1CG2A

Carboxypeptidase g2
Total Genus 135
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
135
sequence length
389
structure length
389
Chain Sequence
QKRDNVLFQAATDEQPAVIKTLEKLVNIETGTGDAEGIAAAGNFLEAELKNLGFTVTRSKSAGLVVGDNIVGKIKGRGGKNLLLMSHMDTVYLKGILAKAPFRVEGDKAYGPGIADDKGGNAVILHTLKLLKEYGVRDYGTITVLFNTDEEKGSFGSRDLIQEEAKLADYVLSFEPTSAGDEKLSLGTSGIAYVQVNITGKASHAGAAPELGVNALVEASDLVLRTMNIDDKAKNLRFNWTIAKAGNVSNIIPASATLNADVRYARNEDFDAAMKTLEERAQQKKLPEADVKVIVTRGRPAFNAGEGGKKLVDKAVAYYKEAGGTLGVEERTGGGTDAAYAALSGKPVIESLGLPGFGYHSDKAEYVDISAIPRRLYMAARLIMDLGAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CARBOXYPEPTIDASE G2
publication title Crystal structure of carboxypeptidase G2, a bacterial enzyme with applications in cancer therapy.
pubmed doi rcsb
source organism Pseudomonas sp.
molecule tags Metallocarboxypeptidase
total genus 135
structure length 389
sequence length 389
chains with identical sequence B, C, D
ec nomenclature ec 3.4.17.11: Glutamate carboxypeptidase.
pdb deposition date 1996-12-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01546 Peptidase_M20 Peptidase family M20/M25/M40
A PF07687 M20_dimer Peptidase dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.360 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1cg2A02
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 1cg2A01
3T8WA 4ONWA 3CPAA 4IK2A 2IJZA 3NH4A 1BLLE 1UWYA 2O4HA 2PJ8A 3DLJA 3GUXA 1H8LA 1YW4A 1XFOA 4NGPA 3PB7X 4OC3A 3LMSA 1DE4C 3D4UA 6CPAA 4OC4A 2GREA 3PBBA 1AMPA 3SI1A 4R7MA 4NGNA 4DYOA 2XEGA 4WWVA 4ZYQA 3KR4A 2WZNA 2QYVA 4P4EA 1CP6A 1LFWA 2BCOA 1XRYA 3FVLA 3PFOA 4OIWA 5J1QA 4NGRA 4OC0A 3B3TA 4P6YA 4MCSA 3HLPA 3WT4A 2ZOGA 3B7IA 4P45A 4P10A 2PJ9A 5IB9A 2IMOA 3PFEA 1ELLP 1F57A 2PJ3A 3FEEA 4PQAA 2OR4A 1QQ9A 3N5FA 2ZEFA 4OMEA 4OIDA 3TX8A 3NH8A 1VHOA 3SJXA 3B3SA 1BPMA 2G9DA 2Q4ZA 4NGSA 4P4BA 1EE3P 4NGQA 1VGYA 1KWMA 2WYRA 3WC6A 3WC7A 2RB7A 3JRUA 4B6ZA 2ZELA 4UF4A 5HVGA 4FWUA 1Z5RA 2XEFA 2GLFA 4PXBA 4GM5A 1TF8A 3GB0A 4UEFA 3D67A 3D7DA 3PB8X 1DTDA 2AFOA 4PXEA 2OOTA 3B3WA 2AFUA 2ZEPA 2AFMA 3FH4A 4UEEA 2C6GA 3NH5A 4UEZA 4YWYA 3D7HA 2PJ2A 2PIYA 2PJ0A 2C6CA 4O23A 2PJ1A 2PCUA 4P4FA 3BHXA 3VATA 4MHPA 3PB6X 4RUHA 2PIZA 3BI0A 4A37A 3K2KA 3MN8A 4P44A 4MRIA 5THWA 1FNOA 1LCPA 4H2KA 1ZLHA 3BXMA 3PRTA 2PE3A 1CX8A 4PXCA 2IQ6A 1CPSA 1ZG8A 3IEHA 4ZX8A 4DJLA 4MXUA 1R3NA 3MRUA 3NFZA 4A94A 3S9NA 1BPNA 3RZAA 5LYIA 5JGFA 4WJBA 2ZEOA 3KASA 4R76A 1F2PA 1HDUA 1Z2LA 1CBXA 2V77A 4NJRA 3LWUA 2PJBA 1JQGA 1YW6A 2ZEDA 4K3NA 2CTBA 3RAMA 3KZWA 1OBRA 2I3CA 1QMUA 3HUVA 1F2OA 2NYQA 1TF9A 2BOAA 3FX6A 4PXDA 3ISXA 3D7GA 2ZOFA 3D66A 4OC2A 2C1CA 5LYDA 3NA6A 8CPAA 1LANA 2XEIA 1IGBA 2PJAA 1PYTB 5ELYA 3S9MA 4NGMA 4UIAA 2JEWA 4X3RA 2EWBA 2PJCA 4YU9A 2PJ6A 2AFWA 1VHEA 4FUUA 5LYFA 4EMEA 2VL1A 3BI1A 1PCAA 1NSAA 2CF4A 3I1UA 1ZG9A 1Y0RA 1ELMP 2GLJA 5DS0A 1HEEA 2PJ4A 3CDXA 5LRKA 1ARLA 3DGVA 1Q7LA 2C6PA 5HXDA 2DEAA 4MCQA 3FF3A 1YMEA 3TC8A 5CBMA 2JBKA 2Q43A 1TKJA 1R43A 2ZEHA 3D7FA 5I4MA 4ZY1A 2AFSA 2RFHA 7CPAA 4OC5A 1XBUA 3KR5A 1ARMA 4OC1A 1GYTA 4F9UA 1LAPA 3H8FA 4ZX9A 2JBJA 4W9YA 3KQZA 3FEDA 3PB4X 2V8VA 2EK9A 2O53A 4ZY0A 3ISZA 3FECA 1CPXA 4P4JA 3IIBA 3SJFA 3WC5A 4MHNA 4MCRA 4X8IA 5K8OA 2PJ5A 3SI2A 1CP7A 5K8MA 2PVVA 2EK8A 2BO9A 1AYEA 3K9TA 3KGQA 4P4IA 4DUKA 4IHMA 2ZEGA 2F7VA 3QNVA 5JM6A 2V8DA 4NJQA 2ABZA 2NSMA 1TKHA 2ZENA 2J9AA 4A38A 1YSJA 1LOKA 1YLOA 3SJEA 4F9VA 4LQGA 4BD9A 4KSIA 1VIXA 3KHZA 4F8ZA 2ZEEA 2F8HA 3H8EA 1Y0YA 4JYWA 4JZ0A 3KL9A 1Y7EA 5K8NA 4EFDA 2CTCA 2ANPA 2AFZA 2AFXA 2HC9A 3VARA 1XJOA 3B3VA 4OP4A 2PJ7A 3IWWA 4Z65A 3GLJA 2PRQA 5JH9A 2Q51A 3KQXA 3L2NA 5D29A 1FT7A 5LYLA 3PB9X 2V8GA 4P4DA 1ZLIA 5F09A 4PPZA 4UIBA 3S9LA 3VH9A 5D8NA 4TWEA 3IC1A 4A39A 4G1PA 3PBEA 3CT9A 3IO1A 4MCPA 3WABA 1RTQA 2HB6A 5LRGA 1ZG7A 3SJGA 1Z8LA 4CPAA 3B2YA 3D68A 1CG2A 1LAMA 4NFRA 4EWTA 3KI9A 2CIJA 2QJ8A 3FJUA 4MHZA 4AXVA 4FAIA 4MMOA 2QVPA 5CPAA 4ZY2A 1TXRA 3KHXA 4TNUA 3B35A 5HVFA 4OKOA 3PEIA 4MHYA 3IJ3A 3H8GA 2ZEMA 4NGTA 3B3CA 1TKFA 3SI0A 5HVHA 4X2TA 2XEJA 2POKA 4IAVA 3IFEA 1IY7A 4Q7AA 4R6TA 2V8HA 1BAVA 3RBUA 2PVWA 1HDQA 5LRJA 1XMBA 2GU2A 4ZI6A 3V7ZA 2FVGA 4R8FA 3FMCA 5K8PA 4FBEA 3CPXA 3V38A 1M4LA
chains in the Genus database with same CATH superfamily
4Z2XA 4WXWA 2HLTA 1RTDA 2AJFE 3GPAA 1P9QC 4ZPWR 3F5BA 4CGPA 2DHHA 1FCAA 3JQJA 2AJ0A 3MTJA 5EBVA 1Z8TA 4CP5A 1CJVA 5MAOA 3OUYB 2EFGA 1S9GA 2KU7A 4F36A 2FSRA 2PGCA 1CJKA 4IFVA 4WWVA 2PA8D 4WE1A 3MM7A 1X9WA 3I0RB 4NI2A 2D3ZA 3TO6A 4M6IA 3MURP 1UVNA 3NGTA 3QGPA 3UVJA 1WOOA 1C1BB 5DDRC 2FPHX 4C4WA 1LOUA 4A47A 4P10A 3EY5A 2PJ9A 3DRRA 3MM8A 4OI1A 3ZTPA 2BEIA 1FT8A 4NLYA 4X5KA 3ENQA 1HNIB 1TL5A 3BJYA 1YBAA 2R2UA 3SJXA 3PIPQ 2IIHA 2JEGA 4C7QA 4MY3A 5F8JA 2UXDF 4NGQA 3D3SA 4DCPB 4KQZA 1WF0A 3FMBA 4YN3B 5KT7A 4B3OA 3CJKB 2IM3A 1IKYB 1K44A 1TF8A 3GB0A 1ZM9A 1JB0C 2DGVA 1TTHB 1QE1A 3QIPB 3OSPA 1L3UA 1UWBB 4DR5J 1SQEA 4J37A 1LK5A 5KFXA 2ZNYA 3QSYB 2ILZA 4JV0A 3H4DA 4DR2F 1EP4B 2GJ2A 1QJHA 2OEMA 3HHLA 3R1KA 1Q86T 2GMJA 3EXCX 1KHWA 2ILYA 4CTAA 3VZHA 5DLFA 2KHDA 4PXCA 2HFSA 2EEYA 3QGGA 2W2OP 3TA1A 1VQYA 4QYRA 3CULA 3MRUA 3M6WA 3H2UB 4I6AA 4WJBA 4M8LA 3PRBA 3DM2B 3SI8A 4XTTA 3NOCA 1IB1E 4C6AA 2YWEA 3U02A 2IJNA 2LVWA 5FDLA 2EBGA 2NYQA 2DEIA 3CD0A 1KQGB 1TUGB 4LF7F 5JPHA 4USJC 2W4DA 4ID8A 4CRZB 2ZBIA 3CDWA 4MIAA 1VQ9S 1D3WA 3PKYA 4B9NA 1U1KA 3T1YF 1REVB 3CCZA 1M5KC 1RT1B 4KE5A 5A76A 1RBLA 2P2CB 1M1KT 2PJCA 4OI4A 2QMXA 3HVTA 1VHIA 1YWXA 1K8AT 2J6TA 3RBZA 3E01A 3DHWC 3V81A 2VPXB 4R9MA 1I21A 1RU1A 1H2UX 5CHCB 3S6FA 1LWFB 2GLJA 3WX4A 1MNEA 2OIHA 2PJ4A 4X2BA 3K5MA 2VG5B 4X4NA 2LU1A 4P73A 2BQRA 1X4DA 1M1GA 4QR0A 5I4MA 2QSWA 4CAFA 2Z3KA 1U09A 2XBPA 1T03A 4JI1F 2AFSA 2XMMA 2NYHA 1G1XA 4DV5J 3EE3A 3R1HA 3HSJA 1RTJA 4F9UA 2Y1RI 2ZUAA 3TVKA 2UV8A 2YQ0A 4FF2A 1RACB 5CCLA 1BC6A 2V8VA 4B9TA 4ZLJA 2HNZB 1XBWA 4FF4A 3KKWA 5A8KB 4MCRA 2DO4A 4QIEA 2RRAA 2VDHA 4ZK7M 4PSWA 2BO9A 5KT4A 3O6QA 4C2YA 4QR1A 3TJ8A 3I9SA 2J9AA 2YKNB 2A10A 2DGTA 4IG3B 4LQGA 1AFIA 2HK3A 1S1UA 4F0YA 2E1CA 1MU2A 1LKZA 1HFEL 2VPZB 1KHVA 3W63A 4DR1J 1FJ7A 1SBRA 5DDOC 4TQRA 5I3UA 2P5VA 4PAAA 2IAJB 3G82B 4NLWA 5KTDA 3OFGA 4HR2A 1F0XA 1A6LA 3BN4A 3BR9A 4J9PA 3FZBA 3OTDA 2N3OA 2V8GA 2NSCA 4DV1F 1Z8WA 2DY9A 2OHDA 1U8SA 2LCWA 2KKHA 3RB0A 3DLEB 1FD2A 1W7WA 3R5DA 3J81Y 3NNHA 4UOGA 4KPYA 1W2BR 5CD4A 4I7FB 2J0SD 5IT9Y 3UQSA 3CJRA 1WI8A 4XIUA 1PUAA 1FDBA 2XMWA 4DG1B 4IH6A 3OLBA 1YI2S 3CC7S 4NCGB 2K3IA 3LWMA 2Q7BA 2BSWA 1VMBA 4NEYA 4DS4A 3VVTA 3W2WB 1TK0A 1C4AA 2VEZA 3AB2B 4DSLA 1JNRB 4DF4A 4UUXA 3IAS9 4AVCA 2MTLA 2ALZA 2H5MA 4ZI6A 2VXKA 4ZVTB 1S97A 4OJ1A 5KOXA 3LO3A 4J9OA 1R8HA 1CPZA 2VG7B 4DBQA 4L89A 3BF4A 4ZS6A 2O1PA 1MJBA 1YW4A 3WBZA 3KDNA 1GTHA 4CO3A 4O3RA 2KDOA 3GMGA 1FDNA 1V3SA 4F0HA 1DE4C 1SPBP 3CC2S 4A8MP 4UY8T 4K4VA 4ZVSB 1PIEA 2E1PA 2X1GA 4Q43A 4NRTA 2R2TA 4EZ9A 3FRYA 4UOHA 4P9SA 2FHKA 2DITA 4DV7J 5KFAA 2FJEB 4F0KA 3HPOA 1QAXA 1X10A 4A32A 2G0BA 3TUJC 2CJXB 3FEEA 2V94A 5F8NA 2JRSA 1Z4UA 2C2EA 2HQDA 4RLEA 3VGVA 4RW8A 2AJ6A 1KP6A 3D2PA 3BSOA 3UNYA 4LFAJ 4RW4B 1K0TA 1GMWA 3ZC4A 3NS7B 1RBAA 2CNTA 2X1FA 1VRUA 1WC1A 4YB5A 3JRUA 3Q8SB 1PJ6A 4ZJLA 2CNNB 2SXLA 3BR8A 3M32B 4Q0BB 4J7CA 2XS7A 4H4KC 4A2ZA 1YVKA 2FVCA 1WSRA 1NH7A 3R5BA 2QA4G 4K0KF 3CCSS 4ED8A 3CO9A 1QTNB 4JV2A 2DNYA 3Q8VA 4L72B 1MMNA 3DI6A 3I96A 2YNCC 4JI6F 3W5YA 6FD1A 3EZOA 2C6CA 2V63A 2VPWB 5E3PA 1LEOA 2FVRA 2XZWA 4IOAQ 1RT4A 4A31A 4W92B 3MN8A 5THWA 1FNOA 1WHYA 1J5EJ 3IWXA 3AODA 2PE3A 1FEEA 3VVUA 4K5SA 4LRFA 2F40A 3NFZA 4ZCIA 1RP5A 2XM3A 2HSEB 1KOOA 1S0NA 5B0AA 1CBXA 2B6AA 3FNCA 3ZZOA 2O5DA 3OT9A 2ZEDA 3H5XA 2AQ4A 3LGHA 3RAMA 4NZ6A 1QMUA 4NYZA 2BABA 4GRSA 4FKYA 3BDPA 4PXDA 4B9SA 1MJAA 3JSMB 4PG5A 1SJFA 2OMOA 3ITHB 4OYWA 2UXCF 3EM1A 1UEKA 1ZAXA 2PMZD 4CNYA 3I31A 4RW7A 1GK8A 3PW7A 1EAYC 2AV5A 1AA1B 4AQYF 2RHSB 4PYDA 1YK3A 2IVMA 3LTOA 2UXBJ 3BI1A 4C8KA 3HD2A 1IM4A 4OJHA 3QLHA 4ELUA 3HHNB 3AY0A 2E9RX 1ELMP 5G22A 4FNIA 5DS0A 2RT3A 1RO5A 1AT1B 2OU2A 1XEZA 3SDEB 1WOSA 1NSPA 2CNLB 2MQPA 1VHFA 3MUTP 4LIRA 2YQ1A 4C98A 5CBMA 1CC7A 1TKJA 2H3EB 4AXJA 4WFNQ 4ECTA 4P75A 4HNWB 3IS9B 4LF9F 3KR5A 2VQEJ 4DFJA 3KK3B 1BWEA 5ETRA 3H8FA 4F4KA 1FDDA 1B0TA 4H54A 2XGQA 2EK9A 4P7TA 3FECA 3AD8C 1F9HA 3QNWB 1PU9A 1NMEB 1YKWA 1ULRA 2BANA 5HQ8A 4PG8A 2EK8A 4Q38A 2CQGA 2OSRA 5CNPA 2GHPA 4LF6F 1T9VA 3OUYA 1RT7A 3HMJG 4A38A 2CPXA 3MDFA 4LF1A 5KFNA 3E2EA 3D7SB 3BM7A 3WIVA 2HHSA 5J1EA 3H8EA 1F9FA 1Y0YA 1UFKA 4C2ZA 2AZ3A 1P1TA 4KOVA 2ZC3A 4G1QB 5G0RA 2B5JA 3M1VB 1XNRF 3DLBA 1JLGA 2HC9A 3B3VA 3IWWA 1S10A 4O44B 4Z7YA 1QUVA 2Z3OA 4OYPA 4KTQA 5LYLA 4IR9A 2CUYA 4LBHA 2FJWA 4KLVA 3JAMY 4EUVA 4DL4A 3T5KA 8AT1B 2RKIB 3AD9C 3TWZA 3B4DA 1Q4RA 4G1PA 4RBUA 3GSIA 4NF1A 3SJGA 2Z3LA 1Z8LA 4BHQA 4OX7A 1N0UA 5C82A 2AP6A 5CZXA 3W8PA 3CJKA 1M5VC 2UU9F 2DNNA 4LVNP 2IRUA 2RUGA 1X9MA 3R2CJ 3EDRB 3MECB 2DKOB 1NJZA 4I69A 4KGKA 2DPTA 3OVBA 3NAHA 2HHHJ 1TXRA 5HVFA 4URGA 1UWBA 2Z4PA 4K8RA 3FEZA 4DR3F 1TKFA 4I49A 3F44A 2V8PA 4CLFA 4PK3A 4Q7AA 5CA5A 1HNZJ 3RBUA 1WELA 4DCJB 3FRMA 1EP4A 4ZPDA 4QYZJ 1M4LA 5IQ6A 3D6HB 2YPYA 3H7HB 4USMA 1YR0A 4LUBA 1IXKA 3F41A 1UWYA 2VG6A 3NY0A 2YNFA 3V8IA 3BDEA 1H8LA 2FLNA 2X3GA 4IH5A 4C3KA 4WK1A 3U7JA 2RF2B 3H25A 2EO8A 2W01A 1YVFA 3S8SA 2HLUA 1HPZA 2ZC4A 4PV6A 4NPOA 2KCWA 1RSCA 2GREA 4M1KA 1T9WA 1R6VA 1ZO0A 4K4XA 4Y34A 4OC0A 4B3MJ 2W7PA 4MCSA 1UW4A 3DDIA 4E8OA 1B0PA 3NAIA 2KVQE 2OB0A 3SFUA 4K4SA 2K2PA 5F9LA 2XSFA 5LXRA 3DOMB 2C28A 3FQLA 2WTFA 3CJ5A 4ZCKA 1FXDA 2OLWA 3M9OB 2EFNA 3GG0A 4R0EA 4OZJA 5KFMA 4F26A 1KLMB 8ATCB 2GGPA 4NLPA 2UVVA 2OPSB 1YRUA 2MMYA 4EYHB 1LWEA 2EVZA 3LP1B 1Q78A 1BLUA 3IBCB 4YDXA 3T1HJ 3D9BA 2XMAA 2PEBA 2WBRA 1XE4A 1GQEA 1LW2B 3PW2A 2BJEA 2DNLA 3D7HA 2WW4A 4KPCA 3NGDA 1Y11A 5KFGA 3KJVA 4X64J 1ZM3A 1IOFA 1S9FA 2W24A 4NLOA 4CAEA 2B4VA 1SUQA 5DDQC 1CPSA 3DLGB 4DX7A 1CULB 1SIWB 5K9FA 4IG3A 3M6UA 1ZM2A 1WSVA 4QIGA 2LQ8A 4KUAA 3NS6A 3CJ3A 1FNXH 1U47A 1XIXA 3KASA 3FIXA 5A2QY 4UCPA 1I51B 2HNYA 2GAGC 3HKZD 2DRBA 1R6YA 3Q8UA 2GNKA 2UUBF 3NE8A 3QGIA 3KZWA 1VCTA 1RXTA 5AE3A 2IAJA 3CMAS 2YNGB 4Z37A 2QMWA 3KG1A 3ISNC 4MFBB 3BO2A 4ED7A 4YQWA 5GAEI 4IG0B 5H86A 1T8EA 5F8HA 1EETB 2PJAA 3ZNUA 3DLEA 2VOPA 4UIAA 3WIUA 2ZH6A 2Y8YA 4QZVB 4HHHA 2LA4A 4RKUC 3C2PA 3F8KA 4EMEA 2XYHB 1VLYA 2KM8B 3BZQA 4BCAA 3VAHA 2Y0MA 4A8OA 3OTOF 2VFRA 1WG5A 3I9ZA 4F4WA 2LQBA 4KVME 1DTTB 4KC5A 5DM7Q 4X65J 1NHVA 1F9EB 4LRAA 5HXDA 4QJVA 3PY8A 1SI9A 3FF3A 2OZGA 2VICA 1WEXA 3W60A 3W2WA 2W1BA 3G9CA 3P49B 2QLJB 2M70A 4HDHA 1NSLA 4C9DA 3R5AA 1X0FA 1FVQA 3ET6A 3KLHA 1KVIA 4YDDB 1S6PA 3DMJB 2R8HA 4LFCF 4XPEA 2JZ5A 1P6TA 2WONA 1HW9A 4ZVQB 5HROA 1CLFA 4NRUA 4P4JA 5J2PB 2YQ3A 2XB2D 3CXPA 5K8OA 4NXMJ 3W9JA 4OV1A 2PVVA 3EGVA 3I87A 1GXTA 2I00A 1HNWF 4DL6A 3KLVA 3QQCD 3SJEA 2WBMA 4R5PA 4EO6A 5LSLA 4BD9A 1H72C 4DLGA 2M2BA 3EMTA 4QBJA 5DG8A 3ILIA 4DOZA 4ZVUB 2YNDA 2ZBRA 2V67A 1AUGA 2LQJA 3LD2A 3VAMA 3IG1B 3LOUA 1Y7EA 2OGUA 3MGJA 2DR6A 4QVTA 4MKBA 3NGUA 5L1IA 1FRXA 4Q45A 1LWCA 2D1CA 2E5GA 3MD1A 2IA0A 4KSFA 4DV3J 2G1HA 1YQEA 4DCOB 4FS1A 4N7TA 4JI7J 4YRHA 4PG6A 3V2UC 5G21A 3EVMA 2PMWA 4RPFA 3IC1A 2VFVA 4A39A 4IDKA 1FY7A 5E3RA 1VKCA 3WABA 4MK8A 3FUYA 3A8IA 3PYFA 3MWBA 3MAHA 2MQQA 3PZJA 1IICA 5HK4A 4MK9A 3M32A 1VJWA 1IBKJ 1JLBB 1BQNB 4DL7A 4E0DA 1MROA 2GO9A 3W64A 3GP9A 2V50A 4RNHA 1XIQA 2YWGA 3CW2C 2NPIA 4PWUA 3DRPB 5EX0A 3GJQB 1X5OA 4DNCA 3CUNA 2ERRA 4UFVA 1TAQA 4C0HA 1HWIA 3CPXA 1KVKA 2HVIA 1WDTA 2AEJA 3H42A 3QBCA 2ZBQA 1LRZA 2X1AA 4PCQA 5KG0A 3DOLB 4S0MA 4B17A 1U2RA 4OZ3A 2XGPA 2EXUA 3AJ1A 5KG1A 3UDCA 3G8WA 3LMSA 3MD3A 2Y9HA 1HR0F 4OC4A 3U1LA 3CCTA 4CM0A 4QBUA 2XEGA 2YGWA 4KSAA 1S7LA 2BUEA 2HNDA 4RUAA 2Q79A 3BEGB 3WT4A 3KG0A 2HVDA 3JSMA 2DK2A 3DCAA 1H98A 2PC6A 1HLWA 4P45A 4DHVA 5EDWA 9RUBA 1Q8IA 4YR3A 3SSQA 1H3DA 5CYQB 4QR2A 2QA2A 4B3TJ 4TNOA 3WDOA 3BQ2A 3HDSA 2AJ2A 4DN9A 1D9AA 4LSNB 1I3OB 2G9DA 3W1YC 1R57A 1EE3P 2GVZA 5EN1A 1ZA2B 4I56A 3GJSB 4TU8A 4B6ZA 2NXNA 5LL6d 4L3KA 2XYPB 4OYXA 4FXWA 4NASA 4F3MA 5DWMA 2AEMA 5AE1A 4B9VA 3GIKA 1DQ9A 4RWXA 3KK3A 2N82B 5ETVA 2QA4S 2R7XA 3NH5A 3OFFA 1WJ9A 4DUZJ 1FWPA 1XMOJ 3DLLQ 1S6QA 2HZAA 2PCUA 3MMBB 3C15B 4F2SA 3UFCX 3O3LA 1VC5A 3BI0A 4MRIA 2HURA 1NRKA 1NSQA 2H5JB 3C14A 5HN0A 4J9UE 2ZH5A 2DGWA 1JXVA 4YHHJ 3BSAA 3RZAA 2CQ2A 4DSKA 2QLXA 1N5SA 4K4YA 2NR0A 2F4FA 5B7WA 1PBAA 4QIFA 2D4OA 1JIHA 2RSQA 3LQVA 1TKXB 2Y1IA 1KBRA 4C2XA 3S6KA 3HVRA 2CQHA 1TF9A 1VDHA 3OR1B 4N56A 1TL1A 3FX6A 4OC2A 4FD7A 2W4PA 1IGBA 2QLFB 1PYTB 2P9GA 4K5RA 2ZPAA 4J9KA 5D4PA 2RS8A 4FBTA 4LRBA 1PJ7A 2M7SA 2AFWA 4J9QA 2IC3B 2VU5A 2KRBA 4ZVFA 4FVMA 2BRKA 4AE5A 5A6WA 3MECA 5GADU 5KFLA 4OHVA 4DQSA 2OPQA 4DFMA 1H38A 3VCDA 2F9JA 4JI3F 5KFPA 1RWOB 1BOBA 3RO0A 2YKMA 3FZ2A 3MR7A 3MMAB 1RYSA 4BMHA 1TKTB 3JQMA 2CQIA 3IWEA 3AFGA 3O2IA 4WFBQ 5D77A 2H48B 1RCXB 4TYBA 1B6BA 1KSPA 4UCMA 1WC3A 4NA1A 2D3UA 3V6DB 2PO4A 2IBKA 2R7TA 2J8NA 4D3HA 2RF2A 5C2GA 4XPDC 3A13A 2WPWA 4KGMA 1JXLA 1MN7A 3W5ZA 2WCXA 2HHVA 4Q36A 3JVNA 2CPDA 1NDPA 1CJUA 1IBLF 3W6XA 1TKZA 4JYWA 3D0HE 4RJVA 3PP9A 1RA7A 3IM8A 2A4NA 1S1XB 3POTB 3R5GA 3CGIA 2RDDA 1RK8A 3N01A 4GXHA 1AZSA 2R7HA 1AROP 4TQSA 3B82A 2Q51A 2RJZA 1NJWA 1TMMA 4X4RA 3NGSA 1XJWB 2GHWA 3EGNA 4H4OB 4DDFA 1G2EA 4XNHB 4PPZA 1K4JA 1WKJA 3FBUA 1VQ8S 2CJBA 2GFQA 4NLVA 5LMUJ 1ITPA 4TWEA 5FD1A 1H74A 3OBIA 1F2HA 2HFNA 4GMKA 5ETKA 2HHUA 2CPIA 1S12A 4OZ5A 2HRTA 3BBFA 3ETOA 4TKTA 3D68A 1IJEB 2V2KA 1C4CA 3I4HX 4X65F 2P0WA 1DLOA 1UAWA 4ZY2A 3TFYA 2HS3A 2MKSA 2NYIA 4WK3A 5EX3A 4X62J 2VZZA 2A1BA 1Y7RA 1LW2A 2XEJA 1JLEA 3FXTA 5G1ZA 1HWJA 4TN2A 4UOFA 2ZHOA 3BREA 1YZ7A 1Y10A 4DV0J 1X4AA 1VBXA 5C24B 4OZ1A 1RYRA 5KT6A 1JJ2R 3FEXB 3SBMA 3ZZ0A 1O51A 2VQFJ 3LALA 4KRWA 2HYIB 3DLJA 1T9YA 2DXEA 2DGXA 3GSDA 4GKKF 5C2CA 4UA3A 4MFKA 2AYMA 3D4UA 3LF0A 3M2RB 1Q2YA 3NCQA 1S0VA 4QUSA 4U67Q 4L3NA 2M52A 4C8YA 1BGXT 2ZH8A 3KG4A 4J90A 2JLFA 2YNGA 3P5TL 5IT0A 5J1QA 1KFSA 4MT1A 3CC4S 1SJ3P 3ICLA 4FF1A 2GQQA 4WPAA 4I2PA 1RLCL 1EETA 4ORFA 1OY8A 2IVYA 2Z2ZA 3O8WA 4MFPA 1S48A 4PQAA 1J2VA 3GU0A 2MZJA 4RI1A 1VBYA 3NH8A 3FNNA 1WEYA 3OXLA 1U25A 1GH8A 4AG7A 3TAMA 3RU0A 1Q7LB 2RB7A 1VJQA 1UJ5A 4UF4A 4D3GA 1R89A 3BO4A 1KOHA 2FT0A 3S6EA 4EI2A 4OAEA 2B9WA 2QSFA 1VQSA 4RNNA 2KH9A 2AEFA 2LXFA 2V0NA 3MM5B 3DMJA 3TUPA 2CNSA 2C6GA 2W25A 3CXQA 1T3OA 4AFFA 1U4BA 3RBDA 5M2PA 2D7SA 1F5BA 4O23A 3SQGB 3TARA 4RUHA 2MZTA 3DGPB 1R0AA 1D1UA 3A8EA 4TLQA 3CJ8A 4EK2A 1SQHA 2DRDA 2HQIA 3BXMA 5F0UA 3HFKA 1JLCA 4ZN3A 2ASJA 3DR6A 5L39A 2EFOA 3CDEA 3NKYA 3S9NA 2D69A 3MM9B 3LP0B 1CJTA 2BBEA 1HBOB 2DR5A 2CQ0A 3IMQJ 1IJFB 4JOUA 1FKPB 4DX5A 1YW6A 1FTRA 2I3CA 2XY6A 2DYAA 3R27A 3GFZA 3D66A 1TVRB 1A2ZA 1HWLA 2RH3A 4C0OC 5KFBA 1FHTA 4NLXA 2ACYA 2NLWA 1RKJA 1UA0A 4M63A 5KFKA 2YNCA 2FJVA 3W7BA 2WB4A 3RRKA 2B51A 2EFQA 1U7LA 4KH1B 4JI8F 1XMQJ 3IGVA 1H6KX 2FDNA 4KKOB 2FC9A 5GADI 4AYBD 4F4ZA 3H0PA 4H6ZA 3BSCA 3IXQA 4TY8B 2L08A 3TVYA 4JD6A 4CYNA 2MYFA 2IDEA 5LT5A 4OADA 2JFDA 1S0MA 3DC2A 3SQOP 4OC5A 4FD6A 2F9DA 1N34F 3M30B 3AH6A 1GYTA 4JI4J 1VK8A 1R0CB 4K50A 3LAKA 4WWSA 4ZY0A 4TVAB 5D8HB 1LNQA 1CPXA 3ZZIA 3EJMA 5GCNA 3WC2A 3R9EA 3UD4P 1DJ0A 1UVKA 3K9TA 3OQ2A 2Z30B 2EFVA 5JM6A 1VC0A 3OSNA 4DSEA 3I0SB 1F1BB 2BKNA 5GMDA 2WVCA 3HZGA 5FLXU 3AAWB 1U6MA 2IVFB 1T11A 2QMLA 2J6UA 4JZ0A 6AT1B 4NZ7A 2REFA 3P4UB 4RUBA 4CLLA 4WKRA 5CH7B 1WF2A 1NK6A 5AG4A 2IYGA 1NKEA 4CQ1A 3HJFA 3UPFA 1GMVA 3BGRA 2JLGA 1GX6A 3JAMU 5JH9A 2CAJA 1FFWB 4F4AA 2ZDOA 3OVAA 4DPTA 3W61A 4CYUB 2LLZA 3UDLA 1U2CA 4KJIA 4NZ0A 3S9LA 2GIQA 4LSNA 2M3DA 2H1YA 4HACA 5KAKA 3VH9A 1FXRA 5T7LA 3QO9B 5B09A 4MCPA 2R9LA 2JL9A 1JKHB 4DR6J 1S99A 1LAMA 3TTHA 4EWTA 1T94A 2NUHA 1DZ5A 4ILMA 3BBBA 1I94F 4JI2J 3HK2A 5CPAA 1P1LA 4OKOA 1TR0A 1XWLA 2PQ8A 3H8GA 2NXUA 3TOAA 3HD1A 2PFFB 3FSXA 4J9RA 2QL5B 4K2JA 1WWHA 1UZHA 2POKA 4YOEA 3W66A 1MLAA 1GX5A 1HARA 4JBCA 1C0UB 2VB6A 2PR8A 4NCAA 1H7XA 2HRYA 2BJ7A 3R9LA 2FVGA 2GJFA 2C2NA 2IM0A 2H51B 2VBZA 3C15A 2LECA 3S6HA 5KFRA 4KIAA 3TANA 4B02A 2C2KB 1WDDA 3ZTRA 3L7UA 2VBWA 1U2FA 1EQMA 4DPWA 1FNMA 1Q5VA 4NGPA 5A0YA 4KGZB 1HQEB 2V2VA 4ANCA 1HBUB 2CQBA 3PX6A 2EC0A 1EJ7L 2HW3A 4NX9A 3J80U 1PBUA 1TKXA 1EQ0A 1HIYA 1CVJA 1CS4B 2WZNA 2F8MA 3M2VB 4F25A 2XSJA 4LFBJ 4F67A 2GVDB 2AGOA 3NMRA 2ZOGA 3NLCA 1Q5YA 1QDUB 1L0CA 3ZFVA 1PYTA 4DV4J 5IB9A 5JJBA 4G65A 1NZ8A 1VQMS 2FD2A 2BRLA 4OI6A 4WYWA 4H4MB 4F50A 3PO4A 4OIDA 3MR6A 2CPEA 3M8RA 1RADB 3H4QA 2DNZA 1VS3A 1YBTA 2L41A 3QT6A 4ZIWA 3GWCA 5C25B 3UR0A 1RWMB 2WYRA 3MEDB 4DI6A 3CIMA 3C3LA 5HVGA 4CT9A 4FWUA 5KFUA 5DDPC 1B3TA 1RT6B 5BR8J 5BYRA 2N7YA 2W2QP 1K47A 3GTYX 2AFOA 4PXEA 4DL5A 2OOTA 3CJ2A 3QRPA 4JI0J 4OHYA 2MLZA 3Q8RB 4AT1B 2AFMA 2F5GA 2FJDB 3OFHA 3M8PB 1N5YB 4HL9A 2PIYA 3JB9k 4B3SJ 2BJDA 3W9IA 4ECRA 1U0HA 4OYZA 3CJTA 3K5PA 4Y2AA 2K1RB 1UCNA 1YTYA 4LR7A 4IKAA 1KQSR 2B8QA 2MKJA 2UUWA 4WKYA 2Q1LA 2VD3A 4M5LA 2P8IA 2XG8A 3CDUA 3KXDA 3OXGA 2QIRA 5JVGQ 1T95A 1RKIA 3CD7A 4LSLA 4N5SA 3IAM9 3T1AA 3X3UA 3B54A 1BPNA 2BM0A 5IB0A 4FYWB 2HS4A 2ZEOA 3QRRA 1RAAB 3D5MA 3VAGA 3JYTB 1F5AA 5D3GB 2ABYA 4U9YA 5D0HA 2KT5A 4R8UA 2HMIA 2L9DA 3PCOB 4N76A 3NGKA 2BOAA 4KOUA 3GILA 1NK9A 5DWNA 1N88A 1WF1A 4KV8B 4M94A 5LSOA 2PDOA 1IKWB 3KLGB 5KT5A 4N8NA 5IWAF 1P9YA 4TLRA 2QYGA 2R7UA 4II9A 4WU3A 2G13A 3D6MB 3CWJA 3VQSA 1SL2A 4LREA 5B0DA 2UVUA 2CF4A 4PWDA 4RW6B 3R9FA 3D2WA 2ZJRQ 5BWAB 1HEEA 4IUSA 2UXDJ 1LW0B 3FRZA 1G4CA 1OSCA 1RAFB 1OS5A 1QD1A 4LIWA 1S6UA 4V1Ak 1IR2A 2IFXA 4NXNF 3JTNA 3WX8A 3ENVA 5AXMA 2KXHA 2CJKA 3HFZB 1UWAA 1B87A 3EC4A 3UY5A 1NZAA 5C24A 1LQ9A 3Q89A 2IPOB 2O53A 1EB0A 3HX9A 2P9CA 2DH8A 2DRAA 2B9XA 5AT1B 3LP2B 1X0PA 4N77A 1VQOS 1YQHA 1YLOA 1FKOB 4HH0A 1T0TV 3BGFA 4CGNA 3ZTQA 3PW5A 3TQ1A 1IU8A 2R7WA 2UP1A 1SC1B 4B5PB 2MQMA 2RMLA 1YG0A 2AIRB 2BDPA 2V9WA 4ZVHA 2EG1A 5E7OB 4OP4A 4LF7J 1V3ZA 3GLJA 1JLAB 1SV5B 2RQCA 2KZMA 1QM9A 1OZPA 1KZFA 2FLPA 4DSIA 3T1YJ 3Q83A 3W2VB 2UUCF 5IM0B 2R2RA 3PHTA 3CD6S 4KHRA 1DHMA 1U6BA 1HBNB 2IYIA 1KEKA 3IO1A 4OI0A 4Y65A 2H4YB 1ZG7A 1S3ZA 2RHQB 4KGVB 2ZM6F 2IBOA 1YITS 1KNZA 2I79A 2K06A 1J4JA 1J5OA 4Y00A 2I5JA 4AXVA 3KK1B 1MWYA 1V5VA 2JH3A 2MGZB 4K4ZA 3GYGA 5IX3A 4KR0B 2W9CB 1NPPA 2QRRA 4MAKA 4OYIA 1S7IA 1HYSA 4NCBA 2ATCB 4JI1J 2I8EA 2DH9A 3V7ZA 4MYUA 4Y0FA 2B8PA 3A3NB 2IJRA 1XOVA 1YJVA 3PTWA 3KNAA 3T90A 3EXYA 5HSPA 4M5MA 4B12A 1TUVA 4CT8A 1KD1T 4CAWA 4PPDA 4RNFA 4AL6A 1R8PA 3RYLA 3MM9A 1X5PA 3PB7X 4I0WA 1ZAVA 1RWWB 2HWIA 4P6QA 3TAQA 2FVSA 1IKVB 2XC9A 2JVOA 5AG7A 1FKPA 4MBUA 3L9ZA 5DS7A 3MEEB 4GVLA 3P6YC 2MKCA 2XZDB 4KO0B 3EGWB 2CJYB 3OHBA 1GXLA 2VBQA 4GVBB 3DDKA 4MFLA 2MKHA 4PUOB 2ZD1A 1S4EA 1TZ0A 1NJYA 4FXVA 3CMES 1VQ7S 4TU7A 3PYEA 4DR7J 2DJWA 4WXOA 7FD1A 4DV1J 3R6GB 1VI7A 4ZP8A 4KKOA 2YWWA 1RLDA 4RBVA 4CGOA 1KQKA 4NGSA 1R8BA 2VONA 2HIQA 2V4JB 4ED3A 3NS5A 2B4DA 2MKKA 5J2MA 3CNQP 2R1IA 1Z8XA 4RS2A 5E3AA 5ETOA 4PEOA 2EKYA 2VV5A 2N3LA 3MHYA 1PSDA 1N71A 1BHNA 3DYAB 2KRRA 4WIIA 2HG4A 2P6SA 1TIQA 1PYSB 1XN9A 3OJUA 4DUYF 3QWUA 4MHPA 2FS5A 2DIVA 4AB7A 2W8LA 2WSAA 1AUSL 2Q6BA 1RTHB 1ZLHA 3GG1A 4A48A 3E51A 2B5GA 2RC4A 1ZTWA 3TVZA 2M8HA 1QSRA 3T3FA 1F2PA 1Z2LA 2GV1A 5GMEA 1BO4A 3QB8A 1E6YB 2G4BA 1Z4EA 1Y00A 3DOKA 2OPPA 4NLSA 2J8MA 4UQTA 3FQKA 1F6TA 3HHLD 4ZDNA 1KQFB 5J2QA 5A8WB 3N28A 3M8QB 1YLXA 3W65A 4HI2A 3QGHA 4DL0C 4CYUA 2FC8A 4M5DB 2X7IA 4JV5F 2JDCA 1R7IA 3S9MA 4NGMA 4N47A 1Q8LA 2EWBA 1FK9B 2R8JA 3RW7A 3RB4A 5JXSA 2FJBB 1VHEA 2QEXS 3QO9A 3TI0A 2OO4A 2VL1A 1SH2A 1FD8A 3C6UA 4JUZA 4WFYA 2MSSA 1H2VZ 2YNIB 3QAUA 3M8SA 3M2UA 1HBMB 1K1QA 2DNPA 4CO0A 1YMEA 2B4BA 3H5ZA 3EPGA 1SC3B 3G2XA 5BR8F 1IKXA 5HBMB 4C7IA 2WVFA 1Z2ZA 2OEJA 2ZE2A 2RRBA 4KFBA 3X1LB 4K0KJ 2JC1A 3K8VA 4LJMA 1TL3A 4PSXA 2DPJA 4ZX9A 5HH1A 3CSKA 4JI6J 3FEDA 1NK8A 4BC7A 3DRSB 4AUKA 4ELVA 3IIBA 3WC5A 3N4WA 4AL5A 3C19A 5AJ3F 1S4FA 2LEPA 3G87A 2ATRA 3SCKE 1NE9A 2QMUB 5KFIA 2CPFA 2F7VA 3QNVA 4DPOA 2V8DA 1HBUA 2ZENA 2GA7A 2E7XA 2GZOA 3TRGA 2OSQA 3CIZA 2CPZA 3EVOA 3TO9A 3DNCA 1KLNA 2FB0A 4ED2A 2GIVA 4DJBA 4DU7A 2CJAA 3L7OA 4JB8B 4CWBA 2GVDA 3QPIA 2RIJA 3S01A 4WTOB 2N4CA 2A3JA 5IV0A 5K8NA 2ANPA 5EHHA 2I0XA 3HKWA 3SV3A 2FHOB 1TAUA 4J9VA 5IQQA 5ISVA 3L2NA 1RT2B 2ZW7A 3M05A 2ZHBA 2VFUA 2VA2A 2I6WA 4XO0A 4NLUA 2UXCJ 3K5LA 1U1MA 5HMXA 2C3OA 4AD6A 4RW9B 4ZN1A 4AQYJ 2AYEA 2QL7B 2BA9A 3GFHA 3MOZA 1WK4A 4CH1A 5C25A 1N33F 5LRGA 4NLQA 3MEDA 2E5LF 4CPAA 1CG2A 4P2SA 2V34A 2R7RA 3KHXA 2FZGB 4TNUA 2FGOA 3SV4A 1EKRA 4G3IA 2VODA 1IN0A 4K4WA 3TYTA 4NSQA 1QSOA 5M2RA 2X3DA 5HVHA 2CQ3A 3QAYA 3T6BA 1IQZA 3N6MA 4OZ0A 5ITHA 4LF9J 2EI5A 3DXSX 4E2AA 5HL7Q 3UN5A 4XAKA 4OJ3A 2G2YA 1TFYA 1UW9A 2HQGA 3PDNA 1RBOB 1DBDA 1NEEA 4U8VA 2PJ8A 2C2ZB 4ZBGA 3FFIB 2C3YA 5ETSA 1L5UA 2LQ5A 2YNHB 4LF6J 1YJ9S 5BJRA 1KFDA 1EKSA 2A2DA 3TZXA 2RQMA 4C2MA 1XR5A 2B3VA 2ACMA 3TT2A 2PIIA 3JYTA 4U96A 4OMFG 5D3GA 2RS2A 4QOTA 1NDLA 2AJ1A 2A2CA 1MMLA 3IWGA 3Q8PB 1CP6A 1LFWA 2BCOA 1XRYA 3PFOA 5LMNF 3OR2A 3TZWA 4IO1A 3HLPA 4GC7A 2W9AA 1XNRJ 2BE2B 3GYXB 5KFTA 1SKUB 5K14A 1FESA 1K73T 1T05A 3D3CJ 4Y2MA 2CPJA 3GE9A 4A8QA 3HZEA 5LM7E 2ZOMA 1KUXA 2XI3A 3WC0A 3QWPA 4YUDA 2C42A 3IU2A 3UWTA 1OYDA 1TL7A 1X9SA 5EGYA 2Z3NA 2EC2A 4R87A 3JTKA 1S49A 2CVEA 1Y5IB 4F4XA 2HBRB 1FXLA 2UU9J 1C0TB 5EUHA 2XEFA 2IJFA 4DU8A 1U1NA 3MM6A 3JSYA 4IQXA 4DR3J 4A30A 3B3WA 4QU7A 2MKIA 2QIFA 4FZVA 4YFJA 3T19A 3PO5A 2LQ9A 3VHQA 1E6VB 4OX9F 3VWSA 5A8RB 5H9EJ 2F1FA 2WAQD 3GJRB 1UPMB 3K2YA 2FQQB 2HGMA 1S1VB 3G8SA 4FYVB 2H4WB 5K5MA 4H2KA 1CX8A 1U0SA 1EARA 2IRXA 4CYOA 2P6FA 1DARA 2Z57B 4CLUA 3J7A1 1KTQA 1YDLA 2DCUB 2IHR1 2XMJA 2DNKA 5L9XA 4FBUA 4HVZA 1RE1B 3QMQA 1JWQA 3NBPA 3KLEA 2RNEA 5ETQA 5A6PA 1X4GA 2V2ZA 5MLCV 2J8AA 3R97A 2ZW5A 1T9XA 2HBQB 4CLZA 1PYOB 1NK4A 4N8OA 1RXOB 3QJJA 2MLYA 2JDDA 3W2VA 1QUPA 4URQU 2ZDPA 4QWDA 4XDDA 2N4DA 2JEWA 3SZ2A 4DR7F 1LWXA 5E33A 3GV5B 4CS0B 1B70B 4B5OA 1RABB 3HHKA 1X12A 3CCLS 3THVA 1NJIT 4ZGYB 4YEAA 2NQPA 5IT4A 1PGZA 1K9MT 3IGRA 5LRKA 5C7PA 3A12A 1VQ6S 2AMCB 4ECQA 3MCSA 2JBKA 2Q43A 2BW2A 4QWCA 2RRNA 4E98A 1QAYA 4TYAA 4O3OA 2ZJQQ 1QAJA 1R27B 4OZ2A 1MJ9A 2Q44A 1C1CB 1HNVB 2KG0A 3BLNA 1HMVB 1NHKL 2JBJA 2ZH7A 2Q6CA 4LT6A 4ZHRA 2KM8C 2KYZA 3VF0B 1RTDB 3SJFA 1TMJA 4IO9Q 3OLAA 1S1TA 2FJXA 4X4PA 1SQFA 4BC9A 3KGQA 4PKDB 2NMTA 1BQMA 1CJVB 5ADZA 1HQUA 2G0CA 3JSRA 4ZPVR 4F9VA 3V6HA 2HHPA 2WHOA 1WHVA 1VIXA 1CJKB 4YY3F 1N32F 3MM7B 3KLFA 1A7GE 1OY6A 1IWGA 4NI2B 1Q2CA 1LXJA 4USVA 3KK2A 1FERA 3MPYA 2UUBJ 2J8SA 2Y8WA 3UVJB 2AFXA 5KG3A 4OZNA 2FZCB 3VARA 1WOPA 3PGPA 3OTCA 2UUAF 3DRRB 3MM8B 3PW4A 1ZLIA 2YY3A 4K7QA 3MMCB 2AT1B 2DD8S 1RTZA 1VRTA 2CDQA 2UVRA 1L3TA 5KG2A 3I5AA 3KDOA 1SJ1A 3J7Z5 5B0BA 3PBEA 3UCZP 2JEVA 1CC8A 3QJLA 1NK0A 1R0BG 3PYDA 4RNMA 1RHUB 1JLQA 2CFXA 2BJ8A 5JUMA 3OTOJ 3ZTOA 4B3OB 1FWKA 2JVRA 1HI0P 1WTBA 3IR5B 4UOCA 4B3RF 1JJHA 3EPIA 1JLFA 5B0GA 2YH0A 3TZYA 3EO4A 4L8AA 5IZHA 4JLYA 1TP7A 1QE1B 1WKLA 3G8QA 4X2TA 1U1PA 1S7KA 5AG6A 2JFKA 2V8HA 2R2SA 4ONUA 1WG1A 2PT0A 1RTIB 4LFCJ 5DETA 3FMCA 3TO8A 3LGMA 1CEZA 2JNJA 3T8WA 1UA1A 3HHDA 3HHLB 5IFMA 1OQ3A 2VH7A 1BLLE 2IM2A 4CTAB 5CYMA 1QVGR 1RT5A 1S9EB 3GUXA 5LOQA 1RJJA 4NMLA 2XLIA 1HNWJ 1DTQA 4OYAA 3M8ZA 2VJVA 3V4IA 1ICEB 4WCEQ 5E0OA 2AHOB 5HMYA 2ZXVA 2HVHA 4DFPA 2NXJA 3TUZC 4I4BA 3MFHA 4OIWA 4U8YA 4HPSA 3B3TA 5FDLB 3M8QA 2F4VF 1Q95G 4DPXA 1H2TZ 1SH0A 4W90B 4UW2A 3D3BJ 3K17A 1RDRA 4HNYB 3BV8A 2C3MA 5GAEU 3IP0A 3G8TA 1YRTA 3CDAA 5KT3A 4OMEA 3HVTB 2K3KA 3OVSA 4J9SA 1KR4A 4L73A 3V81B 1BPMA 4C68A 3UNGC 4P4BA 1KKHA 3A3PB 1VGYA 5JMNA 3HO1A 3D54A 4Q2LA 3W62A 3BS9A 2N7CA 2GFFA 4H6UA 1QSSA 4URSA 3C46A 1T03B 2JHEA 1D0EA 2WRMA 1FRHA 5KFOA 2WSEC 3CJQA 2PJ2A 2EFPA 4CO5A 2M0GB 3GIRA 3EICA 4PABA 1FKAF 1NJXA 3R7SB 2PIZA 1OO0B 3GCXP 2GANA 5HAOA 2QFIA 2D3O1 3PG9A 3UR3C 4DJLA 4RO0A 1NO8A 2LMIA 3GR0A 5EWGA 1B99A 2NPFA 3HT3A 5KG7A 5FVJA 2HZCA 1S1UB 3HSZA 1MU2B 1NLKL 2EKNA 4CAXA 1HR0J 1UL3A 2H65B 4NJRA 1PO6A 2ZH4A 3HP6A 5IS2A 3I0RA 4KUBA 2G0IA 2FL4A 4CAVA 5I3UB 1XNQJ 2XEXA 1C1BA 1RWVB 2VBYA 1KDNA 2CQCA 3AB4B 4JYAF 1NKBA 4M5KA 4OHWA 3NP5A 4K59A 3N0VA 2YX7A 2ZH2A 5AGEA 5HP1B 1FX2A 1IR0A 1APSA 4CYPA 4WP8A 4DR4F 2DXFA 5CABA 4LUAA 4AG9A 1HNIA 2BUNA 2W4CA 3I1UA 4Q44A 4KOWA 3K0JA 5CYJA 2M5YA 3K8WA 2BQUA 2B9YA 2H5EA 2GMHA 3HM9A 2DEAA 3PRVA 3NCRA 5BYQA 1FFSB 1IKYA 2ROGA 4IRKA 3J7YU 3OL6A 4CM2A 4X4UA 4UZBA 3QIPA 2RFHA 4PYAA 4HHUA 3CXSA 3R8YA 4DX6A 1U45A 4WFXA 2MHNA 4OHZA 4UZCA 1RB0A 3A8KA 2ATLA 2B56A 3P2HA 4U7UD 4MHNA 3EX7B 4X8IA 4A4JA 3TAPA 3ILLA 4LBPA 2DNQA 3D0IE 3GIIA 2CXEA 3UD3P 1JNZB 2ZEGA 4HTJA 1KTVA 3ZJ0A 1TL4A 4KSEB 4ILLA 1YREA 4A8WA 4CZCA 3LAMA 5E3CA 2AGPA 4C11B 2L48A 2CJ9A 3DM2A 4USTA 4Q8FA 4ZPTR 3QZ7A 4UFXA 3TO7A 3MR2A 1IBMF 1GT8A 3W8GA 4U7UK 3G6VA 2ZBPA 2XS2A 4BWMA 3KQXA 2APOA 1QSNA 1B0VA 4ELTA 2FHJA 1REVA 4ED0A 1RT1A 1XEBA 2LFVA 4UIBA 1XMTA 3SMZA 2ZKUA 4MY0A 4RW8B 2J0WA 2E44A 2B58A 5E2QA 5CD4H 3T5LA 4QIWD 1VR6A 1EZZB 1LWFA 2J9DE 3VQTA 4NFRA 1VRUB 2DHAA 3RBEA 3CCES 2VG5A 2VZYA 4R25A 2CZ9A 1GEHA 1S59A 2QVPA 4Q5VA 1U6FA 5D15A 2MJUA 3D6TB 1D8ZA 2M88A 4JI3J 2R8VA 1IY7A 2OD4A 4U7CA 2XO7A 4JI5F 2NZCA 4TXSA 5F48A 2G1DA 1WWZA 3U1MA 1IBCB 4ED4A 4XNHC 4FD4A 5LJ3Y 3KMSA 3PR4A 1M5PC 1WG4A 4YR2A 3HXMA 2FVPA 2HNZA 3IR6B 4XPCA 1RT4B 2B4UA 1RAGB 2W7AA 2RILA 5A8KA 2C22A 1TU0B 3OFEA 3TX0A 3EXNA 1CM0A 4IYQA 2KG1A 3TQEA 1Q8BA 4MTPA 4HEA9 3SYZA 5D6GA 2YKNA 5EC4A 2V6AA 3PBBA 2R4FA 2D74B 4LF5F 2K7JA 3OL8A 1IBLJ 1OJ4A 4P4EA 2ASYA 2QZ8A 4E8UA 4ES3A 3L09A 3G82A 3PKMA 4ZVOB 4EYIB 4M5HA 2XZTB 4RW7B 3KTQA 2KHCA 3KHRA 3NWRA 2Z56B 2R7SA 4B14A 2OPRB 4RUCA 5CZVA 4JV1A 4NLTA 3B3SA 4DEZA 2XS5A 4I7FA 1URNA 3QLHB 3MCNA 2P6TA 1Z4RA 4P74A 4ECUA 3FYNA 3TEHB 2WVBA 2IM1A 4CH0S 1N5QA 4DG1A 4DFKA 2ZFHA 4U95A 2YKAA 1Z5RA 3IR7B 2DF5A 4CO4A 2WZ1A 3JTOA 5AXNA 4NCGA 3A3OB 1ZOTA 3TJAA 3D67A 1ZTTA 2AYGA 3H90A 4MKYA 3PB8X 1HHQA 2RD5C 4ZJQA 2COLA 5ETNA 1S72S 2G0JA 1HNXF 2J0QD 2VASA 1DQ8A 4YWYA 5DZ6A 3SXOA 4ZP9A 4YB1P 3ZXWA 1Y9KA 4ER8A 2PJ0A 2QLWA 7AT1B 3BB5A 1GHEA 2DXDA 4GKJF 1N36F 2BYCA 4X4TA 2Z2YB 2VG7A 1B4SA 2BANB 1L3SA 4FYYB 2VI7A 2IQ6A 1RT7B 3AOBA 4GKKJ 2LKZA 1F60B 1DURA 2HVEA 5J1EB 3R95A 4I6YA 2PJBA 2PSWA 2ZVSA 2LYVA 4DPUA 3CXCR 5G0RB 4EMDA 1ZAWA 3H2LA 2B5JB 1FJGF 4C8LA 3RR8A 3HUVA 2ZWPA 1JLGB 2GO8A 1S7NA 1JXEA 3M8WA 4M5NA 2QFJA 3IRWP 3D7GA 1KC8T 4WFZA 8CPAA 4DN0A 2CQ4A 3JUWA 3FBEA 4UBRA 4F6AA 2E5HA 3MMCA 4ZVEA 1VQ5S 3PJ9A 4WP3A 1KUVA 3KLIB 3R96A 2HKEA 2VC1A 2PJ6A 3NG8A 1GXUA 2CZ4A 4CO1A 4QWEA 1TUWA 2CNMA 2HHQA 4RU2A 4DMZA 1ZPVA 2W2MP 2FE7A 4RW4A 3E3XA 2ZHAA 1Y0RA 4ZA1A 1HI8A 2FCKA 1ARLA 3OHAA 2GAHC 4MCQA 3GV7B 2XY7A 3J7YI 2X7BA 4Q0BA 1SJ4P 2Y0SD 1R8AA 4L76A 4KHPF 2GW8A 2KYXA 2DNGA 3KWMA 4ZMMA 3QFHA 3TR5A 4L74A 1RTIA 3TA0A 3I5BA 1JX4A 4DX8H 3ISZA 2DY1A 4XPKA 2A6OA 2VG6B 5L46A 1S9EA 3HSDA 3V4MA 2JOQA 2YNFB 4FPIA 4X66F 2J5AA 3DHXA 1IR1A 2IRYA 4CLPA 4FS2A 1S76D 3J7AN 3H40A 3ILOA 2P6GA 1OY9A 1HPZB 3HHEA 2UVWA 4HKQA 4JP8A 4KHMA 3MAAB 5DRKA 2F8HA 4U5YA 4HT7A 4OIXA 1W2IA 3G86A 4HHJA 2D4PA 5D0RA 3JS9A 2XTJP 3WR7A 1NB2A 1I12A 2XNQA 2ZH1A 3MPVA 2WOMB 1SL1A 3OW2R 1XNQF 1XJOA 3BH6B 3GIUA 1RU2A 3C16B 5IC6B 4A95A 3ITHA 3EWGA 2ZZTA 4P4DA 3IBWA 4DV6J 1NH8A 3GONA 4USWA 5T14A 3D2MA 3VWDA 2VFSA 2IDLA 4MYTA 4RNOA 5D8NA 1QSLA 2PRBA 1UFWA 2CG4A 2ZWOA 4JI8J 4B9MA 4OYBA 5F8MA 4Y2IA 1IIDA 2OMLA 2Z0ZA 2J8RA 3SDEA 1BXNA 3FJUA 2X1BA 2GGPB 5EWEA 3B4MA 3MFIA 1M4GA 1LWEB 3DDNA 5HI7A 3MPDA 1X60A 3L4BC 3SI0A 5KFZA 1O6XA 3ZTSA 4C48A 5KFSA 3L3CA 3IS9A 2PC1A 2R7QA 3RBXA 2E29A 4C8MA 1N34J 3UE2A 2PI4A 2KFYA 4P7VA 4ES1A 3KJVB 2C2OB 4J3GA 1AXQA 2AF6A 3MPUB 1URRA 1L3VA 4KB7A 1SUQB 3R7BB 4FYXB 1SJRA 1KONA 4DWIA 3OV7A 1BD6A 2MLXA 3TOQA 4QWAA 2XNRA 2C3UA 2XQCA 2QECA 3NE7A 5D4NA 1N6QB 3K57A 3VGSA 3SI1A 4DYOA 2HNYB 4DPYA 2CQ1A 1BE4A 2FIWA 4UT4A 4G1QA 4OLLA 3M1VA 5C88A 5J8FA 2B9EA 1OIAA 1NMTA 4I64A 5E5NA 4M6HA 5L1KA 2BJ9A 4O44A 2HQ3A 3PXGa 2XMTA 4Y6IA 2QE5A 5HP1A 3DSBA 1X5SA 5F3TA 1QLNA 1XC9A 2E9TA 2RKIA 4P2MA 3UCGA 3RB6A 1L3KA 3BPDA 3R7NB 2R7OA 3EUNA 5J8CA 4IFYB 4C7HA 2XHCA 2EG2A 4KH0B 1OPZA 2MY7A 1QVFR 2OP5A 4OX8A 2LDYA 1YIJS 3LUYA 2CNKB 1UJ6A 3PV8A 4GM5A 1I94J 4Y2KA 5KT2A 3MEGB 4DUTA 2KJWA 1DTDA 5HJXA 2YH1A 2AJQA 3G6XA 2L9WA 2G2ZA 2R3VA 3ET6B 3KLHB 1EHWA 4MK7A 5F8LA 2XHWA 4UEEA 3PX0A 1S6PB 1W25A 1LK7A 4UUWA 3UN3A 2AU0A 2ZH9A 4O3QA 4WFAQ 2WONB 3VWEA 5HROB 3PB6X 3QT7A 4ECVA 4ECXA 4TU9A 2I38A 3WHIA 4C8NA 3VTIA 2BVZA 3N9UC 2O67A 4B9LA 4MKAA 1YBUA 1ZG8A 2JLEA 1YZ6A 4R5PB 4C11A 3RR7A 1NBEB 5LYIA 4ZIVA 2B3TB 3KOAA 5CCMA 1RWNB 3H2VE 2DNMA 1M5SA 3I3GA 4U9RA 4LF4F 3LWUA 4PG4A 1F3FA 3MAQA 3I56S 4K3NA 1OBRA 2KI2A 3NGRA 4IQMA 4ID5B 2C1CA 2REEA 2AYBA 4KT0C 1LANA 2XEIA 1LWCB 2JEIA 3DDDA 1VYAA 3FMWA 1SL0A 1RT3B 3LA0A 3FBBA 2XWYA 3KUHA 3J81U 3EGZA 4MFZA 4LF2A 3DOMA 2HRUA 3DNSA 2VUGA 2G3TA 3PX4A 1VIOA 4IDKB 4ZVGA 5IT9U 2RU9A 4CYQA 3FCWA 1HA1A 1GMUA 4EU0A 3Q23A 2HS0A 1GTEA 2ZKTA 4O4GB 1T3NA 3AXMA 5DGBA 3LPYA 3K9UA 4YP3A 1SJQA 4P71A 1YX0A 1KLMA 1WKKA 4I2QB 4BWJA 4ETZA 1DY3A 3LGNA 1CJWA 2OPSA 1MROB 4DV2F 1R43A 2QYCA 5J1PA 3D7FA 3LP1A 4UCNA 2ODFA 4DQQA 2NREA 4OLOA 1RA6A 1YX2A 1XBUA 4QPXA 3S7RA 5D0GA 4ZVRB 4OI2A 2HQYA 3H20A 4OC1A 4KLWA 3CE8A 1LAPA 1J27A 1D9FA 2G9OA 4NXYA 2VIHA 1FFGB 2RUSA 4M5IA 3AJDA 4A8KA 3NCPA 5E96A 1RAIB 2PDAA 5D4LA 1AYEA 4GO7X 4Y49B 1MSWD 1Z1ZA 3KHGA 3DLGA 1CULA 3TNVA 2NSMA 1TKHA 5I0CA 2YNEA 3UN2A 3KHLA 3AXKA 1QAIA 4DQPA 3T9ZA 2K5TA 3IWNC 1Y5NB 2WVEA 3SXLA 2VDIA 3Q8YA 2Q4YA 4B10A 2HNDB 3LWLA 3TP2A 2MKYA 5DM6Q 1NB7A 4EFDA 2AFZA 2IMWP 2DR7A 4EFAC 5IOLA 4MFBA 2PRQA 3QRQA 4IG0A 1N5TA 3MR5A 2HPUA 2MB0B 2FXFA 2OPRA 3Q86A 5IWAJ 4IOCQ 3MMJA 5KFQA 4A8XA 4HI1A 2MZQA 3GIMA 3CT9A 4ITSA 2B3UA 3RYOA 3VR1A 2I1RA 5ETMA 5T41A 2XCPA 2GVZB 2FYXA 4HKFA 2HEKA 1DTTA 4IOBA 4CNZA 2QJ8A 2Q4VA 2O66A 2Z3MA 3W9HA 1JJ4A 4DR5F 3ZNJ1 4NWBA 3G71S 4NXNJ 1I6JA 3EZ5A 4O0IA 3BSNA 5IV3A 4CH7A 2OZUA 5DG9A 2KFNA 1XMBA 4MFJA 3I32A 1O5JA 2QLBB 1NPRA 1S6QB 2B0GA 5DO2A 4GO5X 5HQLA 4NYOA 5J2PA 2EK6A 3SCLE 4ECWA 1V5IB 2O4HA 4RZRA 4F02A 4KOSA 3E8OA 2L9NA 3C14B 1RWPB 5DGAA 4LR9A 3I82A 3RTVA 4E0AA 2QC3A 2ALYB 1PKUA 1X4HA 1X4EA 5KFHA 5KFEA 1H7WA 2GJIA 6CPAA 2J9DA 1OMSA 1PG5B 3AJ2A 3RJMB 5B0CA 3SEOA 3HFVA 5FLXY 2OH1A 1WC6A 2IA6A 2J7UA 3M9NB 4CRYB 5KFWA 4FD5A 2HFZA 3IG1A 4NGRA 1UVLA 3GV8B 4ZITA 9ATCB 1TL1B 2CJQA 4Q2MA 2HUZA 3SXNA 3B7IA 2DR9A 4FXDA 2P9EA 3SFGA 4K4TA 1YRXA 1HD0A 2FIAA 1AB8A 3KLIA 1I1GA 4DV6F 1Q2DA 3B6BA 2CXAA 1EX8A 2UUCJ 2DCLA 3K5OA 1WHWA 2EPIA 2ZEJA 2QL9B 1Q7YT 4K2XA 2ZNZA 2YKOA 3SCIE 4DF8A 4WZMA 1Y9WA 4LR8A 4PWWA 3THPA 3VALA 2CPHA 2ZM6J 2RAQA 1DAXA 1PC5A 2OPQB 3MUVP 2DVIA 4LVOP 1JLBA 1BQNA 4I1TA 4UEFA 3J81j 2UZAA 1UEVA 2W2NP 2YKMB 4ECYA 3ENWA 2YKPA 3J7ZT 3C6TB 5RUBA 4DV5F 4R3LA 2VQYA 1RWUA 3DRPA 5FIIA 3CCJS 4MJKA 3CJ4A 1W26A 2OI2A 2ADCA 1RWXB 1FE4A 2L3MA 3BHXA 2J76E 3NEKA 1M1DA 2BKPA 3IN5A 3PNIA 2HIYA 2OEKA 5F41A 2V69A 3CF5Q 1YLEA 4P44A 2MY8A 3DOLA 2MZRA 4C3LA 1CQNA 1SH3A 1XF8A 4ZX8A 2KZZA 2KFZA 2CIMA 2JX2A 3MAAA 3K5NA 5JGFA 5KFCA 2Q04A 3HULA 1A9NB 3CJ0A 4YFUA 3QT8A 2E1AA 1CJUB 2MDAA 1TKZB 2V77A 1M0SA 1ON0A 3J80Y 4YB7A 2OZHA 1SXLA 1VLOA 4DR1F 3N6LA 2WOMA 2OUGA 3O5TB 5H1SV 2C3PA 4ZLLA 1SKWA 4QCLA 3C16A 5JQ4A 1AZSB 1H0HB 1NPKA 2OELA 4B9UA 2DNHA 4QB9A 1RQ0A 1K0VA 5CYQA 1FI4A 3QZ8A 1WC0A 2H9ZA 3D8PA 4BLGA 2Y1JA 1PCAA 3H5YA 1JJCB 2W8KA 5BXIA 4YGOA 4NE9C 4QIVA 1ZG9A 4OZLA 1S77D 5I42B 3GIJA 3PR5B 2ZZMA 2CYYA 1X7VA 3DGVA 3EZUA 1DLOB 2DGUA 3FEYB 3ELHA 2Z2LA 2W9BB 1UVMA 1OPIA 4NA2A 5D0EA 5D78A 5BYSA 3UDVA 4OQJA 2NS1B 4M3SA 4I6WA 5F8GA 1NNDA 1RAEB 1JLEB 1MG7A 3ZO7A 4MI4A 7CPAA 1HHSA 2MQNA 3V5RA 2AX0A 4UTGA 2DGQA 5H9FK 4QWBA 3W5XA 2FVQA 3ULHA 2MJNA 3MMBA 4FNHA 2XLJA 3G3SA 3SHPA 4DUYJ 4J9MA 1Y3KA 2MQLA 2VKZG 5K8MA 4WF9Q 2YKQA 2F8EX 1RZMA 3R5JB 4IHMA 2V5HG 2OD6A 6FDRA 4ECZA 1N6QA 4QW8A 1YSJA 2OFHX 4NLGA 3D1QA 3I55S 4EZ6A 3PVXA 2WUUA 4F8ZA 2ZEEA 2C2RA 3A9LA 4EBDA 4BBHA 1VQLS 3ISND 4IRCA 3A4TA 2VA3A 4IH7A 5KG5A 2J0XA 2PD1A 2AE6A 4DV7F 2FHMA 1ZYQA 2NSBA 3OR1A 4KYZA 4I2PB 4FN5A 3BKFA 4A8SA 1N48A 3LW5C 3UI3A 3A8JA 3MPWA 4W98A 4C3MA 4JV5J 4F7VA 4WTYA 5KTQA 3QATA 4O3NA 4KY3A 3F0AA 2M4MA 1N4LA 3FDSA 1PC4A 4IFYA 1WORA 3VZIA 4LFAF 2IC3A 5E41A 1FDAA 2FLOA 2CY2A 5AG5A 3D28A 1MMDA 5DQIA 2GCFA 2ZUGA 3Q8QB 5F47A 4EEYA 3B2YA 3TAMB 4GS4A 2JLMA 3KI9A 2MZ1A 4MKVA 2DGOA 4V19J 3MEGA 2ZW6A 3GR1A 1ACMB 3CB4A 7FDRA 1NKCA 3MMAA 1TKTA 3IBFB 2KB2A 2HV2A 3SIPB 5HO4A 1IOIA 4Y28C 1M4IA 3CPAA 4I68A 4JXQA 2IJZA 1J5EF 3VGUA 3K58A 1R0AB 4P2XA 2O3DA 3V6DA 1LXNA 4G6VB 5AJ3J 4UQGA 3MF5A 5KOWA 1JLCB 2XI2A 1XFOA 4X4SA 2BM1A 1ZBTA 4NA3A 4QU6A 1Q81T 1YJTA 5A2QU 1Q16B 1CJTB 4R7MA 3KUEA 3N7ZA 1S6OA 1S1XA 3POTA 4LQ3A 1H73A 4EO8A 3KJFB 1FE0A 4NLRA 4ID5A 1UVJA 4ED1A 2CDRB 3T9NA 1RT3A 1WC5A 2IMOA 1M44A 5H84A 3CCUS 4P52A 2F5IA 3M4XA 1KVJA 1Y5LB 2OR4A 3FSYA 4OI3A 2AKWB 1NK5A 4H4OA 4FKXA 3NNCA 3DLKB 1X5TA 2UXBF 1V6HA 4ZCMA 1ZA1B 1VHOA 2DB1A 1C2PA 1KUYA 4O4GA 2JSXA 4USHA 4P2FA 2BMBA 1N33J 1KWMA 2VF3A 1UPPA 5A27A 2Z11A 2NXEA 4I2QA 5KTCA 5HMWA 2E5LJ 4JWPA 3WC7A 3SSSA 3ZZPA 2M8DB 4O3SA 3THTA 2CRLA 2OTJS 5HMNA 1ROFA 5DLGA 4MHDA 3DRXA 4PXBA 4ATNA 1LV5A 4OL8A 3R2DJ 4WZQA 3DR8A 1AUDA 3TJ9A 2VQEF 3VV2B 2VJUA 1YK9A 4UEZA 3KFWX 2YWHA 2PJ1A 1BUXA 4P4FA 4ZLNA 3QFWA 1NU4A 1NUEA 2KN4A 3VAKA 1G3OA 2NZ4A 1LCPA 1WD6A 2GIFA 3PRTA 3WQPA 3BO3A 2DGSA 2BE9B 5B08A 3FCVA 2GIRA 5G20A 2FIUA 3PYGA 2GX8A 4NCZA 2DHGA 3I9V9 4ZJOA 5JVHQ 2HAIA 3M2RA 4FVCA 4R76A 1RHJB 3ZZYA 2DT9A 2XMVA 1YJWS 1JQGA 1RUSA 3P2FA 4RU9A 3QAEA 4CLYA 4KORA 5LMNJ 3DFEA 1DFDA 1JMTA 2I9SA 1RISA 1IYKA 4P72A 4KGXB 1Q79A 2NCKL 3MZIA 3ISXA 1UKUA 2CZVC 3BGRB 2KXNB 5U47A 1R8CA 5F46A 1YGHA 3HLUA 1HKAA 2BE7D 1FRIA 4ERDA 3OL7A 4AXIA 3H5SA 4Q8EA 2WPXA 5GMKa 4HACB 2IY5B 2EW9A 3F0NA 1K1SA 2EBJA 1XERA 3C66A 5T7LB 2X51A 1U8WA 4FYDA 3MCMA 1XR6A 2G3AA 2BX6A 2HHHF 3CDBA 1Q7LA 1D9DA 4ZVPB 3G6YA 5F3ZA 1MWQA 2C27A 1QSMA 1F2GA 1HNZF 3MM5A 1ZZNA 1TK5A 2V9KA 1SC6A 2CG8A 4F2RA 3E0KA 2DXQA 1SKSA 3LPEA 4OX9J 2ZBCA 3SQGA 3S6GA 5KFJA 3T6JA 3DGPA 3DLHA 4PR6A 2PN6A 4YB6A 5A0YB 4RBTA 5L8RC 4B08A 1R31A 2HZVA 1NCLA 3LP0A 3VAJA 4NYPA 2R8KA 2LXIA 3ETMA 4CLKA 3ADAC 1HBOA 3R1LA 2RE1A 3TEGA 3D1OA 4O3PA 4B3MF 2XSJB 3P8BB 1Q0NA 2MXYA 3RG6A 3B78A 1ZPWX 1YVOA 4K30A 3H5UA 2PJ7A 4M5JA 3IRXB 5SZTA 4Z65A 4ANDA 4DSFA 5GVQA 1TVRA 2BZ2A 3F56A 3PB9X 2GQ2A 2G2OA 1BY9A 3AA8A 1TV6B 2Q3PA 1HD1A 2I2YA 5HLFB 1UFHA 3OWCA 1GAOA 2OH2A 4LQ6A 4EBEA 2CWXA 3GFXA 1VRQC 1RTQA 2C1EB 1RGVA 1MWZA 1X8DA 5F9NA 5AE2A 5FJ4A 2AWZA 3PHEA 5C42B 5F0WA 4HH1A 4TY8A 4FAIA 4CRJA 1YGYA 3HF5A 3T1HF 1QSYA 2KL8A 4MHYA 2B43A 2MPUA 4LBIA 4CGLA 3C6TA 1S60A 3V6JA 2DNRA 1TK8A 1V3RA 1NDKA 5KFVA 3RAXA 4USUA 2XMUA 3M30A 4QPTA 3JXOA 1RI7A 5LXYA 2Y1LB 1U0HB 3QSIA 1FRLA 4X64F 3S1TA 4X84A 2ADBA 4IK2A 2ROEA 3RB3A 2O01C 3FGVA 2YX4A 3GZ7A 1FJEB 3GKRA 3PACA 1G6BA 1HHTP 1NHUA 1FRMA 4LSLB 5J2NB 1M5HA 2HBZB 3NMAA 3P5BP 2O28A 1PAUB 4QQBA 3I0SA 2H5IB 1MW7A 4BBYA 2DNOA 2BJ1A 3M7VA 1OQ6A 4C97A 4YY3J 5DG7A 2UV8G 4LF8J 1N32J 3PJWA 4ECSA 3FVLA 4QC6A 3CEDA 4R8UB 2QGFB 4P6YA 2HMIB 1RCOB 4LX9A 3CVKA 1NM2A 1T7PA 1FWLA 2AX1A 4RL1A 2PR1A 4RWWA 3H59A 2AD9A 8RUCA 3HHLC 4K4UA 4DL2A 1ELLP 1HQ2A 1F57A 3BJ8A 3GCWP 3GYNA 1M90T 3T5JA 1UTAA 2UUAJ 2KJVA 4XK8C 2PFDA 1S5KA 4OV6A 3GY9A 1B7FA 5L1JA 3RGIA 2XCAA 3TX8A 3K7RA 3ZZUA 1YJNS 3QT5A 2R8GA 2XMKA 2Z2MA 2KT2A 4PWDB 4J5OA 4WBFA 2Q4ZA 4TY9A 5I42A 4B13A 1JKHA 3UO0A 4CIOA 4HT5A 2HWTA 2CVIA 3U1NA 2W9BA 3ZZZA 2BOPA 2GLFA 2F3JA 5I3QA 2HQFA 3M6VA 4B3RJ 4DLEA 3CPWR 3AHPA 3FVYA 3P96A 5D4OA 2AFUA 1O8BA 2ZEPA 3NL0A 3KKFA 1M5OC 2FUG9 2JC0A 1C0UA 4WP9A 2KO1A 4CCHA 3HJVA 4GC6A 3D0GE 2UUTA 3ONQA 1D8YA 4PQUB 3DRYA 4AVBA 1X31C 2DO0A 3VATA 4QW9A 4DQIA 4R0JA 4NXMF 4A37A 4OFZA 4ED5A 3MOJB 5KG6A 2RVJA 3IEHA 3QIDA 4PRFA 1HQEA 3MI7X 1BWVA 3SSRA 1O0PA 4F04B 3BBCA 3VGTA 4FPRA 5KFDA 1CS4A 3GQCA 3M2VA 1U24A 3OTEA 3R6LB 3IM9A 4DXLA 3FSIA 5DZ7A 4N41A 1V0CA 3PZPA 3AOAA 3PEJA 2F4VJ 2MEWA 3CTRA 4M85A 2DH7A 2M9KA 3N5BA 1UJ4A 4M5GA 5LJ5Y 3F73A 2ASLA 4LQ9A 2A6MA 1N5VA 4DV3F 4IUFA 1M1HA 4X4VA 4JI7F 1BMQB 2XLKA 3OPKA 2VOOA 2PMHA 4H4MA 1P4NA 1P8GA 2H54B 1ZETA 1U1QA 5EWFA 1HWUA 4H89A 5AXLA 1J5OB 3CCVS 2I5JB 1IBKF 5F49A 1WHXA 4ZP6A 1VFJA 3L95X 4IF5A 1GNKA 1RT6A 4NEZA 3WZ0A 1FTCA 4R57A 1HYSB 4FDFA 2BL1A 4ZY1A 3M8PA 2DPSA 1N5YA 3AD7C 4LSZB 3K59A 5LSRA 1X4FA 4HDGA 4UY85 2HGLA 1DQAA 1YHQS 5CQGA 4WU2A 4X4OA 2OJ3A 5CAAA 2WB1D 5F8IA 4KOXA 2K1RA 2ZW4A 4LRCA 3CCWA 2J7KA 1TKDA 3BGLA 1CP7A 1U1OA 4P4IA 4DUKA 1RAOA 4I67A 3BKTA 4PZVA 2QG9B 3OTBA 1OYEA 3GJTB 3Q2TC 4OX6A 1HWKA 3M6XA 3RRGA 1RHQB 4XDCA 4KVOE 4KAIA 1SB6A 4Z7CA 1NDCA 3EVWA 4J91A 2Y3YA 5L1LA 1Y3JA 5GAGU 2HAFA 4NOHA 2B7CB 2WK4A 3R5CA 4H4KA 5SUHA 2GHVC 3NWGA 4ZLPA 2CQPA 4KV8A 2QX0A 2ZD1B 3BGOP 1F3VA 3OJSA 2J9CA 4G1IA 2XY5A 2AW0A 1IKWA 4JYAJ 3DLKA 4B3TF 3KLGA 2CQDA 5KG4A 5KFYA 1YJRA 5H9FJ 4MIWA 1IVZA 4A46A 2CPYA 4DR4J 1PILA 1VOMA 1SKRA 2HVZA 2ZITA 1FA0A 3DXBA 1RAJA 4RW6A 2PSZA 2B4DB 5J2MB 3PW0A 1VQPS 2QO3A 1LW0A 2B7BB 2CIJA 2HFUA 2F65A 2NUUG 1UETA 5GAHU 3B35A 2FGCA 2ZJPQ 4KS9A 3KYLA 2ZEMA 4KOTA 1P0HA 4XPLA 1KN6A 3LANA 3H8YA 2XWXA 3M9MB 2CADA 3IFEA 2HWHA 1FX4A 1HDQA 1RHRB 4DUZF 3VAFA 3HVWA 4ED6A 1XMOF 2GU2A 5ETTA 1F5CA 2E5IA 4X4QA 4B11A 2EVNA 5IV4A 1B7YB 2MQOA 4UFWA 5IXUA 3B8HA 3FCHA 1GMWD 2E1RA 1RWKB 3CMQA 1UFLA 2QN6B 3BGUA 2HHWA 3CCRS 4YHHF 2VFTA 2B5GB 3LP2A 1PJ5A 1U48A 1FKOA 2PEHA 1JK9B 1U1LA 4F8RA 1NXIA 4NGNA 4RX6A 3QYYA 4ZYQA 1MK4A 2DR8A 2GMLA 1JWWA 3DOKB 4B5PA 2OPPB 3QAHA 5I3PA 1CBKA 2IL4A 3AOCA 5J2QB 3OXFA 1IBMJ 2Q7SA 4MJ8A 2OFGX 3LODA 1JLAA 4DZDA 1SV5A 3TA2A 3KHHA 3P45B 4CGMA 1QQ9A 1B64A 3LH2S 2LP4A 5IM0A 3RAQA 1XQIA 3T41A 3LACA 2DIUA 1HBNA 3CJSA 3C6UB 4ICLB 2KVIA 1U02A 2VBXA 3Q24A 3W3SA 1XK8A 1AFJA 3BH7B 4UWIA 4ES2A 5ETLA 3M2UB 2E7VA 3KK1A 4A33A 2HHXA 2MGZA 4C0BA 4F3OA 2E7WA 1IKXB 2W9CA 3RNZA 4Y2CA 1WC4A 4OYOA 1I1DA 2HK2A 2ZE2B 3BKUA 3FH4A 4KFBB 4JI5J 2OAUA 1FVSA 1TL3B 3D1HA 2K8GA 4USIA 3UDEA 2PE8A 3PJXA 1S1WB 4LMZA 4DS5A 4MIBA 4ALZA 3K2KA 3O44A 1P27B 2CNOB 2PA3A 2DHXA 1FF2A 4AL7A 2FZKB 2Z8QA 2FY1A 4NEXA 1IWAA 2V4QA 4MXUA 4A94A 4BDPA 1ZM4A 2GE3A 2JEFA 3DN9A 2B4PA 4IR1A 1IKVA 1S9GB 2BACA 2VKRA 2GC8A 3I6PA 5C5JA 2EK1A 1GFWB 2AZ1A 4FF3A 1WEZA 3BPSP 3MEEA 2J6SA 4LF5J 5H9EK 4IFVB 4LF8F 2CTBA 4WE1B 2RDJA 2MHEA 4LRDA 4KO0A 2D41A 2WW8A 4OJGA 2Z10A 3IRXA 3NXZA 4ZPBA 2A0FB 2ZOFA 1FRJA 3C8YA 5LYDA 3N6NA 3NA6A 4GVBA 3AQPA 3ZZRA 3HVAA 3ILJA 2FLLA 4CI0B 4PUOA 3AA9A 5G4DA 1G7CB 1TV6A 5ELYA 3FKBA 1BQXA 1WTFA 5HLFA 4X3RA 5KFFA 1U6ZA 5LMUF 2BR0A 2CA9A 3L7PA 5CXTA 4Y3CA 3R9GA 1NSAA 1SIZA 2V4JA 5C42A 5M2UA 3CDXA 4XPDB 2CKWA 4X62F 3MR3A 2Q66A 4ZCLA 3TC8A 2QA1A 4JJXA 1QSTA 2ZEHA 1MN9A 3DYAA 3I5CA 3KJNB 1U1RA 2ZVIA 1ARMA 3OL9A 1HNXJ 4EVYA 1S7HA 4DV0F 2ASDA 1FEHA 4C8ZA 3D6FB 1VBZA 1T02A 4CLSA 3BJ7A 4OHXA 4NMXA 4DZ6A 2VQFF 2DPIA 4A8FA 4M95A 2YXLA 5J2NA 4GKJJ 1N36J 1RTHA 2AJ4A 2XYGB 3CD5A 1U49A 3BYRA 4NJQA 1WI6A 2ABZA 3FBCA 2DHSA 3MGDA 3NNAA 2BW7A 5K20B 5L9NA 4KSIA 1LFPA 3KHZA 3SCJE 2Z3PA 2RQ4A 2YWKA 1VC6A 2R42A 3FC9A 1E6YA 2V68A 4AVAA 2K7KA 2GS8A 4OLPA 1SCJB 2BQ3A 5GAGI 3OR2B 3VAIA 2KT3A 4M6GA 1IYLA 3FK4A 2BV3A 1IUJA 2ZH3A 1FJGJ 4WYLA 3NRBA 5A8WA 5K14B 1VK3A 2V4RA 5HQMA 1T05B 2EBEA 4USKA 5HMZA 3G96A 4NLDA 4M5DA 1FT7A 4FP9A 2MZSA 3BQ1A 5F09A 4ZP7A 3M8YA 3IWLA 3U27A 1UEUA 4W4MA 3KJQB 1FK9A 1RAHB 1TL7B 2JWNA 1QTMA 4JXRA 1S5ZA 3R3TA 3CCQS 2LDIA 3E01B 3DKDA 2HB6A 2NXCA 3V6KA 2FJAB 2J9EA 3QJPA 4OYMA 2CWKA 5DQHA 2YNIA 3FBFA 1TQLA 1EIYB 3DU6A 5GAHI 1ZS6A 1X4CA 2HFOA 4O4RA 1HBMA 1YJUA 1SVDA 2FHJD 3TOBA 2WVDA 3MM6B 3N79A 3B3CA 1VQNS 5HBMA 2J7WA 2D9OA 4IAVA 4CLWA 4KHPJ 4R6TA 1VQ4S 3Q2SC 2YWFA 1BAVA 5IC4B 2PVWA 1VQKS 4PQUA 5LRJA 3MXHP 3A1YG 2RU3A 2HQCA 4DR2J 3US5A 5K8PA 4FBEA 1RTJB 3V38A 2FTRA 2B4OA 4RR5A 4ONWA 3DRSA 3NH4A 1RHKB 1T9TA 3O1LA 5L38A 1VBKA 4KZTA 1HI1A 4CDIA 1UZDA 2DTJA 3CZXA 2WSFC 4X66J 2VPYB 2P6EA 2DISA 4OC3A 1WUUA 1UVIA 4J9LA 1AMPA 2DBBA 1DRZA 3NBPB 3KLEB 3ZZTA 3KR4A 2AGQA 5HATA 2QYVA 1Y7PA 4CLTA 2MSTA 4PK2A 3MEKA 3TUIC 5DQGA 3B8GA 3HI9A 4BS2A 1S0OA 2YVSA 3JSBA 1RT2A 3PFEA 2PJ3A 4MFQA 3TW0A 3Q0AA 1M4DA 2D9PA 4HYKA 2YTCA 4O0NA 2JJ4D 3N5FA 2ZEFA 2C2DA 2F63A 4F0XA 4F4YA 4RW9A 4ZKAA 1XMQF 1KS2A 4R3KA 5ETPA 2QJ3A 3IGNA 1Y0HA 2LU2A 3HCXA 4E2FB 4A8YA 5HJYA 2Y0BB 3T9YA 3FB3A 3FJ2A 1T9UA 3HT0A 5E3QA 3W91A 4WIQA 3WC6A 1AW0A 4KVXA 2ZELA 4V19X 1S7FA 1UMJA 2RDIA 2YX1A 4ZPCA 3H98A 3PEHA 1WNEA 1NSKL 1S79A 2KTQA 3D7DA 1SQGA 2Z0GA 2E5JA 4RN7A 3AT1B 3C26A 3MTKA 3UD5A 1SC4B 1Q1KA 4JI4F 5AXKA 3EDQB 1Z9UA 3MCOA 4ZHRB 1VISA 4U6PA 4ENOA 2R8IA 1FO1A 1UP1A 1TFWA 2VC0A 4J9NA 4IRDA 1S1TB 3Q22A 3CO0P 2C2MB 2D3OR 4DQRA 2QV6A 4U9ZA 2A18A 3FFIA 1BQMB 4F0MA 1RHMB 1HQUB 2WSCC 2U1AA 1R3NA 2YNHA 3ENAA 4HNXB 3IU1A 4YMEA 1CSJA 1ZZFA 1N56A 3RRHA 2W7OA 1HDUA 2YBVA 4HLBA 1TELA 3GFYA 3KLFB 4L75A 5J1NA 4DSJA 3KK2B 4BINA 2EWHA 5HANA 3I4PA 3T5HA 2VZ9A 1XTZA 1N52B 1F2OA 2LA6A 2XO6A 2BE2A 1S57A 4C8OA 2EUIA 3KUGA 2QTWA 5KTAA 1N0VC 4EGLA 4ETXA 1OWXA 3NOGA 4MH8A 2OKQA 2DEJA 2Z58B 2PI5A 4YU9A 4PG7A 1VRTB 3PRDA 2ROPA 3DU5A 4F3QA 1YJ7A 3KNGA 4FUUA 5LYFA 4ZPAA 3K89A 3MUMP 1U26A 1JLQB 3RUBL 4DR6F 2MQ8A 1QY7A 1NAQA 1OSDA 1PAEX 4JI2F 3W6SA 2C6PA 2HGNA 1C0TA 1XR7A 1JLFB 1Y4ZB 3HSGA 1HW8A 3BN7A 4L6V3 2HBYB 2QT7A 2BJ3A 2LEAA 1N54B 3BQ0A 4HTIA 3RW6A 2E66A 2VHGA 1Y9OA 1NK7A 4UWJA 5A28A 1HL6A 1ZH5A 1I5OB 5B0FA 4YS2A 3DI6B 1IM6A 1E6VA 4W9YA 5EMIA 5A8RA 3KQZA 4CO2A 3PB4X 4DL3A 2JDJA 2E1MC 2HFVA 3SI2A 1S1VA 2R7VA 2BKOA 2PJ5A 3PIOQ 5CYMB 1RT5B 1Q53A 3BYPA 3EYZA 3H4BA 2RQKA 1DTQB 2YPZA 2LEBA 4ILRA 1LOKA 3UW1A 3V4IB 1FRKA 1CQMA 2ARHA 1A0OB 3KMQA 1WACA 2V2QA 4KBIA 3JQKA 3UCUP 4LFBF 4LF4J 5B0EA 1REGX 2B6AB 3KL9A 2CTCA 2R98A 4QYZK 3D4JA 3G6ES 4DV4F 2BEFA 1IQTA 5DJBA 5D29A 3AQOA 4NL5A 1VHSA 2XULA 4Y49C 1V9OA 1X4BA 1D09B 3EFAA 3IA0A 2JEJA 3TZZA 4ZOSA 4ICLA 3JTPA 3G4SS 2W2PP 4YR0A 3GYAA 1N8RT 2KXFA 1FJCA 2FY8A 2ZZNA 1Q8KA 2U2FA 3PM9A 1KRPA 3TCVA 4MHZA 2Q0YA 4MMOA 2GQCA 4KOYA 1Q82T 3PEIA 3IJ3A 3OD2