1CG2A

Carboxypeptidase g2
Total Genus 135
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
135
sequence length
389
structure length
389
Chain Sequence
QKRDNVLFQAATDEQPAVIKTLEKLVNIETGTGDAEGIAAAGNFLEAELKNLGFTVTRSKSAGLVVGDNIVGKIKGRGGKNLLLMSHMDTVYLKGILAKAPFRVEGDKAYGPGIADDKGGNAVILHTLKLLKEYGVRDYGTITVLFNTDEEKGSFGSRDLIQEEAKLADYVLSFEPTSAGDEKLSLGTSGIAYVQVNITGKASHAGAAPELGVNALVEASDLVLRTMNIDDKAKNLRFNWTIAKAGNVSNIIPASATLNADVRYARNEDFDAAMKTLEERAQQKKLPEADVKVIVTRGRPAFNAGEGGKKLVDKAVAYYKEAGGTLGVEERTGGGTDAAYAALSGKPVIESLGLPGFGYHSDKAEYVDISAIPRRLYMAARLIMDLGAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of carboxypeptidase G2, a bacterial enzyme with applications in cancer therapy.
pubmed doi rcsb
source organism Pseudomonas sp.
molecule tags Metallocarboxypeptidase
molecule keywords CARBOXYPEPTIDASE G2
total genus 135
structure length 389
sequence length 389
chains with identical sequence B, C, D
ec nomenclature ec 3.4.17.11: Glutamate carboxypeptidase.
pdb deposition date 1996-12-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01546 Peptidase_M20 Peptidase family M20/M25/M40
A PF07687 M20_dimer Peptidase dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.360 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1cg2A02
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 1cg2A01
4KSIA 2PJ1A 4ZX9A 2XEIA 4P4BA 5D8NA 4FWUA 3BI0A 1YSJA 1LANA 1QMUA 3GB0A 3NH5A 3FEDA 2AFUA 2PJ0A 4LQGA 3I1UA 4MHPA 2F8HA 3CPXA 4X2TA 3IWWA 4X3RA 4R76A 4R8FA 3D7HA 1RTQA 2Q51A 2JBKA 2ZEFA 1XBUA 4UEFA 2BCOA 1M4LA 1VHOA 1PCAA 3N5FA 4EFDA 1IGBA 2V8HA 5IB9A 3PB7X 1Y7EA 4OC0A 2WZNA 4Z65A 3IJ3A 4PXDA 3JRUA 5K8PA 4MCPA 2NSMA 3FJUA 1LAMA 3PB6X 3HUVA 4PXBA 4P4JA 1Z5RA 4TWEA 2PJ3A 4P4IA 1EE3P 4UF4A 2F7VA 5ELYA 1XMBA 3D7FA 2C6PA 4PQAA 1H8LA 3PRTA 3S9NA 4WWVA 2OOTA 1XJOA 2PJ5A 3PEIA 4P6YA 2GLJA 2EWBA 1BAVA 4DYOA 3NH4A 1ZG7A 2GU2A 1TXRA 4NGSA 3T8WA 2ZOGA 5J1QA 2PJ4A 3ISXA 1ZLIA 3V7ZA 4OC2A 3PB4X 2GREA 2PJCA 2O53A 2C1CA 4ZY0A 1ARLA 1LFWA 2EK9A 4NGPA 2Q4ZA 5CBMA 3V38A 3TC8A 2NYQA 4K3NA 3H8EA 3GLJA 4ZY1A 4YWYA 2RB7A 3ISZA 1TF8A 4CPAA 1Y0YA 4P4DA 1VIXA 3PFEA 3TX8A 4TNUA 1CBXA 2GLFA 1Z8LA 1VGYA 3B3WA 4A37A 1UWYA 1ZG8A 3KR5A 4MMOA 3K2KA 3SJXA 3B2YA 3IO1A 2PJ2A 1R43A 1LAPA 3KQZA 1BPNA 2JBJA 1QQ9A 3D4UA 4F9VA 3FEEA 2PIZA 4ZY2A 4A94A 5JH9A 4A39A 2HC9A 3WC6A 4OIDA 3KQXA 1F2OA 4ZI6A 4MCSA 3HLPA 1FT7A 2PJAA 2FVGA 4OC4A 2XEJA 4P10A 3D68A 3NH8A 1AYEA 2G9DA 2PJ6A 4FUUA 2JEWA 4UIAA 1CPXA 4OC5A 3BXMA 1TKFA 3SI2A 1ARMA 4ZX8A 4OMEA 4ONWA 2CTBA 2ABZA 3MRUA 3PB8X 4UEZA 3FF3A 4A38A 3WABA 3NFZA 4GM5A 3VH9A 3CT9A 3D66A 5D29A 3H8FA 3FMCA 2ZEEA 2HB6A 2IJZA 4IK2A 3FH4A 1YLOA 2IMOA 1DTDA 3VARA 3B35A 1HDQA 3PFOA 2CTCA 5I4MA 3MN8A 2PVVA 5THWA 4NGTA 1JQGA 3B3VA 4NFRA 4MCQA 2V8VA 2RFHA 2AFSA 1ZG9A 4FBEA 2ZEOA 4P45A 3B7IA 4F8ZA 1YMEA 3LMSA 2V77A 1CP6A 4FAIA 4Q7AA 2V8DA 2CF4A 4UEEA 4MXUA 2VL1A 2AFWA 4P44A 4RUHA 4MHZA 3KL9A 4EMEA 2AFMA 2QJ8A 2AFOA 2OR4A 1Q7LA 3LWUA 2POKA 3GUXA 1R3NA 3RBUA 2EK8A 3WT4A 3NA6A 4MHNA 1CP7A 1ELMP 1ELLP 3IC1A 3FECA 4R6TA 4PXCA 1IY7A 3IEHA 1ZLHA 2AFXA 3BHXA 3KI9A 3S9MA 5LYLA 4BD9A 2PRQA 4NJRA 2ZENA 3IIBA 2ZEDA 2J9AA 4YU9A 1F57A 2CIJA 4NGNA 1XRYA 1DE4C 4OP4A 2C6CA 5LRKA 1BPMA 4WJBA 3SJGA 1CX8A 2V8GA 3D7DA 5HXDA 4IHMA 3SI0A 2XEGA 3KGQA 2I3CA 4JYWA 3SI1A 2PE3A 3KHXA 1CPSA 5K8MA 5F09A 3S9LA 2ZELA 1BLLE 3VATA 4PXEA 5K8NA 3IFEA 5DS0A 3SJEA 4ZYQA 1XFOA 4W9YA 4OIWA 5K8OA 1LOKA 2IQ6A 2C6GA 4UIBA 8CPAA 1KWMA 2Q43A 3KHZA 5LYDA 5CPAA 3QNVA 2BOAA 1AMPA 2QVPA 3PB9X 5JM6A 5HVGA 1TKJA 2PCUA 5LYFA 2PVWA 5HVFA 2XEFA 4OC1A 3SJFA 1TF9A 2PJBA 1YW4A 3DLJA 1HDUA 4O23A 4R7MA 3WC7A 6CPAA 1CG2A 3KR4A 1PYTB 2ZEHA 1YW6A 4X8IA 2ZEPA 3CDXA 4P4FA 3DGVA 3L2NA 3K9TA 2BO9A 4MCRA 2ZEMA 2PJ9A 5JGFA 3D67A 1Z2LA 4NGMA 2PJ8A 2ZOFA 3B3TA 4MHYA 3PBEA 4MRIA 3RAMA 1HEEA 1OBRA 1FNOA 1Y0RA 4H2KA 4OKOA 4G1PA 4NJQA 2PJ7A 3WC5A 4IAVA 4EWTA 1F2PA 1GYTA 3PBBA 4NGQA 1TKHA 2AFZA 2QYVA 3B3SA 2ZEGA 5LRJA 4OC3A 2O4HA 4DJLA 1VHEA 3RZAA 4P4EA 3B3CA 3FVLA 3KASA 4F9UA 3BI1A 1LCPA 3H8GA 3KZWA 7CPAA 4PPZA 2WYRA 4B6ZA 3CPAA 3D7GA 4AXVA 5LYIA 4DUKA 5LRGA 2ANPA 2PIYA 2DEAA 4NGRA 3FX6A 4JZ0A 1NSAA 5HVHA
chains in the Genus database with same CATH superfamily
3M2UA 1TKZA 2LA4A 2HRUA 4DR1F 4ICLA 3PJ9A 5GMKa 3M8QA 4OZ0A 2G13A 4J9KA 3MM9A 5M2RA 3GE9A 3EZUA 3I0SB 2D7SA 3Q8UA 2D3UA 2V34A 1SJFA 4DV2F 3M8QB 4OQJA 2B9EA 4N47A 1WSVA 2YNHA 1YQHA 1IKYA 3QO9A 1QSNA 5IB9A 3LAKA 4CGNA 2B3TB 1R6VA 2Y1RI 2FT0A 4IG0A 2CNKB 3QLHA 4PCQA 1L0CA 5A8WB 4ZVQB 1R0AA 1SKWA 2EBGA 3CCJS 4F50A 2N3LA 4P4JA 2DXEA 1RE1B 5DS7A 3LP0B 4Q8FA 2GQCA 2NMTA 5DQGA 3DLLQ 1N5QA 1XOVA 4WWVA 3J81Y 3BM7A 3QT6A 1ACMB 5D8HB 2W9AA 3BSOA 4ZCMA 4U96A 2YKNB 3I96A 4UCMA 4E8UA 4RU2A 1K44A 5CA5A 1ZLIA 4OFZA 3PB4X 1HBOB 2OMLA 3MR6A 1GEHA 3G4SS 5F8HA 1B0TA 1LFWA 1RHUB 2EK9A 4X2BA 3BGRB 1X7VA 4U9ZA 1QSTA 3PX4A 2FLPA 1HWLA 1I3OB 2GMLA 3DR8A 3FK4A 2R8GA 4KOUA 5HATA 3TQEA 4FBTA 1S72S 1HNZF 4C8OA 5G21A 3HVTA 1Y0HA 4WP9A 1FRXA 2XYPB 4RNHA 4ZKAA 4MMOA 2C27A 2IVYA 1ZA2B 2Y3YA 5KG2A 4NXMF 3LD2A 4F9VA 4WFBQ 4A39A 4FKYA 2GVDA 3R1HA 5LSRA 4A8FA 4DL3A 3NH8A 4LF5J 1HI8A 1RTDA 4DV6F 3CJTA 3OR1A 3LGMA 4FS2A 4AD6A 4NYZA 3VGVA 3I9ZA 2JSXA 2W01A 4LF4J 2LFVA 4CLTA 2Y8YA 2FIAA 4B10A 4IH6A 2ZBIA 2GA7A 1X0FA 4DG1A 4UUXA 1XMQJ 1SV5B 3HCXA 2R7TA 1VHIA 2ZVSA 3IRXB 3TZWA 3VARA 4B3RF 4BMHA 3I0RA 3I5CA 3OBIA 2GO9A 1D1UA 2X1FA 4YOEA 2Q4YA 1XC9A 1Q7YT 2VD3A 2CQBA 3TFYA 1ZG9A 3IM8A 4GVLA 4URSA 3FRMA 2VJUA 1YVFA 2FGCA 4K0KF 1Q2DA 4A48A 3FQLA 2PMWA 4AL7A 2FVPA 1FK9A 3ZZZA 2WPXA 4NLVA 5HANA 4DDFA 1WI6A 1TZ0A 2UUCJ 4LJMA 1XBWA 3NBPB 2OR4A 2K06A 1Q7LA 3GV8B 2X3DA 1SKSA 2H3EB 5HQLA 1KQFB 2YKPA 4GKKF 1WHYA 1UVJA 2AFXA 5CQGA 4O3SA 3W62A 5JUMA 2WRMA 1Z8WA 3IIBA 2UXCJ 1MWYA 2YKQA 1RTHB 1F57A 3DRRB 3PW4A 3GFZA 1FD8A 2RUSA 4QWBA 4ZVRB 2QFJA 3D1OA 1YHQS 4HACA 3N28A 4JV2A 2QL9B 2HHHJ 2E7WA 3KWMA 3OD2A 2MKJA 2WVCA 1NAQA 1VRTB 1OSDA 2C2MB 1VQ5S 3H2UB 1I12A 1U1LA 2DY9A 2VJVA 2DGOA 2VDHA 3F56A 2GX8A 1BHNA 2W9BB 4Q2LA 2ZJQQ 3VZIA 2MYFA 2M70A 4K7QA 4OIWA 3K57A 2RDIA 3ENWA 4E2FB 1EAYC 1YITS 4F25A 1V0CA 3G87A 4FD6A 4MKVA 3CJ4A 3QQCD 4KQZA 2WBMA 4CO5A 2RS8A 3SXLA 4AVBA 3VAGA 2G0BA 3M6WA 4TU8A 5KT4A 3J7ZT 2AGOA 1VQ7S 3QT5A 1ZAXA 4RW6A 5GVQA 1NB7A 1BY9A 2VODA 1QLNA 4EYIB 1ZTWA 2FQQB 1FNMA 3THVA 2PJ9A 4KE5A 5K20B 4MHYA 4KGZB 4DR5F 4NCZA 4C9DA 1X9SA 4CM2A 2ZHBA 4ED0A 3OUYB 1FTCA 2AJ0A 1S1TB 2RKIA 4EU0A 5HMZA 1B3TA 2DNGA 3PNIA 1IBKJ 4Q36A 2FJVA 4CLUA 1MSWD 3IAS9 3PHEA 1X60A 1Y4ZB 4KVME 2CFXA 2RU9A 3C19A 5I42A 1XR6A 2V8PA 4UOGA 5KG3A 3R5CA 3H4QA 4J3GA 2BE7D 1SV5A 2Q66A 4WXWA 1NPKA 1TK8A 3WC2A 1SJ3P 2ZM6F 1BO4A 3HFKA 1IBLF 3MEDB 4ZP8A 1YSJA 4LFBJ 4ER8A 1ZH5A 3F73A 1YDLA 1EQ0A 3E01B 1YLEA 4ANEA 4R76A 3D7HA 5FLXU 2OEMA 3JSMB 2F5GA 3TR5A 2ROGA 3ILIA 3J7Z5 3PZPA 1VR6A 2Z3PA 1RCOB 8RUCA 2HPUA 1QSYA 5GAEU 3TARA 1T9YA 3D6MB 2DCUB 3I56S 4PXDA 4CH0S 1UW9A 2JNJA 2X51A 4RLEA 4O3PA 4KJIA 3ETMA 5E33A 2VONA 4K50A 3OTDA 4PG5A 1REVA 2L08A 2P9GA 4WWSA 2DR8A 4EBCA 5KFQA 3KUEA 3RUBL 4KLWA 5LSLA 1HFEL 5E41A 4DUYJ 5IV0A 1XN9A 5ETNA 5IM0B 2IM0A 3I31A 3TC8A 3QT7A 4L3NA 3UQSA 1RYSA 1F3FA 2ZH8A 1L3KA 2FD2A 3Q83A 4MJ8A 3P96A 2GLFA 4BC7A 4IOCQ 1FVQA 3JS9A 1HD1A 3SCIE 1UWYA 4QIEA 4CYUB 1IIDA 3MFIA 3K58A 1R43A 3I87A 1ELOA 4B11A 1Q79A 2GMJA 2FB0A 3D4UA 2I0XA 3MEGB 3DOKB 3KQXA 4XNHC 4JI0J 3CCTA 2R2UA 1GTHA 4DWIA 2ZJRQ 4GVBB 1FJ7A 4P10A 3AY0A 3KG0A 2IHR1 3NP5A 4ZHRA 1QAYA 1VBYA 4W4MA 5HROB 1YRXA 2KG0A 1JLGA 2W4DA 2UV8A 1I5OB 4QWDA 3WABA 4F2SA 4ONUA 4R5PA 2WAQD 1VISA 2HB6A 3EJMA 3CUNA 2XM3A 3KYLA 5DWNA 4QC6A 4M5KA 1UVMA 1N5SA 3M8WA 2YNCC 3E51A 3JSYA 1BD6A 3DLEB 4HDHA 2W2PP 5A8RB 1RHKB 2Y1IA 4XPDC 2CPXA 2Q7BA 1Q4RA 2J9EA 3DCAA 4C8KA 2V8DA 3W1YC 1ZM2A 4FKXA 4DX7A 2AFWA 5AG5A 2A0FB 1U02A 2HNDA 1H73A 1H7WA 4Q8EA 5BXIA 2JEVA 1YZ7A 4U8YA 1HNWF 4C68A 3LGHA 1R8AA 2VQEJ 2HAIA 3LWUA 4B17A 1JLFB 4Q0BB 3HZGA 4H6UA 4KV8B 1U8SA 4J91A 2B58A 2MKSA 5F8NA 2HFVA 3M32B 1UCNA 2H5JB 1A9NB 2NPIA 2DEIA 5BYSA 3PRDA 3L7OA 2J9AA 3GJQB 1MJBA 1SI9A 2XY5A 4H4OA 3PG9A 2EG2A 2UZAA 2V4QA 2ZUGA 3GY9A 1TKXB 3EVWA 4NZ0A 2R7OA 3M6XA 1S9GB 3DLKA 1EQMA 3SJGA 3MFHA 3MM7A 1M5VC 4R8UB 1S1VB 3G86A 4MFLA 3FBEA 1VOMA 4UBRA 2FIWA 2A10A 5K8MA 2WPWA 3TAMA 2DNLA 4I7FB 1C1BA 4PXEA 4ZVEA 4NLQA 5DS0A 4NLOA 1XR5A 4B5OA 4IKAA 1U1KA 2OGUA 4WU2A 2ZH2A 4ZVFA 4HACB 4KH1B 3OVBA 2J7WA 3OR1B 4NXMJ 3QIPB 4CI0B 2UP1A 2G0JA 4WYLA 2NZ4A 3SYZA 4FD4A 4UOHA 5LOQA 2BW7A 2DT9A 4ECVA 3W61A 2GJ2A 3S6HA 1N71A 3WC7A 3W65A 5KTQA 4MY3A 1PYTB 4GMKA 5LMNF 2AYGA 4ZPVR 1XWLA 3OLBA 4OMFG 4LRFA 5F8MA 3M7VA 2BM1A 2BO9A 4MCRA 1LFPA 3EO4A 4ENOA 4NGMA 3M4XA 4LVOP 2C2OB 4H4MA 2DJWA 4KHRA 2NR0A 3PGPA 5B08A 2CJXB 4DOZA 2FDNA 4LRCA 1F5BA 4MIBA 2ZW5A 4ZJLA 2VFUA 3RB4A 3CCZA 1B0PA 4J90A 1WSRA 4ECUA 2CNLB 3UCZP 4PPZA 6FDRA 2UVWA 1HHSA 3KHLA 4NGRA 4JZ0A 2K3IA 4JI6F 1X9WA 4ES3A 5DGAA 3QATA 1EKRA 1IKVB 4CYUA 2H48B 3POTB 2AEFA 3D8PA 4C8ZA 3H5XA 3K5LA 2FHOB 2YNIA 1S6QB 3NAIA 2MY8A 1S1XA 4O44A 1NSLA 2QLJB 4OLLA 2QECA 2B5GB 4LF9F 3AJ1A 1V9OA 1VC6A 3MM6A 5I3UB 3CDUA 4OJGA 3LOUA 2VOPA 3ZTPA 3EGZA 3OTOJ 2CXEA 2DGXA 2QMLA 4FZVA 4ZJOA 2MPUA 4UWJA 2OHDA 5I3QA 2EFOA 4DUZJ 4KOTA 1KTVA 3BDPA 4OC0A 4XTTA 2PR8A 1A2ZA 3UD5A 2HNZB 1OMSA 2V4JA 3PX6A 4DNCA 3A9LA 3TRGA 2IJFA 3SHPA 4TWEA 2KT2A 4UF4A 1G6BA 2JJ4D 2V2ZA 2XMUA 3SCJE 1QAXA 1H8LA 4KS9A 2B5JB 5L1JA 3CNQP 4G65A 4P6YA 3ZZRA 1X9MA 4DU8A 4LR7A 2BANB 3M2UB 2C2KB 1XEBA 3LP1B 2F8MA 3P4UB 1YX2A 2MSSA 3ONQA 1ZS6A 3KLIA 2MGZA 1JXEA 4A8SA 1NJXA 1LWCB 2XY6A 4A46A 4OV6A 4C8YA 3DI6B 4AUKA 4OI3A 1KHVA 5CBMA 1FA0A 1XMOF 2Z2ZA 2MKYA 2JFKA 2GVZB 4OI4A 1HHTP 2PR1A 3PFEA 5ETPA 4DI6A 1S7KA 4NRUA 4A37A 3LP2B 1KTQA 3MUVP 2IVMA 5KFNA 4FNHA 1RO5A 2WZ1A 3R1LA 2W2OP 5GMDA 1S6OA 2DNQA 3MURP 5EBVA 5DGBA 1GT8A 2Z2MA 4DCJB 3B82A 4XPEA 4KR0B 4FUUA 2JEWA 1IKWA 3CO0P 1IM4A 1I1GA 1YJTA 2NXUA 2LQ5A 1RHJB 1HBNB 1U1PA 1U26A 4Y34A 4NLWA 5T14A 5E3RA 2L9WA 3H25A 2CQCA 3KK3A 3LA0A 1JXLA 3RBEA 4C7HA 2M52A 2Y1JA 1NBEB 1VK8A 1V3SA 7FD1A 2R8VA 1HBMB 2ZD1B 1RT1B 2BJ1A 3DLGB 1UAWA 2GGPB 2PVVA 2BR0A 2ZPAA 2ODFA 4WK1A 4UZBA 4LQ6A 3RO0A 1Q2YA 4LF9J 4KC5A 2NLWA 1S12A 5KFKA 1ZM3A 3UNGC 2KJVA 1U1OA 3M2RB 2BJEA 2CF4A 3QJJA 4UEEA 1NH7A 1S6UA 3H7HB 3W5ZA 4YB1P 2GW8A 1RU2A 3K9UA 3CZXA 3MHYA 1YJNS 2XC9A 3MTKA 2POKA 3ICLA 1RXOB 3BV8A 3CDBA 2LKZA 2VG7A 5I3PA 4UFVA 2KCWA 2D9OA 5U47A 3OSNA 1HHQA 1WC0A 4Y2AA 2IRUA 2KG1A 2B4BA 4KORA 2HMIB 1H2UX 5LMNJ 1S59A 1FEHA 4J9UE 1DTQA 4DX5A 1FT8A 3BLNA 4QU6A 3MI7X 3QMQA 2GMHA 3TOAA 3FRYA 3P49B 1S6PB 4C3MA 1N48A 1OO0B 1RDRA 3OL9A 3CIMA 1VQNS 3FSIA 3NY0A 1H0HB 7FDRA 3FUYA 3X3UA 1HI0P 2IJRA 3MCNA 4ED2A 3J81U 1FCAA 3SMZA 5C5JA 1FFWB 5E3AA 2F9JA 2BUNA 1FDBA 4M6HA 3GG1A 1WDDA 1AMPA 2QVPA 4PSWA 1HNIA 4QPXA 2PVWA 4RI1A 1NKCA 2YWKA 1REGX 2F4FA 1S7IA 1O5JA 4MT1A 5AXMA 3IG1B 3MR2A 4ECRA 2XYHB 4TU7A 4I4BA 4R3LA 5K9FA 2VQFJ 2RIJA 1DQ9A 2VG6A 1LK7A 4QYZJ 1U8WA 1LWEB 2J7KA 2RT3A 3MAAA 1RU1A 2K5TA 1RHQB 2ZJPQ 1JWWA 4CNYA 5I0CA 3OVAA 4O3QA 3TUJC 4ZS6A 5F49A 1VHEA 3HKWA 1Q16B 5IQQA 4IG0B 1ZZFA 4J9OA 2FY8A 2WW8A 5BWAB 3MMJA 2W9BA 4QZVB 4LMZA 3P8BB 2PIYA 2VQFF 1KOOA 2VBZA 3TQ1A 3JQKA 1Q53A 4FP9A 3J80Y 1S79A 1VBZA 2H1YA 1VRQC 5KT7A 2KHCA 2PA8D 2OPPA 1IOFA 1IWGA 3M05A 4B3TJ 2HRTA 2CG8A 1HL6A 1HA1A 5ETMA 1ZA1B 4X2TA 3W5YA 3F41A 3BO3A 3IWWA 2HZVA 3DNCA 4CWBA 4FNIA 4R8FA 1H98A 3ETOA 1UEKA 5CAAA 4OX9F 1C0TA 1X5TA 3FC9A 1C1BB 5LSOA 3FFIB 1QVGR 3ZZYA 5H1SV 3DOLA 4NXNF 4XPKA 2DPTA 4LX9A 3PRVA 1RKJA 1HLWA 1FKAF 3OJSA 2BJ7A 2VFSA 3PW0A 2VBYA 4PABA 3G8WA 2GIRA 3T1AA 1BQNA 5A8RA 2HGMA 3HJVA 2IAJB 1Y00A 1CEZA 3RW7A 3KLIB 2C2EA 4U8VA 1RSCA 3M8ZA 4NA2A 1XNQJ 2AYBA 5CNPA 3LPEA 4L73A 4L3KA 2MHNA 4HEA9 3IR5B 1U1NA 2ZOGA 2UUCF 4CH1A 1Q8LA 1FDNA 2X3GA 3HT3A 1S99A 3J7A1 2FC8A 2DK2A 3A3NB 3CJKA 2EC2A 3LQVA 5DZ6A 4PWUA 4KO0B 1C0UA 4NCGA 4WXOA 4HPSA 3VQSA 2E5HA 1YBUA 4ZY1A 3ISZA 1TF8A 4JI1J 2ZOMA 3D1HA 3R9FA 3NWGA 3NGDA 1CBXA 2YH1A 1WF0A 1Q2CA 3HVWA 2HURA 3RBDA 1T9WA 4TY9A 4ZLLA 2H4YB 1KLMB 3GU0A 2PDOA 3TUPA 3CD5A 2OIHA 1U24A 5IV3A 2CQ4A 3AODA 1FWLA 1F2OA 4OZ1A 4BINA 4DV5F 1YX0A 2XEJA 4DSFA 2FXFA 4ERDA 4KFBB 3OFHA 4X4RA 3QZ7A 3CXQA 4QPTA 1XE4A 4OL8A 3UE2A 4EZ9A 1FE4A 4I6YA 2CTBA 4C8NA 4LR8A 3LO3A 5CH7B 3CDAA 1LXNA 5KFBA 4RUAA 2ILYA 1WORA 3SXNA 1JLQA 1JLCA 3CJ0A 4LF6F 1IKYB 3DN9A 3QO9B 4J9RA 1X4GA 4X65J 2AWZA 4LFAJ 5HQ8A 2IYIA 1NU4A 4OZJA 2Z30B 5I4MA 5B0AA 3MR3A 3RBZA 1JJ2R 1T7PA 2V8VA 4KAIA 1R6YA 4WF9Q 1SH3A 4DFMA 4R57A 4UT4A 3FNNA 1QDUB 2DGVA 1KHWA 3KUGA 1LV5A 3CD7A 2EFGA 2IDEA 1E6VB 4KT0C 3EDQB 2KYZA 4ZA1A 2VQEF 3CCSS 4MHNA 1B87A 3SCKE 2HAFA 3IG1A 2KRRA 1YK9A 2B9XA 1UZHA 4JWPA 1MLAA 2PE8A 3DDKA 3MD1A 3M2RA 3F0AA 2LLZA 3EYZA 1IVZA 2XZTB 1QTNB 1TL7B 3BH6B 4LT6A 1G1XA 2YNIB 2DGQA 4JI5J 2BA9A 2Q1LA 4A8QA 1WG4A 4OLPA 1F3VA 4ZP9A 3DC2A 2GCFA 5J1NA 2AYMA 5DDOC 3HDSA 2ZITA 4MK8A 4C0BA 2HQYA 1PYOB 2ZELA 5RUBA 2V9KA 2ZBPA 1Z4UA 4YQWA 4W9YA 5C42A 1AZSA 1NK9A 3W2WB 3UDCA 3CD0A 8CPAA 1GHEA 5CYJA 5GADU 2GAGC 2Q43A 5A8KB 4KGKA 4B9SA 1DBDA 2HVHA 3BJ7A 3HMJG 3QSIA 4ITSA 1E6YB 1MWQA 4IG3A 2YNCA 1S1UB 1EX8A 4RW7B 4C3LA 1WC4A 3QLHB 2XEFA 5HH1A 1HDUA 3MZIA 4PWDA 3J7YI 3EGNA 4Q0BA 2ZEHA 3RB0A 4HL9A 3W8GA 3L7UA 1KLMA 1UFWA 3HX9A 3B4DA 2W7OA 1Y11A 3QGIA 4IFYB 2ZEMA 4WIIA 3VAIA 2IRYA 3G82A 2XLJA 1FNOA 3I32A 4OYWA 2KT5A 2DKOB 2VB6A 2ZNYA 2QSWA 3D6HB 3EICA 4OHYA 3D3SA 1F2PA 1HWIA 3U7JA 3TAQA 1ZETA 1PAUB 2DNKA 4HHUA 4PEOA 3ILJA 2CQHA 1X4AA 3D7GA 2BJDA 2L3MA 2ZH7A 3MPWA 5H9EK 4M5LA 2HHXA 4R5PB 4NZ6A 2RQCA 4QB9A 4L75A 1CJWA 5B7WA 2LQBA 2RQ4A 2B7BB 4XDDA 5CCMA 1DTTB 1KUVA 2XTJP 1VQ6S 4UUWA 3R8YA 2Q44A 3CSKA 1HNXJ 3BR9A 3Q23A 5G4DA 4DV0J 4YGOA 4DQPA 3GJRB 2CQ1A 1JKHA 9RUBA 2C28A 3CPXA 1YWXA 4BC9A 2H9ZA 2LQ8A 3MWBA 2B8PA 2LVWA 4B3SJ 5KFGA 4NLUA 2E9ZA 2DPSA 3GIIA 3BO4A 4RKUC 2EUIA 3CDEA 4DL7A 4ALZA 1KFSA 1GX5A 4ZVUB 2Z3NA 2E9TA 3HVTB 2AT1B 3TE4A 4NI2A 4FXDA 2CNSA 4MCPA 3R5GA 4A31A 3RU0A 1LAMA 1TKTA 3OFGA 4ZN1A 1Q8BA 4R25A 2CY2A 2CVEA 2E66A 1YTYA 1Q0NA 3KDNA 1GTEA 4DV5J 2P2CB 1H3DA 5GAGI 2E5GA 5A2QU 4RX6A 4NX9A 2W7AA 1RABB 4UTGA 3RB6A 4RS2A 2ZWPA 4NGSA 4PG6A 3RRGA 2PJ4A 4IRKA 4N7TA 2BM0A 4ZIWA 4ELUA 2MQ8A 3M8SA 1OY8A 2P6EA 4K2XA 4MFKA 2FZCB 2XHWA 4NGPA 2Z0ZA 4FS1A 3TA1A 3SEOA 2L48A 4ZIVA 3PJWA 5FIIA 3VHQA 3KK2A 4TKTA 3TX8A 2N4DA 2RF2A 3Q86A 2V2QA 4Q5VA 4X64F 3KQZA 4O3NA 2KU7A 1WWHA 2OSQA 1R57A 4B9UA 5E3QA 1FTRA 1RGVA 2H54B 2RDJA 5IT0A 4L76A 2GVZA 4NLTA 1NDKA 2HGLA 2J6UA 4NWBA 3RB3A 4O3OA 1U0SA 3PCOB 1JX4A 1L3SA 3MM8A 3M30A 1SL1A 3VTIA 1RCXB 2BXJA 3UR3C 4MTPA 2WBRA 3CT9A 5A2QY 4CAWA 4RWXA 2MZTA 3IWLA 3I55S 2OO4A 3K8VA 3DNSA 4PG8A 3IWGA 4X64J 3CXPA 1S5KA 4P2XA 3TJ9A 3LPYA 3KK1A 1CS4A 3OLAA 1T94A 4RBVA 3IBCB 4JI2F 2OAUA 2ZH4A 1C1CA 4KPYA 4DL0C 2E29A 5KFCA 4NZ7A 4JUZA 3RRHA 3PJXA 4HKFA 1P9QC 4TNOA 2VICA 4A8KA 1GXLA 2HNYB 2CJQA 3HFVA 4ZPBA 3W6XA 2QA1A 3C3LA 1CS4B 2VL1A 3IWEA 4MHZA 2Y9HA 1CJUA 4DR3J 1M44A 4EMEA 3DLGA 2GIVA 4K4UA 1IOIA 1Y5IB 1Z1ZA 2GQ2A 4UY8T 3IC1A 3VGUA 4PXCA 2YPYA 1IY7A 1F5CA 4MFBB 4F4AA 2HBYB 1JXVA 4P9SA 1NB2A 4RW4B 1J4JA 2VZYA 2FHMA 3TT2A 5HAOA 5DM7Q 4OP4A 3DHXA 5F0WA 3THPA 1VJQA 2CJKA 3C6UA 3BB5A 4H4MB 4C11A 2XY7A 5ADZA 3H42A 2YVSA 2WONA 1MROB 1RT1A 4KV8A 2NXJA 2W8KA 2VASA 1WC3A 3SFUA 1CPSA 1SBRA 5KTDA 3EM1A 4J9NA 3DM2A 4ES1A 2HVZA 1H6KX 4IFVA 4C3KA 4BBHA 1FVSA 3LWMA 1JJHA 3GFYA 2OB0A 3PACA 4Y65A 3QNVA 4CRZB 2KXNB 5AXKA 1IQZA 3RTVA 2HV2A 1IBMF 2QFIA 1P1LA 2VBQA 2PJBA 1LW2A 3DLJA 4CO2A 2I5JA 1ZO0A 2Q6BA 2J8MA 3R7BB 1QSRA 3C6TA 1Q7LB 3BQ0A 4C2MA 3K5OA 4ORFA 2WVFA 2FY1A 1Z2LA 3R2CJ 5T7LB 1KNZA 2HKEA 1KSPA 1TL4A 4CLYA 3QGPA 3JSMA 3NNHA 1OBRA 1W2BR 5IQ6A 2M4MA 1S1UA 4J9VA 3RBXA 5C2GA 1VHFA 3O3LA 3P6YC 1RAIB 4KZTA 2MKKA 3R6LB 4NGQA 2QYVA 1I6JA 3R97A 1V3RA 1AUSL 4Z37A 3DI6A 3BO2A 4DF4A 3FVLA 2KL8A 4WKYA 1NXIA 5MAOA 3HVAA 3JAMY 3CJ3A 3VVTA 4N8NA 1TKZB 2M0GB 3NNCA 6AT1B 4F0MA 2E5LF 5LYIA 1SH0A 4CZCA 4EZ6A 2DGTA 3ISNC 2VKRA 1JLQB 3QAYA 3D2PA 3JTKA 2F8EX 2PJ1A 4AE5A 2X1AA 2QN6B 2XEIA 1GK8A 3IWXA 3NAHA 1OWXA 1BWVA 2O28A 2V2KA 5CD4A 1HNIB 1UFHA 4V19X 1E6YA 4CTAB 4USUA 4TYBA 4NLRA 4CAVA 3HHKA 1BUXA 2FGOA 1RWOB 4X3RA 2FJEB 1RTIA 4HHHA 3AOCA 4F3QA 2XS5A 4LF7J 3W64A 4DU7A 1BOBA 2FZKB 2JDCA 4UQGA 1F6TA 2AHOB 3TYTA 3KNAA 4NCBA 3IP0A 5F41A 1M1HA 5H9EJ 2MTLA 2DHGA 5BJRA 4GKKJ 4C2XA 1AROP 5IT4A 3V6DA 4Y2CA 1XF8A 3LGNA 5IC6B 3BSCA 2P6TA 1U48A 1D3WA 2B3VA 2BYCA 2BOPA 2KDOA 1PG5B 4DCPB 3HLUA 2IFXA 4OI2A 3Q2TC 4N56A 4I2QA 3BGOP 1J5OA 3GQCA 3QWUA 4PQAA 2BKPA 2LMIA 1MN7A 2X1GA 1XMOJ 2GV1A 4DZ6A 4A4JA 3H40A 3T8WA 2BZ2A 4KOSA 2L9DA 3FCWA 2MLZA 2FVSA 3ISXA 2QT7A 2HNDB 3C15B 4GC6A 3H98A 4ZDNA 4K4SA 3LH2S 4I2QB 2OPSA 2JDJA 3CC7S 2P9EA 2QLFB 2C3UA 1S4FA 3MECA 1OY6A 2AGPA 5IT9U 4LSNA 1V5VA 4RW4A 2WVDA 1U1RA 4FVMA 3NKYA 1ZM4A 3G6XA 2B4OA 4I49A 5KFTA 3CJ2A 2MZQA 3RNZA 3FFIA 4H4KC 2XMMA 4OADA 1LAPA 2RDDA 1JWQA 2ZFHA 2JLMA 4KB7A 2FSRA 2RQMA 1WG5A 2OELA 2Q7SA 3UFCX 4OC4A 2BW2A 4DZDA 3KK2B 2M2BA 4ECTA 2Z58B 2PJ6A 2G9DA 2REEA 5KFIA 1JKHB 5D15A 1YJRA 2GFFA 3BXMA 1TK0A 2M8HA 1NDLA 3QJLA 3SQOP 2ABZA 4RL1A 2ZE2B 4YN3B 4J9PA 2W1BA 1PIEA 2VPWB 4H54A 3NOGA 1I94J 4KOVA 3KMSA 2YNGA 3Q89A 2UUBF 4JBCA 2ZDPA 3TO7A 3VR1A 3GV5B 2QSFA 4UWIA 3IM9A 2DGUA 2ZXVA 4U7CA 3HF5A 1U6BA 3ZZOA 3VZHA 3PP9A 2OPQA 4DX6A 1R0CB 4NLDA 2BEFA 1RAOA 1PC4A 2NUUG 2FHJD 4JI0F 3ULHA 2JLEA 3F8KA 1RT3B 4R87A 5H86A 3KLGA 3V4IB 4MFBA 1J2VA 1N4LA 2XS7A 1UWBA 5LT5A 3M32A 4YP3A 2ZD1A 4ZVTB 4CM0A 4IDKA 5IXUA 1I94F 2B4DB 4RU9A 2Q0YA 1R8HA 1K0TA 4KYZA 5DM6Q 3HO1A 5LYLA 4L6V3 5KFFA 4XO0A 2ZWOA 4M8LA 1CJKA 2HFNA 3EDRB 1T9XA 1HQUB 4NA3A 4M5MA 2EVZA 1LQ9A 2VHGA 3IBFB 2ALYB 1NMEB 4HNXB 3GR0A 3BBCA 1L3VA 3EXNA 2XNRA 5KTAA 2HQ3A 4BLGA 3ZZIA 3S6KA 4Q44A 3PX0A 4JV5J 4F3MA 1KBRA 2B4UA 3OR2B 2XMTA 5BR8J 4N76A 1YLXA 1Q8KA 3GYGA 2C6GA 1KWMA 4B3SF 1GMWD 2FJBB 1KD1T 1IKWB 1C0UB 1SIWB 3EMTA 4B02A 3H5UA 1FRLA 3VV2B 2R7XA 2HNZA 1FRJA 2XI2A 3AQPA 3TA2A 4DS5A 4M5GA 2FCKA 4L72B 4Y00A 5EWFA 2FLNA 1C4CA 2I2YA 2H65B 4OJHA 4O0IA 1QY7A 1HEEA 4H89A 2BRKA 5KTCA 1RP5A 3AT1B 1R8BA 3QT8A 1QD1A 4G1PA 4BWMA 3WC5A 2CADA 2XMKA 1LNQA 3IS9B 5D4PA 5D4NA 4OYOA 1TMMA 1T9TA 4OC3A 4DR3F 1RWKB 2MQMA 1UJ4A 3MEKA 1D8YA 1F2GA 3T5HA 3BI1A 3RR7A 2J8RA 4ZITA 2XWYA 2VKZG 5IC4B 1SIZA 4FXVA 4HI1A 3DM2B 1TAUA 4DUKA 5LRGA 2ASLA 5J2QB 1FRIA 4B13A 2DEAA 2RRBA 2A4NA 2VU5A 3PYFA 4R0EA 4ES2A 5HVHA 2Z0GA 2DO0A 1CPZA 2WW4A 3D0GE 4C6AA 4WKRA 3M8PB 1Q95G 1T9VA 4NOHA 4FWUA 5GAEI 1SVDA 3I82A 1LANA 2QG9B 1S7HA 4TY8A 3MCMA 2XSJB 1RTZA 3ENQA 4LQGA 4ED7A 3QIPA 1EIYB 2HMIA 3IGVA 2Q51A 4JI8F 3D9BA 5DG9A 3HT0A 2KH9A 2IIHA 2EK6A 5AGEA 5J8FA 2A18A 5E3CA 5KFRA 1EKSA 4WIQA 1JJ4A 2UV8G 4ZN3A 4KOYA 1PCAA 2OEKA 1CSJA 5D0HA 2X1BA 1WF1A 4JXRA 3PB7X 1NHKL 1RXTA 1Y7EA 1DFDA 1RAHB 2EW9A 2ARHA 3JSBA 2Z2YB 4KHPJ 3ZTRA 3VGTA 2PN6A 2OJ3A 2CJBA 5K8PA 3V6JA 3G6YA 2IBOA 2NSMA 1OPZA 4RPFA 4P71A 3PHTA 4TVAB 2VG5A 2CDQA 4RWWA 2CPJA 1K73T 3HXMA 2PJ5A 4R9MA 2B43A 1QJHA 2IRXA 2GU2A 2GIQA 2G3TA 1QUVA 1S49A 4CGPA 4CGMA 2Q3PA 3JVNA 3G8TA 2OP5A 2NREA 2IMWP 3TOQA 2MXYA 1OZPA 4DL6A 2XQCA 1RT7A 5EWGA 5LMUJ 4MYTA 3DFEA 4OX9J 4DEZA 3GYNA 2AW0A 3G6ES 1CJVB 3CXSA 3BBFA 5A8KA 1TK5A 1SC3B 1GNKA 3BZQA 3RJMB 2MZSA 4RJVA 2FVCA 1FXRA 3T1YJ 2HWIA 3W5XA 4K4VA 3E8OA 2V2VA 4QIFA 1PO6A 1HMVA 2YGWA 2JEJA 4OZNA 4HYKA 2HW3A 1OQ3A 5KFEA 4A94A 4R8UA 3I3GA 5F9LA 2XMVA 3D68A 2HFUA 1NK5A 4XPCA 4FYVB 1P9YA 2EXUA 4ZLNA 2JDDA 4OMEA 1P8GA 3IN5A 1N36F 4ZLJA 2IC3B 2E1AA 4D3GA 4GM5A 3FMCA 4IK2A 2AZ3A 1HARA 3FH4A 4KHMA 2GQQA 3VVUA 1IJFB 5KG4A 3BGLA 2FYXA 1A0OB 2AYEA 4CP5A 4DQRA 4QQBA 4NFRA 3F44A 2G4BA 1Q5YA 2GHVC 2RFHA 2ZW7A 2QTWA 1T11A 3N6NA 4FF3A 3UN5A 2HFZA 4LVNP 3LMSA 1MMLA 2PEHA 1YMEA 3A4TA 3WZ0A 3M6VA 1NJIT 3K5NA 5IWAF 4GO7X 2ASDA 4ZPWR 2CPDA 4MY0A 1NSKL 5L9XA 3L7PA 1U6MA 1MWZA 4M63A 2LDYA 2VF3A 4V19J 3TUIC 1FWKA 4PG7A 1HNZJ 4DV3F 5JVHQ 3HP6A 3S9MA 2ZBQA 1ZM9A 2WUUA 3KLGB 4LFCF 5L1LA 1RT3A 1RA7A 1HNXF 1MMNA 2V68A 2QZ8A 1JNRB 5GAHU 4L8AA 2QIFA 2HHVA 1RWXB 1OY9A 3NGTA 1EJ7L 1J5EF 2R7UA 1CX8A 4HDGA 3EZ5A 2V8GA 2BUEA 3TJ8A 4ICLB 3KOAA 4FYWB 4YS2A 2A1BA 5DO2A 2XEGA 3CCQS 1TMJA 5LMUF 2XO7A 2FTRA 2LEAA 4E98A 5K8NA 2BANA 3GONA 1RTJB 3AB4B 1XFOA 2CNOB 3LWLA 2MZJA 4QR0A 2YBVA 2KXFA 4JXQA 3A8EA 2AJ1A 2C3PA 2BOAA 4X4OA 4OZ5A 3HD1A 4FD7A 3JQJA 3GYXB 4LSLB 4YUDA 4GVBA 2QRRA 2IL4A 5ETTA 5HVFA 1LW0A 3MMBB 1TF9A 5KFHA 1ZOTA 4O23A 4MKAA 1RTJA 3OL8A 1Q81T 1YGYA 5AXNA 4R7MA 1MG7A 3CPWR 3R5JB 2HLUA 2DHXA 1F5AA 4QW8A 3OSPA 1R8CA 2G2ZA 1TVRB 3TW0A 1HQ2A 3CJ8A 2GFQA 1P4NA 1M5PC 2YQ0A 2ZVIA 3AFGA 5F3ZA 2F4VJ 5J1EA 1PYSB 2D41A 2PSWA 4IAVA 3PVXA 3HK2A 1TUWA 2BJ8A 1YJWS 2PQ8A 2U1AA 3D0HE 4B08A 2ASJA 3B3SA 2DB1A 4ZPTR 5FD1A 1M4GA 5JJBA 3HHNB 1KZFA 2PC6A 2DITA 2W2NP 5FDLA 1FE0A 1GMVA 3EE3A 5KG0A 3D1QA 1NPPA 3MPDA 1PGZA 2VFRA 3HSDA 2H5IB 3BKFA 2H5EA 3BI0A 4F4KA 2BEIA 3LP0A 5AXLA 1S0OA 3FZ2A 5D6GA 3HHLD 4MK9A 2FPHX 4OHZA 4YFJA 4IF5A 5ETKA 2AF6A 4CLSA 3KLFA 4PR6A 1KN6A 2PMHA 3MF5A 4MH8A 4PQUA 1X4BA 5H84A 3GCXP 1TFYA 4M5DA 2JBKA 3FZBA 2CJAA 5L46A 4KGMA 4EYHB 3M8PA 2FZGB 1Q78A 2QLXA 2B6AA 5BR8F 1NRKA 1PYTA 4YR3A 1BQXA 1VQPS 3EC4A 2DBBA 1TKDA 1S5ZA 3JTNA 1WHXA 4LSLA 5MLCV 4TQSA 1M5OC 1WTBA 2AGQA 3CMES 4JV0A 5H9FK 4GO5X 3PW2A 2DPJA 4F0HA 2EWHA 5ETQA 1WD6A 1S0NA 4P2SA 4S0MA 2OOTA 3C15A 2GLJA 1AT1B 1P6TA 2XI3A 5KFUA 4A8WA 4EK2A 1RADB 3NH4A 1QTMA 3TP2A 2Z57B 1L3TA 4ED3A 4CO4A 2YNFB 3UI3A 2F9DA 3OPKA 4WFYA 3TNVA 1S6PA 1N36J 3GPAA 2BACA 1TTHB 2YX4A 2HQDA 3WX8A 2Q79A 4USJC 3QWPA 2RUGA 4FYXB 4ID5B 2VFTA 4LR9A 2VG5B 1L3UA 2MQLA 4DFPA 2R7WA 1RAEB 3IS9A 4KSAA 1NK4A 1T05A 4DV1J 4QWCA 2UU9J 4DXLA 5LJ5Y 3P5TL 1Y0YA 3D7SB 3H0PA 3CC4S 1U0HA 2VFVA 3KLEB 1R27B 4IUFA 4LF1A 2EPIA 2RHQB 1U4BA 1IR2A 3J7AN 3EZOA 1PAEX 2B0GA 4NPOA 3ILOA 2WVEA 2J9DA 3M8RA 4DS4A 2VV5A 1BPNA 2J8NA 1CJTB 2KB2A 2OH2A 4ELVA 1TV6B 1SH2A 2HC9A 4HT7A 4ZI6A 4LF7F 2IC3A 3A8KA 1FT7A 1S4EA 2DNHA 1FKPB 4NRTA 1NUEA 6FD1A 2ZH6A 3AJ2A 2V0NA 2C42A 5F8LA 5CYMB 1RAJA 1R0AB 2HVDA 3LALA 1FF2A 2COLA 3ZNJ1 3O8WA 5J2NB 1YJVA 4P2MA 2W4PA 4TQRA 4PRFA 3R9LA 4JI7F 3C16B 3FCVA 2FHJA 1YBTA 1D9FA 3EX7B 3DLBA 3TI0A 3R9GA 4PAAA 3PW7A 1DTDA 1SL2A 1O8BA 1FWPA 3QAEA 3D2MA 4MFQA 3DRXA 3MUTP 2DR9A 3MTJA 5EDWA 2Z8QA 2Z4PA 3I9V9 1N56A 2MKCA 5AT1B 3WDOA 4UOFA 3TZXA 5FJ4A 2XSJA 2FC9A 2HGNA 1N33F 4U5YA 4ZJQA 2NQPA 2XCAA 4EBEA 4USKA 3MEDA 1AZSB 3RR8A 2G1DA 3V81B 5EC4A 3H5ZA 5F48A 4LSZB 1UL3A 2AFOA 4MKYA 1HBUA 2P6GA 3BPSP 2CZ4A 1CP7A 5HSPA 1XERA 1BQMA 3CTRA 5KFYA 3OFEA 2EC0A 3KI9A 5HMXA 3SQGA 4N41A 1F9FA 4XPDB 2IA6A 2ADCA 5C7PA 3HHLA 4DV4F 2MLXA 1RLDA 2UXBJ 1IKXA 4NGNA 2GIFA 1X4FA 4URGA 1XMQF 2VQYA 1MJ9A 1CLFA 3CJKB 4DL2A 3E2EA 4ILRA 2CPEA 2OFHX 3MGJA 3SZ2A 4DSJA 2D69A 2DNRA 2WVBA 2N3OA 2UUTA 2QO3A 4DQSA 4WFAQ 1Q5VA 1S76D 1BLUA 2YNFA 5F09A 1MW7A 4DG1B 3DRSB 2DR7A 2GE3A 1UKUA 4EO8A 4TXSA 2O5DA 4CYQA 1VBKA 2BE9B 3OTOF 1T3NA 2JZ5A 4UZCA 5CPAA 2GNKA 1RUSA 1UP1A 1XIQA 2Z3OA 3FMWA 2R42A 2YWHA 4KFBA 5JM6A 2QE5A 1XNRJ 3BJYA 1KFDA 2ILZA 1JLAB 1AFIA 3I6PA 2XGPA 2Q6CA 2WB1D 2AV5A 5AE2A 5HI7A 3LUYA 5D0RA 2NSCA 3CD6S 2ZKUA 3L2NA 4USMA 4GC7A 3PBEA 2HIYA 1JLAA 3RAMA 2Y0SD 5DQIA 4X62F 1KUYA 2Y1LB 3WHIA 2JHEA 4NJQA 3HI9A 4IG3B 4QR1A 2HHHF 1TKHA 2CPHA 1RTHA 1U25A 4DJLA 2Z10A 3R96A 2R3VA 3BH7B 1RT6B 1IKVA 2MQQA 1SL0A 2HQGA 1WF2A 3G8SA 3NL0A 3SV3A 2P9CA 4AQYJ 3UD3P 1IWAA 4F04B 1JLGB 5D8NA 2AZ1A 2IJNA 1VMBA 1QMUA 4C8MA 3NH5A 1UVKA 3ZXWA 2RS2A 5KOWA 3I1UA 1XR7A 3S1TA 1RTQA 4X4UA 3BGFA 4BWJA 1J5EJ 2ACYA 2HQIA 1D8ZA 4XDCA 4UEFA 1GXTA 2YTCA 3MEGA 4BDPA 4RNMA 5B09A 1RZMA 1VHOA 2KFYA 1MN9A 3N5FA 4LF8F 2DNNA 2LXIA 4RW6B 4DV4J 3GMGA 1VKCA 3AD7C 5DLFA 3Q8YA 3MMCB 2C3MA 2FJDB 3L09A 4P75A 1N32J 3M9NB 4A30A 5G0RA 4M5JA 1EP4B 4O4RA 1L5UA 5KAKA 3R27A 2QX0A 3NEKA 1X8DA 2RMLA 3MMCA 2RH3A 4I64A 3NE7A 3CCLS 1BAVA 3U1NA 4ZP7A 3T1HF 3PXGa 1M0SA 5BYQA 4QUSA 1N0UA 4K59A 5KT3A 1NHVA 1UWBB 5HMWA 3C16A 2PJCA 4MYUA 1ARLA 3U02A 4NYPA 1NZAA 5KFZA 2AJ6A 5DG7A 1X4DA 5CYQB 3AXKA 1OJ4A 3L4BC 2XO6A 4OZ3A 1NK0A 5L9NA 5DDPC 2XLKA 2ABYA 2PSZA 1H2TZ 3MM9B 4KUAA 4ZVPB 3PY8A 4A8YA 3RYOA 4URQU 4IYQA 3PO4A 5KFWA 4LFCJ 3B2YA 1VQSA 3IO1A 3ZZ0A 2DNMA 4X4SA 4Y28C 3HSJA 5KFLA 3BSNA 2I00A 2JRSA 2ZHOA 2JBJA 1AW0A 4ZY2A 4I2PA 3AOBA 4NE9C 2FJWA 3V4IA 2PI4A 3DMJA 2FVGA 5DDQC 2MB0B 1SJ1A 4PPDA 4J7CA 1X5SA 2LQ9A 3W3SA 5F8GA 2I8EA 3TJAA 1CPXA 4C7QA 1RQ0A 2DCLA 4A33A 2BJ9A 1TKFA 1KDNA 2SXLA 3LACA 5C2CA 4PZVA 2DVIA 2O3DA 1SB6A 3W2WA 4CAFA 2I79A 4YR2A 4NXYA 2P0WA 2VPXB 3MPUB 2XEXA 2W25A 3BYPA 1FJCA 4F6AA 5BYRA 2KVQE 4KUBA 4LIWA 5THWA 2RILA 2EO8A 1JQGA 3TZYA 3JQMA 1TAQA 4WYWA 3ZC4A 2DXFA 1I21A 3B6BA 2Z3MA 3R5DA 2HRYA 2C2DA 3OV7A 4NCGB 3W9JA 1WWZA 1QE1B 1Z4RA 2F3JA 2P6FA 4RW9A 3SIPB 4I2PB 1TV6A 1YRUA 2VG7B 2QJ8A 5L1KA 4QYZK 4UFXA 5J2MB 3PM9A 1TL3B 1TUGB 2J0QD 1FX2A 3V4MA 4HH1A 4NEZA 5AG7A 1X4HA 1LW2B 1CM0A 2CNTA 5JVGQ 2ZENA 2EG1A 1UJ6A 1X31C 4J5OA 5K5MA 1TELA 4GXHA 1RWNB 1EP4A 4NA1A 2CPFA 3DRRA 3DGPA 3CCWA 5E2QA 3UDEA 3VF0B 2L9NA 4F7VA 1EB0A 4YDDB 2VC0A 4M5IA 4ED8A 1EETA 4YB6A 5F3TA 2OH1A 1RT4A 2ZW6A 4PK2A 3KHXA 3QRQA 1UA1A 2J0SD 1Y9WA 3KLVA 1QAIA 2ATRA 4CGOA 1W2IA 3BPDA 2JEIA 5L39A 5HL7Q 5AJ3F 2MQOA 1AB8A 1HR0F 1SQGA 4X84A 2C22A 5J2PA 3QAUA 1CBKA 1JLEB 3N0VA 5HJYA 1LWFA 4IH7A 1VQMS 2U2FA 3Q0AA 1YK3A 4B9VA 2KZZA 3FBBA 4K4TA 3RGIA 1GAOA 1BXNA 2B56A 2F4VF 2ZH5A 2WK4A 3UR0A 2ZOFA 4CLLA 3R1KA 3UY5A 3VAKA 4YDXA 3M1VB 2K1RA 2LXUA 4PV6A 3Q8VA 4LRBA 3AXMA 2QA4G 2D1CA 2YKMA 2AJFE 2PJ7A 1TQLA 2E7XA 2LECA 1GYTA 2R7SA 3CDWA 1N6QA 4UFWA 4G1QA 2E1PA 5ETVA 4P4EA 3R3TA 3M1VA 1LCPA 4MAKA 3H8GA 4A2ZA 4OYBA 4D3HA 4CYOA 4TLQA 5KFXA 1MK4A 1S7NA 1TVRA 1FJGF 1TL3A 5CXTA 1DJ0A 2UUAF 2KJWA 3H2VE 2QL7B 2J0XA 1VQKS 2PI5A 1B99A 5HO4A 1K47A 1U2CA 2CUYA 4ZX9A 4P4BA 2BRLA 4OJ3A 1T02A 3AD9C 4CAXA 1MJAA 2JC1A 3ZZPA 2I38A 2YH0A 2ZC4A 1RBLA 4OI1A 2AFUA 4DR5J 5IX3A 5M2UA 4WFZA 1NK7A 4WK3A 3E3XA 4K2JA 2OPRB 4IR1A 2VA2A 1HW9A 2MMYA 4LRDA 1RT7B 3T9NA 4MFPA 1MMDA 2BCOA 1OPIA 1WK4A 2HFSA 1NLKL 3VWSA 1FD2A 4U7UD 1PUAA 1HNVA 4PSXA 1SUQB 4X66J 2QIRA 3KKFA 2V8HA 4X4PA 1IBKF 2YY3A 3N7ZA 5IB0A 4DSEA 3IGNA 3NCQA 3DRPB 1S48A 4O4GA 1Q1KA 5KFDA 1FDDA 1B6BA 2R7HA 1JNZB 4WFXA 3UWTA 3TVYA 3DXSX 2E5LJ 4PXBA 4XPLA 2MZRA 2D4OA 1S9FA 5ELYA 2ROPA 2XB2D 2LEPA 5C24B 2EWBA 4F8RA 2OD4A 2QMUB 3FEYB 3C2PA 5C25A 1VRUB 1UVIA 1K0VA 5G1ZA 1DAXA 4KY3A 4USHA 1YRTA 3BQ1A 3EVOA 5KT2A 3SFGA 4U7UK 3RAQA 3TO6A 3NXZA 1HBNA 3K5MA 2AKWB 3V38A 4G1IA 4K3NA 4ZLPA 3D3CJ 2FVRA 2VPYB 2RB7A 2QL5B 1S6QA 2DYAA 1TP7A 3BYRA 2R8KA 2PRBA 1OYEA 1UA0A 3MAQA 3PKYA 5L38A 4B3TF 4NMXA 4ED1A 4HH0A 1RAAB 2JOQA 5A6PA 4HKQA 3FEEA 4OYMA 2IM3A 4CO0A 1HWKA 1HD0A 3HLPA 2CIMA 1WKLA 3QAHA 1AUGA 3WIUA 2EFPA 3SBMA 2G0CA 4FD5A 2EFVA 3JYTA 4MIWA 1SKUB 4TY8B 1RAFB 2HHTA 4Y2IA 5CZXA 3US5A 1WG1A 2HIQA 4RN7A 3D6FB 5IS2A 5ITHA 3J81j 1RACB 1YVKA 2ZEEA 2ZW4A 4ATNA 2IJZA 4QIVA 1B0VA 2MKIA 3RG6A 3B35A 5SUHA 4Y49C 2IM1A 4F4XA 2JWNA 3BEGB 2VH7A 3FBCA 3CB4A 1HW8A 5EN1A 1TIQA 2AU0A 2HBQB 4F8ZA 1RB0A 2VIHA 1AXQA 4KO0A 1ZAVA 4ILLA 5IM0A 3H4DA 5F8JA 4RUHA 2K7KA 4J9SA 4DCOB 4IQMA 4NLPA 1VRUA 4U67Q 4QBUA 4C97A 2C2NA 1EARA 1R3NA 3GUXA 3R5AA 4DHVA 1RLCL 1G3OA 3GSDA 1J27A 3GIJA 5A6WA 3R2DJ 3HKZD 5CCLA 5D0GA 3W7BA 3Q8RB 2ZNZA 4JV1A 3SDEA 1QE1A 1DY3A 4NLSA 4QWEA 1ZPVA 4EO6A 1DTQB 1N88A 1CJVA 3G6VA 3OXGA 4YY3J 2UUBJ 3IXQA 3BF4A 4YEAA 2VBWA 2C6CA 2DR5A 3H59A 4KVOE 4F2RA 3N6LA 5G20A 5T7LA 2ZUAA 4DMZA 3SI0A 1HNWJ 2AE6A 2PE3A 4I7FA 3DDDA 3UDVA 5DJBA 1BLLE 2D3ZA 3NBPA 1OIAA 4C98A 3SJEA 3P45B 2V50A 1FKOA 3MM5B 2GO8A 4UIBA 4LBHA 4OHWA 4JI6J 1S1TA 5CYMA 2NPFA 5G0RB 4F0KA 5T41A 2B4PA 5GCNA 2EBJA 3LTOA 4JLYA 3DHWC 2XGQA 5FLXY 2F5IA 5A0YB 2KTQA 3W63A 2RQKA 1DURA 3KR4A 1OS5A 3LAMA 4E0AA 2E44A 3CDXA 4P4FA 3ZTSA 2FE7A 3ZTOA 1Z9UA 2RF2B 2PD1A 4B9NA 2DISA 2FJXA 3CJQA 3I4PA 1Y3KA 3L9ZA 4USWA 2GZOA 5B0EA 3W2VB 1FHTA 4JI8J 1ZBTA 1HQUA 1YQEA 2GAHC 3LF0A 4I67A 2ZEGA 5KG7A 3L3CA 4JI2J 3OXLA 3IMQJ 1B70B 2ZC3A 2PFDA 1X4CA 4HR2A 2AX0A 3BREA 3LW5C 7CPAA 4DPTA 2DRBA 2EBEA 1K1QA 4I1TA 4OYPA 4ZCKA 2H5MA 3V6HA 4DR1J 4B14A 4RW8B 3KMQA 4UA3A 1LKZA 2F65A 1FK9B 5AG4A 1NEEA 1U6FA 3HHDA 4QJVA 1JLEA 3NE8A 2F40A 5J2PB 4H6ZA 2R7VA 4N5SA 1CJKB 4DPUA 2BABA 2G1HA 3I0RB 4GRSA 2RRNA 2R2TA 1CQNA 1FXLA 5E5NA 2CQIA 5EMIA 2YKNA 4EFDA 2YNHB 2WONB 2G3AA 1B64A 5EWEA 1UPMB 2DR6A 3NGSA 3M8YA 5ETLA 4CO1A 4YHHJ 4YY3F 4DR7F 3I4HX 2RHSB 4O44B 3O1LA 4OX7A 4B3RJ 2LCWA 5E0OA 3T6BA 1WC5A 1IN0A 1G7CB 5DDRC 2B9WA 1XJOA 2PT0A 1AFJA 1N5YB 3AA8A 1IR1A 4MFZA 3D4JA 3IRXA 3R7SB 5LM7E 1S7LA 1X12A 3T41A 4ZBGA 2FUG9 2C1CA 4IH5A 2HQCA 4C11B 4ZY0A 3DSBA 1Z8XA 2HNYA 1FY7A 3N4WA 3OHBA 1GMUA 2OPRA 4DV7J 2N7CA 1AA1B 4JP8A 2NYQA 4DPOA 3KLFB 5KFMA 4WP8A 1YJ9S 2BE2B 4YWYA 3FEZA 1UEVA 3DOMB 4M1KA 1V3ZA 1YR0A 2OPQB 3RYLA 2WSAA 4FDFA 1V5IB 1VCTA 3KR5A 3K2KA 3IA0A 3O6QA 2R7QA 2PJ2A 1M4IA 1F2HA 2MSTA 3LP1A 2OZGA 5IWAJ 4B9LA 1U2RA 2J5AA 2RNEA 2Q4VA 4F4WA 4JYAF 2XYGB 4MCSA 1JB0C 4QR2A 1TFWA 3SSRA 1TKXA 3KJNB 3FIXA 4R3KA 4F36A 1BWEA 3MMAA 1DRZA 3DKDA 4ZPAA 3HPOA 1Q8IA 3UDLA 1PC5A 4KTQA 1SQHA 2C2ZB 4EMDA 3TZZA 5D29A 2RE1A 4I68A 3ZZTA 5AE1A 4DJBA 3KLHB 3HM9A 2X7IA 5CHCB 2CTCA 4FF4A 3B3VA 2G9OA 1Q86T 2AFSA 3R7NB 2OZHA 4DR2F 2LQJA 3K89A 3GFXA 1T05B 3PRBA 2J6SA 1SC6A 4NI2B 5IV4A 2ACMA 1IYLA 3P5BP 3OR2A 2Z3LA 3PR5B 2AFMA 3KUHA 1HMVB 3EVMA 3VAHA 5B0DA 2DXDA 3Q8SB 3FECA 4R6TA 3IEHA 1ZLHA 3BHXA 3E0KA 4ZVSB 2PRQA 3GTYX 4RW7A 2ZEDA 1RWVB 2UXCF 3JYTB 4P73A 4ZPDA 1NO8A 5LRKA 1LWCA 1Y10A 2CWXA 2WOMA 1KQSR 4CCHA 3DOLB 2ZM6J 1LOUA 5F47A 3BJ8A 3D7DA 4IHMA 4YR0A 4JYWA 2BMBA 3SI1A 4DV6J 1TL5A 2B9YA 4A8MP 1KC8T 2YNGB 2BKNA 4USVA 5HQMA 3CIZA 3KNGA 4MFJA 4QYRA 4JB8B 4YB5A 2D74B 3PYEA 4QIWD 3FCHA 1ZAWA 3PB9X 2KT3A 3KKWA 4P6QA 5HVGA 2W4CA 1TKJA 2LEBA 1RWMB 4OC1A 4USIA 4HI2A 3KJQB 5GMEA 1M90T 2XBPA 1RISA 1U6ZA 2XHCA 4ECSA 2HHWA 2ZEJA 5J1PA 4U9RA 3DGVA 3K9TA 2MHEA 4MKBA 1ZZNA 2ADBA 4MRIA 3KK3B 4W98A 1RT2B 3TWZA 3MR5A 3QRRA 4M5DB 3ELHA 4H2KA 2N4CA 3JB9k 4AL6A 1FDAA 4B3MF 2V67A 3DRYA 3H8YA 2B5GA 2I9SA 2HUZA 4EGLA 2AD9A 2ZHAA 2HZCA 4PYAA 1HYSB 2E1RA 3B3CA 2QJ3A 1RT5B 3AQOA 4LQ3A 2ZH3A 2J7UA 1S1WB 2AJ4A 2E9RX 2Q04A 4AXVA 2PC1A 3QFHA 4JD6A 2XMAA 3CO9A 4KSIA 2CQDA 1CJUB 2CQPA 2YPZA 2DXQA 1IU8A 3JTOA 4IO1A 3EUNA 1RK8A 1J5OB 5HROA 3GB0A 4N77A 1MU2B 3FEDA 3GJTB 1B4SA 2M8DB 2DEJA 4C7IA 3QRPA 3W6SA 2PDAA 2OEJA 1VQOS 4HTIA 5F46A 2KRBA 4JV5F 1A6LA 2NXCA 4Y49B 5D4OA 1KEKA 4HVZA 2L41A 3GIMA 1X4EA 4PK3A 1GH8A 3T1YF 3R6GB 2WZNA 2A6MA 4Z65A 1R0BG 1APSA 1N6QB 2AMCB 1QSLA 2YQ3A 2GHPA 3BKUA 3U1LA 4FN5A 2HWHA 3HFZB 5EX0A 4K4YA 1D9AA 3VCDA 2C6PA 4I6WA 2MEWA 3PRTA 4NSQA 3PW5A 4DL5A 3V2UC 4OYAA 3RW6A 3P2FA 4CS0B 3W9IA 1NKBA 1WOSA 3TAPA 4B9TA 1TXRA 4ZVOB 1Z8TA 3CJRA 1FI4A 3KFWX 2N7YA 5DETA 3R9EA 5J1QA 4WCEQ 3W66A 4ZOSA 2I5JB 2GREA 3HZEA 2K2PA 4Q2MA 4O0NA 2HS3A 4OYZA 4KLVA 2EKYA 5A76A 2HS0A 2IYGA 3LODA 3ET6B 2CKWA 4C2YA 3AHPA 2WCXA 4CQ1A 2W2MP 4P4DA 4DQQA 2E5JA 1VIXA 1IJEB 4J9QA 3NGUA 3FJ2A 1Z8LA 3BN4A 1UW4A 4G3IA 1WNEA 1ZG8A 2R9LA 3SJXA 2CZVC 3GSIA 2Z2LA 4CNZA 1HNVB 4LF6J 3B54A 3FDSA 2O67A 2PMZD 3K0JA 5ETSA 1ON0A 1C0TB 4RNFA 3T90A 2RJZA 3CCRS 3C46A 4RW9B 1JMTA 4HHJA 4DR6J 2JX2A 4ECQA 4EI2A 2CRLA 4M6GA 1JLBA 2HLTA 3JAMU 1WKKA 2J8AA 4ZX8A 4ONWA 4ED5A 1BGXT 5J1EB 4DV1F 4UEZA 4X4TA 2ZZMA 1LWEA 2A6OA 1QM9A 4TYAA 1PJ7A 2KHDA 3H8FA 1WOPA 1PILA 4IQXA 1RT6A 4NGTA 5HLFA 3C14A 3O44A 1HQEA 2O1PA 2DNPA 3NMRA 2DNZA 2IM2A 2H51B 1NM2A 2BE2A 4DR6F 3KJVA 1CP6A 4PG4A 4RR5A 1S9EB 2LU1A 2NS1B 4F02A 1FKOB 3MM5A 4ZVHA 5IZHA 2HVIA 1JJCB 4DV0F 1OQ6A 4XIUA 3QYYA 1X0PA 1FJGJ 1PJ6A 1FRHA 2BSWA 2DNYA 4KSEB 3ZTQA 1UVLA 3EY5A 3GIRA 1ELMP 1F1BB 3P3DA 2JFDA 2EKNA 3AOAA 3GIUA 1LW0B 4BD9A 4NJRA 1H2VZ 2QMWA 1WTFA 5HJXA 4ETZA 3VGSA 1WHWA 2B3UA 4F67A 1MU2A 3UN2A 1N33J 4NF1A 5H9FJ 1Y5NB 1OSCA 3OTCA 3NS7B 1FRKA 5DG8A 1M1GA 1W7WA 4BS2A 5CZVA 2LDIA 2J76E 3VQTA 2WSCC 2YXLA 5D77A 4HLBA 1QSOA 1Z4EA 2ALZA 1XMTA 3S9LA 1SQFA 2YNEA 3T5LA 5K8OA 4C0OC 2IQ6A 2KN4A 3J80U 3VWDA 3KHZA 1VQLS 4RZRA 3I0SA 4MIAA 2CA9A 1IBCB 4ID8A 3O5TB 1ULRA 2B7CB 2HHSA 2HHUA 2YQ1A 3HVRA 3UCUP 4HT5A 2FHKA 1URRA 5LL6d 5KG5A 2KFZA 1UWAA 4I56A 1YW6A 2ZEPA 5L1IA 4ECYA 4KGVB 2YWWA 3K7RA 2PA3A 1FJEB 1E6VA 2PJ8A 3AD8C 3D28A 1FERA 2CQ0A 5AG6A 4K30A 2OI2A 4J9MA 1FNXH 2I1RA 1ZPWX 2C3YA 3QGHA 2JEFA 3C8YA 5CD4H 3W9HA 4DSIA 2ZH9A 4IRCA 4FF1A 3RZAA 2ERRA 1TL1B 3DYAB 2APOA 4JI7J 4WTYA 3VWEA 1PKUA 2YKAA 1V6HA 3S7RA 3V6DB 2HFOA 3A3PB 2CNMA 5KT5A 3DXBA 3NG8A 3HHEA 2P5VA 2NYIA 3NOCA 3A8JA 4P52A 4WZQA 5C24A 2KM8B 2M9KA 4CLWA 5B0CA 1TL1A 3DYAA 4MJKA 3AA9A 1HYSA 2HQFA 9ATCB 3B8GA 4GKJF 3AAWB 2EFQA 3BGUA 1H7XA 2VZ9A 4V1Ak 3M9OB 2OSRA 2NCKL 2CAJA 3K59A 3MPYA 5CABA 3HHLB 2ZBRA 5D0EA 3DMJB 1LK5A 3KK1B 3EXYA 4RW8A 3CCVS 3U27A 1M4LA 3CULA 3CCES 2QYGA 2NXNA 4U95A 2R8IA 2Y0MA 3TEHB 5DLGA 5JXSA 1NDPA 3B8HA 5E96A 3V81A 1SC1B 2VDIA 3CW2C 2XS2A 5I42B 2CXAA 2V69A 4Q45A 3IJ3A 1N34F 4RO0A 4LSNB 2VBXA 4WP3A 2XMWA 3CCUS 3MXHP 3L95X 4ZK7M 1IYKA 1XMBA 2DRDA 4IFVB 2QGFB 4PUOB 1DLOA 4RBUA 4N8OA 3P2HA 2OTLS 1RWWB 1LRZA 2UUAJ 2BQ3A 3IU1A 2UXDF 2BX6A 4PUOA 2R8HA 3RAXA 2KYXA 4LIRA 5J2NA 1A7GE 4OYIA 2J6TA 2WTFA 2CDRB 4USTA 4O3RA 2Q4ZA 2HK2A 1SJ4P 1RHRB 1T0TV 3BGRA 1HKAA 2OPPB 4W92B 3GP9A 5EHHA 4TNUA 1VLYA 4NLGA 4ZCLA 3DU5A 2K7JA 3Q22A 1IICA 3ENVA 1WOOA 4CYNA 4M85A 1QQ9A 4II9A 3V6KA 1UEUA 2ASYA 3WC6A 4OIDA 2DO4A 2PJAA 3VALA 1SKRA 3UN3A 1WC6A 4CT9A 5GAHI 3IGRA 4FPIA 4JI4J 4UIAA 4K4WA 2PFFB 2RVJA 2BJ3A 2CWKA 3R95A 2YKMB 3BQ2A 1YI2S 2DTJA 1W26A 4OLOA 1D0EA 3CCMS 3D2WA 2R98A 5HLFB 3PEHA 2BQRA 3BDEA 1IM6A 1NJWA 3D66A 2DIVA 3PZJA 5B0GA 2IMOA 3GZ7A 2GJFA 4BHQA 4ZGYB 3MN8A 2PO4A 3T5JA 3QFWA 3FXTA 3MOZA 2B5JA 4C2ZA 2OTJS 3NGKA 5ISVA 1KQGB 1HI1A 3NNAA 3E01A 2ZEOA 3ISND 3B7IA 4NMLA 4H4OB 2R2RA 2VC1A 3EGVA 1EHWA 2D9PA 4MXUA 3EWGA 2KFNA 2M7SA 2MGZB 3I9SA 1M1KT 3KXDA 4DV7F 1RKIA 4NL5A 1BC6A 2ATCB 3KL9A 4TU9A 4DLEA 4IOBA 1UETA 4G6VB 3FSXA 5EX3A 2I6WA 1H72C 3MGDA 3PYGA 3NGRA 3TO8A 2CQ3A 3S01A 4X66F 4DR4J 1NDCA 2IY5B 4MHDA 1VBXA 3MM6B 4QVTA 1P1TA 1XRYA 2RKIB 4FBUA 1DHMA 2CQ2A 3TTHA 3O2IA 1TU0B 4B5PA 5CYQA 1WEZA 4M6IA 2LP4A 1T95A 1CC7A 2GANA 4DUTA 1BPMA 3ENAA 4CRYB 4WJBA 1KQKA 2DHAA 4KOWA 1AUDA 2DY1A 5HXDA 3PYDA 3DRSA 2I3CA 1K9MT 2EI5A 3MR7A 1VLOA 2BVZA 2K8GA 1R7IA 1HPZB 2ZZTA 1YKWA 3IFEA 3SSQA 3T5KA 5HBMB 3N5BA 4K4ZA 1FEEA 2WHOA 4DR4F 3C66A 3SSSA 5LYDA 3DGPB 4XNHB 3T9YA 4ETXA 4YRHA 2K3KA 4QCLA 5D4LA 3AB2B 1WHVA 2J9CA 3DRPA 3QGGA 3FGVA 4OI0A 3SJFA 2KO1A 2QYCA 3M2VA 3A8IA 3V5RA 4IRDA 3N9UC 4W90B 3G8QA 3ZFVA 2IVFB 4OHVA 4TLRA 5JGFA 1RHMB 3Q8PB 1S1VA 4J37A 3M2VB 3QZ8A 3ZNUA 4M5HA 3JTPA 1HWUA 2OZUA 3FKBA 4OKOA 5GADI 1BQNB 4YB7A 4CGLA 3KJVB 4CLZA 3TO9A 2DGSA 1KUXA 1OYDA 4E8OA 1YREA 3PBBA 3G71S 1YVOA 1TR0A 1F9HA 4K5RA 2JH3A 3DLEA 4FPRA 3PEJA 2WYRA 1F0XA 5KOXA 1QSSA 5JH9A 4B9MA 3SV4A 2AJQA 1WJ9A 4WTOB 3BBBA 2WSFC 4EUVA 2XMJA 1ZTTA 5HK4A 5LXYA 1S9GA 4CRJA 3MM8B 5SZTA 3UVJA 4NCAA 5C82A 3T9ZA 4MHPA 1RWPB 2OUGA 3R5BA 4ZPCA 1NH8A 1CC8A 3I5AA 2ZEFA 2O01C 3X1LB 1JIHA 2W9CB 1VQ8S 3A13A 2GGPA 4Y2KA 3BSAA 2OLWA 2MJUA 4UCNA 4JI3J 5J2QA 8ATCB 3OWCA 3UCGA 4LBPA 1DARA 1VC5A 1KS2A 4KBIA 3DR6A 1IBLJ 4Z2XA 4DF8A 2LA6A 3TX0A 2B51A 4A47A 5DZ7A 1VQ9S 4ZHRB 2WB4A 3CEDA 3PB6X 4CTAA 4LF4F 3S6EA 1PBUA 3D7FA 3MDFA 1RI7A 4AXIA 5K14B 1G2EA 3NMAA 2HBZB 3B4MA 2C1EB 2P6SA 4DYOA 1XNQF 3QIDA 2B6AB 4DSKA 3IBWA 4MK7A 3V7ZA 2FLLA 3OXFA 2VOOA 2OKQA 2HWTA 5K14A 3C6UB 1IBMJ 1K1SA 4QIGA 1U1QA 3K5PA 4Z7CA 1WC1A 4FVCA 4B12A 4YMEA 2FL4A 3DDIA 3K2YA 3A1YG 1ICEB 3W2VA 1RTDB 4CPAA 2NYHA 3H2LA 5HP1B 3SDEB 3G82B 2J9DE 3OTBA 1VGYA 2DHHA 4I0WA 5E3PA 2XWXA 3HSGA 2AJ2A 4DUZF 4M3SA 2MQPA 4QU7A 1JLCB 3J7YU 1H38A 2ZZNA 2C3OA 2PGCA 5JMNA 1EETB 3TEGA 1DZ5A 4CAEA 1NNDA 2DH7A 3VAMA 3SI8A 5J8CA 1Y5LB 5HP1A 1B7YB 1KOHA 2E5IA 2B4VA 1O51A 4OC5A 2Y0BB 3MECB 1ARMA 4YHHF 3NCPA 1UFLA 3MEEA 4L74A 4DV2J 1DTTA 2R8JA 4IR9A 3DLHA 2DD8S 3PDNA 3VH9A 4IDKB 1S77D 3TOBA 4F0XA 1HDQA 2KI2A 5F0UA 1T9UA 2DIUA 3DDNA 2HYIB 1NJZA 5KG1A 1EZZB 2CVIA 4P45A 2NSBA 1R89A 4FAIA 4Q7AA 2QLBB 1XK8A 2W2QP 1HWJA 5L8RC 2GVDB 2UVRA 8AT1B 4RNNA 7AT1B 2J0WA 1QVFR 2VG6B 4DLGA 3H4BA 3FRZA 3T1HJ 3WT4A 1NE9A 3NA6A 3FNCA 1ELLP 4DX8H 4K4XA 2LYVA 1RJJA 1H74A 4F0YA 1JK9B 2VUGA 3MCSA 1M5HA 1S9EA 3HHLC 1VS3A 3JXOA 4PWWA 4ECXA 4YU9A 2M88A 2E7VA 1S57A 1DE4C 1D09B 4Y0FA 4KKOA 4UQTA 1RA6A 4KHPF 1NSPA 1WUUA 4RNOA 5KFJA 2OFGX 4CDIA 4AVCA 3DOKA 1N54B 3NCRA 2BKOA 1TUVA 3C6TB 5EUHA 1KLNA 4X4NA 3JUWA 3I5BA 1M5KC 3T6JA 2V5HG 2IDLA 1F60B 4K8RA 1FESA 4OI6A 4NXNJ 1LOKA 4P72A 1RT5A 4AT1B 1VC0A 4ANDA 3MPVA 4ANCA 1YJUA 3VAJA 1RWUA 4C0HA 2NUHA 3EXCX 3GJSB 3CJSA 3MD3A 2QA2A 3FBFA 1XNRF 2Z56B 3OUYA 1PJ5A 1VJWA 1FKPA 1VDHA 3KG4A 4A95A 1YW4A 1UTAA 4NEXA 2RSQA 2D3O1 6CPAA 1UZDA 2BBEA 3HSZA 4X8IA 1S97A 4LRAA 2XZDB 2YWEA 3HD2A 4IO9Q 5JQ4A 3KHGA 3S8SA 2W9CA 1NMTA 2MZ1A 3MM7B 4TN2A 1VRTA 5KG6A 1Y0RA 1NPRA 4QW9A 4R0JA 4FYDA 3EPGA 1Y9OA 1NSQA 3UPFA 3TVZA 3BKTA 1S1XB 1JLBB 1P27B 5HMNA 4X62J 1YGHA 3KASA 3GYAA 1IQTA 4QWAA 1UFKA 4I69A 3KZWA 3IAM9 2FJAB 5HBMA 3OW2R 1M4DA 4K0KJ 3TANA 5KFAA 3PO5A 3MUMP 2BQUA 4PWDB 3CWJA 4X4VA 1FO1A 4U9YA 4BBYA 3T19A 5ETOA 4OJ1A 4GKJJ 2V94A 2PJ0A 2F8HA 2MQNA 3QNWB 2UUWA 3MAAB 4LF2A 3GR1A 4MBUA 4DR2J 1SJRA 4OV1A 2FLOA 4RBTA 3N6MA 4PKDB 2GS8A 1NJYA 2MY7A 3ZZUA 1HPZA 2AX1A 3FSYA 2HHPA 3FMBA 3N01A 4JI4F 4LBIA 4F26A 3PR4A 2PIIA 3ITHB 4OZ2A 3DOMA 4X4QA 5DQHA 1HR0J 3IR6B 3U1MA 2F63A 4LUBA 2MLYA 4GS4A 3NS6A 1U09A 3QPIA 4JJXA 3FJUA 3CXCR 3HUVA 4DPXA 4A32A 1T03B 1Z5RA 4C48A 2PJ3A 4UW2A 2DNOA 2AEMA 2UVUA 3D3BJ 3SQGB 5C42B 3M9MB 3BN7A 2KVIA 3ILLA 3PIOQ 4UY85 4NLXA 3DU6A 1CJTA 3M6UA 1JLFA 1YIJS 4JYAJ 3F5BA 4X5KA 3NLCA 4CLKA 3D0IE 1UJ5A 3RRKA 4DPWA 3OTEA 3GILA 2EVNA 4ELTA 2CNNB 2G2YA 2QC3A 1UMJA 1S60A 2BL1A 2CJ9A 1S10A 3KHRA 2UXDJ 3GLJA 2CYYA 2RRAA 1U1MA 2RC4A 5HMYA 1RBOB 1HQEB 1MNEA 3THTA 5DRKA 5IOLA 1C2PA 1GMWA 1BQMB 2E1MC 2RU3A 2CQGA 2B4DA 2HHQA 4DFKA 5C25B 2V6AA 4AG7A 1WELA 1XJWB 2B8QA 1YG0A 4U6PA 4OHXA 1N0VC 2VI7A 2W7PA 2DHSA 1FFGB 2JC0A 3KDOA 3GCWP 1XIXA 5B0FA 3MMBA 5I3UA 4KPCA 2AQ4A 1Q82T 1AYEA 2R7RA 4DSLA 2REFA 3OT9A 2AP6A 1BMQB 1U7LA 1XQIA 1C4AA 4WE1B 1WKJA 3PB8X 4WFNQ 1U45A 4DN0A 5EGYA 1S0MA 4A8XA 4OAEA 2FS5A 3EGWB 3KJFB 4DV3J 3FEXB 4BCAA 2OD6A 3S6FA 3TAMB 1VIOA 5F9NA 4OZLA 1FX4A 1S1WA 3QJPA 2HS4A 1Y7PA 4CLPA 4LREA 4FYYB 4MCQA 4AG9A 2WOMB 2VPZB 1DQ8A 4F4ZA 4WE1A 1NKEA 1REVB 2ATLA 1S3ZA 1T03A 3PIPQ 2YNDA 1IR0A 1FFSB 4NLYA 1SCJB 3S6GA 3PV8A 3HULA 3K8WA 3OL6A 2QV6A 2ZH1A 2V77A 2A2CA 3JSRA 3G96A 4O4GB 4ED4A 2OPSB 1CQMA 4OX6A 4CYPA 4FXWA 1KVJA 2K1RB 2DH9A 3AH6A 2Z11A 3QBCA 1U49A 1FRMA 1M1DA 3B78A 2H4WB 3WIVA 1SPBP 4EFAC 1B7FA 1N5TA 1KONA 4OIXA 2Z3KA 2XLIA 5G22A 2R1IA 4CH7A 2HSEB 4ZMMA 2M3DA 4KSFA 2IAJA 1KKHA 4KVXA 2CPZA 3GWCA 3CF5Q 1Y3JA 3ET6A 3D5MA 2CZ9A 3W91A 2HBRB 2NZCA 4ID5A 4ED6A 1VYAA 2J8SA 1RT2A 1KVKA 4WZMA 2JVOA 5KFSA 3KGQA 2XG8A 5KFVA 4LFAF 3ZO7A 5J2MA 4WPAA 1HBUB 2DGWA 3MOJB 2HG4A 3VAFA 2KZMA 3NRBA 1NCLA 2DRAA 4P7VA 1NZ8A 4ZYQA 2D4PA 4KRWA 4NEYA 2F1FA 5IFMA 4DFJA 1X5OA 2YX1A 2JLGA 3EFAA 3TVKA 1GQEA 4HTJA 4AXJA 3UD4P 3QB8A 4UCPA 2MJNA 3UO0A 2HVEA 1P0HA 1VQ4S 3IRWP 1CVJA 4UOCA 2LXFA 1IXKA 4ZP6A 1K8AT 1KR4A 3KHHA 2XNQA 1BE4A 1WDTA 4P2FA 4Y3CA 3CMAS 2ZKTA 1WEXA 3D67A 1UVNA 4B3OB 3IU2A 5JPHA 4MI4A 2QMXA 4IUSA 2FVQA 3M30B 1U0HB 1VQYA 3KLEA 3IWNC 1LXJA 4DL4A 1QSMA 4XK8C 4B5PB 3CGIA 3WBZA 4E0DA 1XEZA 3HJFA 4KKOB 3GFHA 3H90A 4EWTA 2BDPA 1S7FA 3FBUA 4JI5F 4AQYF 5LRJA 2ROEA 2LU2A 5D78A 2Y8WA 4F9UA 4B3OA 1WACA 4A8OA 1NK8A 4XAKA 5LXRA 3CPAA 1X10A 2YWGA 2ANPA 1PSDA 3FX6A 2P8IA 5FDLB 3EPIA 3OL7A 5FVJA 3D6TB 1RT4B 1R8PA 3K17A 4KIAA 4NASA 2YWFA 3OQ2A 1DLOB 2ZDOA 1GXUA 5M2PA 4P7TA 4B3MJ 1WEYA 1LEOA 1O6XA 3NS5A 4KH0B 5C88A 2C2RA 4LF5F 5A8WA 1YBAA 1R31A 1WI8A 4Q38A 1XBUA 4ZCIA 3OHAA 2IA0A 5KT6A 1HBMA 3OFFA 3KTQA 3UNYA 1KRPA 2DF5A 3Q2SC 3MCOA 2KM8C 1IGBA 4ECZA 2N82B 2HK3A 3CVKA 2W8LA 4Q43A 2IBKA 3T3FA 4AL5A 4JI3F 4QBJA 4JOUA 2VA3A 1SQEA 3JRUA 4JI1F 1YZ6A 4DBQA 5F8IA 4P4IA 1EE3P 3FVYA 2F7VA 4CO3A 2CPIA 1K4JA 3WC0A 1S0VA 1DQAA 3S9NA 2UXBF 1SJQA 3ITHA 4J9LA 4DPYA 2M5YA 3PEIA 1U47A 3QSYB 1KVIA 4LQ9A 1ZG7A 4RUBA 2UVVA 4DR7J 1GX6A 5A0YA 2KKHA 4OC2A 2A3JA 5B0BA 2O53A 2A2DA 3KG1A 2RD5C 4FF2A 4DN9A 2JEGA 1SC4B 1UPPA 3CC2S 3Q8QB 1FXDA 3H5SA 1D9DA 3H8EA 1URNA 1VHSA 5GAGU 3UW1A 2V9WA 1VFJA 3C14B 2O66A 2XULA 2MDAA 3B3WA 4K5SA 1O0PA 1Y7RA 3POTA 4IFYA 2YKOA 3G2XA 4LF8J 2E1CA 2D3OR 3W60A 2BV3A 3N79A 2OU2A 4EBDA 1I1DA 5KFPA 3MAHA 3CMQA 1SXLA 3WR7A 2PIZA 5A27A 3LP2A 3H20A 3TA0A 1N34J 1Y9KA 4EEYA 3MEEB 2DPIA 1T3OA 1IB1E 3MMAB 1TL7A 4YFUA 4NYOA 3CE8A 3SI2A 4AYBD 3IR7B 5AJ3J 3GG0A 1NK6A 3MRUA 1VK3A 1RAGB 2EEYA 1XTZA 1HIYA 3FF3A 4OX8A 3LANA 4A38A 1HBOA 3NFZA 3FB3A 2R2SA 4AFFA 4IOAQ 2HEKA 4L89A 2WSEC 2VXKA 2KXHA 4LUAA 1YLOA 2XZWA 4OYXA 1ROFA 1T8EA 2GC8A 3FQKA 5D3GB 4Y2MA 3CJ5A 3PFOA 2XCPA 2RAQA 1F9EB 2PEBA 1I51B 1CULA 1RTIB 1X5PA 4F4YA 3ZJ0A 4CT8A 1LWFB 5KFOA 1VI7A 4FBEA 2QA4S 1G4CA 1PBAA 4M95A 1N8RT 1C1CB 2IPOB 2DH8A 4CLFA 3SXOA 3TUZC 4F3OA 3GV7B 3GIKA 1CULB 4H4KA 1RBAA 4P44A 4CIOA 4LFBF 3GKRA 3KLHA 2EFNA 3RBUA 2ZBCA 2V4RA 2EK8A 3FYNA 4QOTA 1N5YA 4Y6IA 2AEJA 2GJIA 4KOXA 3G3SA 4G1QB 1YJ7A 2YX7A 4AB7A 2CIJA 3NWRA 4I6AA 2JLFA 1IKXB 2G2OA 3C26A 2XSFA 1Z2ZA 5E7OB 3UVJB 4KGXB 4WU3A 2GHWA 4ZVGA 2VEZA 3WQPA 5HN0A 4AVAA 2CPYA 3D54A 1ITPA 2OMOA 2V63A 3F0NA 4C8LA 2AIRB 4C4WA 3VATA 3A3OB 3BR8A 1MROA 2QEXS 2VZZA 5AE3A 4HNYB 4EVYA 4PYDA 1ZYQA 1M5SA 1GFWB 2UU9F 2ZE2A 4WBFA 2QLWA 4PQUB 5A28A 1RYRA 4Z7YA 2G0IA 1N52B 4P74A 3SCLE 2PCUA 5LYFA 2JL9A 4DUYF 1QUPA 3V8IA 2FIUA 2W24A 1IUJA 4RUCA 4E2AA 2X7BA 3H5YA 1PU9A 1CG2A 2R4FA 3AJDA 5D3GA 3ADAC 4ILMA 1N5VA 3PKMA 4HNWB 1NHUA 5IT9Y 3Q24A 2JVRA 3B3TA 3G9CA 3DLKB 3OVSA 1W25A 2CJYB 1TKTB 3OJUA 1QAJA 1LWXA 4ECWA 3TCVA 3BS9A 2AFZA 2V4JB 5ETRA 2CG4A 4DQIA