1CG2A

Carboxypeptidase g2
Total Genus 135
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
135
sequence length
389
structure length
389
Chain Sequence
QKRDNVLFQAATDEQPAVIKTLEKLVNIETGTGDAEGIAAAGNFLEAELKNLGFTVTRSKSAGLVVGDNIVGKIKGRGGKNLLLMSHMDTVYLKGILAKAPFRVEGDKAYGPGIADDKGGNAVILHTLKLLKEYGVRDYGTITVLFNTDEEKGSFGSRDLIQEEAKLADYVLSFEPTSAGDEKLSLGTSGIAYVQVNITGKASHAGAAPELGVNALVEASDLVLRTMNIDDKAKNLRFNWTIAKAGNVSNIIPASATLNADVRYARNEDFDAAMKTLEERAQQKKLPEADVKVIVTRGRPAFNAGEGGKKLVDKAVAYYKEAGGTLGVEERTGGGTDAAYAALSGKPVIESLGLPGFGYHSDKAEYVDISAIPRRLYMAARLIMDLGAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CARBOXYPEPTIDASE G2
publication title Crystal structure of carboxypeptidase G2, a bacterial enzyme with applications in cancer therapy.
pubmed doi rcsb
source organism Pseudomonas sp.
molecule tags Metallocarboxypeptidase
total genus 135
structure length 389
sequence length 389
chains with identical sequence B, C, D
ec nomenclature ec 3.4.17.11: Glutamate carboxypeptidase.
pdb deposition date 1996-12-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01546 Peptidase_M20 Peptidase family M20/M25/M40
A PF07687 M20_dimer Peptidase dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.360 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1cg2A02
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 1cg2A01
1LOKA 4MCRA 1LCPA 1PYTB 3HUVA 4NGQA 2PJ2A 5K8MA 5I4MA 3RAMA 2C6GA 2WYRA 1YMEA 2V8DA 3LMSA 4G1PA 4P45A 3PB4X 3N5FA 3WC5A 3B3SA 1YW4A 5D29A 4UEZA 1ZLIA 4A94A 1TF9A 1CP6A 4WWVA 1BLLE 4MXUA 3B35A 2C6PA 5LRGA 2POKA 1TKFA 3D7DA 3IJ3A 4WJBA 4MHYA 1HEEA 4P4FA 1R3NA 2RFHA 1Y0YA 4P4EA 4MMOA 3BI0A 3KR4A 2QVPA 2F8HA 2IMOA 1LAMA 1BPNA 2O53A 1IGBA 1TF8A 3D7FA 3B3WA 2PE3A 1Y7EA 3KQZA 1CG2A 1BAVA 3FMCA 2AFMA 5K8PA 3D4UA 4LQGA 2NSMA 3T8WA 2PJ1A 4P6YA 5LYIA 3FX6A 3B3VA 4UIBA 4YWYA 2PIYA 4OC4A 3V7ZA 3SI1A 3H8GA 4DYOA 2ZEMA 2PVVA 5LRJA 1UWYA 2ABZA 2PJ3A 4JZ0A 4UIAA 4MHZA 1CX8A 2C1CA 4NJRA 4OIDA 1ZG9A 1CPXA 2OR4A 4X2TA 4OIWA 3B3CA 2PCUA 3IO1A 1VHEA 3PBEA 2VL1A 3FECA 3NA6A 3D66A 3IIBA 3MRUA 2J9AA 4ZX8A 2XEIA 3PFEA 3KHXA 3PB9X 4EFDA 4ZY0A 1FT7A 4X8IA 3S9NA 2NYQA 2ZEFA 3VARA 4F9VA 1LAPA 4JYWA 4X3RA 4ZX9A 3WC7A 3BXMA 3K9TA 2BCOA 4R6TA 2V8GA 4YU9A 2BOAA 2RB7A 1YLOA 1F2PA 2WZNA 3PEIA 4ONWA 4NGPA 2GLJA 3B2YA 1ARLA 4MHPA 2OOTA 2PJBA 1XFOA 1ZG7A 1ARMA 2F7VA 2ZEPA 5LRKA 4IK2A 4ZI6A 1OBRA 4NGNA 4OC2A 3KQXA 4PXEA 3B3TA 3KASA 3DGVA 3VH9A 4PPZA 1H8LA 4FUUA 4EWTA 2CF4A 4NGTA 4EMEA 2PVWA 3V38A 4R76A 3PB7X 4ZY1A 3PBBA 3JRUA 3BI1A 2BO9A 1LANA 4GM5A 1QQ9A 5HXDA 2HC9A 3D7GA 1VGYA 1VIXA 4NJQA 2AFSA 4P44A 4RUHA 3RBUA 1PCAA 4NGRA 2Q51A 5J1QA 3LWUA 2ZEOA 2JEWA 3FJUA 4UF4A 2ZEDA 2PJCA 4UEFA 1NSAA 3ISZA 2JBJA 2PJ0A 3ISXA 3KR5A 4OC0A 2CIJA 3PRTA 4UEEA 3CPXA 4P10A 3H8EA 3KZWA 1HDUA 3IEHA 4Z65A 4MCSA 3KGQA 4P4DA 2PRQA 3TX8A 3B7IA 4P4IA 7CPAA 4TWEA 1Q7LA 2CTBA 3KL9A 1RTQA 4TNUA 5CPAA 1M4LA 4BD9A 2AFWA 2PJ7A 4NFRA 4CPAA 4A37A 5HVGA 4IAVA 3WABA 4B6ZA 5K8NA 4FBEA 4AXVA 4OMEA 4O23A 4OKOA 2PJAA 3IFEA 3FEEA 2AFXA 4DUKA 2C6CA 5D8NA 3PB6X 2XEFA 3SJXA 5JM6A 3S9MA 3NFZA 2ZEEA 3VATA 3NH4A 4NGMA 1BPMA 2PJ8A 1Z8LA 5IB9A 2V8VA 4R7MA 4R8FA 3FEDA 4K3NA 2G9DA 3DLJA 3IC1A 2FVGA 2AFZA 1QMUA 4ZYQA 3PFOA 4MHNA 5CBMA 1LFWA 4FAIA 3D67A 4PXCA 1ELMP 4H2KA 4OC3A 1Y0RA 1EE3P 5LYDA 3HLPA 3FF3A 1CP7A 1XMBA 2AFOA 2Q4ZA 2QYVA 1ZLHA 1DTDA 1KWMA 4P4JA 2IQ6A 4OP4A 3BHXA 3IWWA 1F2OA 2V8HA 2EK8A 1ELLP 3SI0A 1VHOA 1XJOA 1Z5RA 3NH8A 1CBXA 1TKJA 2O4HA 5ELYA 3WC6A 1XRYA 2GU2A 4MRIA 2I3CA 8CPAA 3CDXA 3RZAA 6CPAA 1HDQA 2XEGA 3D68A 3FH4A 2EWBA 1YW6A 1TXRA 3QNVA 4DJLA 4OC1A 1YSJA 2PJ5A 3NH5A 3I1UA 3WT4A 1FNOA 4P4BA 3CPAA 2V77A 1ZG8A 1CPSA 2CTCA 1AMPA 5JGFA 3KHZA 4F8ZA 3SJFA 2DEAA 2QJ8A 2PJ4A 3H8FA 4W9YA 3PB8X 3SI2A 3TC8A 1F57A 3S9LA 3MN8A 5LYFA 4PQAA 4MCQA 4NGSA 4PXBA 5JH9A 2AFUA 4IHMA 1Z2LA 1R43A 2EK9A 3SJEA 2JBKA 2PJ6A 4KSIA 3D7HA 1GYTA 2ZOGA 1DE4C 2ZEHA 3GLJA 3GB0A 4A39A 2ZELA 2ZENA 4Q7AA 4ZY2A 3CT9A 1IY7A 4MCPA 2HB6A 5THWA 4OC5A 2Q43A 5HVHA 5LYLA 4PXDA 3L2NA 3SJGA 2ANPA 2XEJA 1XBUA 2GLFA 5DS0A 2ZEGA 3GUXA 2GREA 3FVLA 4F9UA 3KI9A 1TKHA 2IJZA 4FWUA 5K8OA 1AYEA 2PIZA 5F09A 3K2KA 2ZOFA 4A38A 2PJ9A 1JQGA 5HVFA
chains in the Genus database with same CATH superfamily
1N48A 2B4DA 5IZHA 2GCFA 3DXSX 1P4NA 4RI1A 5ETQA 3E2EA 4KR0B 2Y1LB 2HIQA 3KFWX 5A8KA 1ICEB 2MKCA 1S4FA 3DYAA 1RB0A 2UZAA 1N6QA 3WZ0A 4RW9B 1U1OA 2WVFA 5KFVA 1RWXB 5B0FA 3M6VA 2L08A 2UUBJ 3MPDA 1RDRA 2NS1B 4KPCA 4HKQA 2BM0A 3LP0A 8ATCB 2NPIA 2QGFB 2HHVA 4EMDA 2PEHA 1FRMA 1KHVA 1N5QA 1YI2S 5KT2A 4LBPA 2UXDF 4B13A 1NHKL 1D9AA 2JDCA 3KLFB 1WD6A 3DDNA 3HVTB 4DPUA 1IGBA 4BBYA 2LLZA 4C8YA 3G8SA 1CG2A 4UZCA 3OL7A 4EO8A 4KUBA 2PJ1A 3FCVA 1WDTA 2RHSB 3V7ZA 4U6PA 3W62A 1XNQF 2E9RX 3QSIA 2O66A 4DL6A 2DHGA 2D3OR 3C3LA 2PJ3A 4ZJOA 3ETOA 4K4VA 2ZJRQ 1APSA 2HV2A 3JQJA 2Z3LA 1NSLA 2XMKA 2H54B 4CYQA 3JSBA 1ZG9A 2MQ8A 2VBYA 3FEXB 1I94J 5IT0A 4WBFA 4LRDA 4NASA 1WSVA 1Q4RA 3PO4A 2QIRA 4DN9A 2VEZA 3V6KA 2P0WA 1FT7A 2F5GA 4M8LA 1RLDA 4WE1B 3FEZA 3MEDB 1XR5A 2VG7B 4DU7A 5F8GA 5KFHA 4DR2F 4X65J 4CCHA 2AX1A 3VQTA 2W01A 5DDQC 1X60A 5IXUA 3R5JB 4URSA 2YH0A 4N77A 3MR5A 1TAQA 3MM8A 2RC4A 4F0YA 4YR2A 2XY5A 2EC2A 4M94A 3IP0A 3Q23A 5F48A 1XFOA 1ZG7A 5KG4A 2ILZA 2HUZA 4IK2A 3EWGA 3KQXA 3LUYA 3IWGA 4PXEA 3RGIA 3D2PA 2K3IA 4KOVA 2LXIA 4EMEA 2B8PA 3W7BA 4DL3A 2LU1A 1RT5B 4IO9Q 2DR7A 2GGPA 3B4MA 1FXLA 1QJHA 4GRSA 5CCMA 2WOMA 3TA2A 4KOUA 3RBUA 4MK7A 4PWWA 4R0EA 1NPPA 4FXDA 2B3TB 3N4WA 2XLIA 2DGWA 4XPDB 1CC7A 1NJIT 5AG5A 1VK8A 4F0HA 4RZRA 3IWEA 2ZEDA 3DOMB 1FJEB 4QW8A 2YNIA 2VQYA 3VGVA 3UY5A 3UD5A 3BO2A 2QTWA 3C6UA 5K5MA 3H5UA 1R0AB 4DUZJ 2W2MP 1KS2A 3WR7A 5I3UA 1KUVA 4U67Q 3N6NA 1RYSA 1LW2B 5HVGA 2XMAA 4ED0A 3K8WA 2PGCA 1CJTA 3L7OA 4XIUA 4LUBA 2M9KA 2MZRA 2UUTA 1PO6A 3EVOA 4DV0F 1VHFA 3U1LA 2FVGA 5CD4A 4LSNB 4IOAQ 4MBUA 1DRZA 4DPWA 1L5UA 2YX7A 5L1JA 3KHLA 4JI2J 1XMQF 3GKRA 1F2HA 3FZ2A 1CS4A 5IQQA 3V4MA 1HMVA 1HNIA 3UDLA 1F9EB 3S6FA 2HFSA 2PMZD 3VCDA 4NF1A 4MRIA 2CJKA 2DVIA 4L3NA 3G6YA 2ZH5A 1VCTA 5KOXA 4ZP7A 3NWGA 2CZ9A 4N8OA 4GC6A 5L9NA 2K8GA 1ZM4A 3OR1B 1TXRA 3HHLC 2MLYA 4JXQA 3J7Z5 4P4BA 4LRBA 4C6AA 2CTCA 1AMPA 2UUAJ 1UWBA 2IM1A 2GMHA 3ET6B 1JLFA 4ZPDA 2XSFA 4M5GA 3LP2B 3EVMA 3TC8A 3VHQA 4NMLA 1QSSA 3M8PA 4FNHA 4CRZB 1KZFA 1S60A 2BYCA 5A0YB 2EK9A 2XG8A 3PJ9A 2GIQA 3Q24A 4KSIA 1OMSA 1SC6A 2FJEB 3H25A 2QIFA 3CXQA 4DF4A 2ADBA 1HNZJ 2IC3B 2CJQA 5HMYA 3CDBA 1DQ8A 4OLLA 4NZ6A 4B9TA 2HKEA 4CZCA 5ETNA 4EBEA 1ZAVA 3E01B 4FYDA 5D6GA 4D3GA 4DPOA 2ZZNA 5HN0A 5C42A 1RADB 2ZHOA 3CJTA 1U8SA 2FJAB 4WFXA 3BLNA 2V6AA 3KLEB 1GTHA 1F9FA 3IN5A 4YUDA 4R9MA 4OX9F 2BMBA 2VG6A 4NPOA 3VAFA 2RT3A 4ERDA 1NLKL 4KHPJ 2DNKA 2YNDA 3MEEB 1FDNA 2FDNA 2DH9A 3BS9A 4YS2A 1KRPA 3V4IB 2QL7B 4EYHB 1S59A 3VWSA 2DNRA 1J5OB 5E33A 1S99A 3B4DA 4IF5A 3DLGA 2JJ4D 1B0PA 5D78A 5KT3A 4A8YA 4WJBA 3IWLA 3CGIA 1DTTA 3N7ZA 2YVSA 3W60A 2XC9A 4RW7A 2QT7A 1LWEB 3BJ7A 2WB1D 1X5TA 1RHUB 4LR8A 4WKRA 1TF8A 1S6PB 2Y1JA 2YWWA 1BAVA 3CULA 4RNHA 3SFGA 2FJBB 3SSQA 4AXJA 4YHHF 2ZH8A 3HT0A 2XMMA 3CXSA 4ELVA 4B9UA 2CWXA 4DR5F 1Y3KA 3DHXA 4CTAA 3W6XA 5KTAA 2IIHA 4Z37A 1IBLF 2CQPA 4A32A 2B7CB 2ZM6J 4OIWA 3PBEA 2J8MA 3U7JA 1DTQA 3MRUA 3KWMA 2DB1A 4ILRA 2ZWPA 2HBYB 3PZJA 2C27A 3PIPQ 2Q44A 4DX8H 1EB0A 3NGUA 2BR0A 3LALA 5AXNA 1Y3JA 2BJEA 4OYIA 4LFBJ 1M5KC 5GCNA 2BOAA 4JI8F 4OHVA 4PCQA 3NAHA 4EVYA 2CQBA 3M1VA 4Y2MA 3BO4A 1C0UA 3NGKA 3UCUP 4KORA 1RA7A 1V3RA 4KGMA 1GX6A 3CCTA 4CRYB 2HHWA 2KVQE 4H89A 2DR6A 3Q8UA 4ECVA 4PK2A 5DQHA 4F26A 4RBVA 4NGTA 1T0TV 1CQNA 1VIOA 1S1TA 1X9SA 4NEXA 5KFMA 2VBQA 3EXCX 4OZ2A 1TL1A 2HURA 4PABA 4NJQA 1VQLS 2BQUA 4CAWA 1S10A 5J1QA 2V94A 2D1CA 2VFVA 4DCOB 1NZ8A 2NXNA 3VZHA 2HAFA 2G13A 3PVXA 3JSMB 4W90B 1IU8A 4UEFA 2PSZA 2BRKA 1LWCA 2PIIA 1EX8A 4YFJA 1UJ6A 3PACA 3CO0P 3H8EA 2FS5A 2VPXB 4KKOA 3RG6A 5KFIA 1HPZB 1TV6B 1HYSA 4C0OC 1HBNB 2VJVA 1S1XA 2REFA 2OAUA 3G6XA 3MEGB 2HW3A 1URRA 1VHSA 5T14A 1IKYA 2ROGA 2DRDA 2GW8A 1BMQB 5EWGA 5M2UA 2ODFA 3PW7A 2ZD1B 2P9GA 4J9RA 4MAKA 3DR8A 5EGYA 3TOQA 5A2QU 4ZYQA 4ZGYB 4CI0B 4QVTA 4FF4A 5CZVA 4I6WA 5AXKA 5BXIA 3MMAB 1S9FA 2ZH9A 5CD4H 3NNCA 1UETA 4F4KA 1FT8A 3HXMA 2RD5C 3DRRA 4A8KA 4WKYA 2DHSA 4I2QA 2A6OA 2YQ0A 3OUYA 2C3OA 3AOCA 1PJ6A 4LBIA 2JEGA 2AJ2A 2A3JA 4G1IA 2V4JA 2Q6BA 3BM7A 1IQTA 3A8JA 4LIWA 5SZTA 3VAGA 1XRYA 3QQCD 2P2CB 4I69A 3VAJA 4ID8A 3BN7A 5HROB 3GFYA 3PZPA 2HNZB 3C8YA 3MECB 1Q82T 1YSJA 4OJGA 2R2RA 3LGNA 2ZXVA 1H73A 3R7SB 4KV8B 1BQMB 1GNKA 5KT4A 2ZH6A 5CA5A 3OVSA 3FBCA 3Q8SB 5ETPA 5DGAA 4KVME 4MCQA 2R98A 3OSNA 4QR0A 3A3NB 4QU7A 1FD2A 4L89A 4CGLA 5EBVA 2IYIA 4UWIA 2M88A 2X1AA 1PYSB 2A18A 4LIRA 2R4FA 4RW9A 2HVZA 1X9WA 2VC1A 2CJXB 1YRTA 4UOFA 1U02A 4EU0A 4UZBA 1IJFB 2RDDA 4LUAA 3M2VA 3R9EA 1GH8A 2X7IA 4ER8A 2DNZA 5ETTA 3DFEA 3M7VA 2V68A 1NZAA 3JB9k 3GYAA 3KLFA 1DAXA 3HVTA 1U26A 2WRMA 3RR7A 3DCAA 1JJCB 3OQ2A 4CAXA 2DNPA 4OL8A 3FBBA 2PJ9A 2XQCA 3R5CA 5KOWA 2DT9A 4PYAA 2FYXA 3VTIA 4JI3J 2F4VJ 1U1RA 2R42A 3SYZA 1WF2A 4W92B 4LF8J 1F3FA 1X4HA 3OVAA 4ED6A 1WC5A 1Z8TA 3A3PB 1R57A 3CMAS 3QJJA 1X31C 3BKUA 2EPIA 5DM6Q 2DXDA 4M6HA 1HQEB 2YNFB 3N5FA 1YW4A 1ZBTA 1ZLIA 3DN9A 2OH2A 1N71A 1WTFA 4JV5F 1RA6A 3B35A 3TUZC 1RK8A 3HZGA 1XMOJ 1LK7A 4LF1A 4HEA9 4WE1A 1V5IB 3MEDA 2B5JB 2DK2A 2MDAA 5DGBA 1CJVB 2VG7A 4A4JA 1WWHA 1XIQA 3GIIA 3EM1A 2QVPA 1BPNA 3RBXA 2BJDA 1RCOB 2EFVA 2QSWA 3OBIA 1SL2A 4TY8B 3KQZA 1P9QC 2FLLA 4QYZK 4KOXA 2PE8A 3MD1A 5K8PA 1R0BG 4P6YA 3B3VA 3G2XA 2DPTA 1I51B 2VODA 1P8GA 4QIGA 3TW0A 4JB8B 4X62F 1YQEA 1JXEA 5KG1A 2ADCA 3H59A 3TO7A 1RT5A 1UFWA 2DNMA 1ITPA 3IO1A 3PM9A 4EGLA 4Y65A 3TYTA 2CFXA 1TMJA 5DETA 2QLJB 3AJ2A 2MB0B 1XN9A 3W1YC 3PRVA 2XEIA 3KHXA 1OSDA 1KBRA 3AJDA 2J6UA 3AA8A 1Q2CA 3SXOA 3DOMA 3PTWA 2KHCA 3BSNA 4M5LA 2VPZB 4FS2A 4DU8A 2WVDA 3ILLA 2X1BA 4OX6A 3I6PA 1YLOA 3BPSP 3HFZB 3KMQA 2ZFHA 4CYUA 4NGPA 1Y9WA 2JC1A 5LSLA 1L3KA 2C2DA 3OL9A 4CLFA 4OI2A 2HNDB 3FNCA 1IBKF 2HQFA 4NGNA 4P2MA 1WC0A 1LW2A 1CSJA 4I2PB 4DR1F 4LJMA 3IM8A 3GU0A 3GP9A 4M5HA 2F1FA 3E51A 2XGPA 3G8WA 2X1GA 4USMA 1RAHB 3AAWB 3OXLA 4J9UE 2RRNA 3HSDA 4CH1A 4OYBA 1X5OA 2I6WA 3HFVA 2DJWA 3DMJB 3UCGA 1IM6A 4NLXA 2J7UA 3SDEB 2G0IA 4KAIA 1S97A 3T9YA 4LSNA 1NU4A 2NXJA 5F3ZA 2YNCA 2FIWA 3AQPA 1HR0F 1ZZNA 4TXSA 2DPIA 2HFUA 2PD1A 1X8DA 2JNJA 1IM4A 3BKTA 2YGWA 2XWYA 1TMMA 5KFEA 2QL5B 1GEHA 3QZ8A 2JEFA 3Q22A 1TKXB 2A6MA 2E7WA 3B7IA 4R5PA 3PHTA 4OZJA 3KK2B 4TWEA 2B3UA 2RU9A 4LQ9A 2NUUG 1IVZA 4B6ZA 1FWLA 1K1QA 5B0AA 4A95A 3C46A 2GE3A 1SUQB 3OR1A 4OZ5A 2IRYA 2C6CA 1T94A 1H6KX 2JC0A 4LQ3A 1OYEA 4KE5A 4ZP6A 4NZ7A 2QZ8A 4LVNP 2ZEEA 3OTCA 3GV7B 2J8SA 3L7PA 2Z4PA 3OR2B 5CBMA 1X4GA 4ECSA 2Y0MA 3LP2A 2V2ZA 4FAIA 1KFSA 3NE7A 2RRBA 3UNGC 2DXQA 4AVBA 1VRTB 5A0YA 3R5GA 2Q4ZA 4Q38A 2JLEA 5KFKA 1I3OB 1DQ9A 4I1TA 2EK8A 3MCSA 1F2GA 2B9WA 3TVZA 2C2EA 2IC3A 5ETSA 1Z5RA 2XZDB 3A1YG 2J6TA 1HNXJ 1SL0A 2UXCJ 3DOLB 3MUTP 2CA9A 2WSAA 4RW4B 2Q66A 3CDXA 4RW6B 4ZIVA 3X3UA 3E01A 1KTVA 5AE3A 4RW8B 1Q0NA 2EWBA 2CPZA 2RAQA 3OTDA 3LWLA 4DUTA 1RAFB 4KY3A 3MR6A 1L3TA 3KLEA 4N76A 3GMGA 3CWJA 1QE1B 4FYYB 4QQBA 1RHJB 2LEPA 3T5KA 4F4XA 3H8FA 4RWWA 4NYZA 3PB8X 2REEA 2ABYA 1C1BB 5DDOC 3MEEA 4DHVA 1VMBA 2Q3PA 1BUXA 4IUSA 4DQIA 4FP9A 3V4IA 2IHR1 2YH1A 1VK3A 4D3HA 1P27B 4ELUA 5LM7E 4FPRA 3MM9B 4PWUA 2UUCJ 4QYZJ 2GHPA 1Z4RA 4PR6A 2WVCA 3DC2A 2Z57B 2HB6A 4M5NA 4H4MB 4WK3A 3HSJA 1RWUA 5HMXA 3QIDA 2ANPA 2KJWA 4J9QA 3SSSA 3GUXA 1LWEA 1BWVA 4ZVOB 3HVAA 2KRBA 3IS9B 1FI4A 2IJZA 4ZPWR 1U6MA 3K5PA 2G2ZA 1WC1A 1S6PA 3DGPA 3UE2A 3KJQB 4F50A 1M1KT 5J2QB 2V2VA 4MJ8A 5HVFA 4MCRA 4NGQA 2HGLA 3HUVA 2MY7A 1MWYA 5E5NA 2LP4A 2A2DA 5C25B 1XNRF 4XPKA 4QYRA 4DSLA 1KVJA 2DNYA 2CDQA 4HPSA 1MLAA 3FMBA 3T1YJ 5J1EB 2FGOA 3G6VA 1TUVA 3QGPA 2V9WA 5D29A 1TF9A 3I5BA 4MIBA 3CJKB 4R57A 3CW2C 1EJ7L 2HQGA 4DX6A 5B0DA 4MHYA 4C7IA 2AJFE 2QLXA 4PG7A 4URQU 1LAMA 4CM0A 3TANA 3W65A 5IT9Y 1RACB 1TU0B 4ECUA 1OPIA 3VGTA 2BJ3A 1FO1A 1JNZB 2XMWA 4LFAF 4LFCJ 2Z2YB 1G6BA 4LF9F 2X51A 3ZZZA 3RW7A 2UVWA 1RT6B 2EFOA 3Q83A 1Q53A 3DDDA 2ZH4A 2Z2MA 2GAHC 2GVDA 2V4RA 4C8KA 2WBRA 4DUYF 3FECA 1Q8LA 1ZM2A 4FF3A 3OLBA 3H0PA 2CJYB 1UA1A 3CCWA 1GAOA 4DMZA 3JSMA 2VG5B 3OFFA 1MN7A 1UWAA 2J7KA 3BXMA 2GX8A 4Y34A 4OHZA 3N6MA 3GYXB 1OQ3A 1L3UA 3MI7X 1DARA 5DLGA 5AXMA 1TV6A 4IFVB 1SV5B 2WHOA 4OHXA 2DEJA 1HBNA 4ZI6A 2HAIA 3D3SA 3HVRA 2OEMA 3HDSA 3MEGA 2JFDA 3DGVA 5DWMA 2O5DA 1NKCA 3N5BA 1PC5A 1JJ2R 4DV3F 3H2LA 2E9TA 1U6FA 4NLQA 2IL4A 5EWFA 3NMAA 2FC8A 5HXDA 3LANA 3A12A 3TOBA 3PO5A 2ATCB 5B0EA 5KFCA 1YG0A 2Q51A 2V9KA 5LXYA 4I6YA 4B9VA 4JV2A 1WC3A 2KYZA 3ZNJ1 3TJ8A 3MMAA 2UP1A 5F0WA 1JLCB 4TN2A 3D54A 1FJ7A 2QN6B 1RI7A 1BLUA 2KXHA 4CLTA 3PYGA 2BANB 3PRTA 2XSJB 2ZC3A 2DGVA 2RU3A 3BN4A 4X66J 4LMZA 1EQ0A 1N32F 5AJ3J 2LEAA 5GAGI 2FQQB 4A37A 4DL4A 4IAVA 2HGMA 5D0GA 4G1QB 5HROA 4KOTA 3AODA 2HNZA 1P1LA 5LMUJ 2PSWA 4CAFA 4DUKA 5DM7Q 4MY0A 2HFOA 1Y4ZB 4O3RA 2I00A 2I5JB 1HI1A 3W9HA 3MXHP 1RCXB 2PJ8A 3GY9A 4CLWA 1SC4B 4KV8A 1BQMA 4JI4F 2RF2B 3LF0A 4OMFG 2AJQA 4K3NA 4V19X 3IC1A 1UJ4A 2P8IA 2L41A 1HNVB 4RPFA 3R1HA 4WK1A 1WK4A 4OJ3A 1NSKL 4GVBB 5IX3A 2ZC4A 4PG8A 1TFYA 4C48A 3ILJA 1AUGA 5F8JA 1S9GB 2ROPA 1VHOA 4IQMA 1IQZA 2APOA 3PV8A 3UO0A 1CBXA 4K0KF 4MFBB 4JV0A 1QSRA 3M8SA 1FE4A 3ZZTA 4E8UA 5K20B 1K47A 4YY3J 1U1QA 2BE2B 4BLGA 4ECTA 4QUSA 1FJGJ 1MWZA 4DJLA 1NPKA 5FVJA 1N33J 4CO2A 4HTIA 1ZG8A 3LA0A 3OHBA 2PO4A 2W2OP 3NL0A 3AXKA 3TJAA 3MCNA 3L7UA 1HNWJ 2QJ8A 1KQSR 1K0TA 3OJSA 2Y0BB 4M5MA 4DCPB 3RRHA 1PKUA 3S9LA 3OD2A 3P8BB 3AA9A 2ZNYA 3TQ1A 4LF4J 1R43A 1ON0A 1M5SA 3J7YI 1HQEA 1IXKA 2YNFA 1U1PA 2QMLA 2B6AB 4Y49B 1FFWB 4ZJLA 3UVJB 1IOFA 3CT9A 1DLOB 5LYLA 3EE3A 2B5JA 1CJVA 4YDDB 3CJ8A 1BGXT 1N34F 1RKIA 3DR6A 2H65B 2GREA 2BKPA 4Q5VA 2D69A 4OYPA 1TKHA 4E98A 2BVZA 2R8VA 5BR8J 1S4EA 1PUAA 2XHCA 3OFEA 4TY8A 3K5LA 2N4DA 2VPWB 4B9NA 1GT8A 2CJ9A 1SKWA 2AYEA 1PC4A 3A8EA 2UXBF 3LACA 1XBWA 4OZLA 1EKSA 5KFUA 2C6GA 2WYRA 5B09A 3LMSA 1M5HA 2U2FA 1T9VA 4LF5J 3JQKA 3D5MA 3PW0A 1KVKA 1DY3A 4WP9A 4U7CA 4OX7A 2DNNA 2KKHA 3KMSA 1S7FA 2MZTA 2ZDOA 2W2QP 2W24A 4FNIA 2V69A 4GKKF 3W63A 2R8KA 4FD4A 1G4CA 1T11A 3MEKA 4B02A 1H74A 1S57A 2VQEF 4I0WA 1VLYA 4DR4J 1YX0A 4BINA 1TZ0A 2DHHA 1S1VB 2F5IA 2YKQA 1U8WA 2A2CA 2J0SD 2HPUA 2HNDA 2W2PP 1QSYA 3SQGB 4I2PA 3GILA 4PV6A 4PQUB 2P6TA 2WUUA 3FGVA 4GKJJ 3NKYA 3EGVA 2M7SA 2YNGB 1VOMA 3THVA 1CX8A 4JI5J 4OYMA 1HW9A 3DMJA 2NXEA 4AXIA 3F73A 1J5EJ 4TQSA 3KHRA 3SDEA 1UVJA 3L4BC 1XJWB 4AQYF 2PMHA 1X4BA 1M1DA 3PX0A 3DLEB 3TZWA 1JLGB 4EK2A 3CCJS 1FD8A 4Y6IA 4AL5A 2Q4VA 5L1IA 1YJNS 4ECQA 1XERA 4OYOA 4XNHB 2EVZA 1TKXA 3H98A 5I3QA 4UT4A 4QBUA 2X3DA 1UCNA 3KK2A 3ZO7A 3EGWB 2F7VA 4PG4A 3JSRA 2RVJA 2IVFB 3B3TA 2OD6A 3GFZA 4EBDA 3AQOA 1AFIA 5G1ZA 1SUQA 4QOTA 4EWTA 4Q45A 3BEGB 3V38A 1UMJA 2Q04A 3PBBA 3TFYA 1WNEA 3RB4A 2BO9A 3LP1B 1FF2A 3AB2B 3CO9A 4XDDA 2RSQA 2CJBA 2M52A 1PCAA 2MPUA 3NXZA 4PPDA 1RP5A 3OR2A 2FD2A 1REVA 2ZEOA 4H4KA 2MKJA 2W9AA 2YTCA 1H3DA 2OH1A 2E1MC 1VRTA 1B0VA 5RUBA 1VYAA 3QT8A 3WX4A 2FJXA 4IQXA 4NEYA 1TL3B 1WKJA 4Z65A 2WB4A 2ZJQQ 1S5ZA 5T7LB 4XPDC 4X2BA 4DR3J 3RR8A 2YQ3A 1H7WA 2NSCA 2VASA 3W6SA 3DOLA 1UAWA 4BD9A 1YRUA 2AZ3A 4O3SA 4CLYA 4RW4A 3THTA 2GMJA 4RW6A 4IFYB 1CULB 2E5IA 4ZHRB 3RW6A 1Y9OA 4RW8A 5EHHA 1N5YB 4F2SA 4BHQA 4DZDA 4KHRA 1UEKA 1QAIA 5KFQA 3CC2S 1IB1E 3QGIA 2NXCA 2IJNA 4K4XA 3PY8A 1JLBB 1FK9B 2OHDA 1KD1T 1QE1A 1U48A 4YRHA 5EDWA 3PJWA 3GSDA 1FRHA 3PFOA 3S7RA 3MHYA 1ZM9A 1NSPA 3G96A 2Z3OA 1C1BA 4PXCA 1IUJA 2C2KB 1NPRA 3NLCA 4CP5A 2DNOA 4NXNJ 2I2YA 3H4DA 2VOPA 1Y5IB 3IWWA 2HIYA 2I0XA 5KFOA 3MM9A 2JVRA 1XJOA 1S1WB 4HDHA 3NH8A 4K7QA 4OADA 4H4MA 3NS5A 2GU2A 2N7YA 1TKTB 2MLZA 4X4NA 2HHHF 1CJWA 3QAYA 1B4SA 2XO7A 1IYLA 1HWIA 2HS0A 3CPWR 1HDQA 3IGRA 3IS9A 2FZCB 1NO8A 2DR9A 2C1EB 3HHEA 3I1UA 4WTYA 2ROEA 4ZCLA 4K2XA 2ZDPA 1F5CA 4FKYA 1M90T 4OI0A 5J2QA 3TEGA 3SJFA 3GJSB 2YPYA 3HHDA 1LRZA 2VA2A 1U7LA 2OZHA 4B3SJ 4U8YA 5C25A 3PRDA 3T1AA 3H5XA 4ZP8A 4I68A 3VAMA 5J1EA 5AGEA 2LECA 3SBMA 4F8RA 1R27B 3P6YC 4B5OA 3CJKA 1VQ8S 4LQ6A 2QO3A 2EBGA 3KLVA 4C0HA 4K4SA 3A13A 1HWLA 1X0FA 4MT1A 1T02A 3C26A 3FRZA 3FVLA 2LYVA 4NLUA 5AG7A 3KI9A 1SJ1A 1OS5A 2E1RA 3HSGA 4DV7F 1Y7PA 3M30B 5T41A 3N28A 3H40A 1WG4A 2CXEA 3ZZIA 2BDPA 4G3IA 2KHDA 3CCRS 2XZTB 2AQ4A 1ZTTA 5LMNJ 5D4PA 1U25A 4B9LA 2LQ5A 5I4MA 3GYGA 1RT6A 4O44B 3R95A 5GMDA 1V5VA 3EC4A 1WHXA 1SIWB 3MMCB 3LPEA 4Z7CA 3B3SA 5J2MB 1Q16B 4CYPA 3KG4A 1UZHA 1JX4A 3EVWA 5DLFA 4DV6F 5JJBA 5CAAA 4WF9Q 1DURA 2OEJA 4RUAA 3D7DA 3SV3A 1VQOS 4ED5A 2VG5A 3BO3A 1X4DA 4W98A 2EEYA 2HHSA 5EC4A 2F8HA 2XYGB 5D3GB 4UBRA 1C0TB 4RJVA 4KGVB 1CJKA 3ITHB 2JEJA 2DR5A 5B7WA 2GS8A 5DDRC 2QA2A 4FZVA 3T8WA 2KZZA 4BWMA 2PQ8A 1RAAB 4IFVA 4ZN3A 2F9DA 3VGSA 1HD1A 1VQ9S 1IKVB 1HI8A 1QUVA 4PUOB 1IOIA 2XY6A 3H2VE 1IYKA 1FESA 1UWYA 2YX4A 4C97A 3P49B 1CPXA 3EMTA 1HD0A 4KGKA 4JI7F 2XS5A 4M1KA 3JVNA 1WG5A 2J9AA 3QLHB 3VAKA 1RWKB 2WCXA 4P52A 1NJZA 1YBTA 1Q81T 4WFZA 3TUPA 4ZIWA 3KLGB 1NK5A 1JLCA 1UA0A 4Q8EA 3GIKA 4ZVQB 3R6LB 4X3RA 3PW5A 3K9TA 1N88A 1UKUA 2B4UA 4C4WA 2BCOA 3FJ2A 1KEKA 4RO0A 2BANA 1D9DA 1YJ9S 1RHQB 2XSJA 4C3KA 1I6JA 2DNQA 1H0HB 5D15A 4OFZA 4DV2F 2YNIB 4HNXB 4U9YA 3MTJA 5LRKA 2IA6A 1VDHA 4B3MF 4G1QA 2EG1A 1OWXA 3EPGA 4CAVA 2KB2A 3DRXA 2W9BB 3TJ9A 3F8KA 2DY1A 4C68A 2I5JA 5DG8A 2V2KA 2VONA 3ENVA 2ZWOA 5A8RB 2FL4A 3H5ZA 1KDNA 2RF2A 1WC4A 5KFLA 4TY9A 4CO0A 3O8WA 2LMIA 5J8FA 1TL5A 1HNVA 1O0PA 4N8NA 3FJUA 2SXLA 4DWIA 2CY2A 4FYXB 1REGX 4L3KA 4GVBA 4ZLNA 1GMWA 5D77A 2XHWA 5IB0A 5J1NA 1NE9A 1SJQA 1S9GA 1SH2A 2ACYA 1M5VC 1VJWA 2RNEA 4P4DA 2N7CA 3EGNA 4CO1A 3MGDA 1NK9A 5D0EA 2CQCA 4MFBA 3ZTOA 4TNUA 3BSAA 1V9OA 2WSCC 3AD8C 4O23A 3IFEA 3SZ2A 1P1TA 1P6TA 4RBUA 2Z11A 2E1AA 4MFQA 4B3TF 3NFZA 4DPXA 4ZLPA 3HJFA 1RXOB 1B7FA 4R8FA 1DZ5A 1M1GA 3QSYB 5LSOA 2BABA 2YKNB 4MHNA 4P7TA 1D0EA 3G6ES 2XCPA 4U8VA 4KSAA 4I4BA 4A31A 3A3OB 3OHAA 3RBZA 4ANDA 3V6DB 3I55S 2IQ6A 4OP4A 2EBEA 3G9CA 4RNFA 2B6AA 1NK7A 2XMVA 4O4RA 3BJ8A 3UVJA 5J2PB 3JTNA 2XTJP 1DLOA 3K17A 1Q7LB 3Q8YA 3MMBB 2ZE2A 1ACMB 1R31A 2R1IA 3AD7C 4NLPA 3M8WA 3FCWA 2CNOB 2LEBA 1YW6A 3QNVA 5G21A 4QIWD 2YPZA 1HHSA 2M8HA 3CPAA 2R3VA 3M32B 1CPSA 3DHWC 1FX2A 3P5TL 4IR1A 1DHMA 2BKOA 2B0GA 2PJ4A 2J8RA 1OY6A 4XO0A 2PN6A 1TTHB 4P74A 1LXNA 4I6AA 5C88A 4JYAF 4ES2A 3DDIA 3RAXA 2BKNA 5KG6A 4CLKA 3P45B 1XTZA 3DLHA 1RAOA 5GAHI 3EY5A 2NUHA 2FC9A 1C4AA 4TU9A 5IWAF 2AYMA 4R3LA 4PXDA 3L2NA 2CPDA 1CQMA 5E3RA 4ZBGA 3W3SA 4K59A 3NNAA 4DQQA 3T1HJ 2DRAA 2ZOMA 1GMUA 3ZZ0A 5GMEA 3D1QA 4WIIA 4EO6A 1S1VA 2QC3A 2G0BA 4R25A 2WZ1A 3ZXWA 3SQGA 2M3DA 2QMUB 2LA6A 1D09B 2EFNA 3D0GE 3HHLB 1NBEB 4DSJA 3MM5B 1VC0A 1K73T 2HZCA 1YMEA 2IRUA 2YNGA 3IXQA 5AG4A 4G1PA 4ECYA 3J81Y 2HBQB 1X4EA 2Z3PA 4WWVA 4DZ6A 2E5GA 3DLEA 4ZMMA 1JLGA 1YIJS 5HJXA 1JWQA 4P4FA 2RS8A 5LJ3Y 2OLWA 2JLGA 2ZH7A 3SQOP 4UA3A 3BI0A 4NCAA 3BR9A 4DX5A 5DO2A 1VHIA 1FWPA 4Q2LA 1ZH5A 2PFFB 4ZKAA 1ZZFA 4WIQA 2MKSA 5KT5A 1Y7EA 3EDRB 1C1CB 2HQDA 1QY7A 2YBVA 4ZS6A 1JXVA 4M5IA 4B10A 3OWCA 1FVQA 3IR6B 2ZEMA 3GR1A 3NGDA 1BO4A 2J9EA 3D0IE 2W9CB 1ZPVA 2CJAA 1FWKA 3P4UB 2VBXA 4DV5F 5KFJA 3LP1A 1I1DA 3GE9A 1Q7YT 3I5AA 2WPWA 4QPTA 2QE5A 1CLFA 4LF7F 4I64A 1AZSB 4DV4F 2MQQA 4HNWB 2AT1B 1WC6A 2V8PA 4P72A 3EZOA 3QZ7A 2GVZA 2Y8YA 1LAPA 5E2QA 5BYRA 3JS9A 3KJVB 1IIDA 5A27A 4MKYA 5MLCV 1TL3A 3W2VB 4FYVB 1YTYA 2D41A 2JLFA 1KNZA 1C2PA 1WEZA 5T7LA 3M8ZA 2XCAA 5CZXA 2KDOA 2DO0A 2WSEC 3GV8B 4JBCA 1YHQS 4K4UA 2UVRA 4IFYA 1CULA 2DH7A 4ZHRA 1N5YA 4Y28C 2ASDA 1GXTA 1S0OA 3NY0A 4CH7A 1RTHB 5C24B 2CDRB 3H20A 2RJZA 1AA1B 3D7GA 4OAEA 1JLBA 1FK9A 2F4FA 1VIXA 1R8HA 3I0SB 2NZCA 4Q43A 1FRIA 2N3LA 1DBDA 4NX9A 1W7WA 2PJCA 5J8CA 1NSAA 5HP1B 5DQIA 1F60B 1EZZB 4DNCA 2J76E 2LU2A 3BYRA 3TRGA 4QB9A 4HHJA 3KHHA 3WBZA 2CIJA 4HACB 3POTB 1NK4A 2OPSB 2Z3MA 1F5AA 3KZWA 4MKVA 2AMCB 3RO0A 3PW4A 2VQFF 2J9DA 2RUGA 3D0HE 2OUGA 1S1WA 2FLOA 2AP6A 5DQGA 4WP8A 1TKTA 2AYGA 3OUYB 2GIVA 4AB7A 1W2BR 5F8LA 1WORA 4C3LA 1WKKA 3LGMA 4JI1F 3OTEA 3AT1B 3S9MA 4QIFA 5H86A 2XM3A 1F1BB 4NRTA 4RLEA 2NYIA 2CWKA 1RLCL 3D8PA 2L48A 3K0JA 2MXYA 3OPKA 5D4OA 1S76D 4I7FB 2ZBCA 2J8NA 2HBRB 2AGOA 2KL8A 2V67A 1RT4B 3MF5A 3H2UB 3MR7A 4HH0A 3BHXA 2BBEA 4J9NA 1X4CA 2FB0A 3SI0A 1U49A 5A6PA 3IRXB 3FC9A 1ZAWA 3FSYA 2GQCA 5ELYA 4P6QA 2W8LA 1B70B 2WBMA 1N0UA 3I3GA 2UU9F 3GQCA 5J1PA 3A4TA 4DR6F 4ZVGA 3DKDA 3UQSA 3D28A 1S0VA 1R6VA 3WT4A 1N4LA 4JI6F 2VOOA 4Q2MA 3M30A 4CO3A 4HT5A 2DR8A 1T95A 5IC6B 5CYJA 1FXDA 2HZVA 1NMTA 2XS2A 3M2VB 4ES1A 1RWMB 4UY8T 3ZTSA 1JK9B 1YJRA 5LYFA 3MCMA 4O44A 2BQ3A 3B78A 3DDKA 3G71S 1YK9A 2ZKTA 3MMCA 1SPBP 4F4WA 5J2MA 2WPXA 3PHEA 2ZOGA 4C9DA 1DE4C 1YKWA 4JWPA 3GLJA 5LOQA 3EXNA 4ZY2A 1IY7A 3I4PA 1XIXA 1YVFA 1M5OC 5THWA 2Q43A 3OTOJ 3BBFA 4MKAA 4CGPA 4DV1J 3IR5B 1XBUA 4BBHA 1NJYA 1HWKA 2HZAA 2ZEGA 4FN5A 1PILA 4F9UA 4ZK7M 1T9TA 2C2RA 3RYOA 1TAUA 5D3GA 1C0TA 2DIVA 4JI0J 2HNYB 4USJC 3ITHA 2DNHA 3QYYA 2NMTA 2IM0A 3S6GA 3FSIA 2E29A 2XGQA 4FF1A 5GAGU 3KUEA 4DR7J 1IKVA 4J7CA 5L9XA 3GONA 3IBFB 4PUOA 3HHNB 4PG6A 2CAJA 1N36J 4WFNQ 1IICA 3CJ2A 3JAMY 5KG2A 2I9SA 1W2IA 1WUUA 3NCPA 4P45A 3UDVA 2FPHX 4K4WA 3CIMA 1CP6A 3QLHA 2BM1A 1IJEB 3B82A 2MZSA 4TLQA 4B3RJ 4RNMA 2KG1A 5LRGA 3TWZA 3KLGA 4USTA 3S01A 2ILYA 2L9DA 2VKZG 4WCEQ 2JEIA 5H1SV 3TARA 3EZUA 2FLPA 2AGPA 1BHNA 2EK1A 4KFBB 4CGOA 3WX8A 5HJYA 1RT3B 3G8TA 2E9ZA 3B3WA 4UQGA 5BYQA 3FBFA 4LF6F 5GVQA 3C2PA 4YWYA 4KVOE 2Q6CA 2DCUB 2KXNB 3RB6A 2R2TA 2JL9A 1LWFB 2C2NA 2R2SA 4CYUB 2P6GA 4I56A 5KFYA 3WC0A 3SV4A 4P75A 2YWKA 3TUJC 2KT5A 2OFHX 3HF5A 3SCKE 4YMEA 2W9BA 1S49A 4DG1B 2L9NA 2D4OA 5G0RA 1AXQA 3TQEA 2MQPA 4CO4A 5A8RA 1KTQA 4IRKA 4NXMF 3NCRA 1RHRB 1VFJA 2B51A 2VPYB 3PFEA 1FFGB 2GHWA 2NCKL 3J7YU 4DQPA 5KG3A 4ZX9A 2RQMA 2IY5B 2CQ4A 4ONWA 4F25A 3JTOA 4RN7A 2N3OA 2CPYA 1DJ0A 4HI2A 1NDLA 1E6YB 1KQFB 3CVKA 2CPXA 4M5KA 1T9XA 1IKWB 2VZYA 3K57A 2H5EA 2RMLA 3KASA 3QWUA 4C3MA 4RNNA 2IJRA 4O0IA 4X64J 4R5PB 4DSKA 2PVWA 3U1MA 2RKIB 2R7OA 2E5LF 2ZJPQ 1O51A 4LRAA 1SQFA 2HWTA 2Z10A 2JZ5A 1TELA 3KNAA 2OO4A 3VQSA 5L1KA 4KYZA 2ZHBA 4P44A 4MFKA 3CEDA 4OZNA 1R0CB 2YKNA 4BWJA 2GZOA 3SMZA 4UF4A 1NUEA 5GAEI 1XK8A 2VBZA 5BYSA 4NLGA 5M2PA 4O4GB 1OQ6A 3AJ1A 3MGJA 2UUBF 2PI4A 4KO0B 3V6DA 2FZGB 5ADZA 4LSZB 5KT7A 1S9EB 4JUZA 3QO9B 4DDFA 5J2PA 2EWHA 3R2DJ 7CPAA 2IM3A 1Q7LA 3KL9A 1WI6A 1RYRA 3R5DA 3MMBA 4OKOA 4NRUA 4P73A 2AFXA 4PEOA 4L75A 3HULA 3M32A 2F3JA 3QT7A 3UR3C 4YB6A 4ETXA 4H6ZA 3DLJA 3GYNA 2VB6A 2XEXA 3OVBA 3GG1A 1X4AA 4MIWA 1LFWA 2FUG9 2IBOA 1IN0A 4KB7A 3PR5B 1I94F 2DGOA 1VC5A 4ES3A 1CP7A 2AFOA 1NEEA 4NLYA 3NS7B 4IRDA 3BQ0A 4NYOA 3ZJ0A 1FX4A 5E7OB 4DL2A 3BGLA 3JQMA 2V8HA 6AT1B 2MQLA 1JKHB 2MEWA 1Y10A 4X65F 2FT0A 4NA2A 2E7VA 4J9VA 2MZQA 1TKJA 3HHKA 1KLNA 2K3KA 3A9LA 2G1DA 3VWEA 4B14A 3M9NB 1Q8KA 3RZAA 1MJAA 4MIAA 3FVYA 3FDSA 3R96A 3HFKA 5KG0A 4MHDA 2WW4A 1YRXA 1FCAA 2D3ZA 4ZA1A 2V2QA 3OLAA 3KHZA 1PSDA 1OO0B 3SCLE 1PYOB 5B0GA 3NP5A 3HHLA 1HHQA 2NZ4A 3MM5A 2C3PA 1RT2B 1YLEA 4XDCA 3DGPB 8RUCA 5JH9A 3SHPA 3AY0A 4MH8A 1HQ2A 4U96A 2CVEA 1GYTA 3CCLS 4Y2AA 4ZVFA 5G4DA 1XEBA 1RWVB 4Q8FA 4HKFA 1VQ7S 4OC5A 1QAYA 3VVUA 4J9OA 4DL7A 4B3OB 2BZ2A 4DUZF 3F0NA 4ZITA 2IVMA 1ZAXA 3TAMA 4XPLA 1GHEA 2Z8QA 3B8HA 3CJQA 1K8AT 4PG5A 5E3PA 3QGHA 1C1CA 3CCZA 2CRLA 1PYTB 5GMKa 1WDDA 4ED8A 1NH8A 3SXNA 4ZN1A 2CPHA 4R8UB 5F0UA 4YGOA 2W9CA 3ENWA 3LD2A 2ATLA 1RT1B 4AUKA 4QW9A 3CCMS 3BYPA 3JUWA 3PB4X 4USKA 3WC5A 3QT6A 1YBUA 1NJWA 4JI2F 4NSQA 4V1Ak 1AZSA 4G65A 1QSOA 2GVDB 3IWNC 2EUIA 3D3CJ 2C3YA 3TZXA 3MUMP 1F3VA 1JLQA 2LDYA 4V19J 3R6GB 3TO8A 3KJVA 1D8YA 3GIUA 3ZZPA 2J8AA 3I9V9 2O53A 3W2VA 2GIFA 2R7RA 4HH1A 1YJWS 1OJ4A 1Y0HA 3MD3A 1HBOA 2HFZA 4M63A 5CYQA 3C6TB 1WI8A 2BW7A 1X10A 2MHEA 3K9UA 3O3LA 4Q36A 4C8MA 1VQSA 2UUAF 4JJXA 1XC9A 3PKMA 5K9FA 4DPYA 5EX0A 3NE8A 1RTHA 5C24A 1WHVA 5AE1A 2YWHA 3GWCA 1WSRA 3TNVA 4PK3A 2PCUA 1SBRA 2MKHA 4MYTA 4KHMA 1V3ZA 1W25A 3UN2A 4U7UD 3D66A 5HBMA 4AL6A 3I0SA 1FERA 4KH1B 4K4YA 2DPJA 3J81U 1IR0A 4H4OB 2PR1A 5FJ4A 1BQXA 3VZIA 4K5RA 4CGMA 4WU2A 3EICA 3W5YA 2NYQA 2ZEFA 1VJQA 3HD1A 1UFLA 5HP1A 2PI5A 3K5MA 1HNZF 3K58A 1K1SA 2CZVC 2Y3YA 5LXRA 3ZTRA 2HQIA 4MY3A 4YU9A 2IPOB 1I12A 1O6XA 4HACA 3POTA 2OPSA 3LAMA 2WZNA 1FDBA 1WG1A 5G20A 2AD9A 3W8GA 1VBXA 4MHPA 3BREA 3UD4P 3L3CA 3I82A 4FD6A 5IT4A 1VLOA 4A2ZA 1SI9A 2N4CA 1ROFA 4PPZA 3M2UB 2ASJA 2CQ0A 2K2PA 1PU9A 4F0XA 2OZUA 1U6ZA 3JRUA 4KHPF 1RE1B 3BI1A 3HI9A 1IBMJ 1CC8A 2QA4S 3P2FA 1EIYB 1RTZA 1Y5LB 2HRUA 2ZW4A 1TR0A 4K2JA 3CXCR 4I7FA 4ZOSA 1P9YA 1JJHA 1RT4A 2OJ3A 1VRQC 1HW8A 1FDAA 2OPRB 2VFSA 2X1FA 2CIMA 3SIPB 4U5YA 3IRXA 4KQZA 4UQTA 3ZTQA 4RUBA 2WSFC 2GO9A 1WTBA 4KZTA 4CO5A 4P2FA 2BA9A 3NOGA 4YN3B 1NDCA 4CPAA 2JLMA 4TNOA 4AXVA 4CLUA 3DSBA 1YITS 4FVMA 1RQ0A 4TQRA 4J37A 3PB6X 5J2NB 3CCUS 2O67A 5KFDA 4P9SA 4C2YA 4K30A 1GFWB 3NH4A 1UTAA 4HDGA 3I0RB 2DF5A 4RS2A 1QMUA 1MMDA 3RB3A 2ZM6F 3D67A 4NMXA 1V3SA 2AJ4A 4KIAA 1A6LA 1U1LA 1NSQA 3A8KA 1LEOA 2QEXS 1RTDB 1C4CA 2ZKUA 4AE5A 2KFYA 1ZLHA 2GQQA 1SXLA 4P4JA 4CLLA 3IBCB 2CQ1A 2J0QD 5F8MA 2XLKA 5A2QY 2UXDJ 4LFBF 3ZFVA 4IOBA 2IVYA 3Q0AA 2FJDB 2AKWB 2VBWA 2LQJA 3D68A 1D9FA 4TKTA 4NA1A 1UEVA 1N0VC 3J7ZT 4ORFA 2HNYA 4A8FA 2V77A 3SCIE 1XNQJ 1K4JA 1ULRA 4QWAA 2GO8A 2BEFA 5C82A 4L73A 1X5PA 1UVNA 4HYKA 3HJVA 2X7BA 1S7NA 1LK5A 1WWZA 1EQMA 1ZA1B 4WXWA 3HO1A 4IH5A 2HHQA 5DWNA 1IWGA 4IOCQ 4M6IA 3SJEA 3W5ZA 1RWOB 2G1HA 2BUNA 3CJSA 3HCXA 1UPMB 1N54B 1WEYA 5KG5A 1JMTA 3NCQA 2HHUA 2AHOB 3H8YA 1TUWA 4DR2J 2ZELA 2ALYB 3MAQA 4MFLA 6FDRA 1WOSA 3DLKB 5C2CA 4UOCA 3MR2A 5H9FK 3GFHA 2HSEB 1GMVA 4A47A 2GLFA 2AIRB 3PW2A 4RU2A 4KC5A 1KN6A 4KFBA 1FRKA 5HI7A 3Q8VA 1RT3A 3RYLA 2BL1A 2PIZA 2KVIA 2MJUA 1JQGA 4KGZB 4R87A 3LW5C 3KYLA 1U0SA 3HK2A 2A1BA 2PA3A 2BJ9A 5K8MA 1LWFA 5IM0B 2HLTA 1XQIA 4LR9A 4L74A 2LA4A 3CZXA 2V8DA 4DG1A 4AD6A 2C2OB 1Q2YA 4ICLB 1KUYA 3LGHA 1RBLA 4UTGA 1KP6A 2H4YB 2XI3A 2DH8A 2ZBQA 5F9NA 3BBCA 3CD0A 5IV4A 4PSWA 5CCLA 3Q8PB 2PC1A 2MY8A 2A4NA 3P2HA 5HMNA 3AB4B 1Q2DA 4ANEA 2IMOA 3BKFA 2NXUA 3TVYA 3IR7B 1BE4A 3GZ7A 2YKMA 1NXIA 1Z4UA 3GCWP 1FXRA 1E6YA 4LQGA 2NSMA 5LYIA 2C2MB 1IKWA 4DYOA 1YDLA 3R2CJ 1SJFA 2HVIA 4PKDB 3N6LA 4DV0J 1YBAA 5C5JA 2RKIA 4C2MA 2CXAA 2QRRA 2OPPB 3RBEA 1LW0B 4A33A 3TO9A 2ASYA 2XLJA 1NK6A 3EZ5A 4QC6A 4E0DA 1FJCA 2IRXA 1UP1A 3TAPA 1XMQJ 2RS2A 4ZY0A 4CLPA 4X8IA 3R97A 2V4QA 1ZYQA 5JVHQ 4JYWA 4KH0B 2DGQA 2ZBRA 4O4GA 3I31A 4R6TA 3RJMB 4KO0A 1HWJA 5GAHU 2RB7A 3TX0A 1F2PA 3BH6B 1REVB 1S9EA 3QO9A 1BY9A 5U47A 4OZ1A 5K14B 3US5A 3B2YA 3HKWA 2RHQB 3CMES 3MUVP 4B5PB 5EUHA 2ZH2A 3DU6A 5I42B 3RU0A 1QSMA 2PFDA 5AXLA 3QWPA 2W7AA 5HMZA 4JI3F 2F4VF 1X5SA 3VVTA 2HK2A 1D1UA 4LF8F 2VZ9A 2J0XA 3J80Y 3MWBA 2LKZA 2FHOB 3CCSS 3N9UC 2RQ4A 3DLBA 5IFMA 1T05B 1M4IA 1M4GA 3GPAA 2JBJA 5ITHA 2HS4A 3BPDA 3KR5A 3HSZA 3OL8A 1XMOF 4A8XA 2E1CA 2ZBIA 3CNQP 3IGVA 4UEEA 2L3MA 3K8VA 1JKHA 3KGQA 1FFSB 2PRQA 5B08A 3ENQA 3CE8A 4AFFA 2K5TA 2G4BA 2ZBPA 2M0GB 1M4LA 2DGTA 1XF8A 3FQLA 5KFZA 3M9MB 2AV5A 4OX9J 2F8EX 3I96A 2XEFA 1RAIB 4BS2A 3LTOA 1JLEB 1FNXH 1FTCA 5HK4A 4DI6A 4FKXA 4NGMA 3MPYA 2BJ1A 1NHVA 1AUDA 2JDJA 2RDIA 4AT1B 4KS9A 3G87A 3NRBA 2HQ3A 3CB4A 4ETZA 5H9FJ 2AW0A 2MTLA 1RT2A 4KGXB 1MSWD 4G6VB 3BGUA 2JEVA 5B0CA 4ITSA 3UN3A 3FYNA 4JV1A 2CZ4A 1YZ6A 1V6HA 5A8WB 3HX9A 4C7QA 3DOKB 1LV5A 1TQLA 3O6QA 1ZETA 2GAGC 4O3PA 2DGUA 4MFPA 3JYTB 1QSNA 1PAEX 2K7KA 4TYBA 4H6UA 1TKZB 1IR1A 4NLWA 4B3OA 1RTJB 2I3CA 3CXPA 2J7WA 3ETMA 4CT9A 3TCVA 4F7VA 4ZCMA 4LT6A 5KFXA 2IMWP 2RE1A 2HS3A 4YHHJ 2ACMA 2VD3A 2K1RB 4ID5B 5L8RC 4ZPVR 5D0RA 2RILA 5ETKA 4DR5J 2BACA 5DZ6A 5F49A 3TR5A 4RBTA 5CYMB 2WW8A 1PYTA 2W25A 3AD9C 1IBLJ 4W9YA 1N52B 5I3PA 1VQYA 4IH7A 3KK1B 4KLVA 4R8UA 4IDKB 4PXBA 3L95X 1RT1A 4PSXA 2HRYA 3BBBA 2GJFA 4K8RA 1ZS6A 3EGZA 4WU3A 3GB0A 3ILIA 1RGVA 4KBIA 5E96A 4EYIB 3UN5A 1O8BA 4JI8J 1R8BA 2B4VA 5KFPA 2CADA 4YFUA 5HANA 3QMQA 2H5JB 3D1OA 1JB0C 2CQGA 1RWNB 3MM7B 3Q2TC 1ZTWA 3MPWA 1FRLA 2R9LA 1MWQA 4DLEA 1AYEA 1FRJA 3HMJG 2M8DB 2B5GB 5F09A 4IKAA 2ZZMA 3C6TA 4GXHA 4A38A 1L3VA 2H9ZA 3M8QB 1QTNB 4E0AA 1LOKA 4O3NA 2MJNA 2W7PA 1LCPA 3EX7B 4DJBA 3EPIA 3SCJE 1CJKB 2FJVA 2Y0SD 4MYUA 4GO7X 2CG8A 2KT2A 2BX6A 1S7HA 4NLTA 2V5HG 3O44A 3DI6B 4LR7A 4C0BA 4R0JA 3QPIA 3OL6A 2HFNA 4ZLLA 2IA0A 4A46A 2KM8B 5A6WA 1HLWA 4UOGA 3IMQJ 4H4OA 2E5HA 3NGRA 4DL5A 4NLRA 4XAKA 3SSRA 1U4BA 3D7SB 1F9HA 1OIAA 2FGCA 2PRBA 1MROB 1NK8A 2H4WB 3I56S 4C8NA 1Y0YA 4P4EA 2DY9A 3HHLD 4TLRA 1RHKB 2ZEJA 2GHVC 3H7HB 1HNXF 3HP6A 2UXCF 2FHJA 3CJ0A 1Z2ZA 4OYXA 4CLSA 2AJ6A 1KLMB 1RAGB 5SUHA 3MFHA 4ED3A 3LQVA 5E3QA 2W4PA 3UW1A 5KTCA 3P5BP 3J7A1 3R7NB 3FX6A 4WTOB 4UIBA 2BJ8A 3GG0A 4OYZA 2MKIA 4ZDNA 3R9GA 3M2UA 2G0JA 5AT1B 2PEBA 4O0NA 4DLGA 5DG9A 2HVHA 2C1CA 3B3CA 1PAUB 2CNTA 3PDNA 4M3SA 3U02A 2XMJA 1DQAA 3UNYA 1TK0A 2RH3A 3IG1B 3NOCA 2X3GA 4GO5X 4NLVA 1U2FA 4F9VA 2UUCF 3FBEA 3OT9A 2Z58B 3W61A 1AT1B 2OPRA 2FIUA 5F41A 4KOYA 1YX2A 2BRLA 5EX3A 4QPXA 1XOVA 2QLWA 3GIRA 1UFKA 2OOTA 4JXRA 4DSIA 3RB0A 4MI4A 4IG3B 3M6XA 2H48B 5DJBA 2HMIB 4IR9A 1VRUB 1H8LA 1HIYA 4FUUA 3GSIA 2Z0ZA 2BUEA 5J2NA 3W9IA 2FHMA 2QYCA 2AZ1A 4USIA 3EJMA 4DFKA 1LWXA 4X4VA 4HNYB 2R7VA 2H5MA 2GNKA 1KOHA 1RHMB 4URGA 3I0RA 3VR1A 4EUVA 1YREA 4FYWB 3J7AN 3KUHA 4UUXA 3T1YF 3QRQA 2MKKA 1CJUB 2B9EA 2M5YA 2Q1LA 3D6MB 3ISZA 1RTDA 2KFZA 3H4BA 1T3NA 3BF4A 3ISXA 4Z2XA 2LCWA 2GFFA 2VFUA 2MGZA 7FDRA 5IOLA 4DSFA 2XYHB 2Y1IA 4OI1A 3ZZOA 3IM9A 2OPQB 4ZVSB 3QGGA 3V2UC 4BDPA 2FE7A 3OV7A 2CUYA 3V6HA 4ENOA 4PYDA 5ETVA 2Y1RI 4LFCF 3VALA 5HQLA 2CNKB 1URNA 2I1RA 3RTVA 4Q44A 1NKBA 3CDAA 2ZE2B 4JOUA 1S6QB 1SKSA 9RUBA 4CYOA 4TU7A 2OMOA 4CRJA 2AJ0A 1ELMP 3MCOA 3P96A 3FXTA 4LF2A 1Y0RA 3LPYA 5D4NA 3H42A 4DPTA 3OFGA 1Q5YA 3RNZA 4JV5J 3UWTA 2Z0GA 2R7TA 4KPYA 3FF3A 3HLPA 5L46A 4QWEA 1LFPA 2CQ3A 3DM2B 3CCQS 2W4DA 4EI2A 1ELLP 4LRFA 1YGYA 2A10A 2XNQA 2QECA 1B87A 3WQPA 2C42A 5ETLA 2DYAA 3DLKA 2FZKB 1N5TA 4NI2B 4ECWA 3KUGA 4QJVA 3N01A 1A7GE 2HLUA 8CPAA 1Q5VA 4Y2IA 4E2FB 4KVXA 4ILMA 3E8OA 1KONA 4GMKA 3MMJA 5A76A 4F02A 4X62J 5HQ8A 3U27A 4E2AA 2OEKA 2WVBA 4UCNA 2MKYA 1RU1A 1X9MA 5IM0A 4AYBD 3L9ZA 3UPFA 4USVA 2IDLA 3MTKA 3EUNA 4DOZA 1BQNB 3CF5Q 3L09A 4ICLA 2V0NA 2DHXA 4PZVA 1RT7B 2FCKA 5KFRA 3T5HA 4B12A 1SJRA 4MCPA 4RNOA 4WFYA 5GAEU 3LOUA 5HVHA 3M8YA 4KRWA 1J27A 3IA0A 4LBHA 2B43A 3NMRA 4X66F 3WHIA 5BWAB 5AJ3F 1IBKJ 3TA0A 3BH7B 2AGQA 2NR0A 4C8LA 4DR1J 4ZPBA 4ZPCA 4QR2A 3HD2A 2PR8A 2W8KA 4RL1A 3K2KA 1EKRA 5LMUF 3TE4A 1N5VA 1QVGR 3ZZYA 4IUFA 2QLBB 3ELHA 2J9CA 1NK0A 5KFGA 2VKRA 3QIPB 5LJ5Y 3HZEA 2OPPA 1PGZA 1LW0A 1Y9KA 1WOOA 3M4XA 2IDEA 3LH2S 5D8HB 4DFMA 1HR0J 2EW9A 1HL6A 4C2ZA 4C7HA 5JMNA 3U1NA 4MXUA 3K2YA 1MNEA 1KHWA 4DX7A 4N56A 4HVZA 2RDJA 3HM9A 4J5OA 2ARHA 5LT5A 2DO4A 1Y11A 5DS7A 2VF3A 1HI0P 3SI8A 2GMLA 3GCXP 4LSLB 4YY3F 2PE3A 5K14A 2GVZB 5CHCB 3FMCA 2AFMA 3D4UA 1FJGF 4B5PA 4E8OA 2BJ7A 1N33F 2PIYA 3SI1A 4F0MA 4YB1P 5I42A 2XULA 4M5DB 4N47A 2FVPA 1T8EA 1HNWF 2IAJB 2EVNA 5DG7A 4YB5A 2VC0A 4K5SA 4ILLA 2DD8S 4OIDA 2KZMA 1SQGA 3MZIA 3TZZA 1VHEA 5CXTA 2VL1A 2GV1A 1FE0A 3IIBA 1J4JA 3R1KA 4LF4F 3JXOA 2OI2A 3DXBA 1K44A 4FD7A 2F65A 2OFGX 1LQ9A 3S9NA 2BQRA 1T05A 4OV6A 2Q0YA 4WZQA 2LXFA 4N5SA 1UJ5A 3LWMA 2IJFA 2XO6A 1YVKA 3PEIA 2VFTA 1YJTA 2WK4A 4MJKA 2GLJA 2RQCA 2IBKA 1VQ6S 3RRKA 4IRCA 3PX6A 4AG7A 1NJXA 4X84A 2DNLA 4C2XA 3DRYA 4OYWA 2FY1A 1YWXA 5BR8F 3GJRB 2KN4A 3T19A 1KC8T 3VH9A 2CF4A 2I38A 2PDOA 4QU6A 2YNCC 4R76A 3CDWA 3C14B 2P6SA 1JLEA 1IWAA 2W1BA 4DQSA 1QQ9A 3Q2SC 4MK8A 1VGYA 4NOHA 2CNMA 3UR0A 1K9MT 5D4LA 1EHWA 1VQ5S 2AFSA 5DDPC 3JTKA 1TL7B 2YNEA 3G82B 3IU2A 4ED1A 2P6EA 3LWUA 4OI6A 2UVVA 1KKHA 1BOBA 4LF5F 5KTDA 4NCGB 1VBZA 1MJ9A 3QRPA 1Z9UA 4FPIA 2GANA 4HR2A 2MQMA 4H54A 1RWWB 2HHPA 4FXWA 1B7YB 2D74B 5A8WA 2Y8WA 1U09A 3DOKA 2ZZTA 2KH9A 4A8SA 2V63A 3JYTA 5IQ6A 9ATCB 4CT8A 1LNQA 1SH0A 2OTJS 2B3VA 1TKZA 3QNWB 1RTJA 2C3UA 2PJ7A 1PBUA 3I9SA 4DR4F 5HLFB 3ADAC 5HAOA 2AWZA 4YOEA 4J3GA 3TAQA 5F46A 5JVGQ 5F8NA 2OD4A 4DL0C 3FMWA 2K1RA 4ID5A 3HLUA 2YXLA 1RTIB 4GKJF 4F6AA 1XNRJ 3ZNUA 3J81j 5CYMA 4ZP9A 4JI5F 3PRBA 3IGNA 4A8QA 1R0AA 3KK1A 4JD6A 2W4CA 1J5EF 4IDKA 3J80U 2I79A 1Z8WA 5AE2A 2XBPA 4R3KA 3O2IA 1FA0A 5LYDA 3R3TA 3PGPA 5LSRA 2Q79A 2AJ1A 1JNRB 4I49A 2VI7A 4Y3CA 3CD7A 1OY8A 4M5JA 3R7BB 4QBJA 3PJXA 4L72B 4OLOA 3FSXA 4F36A 4CNZA 2XEGA 4Y00A 5L38A 3MM7A 2GQ2A 3KG1A 4LFAJ 3NH5A 1GTEA 4DS5A 4LF9J 3KDNA 1G7CB 2GJIA 2F40A 2B5GA 5E41A 2J0WA 1CBKA 3M8QA 1B3TA 2EC0A 1ELOA 1YJ7A 2D3O1 4YQWA 4CH0S 3MN8A 4PQAA 4DUYJ 1UVLA 3CSKA 1UPPA 1Z2LA 2JBKA 2YNHB 3DI6A 4FVCA 3NS6A 2BW2A 4U9RA 2UV8A 2KG0A 2BOPA 3EYZA 1EP4B 2CYYA 2ZENA 4Q7AA 1RUSA 1KR4A 5DRKA 1NNDA 3C66A 2G3AA 2R8JA 5BJRA 2Z2ZA 4UOHA 3TP2A 3LODA 3PKYA 1MROA 3ET6A 4K4ZA 3H5SA 3M6WA 4DR3F 3KNGA 2QJ3A 1CM0A 2IFXA 1KLMA 1HARA 4LRCA 2FSRA 3W66A 4DV3J 4ECRA 2B7BB 2WTFA 5KTQA 5D0HA 2Q7SA 3DNCA 1AW0A 1SQEA 1TVRB 3O1LA 3S8SA 1FY7A 2D3UA 1ZPWX 2QA1A 3TZYA 4OI3A 4NZ0A 5IT9U 2D7SA 3D2WA 3QBCA 2CQ2A 4BC7A 5JPHA 3GJTB 2CKWA 1YZ7A 3MPVA 5CABA 1BLLE 4NXNF 3OFHA 1FVSA 2H5IB 3IG1A 3WC2A 1CVJA 3D6TB 4A48A 5G0RB 2RFHA 4X4RA 1QTMA 3QJLA 1U1KA 3KR4A 4OV1A 4CQ1A 1N32J 2XY7A 2ERRA 1T9WA 5ETOA 2EXUA 2BV3A 4DSEA 2M4MA 4OI4A 4DCJB 1U0HB 1U1MA 1IKXB 3Q8QB 4CS0B 2LQ9A 4EFAC 4OC4A 2P6FA 4IG3A 3H8GA 1S7IA 2HMIA 2VUGA 1J5OA 1VRUA 3HVWA 3HKZD 2ABZA 4JI4J 3T3FA 4UIAA 2EBJA 4TYAA 2LXUA 4MHZA 1QAJA 1VC6A 4NJRA 2OR4A 2G2YA 4B3SF 2G9OA 2QMXA 3OXFA 4JP8A 1YJVA 1N56A 3NA6A 3S6HA 4KOWA 3CC4S 4ZX8A 3FUYA 4NLDA 5GADI 3EFAA 4WWSA 1TKDA 1CJUA 2OGUA 3VARA 4IG0B 3BB5A 2N82B 3WC7A 4K0KJ 2HGNA 1Q78A 1R89A 2ZUGA 4NEZA 2DRBA 4GS4A 3FKBA 5ISVA 2KTQA 3WIVA 2HYIB 3AH6A 1VBYA 4DBQA 4A8MP 1QDUB 1HQUB 2OPQA 3R9FA 1LXJA 1B0TA 4OC2A 3MDFA 4ELTA 4ZVTB 1SB6A 4WXOA 3PP9A 3CMQA 4QWBA 3PB7X 3CDUA 4L76A 5LMNF 3UFCX 2DXFA 4JLYA 1T7PA 3R9LA 1H7XA 4PWDB 3MAAB 2GIRA 2FHJD 2D9OA 1S6QA 4N7TA 4NGRA 4NLOA 2UUWA 3I4HX 3QFWA 4Y2KA 3BSCA 1S72S 2R7HA 1K0VA 1QM9A 3THPA 2R7SA 1XWLA 1W26A 2Q4YA 3I5CA 4OZ0A 4WYLA 1YJUA 5F3TA 4J9LA 1U45A 4YDXA 4BCAA 4YEAA 1MW7A 3DM2A 3M2RB 4F3QA 1YVOA 5L39A 4HHHA 1N34J 1ZOTA 3TX8A 2EKYA 2QX0A 1RU2A 4XK8C 4UFVA 3BQ2A 4NI2A 5CPAA 1PJ7A 1H2UX 3G4SS 1E6VB 2PJAA 4F4YA 2D9PA 3KG0A 3PIOQ 2QLFB 4MFZA 3GTYX 4P2SA 2VU5A 1KFDA 1XMTA 1I21A 2KT3A 2UXBJ 2F63A 3PXGa 2P5VA 3FRYA 1BPMA 1JLAB 4M95A 4QWDA 1Z8LA 1OYDA 3PEHA 4AL7A 3F56A 4R7MA 3FEDA 4C11B 2EKNA 4J9SA 2QSFA 2AFZA 1KQGB 1S5KA 4F4ZA 1P0HA 2HQCA 4H2KA 1CEZA 4OC3A 2MLXA 1HPZA 3I9ZA 4DFPA 4QIEA 3B6BA 1TIQA 3H5YA 1DTDA 1KWMA 1BQNA 4X4QA 3G8QA 1RT7A 3TEHB 3MPUB 3ZTPA 4GKKJ 2MSSA 5FLXY 3WC6A 2OB0A 2VQEJ 2ZD1A 2AYBA 6CPAA 1SC3B 4KTQA 1N8RT 4L6V3 1UEUA 3QRRA 5FD1A 3FNNA 1FNOA 4MTPA 5DZ7A 2HHXA 2JVOA 3I32A 2RRAA 1SIZA 1WHWA 1QAXA 3W2WB 3C15B 3TAMB 5CH7B 4CLZA 4P2XA 2DIUA 3ICLA 2HFVA 1TFWA 3QIPA 1S79A 5IS2A 3QFHA 2FIAA 4AQYJ 1RXTA 3C16B 3T5LA 4USUA 1S6UA 1G3OA 2ASLA 2YQ1A 2RIJA 1HBUB 2QL9B 3MECA 4A39A 1BXNA 3D6HB 2CQDA 1NAQA 1VQ4S 3H90A 1Q86T 2VDHA 2R7WA 4EZ6A 1RBOB 2DCLA 2VDIA 4OQJA 1D8ZA 2B4BA 2NREA 5FDLB 2CNSA 5DS0A 3OTBA 3DLLQ 2OU2A 3TVKA 2YY3A 1SJ3P 2YX1A 3GJQB 4XTTA 1ZO0A 4OHYA 4J9MA 3WIUA 4LSLA 2AEJA 1G1XA 2R7XA 1JLQB 2CQHA 1WF1A 2ZOFA 3H4QA 2WONB 2GFQA 3CD5A 2R8HA 2FVQA 1F0XA 2PJ2A 2E44A 8AT1B 3UD3P 3TT2A 3ISNC 2CG4A 4M5DA 1S0NA 2FVSA 1UW4A 3NAIA 1HBOB 1R8CA 5CYQB 2IAJA 3BV8A 3CCVS 3DRPB 4Q0BB 3NNHA 4IYQA 3CJ4A 1SJ4P 3W9JA 2HWIA 4ECXA 3ISND 2FLNA 4ED7A 4A94A 4J90A 1G2EA 1VISA 4C8ZA 4M85A 4YP3A 1TKFA 3IRWP 3IJ3A 1R3NA 2U1AA 2OMLA 3MR3A 2Y9HA 5HBMB 4MMOA 4S0MA 3FFIB 3CTRA 2E7XA 5ETRA 2VIHA 1S48A 1RO5A 1WOPA 3AHPA 3D7FA 2O1PA 4A30A 1UZDA 4WYWA 1S1UB 3KJNB 4ANCA 1TUGB 4ZLJA 3R5AA 4PAAA 1U2RA 3BGRB 3RUBL 1PBAA 4M6GA 3G3SA 2DGXA 1CPZA 3C14A 2Z56B 2D4PA 1IR2A 3T41A 1GX5A 2ZUAA 1H2VZ 4KSFA 2F8MA 2HHTA 1RSCA 1TL7A 3TOAA 3G82A 2VA3A 3PB9X 4NCGA 3NBPB 2DISA 3O5TB 4HHUA 2XNRA 3TI0A 2PMWA 4XPCA 2QYGA 1Y00A 5IC4B 1T03B 1M44A 2HHHJ 2H51B 2QMWA 2MZ1A 1KVIA 3T1HF 2XB2D 3VF0B 1YLXA 4MFJA 3FRMA 2NQPA 1ARMA 2ZEPA 1SH3A 2VXKA 5HLFA 3GR0A 1XR7A 1LKZA 1NRKA 2BXJA 3VV2B 1A2ZA 1Z4EA 2B4PA 4F04B 2IYGA 1GXUA 5IV0A 2QG9B 2DXEA 4H4KC 2JFKA 4GM5A 1FKAF 1RTIA 1NH7A 2ZW5A 2AF6A 1JWWA 1Q1KA 2HBZB 1FRXA 1S3ZA 2JEWA 1PG5B 1FEEA 1R8PA 5EMIA 3LO3A 4P7VA 3RBDA 2PJ0A 2EFGA 3VAHA 3CPXA 1OZPA 1Z8XA 1R6YA 4F4AA 1HDUA 3BQ1A 1SKUB 2QV6A 1HBMB 5I0CA 3D4JA 4FS1A 3NGSA 2FY8A 4B9SA 2QA4G 4QZVB 4QIVA 4DV7J 3WABA 4ED4A 1EAYC 1YR0A 5K8NA 1NCLA 3E0KA 1MK4A 4YR0A 3KLIB 2R7QA 1FKPB 3HT3A 1M1HA 3QJPA 3DNSA 4CIOA 4MK9A 1L3SA 3M05A 3W8PA 5E0OA 5HH1A 1X12A 5IB9A 3F44A 1QSTA 3T9ZA 1M4DA 2V8VA 2NLWA 3KOAA 1A9NB 1SVDA 1VKCA 4TVAB 2R8GA 2YWFA 2PA8D 5KFTA 3EO4A 4DV6J 1Q8BA 2YKAA 2YWEA 3FB3A 3MM6B 4DS4A 2YNHA 1FKOB 3IAS9 2KO1A 4QR1A 1WEXA 2ZVSA 2PC6A 1EP4A 2M2BA 4EZ9A 1VQNS 1OY9A 4UCPA 2VV5A 4F67A 2CNNB 3B54A 1FTRA 3UI3A 1H72C 2ZPAA 4Y0FA 4UWJA 4F2RA 4CAEA 4CM2A 1S12A 3DRSB 3KHGA 3SFUA 1SCJB 3BZQA 2DEAA 3KK3B 5LL6d 3MOJB 2XMUA 1F6TA 3F41A 4JI7J 3MOZA 2LQ8A 4AG9A 3AOAA 3V81B 2AEFA 1TVRA 2AFUA 3CCES 3W91A 5FIIA 2XS7A 2OTLS 3BGFA 1QSLA 2JH3A 3M9OB 3K59A 3D7HA 2VZZA 5F8HA 1Z1ZA 2GJ2A 3FIXA 5ETMA 2ZEHA 1JJ4A 2JHEA 1FEHA 3QB8A 1B99A 2DPSA 4HLBA 3SJGA 2BE7D 2XEJA 4I67A 3AXMA 3QAUA 3IU1A 2HWHA 3GFXA 3K5NA 1XEZA 4LREA 4DV2J 2WAQD 2RUSA 2XYPB 4QCLA 3N0VA 2HG4A 3T6JA 3CUNA 4FWUA 4X4UA 1RBAA 4B3MJ 5K8OA 1U0HA 4X4SA 2MQOA 3KLHB 1RZMA 3LAKA 3FZBA 1IKXA 1AROP 3TO6A 4HL9A 1U47A 5F8IA 2MYFA 3K5OA 1MU2B 1MMNA 4NA3A 3T90A 2P9CA 3JTPA 2YKMB 1PJ5A 2DITA 4Y2CA 3RRGA 1HWUA 2XWXA 4FDFA 2OP5A 1S7KA 5HO4A 4OJHA 5HMWA 2YKPA 3E3XA 4IH6A 2DHAA 3Q8RB 4UEZA 3D9BA 5F9LA 3I87A 2GC8A 5H9EK 3T6BA 2C6PA 3FQKA 2POKA 1X4FA 1UL3A 4YB7A 4RKUC 1T3OA 2J9DE 4IG0A 4N41A 2IM2A 1XR6A 5KT6A 1EETB 4P71A 3PR4A 4UFWA 2OKQA 2KM8C 2OIHA 1IBCB 2UV8G 4F0KA 3KXDA 1HQUA 2K7JA 2FJWA 2B4DB 1RAJA 4B3TJ 4KSEB 3KTQA 3AFGA 1R8AA 5LRJA 2OZGA 2ZH3A 3B8GA 4JZ0A 5AG6A 2MQNA 4DQRA 4U9ZA 2ATRA 5A8KB 3IBWA 1BWEA 4BC9A 1TK8A 3DYAB 1N6QB 1NDKA 1DFDA 4PWDA 3MAAA 2YWGA 2DKOB 1QD1A 1MMLA 1WHYA 2B9XA 1KUXA 4EFDA 2R8IA 2O3DA 3FK4A 2C28A 2JDDA 3LP0B 2Z2LA 2COLA 4X4PA 1NMEB 5B0BA 4FBUA 4NLSA 4B9MA 4LX9A 3X1LB 2CNLB 4A8OA 5F47A 4ZCIA 3OTOF 4DV1F 3M2RA 1D3WA 1M0SA 4RUCA 3BSOA 2ALZA 1RWPB 1PIEA 2CVIA 4NWBA 2K06A 1SQHA 1KQKA 2OSRA 1KOOA 1LOUA 4JI0F 3KKWA 3UCZP 4PRFA 1E6VA 1RKJA 4RU9A 2VFRA 4DR7F 1S7LA 4X4TA 3GV5B 1LANA 5KFWA 2HC9A 1N36F 3K89A 1HKAA 3R1LA 1JLAA 4JYAJ 1T9YA 4RUHA 4CYNA 4C11A 1SL1A 4KLWA 2XMTA 5C7PA 2KRRA 2PT0A 2BEIA 2E66A 2JX2A 3S1TA 1UFHA 1GMWD 3T9NA 4BMHA 3D1HA 2B9YA 1SV5A 3PCOB 3PNIA 4B3RF 2O28A 2C22A 5IWAJ 3MM8B 1HA1A 4P10A 4ZVPB 2KCWA 3IEHA 2J5AA 1Q79A 5E3CA 3BR8A 2BSWA 1VQPS 4O3OA 2CTBA 2DTJA 2AFWA 2G3TA 5EWEA 4NFRA 2VHGA 4FD5A 2R7UA 1I1GA 2C3MA 1A0OB 3ONQA 4ZVHA 4C98A 3K7RA 4F3MA 1H38A 3P3DA 2EFPA 4FF2A 3Q89A 2B8QA 4WFBQ 2ZW7A 3V5RA 5JM6A 2GGPB 2Z30B 1RJJA 3VATA 2O01C 2RQKA 2VJUA 1X7VA 3ZC4A 2WOMB 1JXLA 3W2WA 2JOQA 3C15A 2G9DA 3R8YA 4B08A 4DXLA 4Y49C 5CQGA 5KFNA 1AB8A 4MKBA 2ZITA 1NHUA 2CPIA 4LVOP 2FTRA 3ZZUA 4USHA 5A28A 5KFAA 1XMBA 3C16A 4OYAA 3C6UB 2H3EB 1F2OA 2AE6A 1HBUA 3PYEA 4NYPA 4NCBA 2Z3NA 2O4HA 2PDAA 5I3UB 5JUMA 2LDIA 1NB2A 1SC1B 3ENAA 5FDLA 1EARA 3PG9A 3FH4A 1CJTB 4USWA 2KU7A 4DFJA 4UCMA 2DGSA 3SEOA 3BJYA 4ZPTR 2OELA 2BE9B 2Q7BA 1FHTA 3NG8A 4X64F 2WONA 3NWRA 5H9EJ 4DV5J 4UY85 1SKRA 1VI7A 1AFJA 4OIXA 4J91A 3TTHA 1F57A 3ULHA 3C19A 4IHMA 1Q8IA 4LF7J 1UVMA 3DRPA 2VICA 4DV4J 4Q0BA 2PJ6A 3FEYB 4OZ3A 1CS4B 3N79A 1NM2A 5EN1A 4KJIA 1HMVB 2BE2A 1HNIB 4X4OA 4X5KA 3OJUA 4F3OA 4FXVA 4WFAQ 3SXLA 2MHNA 5JXSA 4WPAA 2WVEA 3CJRA 3VWDA 3NEKA 3FFIA 3HPOA 5FLXU 4WZMA 1WF0A 3KJFB 4ZCKA 3TA1A 2W2NP 4K50A 2A0FB 3CC7S 1UVIA 5IV3A 3M6UA 5MAOA 1UWBB 3BDEA 1S1UA 1VQMS 1HFEL 3JSYA 5KFSA 1GXLA 2KFNA 3VGUA 1JLFB 3QAHA 1L0CA 4OLPA 4ZJQA 2KI2A 3GIJA 4KT0C 4QWCA 5HSPA 3RAMA 4ZVUB 3QT5A 3M8PB 4OHWA 3BGRA 2JRSA 1WKLA 2CPJA 3CDEA 3BGOP 2V34A 3R27A 4RWXA 5HATA 2LFVA 2LVWA 2EFQA 3D3BJ 2Z3KA 3F0AA 1KSPA 4XNHC 3MURP 2FVRA 1WELA 2P9EA 1HEEA 3NBPA 3EDQB 1YK3A 4OX8A 2VQFJ 3A8IA 5C42B 2KJVA 3CIZA 1T03A 1NKEA 2EK6A 4OJ1A 1S0MA 4ATNA 1GK8A 1QUPA 1M5PC 4K4TA 1RISA 4DF8A 1RAEB 2VG6B 4JI1J 3FCHA 3VAIA 5H84A 1VS3A 4CDIA 2PVVA 3W5XA 7FD1A 2ZVIA 1MN9A 5G22A 4KOSA 4ZVEA 4UFXA 2GA7A 1HHTP 4X2TA 3EXYA 3F5BA 4EBCA 2CPEA 2MSTA 1MJBA 3DLGB 2LQBA 2MZJA 4AVAA 2DEIA 4RR5A 1Y5NB 5KAKA 3KKFA 1DTTB 3MFIA 4CNYA 5E3AA 4RW7B 3CJ5A 5L1LA 1U2CA 1YQHA 2V8GA 4WP3A 2HEKA 2HQYA 4YR3A 2UU9J 4PQUA 1FNMA 4DR6J 2VH7A 2L9WA 1HBMA 3S6EA 1ARLA 2ZNZA 1F5BA 2CQIA 6FD1A 3KDOA 4NCZA 2PJBA 5JQ4A 4JI6J 4NE9C 1GQEA 1OBRA 1RABB 2J6SA 3OW2R 4HTJA 3ZZRA 3S6KA 4ECZA 1H98A 2G2OA 3DU5A 2MGZB 3NGTA 4CTAB 3R5BA 4L8AA 4DN0A 2E1PA 3TUIC 4II9A 4Z7YA 3KLIA 1FKPA 4HT7A 4ZY1A 1I5OB 1QLNA 4GVLA 4IO1A 1H2TZ 1YGHA 1TK5A 1NDPA 3M8RA 2B58A 1T9UA 2NPFA 7AT1B 1DTQB 2G0CA 1OSCA 3UDCA 3D2MA 2W7OA 2HVEA 4FBTA 4XPEA 4CWBA 2I8EA 1QVFR 3PX4A 3MM6A 3V6JA 1FKOA 5HQMA 2KYXA 4U7UK 4OC0A 1Q95G 3PYDA 4J9KA 4ONUA 4MCSA 3M1VB 1BC6A 1C0UB 4P4IA 1ZA2B 3AOBA 1BD6A 3ILOA 3IWXA 1RTQA 5CNPA 4ED2A 1TP7A 1VR6A 4B17A 2HRTA 3GIMA 4FBEA 2B56A 4OMEA 1XE4A 5KFFA 4TU8A 3FBUA 3FEEA 3OSPA 4B11A 1S1TB 5D8NA 1U6BA 1WJ9A 3SJXA 3CJ3A 5C2GA 2M70A 1VQKS 1TL1B 1ZM3A 3DRSA 4U95A 3G86A 1UW9A 3KK3A 2UVUA 2E5JA 3MAHA 2XI2A 3UDEA 5KFBA 2FHKA 1S77D 1B6BA 2AX0A 2DNGA 3RAQA 3Q86A 3V81A 4HI1A 3PEJA 1LWCB 4NXYA 1EE3P 2QYVA 4CGNA 4ALZA 2EI5A 2QFIA 5GADU 2ZHAA 4DEZA 4KKOB 1N5SA 1HYSB 2HVDA 3IAM9 5M2RA 1OPZA 1S1XB 4C8OA 1Y7RA 1MG7A 3BDPA 2EG2A 1IKYB 4LF6J 4KUAA 4OC1A 2PJ5A 1FDDA 2NSBA 1VBKA 4O3QA 2V50A 3CD6S 4AVCA 4A8WA 3WDOA 2B4OA 3KLHA 5JGFA 1JIHA 1U24A 1AUSL 2YKOA 5KG7A 4F8ZA 2QFJA 2C2ZB 1MU2A 3W64A 3OXGA 1X0PA 3SI2A 1IBMF 4ZVRB 1O5JA 3T5JA 4NGSA 4NXMJ 2NYHA 2JWNA 2MMYA 3DRRB 4EEYA 4NL5A 4I2QB 4UUWA 2AU0A 1B64A 2ZW6A 2R2UA 3V8IA 1WACA 2XZWA 4UW2A 2EO8A 2V4JB 2FVCA 2H1YA 2ZH1A 2FXFA 2JSXA 1TL4A 1R7IA 2KXFA 3QATA 2HK3A 3JAMU 2AEMA 1S6O