1CG2A

Carboxypeptidase g2
Total Genus 135
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
135
sequence length
389
structure length
389
Chain Sequence
b'QKRDNVLFQAATDEQPAVIKTLEKLVNIETGTGDAEGIAAAGNFLEAELKNLGFTVTRSKSAGLVVGDNIVGKIKGRGGKNLLLMSHMDTVYLKGILAKAPFRVEGDKAYGPGIADDKGGNAVILHTLKLLKEYGVRDYGTITVLFNTDEEKGSFGSRDLIQEEAKLADYVLSFEPTSAGDEKLSLGTSGIAYVQVNITGKASHAGAAPELGVNALVEASDLVLRTMNIDDKAKNLRFNWTIAKAGNVSNIIPASATLNADVRYARNEDFDAAMKTLEERAQQKKLPEADVKVIVTRGRPAFNAGEGGKKLVDKAVAYYKEAGGTLGVEERTGGGTDAAYAALSGKPVIESLGLPGFGYHSDKAEYVDISAIPRRLYMAARLIMDLGAG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CARBOXYPEPTIDASE G2
publication title Crystal structure of carboxypeptidase G2, a bacterial enzyme with applications in cancer therapy.
pubmed doi rcsb
source organism Pseudomonas sp.
molecule tags Metallocarboxypeptidase
total genus 135
structure length 389
sequence length 389
chains with identical sequence B, C, D
ec nomenclature ec 3.4.17.11: Glutamate carboxypeptidase.
pdb deposition date 1996-12-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01546 Peptidase_M20 Peptidase family M20/M25/M40
A PF07687 M20_dimer Peptidase dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.360 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1cg2A02
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 1cg2A01
1XMBA 3CDXA 1LOKA 1ELMP 2NSMA 2GU2A 3PBEA 1AMPA 4NGMA 3L2NA 4P4FA 2ZEGA 3FF3A 4KSIA 4B6ZA 3NA6A 3PB6X 2JEWA 4A37A 2C1CA 3K9TA 2ZEFA 5DS0A 2O53A 3N5FA 4UEZA 2PJ5A 4R76A 4JYWA 2PJ7A 3D7GA 4OKOA 1YSJA 2PJ0A 3FH4A 2ZEMA 3SJGA 3IC1A 1LCPA 4MHZA 4DYOA 1Z2LA 3WC7A 4P6YA 4MHNA 1GYTA 2V77A 2J9AA 3T8WA 3NFZA 1H8LA 2PE3A 4NJQA 4MRIA 2V8HA 3KQXA 1R43A 5THWA 1FT7A 1HDUA 5JH9A 3KZWA 3GUXA 4F9VA 3RZAA 2JBJA 2WZNA 3IO1A 6CPAA 4UF4A 4W9YA 4FAIA 1AYEA 2PJ6A 5HXDA 1FNOA 1IY7A 4CPAA 4NGRA 3D7DA 1ZG7A 4P4IA 1YMEA 3CT9A 2AFWA 3K2KA 4YWYA 1CP6A 2FVGA 4NGSA 2PJ1A 3GB0A 1BLLE 3KR5A 4X2TA 1VGYA 5K8OA 1TKJA 2ABZA 3WT4A 4MCQA 4YU9A 1DE4C 1XFOA 2Q51A 2ZELA 3FJUA 4JZ0A 1Y7EA 3QNVA 4Z65A 4ZX8A 4ZY1A 2RFHA 3D7FA 3NH4A 4F8ZA 2F8HA 3B3WA 3KI9A 3PFEA 3B3SA 3B35A 5LRJA 5F09A 1PYTB 3D4UA 4UIAA 4OC1A 3B7IA 4BD9A 4IAVA 5K8PA 3SJFA 2PJBA 2IJZA 5JM6A 4GM5A 1TKHA 4X8IA 1CBXA 4A38A 2JBKA 5HVHA 3CPXA 1F2OA 1YLOA 2ZEDA 4OC3A 4F9UA 4P4JA 5J1QA 2Q43A 2PIYA 3KGQA 4H2KA 2ZEPA 4UIBA 1LFWA 4P10A 4MHPA 1UWYA 2EWBA 2PJAA 3B3TA 4OC5A 1R3NA 3CPAA 2WYRA 3LWUA 4ONWA 2BO9A 3V38A 3KR4A 2PCUA 1HEEA 3IJ3A 2ZENA 4OC2A 3FEDA 4NGPA 2I3CA 5HVGA 2GLFA 3H8GA 3HUVA 1VHOA 1IGBA 3LMSA 4OP4A 2ANPA 2CTBA 3IIBA 2AFOA 4O23A 3TX8A 2ZEEA 1CPSA 4Q7AA 2OR4A 4FBEA 2Q4ZA 4PXCA 4P45A 2PJ8A 4OC0A 2VL1A 3ISXA 4AXVA 2AFUA 4ZX9A 4MCSA 3PFOA 1ZLHA 4MXUA 2QVPA 4ZYQA 1LAPA 2C6GA 4FUUA 4P4EA 2AFZA 4LQGA 3KHZA 2EK8A 3KQZA 4IK2A 1CP7A 4NJRA 2CTCA 4PXEA 4EWTA 2C6CA 3PB9X 3IWWA 3FVLA 3HLPA 2NYQA 3I1UA 1F2PA 2BCOA 1ZG8A 4TWEA 2ZOFA 4RUHA 3BHXA 1ZG9A 3PB4X 4WWVA 1KWMA 2ZEHA 2BOAA 3NH8A 4PXBA 5CPAA 3SI1A 2PJ3A 3WC5A 3GLJA 4NGQA 5LYIA 2PJCA 1PCAA 3IFEA 3H8EA 1YW4A 1Q7LA 1TKFA 4NFRA 2CF4A 3S9NA 4R7MA 3KHXA 1BPMA 4P4DA 5K8MA 1VIXA 1ARLA 1Y0YA 2O4HA 3B2YA 2XEIA 1CPXA 1TF9A 3DGVA 4FWUA 1NSAA 3BI1A 2PVWA 3PB8X 2AFMA 4DJLA 2CIJA 4MCRA 3MN8A 4WJBA 2ZEOA 1VHEA 1Z5RA 3D68A 4R6TA 4OC4A 4PXDA 3KL9A 1CG2A 1JQGA 3FECA 4K3NA 2OOTA 3B3CA 2EK9A 3KASA 4OIWA 4P44A 1TF8A 1Y0RA 4NGTA 3FMCA 3ISZA 3RAMA 2PJ4A 3PBBA 3TC8A 3D67A 3PB7X 2QYVA 7CPAA 3SI0A 2PVVA 4ZY2A 4R8FA 4UEEA 3VATA 3H8FA 4MHYA 4A39A 1XRYA 2RB7A 4PQAA 2POKA 3MRUA 4MMOA 4MCPA 3S9MA 4NGNA 3FX6A 1TXRA 5IB9A 3FEEA 4OIDA 3WABA 4UEFA 4G1PA 3PRTA 4ZY0A 3D66A 3WC6A 1YW6A 1ZLIA 2HB6A 1ARMA 5JGFA 4P4BA 1F57A 3B3VA 2PRQA 2IQ6A 1LAMA 5K8NA 5D8NA 4X3RA 4EMEA 1CX8A 2XEGA 3SJEA 1RTQA 2AFSA 2DEAA 5LYFA 3SJXA 2V8GA 2AFXA 1OBRA 2C6PA 3DLJA 4DUKA 1Z8LA 3RBUA 1QMUA 1ELLP 5I4MA 4PPZA 5LRGA 1BAVA 2GLJA 2PJ2A 8CPAA 1DTDA 4EFDA 3S9LA 1HDQA 1EE3P 2ZOGA 2XEFA 3BI0A 2XEJA 2GREA 4IHMA 2PJ9A 3PEIA 5LYLA 3VARA 3IEHA 1BPNA 1XBUA 2PIZA 2G9DA 5CBMA 3D7HA 2V8VA 2IMOA 3VH9A 5LYDA 2F7VA 4OMEA 3SI2A 4ZI6A 4A94A 5LRKA 1LANA 3JRUA 5ELYA 3V7ZA 3BXMA 4TNUA 1M4LA 5D29A 2V8DA 3NH5A 1XJOA 1QQ9A 2HC9A 5HVFA 2QJ8A
chains in the Genus database with same CATH superfamily
1XMBA 3V4IB 2HQGA 2V9KA 2GV1A 3MMBA 3DLGA 3R1LA 2ZW5A 2CQ0A 3IR7B 3CCQS 1AROP 1MW7A 5C2CA 3HP6A 4USKA 3KK2B 4LT6A 2FJBB 2PJ5A 5H9EK 5SZTA 4LF9F 5AJ3F 4NRUA 1LCPA 1WJ9A 5J8FA 2ROGA 4O0IA 2J6UA 4IF5A 5D4PA 3R5CA 2QMWA 2RF2B 3RUBL 2WSCC 3EFAA 3QNWB 1S6PA 4QR0A 1WG4A 1S5ZA 2Z56B 3HVTA 1GX5A 5CCLA 1OS5A 3W6SA 1SC4B 3ENQA 1YBTA 4OZJA 3DCAA 5B08A 1TL1B 4JI0J 3DYAB 1HWIA 3FJUA 1PBUA 1ZM4A 1OPZA 2E29A 4PWWA 3GU0A 3OL7A 3KI9A 4HT7A 3OJUA 3NXZA 4XPDB 2MSTA 1S6UA 3GYAA 7FD1A 3DFEA 3MEDA 4Q38A 3ONQA 2FCKA 2YNHB 1CVJA 1FKOA 3T90A 3TYTA 2V2QA 2XZWA 3LW5C 2ZNYA 1M5VC 1YQHA 4E2AA 1N5SA 1Q2CA 1IKVB 3KLHB 4XNHB 1UA0A 4DL5A 4C8MA 1U2FA 3QAYA 1VRUB 4NA1A 4K30A 3UE2A 2IRXA 3CJ0A 5G0RB 2B7CB 4RI1A 3KR4A 3GG0A 1G6BA 3G6XA 1U1OA 2FZGB 3MECA 1HEEA 2PFFB 4LIRA 2OAUA 3FRMA 4Y3CA 2UUBF 4ZVUB 1MNEA 1HNZF 4O3RA 5CYMA 5HVGA 3ZJ0A 4K4ZA 2RHSB 1W26A 2DGSA 3HDSA 3I3GA 3OTOJ 1D3WA 4OP4A 2G0JA 1ZPWX 5BYRA 1QE1B 3HT0A 5H1SV 1EKSA 3FUYA 4KOUA 3K5MA 3MAAB 1U0SA 4CO5A 4EBCA 5KG7A 3MFIA 1CM0A 3SBMA 5C82A 3DU5A 2Z8QA 3FRYA 1S1VB 2ZE2A 4IH6A 3T41A 3MMBB 3DLGB 1LQ9A 2V63A 3RBXA 3PKMA 3R5GA 2OGUA 3BYPA 2XI3A 2WW8A 3MEEA 4QIEA 3I82A 1NKCA 3TT2A 1VBZA 4YN3B 4KSEB 2UVWA 5EWGA 3OL8A 1XR5A 3PYFA 1TKFA 3KK3A 1WHXA 1QJHA 3L9ZA 4PQUA 2RQ4A 1MJ9A 5FD1A 2W2PP 3L09A 1S6PB 3NOCA 4JI5F 3HJVA 2BJ7A 5DRKA 3BI1A 3HVTB 4Q2LA 3F5BA 4QR2A 5I3QA 3MDFA 3UNGC 3N01A 3H8YA 4OZ0A 2GHVC 4R6TA 4PXDA 4X5KA 2WOMA 4U5YA 5DQGA 1FX4A 3FECA 1BC6A 2J8SA 4CAVA 4JV5J 2JLMA 1JWQA 5GAEU 1TF8A 4USIA 1SJ4P 3HFKA 4KY3A 4PCQA 4ELUA 2HVHA 3CNQP 1YBUA 1RAGB 4OI0A 2WPWA 1HKAA 4I64A 4QB9A 1JMTA 2RB7A 3DNSA 1NK7A 3MEDB 1YJRA 4IRCA 1R8BA 3PY8A 1Q8IA 1FKOB 3FEEA 4KKOA 1PSDA 4U9RA 1SH3A 3BKTA 2ZHBA 2Q44A 2LECA 2FZCB 2Y3YA 3KG4A 4A8YA 2F4VJ 1PO6A 3HO1A 3L7PA 2CQ1A 4DUTA 4XTTA 3MECB 1HI0P 3THPA 2DR9A 5CYMB 3VAIA 3QSYB 5HSPA 2R4FA 2YQ1A 1VFJA 4C2YA 2WCXA 1KEKA 2I8EA 2VF3A 5A6WA 2AJ2A 5KTCA 1LW0A 4WPAA 1BAVA 3QB8A 5KFLA 2RT3A 1K1SA 5J2PA 4IDKA 4G6VB 2HWTA 4WU3A 4ZCLA 1BWEA 1IJEB 2QA4G 4ZVHA 2OMLA 5ETQA 4DV7F 1VQ6S 3D7HA 1JXEA 1E6YA 2ZE2B 2BL1A 5AE2A 2HWIA 3V7ZA 2ZH6A 2YNFA 2CJYB 5DG7A 1TL7A 1QQ9A 1XNRJ 1D9DA 1OQ3A 1XERA 1CBKA 1RWOB 2B4DA 1MMNA 4KSIA 1LOUA 2CZVC 3P8BB 4DV6J 3NAIA 1KN6A 4YY3F 2OZUA 2YKOA 2RDDA 4ED0A 3Q2SC 4JYWA 4FPIA 1DY3A 1NE9A 3EXCX 3KK3B 3M1VA 4B9LA 1XTZA 4CLKA 3NGRA 3PW5A 4PQUB 2OB0A 4OHVA 1P8GA 2EC2A 4L74A 1VRTA 4DU7A 4CQ1A 2A18A 1T05A 2FYXA 3JSMA 3KJQB 2DKOB 2HWHA 4M94A 3I9ZA 2B4UA 5B0GA 4WF9Q 1VCTA 4ECUA 2W2MP 3OD2A 4WP8A 3R8YA 2GZOA 4O0NA 4NXNF 4TU7A 5H86A 2E1PA 3K2KA 2WOMB 3J7Z5 2XI2A 4X4UA 4M6HA 3P2HA 2IVYA 1YVKA 1J27A 2PDAA 3FBFA 4ILLA 3KR5A 2HHTA 2FSRA 1JLCB 3FMWA 5K8OA 5C25A 4HNYB 2DXFA 4MCQA 3PW0A 4DWIA 2KTQA 3FYNA 2KB2A 4DV3J 4F8ZA 2QX0A 2WVEA 2Y8YA 2J0SD 2JEGA 4O3PA 2W7OA 2CG4A 2R7SA 4M5DA 4BD9A 4IAVA 2DRDA 4KKOB 4ZCMA 1FRLA 2R7WA 1VMBA 1X4HA 1L3SA 4BC7A 4CGPA 3O44A 1M1DA 4HVZA 1HNWJ 2B58A 1FDAA 4JYAF 4LRBA 1H3DA 1W25A 3V4MA 2G4BA 1HHSA 3CDWA 2CNOB 1EKRA 5LM7E 4ZGYB 3DMJA 3IJ3A 2ZENA 4OC2A 5H9EJ 2JH3A 3FQKA 5D8HB 1LW0B 1U1RA 1NSQA 4ZPAA 3SFGA 3FFIA 4PZVA 1JLEA 5KT6A 1SL0A 2E5GA 1VHOA 2EBJA 1Z4UA 4OZLA 4NLSA 3C6UA 4IDKB 5J2PB 3RYLA 1A7GE 4F36A 2UVVA 1U6BA 2JEFA 1N34J 1LRZA 4OI4A 1VJWA 5KFGA 1E6YB 1WC4A 3FEXB 2QFIA 2VXKA 1S7FA 1GEHA 1RT5A 5D3GA 4OYPA 2DGQA 4KB7A 2KXFA 2YNFB 4OX8A 3IN5A 3IM9A 1TL7B 1N0VC 2B8PA 1WSVA 5C7PA 3ENWA 2B4DB 2C6CA 3RTVA 2HFVA 2MJUA 1UPPA 2XULA 3HLPA 2GCFA 4E2FB 5HANA 1FJGF 1ZG9A 1FDDA 3GY9A 5C88A 4ZVGA 2FQQB 1FK9B 1T0TV 3ZTSA 3M1VB 2GFFA 1XF8A 4PSXA 1TK5A 3BBFA 4NEXA 1PILA 1VRTB 4M5GA 2GJIA 1T05B 3BM7A 4DFPA 3F0NA 2YKQA 1LV5A 2VZ9A 4LR9A 2QEXS 3TE4A 3G8WA 2Z57B 3SQGA 3QQCD 1S79A 3KLFA 3CTRA 3PJWA 1O8BA 2J6SA 2GA7A 4HTJA 3W63A 1OPIA 1CJTA 3Q2TC 1Y9KA 4DPYA 2G2OA 4OLLA 2JDJA 3OTBA 1FRKA 1QVGR 1VQLS 3KL9A 4A31A 1ICEB 2IBKA 2KHCA 1XR7A 1FFWB 4HNWB 3UN5A 2KI2A 1HWUA 3KLGA 4OLPA 2D4OA 1CJWA 4KGMA 3PX4A 2YPZA 1QUPA 1P1TA 3Q86A 2BSWA 4M5DB 3EGVA 1RWXB 1S76D 3FX6A 4L3KA 2IDLA 5D4OA 1A0OB 2VFSA 3B4MA 4KGZB 4R8UA 5AG7A 4OZ2A 3OVSA 4UTGA 1CC7A 2XY7A 2CQIA 3GJSB 2PMZD 1S97A 1XIQA 3OTDA 2V69A 3DMJB 3FBBA 4F0KA 1CJKA 2DK2A 5A76A 2BKNA 4RW4A 2BUNA 1JNRB 4QIFA 4I4BA 3FFIB 3DOMA 4DUKA 1JLEB 3X3UA 2XYGB 2ZM6F 1WI8A 1RWNB 3E51A 4I68A 5HMWA 3WBZA 1RBAA 4PG7A 3C6UB 4YQWA 3RB0A 3V6HA 1FE4A 4DZ6A 2PA3A 2WSEC 2GREA 5LSLA 2F9DA 4YHHJ 3QIPB 1B4SA 1IJFB 1RT5B 3IEHA 4N47A 5D3GB 1BPNA 2X7BA 2PO4A 2PIZA 2XSJB 4LF4F 2DVIA 2DH7A 3HX9A 4GKKF 3H5ZA 4F04B 3DSBA 1OJ4A 5JPHA 1FE0A 4FXWA 1ELMP 4ICLA 1NAQA 1SJRA 4FS2A 4P4FA 4TYBA 1RWKB 2JNJA 1ZS6A 5IB0A 2XHWA 1X10A 4C7HA 3GFXA 2W25A 2Q6CA 1VR6A 4B9NA 3QAUA 5IS2A 5L9NA 3Q83A 5E0OA 3BSCA 2DT9A 4C11B 2ZPAA 4B3MJ 3OHBA 3SQGB 3KLFB 5L9XA 1LWEA 3ZZZA 3C15A 2K3KA 2MKCA 5KFDA 3WX8A 3RZAA 1S0MA 2HVDA 3ETMA 5E41A 4DMZA 1CJTB 3D7DA 1VHFA 2DPTA 4WYLA 2FIAA 1H98A 3TFYA 3CDEA 3LAMA 3GV5B 1Y3KA 4AL7A 1NRKA 1N71A 4FF1A 5F9LA 1QAIA 5SUHA 4JI7F 4MK7A 2DNNA 4R9MA 4ES3A 3US5A 2H54B 4Y6IA 3CZXA 2DNOA 3LQVA 3ZNUA 3QT6A 4MY0A 3AAWB 2CA9A 1C1CA 1RTIB 4R8UB 4MJKA 4LIWA 1C4AA 3BN7A 4F9UA 2IHR1 1S4EA 4NLWA 2ZH1A 3AB4B 4H2KA 3LUYA 4GVBA 1RT4A 3LF0A 3JVNA 3MURP 1WDDA 4DG1A 1CJKB 3LANA 4RW4B 3LWUA 2HUZA 3UFCX 2YWWA 1X4BA 3DOMB 2YVSA 4CLLA 2VG5B 1VS3A 3EXYA 4CLPA 5KT2A 1SIZA 2OSRA 2OMOA 3ZFVA 5J1EA 5FDLB 3UW1A 1HWLA 4WKYA 2MQOA 3GKRA 4ZPCA 3W1YC 6FD1A 4K5RA 5A28A 4E0DA 2VFRA 3ZTPA 3P5BP 1S1XA 1M1KT 2DIVA 5A8WA 5KFKA 2ANPA 3M2VB 2HBQB 4C0OC 4ZPTR 3MD1A 3MAQA 4G1QA 4NASA 2OPRA 2RILA 3CIMA 1KONA 5DDQC 1RHMB 4UY85 2ZW4A 2VOOA 1AT1B 2NYIA 2GIVA 1V3ZA 1NH7A 4L6V3 1VOMA 3WIVA 4E0AA 1ZLHA 7AT1B 2DRBA 1VQ4S 2KT5A 3VGUA 2Z10A 3JXOA 1F3VA 4C98A 2VG7A 4ICLB 3F0AA 4ZITA 3KLIA 4EWTA 1WG5A 4WZMA 1G7CB 1WKJA 2VC0A 2AWZA 2ZH3A 2HHXA 1HHTP 2WRMA 2C2KB 1UMJA 3DRSA 4TWEA 1IBKJ 1ZETA 4LF7J 2LEAA 4JI2F 2FLOA 5L46A 4KH1B 1PJ5A 3OBIA 1I5OB 2VU5A 1NEEA 3CCSS 4UT4A 1UEUA 1R8PA 4CZCA 2UVUA 5EMIA 2PJ3A 1SJ3P 3EYZA 5KTDA 4K2XA 1YW4A 2OSQA 3H5UA 3HXMA 4K4YA 1WC0A 3MGJA 2PEHA 1LWEB 4ZP9A 5IV3A 5D77A 5MLCV 2QL5B 2VASA 3AXKA 1VISA 4P75A 1TKDA 2DNQA 2VDIA 2VBYA 1WSRA 2GX8A 2ROPA 1NDCA 4RX6A 2H65B 1HPZA 1EX8A 1HBOA 3LP0A 3L95X 2FVRA 2Z2MA 2RUGA 3I31A 4L75A 4MKVA 3SSRA 2RQMA 2HVEA 5AXNA 3VWDA 1QLNA 2V9WA 4R8FA 4OHXA 2XGPA 5KFEA 4HDGA 2IIHA 2AE6A 1Z1ZA 4MHYA 1AUSL 2KM8C 4KR0B 3FCWA 1C1CB 1EB0A 4Y2IA 2QYCA 3NGUA 3TAMA 2HFNA 5BYQA 2FUG9 3P4UB 4ECSA 5F46A 3OWCA 3PRTA 4DX5A 3M9OB 4GVBB 3P2FA 1BO4A 1RT4B 2HB6A 4DG1B 1WC1A 2MY8A 3IMQJ 4A8QA 2FZKB 3PM9A 3OUYA 1CX8A 3IBFB 4Y00A 1T03A 2EEYA 4NZ6A 1GXLA 4RS2A 3BREA 5J1EB 1HNXJ 1IR0A 2V8GA 2HIQA 3ZZPA 1AW0A 4WK1A 4M5JA 2U1AA 5A8WB 4QOTA 4NA3A 4NXMJ 3H7HB 4G1QB 2BZ2A 2VB6A 2OPRB 2RNEA 4C4WA 2R7QA 4AL5A 2XMMA 3EE3A 4IHMA 5EWFA 4IG3A 2E5HA 1PBAA 5CBMA 2NS1B 5A8RA 1IQZA 4ALZA 2OD6A 1RU2A 3JQJA 2KVIA 1HBNA 4F4WA 3GWCA 3T9ZA 4A95A 2G0CA 3EGNA 3KLIB 3PCOB 3D7SB 3ADAC 4AYBD 2AJ0A 3IBCB 4RJVA 2MSSA 4DHVA 3PYDA 5JQ4A 4OHZA 3G8SA 3DRSB 5DO2A 1HIYA 1N32J 5DWNA 1IN0A 3T3FA 1WOPA 5F8HA 1N88A 4ZVOB 4WFNQ 3UPFA 3SSQA 3OVAA 4LBIA 2FXFA 2FDNA 3KXDA 3I5BA 3N0VA 3UN3A 1MWQA 1IKYA 4CRJA 3AODA 3TW0A 1MMDA 1OWXA 2HNDA 2BKOA 2EI5A 3QO9A 1VIOA 3BKUA 1RACB 2AD9A 3M8QA 5T14A 1RLDA 3ILOA 1UFLA 3VAFA 5F0UA 1IB1E 1FT7A 3MCSA 2YWKA 3DLEA 1M0SA 1SQFA 2X1AA 3IBWA 3NMRA 1VQYA 4GO5X 3LACA 2LLZA 3HT3A 1HPZB 2LP4A 4J9LA 4OYIA 1HBOB 3LP0B 2Z3KA 1U25A 2YX1A 2YNGA 4WK3A 4JV1A 4FVCA 3J7ZT 3CE8A 1VBKA 2CAJA 5AG6A 4PWUA 2KH9A 5D6GA 3M4XA 4KBIA 4ECVA 1ROFA 1HW9A 3M8PA 3FCVA 1IR2A 4R25A 2KO1A 3OTEA 2Z2ZA 2RRAA 1QSNA 2ZC3A 3WX4A 4KTQA 2M70A 2ZBCA 5LRJA 3TAMB 1YGHA 4F67A 5T7LA 3D0GE 4A38A 1FF2A 4RLEA 3CPXA 4QWDA 3GFHA 4RKUC 4IR1A 3GV8B 4ZPDA 3OUYB 1T03B 2GE3A 4F6AA 3DOLA 2WYRA 1ACMB 3SXOA 3CJKA 3O5TB 1CJUA 2BEIA 3GIUA 4CGLA 2GMJA 3FEDA 2CXEA 2OKQA 1UEVA 2ZDOA 3UDCA 4P52A 1LK5A 3TX0A 1O6XA 2G9OA 3U1NA 1WWZA 3N7ZA 2AX0A 3BR9A 4XIUA 3VVUA 2M2BA 3CVKA 4IG3B 4LBHA 3C14A 2RVJA 2HKEA 1U6FA 3SSSA 4EU0A 5A8RB 2O1PA 1XR6A 5A0YA 2EK6A 3BN4A 1GXTA 2H5JB 3BV8A 1HBNB 3VTIA 2XNQA 2A10A 4MCSA 2RQKA 5IXUA 1K4JA 1X31C 4ITSA 3UCUP 1HBMA 4FBUA 1CP7A 5CYQA 3DNCA 1J5OA 2ZVSA 3CUNA 4Q5VA 3FDSA 3PHEA 3G4SS 4A8FA 3UCGA 1Z8XA 4CLWA 1XWLA 2JEVA 3DN9A 3W9IA 2WK4A 2OO4A 4LJMA 1KD1T 2HNDB 3QO9B 4HDHA 2NUUG 3WC5A 1JB0C 3M8QB 2OH1A 1PCAA 4KE5A 4H4OA 2W2QP 4ZN3A 1U26A 2MQ8A 2F65A 3FC9A 4P2SA 2DHSA 2QC3A 3DLEB 2GHWA 3EVMA 3QT5A 3J81Y 2O4HA 2NXUA 4PYDA 3SXLA 4FWUA 4HLBA 2PVWA 2MTLA 2B9YA 3OR2A 2C3MA 2YNGB 3TARA 2DNLA 4DPUA 1HNIA 3M8PB 3BDEA 3VVTA 4A2ZA 5CZVA 2MKIA 3OFFA 3PZJA 5KFNA 1OZPA 3KASA 5F8LA 1YRUA 2DGOA 3SI0A 3P6YC 5J1NA 1BE4A 2LU1A 4LVNP 2W7AA 3RB4A 3GILA 3VATA 4Y2KA 3D4JA 4F26A 4B08A 2ILYA 1RWWB 2LQ5A 5T7LB 3NNCA 5IX3A 2DNPA 4OJ3A 4V19X 1SVDA 3IWEA 9RUBA 4YR2A 5B09A 4M1KA 5AE3A 1ARMA 2W24A 2O5DA 3JQKA 1U09A 3DOLB 3D3SA 2VONA 3CJKB 1CJUB 3U1LA 2H4WB 2XMJA 1FRJA 1RXTA 1TK8A 1KBRA 4HKQA 4I67A 4YB5A 3DC2A 4RW6A 3GZ7A 2GAHC 1OBRA 5HMNA 4DR4F 1OYDA 4ZCKA 1XMQF 1VQMS 3BSOA 4PG8A 4GKJJ 1TL3A 3C8YA 2A2DA 3OSNA 1RWPB 4RUCA 4J9VA 1RYRA 3OPKA 1EE3P 2BM1A 2BRLA 1R6VA 1Y3JA 3NMAA 1U7LA 1SKUB 5A0YB 3CXCR 1SCJB 3OT9A 5DG8A 2G3AA 2HZCA 2NSCA 3G6ES 1HNWF 2IJRA 2HRYA 3HSZA 4QWEA 1MROA 1CJVA 1AZSA 2G3TA 2AT1B 2EFNA 1M4GA 4QBUA 1HBMB 1RI7A 1WC6A 4QIGA 5CYQB 4AUKA 2HGNA 1J5OB 1SBRA 1T7PA 1BPMA 2QT7A 3T5LA 1HL6A 1RU1A 1QY7A 1LWCB 1PIEA 1UFWA 3PBEA 3SV4A 3FF3A 2MXYA 4HPSA 4CYOA 3QWPA 5DDPC 3C6TA 1HNVA 2QV6A 5GAGU 4FS1A 2VPZB 4ZIVA 2L48A 1KLMB 4ID5A 3BQ2A 1Q8BA 4H4OB 4OKOA 4CRZB 2PJ0A 2FVCA 2ZEMA 4ED8A 2KFNA 5CABA 2VQEF 3HKWA 3SEOA 4NJQA 3FSXA 4CP5A 3KQXA 5IWAF 3V6DA 4B3RJ 3TUIC 3GUXA 3C66A 2HQYA 3OXGA 3TANA 4KOYA 4DFKA 4WTYA 4FAIA 3OR2B 2AJ6A 1RTDA 2HBRB 2L3MA 3ZTOA 1RT3A 5LMNJ 1WG1A 1UA1A 2QRRA 1VLYA 4E98A 4IRKA 5AXMA 1ON0A 2PJ1A 1T94A 2FY8A 2O3DA 1TUVA 2EPIA 4QWCA 1ZM9A 1FEEA 4LFCF 3K59A 3EZOA 2GHPA 4X4QA 3OXLA 3GIKA 4ZY1A 2OEJA 3NS7B 4QPTA 4OI3A 3JTPA 4X4SA 2BMBA 5IT0A 4RPFA 3C3LA 2XO6A 2C1EB 1IYKA 2WSFC 3PO5A 5KFZA 2XC9A 4MKBA 2KZMA 5HVHA 1S7HA 1IYLA 2PRBA 2CNSA 4KQZA 4OYWA 3FBEA 2MHNA 2BJ9A 1UZHA 4RNHA 1RDRA 2PSZA 1U1QA 3H42A 5BXIA 2WZ1A 2OIHA 1U6ZA 4DQRA 5D4NA 1MSWD 2PFDA 2VKRA 3CGIA 5HROB 4RW6B 2PCUA 3BGRB 2ADCA 3PR5B 2V5HG 1TL3B 2AX1A 3GPAA 2B7BB 3Q23A 4Q0BA 1FEHA 3JTOA 2W4PA 1YQEA 2FLPA 1IGBA 4USJC 3ET6A 3FXTA 1GMVA 2FGCA 3MZIA 4M3SA 3THTA 2FLLA 4CT8A 2DH9A 1UW4A 2RRNA 2C2MB 2QA2A 3TX8A 5JMNA 4OAEA 2ASYA 1AFIA 2OPSA 2E1RA 4L72B 1MROB 1CJVB 3P3DA 1AZSB 3VV2B 4PXCA 1WDTA 2YWHA 2DEJA 1R89A 4MXUA 4TXSA 2A2CA 2AFZA 3QZ8A 2CTCA 4O4GA 2XHCA 3HSJA 3I1UA 2PR8A 3C6TB 4Q43A 1BY9A 2Z3MA 1DHMA 3W9JA 3ZZYA 2I79A 1JJ2R 1HNVB 2UXBJ 4ID5B 2AGOA 4YS2A 2Z3OA 5ISVA 3V8IA 3ZZUA 4MK8A 3FSYA 4J3GA 3KKWA 1P0HA 2PJCA 1IM6A 8RUCA 2LCWA 3TO6A 1VHSA 3U02A 1XN9A 2PD1A 4K0KF 3DXSX 3JAMU 3V6DB 3B8GA 1BWVA 3CJTA 1R27B 4NYZA 2KM8B 1VC5A 1RT2B 1FJ7A 1N54B 1RTDB 1X9WA 2XEIA 1RT3B 4DCPB 4CGMA 2VBWA 2V4RA 2BANA 1X5OA 1SUQA 4FVMA 1T3NA 2WBMA 3IGNA 4RW7A 3A13A 1H7XA 4LQ6A 2DHGA 5E3AA 4HI1A 3JSYA 1BQMA 7FDRA 2Q4YA 4DV1J 1Y0RA 2HHSA 2DR6A 4JI8F 4OMFG 4B3SJ 3D67A 5E3QA 1VBYA 5E3CA 2HLUA 2PA8D 2PR1A 1XJWB 3GFYA 3PJXA 1XIXA 2E5JA 3GYGA 3E3XA 4YB7A 2R98A 3MR5A 4Y28C 5DETA 3KHRA 5G21A 1H72C 2J9DE 1YW6A 1ZLIA 2XO7A 2ZH2A 4EFAC 5LJ3Y 1N8RT 2ALZA 2E7VA 4RNNA 3OV7A 2EBGA 1LXJA 3R5JB 1UVKA 2UXCF 3SJEA 1UJ5A 2ZITA 4IOAQ 1S77D 2XG8A 2NCKL 4OIXA 1RT6A 4Q0BB 2EXUA 4DSJA 1N48A 4LF5F 4JI3J 3Q8YA 1N36F 4QYRA 3E0KA 3ET6B 4JI4F 3VGTA 3AOBA 4LF8J 2M8HA 2E5LJ 3PGPA 5LRGA 4OHWA 3VHQA 4F0XA 5F8NA 2AJFE 3J81U 1HDQA 1X4EA 1B6BA 4R57A 2OPSB 4DI6A 4D3GA 3SDEA 1KR4A 4NLQA 3TO7A 3M32A 2UV8A 4GO7X 1N5YA 2G9DA 5HP1A 3MMAA 4ED5A 4KYZA 1S72S 4GMKA 4R87A 1HR0J 2JEIA 2UUAJ 4TNUA 2CQHA 1LFPA 2IJNA 2CY2A 4H6UA 2ZBQA 3NH5A 4KSAA 4O4GB 2R7OA 1D8ZA 3NNAA 3KDNA 2VV5A 1APSA 5KFYA 3Q22A 1K8AT 3KOAA 3MM9A 2L41A 2J9DA 3Q8UA 4PG6A 3JS9A 1X4DA 1FRXA 1VDHA 3KYLA 5ETOA 2VQYA 3NG8A 1YSJA 3IGRA 1F9EB 5ETVA 4DR3J 1UL3A 2DNRA 2C3YA 4RW9A 4B3OA 1U48A 4M5IA 5I3UB 2IYGA 4ERDA 1WC3A 3DLKA 2PI4A 3W3SA 3AHPA 4GRSA 4HR2A 2J8RA 3LALA 4V1Ak 5JH9A 4RUBA 1IOFA 1RHUB 5DM7Q 2BANB 1EHWA 5BR8F 2ZFHA 5IT4A 1SUQB 4QYZK 1Y10A 2DHXA 4RW7B 1NZ8A 3HM9A 5AG5A 2CDQA 1YJ7A 3HSGA 4YWYA 1NHUA 2D3O1 3I9SA 1BQMB 3FIXA 3D9BA 4X2TA 2FC8A 4YEAA 4DN0A 2ABZA 5JVGQ 1DE4C 3BB5A 3EGZA 3CD0A 2VI7A 4ECQA 3CJSA 4ZX8A 2W8LA 4RWXA 1F60B 2IC3A 2HS4A 2RDJA 3IG1B 2FIWA 1FRIA 4X4NA 4LRCA 3B7IA 1NK6A 4LR7A 5J2QA 5K8PA 2HQ3A 2ZH8A 2HRTA 3BPSP 1IBLJ 2B6AA 3W91A 1DBDA 1IBCB 3J7AN 2HRUA 4P4JA 2EG1A 2Q43A 4H54A 4MIAA 2BQRA 4MTPA 1KHVA 4MKAA 2P6TA 1TK0A 4P10A 1NJIT 4UBRA 3BGOP 3TI0A 3BS9A 3B3TA 1R3NA 3VAMA 4YB1P 3BZQA 4GS4A 5IC6B 1RT6B 3A8KA 4UFXA 4NYPA 4DR5F 5DLGA 2NYHA 3HFZB 3N5BA 5E3PA 1IOIA 3ZZRA 2CJXB 4NGPA 4NYOA 4MHDA 2XQCA 1J5EJ 2R3VA 5F49A 3TO9A 2CWKA 1ZOTA 2EFOA 5CA5A 2HK3A 4TQRA 3SDEB 4DR2J 2VKZG 3M32B 2C22A 2QLWA 5F8IA 1RHJB 3TAQA 1N5YB 3IIBA 4O23A 5HP1B 3MMAB 4DL0C 1S3ZA 1CPSA 4WZQA 1RB0A 1H74A 3TA1A 2CJBA 3B82A 2RKIA 2MKJA 2K5TA 3I96A 3ZNJ1 3NS6A 4ZYQA 1YBAA 4NLDA 4P4EA 5DDOC 2I0XA 4KRWA 2JSXA 4G1IA 4IK2A 4NJRA 2Q79A 3UWTA 4J9OA 1TVRA 5I0CA 4U8VA 4LF6J 3MM9B 4NI2A 1N52B 1DTTA 3WR7A 2EW9A 2N3LA 4ZBGA 4OL8A 2DY9A 3NL0A 2YH0A 2HFOA 3BR8A 3T1HF 3HD2A 2W7PA 2PN6A 2AW0A 4RUAA 4B9VA 2ZEHA 3TOAA 4RW9B 4B3OB 2ZW7A 3R6GB 1YJWS 3DLKB 2HGLA 4LUBA 2UU9J 2XLIA 2Z2YB 1UWBA 2MHEA 4ZKAA 4JWPA 1O51A 3Q8SB 2WW4A 2CQPA 1IU8A 4D3HA 1HARA 3CJ5A 2JDCA 2MLXA 3ZO7A 1LK7A 4LR8A 2OEKA 2A6OA 1U8WA 2AYEA 4W98A 1IKWA 2J9EA 3CDAA 4CDIA 2EG2A 4AVAA 3B3CA 2APOA 2OELA 2HMIA 2UP1A 2AF6A 4DSIA 4RW8A 2IC3B 4MFBA 4DV5J 1P27B 3BBCA 5J2QB 1F5CA 3MI7X 2ZUGA 1WHWA 2B6AB 2MQQA 2KFZA 3ZZOA 1D1UA 1HQEA 4K4UA 4EYHB 2MQMA 1V5IB 3D1HA 3AY0A 3OLAA 1NB7A 2VQFJ 3CXQA 2VA3A 5T41A 2SXLA 4UWIA 4OYZA 1T9TA 4F4YA 1Z8WA 4F3QA 1R8HA 4DUZF 2B9XA 1REGX 1WEZA 1VQSA 4WFBQ 3F44A 2C6PA 3HULA 4L3NA 1JXLA 2VUGA 4OV6A 4E8UA 1QMUA 4ZLJA 2HK2A 4MY3A 2V6AA 1KHWA 4KVXA 3GQCA 5KAKA 1UTAA 5HQ8A 2AJ1A 3OL6A 3OQ2A 4ER8A 1TKTB 3JB9k 1JLQA 1I3OB 2VJVA 2XWXA 4FP9A 1XBUA 2RKIB 1R0AA 4DR1J 2JEJA 4J91A 1Y5NB 2ZVIA 1RO5A 2ZKUA 2F7VA 4PWDB 4ZP7A 5U47A 5J2NA 4ZPWR 5CAAA 1M4LA 4DV0F 1TVRB 5KFHA 4ETXA 5ITHA 4NI2B 3CWJA 1DTTB 1JLAA 1LOKA 3UDEA 4CGOA 4OX9J 1R7IA 3KUEA 4F4AA 1Y5IB 1RAFB 2OZGA 2KHDA 1TMJA 5DS0A 4AFFA 1Z4EA 3S01A 1M90T 2P8IA 1PYOB 3NWRA 4KORA 4DJBA 3FCHA 1WI6A 5K20B 2CNTA 4KGVB 1FJEB 1GYTA 3GJRB 2DISA 1UWBB 2WSAA 4KSFA 1F9HA 4XO0A 4MRIA 1KC8T 1HDUA 2OHDA 3OHAA 2GQQA 4N41A 1RKIA 1KQKA 4JI1F 2FC9A 1VQPS 3ISNC 2JRSA 5ETNA 3BPDA 1Q79A 3BGUA 1YMEA 2YNCC 1IKWB 2HQIA 2EKYA 3TEGA 5ADZA 1IWAA 3IS9A 3S6EA 2DR8A 1S48A 4DUYJ 2OPQA 5DS7A 2HMIB 3OFGA 4RW8B 4YU9A 2NZCA 3IP0A 2P6SA 3QZ7A 4JXRA 4CNZA 4F2SA 2X51A 2RQCA 4BWJA 4MFBB 4DR6F 2BJEA 1RHQB 3VGVA 4KHMA 2ZDPA 1HQEB 3D2WA 3M7VA 3SJFA 3H20A 4X8IA 5IZHA 4J9PA 4PG4A 4X4PA 1Q53A 3FMBA 2NXEA 4C6AA 1ZPVA 2CNNB 6FDRA 1NJXA 1F2OA 4ECYA 1NU4A 5J1QA 1B7FA 3W2WA 1VK8A 4O3OA 2RF2A 1C4CA 4EK2A 3VF0B 4Y2AA 4NLTA 2EWBA 2CYYA 3A1YG 3GFZA 4F7VA 2GS8A 4ED2A 1Q5VA 3H59A 3GJQB 4NLRA 3G9CA 2V4JA 2J8NA 2FGOA 2B3TB 1NXIA 4B14A 3UR3C 5HBMA 4YP3A 2DCLA 1FO1A 5AXKA 4EGLA 2HV2A 2ATRA 1NDPA 4KOWA 1KTVA 4OADA 5F0WA 3H25A 2UUCJ 1BD6A 1WOSA 1JLQB 4UUXA 1R0AB 2VDHA 1T9VA 4CO3A 4QYZJ 5GMKa 1H73A 3RBDA 4OQJA 4NLUA 5J2NB 2K1RA 4Y49B 2GNKA 1T3OA 1B0VA 3R97A 1UVIA 3JSRA 3MM6A 4B02A 3SCLE 4O3QA 1SB6A 3KHZA 3PR4A 1JLAB 1KS2A 2KCWA 3BLNA 4DV4F 5G4DA 3IWWA 3V81A 1N5VA 1LXNA 1WKKA 3JSBA 2ACMA 2DGUA 3J7A1 4N76A 4PRFA 4J9KA 5G22A 4I0WA 5EX3A 5KFIA 2JHEA 5LSRA 3E8OA 1YX2A 3BH7B 1SXLA 1SJ1A 2PI5A 4X62F 4IO9Q 1GX6A 1XEBA 4NSQA 4K4VA 1K0TA 5HL7Q 3KHXA 3L7UA 2NXCA 4Q8EA 1FTCA 1MWZA 3QJLA 3CMQA 1SH2A 4ZVPB 2IVFB 3MTJA 2VHGA 4HT5A 4J9QA 4ZVRB 2YWFA 3B2YA 1D09B 4WIQA 2AFMA 4YB6A 4OFZA 3IS9B 2WUUA 2P9GA 4MCRA 3MN8A 3DRXA 3D68A 2OPQB 2YY3A 4GC7A 2BRKA 2MY7A 4DF8A 1FERA 1HMVA 4BINA 3CC7S 3EJMA 2HBYB 2B9WA 2XLKA 2BBEA 5ETKA 3TO8A 3GIJA 1MJBA 3AD7C 3PIPQ 3TJ8A 4LF9J 3VQSA 2CPFA 2PVVA 5AJ3J 5HJXA 2D3UA 2MPUA 5J1PA 3IWGA 5KFSA 4CLZA 1S10A 2BJ1A 1RWUA 4G1PA 3W2WB 1JXVA 2C3PA 4ETZA 1SQGA 4ZCIA 4X3RA 3I9V9 4WBFA 5CNPA 2HAIA 2ERRA 3T6BA 2V4JB 1CSJA 5GAHU 5HBMB 4NRTA 3VCDA 1U8SA 3M6XA 1NJWA 2DO0A 1JJCB 2XS5A 4BBYA 3FJ2A 1FKPA 3LWMA 3UDLA 4CLSA 2MB0B 2XCPA 4M5KA 1DTDA 5EGYA 2QLBB 4XPCA 2AQ4A 1QUVA 3AOAA 3M2RA 1TV6A 5KFQA 3QPIA 1NHKL 5EHHA 5CXTA 9ATCB 2K1RB 4K4WA 4MKYA 4EZ6A 3CC2S 3MM6B 2XMTA 4ZI6A 4OMEA 1Y9OA 3DRPA 3AOCA 3CCES 1YZ6A 3QMQA 2CJAA 1PU9A 4NLXA 3V81B 1XMOF 2HC9A 2XSFA 2NSMA 3CCJS 3T9YA 4NGMA 1ULRA 2DHAA 1NPRA 2CQDA 4UCNA 1UP1A 3UO0A 4MI4A 2UUBJ 4BCAA 4P6QA 1HNZJ 1HWKA 2OD4A 1GFWB 5C2GA 4AB7A 2XY5A 3TQ1A 2I5JA 2MGZA 4B3TF 2QA1A 2QJ3A 1I94F 2Y1RI 1F6TA 5IC4B 1QSTA 1S7IA 3FH4A 1YG0A 2DTJA 5M2RA 3CCRS 4P6YA 3CULA 3T8WA 3R5BA 3EXNA 1LEOA 2IM1A 4QQBA 5JUMA 3TEHB 1SKRA 3IWLA 2M7SA 1X4GA 2R7UA 5K9FA 4LF1A 3A8JA 3AJ1A 2FHJD 2L9DA 2VBQA 4OI6A 1IY7A 4JXQA 4MFLA 4DU8A 3OW2R 2AFWA 3FNNA 2FHKA 5EDWA 2HYIB 1HMVB 1Y4ZB 1LWFA 3BYRA 4QZVB 4PSWA 3DDKA 5ETTA 5F41A 2AMCB 1R57A 2G1HA 2ILZA 2Z30B 3HI9A 2MMYA 4JB8B 4USTA 1M5SA 4C48A 3F41A 4Z65A 4UOGA 3D7FA 3TNVA 5ETMA 4LFBF 1FESA 3D4UA 4UIAA 2YNEA 3ITHA 1L5UA 4NMXA 3UD4P 4PK3A 3GYNA 1VI7A 4LMZA 3E01A 3PYGA 4RBTA 2XS2A 2R8IA 2Z3PA 1KQGB 3KJNB 4JI5J 5KFXA 2R2UA 4DV2J 2BXJA 1M1GA 2B4OA 3BGLA 2HNYA 3N6MA 1VQ5S 2LMIA 2PJAA 2DJWA 4ZLPA 4CLYA 5M2PA 4J9NA 1KFSA 8AT1B 1VBXA 4FYYB 1NHVA 1KVIA 3ILIA 1S7LA 4C8NA 1FKPB 1DRZA 2I3CA 2B4BA 2ABYA 1JLCA 5CH7B 3AFGA 5KFFA 3M2RB 1WEYA 1TV6B 5H9FJ 4R3LA 4X4OA 3D6MB 3EX7B 1S6QA 2XM3A 4F2RA 2Q4ZA 1U1LA 3DRPB 4OC0A 1PKUA 4MJ8A 4ANDA 4M63A 1H7WA 2GVDB 1RTHA 1BXNA 4DL3A 4BHQA 1WC5A 1ZM3A 4LUAA 2EWHA 2F8MA 4WP9A 1YLXA 1BOBA 1YR0A 2MYFA 1RT1A 3AB2B 3M2UA 5M2UA 2YNCA 2I5JB 4C68A 2MGZB 2BA9A 3PHTA 1AXQA 3LAKA 1KWMA 2CJ9A 3R7BB 4TQSA 1F2GA 1SI9A 4ONUA 3NH8A 1RKJA 3IR5B 4YMEA 1RCOB 4NGQA 2DITA 3CMES 3EY5A 2R2TA 1X9SA 3PTWA 1RWMB 2RJZA 2DCUB 4FPRA 2MZQA 4DV7J 1REVA 4TY9A 2RU9A 1ARLA 3CCVS 1TAUA 2DH8A 2DPSA 3KG0A 2V0NA 1DFDA 3T1YF 3QRRA 4J9MA 1LWFB 1NNDA 1NCLA 1U1MA 4H4KC 2AP6A 3ZTQA 2Y1LB 2BUEA 3QJPA 3QATA 2RC4A 1RBLA 4YY3J 5KFJA 1KLNA 4PKDB 2K8GA 2KRBA 5IV0A 4WIIA 3ISZA 3PBBA 1QSMA 2VBZA 1YTYA 3DR6A 3PG9A 2JC0A 2X1BA 3ZXWA 2C2EA 1GMWD 3ITHB 1KUXA 1K9MT 1O5JA 3R27A 2LVWA 1FK9A 3MRUA 2R7HA 2JLEA 3E01B 3NCQA 4EYIB 1TR0A 1X5TA 1LW2B 2B56A 1OYEA 1NSPA 4OIDA 4JUZA 5EWEA 4PG5A 5D0HA 3I32A 2HNYB 1WF2A 4NXNJ 1BQNA 2Q7SA 2B3UA 4ES1A 5DQIA 3TCVA 3H2VE 3DHXA 2GMHA 2NSBA 5EN1A 2DEAA 3MCOA 2HLTA 1Q8KA 3S6HA 3SJXA 2XZTB 1FXRA 1RBOB 1Z8LA 3RBUA 3BJ8A 3G82A 4LF2A 5KFRA 4U95A 3GIIA 4HEA9 2FJXA 1M5HA 3H4QA 1BMQB 5AE1A 2R7RA 1S6QB 1YRXA 3T9NA 3NKYA 3DI6A 4LBPA 3MM8A 1DQAA 1PC5A 1TIQA 3H4BA 5IQ6A 3DRRA 4JYAJ 4LRAA 1RCXB 4AE5A 3S8SA 1RTHB 4KO0A 2J6TA 2VH7A 1NK0A 2C2OB 2MKKA 5A27A 5DM6Q 3PYEA 1DQ9A 4ZJLA 3MCMA 2AYBA 2QJ8A 3HHLD 1DTQA 1RT1B 3MUMP 1N4LA 2HHHF 3FBCA 3M2UB 3H90A 2ZEGA 3ULHA 5IT9Y 2IDEA 2P6FA 1N33F 4ZVFA 4UEZA 4KFBA 4X4TA 2FHOB 5K5MA 4MBUA 1B87A 5DGAA 2REFA 2AZ3A 4BDPA 3SJGA 2J5AA 5CD4H 3IC1A 5HO4A 2WTFA 3WC7A 4CCHA 1WK4A 1REVB 2MZ1A 1K73T 2O28A 3TUJC 5THWA 2R42A 2ZNZA 3TVZA 1RHKB 4JI6F 5HLFA 2FTRA 4NZ7A 2A6MA 3QIPA 4LRFA 1YX0A 4DPOA 1IQTA 3FVYA 2CDRB 3TZWA 2XSJA 1YLEA 3IU1A 3M9NB 2UXDF 1XNQF 2E44A 2ZHOA 4M5HA 1JKHA 4OZ1A 4ZS6A 1CP6A 3CB4A 1S6OA 1ZAXA 4A8WA 2LXFA 2FY1A 3I56S 1VGYA 1FJGJ 1TKJA 1KVJA 2CQ4A 4HACA 1X60A 2Z2LA 4KPYA 5IOLA 3MTKA 3VALA 2LFVA 3B8HA 4LREA 1CC8A 2Q51A 1NUEA 3GIMA 3LGNA 1ZTWA 3QNVA 2NLWA 1R31A 3NH4A 1F5AA 3B3WA 3BJYA 2GGPB 4KVOE 1OY9A 3D2PA 1TELA 2HHUA 2OP5A 3KLEB 2PJBA 1CBXA 1S5KA 4TNOA 3TR5A 1KSPA 4C11A 3M9MB 4CNYA 1BQNB 4DF4A 3K5PA 4KZTA 1I21A 2ZEPA 2VEZA 1U1NA 4AT1B 3I5CA 4I6AA 1HI1A 3FZBA 3NBPA 4OX6A 4PK2A 2MKHA 1L3UA 1P4NA 4K2JA 2BYCA 3G82B 3LGMA 3AA8A 2CUYA 3SHPA 3IAM9 2BQUA 2DEIA 1JNZB 3K7RA 2RS8A 3DI6B 3TVKA 5HMYA 3I0RA 3MF5A 2JLFA 3BH6B 4EMDA 3MM8B 3R7SB 5D0RA 2YX4A 4A30A 4KHPF 1N0UA 3DRRB 3LO3A 1BQXA 1EQMA 2V8PA 3IXQA 3A8IA 2PSWA 2HG4A 2LYVA 4NLVA 4KO0B 4DX7A 2L9NA 2N82B 2RE1A 5DG9A 1RTIA 1FXLA 4UCMA 4X65F 1DTQB 1MK4A 1VQ7S 4B5PA 4CYNA 3VAJA 2XMVA 4L89A 4IH7A 3W7BA 2DGVA 3FKBA 3T5JA 4N8NA 3HHLC 5CCMA 1QSSA 5G20A 2ZM6J 4KFBB 4DR7F 5F3ZA 3S6FA 1TFWA 3ETOA 3TWZA 4O3SA 2H5MA 2VG5A 4N56A 4Z7YA 3JQMA 4PXBA 4P72A 5FDLA 3H8EA 5B0DA 1EQ0A 4LRDA 4X4VA 3M6WA 2CF4A 4CLUA 4R7MA 1HD1A 1WWHA 3EUNA 4EUVA 3LWLA 4U9ZA 2B51A 5HLFB 2WB4A 3M2VA 4X64F 4LF4J 1JLFA 3A3OB 2ATLA 2Z58B 1NSLA 4GKKJ 3E2EA 4Z37A 5LJ5Y 3DDDA 1JKHB 3G2XA 5DZ6A 4NEYA 3F73A 1YDLA 2JVOA 3SIPB 1U2RA 2LQJA 1IBMF 4WJBA 4NZ0A 2N7CA 2DPJA 3AT1B 4FNHA 4HACB 1GMUA 2QA4S 2G0IA 2DBBA 1JQGA 1QAJA 4DCOB 3GR1A 1RAHB 3IWXA 4TN2A 1H38A 2RUSA 4YGOA 4ZJOA 1RABB 3RAMA 3W65A 2FT0A 2CVEA 1F5BA 3AD8C 4KT0C 1G4CA 5A6PA 5KT3A 2QMLA 4F25A 2B43A 1XRYA 4PQAA 1U4BA 4DX6A 1GHEA 4C8OA 5E96A 4IOBA 4KUBA 5E3RA 3HHKA 2LEPA 4HTIA 4RL1A 4ZY0A 4I1TA 4ZIWA 4XK8C 1KNZA 5LSOA 3VWSA 3NBPB 2IQ6A 2Z0ZA 2PC1A 1M5KC 4ECZA 3PW7A 1Q82T 3NNHA 3D28A 2OPPA 1FKAF 4P74A 1YK9A 1I1DA 4HI2A 4ELTA 1RTQA 2ZHAA 3K8WA 3ZZTA 1XOVA 1SH0A 3X1LB 3UCZP 3KJVA 4OYXA 4N8OA 1UVLA 4N5SA 2BDPA 4JI7J 3I0RB 2GLJA 4C3MA 6AT1B 3D0HE 3S9LA 1XC9A 5LMUF 4X66F 3W6XA 1PAUB 3MM7A 3P5TL 3I6PA 3QWUA 2CVIA 5A2QY 4LFAF 1I51B 4JV0A 4J37A 3SCIE 2JDDA 2W01A 5LYDA 5D78A 1HD0A 3QBCA 4NE9C 5GAGI 5JJBA 3W9HA 1KVKA 2HEKA 4B5PB 3RR8A 4LSLA 1X4AA 1AMPA 2D3OR 2GIFA 3UD5A 3WQPA 4I6WA 3NA6A 1URRA 3K5OA 4H4KA 1YK3A 2KDOA 3CJ2A 2IL4A 2WAQD 2BM0A 3D7GA 3ENVA 4RZRA 3THVA 2FVSA 4C3KA 4C7QA 4MHZA 4CTAA 4USHA 2BE2A 2N4DA 5F3TA 1KQSR 2V77A 1WELA 3NFZA 4WTOB 1JLFB 2CXAA 5LOQA 5F48A 4B5OA 5KFBA 4F9VA 2Q04A 4B9TA 6CPAA 2J7UA 3IO1A 2A4NA 4UF4A 4UWJA 4Q2MA 3EVOA 2LA4A 4CPAA 4U7CA 1SJFA 3LOUA 2DO4A 3CT9A 4H4MA 4EZ9A 2A1BA 2YKMA 2H51B 5B0CA 2CPJA 2FVGA 4NGSA 4KGXB 4DSLA 1RAJA 2MJNA 3MPVA 4JI2J 3NS5A 2YWEA 2CNKB 4DDFA 1XFOA 2Y1IA 1AA1B 5KOWA 1KFDA 4TKTA 2XWYA 3K0JA 4NF1A 1X7VA 5F09A 5L38A 1SV5A 1Q2DA 3LH2S 4AQYF 2R2RA 2HAFA 2ZH9A 1CQNA 3PX0A 2JFDA 2JBKA 3WIUA 4ED4A 4YFJA 5FIIA 3RRGA 3CO0P 3F56A 2OPPB 4DSFA 3IGVA 2W2NP 5DQHA 3KTQA 2Y0SD 4KLWA 4CO2A 1UKUA 3NWGA 2X7IA 4ZP6A 3KJVB 1UPMB 1LKZA 4KGKA 1RWVB 5EUHA 3DLBA 4RN7A 3MPUB 4J5OA 3H8GA 2FPHX 1B0PA 1KRPA 1MWYA 2EFQA 4QU6A 3MM7B 3FZ2A 2C2DA 3M8SA 1TKZA 2FJVA 1XEZA 2ZEEA 1R8AA 2XMWA 4KHRA 2VL1A 1IUJA 4FYVB 2AFUA 4LQ3A 5D15A 2P6GA 4LSLB 1IR1A 3RR7A 5KFVA 2JJ4D 3T5KA 2C2ZB 1IXKA 3FVLA 3H4DA 3KJFB 3DU6A 1RAOA 3R9FA 5KFWA 2ZOFA 1TUWA 2CNLB 4DQIA 4JI0F 3NAHA 4O44A 3CW2C 3FNCA 3PB4X 1LWXA 4FF4A 4DEZA 1F9FA 2VPYB 4CTAB 3GCXP 2BE2B 5G1ZA 2GANA 4N77A 1S60A 3ZC4A 3MMCA 1M4IA 2U2FA 3BSAA 4HYKA 1B0TA 2DXEA 3H2UB 3QIDA 4CS0B 1S9GB 2V4QA 1GMWA 4KOSA 4H4MB 2GO8A 2YKMB 1PGZA 4WP3A 2CQBA 2F40A 5IFMA 3HVWA 4U7UK 4P9SA 3U7JA 1ZA2B 3EM1A 2D7SA 3C46A 2LXIA 1CG2A 2HVZA 4UA3A 3R7NB 1FD2A 1K47A 2EK9A 3HHDA 4ED1A 4IR9A 5HN0A 2X1GA 4RO0A 1UFHA 4KC5A 4NOHA 2NR0A 1RT7A 4CLFA 1SV5B 1L3TA 2O01C 3OTOF 4F3MA 5I3PA 2GJFA 2XS7A 1T11A 3H8FA 1ZAWA 1NDKA 4L73A 1Y7PA 4EBDA 2K2PA 4L76A 2IM2A 1S99A 4QC6A 4C97A 1TXRA 5IB9A 2GQ2A 4YDDB 2AKWB 4Y34A 3WC6A 3MM5A 5KG5A 3TA2A 2QO3A 1YIJS 3M6VA 3KFWX 3M30A 4DZDA 4A8KA 3UY5A 3EMTA 4WKRA 5K8NA 1NK8A 4EMEA 4DQPA 2XEGA 3LPYA 4CYPA 4URQU 1EARA 1WHVA 4CO4A 1DLOA 3QRPA 2B3VA 3DGPA 3HFVA 3S1TA 3B78A 4B13A 4DX8H 1PG5B 5KFCA 3HHLA 1BLUA 4ZK7M 4F3OA 8CPAA 1NH8A 1TKZB 2C3OA 2ZWPA 1U24A 2QSFA 2ZEJA 4R0JA 3BI0A 4NXYA 1NB2A 4CM2A 4Q8FA 2QG9B 3OXFA 2YKPA 2H9ZA 4HKFA 4ED6A 5DZ7A 2FL4A 4K59A 2V8VA 1RSCA 3N79A 4DV2F 2B5GA 3JRUA 4KLVA 1X4FA 3M8ZA 4JD6A 2P0WA 4OX7A 1JJHA 1GNKA 3LD2A 2F3JA 1L3KA 3QGPA 3BF4A 5KT7A 4A8SA 3OSPA 2KKHA 4O44B 1QAXA 3MFHA 2C1CA 4JV5F 3N5FA 4TYAA 3EPIA 1FJCA 1I1GA 3M8RA 3MXHP 5BWAB 5KG1A 3BQ1A 2H4YB 4I6YA 2J76E 1A2ZA 1VQNS 3WC0A 3MMCB 2GFQA 2J9AA 3BO2A 3N9UC 3G3SA 1R43A 2IJFA 3R9LA 3HHEA 1MJAA 1DAXA 1NBEB 2WZNA 2W9CA 3D2MA 3D54A 4KH0B 3DDIA 5KT4A 3DLLQ 1A9NB 1FNOA 3CDBA 1NK9A 2B9EA 1NMEB 2HNZA 4CYUA 3PRDA 3QJJA 2IRYA 3RYOA 2QMXA 2RDIA 2F4VF 3ILLA 2YTCA 1BLLE 3AQPA 3S6KA 1RYSA 3Q8PB 3PJ9A 1RJJA 1V0CA 2EUIA 1Q81T 1YJNS 1LWCA 1JLBA 2E1AA 1V3SA 1RT7B 1KKHA 2VODA 5A2QU 3B3SA 2DNHA 5IV4A 3IU2A 1KLMA 1X0PA 2HQFA 3J7YI 2CZ4A 3DRYA 3Q89A 4ECTA 2ZBPA 2FJEB 3CCMS 3MM5B 1KDNA 3K8VA 4UZBA 2G13A 3MMJA 3M30B 4USWA 2YGWA 3Q0AA 4OYMA 1PJ6A 1Q7YT 3GR0A 2KZZA 3I4HX 2MLZA 5CQGA 1DLOB 1XNRF 3MEEB 3O3LA 3V38A 2XZDB 2JLGA 3DGPB 4II9A 4DV6F 4Q36A 2KJWA 3HHLB 2GLFA 3HUVA 3U27A 2OFGX 1QSYA 2LQBA 1V5VA 1TUGB 3EPGA 2YWGA 2CTBA 3CD6S 5KFUA 1T02A 2WVBA 4CYQA 1FI4A 4IG0A 4PYAA 3SCKE 2OZHA 2DGXA 2OR4A 1S1WA 2ZZMA 5LXRA 4C7IA 2B5GB 3SYZA 5C24A 1GQEA 5HATA 1TL4A 2QVPA 4A4JA 3LODA 1S9FA 3RAXA 4UQTA 2AYGA 3G6YA 1K44A 4RNOA 3CXPA 2F5GA 3N6NA 2MZSA 1UEKA 5D0GA 4KVME 2CPYA 2IYIA 2I38A 1S59A 4IFVA 4ECXA 1C0UA 4DR4J 4ECWA 5AG4A 3KNAA 1RISA 1XMQJ 1Q1KA 5HROA 1M5PC 1GXUA 2JZ5A 3BGRA 3BEGB 1WTFA 4NMLA 2DF5A 3NGTA 3EVWA 3GLJA 4DV3F 1ZYQA 2LXUA 3GMGA 3IFEA 5RUBA 3EZUA 1SC1B 2VZZA 5L8RC 2MQNA 2ROEA 3LP1A 3PIOQ 4KIAA 2W9CB 1S7KA 3OR1A 4PEOA 1Q86T 2HNZB 2OTJS 4CYUB 3QGGA 4ZVSB 4NCBA 3MR2A 3PB8X 4NLPA 4QU7A 2UUTA 2WBRA 2HFZA 5DWMA 2CIJA 3UVJA 1IM4A 2BJ3A 4AXJA 4USVA 2CJQA 1YJUA 1JLBB 1YGYA 3RJMB 2HSEB 4UQGA 3G6VA 1Q8LA 3EICA 2VZYA 3HZGA 1HQUA 4EVYA 2ZZNA 5KFMA 1ZAVA 2VQEJ 2EFGA 2FJAB 1S7NA 5IWAJ 1N34F 2EKNA 2KJVA 4FF2A 2LDIA 1HYSA 3H2LA 2F1FA 1NDLA 1HFEL 4WFAQ 2WONA 2MKYA 4OJ1A 1RT2A 1LAMA 2I6WA 2CQGA 4KUAA 3LTOA 2JX2A 1T9WA 4LFCJ 4DLEA 2OLWA 4YR0A 3GCWP 1JX4A 3ELHA 4ZPVR 3T6JA 3KDOA 3RU0A 1RXOB 1IICA 4ES2A 1S4FA 3H40A 2NXNA 4XAKA 1V6HA 5JXSA 3CF5Q 1Z8TA 4EFDA 4ORFA 4IG0B 1KOOA 3JSMB 1NKBA 1S1WB 2GMLA 2CADA 2R8HA 3VARA 2GC8A 3KUGA 5HAOA 4ZMMA 2XNRA 5C24B 1AUGA 4X4RA 4UFVA 1Z4RA 3NGSA 3CXSA 1WHYA 5E7OB 3MPDA 5LRKA 1S1UA 1XQIA 1TKXA 1SQHA 3BXMA 2Q66A 5F8GA 3BQ0A 3G8QA 5C25B 3QFHA 2N4CA 1VQ9S 2WHOA 1FRHA 4IFVB 4C8YA 1C0UB 3L2NA 4A47A 3W2VA 2GW8A 1X8DA 4B6ZA 4FNIA 3KHGA 5KG2A 2Z0GA 1FX2A 4R76A 1C2PA 5LL6d 1ELOA 2MLYA 4RR5A 1U1PA 2NQPA 3LP1B 4Y65A 3A8EA 4MHNA 2L08A 3OR1B 2V8HA 4KV8A 5HMXA 1NPKA 4WCEQ 4J9RA 2HQCA 1JJ4A 4NCGA 5HI7A 3HVAA 4M6IA 2KVQE 2P9EA 4F0HA 3UVJB 3D1OA 5F9NA 4P4IA 2CQCA 3SXNA 2K06A 4KOXA 4YR3A 1RHRB 2JOQA 4K4TA 4UUWA 2N7YA 1YVFA 3AQOA 2IM3A 3WT4A 2LU2A 1HQUB 2FJWA 2Q3PA 1F1BB 2HS0A 2YXLA 3FGVA 1F2HA 1UJ6A 3PRBA 2EVZA 3PFEA 4K8RA 3IA0A 2EBEA 1ZZFA 5CHCB 4K0KJ 4WFZA 5LT5A 1X9MA 4R5PA 2LA6A 4DS5A 1HYSB 1Y7RA 1JWWA 4YHHF 4C0BA 4GM5A 2KXHA 1BHNA 2EO8A 1EAYC 5I3UA 3KLVA 2WONB 1A6LA 3CD7A 2Y0BB 4OC3A 3NCRA 4DL6A 5ETPA 2QMUB 1LFWA 3SCJE 1WACA 1CPZA 1S49A 5KTQA 2ZH7A 4H89A 3CPAA 4ONWA 2MQPA 2BO9A 1R8CA 2KYXA 5B7WA 4JI8J 1W2IA 1OIAA 1UZDA 4FYXB 1U45A 4CO0A 3R96A 2XLJA 4P2XA 3WHIA 2DB1A 2L9WA 4ZVEA 4YOEA 4AVCA 4X2BA 1JK9B 3KNGA 3TRGA 4Z2XA 2DNMA 3KHLA 3VAKA 1N56A 4Q7AA 3H5YA 4B3MF 4YUDA 3IG1A 1FWLA 2PIIA 4ILMA 1S1UB 2Q7BA 1TKXB 4ZX9A 3PFOA 5F8JA 1GK8A 3R6LB 2ARHA 4ZVTB 1QTNB 3M05A 3KQZA 2ZWOA 2K3IA 2UXCJ 3GSDA 3W2VB 4A8MP 3KLGB 1U0HA 2FVQA 2NYQA 1FY7A 4WWSA 2M0GB 4FF3A 3S7RA 4LF5J 4MFJA 2XCAA 1N36J 3MPYA 4JI4J 4J7CA 3K5LA 1NZAA 4W92B 2XMUA 3VAGA 2BOAA 5KFOA 3H5XA 4NFRA 4P71A 1Q78A 1RE1B 4KV8B 1HW8A 2HHVA 3W8GA 3W8PA 5IQQA 1MMLA 2C42A 4XPEA 4NCGB 4O4RA 3POTA 3AJDA 2RAQA 2J7KA 2BJDA 3ZZ0A 2E5IA 1YVOA 1RGVA 1ZM2A 3W64A 1TL5A 2DNYA 1WF0A 3LP2A 2ZEOA 5EBVA 2KL8A 2I2YA 1V3RA 4QWAA 4OC4A 3HD1A 2RH3A 3I0SA 4FBTA 1YJTA 4K3NA 2OOTA 1AFJA 1P9QC 2A3JA 3SI8A 2BR0A 1Q5YA 2NZ4A 7CPAA 5IM0A 4ZY2A 4NEZA 1HBUA 4R5PB 4EO6A 1RAEB 5MAOA 4DL7A 4FXVA 2I1RA 2FS5A 4DSKA 3V2UC 5GAHI 3RG6A 3WABA 5BR8J 5KFTA 2F8EX 3DM2A 3D66A 1P6TA 1OY8A 1X5SA 2C2RA 4G3IA 4ELVA 2HFUA 3D6FB 5B0EA 5D8NA 2W4DA 1UCNA 1TP7A 3C26A 1QM9A 2E9RX 1GTEA 2JFKA 2HGMA 3NGDA 2E1MC 2D4PA 5LYFA 3WZ0A 2OTLS 4Y2MA 1KZFA 3MEGA 2PMHA 2O67A 1IBKF 4LF7F 4DN9A 4I7FA 3HVRA 4W4MA 3IAS9 5I4MA 2VOPA 4L8AA 4C2ZA 2B0GA 4OYBA 3GJTB 4NPOA 4G65A 2QLXA 3R1KA 3C15B 2VD3A 4BBHA 4QW9A 3PW4A 1H2VZ 2D3ZA 1C0TA 4I2PA 2QYGA 3RBEA 2W1BA 1UW9A 4ID8A 4CO1A 4M95A 2IMOA 2AJQA 3CCZA 3I5AA 1E6VA 4NX9A 2KT3A 4P73A 3Q24A 1IVZA 1SQEA 3R2DJ 3H5SA 4CWBA 2X3DA 4CAWA 3IRWP 1U0HB 2C28A 3CDXA 4K50A 3DOKA 4DR5J 2ALYB 4R3KA 2E7XA 3R3TA 2KXNB 2Y0MA 2B5JA 1K0VA 4ZDNA 1EIYB 1AB8A 3J7YU 4UZCA 4A37A 2OI2A 2ZEFA 1BGXT 4FXDA 1Q16B 1VC0A 5KFPA 5DGBA 1JIHA 2KG1A 1U6MA 2V2KA 1MN7A 2Q6BA 1QSOA 2ZOMA 4WYWA 5K14A 4NWBA 1HQ2A 3W5YA 1Z2LA 3R9EA 1Y9WA 2GIQA 2OH2A 1RTJA 2VG6A 1T9XA 3DHWC 2DXQA 3KZWA 1TKTA 3POTB 3HLUA 1ZZNA 1FD8A 2HHQA 3CO9A 4UCPA 3RB3A 2Q4VA 1B3TA 3FSIA 5HXDA 2B8QA 4ZP8A 1P9YA 2F5IA 2V2VA 4DPWA 3LP2B 1VJQA 1ZG7A 3R2CJ 4PABA 1S1TA 2UVRA 4PWDA 3I0SB 4U67Q 2XY6A 2V94A 2Z3NA 4M8LA 4Y0FA 4HHJA 3I55S 1IWGA 1S1XB 4F4ZA 1HNXF 3T1HJ 1UVNA 5IM0B 1XMTA 2BE9B 2F9JA 1Y7EA 1HBUB 1Y0HA 4NXMF 2NPIA 2KG0A 4GVLA 1NO8A 2BABA 4OYOA 4KJIA 3G96A 1TTHB 1H0HB 2XYHB 2REEA 4MIWA 4C2MA 3ZTRA 1N6QA 1TKHA 4YFUA 1HHQA 1RLCL 3DM2B 4CAXA 1FCAA 3CD5A 2VG7B 3ISND 4IUSA 5GADI 2PIYA 3KGQA 3FBUA 2ASJA 4UIBA 2KU7A 1TMMA 4NLGA 2DGTA 5HQMA 5L39A 2EC0A 4ZLLA 3H98A 3M8WA 1H2TZ 3FEYB 3MEGB 5BYSA 1N32F 3MGDA 3QGIA 4OZ3A 4QWBA 3B54A 5ETLA 3EDQB 4I7FB 4UOHA 2FHMA 1VQOS 2RU3A 2VFTA 3TZXA 3G71S 2M4MA 3D3CJ 2R2SA 4BMHA 3MOZA 3PO4A 4DPXA 2KFYA 1QSRA 1C0TB 4I2PB 2GQCA 1RZMA 2BQ3A 1ZBTA 2IFXA 4MK9A 4ZLNA 1E6VB 3ICLA 2IY5B 2XTJP 4M5NA 3NCPA 2BE7D 3DOKB 2HBZB 4KPCA 2YBVA 2B5JB 4DUZJ 3HF5A 4FD4A 4DS4A 5L1KA 3D6HB 4MFQA 2HQDA 5H84A 4U96A 4WU2A 4MYTA 3VZIA 1EP4A 2V50A 4WWVA 2WVDA 4MFKA 1WKLA 3C16A 2VBXA 2YPYA 1YRTA 2BKPA 4QUSA 5K14B 2DR5A 4UW2A 3WC2A 2G0BA 4BLGA 4UOCA 1U02A 2CQ3A 4RNFA 4HH1A 4HL9A 1VRQC 2WB1D 1D9FA 3KMSA 1Q7LA 1V9OA 1RTJB 2VG6B 2VJUA 3PDNA 3PV8A 3O6QA 1VIXA 2DNZA 3JAMY 3QAEA 4GC6A 2N3OA 4WFXA 3AA9A 1URNA 3A4TA 2O66A 3KMQA 4NCZA 4DV0J 3EZ5A 4NA2A 1S1TB 4DJLA 2IVMA 2G2ZA 4IKAA 4QIVA 5F47A 1FDNA 3PXGa 4TVAB 4IOCQ 3SFUA 5BJRA 2PQ8A 3TTHA 2VICA 4URSA 3FMCA 4KOVA 3NGKA 2JVRA 3UI3A 4RBVA 1RUSA 3R1HA 3MHYA 1M5OC 1S57A 2POKA 1N6QB 4I49A 2HW3A 3BJ7A 4DLGA 2IRUA 4E8OA 4MCPA 3S9MA 2MZJA 4WE1A 4NGNA 4DCJB 2ZXVA 4UEFA 4JI1J 2HZAA 4HHUA 3UN2A 3PX6A 3KKFA 3VGSA 3B3VA 4BS2A 2Z11A 3HPOA 2LQ9A 2BV3A 2DPIA 3RAQA 3ILJA 3QYYA 4CT9A 4JLYA 2XGQA 1IKYB 2IA6A 5GMDA 2H5EA 3C2PA 2QN6B 1Q2YA 3IWNC 3UD3P 2AGQA 2OJ3A 4C3LA 4DR6J 1C1BA 1WEXA 2E1CA 3CJRA 4ZHRA 1FT8A 3JTNA 1NLKL 3P45B 1YJVA 4I56A 1S0NA 1Z2ZA 3SQOP 2QSWA 5EC4A 5ETSA 3JUWA 1HA1A 1RAIB 4EI2A 3SI2A 2VPWB 3MPWA 4B9UA 1S12A 1EETA 5D29A 3CDUA 2V8DA 1U1KA 4TU8A 2AGPA 5HVFA 2MQLA 2GU2A 4P2MA 4DPTA 1D9AA 3Q8VA 1EP4B 3CEDA 3O1LA 4HH0A 1G2EA 3RGIA 3VQTA 3C16B 2H1YA 3K9TA 4USUA 2HURA 2RS2A 4USMA 1Q7LB 1P1LA 1NK5A 4QPXA 3EDRB 3PEHA 5KG6A 2YKAA 3TOQA 2YQ0A 5LXYA 3DXBA 5FLXY 3GV7B 3P96A 4ED7A 4PUOA 4B11A 2JBJA 1B99A 1X12A 1Y11A 4P7TA 1AYEA 4AXIA 4DV4J 3A9LA 3K2YA 4NLOA 2V34A 4MT1A 2DYAA 4ED3A 2HIYA 2QLFB 5C5JA 1KUVA 3O2IA 4EEYA 4ZA1A 3SV3A 1G1XA 1CLFA 1SJQA 1UVJA 5C42A 2KRRA 4JZ0A 1ZA1B 4OHYA 4GKJF 3C14B 4B12A 3EO4A 4P2FA 2M9KA 3NP5A 3UNYA 1NJZA 4X62J 3CIZA 1W2BR 3VZHA 2AHOB 2ASDA 1Q0NA 3W5ZA 4OC1A 4WE1B 5E5NA 3MD3A 2D69A 1F3FA 1FWPA 3RNZA 2IJZA 1I12A 2XMKA 3TZZA 2ZBIA 1D0EA 3RW7A 1YLOA 2J7WA 2YQ3A 8ATCB 3GE9A 3FK4A 2AV5A 4A8OA 1F0XA 4C8KA 2FVPA 4MHPA 3NE7A 2F63A 4IO1A 1Q4RA 2K7KA 4QVTA 4Z7CA 3MWBA 1SIWB 4ANEA 1C1BB 2NPFA 2VC1A 4ZHRB 5B0BA 3FQLA 4XDCA 1VQKS 1RADB 3MR6A 4CAEA 4NCAA 3D8PA 2R8JA 3O8WA 4F0YA 2H48B 2M3DA 3NRBA 4TLQA 1WNEA 2J8AA 2V2ZA 1GT8A 4FBEA 4FKYA 4B3RF 2IBOA 3W60A 1EETB 2QL9B 2R9LA 3R9GA 1HNIB 4WXOA 2K7JA 5CZXA 1LAPA 2C6GA 3NY0A 4U6PA 4M6GA 1FTRA 2AEFA 4MAKA 5LMNF 4OJGA 3OFHA 2JC1A 4ATNA 2BEFA 4C8LA 1UJ4A 3KUHA 3PEJA 4A48A 2FE7A 4YDXA 5HK4A 3CMAS 1HI8A 3TJAA 4RUHA 4XPLA 3BHXA 3G8TA 2QLJB 1R0CB 4LSZB 1NJYA 3T1AA 4IH5A 5CPAA 3SI1A 2E66A 3D5MA 3QSIA 2UUWA 2NMTA 4CH1A 5KT5A 2D1CA 1JLGA 3M8YA 4PUOB 5K8MA 2CPXA 3J80Y 1ITPA 2FIUA 3CSKA 3ZZIA 1KUYA 2DGWA 2CQ2A 3MAHA 1CPXA 3A3PB 4B17A 2CPIA 2CNMA 3QT7A 1ZTTA 1XMOJ 4WFYA 4HNXB 1UAWA 1Z5RA 2D9PA 2XEXA 2GVDA 5KG4A 1QSLA 2I9SA 5J2MA 5C42B 1S0OA 4B3TJ 1LNQA 3CJ8A 3PB7X 1I94J 2QYVA 3F8KA 3UQSA 1PC4A 1DZ5A 3SMZA 5F8MA 3DKDA 3D3BJ 1R0BG 2G2YA 3V6JA 3CJ3A 3MUVP 5FVJA 1YWXA 4ZPBA 2BW2A 3MR7A 4JP8A 4UY8T 1PYTA 1WUUA 4K7QA 2WVFA 2CPZA 4J9SA 2BX6A 5GMEA 1KQFB 1TU0B 2IAJA 2LQ8A 2AIRB 3IM8A 3U1MA 1F57A 3A3NB 2PRQA 3MOJB 2GO9A 3TJ9A 2AFSA 1Q95G 2Q0YA 2W4CA 1DURA 4B10A 5KG3A 1CULA 2J0XA 4EO8A 3DLJA 2UXBF 1M1HA 3K89A 1ELLP 5GVQA 4KAIA 2B4VA 2AJ4A 4LFBJ 4JOUA 1MU2A 1N5QA 2PJ2A 3QAHA 2XEJA 3PKYA 3BDPA 4Y49C 4DQSA 1PUAA 1KTQA 1OSCA 3A12A 2R8VA 2AZ1A 4C2XA 1EZZB 3VH9A 2QZ8A 3HJFA 2MDAA 2OEMA 2HHWA 5AXLA 3DR8A 1LW2A 3NE8A 1UVMA 4QW8A 2C27A 2MZRA 4F0MA 2M88A 4I69A 4KS9A 1HLWA 1GTHA 3VAHA 1YHQS 1WD6A 4NLYA 3QRQA 5B0FA 4PR6A 3AD9C 3CCLS 3LA0A 2JEWA 5KTAA 1Y00A 2ZKTA 4OZNA 2R8GA 4DV1F 5EX0A 4B3SF 2DY1A 3GIRA 5GADU 3K9UA 3R5DA 1JLGB 1GH8A 4BC9A 4DYOA 3ENAA 1NK4A 2QFJA 1FDBA 4BWMA 1H8LA 2PE3A 1S0VA 1QAYA 1RK8A 3BKFA 1DQ8A 5J8CA 4ZN1A 4U7UD 1T8EA 4Q44A 3LPEA 4CIOA 4TU9A 1NM2A 2R7XA 1VC6A 1T95A 2MEWA 2C2NA 4CLTA 2MKSA 3W61A 1FNXH 2M52A 2UV8G 5J2MB 3UR0A 5DJBA 4ECRA 5GCNA 3V5RA 1IKXA 5KOXA 2W9BA 1YJ9S 2QE5A 4J90A 4QBJA 2HHPA 1QDUB 4JI3F 3RO0A 1PJ7A 2Z4PA 4LF8F 2RSQA 2E5LF 2F8HA 3GP9A 4UFWA 3CCWA 1EJ7L 3W66A 3TP2A 4DFMA 2QGFB 3HZEA 1J2VA 1PYTB 4U9YA 3JTKA 2ZUAA 4UOFA 2ATCB 1SKWA 1KP6A 1TZ0A 5JM6A 2QIRA 2IAJB 4CRYB 5DLFA 4FKXA 4JV2A 2M5YA 1HR0F 1PAEX 1FNMA 4MFPA 3T1YJ 2UUAF 4FDFA 2YNDA 1D8YA 3DDNA 5ETRA 3RRHA 2QIFA 3FRZA 2DNGA 1OQ6A 4S0MA 1CULB 4TY8A 4DL2A 3EGWB 4ZJQA 3K58A 4F4XA 1UETA 4C8ZA 2Q1LA 3J81j 4MFZA 2LDYA 1X0FA 2VFVA 1MU2B 3PACA 3GTYX 3HMJG 5FLXU 3MUTP 3LMSA 3TQEA 4F4KA 4XPDC 4CM0A 4X84A 4K4XA 4DR3F 1B70B 2AFOA 4OLOA 4OI2A 2CZ9A 2GGPA 4K4SA 4P45A 2FJDB 2PJ8A 2FB0A 4AXVA 1VK3A 2PGCA 4XNHC 3KLEA 4FUUA 3NOGA 1N5TA 4PXEA 1U49A 3TUZC 1QD1A 2BCOA 3PP9A 4I2QA 2QTWA 2AU0A 2AYMA 2NXJA 2GJ2A 2HPUA 2IM0A 5CD4A 5KG0A 4DBQA 4FD6A 3UDVA 3CPWR 2XBPA 3AXMA 2PC6A 3VR1A 2P6EA 4U8YA 2J8MA 1UWAA 1O0PA 4P4DA 3C19A 1IBLF 1KOHA 1YITS 3BBBA 4OJHA 2RRBA 4OV1A 4A33A 3DGVA 1SL2A 2CPEA 1NSAA 3BO4A 4OYAA 3RB6A 1RTZA 1XK8A 2WVCA 2GVZA 2V68A 4YRHA 2HHHJ 2QECA 4RNMA 4XPKA 1IKXB 2H5IB 2W9BB 4AG9A 4URGA 3HCXA 4OI1A 1OSDA 2ZJQQ 3HHNB 3TOBA 2ACYA 2C3UA 1N33J 4P44A 4DL4A 2FLNA 4NL5A 1J5EF 2ZZTA 4M5LA 4GXHA 4UEEA 1Z9UA 1GAOA 3EWGA 2CPHA 4DR2F 4ZOSA 2W2OP 2YX7A 1CS4A 3AJ2A 4JI6J 1G3OA 4DSEA 2EVNA 1ZO0A 4M85A 3H0PA 4JJXA 4OZ5A 3FEZA 4CI0B 2EFPA 1FHTA 3BO3A 4AL6A 3L7OA 1OO0B 4RU9A 4A46A 3PVXA 1M4DA 2XB2D 2UXDJ 1XNQJ 2OU2A 4MYUA 4TY8B 2UZAA 1VLOA 3MCNA 2A0FB 5HH1A 2RHQB 4LF6F 4PPDA 2J0QD 1YREA 2JL9A 4MIBA 2RMLA 4DXLA 2COLA 3TUPA 2P5VA 3J80U 2CPDA 2CWXA 5L1IA 3PNIA 2HZVA 4FN5A 4LVOP 2ZOGA 1SKSA 4J9UE 2RD5C 2PJ9A 3PEIA 5GAEI 5LYLA 4DNCA 2UU9F 1B7YB 3PZPA 2BJ8A 1J4JA 4KOTA 1OY6A 2D74B 2DNKA 2ZW6A 1FVSA 1FWKA 2YKNA 2CJKA 2PT0A 4A94A 3BGFA 4F50A 2NUHA 3LGHA 5L1JA 1XJOA 3L3CA 4QCLA 4IQMA 3K17A 1YKWA 3G86A 4A32A 4I2QB 1QVFR 4ANCA 3CC4S 2KT2A 5JVHQ 1WORA 1UFKA 3B6BA 3D1QA 2B4PA 3PB6X 2J9CA 3TAPA 1K1QA 2O53A 1MN9A 4CAFA 1VQ8S 2F4FA 3S6GA 2VA2A 1WTBA 2PJ7A 2Y1JA 1R6YA 2G1DA 4DV5F 2IPOB 3IR6B 1FRMA 3OVBA 3RW6A 4KHPJ 1X5PA 4AVBA 2EFVA 1BUXA 2NREA 3CCUS 3W62A 2Y9HA 4FZVA 1Y5LB 2DD8S 4K5SA 4W9YA 2HS3A 2VQFF 2PJ6A 3HKZD 4FD7A 3QGHA 4NGRA 4X65J 3TVYA 2GVZB 2GIRA 3QFWA 3N4WA 1TAQA 1RA7A 3NEKA 1SL1A 1DJ0A 2Y8WA 3GB0A 3QLHA 1FA0A 2ZBRA 4JBCA 2VPXB 1TFYA 4DR7J 4W90B 4PAAA 3QT8A 2ZD1A 2ZELA 2YNIA 2J0WA 1CEZA 4IFYA 3RRKA 2RFHA 4FYWB 2ASLA 4P7VA 4F02A 1H2UX 3B4DA 2BVZA 2RIJA 3MEKA 1QTMA 2E9ZA 2BOPA 3B35A 3Q8RB 2DIUA 1CS4B 2YH1A 4EBEA 1TQLA 2P9CA 3WDOA 4O3NA 4X64J 4C0HA 1CQMA 3K57A 4PV6A 5HJYA 3OFEA 4QR1A 4C9DA 4DR1F 5KFAA 3JYTA 2ZEDA 4R0EA 4ZVQB 1SC6A 1I6JA 1S9EA 3OTCA 3W5XA 2OUGA 2ODFA 2XYPB 1UWYA 1IBMJ 4IUFA 1T9YA 4OC5A 1U47A 3Q8QB 5I42A 1RP5A 3L4BC 3KG1A 4CGNA 4ENOA 3K5NA 4OX9F 1RA6A 1FFGB 3OLBA 5HMZA 5D0EA 3T19A 1NSKL 2PE8A 3KK1A 2ADBA 1SPBP 2M8DB 4MH8A 2PEBA 3IRXA 2PMWA 5H9FK 2KN4A 1IIDA 1FVQA 2R7VA 3GONA 2R8KA 5D4LA 2YKNB 4WXWA 1RAAB 2R1IA 1DARA 1X4CA 2CKWA 2X3GA 3ISXA 2KYZA 2CRLA 3GYXB 4DQQA 5A8KA 1FFSB 4LQ9A 2W8KA 3D0IE 1WOOA 2LKZA 4LSNA 4LQGA 2EK8A 2HVIA 1VYAA 5AT1B 3PB9X 4RBUA 3DLHA 2AEJA 2XMAA 4B9MA 3V4IA 4HHHA 1F2PA 1ZG8A 3EC4A 4DUYF 2CG8A 2Z3LA 1T9UA 2IMWP 3GG1A 2OFHX 1MLAA 3HSDA 3PW2A 3KHHA 2VFUA 2IA0A 1HWJA 3KK2A 2JWNA 4IYQA 2H3EB 1NPPA 5E33A 5LYIA 5LMUJ 2BW7A 4X66J 1XBWA 3T5HA 3S9NA 4QIWD 4Y2CA 4H6ZA 2QL7B 1H6KX 4LFAJ 5FJ4A 4IQXA 4Q45A 2D9OA 1Y0YA 3OJSA 2D41A 2I00A 4IRDA 1TF9A 2E7WA 3TA0A 2BACA 2W9AA 1MG7A 4DFJA 2EK1A 1OMSA 5AGEA 3RBZA 3R5AA 1FXDA 4CH7A 5HQLA 2R7TA 1SC3B 4LX9A 2LEBA 3QLHB 2WPXA 1VHEA 2DXDA 2AEMA 2ZH5A 2DRAA 1NMTA 2DR7A 3P49B 3OL9A 2ZD1B 3FB3A 4OIWA 2YNIB 4NGTA 4IFYB 2X1FA 1TL1A 2FHJA 2PJ4A 3TC8A 4FD5A 5L1LA 3HK2A 3DYAA 1AUDA 1B64A 2PDOA 2UUCF 3MR3A 1XE4A 4A39A 3I4PA 3N6LA 4CH0S 1M44A 4MMOA 2CFXA 4F8RA 3BSNA 3JYTB 3NLCA 2HFSA 4DOZA 4B9SA 1S9EB 5E2QA 2YNHA 4N7TA 5JGFA 3I87A 4P4BA 4FYDA 3VWEA 1U2CA 3CCTA 3N28A 5CYJA 1ZH5A 5I42B 2MZTA 2ZJPQ 2VIHA 4TLRA 1IKVA 4V19J 4RWWA 2V67A 3KLHA 1S9GA 3G87A 2CIMA 4QJVA 1VRUA 4M5MA 1VKCA 1RQ0A 5G0RA 2FD2A 2P2CB 3TZYA 2AFXA 1L0CA 3R95A 4A8XA 2ZJRQ 3V6KA 3KK1B 5DDRC 4ILRA 4PPZA 2E9TA 5B0AA 4AD6A 2DHHA 3IRXB 4AG7A 3D6TB 4AQYJ 2XEFA 1YI2S 1QE1A 1L3VA 3GSIA 3MAAA 2ZC4A 2ZH4A 5A8KB