1CG2A

Carboxypeptidase g2
Total Genus 135
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
135
sequence length
389
structure length
389
Chain Sequence
QKRDNVLFQAATDEQPAVIKTLEKLVNIETGTGDAEGIAAAGNFLEAELKNLGFTVTRSKSAGLVVGDNIVGKIKGRGGKNLLLMSHMDTVYLKGILAKAPFRVEGDKAYGPGIADDKGGNAVILHTLKLLKEYGVRDYGTITVLFNTDEEKGSFGSRDLIQEEAKLADYVLSFEPTSAGDEKLSLGTSGIAYVQVNITGKASHAGAAPELGVNALVEASDLVLRTMNIDDKAKNLRFNWTIAKAGNVSNIIPASATLNADVRYARNEDFDAAMKTLEERAQQKKLPEADVKVIVTRGRPAFNAGEGGKKLVDKAVAYYKEAGGTLGVEERTGGGTDAAYAALSGKPVIESLGLPGFGYHSDKAEYVDISAIPRRLYMAARLIMDLGAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of carboxypeptidase G2, a bacterial enzyme with applications in cancer therapy.
pubmed doi rcsb
source organism Pseudomonas sp.
molecule tags Metallocarboxypeptidase
molecule keywords CARBOXYPEPTIDASE G2
total genus 135
structure length 389
sequence length 389
chains with identical sequence B, C, D
ec nomenclature ec 3.4.17.11: Glutamate carboxypeptidase.
pdb deposition date 1996-12-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01546 Peptidase_M20 Peptidase family M20/M25/M40
A PF07687 M20_dimer Peptidase dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.360 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1cg2A02
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 1cg2A01
2PJ4A 4NGSA 4P10A 4OC1A 1XFOA 1BLLE 4X3RA 2HB6A 3KL9A 2AFWA 2O53A 1F57A 4PPZA 3NH5A 2AFSA 1YMEA 3PB9X 4NFRA 3PBBA 5JM6A 4MRIA 4NJQA 3PB4X 5I4MA 4NJRA 3ISXA 1VIXA 3KR5A 2ZEEA 3WC7A 4F9UA 2PJ0A 2RB7A 1LOKA 1IY7A 3SJEA 3FX6A 3FECA 3IWWA 5DS0A 3WT4A 2C1CA 2PJ9A 1XBUA 3D7GA 4BD9A 3DGVA 3FEDA 1BAVA 2C6GA 4Z65A 2Q43A 4P4IA 4UIBA 2PJBA 2BCOA 2PJ7A 4DJLA 3MN8A 2IQ6A 2IJZA 1HDQA 4ZY2A 1CPSA 5LRJA 3PB7X 2PVWA 1VHEA 3IEHA 2ANPA 3D66A 4PXEA 4X8IA 3D68A 1ZG7A 3S9NA 1Q7LA 3GLJA 3SJFA 5D29A 1HEEA 3FF3A 4OC2A 1F2PA 1Y7EA 1Z5RA 3BI1A 3RBUA 4P6YA 1YW4A 3B7IA 4EFDA 1R43A 3PFOA 8CPAA 5IB9A 2PJCA 4MHPA 4MCQA 1RTQA 2OOTA 1H8LA 4NGMA 4ZX8A 4P4DA 5JGFA 2C6PA 4OC5A 4P4JA 2V77A 1CBXA 1FT7A 3D7HA 5ELYA 5K8PA 4MCSA 3HUVA 4OKOA 2FVGA 4R6TA 3S9LA 4NGRA 2V8DA 2ZEFA 1PYTB 3KR4A 1ZLHA 2AFMA 2ZOFA 1Z2LA 2PJ1A 2ZEOA 3BHXA 1ARLA 3PB8X 1FNOA 3IFEA 4MCRA 4OC4A 4P4FA 3VH9A 2NSMA 1UWYA 4F8ZA 1CX8A 2PRQA 2JBJA 4OP4A 5LYIA 5HXDA 3B3SA 5LYLA 1VGYA 4ZY0A 4NGQA 4P44A 4DYOA 7CPAA 2V8GA 3NA6A 2XEIA 4OC0A 3DLJA 3CDXA 1Y0YA 2PCUA 4PXDA 2NYQA 1LAPA 1AYEA 4A37A 4FWUA 5HVFA 2ZOGA 5K8NA 1XJOA 5D8NA 3WABA 2CIJA 1TF9A 3N5FA 3D7DA 2AFXA 3S9MA 2IMOA 3T8WA 2V8HA 3GB0A 2EK8A 1YW6A 2ZEDA 3PRTA 3KGQA 1CP7A 4R7MA 3V38A 4OC3A 3IIBA 3WC5A 3FVLA 2PE3A 1XMBA 3K2KA 1CP6A 4MHYA 3WC6A 4PXBA 4KSIA 3ISZA 4EWTA 2JBKA 3NH4A 2DEAA 3KQZA 2POKA 1VHOA 2AFUA 5LRGA 2ZELA 3IC1A 1DE4C 3TC8A 1NSAA 1R3NA 2GLJA 4P45A 4OMEA 2JEWA 2BOAA 2I3CA 4RUHA 2GLFA 3QNVA 4WWVA 4MHNA 4FAIA 2ZEMA 1LFWA 2ZENA 3PB6X 3KHZA 2PIYA 1BPMA 3V7ZA 3TX8A 3FMCA 3RZAA 3MRUA 4MHZA 2PJ8A 5HVGA 5K8OA 2F8HA 3B3VA 1YLOA 1YSJA 4W9YA 1Z8LA 4OIDA 3CT9A 4FUUA 2O4HA 3BI0A 2J9AA 4CPAA 3SJGA 3FEEA 5JH9A 2PVVA 3D4UA 2AFZA 2QYVA 4YU9A 4UF4A 3I1UA 2QJ8A 1TKJA 5HVHA 3KASA 4H2KA 5CBMA 4Q7AA 3FJUA 4ZYQA 3PEIA 5J1QA 2HC9A 1JQGA 2CTBA 4PXCA 4FBEA 4ZY1A 1CG2A 4PQAA 1DTDA 4NGPA 5LYDA 1TKHA 5F09A 2WZNA 2F7VA 1TF8A 3KQXA 5LYFA 2C6CA 1QQ9A 4P4BA 4P4EA 3H8EA 3IO1A 2ZEGA 1PCAA 4F9VA 3SI0A 2OR4A 3JRUA 1EE3P 4AXVA 4MCPA 4UIAA 3IJ3A 3H8GA 4ONWA 1GYTA 2QVPA 3KHXA 1LANA 1AMPA 1LCPA 2Q51A 1M4LA 2CTCA 4NGNA 4G1PA 3B3WA 5THWA 1KWMA 3K9TA 2AFOA 4LQGA 3B35A 4A39A 3SJXA 1LAMA 2CF4A 1BPNA 4O23A 3VATA 1TXRA 4K3NA 1CPXA 1ZLIA 4UEZA 3B2YA 2VL1A 5K8MA 2ZEPA 4GM5A 4DUKA 2PJ5A 2ABZA 4IK2A 2PIZA 1ZG9A 4X2TA 3VARA 3B3CA 3PFEA 3LWUA 4TNUA 2PJAA 1ELMP 3LMSA 4UEEA 4A94A 1ZG8A 1IGBA 5CPAA 2BO9A 2EWBA 6CPAA 4JZ0A 3KI9A 2WYRA 4ZI6A 3FH4A 1F2OA 1TKFA 1Y0RA 2GU2A 3BXMA 3L2NA 2XEGA 5LRKA 4MMOA 2ZEHA 3KZWA 3CPAA 4UEFA 4IAVA 4EMEA 2Q4ZA 4NGTA 3NH8A 2XEFA 4IHMA 2PJ2A 4TWEA 4YWYA 4ZX9A 2PJ3A 3CPXA 1XRYA 3NFZA 2G9DA 4A38A 3D7FA 1QMUA 3GUXA 4B6ZA 4OIWA 3HLPA 4R76A 1ARMA 3SI1A 3SI2A 4R8FA 1ELLP 2XEJA 4WJBA 2PJ6A 1HDUA 2RFHA 2V8VA 3B3TA 3H8FA 4JYWA 3PBEA 3RAMA 4MXUA 2EK9A 3D67A 1OBRA 2GREA
chains in the Genus database with same CATH superfamily
3ZTSA 3FRYA 2XEXA 1AB8A 4RNOA 3VAIA 2HB6A 3KL9A 5EDWA 1QAJA 4A95A 4ED3A 4HHJA 3RB0A 5D0EA 1HBNB 2ZM6J 2QSFA 4E98A 2DHSA 1HYSB 5F9LA 4IUSA 2CWKA 5J2MB 4YEAA 3W5XA 3KUEA 1KD1T 1NMTA 3UN3A 1LOKA 4M6GA 1RWVB 3QJPA 1SB6A 2CNMA 3BGFA 3HHEA 1XBUA 2MZSA 2FLPA 4BD9A 2XGQA 3DGVA 3W2VB 2Z58B 2FJAB 4UFWA 4E8OA 2IM0A 4OHWA 2VDIA 5GADU 2R2SA 4ZITA 2IPOB 4DQRA 2Z0GA 5DZ6A 2VFRA 4LIRA 3SCKE 3D66A 2I5JA 1RB0A 2DXEA 2MJUA 2PIIA 4ED0A 3J81Y 1X10A 1RTJA 1KDNA 1Z2ZA 3QAUA 3GIJA 3LP2A 1SL0A 2PA8D 2JOQA 4KOUA 3IWNC 2B7BB 2COLA 2DRAA 2LCWA 3QJJA 2PJCA 1YWXA 3AD7C 5IV3A 4XIUA 2NLWA 5E2QA 2VQEF 1N8RT 1D8ZA 4KZTA 5ETRA 4QWBA 5KFOA 1S72S 4EYHB 2CAJA 2E9ZA 1N56A 4AFFA 4W90B 1PJ6A 3VWSA 2J6SA 2DNLA 4O3OA 2DR9A 5D4LA 3HM9A 4QW8A 1MMDA 1RAFB 1PYTB 5GAHI 4I0WA 1S1UB 1Z2LA 2HIQA 3GFXA 1R8AA 2XTJP 5ETPA 3FSXA 1XMQF 4USIA 2D3ZA 2IMWP 4M5DB 3TAMB 3MM8A 1PGZA 4DX7A 4RNMA 1V3SA 2RVJA 1XC9A 3VGUA 2P9CA 4JXQA 1VQ7S 1UVMA 1RTJB 3GCWP 2YNDA 2RH3A 2GO8A 1MSWD 3QB8A 3KLIB 4RW7B 3U27A 1Y0YA 1I1DA 3QO9B 4A37A 3IMQJ 2WVEA 4JWPA 4X4TA 3T8WA 3BREA 3CCRS 9ATCB 1EX8A 4C97A 4C2ZA 3KLFA 4CH0S 1XTZA 1NKEA 5DWMA 1RT5A 3IIBA 2UUAF 2PE3A 4JUZA 2ZBPA 4P7TA 4L76A 3V81B 1JJ4A 4X4PA 2X1AA 3CCUS 3OFEA 1KRPA 4HPSA 2HNYA 3PEJA 3CGIA 1VHOA 3MUTP 1YBUA 1H7WA 2AFUA 4G3IA 3K17A 3D3CJ 4O3SA 1LWCA 4URGA 4ZVQB 2GLFA 2HLTA 1Q8BA 1TZ0A 4WXWA 2Y3YA 3RYLA 1P9YA 1RDRA 1LFWA 2MQOA 3P2HA 3BQ0A 2HFOA 5HP1A 3RJMB 3LPEA 3PRDA 5ETTA 2MGZB 2RRNA 3B3VA 4NA1A 4OIDA 2QO3A 2CJXB 1S76D 1FDBA 3FBEA 4NXYA 1BC6A 2R3VA 4J9OA 4AL5A 1RT2A 4K0KF 4CLPA 4XNHC 1SJFA 2VQYA 4JYAF 3FEXB 4UY85 1SBRA 4PXCA 3M2RB 2KDOA 5BR8F 3X1LB 2UU9F 2YWHA 2XSFA 3I4PA 1S0VA 4C4WA 3CCVS 2YKMB 1RT6B 2C6CA 2JEVA 3H8EA 2BW7A 5E3RA 5CQGA 3BGUA 4ZLJA 1YJ7A 4ITSA 1UMJA 3J7YI 1VS3A 2VDHA 3K5PA 2UUCF 3IJ3A 4ONWA 2R2RA 4CLLA 5ETMA 2M8HA 3PZPA 2CQGA 4IDKA 4HDHA 1IBCB 4X4QA 2NXCA 4ZPWR 1S49A 4X66J 3ZZOA 4CLSA 1FO1A 5A8RA 4KKOB 2BR0A 2MKYA 3O1LA 4U6PA 1N36F 2XSJA 1U1KA 1DZ5A 4TNOA 2AEJA 3B2YA 4FF3A 1JXLA 3M30A 4F26A 3W7BA 4ONUA 4EBEA 2DR6A 4DSEA 2MKSA 1YLEA 1ZPVA 1ZG8A 4K4VA 2OPQA 2AWZA 2HHSA 2MMYA 3TQ1A 2Q7SA 2P6FA 1UVKA 1C4AA 1GT8A 2HVDA 2E1CA 4F4AA 1RWWB 4KH1B 4W4MA 4GVLA 4BMHA 2YX7A 3LP0B 2PRBA 3MF5A 3J80Y 1RTDB 3OTDA 1IYKA 2CQ3A 4FYXB 3MMCB 4U96A 1KQFB 3NH8A 2PJ2A 4RW6B 4ZIWA 2XNRA 1RT4B 1NJYA 4MI4A 4M5MA 2UZAA 3TZWA 4B9SA 4NSQA 3FJ2A 2YTCA 2DGWA 3GMGA 3H2LA 4JB8B 2B5GB 1SL1A 1MNEA 3N6LA 1S0OA 3JSBA 4C3KA 1Y5LB 1YLXA 2LP4A 4NCGA 1JLEB 4QIVA 4WF9Q 4IG0A 3D5MA 4A8QA 2GHPA 1JLGA 5D4NA 3MR6A 1BLUA 4NLGA 2B4BA 4PRFA 3T1AA 4OHVA 4X62J 1VBZA 3GJRB 4K4UA 3DLEB 2Z3MA 3NH5A 2FVCA 2VC1A 3IRXB 5K14B 5JM6A 1Y11A 5KG1A 4OZNA 1Y9WA 4IG3B 2FJBB 4KRWA 4QQBA 3MCOA 2RB7A 4DR4J 5HBMB 1UFLA 1SH0A 3AD9C 3BSOA 2OZGA 3GILA 4USTA 2FS5A 2YXLA 2XLKA 1RCXB 2EC2A 5BXIA 2YKMA 3OPKA 3GWCA 4PZVA 3K5OA 4I68A 1IBKJ 3L7PA 1SQGA 3PX0A 1XEBA 2MZJA 4IQMA 3S9NA 1QSLA 3GLJA 4ZIVA 2QEXS 5CYQB 4OC2A 1OYEA 4P72A 4Q5VA 2CUYA 4UUXA 3NNHA 2ZM6F 3MR7A 2P6EA 2O1PA 5AXNA 1YJVA 1RISA 1CBXA 2BEFA 1M1DA 4XPEA 2XO6A 1JKHB 3RB3A 2C2RA 4R6TA 5DLFA 2HIYA 3QNWB 2V8DA 2AYBA 3MD3A 4MKVA 1YBAA 2F4VF 1M90T 2BE9B 2M0GB 1FNOA 1SKSA 2LA6A 1S1UA 2GHWA 5E3AA 5FJ4A 4ELUA 4FN5A 2VUGA 3FRZA 3VGVA 1N4LA 2BRLA 1IKVB 4TXSA 2VU5A 4KGXB 4AYBD 1K8AT 2W4CA 5LYIA 3B3SA 2XWXA 1VOMA 1W2BR 1ON0A 2DTJA 3DRSB 7CPAA 1RU1A 3MR3A 4NPOA 4RWXA 2V8PA 4YDDB 5MAOA 1S1WB 4KSEB 2ZOGA 1NDCA 4HKQA 2XO7A 1X60A 3ZFVA 2C22A 1NK6A 1J4JA 3CDEA 3QZ8A 5KFGA 1NZAA 1TUVA 2ZEDA 5KG7A 3W2WA 2I5JB 3WC0A 1AW0A 3UDLA 2J6TA 1T9YA 4KSIA 3R5DA 1PBAA 3S6KA 3B8HA 2IRXA 1HQEA 5HROB 3M4XA 2R7UA 5D0HA 4KGZB 4P45A 1KNZA 2VV5A 4FZVA 4RZRA 4F7VA 4IR1A 2HQIA 4KGVB 4WWVA 1I51B 4LFCJ 4KB7A 3DYAB 1IIDA 3BZQA 4NWBA 1NPPA 1LXJA 2WW4A 4N8OA 5DDQC 1D9DA 4YR2A 1NSKL 4QWAA 1VRUB 3F44A 1IVZA 1QLNA 3CULA 3FEEA 4YU9A 1UEKA 1Q95G 1GQEA 1BWEA 2ZKTA 1KONA 4L8AA 3JSRA 3GYNA 4CRZB 2EVNA 5DQIA 1I21A 4ZY1A 2C3YA 2G1HA 1K73T 4MHDA 5G0RA 1T11A 2VIHA 1T9WA 2J9DA 3CJ2A 1SQEA 5HMWA 3MEDA 4P4EA 2V69A 4LMZA 2EKYA 4F9VA 1GK8A 1UW9A 1U0SA 4M5IA 3SXLA 3VAKA 4AXVA 3VZHA 1Q16B 2B56A 5KFBA 1JLCB 1KBRA 5L8RC 1HL6A 1N5VA 4N8NA 5B09A 4OYWA 1FRHA 4EI2A 4ZPDA 1K0VA 1Y0HA 2YKOA 1LOUA 1Q2DA 3SJXA 2LECA 1AUDA 2HMIA 2K3KA 2V4RA 2KB2A 3DKDA 1BQXA 4J9UE 1GX6A 4IK2A 2KG0A 1G7CB 2B3TB 5D0RA 2C2EA 1VQMS 4U8YA 1UVLA 1FEHA 1TR0A 4J9KA 2AJ1A 3Q0AA 1DQ9A 3AH6A 4K0KJ 1N52B 4NOHA 4FD5A 5HO4A 2BO9A 4MY3A 1RBLA 1N33F 4JZ0A 3HHLD 4WPAA 1BQMA 3SDEB 3LWMA 2CDRB 2AT1B 3SSSA 4Y3CA 4Z2XA 3TNVA 2YNFB 1APSA 2OUGA 3L2NA 2ROEA 2CQDA 4JOUA 1TL1B 4WCEQ 3EPIA 3W1YC 4RNFA 4IG0B 1VDHA 4R0JA 2J9EA 2NSBA 4A48A 4L73A 2BZ2A 2V6AA 1EKSA 1GXTA 4QIGA 4DUYF 4FYYB 4OI1A 2C2OB 4NRUA 3DLLQ 2EW9A 3KNAA 3NGDA 2PEBA 2ZD1B 3SI2A 2YPYA 1UA0A 4B5PA 2KG1A 2HBZB 2XEJA 3W2VA 2GJ2A 4EO6A 1LWFA 3AA8A 2R7HA 2B4DA 2DGTA 2WPWA 1Z4UA 2YQ1A 3H8FA 3LH2S 2ZDOA 3TX8A 2Y1JA 2RKIA 4OC1A 2HHXA 4URQU 1XFOA 5KFMA 4CAFA 2CXAA 2DNGA 2MB0B 1YDLA 1MJ9A 2GVDB 4M5LA 1S7HA 1NDPA 2ZBRA 1NZ8A 4DCJB 2W9BB 4YRHA 3CIZA 3PRVA 3G71S 3HJVA 3TOQA 1QUPA 1WI6A 2FIWA 3QQCD 1N54B 2OPRA 4WIIA 3D7GA 1HNVA 2PMZD 3FEDA 2JHEA 1BAVA 5B0CA 4UIBA 3RNZA 1YRXA 5LRJA 1YQEA 4DR3F 3D4JA 1C0UA 5KFYA 4WFBQ 1YREA 4QU6A 3AOAA 2OB0A 2V94A 4B3OB 1HIYA 5ETLA 4TY8B 1RZMA 2XQCA 3Q8QB 1BXNA 1F9EB 1F2PA 1Z5RA 5BWAB 1DAXA 2CPHA 2JDJA 4XPLA 2H51B 4MCQA 4EYIB 4MFJA 6FD1A 4X4VA 2EKNA 4NGMA 4HH1A 1HPZA 3SQGA 4RUCA 4KJIA 2KXNB 4LR8A 4AUKA 1GNKA 3DMJA 5IV4A 1RT2B 2RC4A 3PZJA 4UOCA 4QR0A 4B02A 2E9TA 4NLUA 3DOMB 1IM4A 4KYZA 2V2VA 2F3JA 1SJQA 1FRIA 4TU9A 2AU0A 3EGVA 5GMKa 5H9EJ 1ZLHA 4U5YA 1T95A 3SZ2A 2E1RA 1BMQB 2ZEJA 4PUOA 4DWIA 2VFUA 3G8TA 1HHTP 1X4BA 2P6SA 3QJLA 1HBMA 3GTYX 4OP4A 1SQHA 5HXDA 4CYQA 2P8IA 2QMWA 2VASA 2D7SA 1U1RA 1NK4A 2Y8YA 2PI4A 1DLOB 2OTJS 3N6MA 1NK9A 3J7ZT 1OO0B 2WSEC 2OEMA 1IM6A 1S9EB 4JD6A 4DR5J 3OTEA 4CLFA 3TAQA 4HR2A 4JI4J 5IC4B 2IJNA 3GG0A 3V38A 3HK2A 4F2SA 3DU6A 1U26A 3GONA 3K2KA 2JLMA 3QRPA 3JAMU 1WC5A 1JLAA 1XWLA 3DLHA 4QC6A 4HLBA 4ZS6A 3R6GB 3N9UC 1I6JA 5F48A 2HBYB 2GGPB 3OJUA 3S8SA 4MFKA 2NXNA 4N47A 4KTQA 1UWBB 1H2VZ 4ILMA 2PFDA 2AGPA 4CZCA 2CIMA 2BOAA 2R7VA 2CA9A 1FNMA 1TL4A 2R7RA 3U1LA 4USJC 5EN1A 4KVOE 2W2NP 2PIYA 2M3DA 4V19X 4RW9A 2E7VA 4CT9A 3VQSA 1EQMA 1JWWA 2CZVC 4HTJA 1WF1A 4B3RF 1TKTA 3CDAA 3CZXA 4CPAA 2MTLA 2BUNA 4X4UA 4YGOA 1MK4A 4TQRA 1XIQA 3GJQB 1RE1B 1RKJA 2NXJA 4PG8A 4Q7AA 4KQZA 1Q2CA 1GFWB 3W91A 3BKTA 3POTA 4ZHRA 2W9AA 2QL5B 1Y3KA 4Q36A 3G6XA 1FY7A 4Y2AA 3UO0A 3R5GA 3JXOA 1E6VA 2R4FA 4PWWA 2MZ1A 2B51A 3BJ7A 3K89A 1I12A 3OHAA 2ZEGA 2KYZA 4OZ0A 2CPXA 3MEDB 3NP5A 3AXKA 2DHHA 3E8OA 4I56A 3R5CA 3O8WA 4ZVFA 4TU8A 3HPOA 3A12A 1JLCA 2D69A 3OTOF 1REVA 2DGOA 3PYFA 2VJUA 3D8PA 5LSOA 1P1TA 2HPUA 3VATA 3LTOA 3MEKA 4GM5A 1KLNA 2FSRA 4J7CA 3TZZA 1M4DA 1NKCA 2PIZA 1TKDA 4A8OA 1WOSA 1XR6A 4KOVA 5SUHA 4KGMA 3CC4S 3PR4A 2EWBA 5AE1A 4MKYA 3C6TB 4O3QA 3CCLS 2V50A 3KI9A 2KVIA 3IR6B 3CD7A 1Q8IA 1GXUA 1ZO0A 4ES1A 1TKZA 1U25A 2JLFA 2YKNB 4JI0F 3HSJA 3V6DA 5KFLA 4RW6A 1ZM4A 4QUSA 1RADB 3MAAA 4ZDNA 4CQ1A 2YNIA 4P7VA 4ICLB 2ATCB 3IN5A 7AT1B 1HNXJ 3M8YA 2ATRA 3GJTB 1X4AA 2AW0A 3VAFA 4DV0F 2B0GA 2BA9A 4K4YA 4LF9F 2LXIA 2EK9A 2BV3A 4B14A 1SKUB 2GHVC 3VWDA 4NLPA 4QPXA 5KFTA 3F0AA 1T03B 4QWDA 1RYSA 2F9DA 2VEZA 3WZ0A 3M8QB 3AJ2A 4LRDA 4M85A 2V2ZA 4C2MA 4NJRA 4WFAQ 1ZS6A 2B8PA 3QLHB 3CO0P 3PO5A 4DFMA 1NH8A 1CJKA 2N4CA 3L09A 1RBAA 3QIPA 2V2QA 4X84A 2Q43A 1J5EJ 1KEKA 4X4OA 1CPSA 3AQPA 1RP5A 2CFXA 3CD5A 1Q79A 3W5YA 2YX4A 2IVYA 1V5VA 4KOSA 3TUZC 1K1QA 2NZ4A 1NHUA 4J9PA 5GMEA 5J8FA 4MFLA 3BGRA 4DI6A 2QTWA 1WEZA 3CB4A 4JI0J 2RHQB 4PQUA 4DL4A 4S0MA 1RAAB 2HS0A 2PC6A 4R3KA 2DCLA 3M1VA 4P6YA 3B7IA 2VI7A 1PYSB 2NUUG 5D15A 1FVQA 1C1BB 2IBOA 2DRDA 2GE3A 3QSYB 3M1VB 3W66A 2QLBB 2C6PA 1N88A 2HHTA 1TU0B 1GHEA 3BBBA 4J5OA 1K47A 4MCSA 4ED6A 2M2BA 5AJ3F 1B70B 4L6V3 3Q8SB 1T3NA 3S9LA 3C6TA 3U7JA 1NU4A 1SC3B 2CYYA 3HHLB 4ED8A 1VQPS 3ILOA 4L3KA 2XZDB 4F8RA 4QYZJ 4LFCF 4KPYA 2VB6A 4ZY0A 1FI4A 5G20A 4O0IA 4I7FB 3DRRB 5AXKA 5GAGI 2PCUA 1TL3A 2WVCA 2NYQA 1M5PC 2HZAA 4WFNQ 4FWUA 3NGTA 4LF4F 5IXUA 1U4BA 3N5FA 1I94J 1UWAA 4QWCA 2VHGA 3ENAA 5KG3A 3O3LA 1IQZA 5D77A 2OMOA 2E29A 2G1DA 1C1CB 5A8KA 3BO4A 4CYUB 2QE5A 2RAQA 3A4TA 4A8SA 4DV0J 1FRLA 1K1SA 1NKBA 4EWTA 5L1LA 5HQLA 2HFUA 2HURA 2UXDJ 2VKRA 1FJ7A 5F8IA 2DGSA 4F04B 2MQPA 2GQCA 2F4VJ 2JEWA 2FVSA 4RL1A 3NCPA 4PEOA 5KG2A 3G8WA 2YX1A 4OZLA 4KFBA 4U9ZA 2CJAA 2PA3A 1BPMA 3FQKA 1EARA 2KT2A 3LF0A 3H42A 2PJ8A 3V6HA 1YLOA 3QZ7A 2K7JA 1SIZA 4DLEA 3OVBA 2O4HA 5F8HA 2VJVA 4XNHB 4E2AA 2FHMA 1U45A 1R8HA 4Y00A 4FF4A 2DNYA 4UFXA 2R9LA 4C7QA 2LU2A 4MIAA 1RSCA 4MAKA 4RBVA 4C3LA 1V3ZA 1TKHA 2QMUB 2WZNA 1NM2A 2F7VA 4ECSA 1TF8A 3LP1B 2OH2A 3PM9A 2AEFA 3LOUA 2IL4A 3RR7A 4DPOA 2H5JB 1S57A 5F8LA 3HVTB 2QN6B 4PSWA 4DR7J 2OR4A 3HJFA 1WJ9A 1TL5A 3MD1A 4LIWA 3KJVB 4Y2MA 3NGSA 2HBQB 1YRTA 3Q8YA 3OR2A 2B5JA 1JWQA 2WOMA 5D78A 4NGNA 3OSPA 1FX4A 4QR2A 4FKXA 2VG7B 2WCXA 2A4NA 5I3UA 2CF4A 1KVJA 1BPNA 1TXRA 3OBIA 2N7CA 3CIMA 2E5LF 4WTOB 2HHQA 3PDNA 3AQOA 2BANB 5KOXA 1H2UX 2AYEA 1BQNB 4B13A 1XMOF 3HDSA 4M3SA 2I38A 5GMDA 1TIQA 3DRRA 3FH4A 4F02A 3PACA 1ZAWA 2GU2A 2VBYA 3CCTA 5E3PA 3CC2S 1EJ7L 2ZEHA 2QL7B 4J37A 1S79A 2FPHX 5L38A 3FSYA 2AX1A 4NGTA 2XEFA 3QRQA 4QCLA 1ZYQA 2IA6A 4YHHF 4A38A 2WAQD 4LF8J 5KT3A 3DLBA 3V81A 1I94F 3GYGA 4GC7A 5D4OA 3VAMA 2DNKA 4DFPA 2BABA 1WHYA 4LRFA 3FRMA 3PW2A 5DDRC 3TZYA 2J8RA 2DISA 3DM2B 3MR2A 5G1ZA 3K5LA 4DV2F 4NXMJ 1PG5B 5CZVA 4MXUA 4Y65A 3KJFB 1N32F 2GX8A 4Z7CA 3DYAA 4D3HA 1S6OA 3V6DB 2AGQA 1CULB 4DS4A 4PG4A 2AFSA 4QIWD 3V8IA 3JUWA 3C15B 4NFRA 1K9MT 3E2EA 2PFFB 4CH7A 1A6LA 4DR1F 3KLGB 1FKPB 2NS1B 1Y5IB 4LF5F 3KHRA 4XPKA 4F9UA 2XULA 5LXYA 3GP9A 3MAQA 1YJRA 4K5RA 1XERA 2O66A 2C1CA 3KLHB 4HTIA 5D0GA 2XZWA 3CJ8A 3NWGA 2UXDF 2RE1A 4G1QB 1PSDA 4KY3A 1A0OB 3IA0A 2P9EA 5LMUJ 2UVUA 3TOAA 3R5JB 2OEJA 3BSAA 4O4RA 1FDDA 2FIAA 4LSNA 4DMZA 2GMJA 5CAAA 4YN3B 7FDRA 2XYHB 3TJ8A 4JV5F 1M0SA 2ZZMA 2QMXA 1LW2B 1O6XA 1ZG7A 3WIVA 1R0BG 2J6UA 2KTQA 4CT8A 4NLVA 1S6UA 3D1QA 1OJ4A 3FF3A 2OSRA 1Y9KA 3FFIA 4OZ5A 3H4DA 3I0RA 3C2PA 5FVJA 1VQYA 3GKRA 1Y7RA 1YW4A 3RBUA 4TLQA 3MHYA 2P6TA 4K50A 1PJ5A 2HYIB 4J9RA 3MMAB 3DGPA 5M2UA 1KSPA 3KDNA 1JNZB 2VBQA 3BR9A 5G21A 2HNZA 3PTWA 2DVIA 4JI1J 4FD4A 1YBTA 2V4QA 2ZE2A 3EZ5A 4Q0BB 1JNRB 2XBPA 3Q2TC 2AJ2A 5EWEA 2Z3OA 3D7HA 4DUZJ 5C2CA 4DPWA 2J0SD 1X5SA 1T05B 5F46A 1XMQJ 4HHUA 3GV8B 1RHQB 3KR4A 1WC0A 2KHCA 3FBUA 4OJGA 2ZOFA 1N6QA 3PW5A 2KCWA 1NK5A 5A76A 2FJDB 3IFEA 2E5GA 3NLCA 2NSMA 5J8CA 5H86A 1LK5A 2W7PA 2IRYA 1RLCL 4M5NA 2YVSA 3BN4A 4HNXB 2ZHBA 1CVJA 2WVBA 4LF5J 3QGIA 1P8GA 1NO8A 2DPTA 5KFZA 5ADZA 1DTQB 2LVWA 3D7DA 1QE1B 5IT0A 2V8HA 3GB0A 4BC9A 3RYOA 3KGQA 4NF1A 3H4QA 3LD2A 4IRKA 3UDEA 2G0JA 1O5JA 4BINA 3IBCB 2SXLA 5A6PA 3PKYA 1NK8A 2BYCA 1KUYA 3WC6A 1YZ7A 1G6BA 4PXBA 4E0DA 1IN0A 1OMSA 3PGPA 5DZ7A 4ZVOB 3CJ3A 3DLEA 3PRBA 4ZCKA 3T5LA 1FWLA 3IRXA 1DE4C 5HQMA 1N5QA 4RW4B 4ZCMA 3JYTB 4NXMF 4OMEA 2FC8A 2I3CA 3CXCR 2QIRA 3TW0A 1HMVA 2J8MA 2CPDA 2ZPAA 2QA1A 2ZEMA 2RIJA 3PB6X 3DXBA 3DSBA 3EZOA 4JI1F 4DQSA 1R8PA 2HVZA 3CXSA 3JAMY 1RJJA 2JVOA 3A3NB 1TL7A 5A8KB 2ZW6A 3D4UA 4CAVA 2XY5A 2ABYA 2PC1A 2UXCJ 2ZJQQ 1WC4A 4YB1P 3PEHA 2KM8B 1N0UA 3MTJA 3UD3P 4CO3A 1FKOB 4JYAJ 6AT1B 3B54A 3VV2B 4RW9B 3VGSA 2VG7A 4CWBA 3JQJA 3IWXA 2OMLA 3I0RB 1D3WA 2ZC3A 5A28A 4LT6A 4ANCA 4PSXA 4DU8A 4OHYA 1JLGB 3QMQA 1VHFA 2FZGB 1VBYA 2DPJA 3TE4A 4IOBA 2LQBA 2B5JB 3MMAA 2GAHC 1IWAA 2KFNA 2MZRA 2L9WA 5HAOA 5KTAA 2RF2A 1N34J 3OWCA 5C7PA 2ZEPA 1X5PA 5K8MA 1M1KT 2PJ5A 2W4PA 5KFCA 3FKBA 1ZG9A 3DXSX 4NLRA 3LWUA 3R1HA 4TNUA 2EFOA 4OJ3A 3A3PB 4ZN1A 3TO7A 5IFMA 1M1GA 2DNMA 4WYWA 1IGBA 4LQ9A 3TCVA 2E1PA 1IJFB 3OTOJ 1K4JA 2BE2A 3IP0A 1Y0RA 3MM6A 3BXMA 3KOAA 5I0CA 5HMXA 5CYJA 2CZ9A 3V4MA 4ED5A 3FVYA 4IUFA 2AIRB 2KVQE 4C0BA 2NZCA 2RQKA 4TWEA 4NMLA 3C46A 5I42B 1UW4A 2MHEA 3D7FA 3BDPA 1WDTA 2HRUA 4BS2A 1BGXT 1AUGA 2X1BA 1J5EF 2C3UA 2JEGA 2A3JA 4QYRA 4N5SA 1SC6A 3F56A 1OQ3A 5DWNA 4NLDA 4ENOA 4AQYF 1HNWF 3OFFA 5FLXY 4BBHA 3OXGA 3MWBA 1TK0A 4EK2A 2PJ4A 1MU2A 4UCMA 1VISA 1B3TA 3A13A 1KQKA 3KMSA 4TLRA 1DTTA 3MXHP 4OLLA 4DR6F 3Q8VA 3N6NA 1Y10A 2DNZA 1LWCB 1ULRA 2OTLS 1S7FA 3ISXA 4ZJOA 3SQGB 1CJVB 4K7QA 3RB4A 2BANA 2E7XA 3M2UA 1U8SA 3HVTA 1ZOTA 4UTGA 2OFHX 2OO4A 4HDGA 3I9V9 2KN4A 3FFIB 4X62F 2G0BA 4CIOA 3KG4A 3JVNA 3S1TA 2M5YA 1FWKA 1RWNB 2JEIA 1RU2A 1HARA 3FK4A 3CPWR 1RWXB 5IWAJ 3KMQA 3IBFB 1UA1A 4HNYB 2RHSB 2C3OA 4U7UK 4YY3F 4NASA 3KHLA 2BQRA 3IWEA 1NJZA 1SV5B 4DV4J 3EJMA 2U1AA 3GSDA 1N48A 3TX0A 3MEGA 2ZH9A 4BBYA 2HWTA 3ITHA 1U1MA 1S59A 4P52A 1S9EA 2WVDA 2OPQB 1VQ8S 4F2RA 1RTZA 2WSAA 3LQVA 1PC4A 3W62A 4J9VA 2DNHA 4X64F 2WUUA 4ZVHA 5BYSA 4OC5A 3GPAA 3CJKA 1YR0A 1P6TA 3DFEA 2G13A 4HHHA 5HMZA 3S01A 3LGMA 4NCZA 3EX7B 2MKKA 4A8KA 3HUVA 2ZW5A 2ZH4A 1JMTA 5G4DA 2C27A 4I6WA 1URRA 1UJ6A 4P73A 3BHXA 1GH8A 2GGPA 1YVFA 2DCUB 2VG5A 4OYAA 5KTDA 2FZCB 1VC6A 3UDVA 2ZVSA 2GCFA 3A3OB 4NGQA 4P44A 1GTEA 3N79A 2U2FA 5H1SV 4ELVA 2Z4PA 2I00A 4OC0A 5A0YB 2YKAA 2AMCB 2MSSA 2D4PA 2GMLA 4MKBA 3RO0A 1AYEA 2F5IA 2Z30B 1HQEB 3JTPA 5D8NA 3WABA 1LEOA 3IG1A 4WE1B 1Q81T 3N28A 5L1KA 1S0NA 2BE7D 2HLUA 1H2TZ 1EQ0A 3RUBL 1S97A 3M6WA 4A8YA 1WTFA 4UWIA 2ZH3A 4N76A 3NMRA 1WKJA 2Z3PA 4YMEA 2RS8A 2MYFA 2PQ8A 2H54B 2JBKA 3I0SA 1U6FA 4OX9F 5HMYA 3ILLA 1YQHA 4P74A 3CD6S 4MKAA 4ZCLA 4OAEA 4M5KA 3QNVA 2GA7A 3L9ZA 4DCOB 3IWGA 3P49B 4C68A 2Y9HA 1SUQA 1OPZA 2Z0ZA 4ECWA 3C6UB 3DC2A 5DQHA 4LF7F 3KWMA 2F8HA 2XMAA 2MKHA 3C66A 1YJWS 2MY7A 2XZTB 3C16A 3AB4B 3P5BP 5IT4A 2YPZA 3C6UA 5CYMA 2VA3A 4RJVA 4MFPA 1CQMA 1SKWA 2ZH5A 1NSPA 1H72C 4A8XA 3DRPB 4FBEA 3HHLA 4AVBA 5B0EA 2LQJA 4X65F 1QY7A 4L75A 2CQIA 1NDKA 4UFVA 1Q2YA 5KFWA 4HACB 4U7UD 2FD2A 2HHVA 4R8UA 2Y0MA 2O67A 1K44A 1VRUA 4UY8T 5EX0A 2R8IA 4JJXA 3H8GA 1O0PA 3U1NA 4USVA 4QYZK 1LCPA 2EUIA 5F8MA 3B3WA 3FNNA 4B3SJ 2EI5A 3K9TA 4Q45A 1HW9A 4LQ6A 4USUA 4IR9A 1LW0B 1OSCA 4OX8A 5CD4H 1MWQA 2Q3PA 4UCNA 1FTCA 5K5MA 3EC4A 1T9TA 2VICA 1RK8A 3M6VA 1KLMA 4O3RA 1MMNA 3MGJA 2DY9A 1FKOA 5KT2A 4GKJJ 5M2PA 3PFEA 4P71A 2UXCF 4A94A 2XHCA 2VG6A 4OYZA 2MLZA 1H73A 2DNOA 4LUBA 1X8DA 2B4DB 2PEHA 1JK9B 1UPPA 2VQEJ 3J80U 3M9NB 2QA4S 3M8WA 2WYRA 4NLYA 2W24A 2NCKL 1TKFA 5B0DA 4LFAJ 3TAMA 1AFJA 3SV4A 1CS4B 2PSWA 1EZZB 1R31A 2XHWA 2J8SA 5LSRA 2P0WA 2KXHA 2Q04A 2EFPA 4MK8A 5DGBA 1KQSR 2YKPA 3SMZA 1R27B 3GUXA 1U48A 2HQCA 2DYAA 3RRGA 3BJ8A 4J9SA 2KT5A 4PYDA 1FRKA 1X4CA 3H2UB 1AT1B 3O5TB 2PN6A 3TEHB 3G6ES 3BDEA 3M9OB 2AQ4A 4DV1J 4F4YA 5MLCV 2UVRA 4GC6A 4L74A 3CW2C 3KG1A 5E3QA 4I67A 3D67A 1NK0A 1OBRA 4CGMA 3QSIA 1REGX 5C42A 4TKTA 2M52A 3Q89A 3ELHA 4CAEA 2VA2A 3DCAA 3TUJC 2FLOA 5CH7B 3GYXB 3FCVA 2ZEEA 4RUAA 5FD1A 3RRKA 2AJFE 5AG5A 2ZBIA 4DLGA 5HI7A 1SVDA 2GJFA 4P4IA 5IT9U 1RHUB 4KT0C 3H8YA 2ZKUA 4LF8F 3PB7X 3L3CA 2C2MB 2ANPA 5DDOC 2GJIA 2RF2B 2XI3A 1HQUB 2HBRB 3RW7A 4WFYA 4QZVB 3HZEA 2WW8A 2YWGA 1UTAA 4K2JA 3EWGA 2WRMA 2JDCA 2MJNA 8CPAA 2FVPA 1VYAA 2N3LA 3TFYA 4CNZA 3RR8A 2E9RX 4WFZA 1LRZA 1WD6A 3OVSA 4CS0B 1LWEB 2HHWA 4NLTA 3PJWA 3DOLB 5EC4A 5CABA 1IU8A 4PK2A 1UFHA 4TY8A 4C48A 1YVOA 3R9EA 3HP6A 2E5LJ 2CWXA 4CP5A 2FHOB 3SV3A 3CCMS 2D3UA 5ETSA 2ZEFA 4NGRA 4MYTA 1JLBB 3GIIA 3PB8X 2ZZNA 4C11B 4OC4A 1F2HA 1RHRB 1YX0A 3GSIA 4U67Q 3ZZTA 5LMUF 4DR2J 1CM0A 3MOJB 4KUAA 4OMFG 4YQWA 3M6XA 3OFGA 2RD5C 3R95A 2FLNA 3OXLA 1EHWA 4Y49C 3CDXA 4DCPB 2E5JA 3PNIA 1VQOS 1XJOA 2G2ZA 2W9CA 1IR1A 1Q82T 2IMOA 4F3QA 1OIAA 2GV1A 2A6OA 3JQKA 3W9HA 1ZPWX 3KJNB 5LMNJ 1D0EA 3TVYA 1MMLA 3AHPA 3GFYA 4NYOA 4FDFA 2OLWA 3NH4A 1WEYA 2POKA 4ZJLA 5LT5A 2LLZA 2OELA 2K1RB 3EVWA 2J0WA 3L95X 2Z8QA 4Y49B 2KXFA 3R27A 4R0EA 2D41A 1R3NA 3C15A 3K8VA 2JC0A 4RUHA 4ECZA 5C42B 4H89A 1YK3A 2JWNA 1HI1A 4LF6J 4MIBA 3VQTA 2OEKA 2ADCA 3MPDA 1Q53A 2LMIA 5K20B 4C2YA 1L5UA 1SUQB 2Q66A 4P2SA 2MKIA 3Q8RB 2EXUA 1Z9UA 5A2QU 1TP7A 5EWFA 3UN5A 1JX4A 2REFA 4H6UA 4AE5A 3MEGB 2QYVA 2AJQA 2BQ3A 4IFYB 1AXQA 4A8WA 2AYGA 2VC0A 3FJUA 3NOGA 2B7CB 1OY6A 4GVBB 1SJ3P 2ZHOA 3T9ZA 1U8WA 3DRPA 5F09A 2A0FB 4LR9A 1FDNA 4GMKA 1IKWB 3MDFA 4X4SA 1S0MA 2HQDA 3C14A 4RX6A 2VBWA 1TFYA 1YRUA 3ZTQA 1UZHA 2UXBJ 2VG6B 2DHXA 4YB5A 1R6VA 4CYNA 2Q51A 3S6GA 5C88A 4G1PA 4NX9A 5THWA 1WHWA 4HI1A 3OD2A 3D1OA 4OIXA 4LFAF 4ZOSA 4FKYA 2ARHA 1TQLA 2R1IA 2B4VA 5C25B 2HQYA 4LF2A 5K14A 3C26A 3M8PA 5H9EK 2CQPA 4XDDA 3CMAS 4OL8A 2ROPA 2KRRA 1CSJA 5ETQA 4CAWA 2FC9A 1NXIA 3FCWA 3W9IA 4UEEA 1ELMP 1RHKB 3ZJ0A 1RTHA 3DLKB 3HHNB 3UW1A 3WX8A 1NBEB 5CPAA 2CNOB 4RW7A 1YTYA 2EK6A 4IYQA 1FE0A 3K2YA 3W8GA 1JXEA 3HSDA 2V9KA 4PWUA 2N82B 2BW2A 4O44A 3I9SA 2LFVA 4DV3F 3FUYA 3BO2A 3QFHA 4M5JA 4AL6A 3PCOB 2VD3A 3TP2A 3KLFB 1DTQA 3D7SB 3LP1A 5D6GA 2Q4ZA 1L3UA 5EMIA 4DBQA 4ZGYB 4IHMA 2UV8A 2IRUA 1JIHA 1ZM9A 3CTRA 4Y34A 4E0AA 1R0AB 2CJYB 1HLWA 3RGIA 2JFKA 3SI1A 3DOLA 3Q83A 3UR0A 4FXVA 4K59A 1X5OA 3HULA 2YWFA 3DHWC 4RU2A 2H5IB 2BX6A 2V8VA 3MM5A 3HFZB 2WBRA 3W65A 2O28A 1NSLA 3QWPA 1LW2A 3EGWB 5CZXA 3ILJA 1YGHA 2DEJA 5CNPA 2GREA 4FF1A 4YUDA 1YJTA 3VTIA 1PYTA 1BLLE 4KFBB 1XNRJ 2F65A 2BM1A 1NE9A 5F8GA 1RT7B 3DRSA 1RAOA 4UZCA 3PB9X 5LOQA 3I0SB 2HFVA 3PBBA 3DGPB 1RI7A 5I4MA 3KR5A 5J2PB 2IVFB 1IY7A 3FX6A 3FECA 1F60B 1H6KX 3OR2B 4C98A 3W61A 1M44A 5IX3A 2J76E 1S9GB 3NG8A 4UQGA 2WONA 2QG9B 4L89A 5HJXA 4DX6A 2DXDA 4Z65A 4QOTA 1HHQA 2WPXA 3RBEA 3MCMA 1E6YB 2I9SA 5D3GA 3K7RA 2ILYA 4IF5A 1U49A 1O51A 2Y1RI 1TTHB 4CGNA 3D68A 3GIRA 1DLOA 1RT1A 3Q23A 1VC0A 1TAUA 5D29A 3N5BA 2Y8WA 2GMHA 2DGQA 3D0GE 4JV2A 3MUMP 2FXFA 1FXLA 2GW8A 1NNDA 2ZUGA 4UA3A 4AT1B 4USWA 3C16B 3ISNC 3S6EA 1AA1B 1X9SA 2PSZA 4LFBJ 4LVOP 4I1TA 1NHVA 3O6QA 1GEHA 2KKHA 2ZWPA 2H65B 1Y3JA 4LR7A 3FYNA 4AVCA 2RKIB 1R6YA 2BVZA 2ASYA 1B0VA 4ED2A 4F36A 2F40A 3G8SA 2AFMA 5E33A 4Z7YA 2X51A 1KN6A 3ENQA 3K58A 3NWRA 1JLEA 4EFAC 1UEVA 4LSZB 2VPZB 3I9ZA 4P2XA 3TO9A 4DYOA 2R8VA 1S99A 3D2WA 3BSCA 4A47A 2XEIA 3R97A 1Q7LB 3NMAA 4NZ7A 4KPCA 4Y2KA 4ZK7M 1KTVA 2UUBF 5G22A 4C3MA 3S7RA 2AFXA 3UDCA 1WC6A 2QFIA 4V1Ak 3FSIA 5ETVA 4KS9A 4DN0A 4WTYA 4ZP8A 4YOEA 2IM3A 4LBIA 3CJSA 3PRTA 4KOTA 1QAYA 4NEYA 3DDIA 4FD7A 4OC3A 3FVLA 3ILIA 2F8MA 2F4FA 1WSVA 2HNZB 1CP6A 4C11A 3UD5A 4MHYA 2V2KA 3TJAA 5F49A 4F25A 1VC5A 1S6QB 3EFAA 2XLIA 3H25A 1H98A 2PR1A 2C2KB 2YKNA 2GQQA 4B3MF 1NSAA 4RO0A 1UWBA 2A1BA 4M8LA 4I64A 1WF0A 5FIIA 2GZOA 3V2UC 1FK9B 1L3VA 2IBKA 3KLHA 2WHOA 3BH7B 4OI4A 2Z11A 2UUWA 5T41A 3I32A 1IOIA 3FCHA 4AG7A 3GG1A 2HVEA 3CC7S 4PG5A 2HNDA 1IBMJ 2PVVA 4BC7A 1X9MA 2AEMA 1N5SA 3G6VA 4HYKA 4F6AA 2OPPB 2NXEA 1S5ZA 3ZZIA 2FVRA 3CJQA 1BY9A 3W9JA 2DPSA 2HC9A 1Y4ZB 3FMWA 3HX9A 2KM8C 1U1PA 3CJ5A 2VZ9A 2J8AA 4FP9A 5HATA 3MM6B 4DHVA 3AD8C 5DO2A 4CLUA 1KVKA 1PCAA 2ZNZA 3TRGA 4ZCIA 2HGLA 1R8CA 3MZIA 4ZPAA 5KFHA 1Y9OA 3FXTA 2FGCA 2EO8A 1M4LA 2DITA 4DN9A 3WIUA 3T41A 4EU0A 3CJTA 3B35A 5BYRA 2GVDA 1HBOA 1GTHA 1QSYA 4G1IA 3T5KA 3HO1A 3CCJS 1P4NA 4OI3A 3TA0A 3M8PB 3LO3A 4TN2A 1U0HB 4F67A 3G6YA 1SJRA 2PMHA 4P6QA 3LW5C 1RLDA 2BJDA 4XPDB 5LJ5Y 2AHOB 4FVCA 2FT0A 1KFDA 2W2MP 1RTIB 2YKQA 4B3SF 1NUEA 2AJ0A 3FB3A 4OLPA 2IJFA 1AUSL 4JXRA 4MMOA 1ICEB 2OZHA 3F0NA 3DOKA 3KHGA 1HNZF 1S4FA 3DU5A 2J7UA 3IG1B 4TQSA 3PYGA 4J9QA 2PJ3A 3CPXA 4ZVGA 1NJWA 3K0JA 2DNPA 2CQ2A 1CQNA 4I7FA 4M6HA 4B6ZA 3BYRA 8AT1B 4XTTA 4YFJA 4RR5A 4I2PA 4V19J 3NKYA 3A8KA 5EUHA 2DXFA 4HACA 3HT3A 3BQ2A 4K2XA 4NA3A 4MJKA 3MECA 2XS7A 1NAQA 4JYWA 2DNQA 3PBEA 4B11A 2F9JA 4LRBA 4B9NA 4O3NA 2FCKA 2GVZA 4CM0A 4HNWB 2BM0A 3NAHA 4R8UB 1VQ9S 4KO0A 1ZBTA 5F3TA 1NPKA 2ZHAA 3MPWA 4AL7A 4TY9A 5E5NA 2HFZA 4PPZA 4RS2A 2C3MA 3MM9B 3AOBA 4KO0B 2ADBA 4RBUA 5KT4A 2FL4A 1T94A 3VZIA 3M2UB 2NREA 4X4NA 4Q2MA 1N36J 2PJ0A 2Q6BA 5B0AA 2J8NA 3GV7B 1YGYA 1C0TB 2ZBQA 3NGKA 4PPDA 2PJ7A 2YH0A 4C0HA 3M2RA 3IU1A 5CD4A 1X4HA 5C2GA 3MFIA 2L9NA 3IEHA 4OX6A 3UCZP 4H4MA 4FBUA 2G3AA 4X66F 4N56A 3WR7A 2W25A 4PKDB 5AGEA 2IJRA 4NA2A 3DOMA 5IM0B 1H38A 1R57A 3NBPA 3ICLA 1ZH5A 1NK7A 3SDEA 2HVHA 4ZVSB 1V5IB 2MQNA 4KV8A 1Y7EA 5H9FJ 4P9SA 2C2DA 3L7UA 1R43A 1J5OB 3A8IA 4DZDA 4GRSA 3WHIA 3D0HE 4P4DA 2CQBA 1U2FA 1D09B 1JLQB 3GFHA 1MJBA 1F0XA 2ZDPA 1SI9A 4DV7F 1J2VA 4Y28C 3W5ZA 2M8DB 4B9UA 4IOAQ 2HFSA 3VAGA 4G65A 5L1JA 2PJ1A 4Q43A 4L72B 1IKVA 3PP9A 1BO4A 3VH9A 2IC3B 2QX0A 5DS7A 5E96A 5LYLA 1HR0F 3RBXA 4X5KA 1P9QC 2DGXA 2Q4YA 3I56S 3UR3C 5EX3A 3AOCA 1S1WA 2K3IA 5LJ3Y 3M8ZA 1YIJS 2MGZA 1J27A 1CLFA 3R9FA 2D9PA 3PYEA 1REVB 4CAXA 2QL9B 3FZBA 2X3GA 5B7WA 2VZZA 4ECVA 3BS9A 5J1NA 4PWDA 1SH3A 1C4CA 3EMTA 4QU7A 3ZZ0A 2ATLA 3RBDA 2YNHB 2I6WA 1IB1E 3TANA 5JJBA 3J7Z5 3IRWP 3DR6A 5H9FK 5KFEA 1FJEB 5B08A 2M88A 3NS5A 2VFTA 2RQMA 5D8HB 4ZBGA 2Z3LA 4JLYA 1VQKS 3BM7A 2IY5B 4C8MA 4ZMMA 3PW0A 3U1MA 4BHQA 3SI8A 4IDKB 2G0CA 2APOA 1QSOA 2QYGA 2NR0A 1FRJA 2FYXA 1X9WA 1R8BA 4IG3A 4CCHA 5EGYA 5IZHA 1U6ZA 1BWVA 4HH0A 3RG6A 1PKUA 4UF4A 1SCJB 1PYOB 4RW8B 1CC7A 1VLOA 1BE4A 5J1QA 2RQ4A 3NCQA 2BJ1A 3ZNJ1 2CTBA 3HI9A 2E1AA 4F4XA 3MTKA 4YR0A 1CG2A 2NYIA 3QYYA 4NGPA 5BJRA 1CPZA 2WK4A 4ES3A 4JI6J 1KFSA 2RSQA 3IO1A 1J5OA 4RUBA 4R5PB 4Q8EA 3SI0A 4EBDA 4B3TF 5F8NA 3QGPA 1I5OB 4PV6A 1S60A 4K5SA 1GYTA 2UVWA 1RAJA 3D28A 2QVPA 5KTCA 4OZ1A 1LANA 1AMPA 4IOCQ 5AG7A 1ROFA 1I3OB 1DHMA 4LBHA 4ATNA 5A8WB 3B4MA 8ATCB 2VBXA 4WP9A 4U7CA 4J9NA 1RQ0A 4C7HA 3SXOA 4KAIA 3HKWA 3R5BA 3GIKA 2H4WB 2FTRA 5AE3A 2ABZA 1G1XA 4ZLNA 3CJ4A 1RO5A 3HF5A 3ET6A 4HVZA 3VARA 4DL5A 2BKOA 5CYMB 1Q86T 4DL7A 2JNJA 2HHHF 3WDOA 5IOLA 2ZVIA 1Z4RA 3AJ1A 4RNNA 3M2VB 3MI7X 5JVHQ 3FBCA 1A9NB 3KLGA 1K0TA 4R87A 4F0XA 4DR2F 1ZZNA 1KQGB 4CTAB 5HQ8A 1RT4A 4B12A 2E5IA 2W9BA 2H5EA 3CJ0A 1RT3B 4TVAB 2W8KA 1FX2A 4DOZA 2ZZTA 4IFVB 2DNNA 4KHPJ 2W7AA 1T0TV 4OIWA 2MQ8A 2C42A 2OI2A 3KLEB 4O4GA 3GJSB 3EZUA 2B9YA 2HG4A 1CJTB 1FNXH 2FJVA 1HDUA 2OKQA 1HNIA 3Q2SC 5HSPA 1FCAA 5DDPC 4WU3A 4F4ZA 3UD4P 2EPIA 3PY8A 4ZHRB 4P10A 2XGPA 1FKAF 3R9GA 2AFWA 5AG6A 3P45B 3SYZA 3A8EA 5HBMA 3SBMA 1QUVA 1TL3B 3I4HX 2C28A 3JSMB 1B7YB 1W2IA 2MZQA 2CJQA 2H1YA 1XOVA 2R7XA 4KLVA 3RW6A 4GKKJ 1R0CB 2ZH6A 3EUNA 2JSXA 2BKNA 3PJ9A 5J1PA 2QECA 4MFQA 3LP2B 3BPSP 1XNRF 2QSWA 2BCOA 3DI6B 1C0UB 1EETB 3IM8A 3HXMA 2GIRA 1T02A 3SCIE 4OJHA 4DSLA 1Q7LA 5B0FA 3PKMA 3PIOQ 2KHDA 2OPRB 5AXLA 2Z56B 3BF4A 2E44A 3ENWA 4O44B 4II9A 2EVZA 2ZOMA 4IO9Q 5J1EA 4EFDA 2VQFJ 1GX5A 4MHPA 4KHPF 2AJ6A 4HL9A 5LXRA 5J2MA 2OOTA 2XMMA 1H8LA 2VKZG 1SC1B 2WSFC 3NNAA 4ZX8A 2QT7A 3BBFA 1WI8A 1TELA 1I1GA 4NRTA 4DF8A 4KUBA 5HH1A 4KKOA 1UL3A 4DPUA 3I5BA 2RNEA 4EEYA 2EFNA 2GC8A 3LA0A 5E3CA 2E66A 1MLAA 5JMNA 5KAKA 3TA1A 1TKZB 4NI2A 1S6QA 3DDNA 4LJMA 1PAEX 2CNLB 4OI2A 2JBJA 2CVIA 5IM0A 4FYWB 3U02A 1OYDA 2I79A 4K4WA 2BOPA 2MHNA 3P8BB 3IGRA 4DQQA 2RDDA 4C2XA 1RTIA 4USKA 1WOOA 1WC3A 4DQIA 2R7TA 3THPA 1F1BB 5K8NA 1E6YA 1S48A 4ZVRB 7FD1A 3HZGA 2EK8A 3P5TL 1HNVB 1HNIB 1QD1A 2HNDB 2RDJA 2R7QA 3I5CA 2F8EX 1CBKA 1QSTA 3M6UA 3CUNA 1U2CA 4OX9J 2EBJA 3POTB 5GAEI 2MKJA 4UBRA 5G0RB 2G3TA 1N71A 3RAQA 1SQFA 4NMXA 3D6MB 4Q44A 4IH6A 4PABA 2YNGB 4M5HA 1S1TB 1WOPA 1HQUA 5EBVA 1NB2A 2HV2A 4IRCA 3IS9B 1RXTA 1UZDA 2V34A 4H4MB 4TYBA 3RZAA 4OFZA 1Z8LA 2R7WA 3G3SA 1HWLA 3OT9A 3V4IB 1RWPB 5JH9A 4NZ0A 4WK1A 4EZ9A 5JUMA 1NH7A 2W9CB 4X65J 2Z3KA 1X4FA 2W7OA 2XC9A 2NPFA 3T9YA 4PAAA 1Q5YA 1VQ5S 5A8WA 5F41A 1U1OA 1XEZA 2XSJB 1VQ4S 5DM6Q 2YNFA 4OYPA 3RU0A 3T5HA 3EPGA 3CDUA 3DRXA 1FD2A 4DL2A 3E01B 4JBCA 1PBUA 4KSAA 2IVMA 5KFKA 4R5PA 3S6FA 1GXLA 4DR5F 1DJ0A 1RXOB 4ZVUB 1IKYA 4DG1A 3KHXA 4DPXA 1FKPA 5JQ4A 4PG7A 3D1HA 2Z2MA 3H2VE 2JL9A 1TK8A 4LQGA 2AF6A 4J9LA 1OZPA 1S9FA 3F73A 2GIVA 4A39A 2BJ3A 1LAMA 3MPUB 4O23A 3K57A 2MEWA 1E6VB 3LALA 2LXUA 3CO9A 2VL1A 4KGKA 3TVZA 4F3OA 5DG9A 3OLAA 3KLVA 2BUEA 1S12A 1IXKA 2UV8G 4ECRA 2UUBJ 2EFGA 2R8HA 1LQ9A 3IM9A 1RAEB 5AG4A 4IO1A 2VFVA 1QSMA 4DSJA 3CE8A 4M95A 4OI6A 3EE3A 4KLWA 2MQMA 1UKUA 3OXFA 3CD0A 3KLEA 3I3GA 1VMBA 2HSEB 4DUZF 2ZH2A 2V5HG 3BGOP 5KG0A 4UEFA 1KLMB 2CPEA 2WZ1A 1FJGJ 2QMLA 1F6TA 1OWXA 5A27A 2OZUA 3SCLE 4OYMA 4W92B 2OU2A 3C19A 3V6KA 2MPUA 3SEOA 1YX2A 2OH1A 4FNHA 3V6JA 1QMUA 3J81U 4LRCA 3JB9k 1DQ8A 1FE4A 4DR1J 3GZ7A 3G82B 4HKFA 4R8FA 3B6BA 2G9OA 2PO4A 1RWKB 3CNQP 4MFBA 1EKRA 1BQNA 5I3PA 4WP8A 4GO5X 2DT9A 4KV8B 4NI2B 1ZZFA 1RT5B 3OUYA 1ZA1B 3FNCA 2Q79A 4MH8A 1WF2A 4RBTA 4QR1A 4PQUB 1IR2A 2HRTA 1IOFA 1BOBA 4DFKA 2EBGA 3AT1B 1YVKA 4LFBF 1N0VC 2KH9A 1A2ZA 4NYPA 1VIXA 1HPZB 3KXDA 5CYQA 3QIPB 5AXMA 3LWLA 1B99A 1AZSA 2JH3A 3BN7A 1D9FA 1B6BA 3GR1A 1LWEA 4B5PB 2C6GA 2K5TA 4YP3A 5I3QA 3M32A 1F5CA 3T1YF 1HDQA 2LU1A 3W63A 5B0GA 3MCNA 3K9UA 2HKEA 4F0YA 4KC5A 2ACMA 3CDBA 1A7GE 4LSNB 2OD4A 4C8LA 3H5XA 4DSKA 3SJFA 2WTFA 1HQ2A 3K59A 3JTOA 1F3FA 4CI0B 2B5GA 3FDSA 3GU0A 1QSRA 3UE2A 4CH1A 4JI7J 2J9DE 1LXNA 2VFSA 1RT7A 1KS2A 2XI2A 4LF6F 5F8JA 3QT6A 2QYCA 3T6BA 1AZSB 3H90A 2EWHA 1OY9A 3R7SB 5HANA 2HRYA 5HLFB 2CXEA 3ETOA 1R89A 4YB7A 1B0PA 3P6YC 4IFVA 2H4YB 3NOCA 1ARLA 1KOOA 3ENVA 4DDFA 2JZ5A 2JLGA 1V0CA 5LM7E 5IV0A 1DARA 4DX5A 2E1MC 2OFGX 5AT1B 3KK1A 5C24B 1TKXB 1S77D 5IT9Y 2AE6A 2D3OR 4ICLA 4QIFA 2XS5A 5KFRA 2UUTA 4ETZA 1TF9A 1S5KA 2EG2A 2ASLA 1YW6A 3D6FB 3HKZD 1S7KA 4R7MA 4PG6A 2HK3A 4M5GA 2GIFA 2CDQA 4MBUA 1CC8A 2MSTA 2RDIA 3PR5B 2HWIA 1LWFB 1XJWB 4HT5A 1HW8A 3H5ZA 4WWSA 5L39A 2DEAA 1L3SA 1DBDA 4H6ZA 4OYXA 5LRGA 3MEEB 4B3TJ 2XYGB 3FBBA 4WZMA 2YNGA 5A8RB 4MHNA 3D54A 4MYUA 3IU2A 2REEA 3ZZUA 2KT3A 4YS2A 3FMCA 3MRUA 3R7NB 2H9ZA 2O5DA 2L48A 4FBTA 4FS1A 4QB9A 1VI7A 3CT9A 1QSSA 4FUUA 3KNGA 5DETA 3OL9A 2VODA 3UQSA 1WORA 3CVKA 3SJGA 3MMBA 3TO6A 3RTVA 2BSWA 2AFZA 4JI3F 4CGPA 1TKTB 3QWUA 4U95A 3M8RA 3EVOA 1Y00A 3BH6B 2J9CA 2J7KA 2I1RA 4F3MA 1JJHA 2FE7A 1RTDA 3T1HJ 4NXNF 2AGOA 1QQ9A 1PAUB 2EEYA 2ZW4A 3QFWA 3WC2A 1QAXA 4DV6J 2DO0A 2M9KA 1XN9A 1FXDA 1DQAA 4WKYA 3VGTA 4GS4A 4A8FA 3V5RA 3HHLC 1X5TA 2P6GA 4DG1B 2B8QA 3MPVA 3QRRA 1OSDA 3C3LA 4RWWA 3EO4A 4DQPA 1HBNA 2LEAA 2EC0A 4K3NA 3IBWA 4M94A 4KH0B 3CJKB 4D3GA 4DUKA 1LW0A 3TR5A 5KT5A 4CRJA 4UOGA 3B3CA 4A32A 2DHGA 4WZQA 2VONA 4CLYA 4FPIA 2F1FA 3C8YA 2F5GA 1IKWA 2YWWA 1W26A 3MFHA 4JI8J 2ZD1A 3LP0A 3KYLA 2GFFA 3GFZA 4OZJA 5KFUA 3M30B 2YNIB 4DPTA 3LACA 3HCXA 4EMEA 1RT1B 2AZ3A 4UZBA 3NEKA 2HAIA 1WNEA 3KK1B 1HFEL 1WG5A 4IFYA 4U9YA 4J9MA 2FLLA 1EETA 3OR1B 4R3LA 1WDDA 3GQCA 3SHPA 2HUZA 4A8MP 4OYOA 4AG9A 2M7SA 2J5AA 2LEPA 4WU2A 3NXZA 2FJWA 1TV6B 2CQ4A 2YY3A 4XAKA 4M63A 2HZVA 4DX8H 2XS2A 3MCSA 4YHHJ 4QJVA 4A31A 1G2EA 3NBPB 4KSFA 3QAHA 1VBKA 2QV6A 4TU7A 2K1RA 4DXLA 1KKHA 1TUWA 4DU7A 3G87A 4DUTA 4ANEA 2XWYA 4IKAA 4ZJQA 4GVBA 4IRDA 4ZN3A 3SFUA 2R8JA 2WOMB 4Q8FA 3D6TB 3WC7A 3ONQA 3SJEA 2UVVA 3DDKA 3HLUA 3C14B 3QT5A 2Y0SD 3RB6A 4DJLA 3LAKA 4X2BA 3CSKA 2IQ6A 2IJZA 3DN9A 4ZY2A 4WE1A 4RNHA 3N7ZA 4OHZA 1CJUB 1WHVA 4PXEA 2ZJPQ 1MROB 1B7FA 3MMCA 1HD0A 2AD9A 3NGRA 3D0IE 1NDLA 3ZTPA 1HEEA 5J2QB 1FT8A 3I6PA 2C2ZB 1HBOB 4IQXA 3R2CJ 1RYRA 2BE2B 5KG6A 2GVZB 2JEFA 3BBCA 2KO1A 2CJ9A 3TT2A 5IB9A 3NCRA 4DL0C 2X7BA 2V0NA 1C1BA 3HD1A 4DV5F 3EICA 5F0WA 3BKFA 2V77A 2HQFA 1BD6A 2EK1A 1TL1A 3IXQA 3N0VA 5HROA 1FDAA 4I2QA 5B0BA 4PCQA 2Z3NA 1S7LA 4RN7A 5D4PA 1PILA 5KFJA 4FYVB 2OPPA 2I0XA 4DJBA 3SQOP 5DLGA 1KHWA 1Y7PA 1YG0A 3EXYA 2Y1LB 4DV2J 1RTHB 3DLJA 5KFSA 2B9WA 5IC6B 3TZXA 3HFVA 1Q4RA 3LAMA 1LAPA 2ERRA 2ALYB 4F0KA 4ECYA 3H98A 3BV8A 3GIUA 4JI7F 1TL7B 1LV5A 2N7YA 3HVWA 5CHCB 1Q5VA 1L3TA 3CXQA 2PT0A 3HHDA 2XG8A 4JV5J 4KIAA 1ZETA 3FIXA 4BWJA 4CLWA 5J2PA 3PJXA 1WTBA 1BQMB 3J7A1 4BWMA 1WK4A 3D2MA 5FDLA 2RRAA 5KFXA 4JI5J 4KORA 1HNXF 2GAGC 2GLJA 4I4BA 2UP1A 3OVAA 3M32B 2RU9A 2VBZA 1T03A 3B78A 1D1UA 3MUVP 1RBOB 2HAFA 2P5VA 2DY1A 1IKYB 1RA6A 1DRZA 2HS4A 2CRLA 3EXNA 4W98A 3VHQA 1S6PA 2ZH8A 2YGWA 2QZ8A 2FIUA 2J9AA 1FJCA 6FDRA 1FA0A 4XK8C 1VK8A 5T14A 2KRBA 1IBMF 4RW4A 2WSCC 2HHHJ 2HQGA 2CNSA 3K5NA 1VQ6S 1MWZA 4EVYA 3W3SA 1JQGA 1M5OC 1IKXB 2MZTA 4PQAA 2ODFA 5LYDA 2YNCC 5IQQA 3PVXA 5C24A 1Q78A 1QTNB 1P1LA 1H3DA 1Q8LA 5LL6d 1FFSB 2B4UA 4ED1A 1FTRA 4C8YA 2H48B 3OL7A 2VZYA 4HEA9 2CTCA 5DG7A 4Q38A 3VR1A 4UCPA 2J0XA 2AFOA 3QO9A 4OQJA 1UAWA 2CG4A 3LGNA 1XK8A 3G82A 2XCAA 3PXGa 2QA2A 2YQ3A 4ECQA 1TK5A 3DMJB 3HSGA 4NL5A 4ECTA 5GADI 3LPYA 5BYQA 4WP3A 3PHTA 4F0HA 3PYDA 5A0YA 4CO5A 3IR7B 1YITS 3CJRA 4LF9J 1DURA 4H4OA 1D8YA 3Q24A 3KZWA 3ZTRA 1GAOA 2Q6CA 4IAVA 4MT1A 2LYVA 1RGVA 3JSMA 1T3OA 1U0HA 1EP4A 4E8UA 1FFGB 5HJYA 1U47A 2CJBA 1X4DA 3H7HB 1HHSA 4R76A 1WSRA 3V4IA 4O0NA 1VQLS 1VR6A 1ELLP 2HNYB 4FXDA 1TVRA 3TA2A 5A6WA 4OYBA 2CPIA 4X64J 1IICA 2RFHA 3F8KA 3IAS9 1HBMB 5ETNA 2ZJRQ 4C8KA 3US5A 2OIHA 1TFWA 4ES2A 4DFJA 3UCUP 3AXMA 4A30A 3KKFA 2RUGA 1VCTA 4WIQA 4H4KC 2HZCA 4DZ6A 5J2NA 2HS3A 3D2PA 3JQMA 3AODA 4RU9A 3MAAB 3O2IA 1WG1A 2ASJA 3GY9A 3KFWX 3M8SA 2XMKA 3AB2B 3MECB 2R42A 4ILLA 2B3UA 2ZNYA 2CPYA 1R7IA 3RAXA 3TI0A 3IWWA 3NGUA 3NE7A 3T3FA 4Z37A 4WXOA 1G3OA 4UWJA 1Q1KA 2CPZA 1S6PB 4JV0A 3BLNA 5KT7A 3ZNUA 1NCLA 4ZKAA 1IJEB 4ANDA 4FYDA 1S9GA 2QA4G 4NEXA 1RT6A 3UPFA 1QAIA 2JX2A 3SXNA 1Q0NA 1VHEA 4DR6J 1S1VB 1RKIA 4OLOA 4X8IA 1S1XA 3W2WB 5F0UA 1FD8A 3UWTA 2DIUA 3MM8B 4C6AA 2MQLA 3QPIA 4JI2F 3I82A 3AJDA 3PFOA 5GVQA 3P3DA 2C1EB 5ITHA 2IC3A 5RUBA 2W2QP 1WUUA 1UP1A 4F50A 1ZAXA 2Z2LA 3E51A 5ELYA 3CMQA 2O3DA 1XE4A 4FF2A 5EHHA 1N5TA 2Q4VA 3BEGB 4CO2A 2VPYB 1JLAB 1FRMA 2R8GA 2Y0BB 4MY0A 2DXQA 2FHKA 4MCRA 1U09A 1YZ6A 4ILRA 4YDXA 3VWEA 2JEJA 2PRQA 1EAYC 2FY8A 2X1FA 1QVFR 1H74A 1VGYA 2M4MA 1ACMB 2Z57B 1RCOB 2CADA 4PXDA 3AFGA 3HT0A 1IBLF 1QE1A 4KE5A 4J3GA 1JLFB 4C7IA 3ZZZA 4ERDA 1WG4A 2ZH7A 5HL7Q 1XMTA 3PIPQ 2FHJA 2XMJA 4B17A 4X4RA 2RUSA 4H4KA 4QVTA 1DFDA 1UETA 1H7XA 3TAPA 2UUAJ 2AV5A 1KVIA 3WC5A 3K5MA 1XMBA 2ZITA 4ALZA 2GANA 1YK9A 1JLBA 3QLHA 1U7LA 4JI5F 1LKZA 1W7WA 3DLKA 5J2QA 1V6HA 4DV4F 3G96A 2LEBA 1JKHA 3K8WA 1U02A 1S1TA 1Q7YT 4OADA 2EFVA 1UJ4A 2ZFHA 4Y0FA 1M5HA 4NLXA 4U9RA 1EIYB 3CCES 2ZENA 2WBMA 3KHZA 1YKWA 4DSFA 1LFPA 3HVAA 4W9YA 1IUJA 2ASDA 4JP8A 1X7VA 4LF7J 1B64A 2PDAA 2JLEA 3BYPA 2M70A 3BI0A 3H0PA 2BJ8A 2BACA 4ZPVR 2DR7A 4QBJA 1U2RA 4JV1A 2L3MA 2K8GA 1TKJA 2QJ8A 1AROP 2XMUA 1S1VA 3PEIA 1R0AA 5C5JA 2UU9J 3HFKA 5F9NA 3NNCA 4CRYB 1DTDA 2H3EB 1ELOA 3G9CA 2EG1A 5LYFA 2CQHA 3M8QA 4C8NA 2CPFA 3CDWA 2IM1A 3QATA 2Z2YB 3JYTA 3UCGA 2W01A 3OR1A 3PG9A 2PGCA 1S4EA 1HWKA 4B3RJ 2A18A 2B9XA 3KJVA 3B4DA 5KG5A 5L9NA 3OTBA 4Y2IA 3MR5A 1BHNA 1KWMA 2ILZA 2N4DA 2Z2ZA 4R9MA 1NHKL 1VIOA 2IYGA 1RUSA 3EY5A 2JFDA 3NY0A 3H40A 4OV6A 4UEZA 2B4OA 3ZZRA 2MDAA 3CWJA 2L9DA 2GNKA 1VJQA 4ID5B 3OFHA 2XYPB 3J7AN 4FNIA 3TARA 3JS9A 4GKJF 1P27B 3W8PA 3LMSA 5GAGU 1FEEA 1PC5A 2DO4A 2YQ0A 1UVNA 4NCBA 2G2YA 1RACB 3EDRB 5DG8A 3KG0A 5E7OB 1WKLA 1VQNS 2V67A 4CGOA 3THVA 2BJ9A 5LRKA 2XY6A 1YHQS 3UY5A 2FDNA 4GXHA 2OAUA 2IYIA 3TVKA 3HVRA 2GS8A 1Y5NB 1UFWA 3LGHA 4L3NA 4KVXA 2FJXA 3H4BA 2DR8A 3TYTA 1AFIA 3VVUA 2YNCA 3MMBB 2W4DA 3KDOA 1NB7A 4NLQA 2PJ6A 3DR8A 1T8EA 2B6AA 4QBUA 3OUYB 4PR6A 4URSA 3M2VA 1FVSA 3RAMA 4USMA 1Z1ZA 1FWPA 4FD6A 3G4SS 4UQTA 1HMVB 3VVTA 2R7SA 1HD1A 2ROGA 3A1YG 2MXYA 1GMVA 1F57A 1JLQA 3R2DJ 2FY1A 1VLYA 1WEXA 1Z8WA 3MGDA 3WQPA 4RI1A 3GV5B 4ER8A 4OV1A 1UVJA 3DOKB 1UVIA 2IAJA 3CXPA 2CNNB 4J90A 2LQ5A 3GR0A 4ZLPA 2DH7A 5F47A 5DS0A 4CNYA 1TAQA 3WT4A 2I8EA 1F5AA 2A2CA 1U24A 2YNHA 2HGMA 4JI2J 4NZ6A 1T9UA 1X4GA 2GQ2A 2J7WA 4CO0A 3IGVA 3G2XA 4JI3J 3DNCA 1XNQJ 4CYPA 5JVGQ 2VPXB 3T5JA 1CJUA 1IWGA 5LSLA 5HN0A 3QGGA 1WACA 4PK3A 4CTAA 1C2PA 1RHMB 5KTQA 1U1QA 5L46A 4ZPBA 4F0MA 2XNQA 5CCLA 4MFBB 2PR8A 2FJEB 3KK3A 2D4OA 4RKUC 2CY2A 3BI1A 4YFUA 1TMMA 4ZPTR 4DEZA 1SV5A 2XLJA 4ELTA 4PWDB 3TO8A 3E3XA 2VQFF 1HYSA 2MLYA 3R3TA 3IGNA 2OHDA 5HK4A 3R5AA 1FFWB 4QWEA 2RQCA 2DEIA 2ACYA 1FT7A 2ZUAA 2R7OA 3KK2B 1WELA 4K30A 4NEZA 4KHMA 1N32J 1FERA 4JI8F 3OLBA 5GAEU 2HHUA 3GYAA 1N6QB 4P4FA 3WBZA 4O3PA 1VBXA 1UWYA 4UOFA 1CX8A 4NLOA 2QLXA 3MMJA 3JTKA 4DV5J 4M5DA 4OJ1A 4EBCA 4H54A 2QRRA 2V68A 3Q22A 4F4WA 4A4JA 2CQ1A 3CEDA 1OQ6A 3KLIA 4RW8A 3LANA 3ZXWA 4DSIA 2XMTA 4R57A 3S9MA 4B9LA 1T05A 3BR8A 1ZM2A 3EM1A 3EDQB 3TJ9A 5SZTA 2D74B 2FUG9 2KZZA 2HQ3A 2HW3A 1D9AA 1HNZJ 5ISVA 4MIWA 4QIEA 4KHRA 1HA1A 2IIHA 4K4TA 2LQ8A 2RJZA 4BCAA 5HLFA 4AVAA 3ZZYA 2BJ7A 2J0QD 2KI2A 1TUGB 4FVMA 1HBUB 3DNSA 1N33J 2VOPA 1MU2B 4QPTA 3VAHA 1ITPA 4FAIA 3P2FA 3TOBA 2KJWA 2W8LA 4FS2A 4MHZA 5HVGA 3OL8A 3FEZA 2VF3A 5LMNF 2AYMA 4ZP6A 3R7BB 3OW2R 3R9LA 2D1CA 4ZVPB 3AA9A 5C25A 3I1UA 5H84A 4I6YA 3TTHA 4P2MA 4UUWA 2JC1A 1T9VA 4ZYQA 2VOOA 4OZ3A 1WC1A 4OX7A 2DGVA 2IM2A 4I69A 2CVEA 1XR5A 4XDCA 3X3UA 5EWGA 1U1LA 2OJ3A 2OGUA 4H4OB 4ORFA 3D3SA 3JRUA 4KR0B 1EE3P 3H59A 1ZTWA 1NJIT 1KHVA 3HHKA 1GMUA 5IWAF 3KJQB 1X0FA 1SXLA 3ITHB 3BGLA 3QBCA 3DLGA 3H5SA 1CPXA 1MWYA 3FC9A 3DLGB 4C8OA 3KKWA 2K06A 2ZW7A 4X2TA 4LVNP 1VQSA 2ZE2B 4Q0BA 4EO8A 4U8VA 2XB2D 2PJAA 2JVRA 1VKCA 2P9GA 1RAGB 6CPAA 1ZM3A 1VHIA 1ZTTA 2QLWA 4DR3J 1JB0C 2DPIA 2Q7BA 3A8JA 2FVQA 2C3PA 5BR8J 2ZWOA 4TYAA 2P2CB 2MLXA 2YWKA 4EMDA 2Z10A 2DRBA 1M4IA 2A6MA 3CMES 2IDEA 2LDIA 3SIPB 4WKRA 1QTMA 3NFZA 3W6XA 3AAWB 1X12A 2WB4A 2KZMA 2BJEA 4KOWA 1KZFA 4ZVEA 1DTTB 1ARMA 3P4UB 2AP6A 2AZ1A 4EGLA 3R6LB 3J7YU 1B87A 2DR5A 1RWMB 1S1XB 3QT7A 3LODA 3ZTOA 1NSQA 4ZPCA 5CCMA 2B6AB 3T19A 2B43A 5ETOA 4PYAA 4K4SA 2LXFA 3Q8UA 1HWJA 1DY3A 4Q2LA 1FXRA 2UUCJ 3GE9A 2V4JB 3G86A 2JRSA 1YMEA 4AXJA 3D9BA 4MRIA 4CO1A 3PB4X 3MM5B 1WWZA 1M5KC 3IS9A 3ADAC 3BKUA 2KL8A 2A2DA 3H20A 2CQ0A 2W2PP 4P75A 3KK3B 3CCSS 2DH9A 4LRAA 3BSNA 1WHXA 5J2NB 2IDLA 5DM7Q 2B58A 2PJBA 4N7TA 3MN8A 2HEKA 2QJ3A 4ECXA 1VRTB 4Y6IA 1HR0J 4LF1A 3VF0B 3ISND 4E2FB 1H0HB 1FJGF 3OV7A 2DKOB 2JDDA 2KYXA 1SKRA 4B9MA 2OSQA 1UPMB 2QLJB 1Z8XA 3BQ1A 4PUOB 2IAJB 1RTQA 4IH5A 4K8RA 5ETKA 2LDYA 3M9MB 4CLKA 4ZP9A 3QT8A 4MFZA 2O01C 1IQTA 5JGFA 2OPSA 3WX4A 3KUHA 4XPDC 3TUPA 3R96A 3MM7B 3SFGA 5K8PA 1KUXA 1LK7A 4LBPA 4NCAA 3MOZA 4OKOA 4KBIA 2FVGA 2LQ9A 4CLZA 1XBWA 3FGVA 3EXCX 5I42A 1HKAA 4M6IA 2CZ4A 2ZEOA 3T6JA 1HWUA 1N5YB 3DDDA 2FZKB 4IH7A 4YR3A 4F8ZA 1RA7A 1OPIA 3R1KA 1PUAA 1L3KA 4DL3A 4MJ8A 3FZ2A 1GMWA 1G4CA 1SH2A 2RRBA 1IYLA 2V8GA 4BDPA 3F5BA 3ETMA 2BXJA 5T7LA 3UNGC 2ZH1A 4ZA1A 3MM9A 2PDOA 1UFKA 3L4BC 1F2GA 3GIMA 1FESA 2ZC4A 1EB0A 1UEUA 4CO4A 3RRHA 1M5VC 9RUBA 1CP7A 4B9VA 1UJ5A 1T9XA 2CKWA 3G8QA 5KFVA 4A46A 1IBKF 4Y2CA 2BL1A 4OZ2A 4AD6A 1HWIA 1U6BA 1RWUA 4EUVA 1IKXA 3B8GA 1XIXA 2OP5A 3HD2A 5K9FA 1N5YA 4HT7A 4C8ZA 2L41A 1NEEA 3CCWA 8RUCA 1M4GA 3ZZPA 2DIVA 2C2NA 4XO0A 3TC8A 3IR5B 3MPYA 4B3MJ 2G0IA 1KP6A 3CCZA 3D6HB 1CJKB 2DK2A 3I87A 2CNKB 4UOHA 1KTQA 5IB0A 2EFQA 3Q86A 1F3VA 4K4XA 1SIWB 2IA0A 3NAIA 4DL6A 3UN2A 4OHXA 1YSJA 2DJWA 1FHTA 2EBEA 2BMBA 3O44A 1SPBP 1YJNS 4C9DA 2BDPA 4DR4F 1ZAVA 4QW9A 3J81j 2HHPA 5A2QY 3MURP 2D3O1 1MROA 1S7IA 5U47A 2YBVA 2AX0A 2DGUA 3T1HF 4NXNJ 1FK9A 2KFZA 3T9NA 4K4ZA 1WKKA 1SC4B 3EYZA 5D3GB 2JJ4D 3KQXA 2B3VA 5F3ZA 2DB1A 5KFNA 2NPIA 2WVFA 5AE2A 4ED7A 4ED4A 1U6MA 1U1NA 1VJWA 3PHEA 3TEGA 1T7PA 1CJVA 2IFXA 1B0TA 2BRKA 1SJ1A 5FLXU 1NJXA 1LWXA 3NRBA 3N01A 5HP1B 2GFQA 1X31C 1OS5A 4ID8A 4NLWA 4I49A 5JPHA 4LX9A 3B82A 4B08A 2B9EA 3BJYA 4ZLLA 3I96A 4KOYA 5IQ6A 2DF5A 2RILA 3ULHA 2RMLA 3MEEA 2NMTA 3DM2A 2PE8A 2N3OA 2YNEA 1VRTA 4R25A 5IS2A 4LQ3A 2PI5A 1MG7A 3OHBA 4B10A 3L7OA 4O4GB 1F2OA 3TUIC 1KOHA 3EGZA 1CULA 1KUVA 4RLEA 2XEGA 2E7WA 2G4BA 3CPAA 2W2OP 4FPRA 2BBEA 1S10A 1JLFA 3BGRB 4J91A 1N34F 4MK9A 1IBLJ 3BB5A 3JSYA 3SCJE 4ZX9A 1XRYA 2G9DA 2X1GA 3EGNA 1RHJB 3OJSA 3M05A 3NE8A 1Z4EA 2NUHA 1HBUA 2CJKA 1IR0A 3HLPA 3H5YA 1NPRA 2V4JA 1XNQF 5GAHU 4C0OC 5FDLB 4AB7A 4DV1F 3JTNA 4WJBA 3NS6A 3DHXA 4GKKF 3QAEA 4A2ZA 1SJ4P 1SL2A 1QSNA 2XY7A 4NGSA 1B4SA 2R98A 4N77A 5L1IA 1CS4A 4X3RA 4LSLA 3F41A 2DHAA 2HFNA 4USHA 2O53A 4I2PB 2R8KA 4LUAA 3IAM9 4B5OA 1MW7A 5DGAA 4DPYA 4NJQA 2FHJD 1NLKL 3TQEA 1TV6A 3VAJA 2CG8A 3ZO7A 2D9OA 2Q1LA 1VHSA 2YH1A 3OTCA 3NS7B 2PJ9A 1Z8TA 4AQYJ 1C0TA 2AJ4A 1F9FA 1PU9A 4LF4J 3UFCX 2I2YA 1CJTA 4BLGA 1X0PA 2E5HA 2MY8A 4ECUA 4XPCA 5KFIA 3OQ2A 3BPDA 4HI2A 4AXIA 2XMWA 2GO9A 3PW4A 2HVIA 4KVME 2G2OA 2X3DA 4I2QB 3S6HA 2PVWA 3W64A 2L08A 4OI0A 1KR4A 1XR7A 4A33A 2NXUA 4DF4A 1TKXA 3M7VA 3NL0A 1HI8A 3UVJA 1QM9A 3FMBA 1RAIB 2KFYA 3RBZA 4GO7X 3PX4A 4B9TA 2QC3A 1QDUB 1YI2S 5JXSA 5I3UB 3PV8A 3FEYB 4OYIA 3HSZA 1W25A 3PO4A 4ETXA 3IWLA 5E41A 2MKCA 1HI0P 2IHR1 1EP4B 2VXKA 4UW2A 4P4JA 2HWHA 4WK3A 2WONB 4MK7A 1URNA 2HMIB 2QFJA 2X7IA 2NYHA 2VH7A 3KTQA 2K2PA 4DNCA 5T7LB 3OSNA 1YJ9S 3FBFA 2ALZA 4LREA 4UT4A 5AJ3J 4CYUA 4WBFA 4WFXA 4ZP7A 1RWOB 1F5BA 2ZBCA 3W6SA 2UXBF 3MAHA 1PJ7A 2H5MA 5CXTA 4P2FA 3PW7A 3NA6A 2KU7A 3FQLA 4I6AA 4NE9C 2Y1IA 4JI6F 2OD6A 2HGNA 2HK2A 4DV7J 2VPWB 5HVFA 3KHHA 2QGFB 1L0CA 2CIJA 2QIFA 3VALA 3MM7A 3T90A 3Q8PB 1FRXA 2F63A 2FB0A 4CYOA 4DUYJ 1M5SA 1MN7A 3CF5Q 2CQCA 5L9XA 2PD1A 1HNWJ 5KFPA 3H5UA 4RPFA 1VFJA 3EVMA 3ISZA 5KOWA 4N41A 3KQZA 3QGHA 3VCDA 1V3RA 3ET6B 2ZELA 3IC1A 4ID5A 5GCNA 2XM3A 4EZ6A 2GIQA 1BUXA 2DD8S 2NSCA 3QIDA 1OY8A 5DQGA 5M2RA 3V7ZA 1RABB 1TMJA 2RU3A 2AKWB 4NCGB 2BEIA 4DV3J 2K7KA 5K8OA 3HMJG 3THTA 2YWEA 4G1QA 3BO3A 2PMWA 1CEZA 3I5AA 1NRKA 1WWHA 1MN9A 2DH8A 4KOXA 2LKZA 2VG5B 2R2TA 3W60A 4F4KA 2QLFB 3KK2A 5E0OA 1XQIA 1RAHB 5HVHA 3KASA 1Q8KA 4H2KA 5CBMA 3QAYA 4ZVTB 4CLTA 4FXWA 1FF2A 2XCPA 1LNQA 1JJCB 4CGLA 4YY3J 5J1EB 3I31A 3UNYA 3I55S 2Q0YA 4DS5A 1S7NA 4P4BA 1JXVA 3D3BJ 4MTPA 2XMVA 3UVJB 2ZXVA 2W1BA 3TWZA 1NMEB 1PO6A 3PX6A 4MCPA 2DNRA 4UIAA 3SSQA 4NYZA 5DJBA 2B4PA 2DBBA 1VRQC 2CNTA 2V63A 1VK3A 5DRKA 3KUGA 1M1HA 1YJUA 2FGOA 1KC8T 1X4EA 1ZLIA 5KFAA 2RS2A 1PIEA 2LA4A 2KJVA 3E0KA 2NQPA 1XF8A 2V9WA 2OPSB 3UI3A 1GMWD 3OL6A 2A10A 5KT6A 3R1LA 4WYLA 3CCQS 1UCNA 3DI6A 5KFQA 4ZI6A 2BQUA 3GCXP 1XMOJ 1F9HA 5KFFA 3R8YA 3A9LA 1C1CA 1TVRB 3E01A 2Q44A 1JJ2R 3SSRA 4YB6A 3DRYA 4G6VB 4NLSA 3ZC4A 3N4WA 1RT3A 1O8BA 2BKPA 4B3OA 2FQQB 5CA5A 4CM2A 1S3ZA 2CPJA 4YWYA 2MQQA 1ZA2B 4DV6F 2R2UA 1V9OA 4LSLB