HMIA 2M0GB 4K4UA 3MMAB 3MM7A 2LCWA 3I31A 4CLTA 2F8EX 2CQ2A 3HSZA 3OVAA 4X62F 2AP6A 3RU0A 3SBMA 4B3TJ 2UVWA 2B4OA 1WHYA 5F49A 4NCGA 4L76A 4WKYA 1VHIA 1WF1A 2DEJA 3OPKA 2NZ4A 4U9RA 3CMQA 4FKYA 1LWXA 1JLAA 4KVOE 5J1NA 2I38A 2ODFA 2V50A 3BJ7A 3GYAA 1RT5B 5EX3A 1KOHA 1C2PA 2YWWA 1VBKA 1KQKA 1W7WA 3P49B 2E5HA 4X62J 4IDKB 3RB4A 1IBMF 3DU6A 4EEYA 2VQFF 2HUZA 4YB1P 3IN5A 2LXUA 1YQHA 2ZUAA 2MZTA 2JC0A 1RAHB 2Q43A 3AJDA 3M6XA 4DL2A 3HKWA 2ILZA 4J9UE 3TAQA 3BDPA 2QYCA 5GADU 1T02A 4HKQA 3G6YA 1FRJA 2D74B 4A8XA 2EK8A 3C14A 1N6QA 2QLJB 4KLVA 5KG0A 2VQFJ 1LAPA 4P73A 2ZENA 2Q79A 2HW3A 1CULA 5D29A 1TKZB 3MXHP 3CCZA 1GNKA 4DPWA 1YZ7A 2ZELA 2D41A 4KOYA 4F0HA 2VQEF 4M8LA 2D7SA 4H6ZA 4ANCA 4HPSA 4CQ1A 1HMVA 4QWBA 4DV6F 1LW2A 3UN2A 3OLAA 4DQQA 3KJNB 1Y5NB 1UFWA 4IAVA 3VHQA 1EAYC 3NKYA 4DR7F 5HLFA 2C2MB 3W9IA 4OLOA 3DGVA 3TO6A 4RR5A 1K8AT 2MPUA 1S49A 4L8AA 5EWEA 1P9QC 5GAEU 4G6VB 3KQZA 4DL4A 6FD1A 1EHWA 2ZVSA 2Z3MA 4I49A 4CGMA 1U7LA 2A0FB 1PIEA 3PFEA 1I1DA 2AE6A 3V7ZA 2GFQA 1OJ4A 5DS7A 3QAYA 2R3VA 4MT1A 1XTZA 2VQEJ 1ZBTA 3GIUA 2MKSA 2JEVA 4OX6A 4ZJQA 4DV6J 5EBVA 4C0BA 4MCRA 1QTNB 1Z8WA 1T94A 4XPLA 5CZXA 1S0NA 1Q8LA 4DR7J 1Q2CA 4R6TA 5SUHA 2ZH5A 2UV8G 5T14A 3KASA 1YMEA 3VWDA 4C9DA 2YY3A 2AZ3A 1RCOB 4CYNA 1N5YB 2BJ7A 1HQUB 2MHNA 2VG7B 4RJVA 2YWEA 3AJ1A 2QE5A 3KNGA 5K8PA 1VLOA 2H48B 4EO8A 1UEUA 1S1UA 3FX6A 1PG5B 2CQ0A 1HWUA 4IR9A 2Y0SD 5CHCB 4ES1A 1IY7A 4PAAA 2Z2MA 3GYXB 4Q8EA 1VQ6S 2D4PA 3MMAA 1DFDA 2COLA 2A2DA 1GAOA 3HUVA 5DGAA 2R7RA 4RW9B 1UFKA 1PJ7A 2FJVA 4DG1A 5I42B 4I68A 4UZBA 3CCTA 4P9SA 3VWSA 1CQMA 1KUVA 3EZ5A 2PRBA 3MCOA 4RKUC 2CTBA 3PGPA 4IHMA 2PDOA 1K73T 4J9OA 4UY8T 3CD6S 1PUAA 1VYAA 1RT5A 2WSAA 1IKXA 3J81j 3ISNC 2ZJRQ 1RU1A 3OVBA 1IM6A 3GJSB 1MW7A 1SQGA 1HEEA 3NE8A 4EK2A 4IDKA 1APSA 1F6TA 3HVWA 3UCZP 2QMUB 5H9EK 4C8MA 4OQJA 1FDBA 4ES3A 4MIAA 4YU9A 4UWJA 1Y5LB 1MNEA 3SJGA 3EZOA 3N01A 2RHSB 3IEHA 1FKOB 2G3TA 4OV6A 3I5AA 1TUWA 2GJ2A 2F4VJ 3ETOA 2KB2A 4USMA 1V3SA 2W2MP 1KOOA 4MKBA 3TNVA 1YHQS 3D7HA 4FDFA 3T19A 4CP5A 3H20A 2CQ3A 2HHHF 3RUBL 2QA1A 2EEYA 1BQNB 3QT6A 3Q8YA 1A2ZA 5F3TA 1U1RA 5HP1B 3VAHA 1QVFR 4NWBA 2WVEA 2Q7BA 1QLNA 5KFYA 2FT0A 3C6UB 4NJRA 1QSOA 4LFAF 5LMNF 4BMHA 1Y3JA 4HNYB 1TKZA 2U2FA 5J1PA 2M88A 4CO5A 4F0XA 1TUGB 2M52A 3B78A 3AA8A 1X4FA 1KBRA 2XEJA 2ZBPA 1FT7A 1CG2A 2HHHJ 4LRAA 2DBBA 4TU9A 1N8RT 3DC2A 2F63A 1XIQA 2EXUA 1HBNB 2CNLB 3S6FA 2ATLA 1Q78A 4LFAJ 1YTYA 1JXLA 5LMNJ 2C3UA 2OR4A 3B3VA 2MQNA 4CT8A 1V5VA 2ZE2B 3T5JA 2OAUA 4NFRA 3MD3A 4CO4A 1XERA 1G4CA 5E96A 2V4JB 1YK9A 4OMEA 4II9A 3OXLA 3WC7A 2KG1A 4A8KA 4G1QA 1LXNA 2FZKB 4DR1F 2I0XA 3GQCA 4FP9A 4ED6A 5J8CA 3KK3B 2OPPA 2K06A 5IZHA 1RK8A 1YJRA 4O44B 4ECSA 2PA3A 1IR1A 2GW8A 4M5KA 1YJWS 1N5YA 3MMCB 3E0KA 1HQUA 4QW8A 3H7HB 3RB6A 2VG7A 2I2YA 3B2YA 5F8HA 3RRGA 1YLEA 3TCVA 5KG7A 2PI4A 5CBMA 3LWUA 3U1NA 1Q7LB 3EE3A 2WPWA 5ELYA 4KO0A 1Q16B 4DR1J 3H4QA 2OD4A 3C3LA 5A6PA 4ZHRB 1SL1A 3ULHA 3KJVB 2VFUA 3NH4A 3N6LA 4RW9A 2W4CA 2HRYA 4AE5A 1JMTA 5H1SV 1TAQA 5IS2A 1Y9OA 2C28A 4YDXA 2ZBCA 4J91A 4X4RA 3ZTSA 4J9PA 1VC5A 1JK9B 4FVCA 2AYMA 2V68A 4DJLA 4MFZA 5G21A 4B3MJ 1NB7A 2RDDA 3QAUA 4ZOSA 4RX6A 3UO0A 2JHEA 5AXMA 1VQLS 2A4NA 2VXKA 5I3UB 4ZVQB 2OZHA 2DY1A 3GV5B 4W4MA 3F56A 2ZWPA 2DHSA 2A10A 4MJ8A 5IOLA 1D8YA 5KFIA 2P6SA 3QFWA 1IKWB 4RBVA 3MAHA 1FKOA 1QY7A 4LF8F 3HSGA 5E3RA 2BSWA 2IM0A 4NI2B 2DH8A 1XMTA 2FHJD 2XNQA 1HFEL 2HAIA 1U26A 2GIQA 1AUSL 3KG4A 3HHLD 3NOCA 4DI6A 4HDGA 1FFSB 1RWVB 7AT1B 1HHQA 5DS0A 3TI0A 3T9NA 1BQNA 3IU2A 4JI7F 3MFIA 3PIOQ 2NYIA 2Q66A 5B0EA 2R2UA 1OPZA 3C6UA 3CD7A 1CBXA 1L3UA 3BO3A 3RBEA 4IQXA 1S77D 4B9UA 2HZCA 2KZZA 2RUSA 4LF8J 3CT9A 1FRHA 1LFPA 4KHMA 3GG1A 1PCAA 3GV8B 5CXTA 1S59A 4JOUA 3ENWA 1T11A 4OYIA 4XDCA 2IBOA 1VLYA 2HQYA 3CJ0A 4JI7J 1HBNA 4UF4A 2C2RA 1QSRA 3IRXB 4EYIB 2E9TA 4ELTA 2CQ1A 2EFNA 1X4DA 4Q5VA 3GIJA 4NYPA 5EX0A 1NUEA 4EBDA 2LEBA 3MEDB 3CJSA 3MGDA 3PRDA 3JUWA 3GWCA 4P4EA 2ZE2A 5GVQA 3EGVA 2GHPA 1QAIA 1FJ7A 2V4JA 4ZVTB 4ED5A 1U6MA 2FLPA 1U6BA 4UQTA 3CMES 3P8BB 2RS2A 3KK3A 3A8KA 4BLGA 3I4PA 3TJ8A 5F8GA 4O44A 4CLKA 3W6XA 2JNJA 2HC9A 3MMCA 4DFPA 3I1UA 1U48A 3GE9A 1GTHA 3UCUP 3DRYA 4WP3A 3HJFA 4NEZA 4F26A 2PRQA 2OU2A 2PCUA 1KS2A 4L73A 1V3RA 4LVOP 1JXVA 1KHWA 2H5JB 1RWOB 1Q7LA 3F8KA 3SCJE 4O3SA 3BO2A 5KFDA 3GSDA 2P0WA 3W62A 3EPIA 4ZHRA 3DCAA 4KSFA 1Z4EA 2LU2A 2LQ8A 1T05B 1RAOA 4A8OA 4CIOA 3QZ7A 2PFFB 1WDDA 2FVPA 2KO1A 4OLLA 2NYQA 1NK6A 4DV2J 4ED3A 2DNZA 4PR6A 3NLCA 2FZGB 2NPIA 1BWVA 1UWBB 3IWLA 2DGWA 3G82B 1GH8A 1UVKA 3HVRA 4PSWA 2W9BA 4NLOA 2L9DA 2W2NP 3QATA 4I64A 4RZRA 1AXQA 5I3UA 3JS9A 1M5OC 4OHZA 4LBIA 3KLVA 3KLEB 2V8DA 5F0UA 3QPIA 1H2VZ 3D0HE 4TU8A 5K14B 2DPJA 1IKWA 4M6GA 2V63A 4PUOB 2R8GA 4B3RF 1MMDA 2VDHA 4ZPAA 1GX5A 3KNAA 4ERDA 1BXNA 5HK4A 1NSAA