4H6ZA

Tubulin acetyltransferase
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
188
structure length
147
Chain Sequence
SFTMDFPYDLNALFPERISVLDSTTVIDELGKARHHLYLLKDGEGRGVIVGFLKVGYKKLFLLDQRGAHLETEPLCVLDFYVTETLQRHGYGSELFDFMLKHKQVEPAQMAYDRPSPKFLSFLEKRYDLRNSVPQVNNFVVFAGFFQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Alpha-tubulin N-acetyltransferase
publication title Crystal structures of tubulin acetyltransferase reveal a conserved catalytic core and the plasticity of the essential N terminus.
pubmed doi rcsb
source organism Danio rerio
total genus 30
structure length 147
sequence length 188
chains with identical sequence B
ec nomenclature ec 2.3.1.108: Alpha-tubulin N-acetyltransferase.
pdb deposition date 2012-09-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05301 Acetyltransf_16 GNAT acetyltransferase, Mec-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4h6zA02
4YFJA 1S5KA 4HNYB 4AB7A 4XPDB 1Q2YA 5CNPA 3RYOA 4MBUA 3R9GA 1I12A 1Z4RA 5F47A 1XIXA 3LODA 3FYNA 4HNWB 1QSMA 2HUZA 2G0BA 4IUSA 1R57A 2R7HA 2JEVA 1GHEA 3CXPA 4AVBA 2CNSA 2BSWA 1XE4A 3T90A 1P4NA 5F49A 4YRHA 4PSWA 5KTAA 2G3TA 4CAXA 2EVNA 1XMTA 3EXNA 4HKFA 2O28A 3DDDA 4MY3A 1V0CA 4JD6A 1CM0A 3LD2A 4QBJA 5E96A 4HNXB 2FIWA 2QMLA 4K30A 3R96A 4H6UA 4OADA 1CJWA 3NE7A 2VEZA 3ZJ0A 2BEIA 2GIVA 1OZPA 5C88A 3VWDA 2B5GB 1S7KA 1WWZA 1YREA 3F0AA 4KVOE 1VHSA 1YVOA 4NCZA 4NF1A 4I49A 4ZBGA 1MJBA 1I1DA 2PDOA 3PZJA 2AJ6A 4KVME 4E2AA 2GE3A 1Y7RA 2P6EA 3D8PA 4JXRA 2JDDA 2R98A 1IYKA 2OU2A 4R87A 4IF5A 3B8GA 2PSWA 1YK3A 2OB0A 5DWNA 2ZW6A 4F0YA 4KUBA 2GANA 2Q04A 4LUAA 4RI1A 4ORFA 2R8VA 3VWEA 4XNHC 3GY9A 5HH1A 2VXKA 3SHPA 2Q0YA 4UWJA 4JJXA 5IV0A 2VZYA 3D3SA 4FD4A 1YVKA 1PUAA 1L0CA 1IB1E 2PC1A 2WPXA 1MK4A 4XPKA 3PGPA 4QC6A 3W6SA 4KOYA 3QAHA 1UFHA 4CRZB 2B4BA 5IB0A 2J8RA 2FE7A 4CAVA 3CXQA 1M4DA 5F46A 5I0CA 1BOBA 1J4JA 1YLEA 3H4QA 2I79A 1SQHA 4MJ8A 1N71A 4L89A 2B4DB 1WK4A 4NSQA 4KLWA 4MHDA 4MY0A 3OWCA 3S6HA 5JQ4A 3DR6A 3TOAA 3TFYA 3FIXA 2CNMA 4FD7A 4U9YA 1M1DA 4JXQA 2ZXVA 3R95A 3WR7A 3BJ8A 2PQ8A 4Y49C 1KUVA 1S7FA 4F6AA 2QIRA 2P6GA 2HV2A 2Q4YA 4XPDC 1NSLA 1Z4EA 3TTHA 2B5GA 1P0HA 3S6KA 3TO7A 1S60A 4R3LA 1XEBA 3FB3A 5EC4A 4KZTA 1KUYA 1Q2CA 2FXFA 2JDCA 4GS4A 5GCNA 3K9UA 4KOTA 2OZUA 4KOSA 2Z10A 2REEA 3S6FA 5C82A 2PR1A 2ARHA 2Z11A 4PV6A 1B6BA 4FD6A 3C26A 2C27A 1YR0A 1IICA 4E8OA 4DNCA 2RC4A 2ATRA 4QVTA 3JUWA 1M4IA 3EO4A 5F48A 2WPWA 1S7LA 2JLMA 4CAWA 4KORA 2Q7BA 5J8FA 1M44A 2K5TA 4B5PB 2Q44A 1TIQA 2HQYA 4MI4A 4RS2A 5IX3A 3EFAA 2J8NA 2CNTA 2G3AA 2FIAA 4OAEA 4KOUA 4X5KA 4UWIA 4PSXA 1M4GA 5HMNA 3T9YA 2EUIA 1RO5A 3BLNA 3BJ7A 3FXTA 4KUAA 2B4DA 1VKCA 3CXSA 5JPHA 3E0KA 3DSBA 3TE4A 5KTDA 4NXYA 2Y0MA 1LRZA 2DXQA 4R57A 1NMTA 4OLLA 3IGRA 4U9ZA 3W91A 3D2PA 1I21A 4M85A 2KCWA 1ON0A 2J8MA 1BO4A 4JWPA 3N7ZA 2FT0A 3SXNA 4KOXA 4L8AA 2I00A 2VBQA 2VZZA 3IWGA 5H84A 4AG7A 3I3GA 3TO9A 4ONUA 2P6FA 4J3GA 4KOWA 4H89A 2QECA 2D4OA 4FD5A 4XPLA 2VQYA 3R9FA 1U6MA 3P2HA 5ISVA 2OZHA 4R3KA 1Q2DA 2BUEA 4PK3A 2Z0ZA 3R1KA 2Q4VA 3GKRA 1XF8A 2PRBA 5EBVA 3PP9A 5KTCA 4B5OA 3I9SA 4E0AA 4R9MA 4UA3A 4YGOA 3W6XA 2X7BA 1KUXA 2CY2A 1S3ZA 1Y9WA 1Z9UA 4NEXA 1QSRA 2REFA 1K4JA 2R1IA 3F5BA 2FSRA 3G3SA 5DWMA 4LX9A 1QSNA 2PR8A 1Y9KA 1PU9A 2P0WA 4H6ZA 1RXTA 4II9A 4QUSA 2ZW7A 1MJ9A 3F8KA 3FNCA 4XNHB 2AE6A 3D2MA 4BMHA 2D4PA 2BL1A 1IIDA 1S7NA 4B5PA 3EC4A 3ZZIA 5J8CA 3KKWA 3R9EA 2VI7A 3UY5A 2OZGA 3MGDA 4M3SA 4EVYA 3FRMA 3TT2A 2B58A 1NE9A 3DNSA 1QSTA 2FCKA 2ZW5A 4KOVA 4AG9A 1KZFA 5FVJA 4U5YA 2B3VA 3QB8A 3GYAA 2F5IA 3SXOA 1B87A 3DR8A 2IL4A 1MJAA 4KVXA 1YX0A 3FBUA 4QB9A 2A4NA 3EY5A 4PK2A 2B3UA 2FS5A 3TCVA 2ZPAA 3TOBA 2H5MA 1IYLA 2FL4A 4UBRA 2OH1A 3G8WA 4JLYA 1QSOA 3V8IA 2ZW4A 4CS0B 4AVAA 1FY7A 3JVNA 3P2FA 5H86A 4AVCA 4CRYB 2NMTA 4Y49B 4KLVA 1YGHA 3S6GA 3TO6A
chains in the Genus database with same CATH superfamily
4YFJA 1S5KA 3WC7A 4HNYB 4AB7A 4CYPA 4XPDB 1Q2YA 5CNPA 1X10A 3RYOA 1X12A 4MBUA 3R9GA 2XEFA 1I12A 1Z4RA 1UWYA 3QAYA 1XIXA 4ONWA 3LODA 5F47A 5ELYA 4UFWA 3FYNA 8CPAA 2PVVA 2RB7A 2JBKA 1HEEA 1Q7LA 4HNWB 1QSMA 2HUZA 2G0BA 2BO9A 1LAPA 1R57A 2R7HA 2I3CA 4IUSA 4KS9A 4UF4A 1TKHA 2O53A 2V8HA 3V7ZA 2JEVA 1F2OA 2OOTA 1GHEA 3NA6A 3CPAA 1TXRA 1ZO0A 3CXPA 4O23A 2CNSA 2ZEGA 4AVBA 2BSWA 4B11A 1XE4A 2ZEHA 3T90A 3FF3A 1ZG8A 4Q38A 1P4NA 5K8OA 3D67A 3KI9A 5F49A 4YRHA 1XBUA 4A31A 1XFOA 4PSWA 5KTAA 3NH4A 2G3TA 2Q51A 3CPXA 2EVNA 1XMTA 4P45A 4CAXA 3EXNA 1XOVA 4HKFA 3CT9A 2O28A 4MHNA 3DDDA 4UIAA 4MY3A 1V0CA 1CP6A 4X8IA 4CYOA 1ELMP 4JD6A 1CM0A 4PXEA 3LD2A 4QBJA 5E96A 4HNXB 2FIWA 4MHYA 1Y7EA 4CGMA 4B10A 2AFSA 2QMLA 4K30A 3R96A 4H6UA 3VARA 2IQ6A 1TKFA 2CIJA 4OADA 1CJWA 3FX6A 3NE7A 3ISZA 2VEZA 2ZENA 3BXMA 3WABA 2BEIA 2GIVA 3A9LA 3ZJ0A 5BWAB 2PVWA 1OZPA 4UFXA 5C88A 3LWUA 3VWDA 4ZY1A 2B5GB 4CGNA 1S7KA 1CP7A 2PJBA 1AMPA 1WWZA 4TNUA 2J9AA 1QMUA 1YREA 3H8EA 3F0AA 4CGOA 1BPNA 4KVOE 1VHSA 1YVOA 4X2TA 2EO8A 4NCZA 2F7VA 4FUUA 4NF1A 2PJ6A 4I49A 4MFLA 4ZBGA 1IOFA 4B13A 1MJBA 1I1DA 1LFWA 2PDOA 3PZJA 4UCMA 1Y0YA 2AJ6A 4F9VA 4KVME 4E2AA 2GE3A 3PB9X 1Y7RA 4BD9A 5LYFA 2P6EA 3D8PA 5G22A 4JXRA 4WJBA 2JDDA 2R98A 4EMEA 3S9LA 2PJ3A 1IYKA 2V8DA 5AG6A 1DTDA 2OU2A 4KSFA 4R87A 1HDQA 5A28A 4IF5A 4C2ZA 4MCRA 3B8GA 5JGFA 1CG2A 3B3VA 4OC5A 1FT7A 3KR4A 2PJ7A 2V8GA 2PSWA 4MHPA 1YK3A 2OB0A 4P4EA 5DWNA 1HDUA 4EFDA 2ZW6A 4F0YA 4KUBA 3FECA 2PJ9A 3B3TA 2GANA 2AFMA 2Q04A 3KZWA 4LUAA 5JM6A 3PB8X 2PJ2A 3D7GA 4RI1A 2ZEPA 4ORFA 2ZEEA 2R8VA 2YGWA 3VWEA 1NSAA 2BOAA 5H84A 4NJRA 3ISXA 4XNHC 4MFKA 1LOKA 4BINA 1JQGA 3GY9A 5HH1A 4OC2A 2XEJA 3PFEA 2VXKA 3SHPA 2Q0YA 4UWJA 4JJXA 4A94A 3KHZA 3BHXA 1ELLP 5IV0A 1YQEA 2VZYA 3D3SA 4FD4A 4UIBA 1YVKA 4NFRA 1CPSA 1PUAA 1L0CA 1IB1E 2PC1A 2PRQA 1AUGA 1MK4A 2WPXA 4ZYQA 4K3NA 4MCQA 3KHXA 4P4JA 5K8PA 1Z8WA 2ZEDA 2GFQA 4FWUA 1FNOA 4XPKA 5F09A 3PGPA 3NH8A 3WT4A 5HVHA 4QC6A 4UCNA 3W6SA 4WWVA 4KOYA 4OIDA 3QAHA 1UFHA 4CRZB 2Z3MA 4UEFA 4LQGA 2B4BA 5IB0A 5K8NA 4IHMA 2J8RA 2FE7A 4UEEA 1JWQA 2GLFA 3CXQA 1M4DA 4CAVA 5F46A 1F2PA 2CTBA 4CGPA 5I0CA 2GLJA 3D66A 1BOBA 1J4JA 1YLEA 3H4QA 2FVGA 2I79A 1Y0RA 2Z3NA 1SQHA 4MJ8A 1N71A 3BI0A 4L89A 3SJEA 1CBXA 1PCAA 2B4DB 1WK4A 4IK2A 5D8NA 2PIYA 3L2NA 4NSQA 4KLWA 3B2YA 3SI0A 4MHDA 2GREA 4MY0A 4C7HA 3OWCA 3S6HA 5JQ4A 3SJGA 2DPSA 3IWEA 3FEDA 3WC5A 3VH9A 2ABZA 4A38A 3DR6A 4CPAA 3TOAA 3TFYA 3FIXA 2CNMA 3MRUA 4FD7A 5LYIA 4JZ0A 3S9MA 5AG7A 3GB0A 4F9UA 4B12A 2CTCA 3D7HA 4GXHA 4U9YA 1M1DA 4JXQA 2ZXVA 4PXCA 4H2KA 2QYVA 3R95A 3BJ8A 3WR7A 1YW6A 2PQ8A 3N5FA 4MFQA 4NGMA 1BPMA 4Y49C 4P4DA 5CBMA 1KUVA 2HC9A 2O4HA 3FH4A 1S7FA 2PJ8A 4F6AA 3KGQA 2QIRA 3PRTA 2P6GA 4NGQA 2HV2A 1Z8LA 5AG5A 4OKOA 2Q4YA 4OMEA 4XPDC 4B6ZA 2WZNA 1NSLA 1Z4EA 3TTHA 5LYLA 2B5GA 1P0HA 4NGTA 4P4BA 3S6KA 3TO7A 1S60A 4R3LA 4CYQA 1XEBA 2C1CA 3FB3A 5EC4A 4KZTA 1KUYA 5A27A 3K9TA 1Q2CA 5K8MA 2AFWA 2FXFA 2JDCA 2Q43A 2Z3PA 4GS4A 4TWEA 2XEIA 5GCNA 4ZX9A 3K9UA 4KOTA 5EMIA 2OZUA 1ARLA 4KOSA 6CPAA 4NGPA 2Z10A 2REEA 1Z8XA 3S6FA 1ARMA 5C82A 2DPTA 2PR1A 3KASA 2ARHA 2Z11A 3PB7X 4PV6A 5I4MA 4P4IA 4LQ6A 4MCPA 1B6BA 1H8LA 4C7IA 1LANA 3C26A 2C27A 2F8HA 4FD6A 5D29A 3KR5A 4AXVA 1YR0A 2C6CA 2ZEOA 3I1UA 4ZI6A 1IICA 3CZXA 1BLLE 1IY7A 4E8OA 4DNCA 2BCOA 2RC4A 4NJQA 3H5ZA 3H8GA 3RNZA 3FVLA 3D68A 2EWBA 1RTQA 2ATRA 4QVTA 3S9NA 5AG4A 3JUWA 3LMSA 1M4IA 3EO4A 5F48A 1ZG7A 2PJ0A 4UEZA 2WPWA 1S7LA 3GLJA 4NGRA 2JLMA 1EE3P 1VHEA 4MFZA 2QVPA 2XEGA 4KORA 4CAWA 3D7DA 1QQ9A 2Q7BA 3FJUA 5J8FA 1M44A 2K5TA 4B5PB 2Q44A 1TIQA 2HQYA 2Q4ZA 4MI4A 4RS2A 4C68A 4B14A 5IX3A 3IFEA 2ZEMA 2PJCA 3NE8A 2AFZA 1F57A 3B7IA 4UCPA 1CX8A 4X3RA 3KQXA 2IJZA 3EFAA 2J8NA 2CNTA 3IU1A 2ZEFA 4ZY2A 3IWWA 3SJXA 2ZOFA 5G20A 2G3AA 1Z8TA 2FIAA 4DUKA 4OAEA 3V38A 3PFOA 4OC1A 4KOUA 4ZY0A 4X5KA 4R76A 2WUUA 4JYWA 4FBEA 4UWIA 4RN7A 4PSXA 4MFJA 1M4GA 3DGVA 5HMNA 1CPXA 3T9YA 5DS0A 2PCUA 2EUIA 1RO5A 1YSJA 3BLNA 3FMCA 4OIWA 1XMBA 3BJ7A 3GUXA 3FXTA 4KUAA 2B4DA 5G21A 1VKCA 4G1PA 3CXSA 4M6HA 4Z65A 4CAFA 5JPHA 4KSAA 3E0KA 3DSBA 1IU8A 2DEAA 3TE4A 5KTDA 4NXYA 5LRJA 4MFPA 2Y0MA 1LRZA 1LCPA 1BAVA 2DXQA 1NMTA 4R57A 4OLLA 2ANPA 3IGRA 4OC4A 4U9ZA 4RUHA 3W91A 3D2PA 1I21A 3QNVA 4M85A 2KCWA 4W9YA 3TC8A 1ON0A 3IU2A 4UFVA 1TF9A 4A32A 2J8MA 1BO4A 4JWPA 4M6IA 2V77A 3N7ZA 2VL1A 2FT0A 3SXNA 3PB4X 4KOXA 2I00A 2PJ4A 2VBQA 2VZZA 2YNCA 3IWGA 4L8AA 4MXUA 4AG7A 2G9DA 3I3GA 4DYOA 3TO9A 4MHZA 4ONUA 4HPSA 2PJ5A 4KSIA 5AGEA 5HVGA 1PYTB 2P6FA 4J3GA 4KOWA 5LRKA 4H89A 2ZELA 3LACA 2QECA 2D4OA 4FD5A 4XPLA 3D7FA 2VQYA 3IEHA 3R9FA 1U6MA 3P2HA 4A95A 5ISVA 2OZHA 3CDXA 2Z3LA 1TKJA 2EBJA 4R3KA 5J1QA 1Q2DA 2BUEA 1LAMA 4PK3A 2Z0ZA 3R1KA 2Q4VA 3GKRA 2JEWA 1XF8A 1VIXA 2PRBA 7CPAA 3PB6X 3NH5A 2DF5A 4P4FA 5EBVA 4A2ZA 3TX8A 3PP9A 4P44A 5KTCA 3SI2A 4B5OA 3I9SA 4E0AA 4Q7AA 1GYTA 1Z2LA 2C6GA 2NSMA 4R9MA 4MRIA 4UA3A 4YGOA 3HLPA 4R8FA 3W6XA 3B3SA 2RFHA 4A30A 3T8WA 4FAIA 2X7BA 1KUXA 2CY2A 1VHOA 4DJLA 4CYNA 1S3ZA 1Y9WA 5CPAA 1Z9UA 4NEXA 2PE3A 1ZG9A 1QSRA 2REFA 3H8FA 4M6GA 1K4JA 2R1IA 3F5BA 2FSRA 3G3SA 5DWMA 1XJOA 3SJFA 4LX9A 2JBJA 3SI1A 4BBHA 1QSNA 3KQZA 2AFOA 4PPZA 2PR8A 3FEEA 1Y9KA 1IOIA 1YMEA 2EK8A 1PU9A 2P0WA 5LRGA 4H6ZA 3RBUA 1DE4C 2YNCC 3KL9A 5IB9A 1RXTA 2ODFA 4II9A 4A33A 4C2YA 4QUSA 2ZW7A 1MJ9A 3F8KA 3FNCA 3NFZA 4MCSA 3MN8A 4OP4A 4XNHB 2AE6A 3D2MA 5THWA 4BMHA 2D4PA 2V8VA 2BL1A 1IIDA 1S7NA 4B5PA 4F8ZA 3EC4A 3JTKA 2QJ8A 2AFUA 2OR4A 3ZZIA 5HXDA 1ZLHA 3RZAA 5J8CA 1OBRA 3KKWA 3IC1A 3R9EA 4CAEA 1VGYA 2VI7A 4C2XA 3UY5A 2C6PA 2OZGA 4PXDA 3MGDA 2YNEA 4M3SA 4R6TA 2GU2A 2PIZA 4ZX8A 4EVYA 1YW4A 3FRMA 1IGBA 3TT2A 2B58A 1NE9A 4NGNA 3DNSA 1QSTA 4A37A 3B3WA 4OC0A 2FCKA 2ZW5A 4KOVA 4AG9A 1XRYA 1KZFA 1Z5RA 4U5YA 5FVJA 2NYQA 2Z3KA 5JH9A 2B3VA 2IMOA 3QB8A 4YU9A 4PQAA 3GYAA 4Q36A 2F5IA 3PEIA 1ZLIA 2EK9A 3SXOA 3JRUA 1B87A 4PXBA 2CF4A 4EWTA 3DR8A 4P6YA 2Z3OA 2IL4A 2HB6A 1TF8A 1MJAA 4KVXA 5LYDA 1R43A 2AFXA 1AYEA 4OC3A 1YX0A 2POKA 4R7MA 3IIBA 3FBUA 3DLJA 4QB9A 4F0XA 2A4NA 4NGSA 3EY5A 2WYRA 2CXAA 2Q7SA 2B3UA 2FS5A 3IJ3A 3K2KA 4MMOA 4PK2A 2ZPAA 3TCVA 3TOBA 2H5MA 1IYLA 2FL4A 2WSAA 2PJAA 4IAVA 4UBRA 2ZOGA 3HUVA 2PJ1A 3IO1A 2OH1A 3G8WA 4JLYA 3RAMA 1QSOA 3V8IA 3WC6A 1A2ZA 5G1ZA 3RO0A 4ZGYB 5HVFA 3BI1A 2ZW4A 4CS0B 4P10A 4AVAA 1FY7A 3JVNA 1M4LA 3P2FA 1R3NA 5H86A 4AVCA 1YLOA 2YNDA 4GM5A 4CRYB 1KWMA 3PBEA 3B35A 2NMTA 3D4UA 4Y49B 4YWYA 4KLVA 3VATA 4CGLA 1YGHA 3GIUA 3B3CA 3S6GA 3PBBA 3TO6A 4A39A
chains in the Genus database with same CATH topology
4YFJA 1S5KA 4HNYB 4AB7A 4CYPA 4XPDB 1Q2YA 5CNPA 3RYOA 4MBUA 3R9GA 1I12A 1Z4RA 5F47A 1XIXA 3LODA 4UFWA 3FYNA 4HNWB 1QSMA 2HUZA 2G0BA 4IUSA 4KS9A 1R57A 2R7HA 2JEVA 1GHEA 1ZO0A 3CXPA 4AVBA 2CNSA 2BSWA 4B11A 1XE4A 3T90A 4Q38A 1P4NA 5F49A 4YRHA 4A31A 4PSWA 5KTAA 2G3TA 4CAXA 2EVNA 1XMTA 3EXNA 4HKFA 2O28A 3DDDA 4MY3A 1V0CA 4CYOA 4JD6A 1CM0A 3LD2A 4QBJA 5E96A 4HNXB 2FIWA 4CGMA 4B10A 2QMLA 4K30A 3R96A 4H6UA 4OADA 1CJWA 3NE7A 2VEZA 3ZJ0A 2BEIA 2GIVA 3A9LA 5BWAB 1OZPA 4UFXA 5C88A 3VWDA 2B5GB 4CGNA 1S7KA 1WWZA 1YREA 3F0AA 4CGOA 4KVOE 1VHSA 1YVOA 4NCZA 4NF1A 4I49A 4ZBGA 4MFLA 4B13A 1MJBA 1I1DA 2PDOA 3PZJA 4UCMA 2AJ6A 4KVME 4E2AA 2GE3A 1Y7RA 2P6EA 3D8PA 5G22A 4JXRA 2JDDA 2R98A 1IYKA 5AG6A 2OU2A 4KSFA 4R87A 5A28A 4IF5A 4C2ZA 3B8GA 2PSWA 1YK3A 2OB0A 5DWNA 2ZW6A 4F0YA 4KUBA 2GANA 2Q04A 4LUAA 4RI1A 4ORFA 2R8VA 2YGWA 3VWEA 4XNHC 4MFKA 3GY9A 5HH1A 2VXKA 3SHPA 2Q0YA 4UWJA 4JJXA 5IV0A 2VZYA 3D3SA 4FD4A 1YVKA 1PUAA 1L0CA 1IB1E 2PC1A 2WPXA 1MK4A 4XPKA 3PGPA 4QC6A 4UCNA 3W6SA 4KOYA 3QAHA 1UFHA 4CRZB 2Z3MA 2B4BA 5IB0A 2J8RA 2FE7A 4CAVA 3CXQA 1M4DA 5F46A 5I0CA 4CGPA 1BOBA 1J4JA 1YLEA 3H4QA 2I79A 2Z3NA 1SQHA 4MJ8A 1N71A 4L89A 2B4DB 1WK4A 4NSQA 4KLWA 4MHDA 4MY0A 4C7HA 3OWCA 3S6HA 5JQ4A 2DPSA 3IWEA 3DR6A 3TOAA 3TFYA 3FIXA 2CNMA 4FD7A 5AG7A 4B12A 4U9YA 1M1DA 4JXQA 2ZXVA 3R95A 3WR7A 3BJ8A 2PQ8A 4MFQA 4Y49C 1KUVA 1S7FA 4F6AA 2QIRA 2P6GA 2HV2A 5AG5A 2Q4YA 4XPDC 1NSLA 1Z4EA 3TTHA 2B5GA 1P0HA 3S6KA 3TO7A 1S60A 4R3LA 4CYQA 1XEBA 3FB3A 5EC4A 4KZTA 1KUYA 5A27A 1Q2CA 2FXFA 2JDCA 2Z3PA 4GS4A 5GCNA 3K9UA 4KOTA 2OZUA 4KOSA 2Z10A 2REEA 3S6FA 5C82A 2DPTA 2PR1A 2ARHA 2Z11A 4PV6A 1B6BA 4C7IA 4FD6A 3C26A 2C27A 1YR0A 1IICA 4E8OA 4DNCA 2RC4A 3H5ZA 2ATRA 4QVTA 5AG4A 3JUWA 1M4IA 3EO4A 5F48A 2WPWA 1S7LA 2JLMA 4MFZA 4CAWA 4KORA 2Q7BA 5J8FA 1M44A 2K5TA 4B5PB 2Q44A 1TIQA 2HQYA 4MI4A 4RS2A 4C68A 4B14A 5IX3A 4UCPA 3EFAA 2J8NA 2CNTA 3IU1A 5G20A 2G3AA 2FIAA 4OAEA 4KOUA 4X5KA 2WUUA 4UWIA 4PSXA 4MFJA 1M4GA 5HMNA 3T9YA 2EUIA 1RO5A 3BLNA 3BJ7A 3FXTA 4KUAA 2B4DA 5G21A 1VKCA 3CXSA 4CAFA 5JPHA 4KSAA 3E0KA 3DSBA 3TE4A 5KTDA 4NXYA 4MFPA 2Y0MA 1LRZA 2DXQA 4R57A 1NMTA 4OLLA 3IGRA 4U9ZA 3W91A 3D2PA 1I21A 4M85A 2KCWA 1ON0A 3IU2A 4UFVA 4A32A 2J8MA 1BO4A 4JWPA 3N7ZA 2FT0A 3SXNA 4KOXA 4L8AA 2I00A 2VBQA 2VZZA 2YNCA 3IWGA 5H84A 4AG7A 3I3GA 3TO9A 4ONUA 5AGEA 2P6FA 4J3GA 4KOWA 4H89A 2QECA 2D4OA 4FD5A 4XPLA 2VQYA 3R9FA 1U6MA 3P2HA 4A95A 5ISVA 2OZHA 2Z3LA 4R3KA 1Q2DA 2BUEA 4PK3A 2Z0ZA 3R1KA 2Q4VA 3GKRA 1XF8A 2PRBA 5EBVA 4A2ZA 3PP9A 5KTCA 4B5OA 3I9SA 4E0AA 4R9MA 4UA3A 4YGOA 3W6XA 4A30A 2X7BA 1KUXA 2CY2A 4CYNA 1S3ZA 1Y9WA 1Z9UA 4NEXA 1QSRA 2REFA 1K4JA 2R1IA 3F5BA 2FSRA 3G3SA 5DWMA 4LX9A 4BBHA 1QSNA 2PR8A 1Y9KA 1PU9A 2P0WA 4H6ZA 2YNCC 1RXTA 4II9A 4A33A 4C2YA 4QUSA 2ZW7A 1MJ9A 3F8KA 3FNCA 4XNHB 2AE6A 3D2MA 4BMHA 2D4PA 2BL1A 1IIDA 1S7NA 4B5PA 3EC4A 3JTKA 3ZZIA 5J8CA 3KKWA 3R9EA 4CAEA 2VI7A 4C2XA 3UY5A 2OZGA 3MGDA 2YNEA 4M3SA 4EVYA 3FRMA 3TT2A 2B58A 1NE9A 3DNSA 1QSTA 2FCKA 2ZW5A 4KOVA 4AG9A 1KZFA 5FVJA 4U5YA 2Z3KA 2B3VA 3QB8A 3GYAA 4Q36A 2F5IA 3SXOA 1B87A 3DR8A 2Z3OA 2IL4A 1MJAA 4KVXA 1YX0A 3FBUA 4QB9A 4F0XA 2A4NA 3EY5A 2CXAA 4PK2A 2B3UA 2FS5A 3TCVA 2ZPAA 3TOBA 2H5MA 1IYLA 2FL4A 2WSAA 4UBRA 2OH1A 3G8WA 4JLYA 1QSOA 3V8IA 5G1ZA 4ZGYB 2ZW4A 4CS0B 4AVAA 1FY7A 3JVNA 3P2FA 5H86A 4AVCA 2YNDA 4CRYB 2NMTA 4Y49B 4KLVA 4CGLA 1YGHA 3S6GA 3TO6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YFJ A;  1S5K A;  4HNY B;  4AB7 A;  4XPD B;  1Q2Y A;  5CNP A;  3RYO A;  4MBU A;  3R9G A;  1I12 A;  1Z4R A;  5F47 A;  1XIX A;  3LOD A;  3FYN A;  4HNW B;  1QSM A;  2HUZ A;  2G0B A;  4IUS A;  1R57 A;  2R7H A;  2JEV A;  1GHE A;  3CXP A;  4AVB A;  2CNS A;  2BSW A;  1XE4 A;  3T90 A;  1P4N A;  5F49 A;  4YRH A;  4PSW A;  5KTA A;  2G3T A;  4CAX A;  2EVN A;  1XMT A;  3EXN A;  4HKF A;  2O28 A;  3DDD A;  4MY3 A;  1V0C A;  4JD6 A;  1CM0 A;  3LD2 A;  4QBJ A;  5E96 A;  4HNX B;  2FIW A;  2QML A;  4K30 A;  3R96 A;  4H6U A;  4OAD A;  1CJW A;  3NE7 A;  2VEZ A;  3ZJ0 A;  2BEI A;  2GIV A;  1OZP A;  5C88 A;  3VWD A;  2B5G B;  1S7K A;  1WWZ A;  1YRE A;  3F0A A;  4KVO E;  1VHS A;  1YVO A;  4NCZ A;  4NF1 A;  4I49 A;  4ZBG A;  1MJB A;  1I1D A;  2PDO A;  3PZJ A;  2AJ6 A;  4KVM E;  4E2A A;  2GE3 A;  1Y7R A;  2P6E A;  3D8P A;  4JXR A;  2JDD A;  2R98 A;  1IYK A;  2OU2 A;  4R87 A;  4IF5 A;  3B8G A;  2PSW A;  1YK3 A;  2OB0 A;  5DWN A;  2ZW6 A;  4F0Y A;  4KUB A;  2GAN A;  2Q04 A;  4LUA A;  4RI1 A;  4ORF A;  2R8V A;  3VWE A;  4XNH C;  3GY9 A;  5HH1 A;  2VXK A;  3SHP A;  2Q0Y A;  4UWJ A;  4JJX A;  5IV0 A;  2VZY A;  3D3S A;  4FD4 A;  1YVK A;  1PUA A;  1L0C A;  1IB1 E;  2PC1 A;  2WPX A;  1MK4 A;  4XPK A;  3PGP A;  4QC6 A;  3W6S A;  4KOY A;  3QAH A;  1UFH A;  4CRZ B;  2B4B A;  5IB0 A;  2J8R A;  2FE7 A;  4CAV A;  3CXQ A;  1M4D A;  5F46 A;  5I0C A;  1BOB A;  1J4J A;  1YLE A;  3H4Q A;  2I79 A;  1SQH A;  4MJ8 A;  1N71 A;  4L89 A;  2B4D B;  1WK4 A;  4NSQ A;  4KLW A;  4MHD A;  4MY0 A;  3OWC A;  3S6H A;  5JQ4 A;  3DR6 A;  3TOA A;  3TFY A;  3FIX A;  2CNM A;  4FD7 A;  4U9Y A;  1M1D A;  4JXQ A;  2ZXV A;  3R95 A;  3WR7 A;  3BJ8 A;  2PQ8 A;  4Y49 C;  1KUV A;  1S7F A;  4F6A A;  2QIR A;  2P6G A;  2HV2 A;  2Q4Y A;  4XPD C;  1NSL A;  1Z4E A;  3TTH A;  2B5G A;  1P0H A;  3S6K A;  3TO7 A;  1S60 A;  4R3L A;  1XEB A;  3FB3 A;  5EC4 A;  4KZT A;  1KUY A;  1Q2C A;  2FXF A;  2JDC A;  4GS4 A;  5GCN A;  3K9U A;  4KOT A;  2OZU A;  4KOS A;  2Z10 A;  2REE A;  3S6F A;  5C82 A;  2PR1 A;  2ARH A;  2Z11 A;  4PV6 A;  1B6B A;  4FD6 A;  3C26 A;  2C27 A;  1YR0 A;  1IIC A;  4E8O A;  4DNC A;  2RC4 A;  2ATR A;  4QVT A;  3JUW A;  1M4I A;  3EO4 A;  5F48 A;  2WPW A;  1S7L A;  2JLM A;  4CAW A;  4KOR A;  2Q7B A;  5J8F A;  1M44 A;  2K5T A;  4B5P B;  2Q44 A;  1TIQ A;  2HQY A;  4MI4 A;  4RS2 A;  5IX3 A;  3EFA A;  2J8N A;  2CNT A;  2G3A A;  2FIA A;  4OAE A;  4KOU A;  4X5K A;  4UWI A;  4PSX A;  1M4G A;  5HMN A;  3T9Y A;  2EUI A;  1RO5 A;  3BLN A;  3BJ7 A;  3FXT A;  4KUA A;  2B4D A;  1VKC A;  3CXS A;  5JPH A;  3E0K A;  3DSB A;  3TE4 A;  5KTD A;  4NXY A;  2Y0M A;  1LRZ A;  2DXQ A;  4R57 A;  1NMT A;  4OLL A;  3IGR A;  4U9Z A;  3W91 A;  3D2P A;  1I21 A;  4M85 A;  2KCW A;  1ON0 A;  2J8M A;  1BO4 A;  4JWP A;  3N7Z A;  2FT0 A;  3SXN A;  4KOX A;  4L8A A;  2I00 A;  2VBQ A;  2VZZ A;  3IWG A;  5H84 A;  4AG7 A;  3I3G A;  3TO9 A;  4ONU A;  2P6F A;  4J3G A;  4KOW A;  4H89 A;  2QEC A;  2D4O A;  4FD5 A;  4XPL A;  2VQY A;  3R9F A;  1U6M A;  3P2H A;  5ISV A;  2OZH A;  4R3K A;  1Q2D A;  2BUE A;  4PK3 A;  2Z0Z A;  3R1K A;  2Q4V A;  3GKR A;  1XF8 A;  2PRB A;  5EBV A;  3PP9 A;  5KTC A;  4B5O A;  3I9S A;  4E0A A;  4R9M A;  4UA3 A;  4YGO A;  3W6X A;  2X7B A;  1KUX A;  2CY2 A;  1S3Z A;  1Y9W A;  1Z9U A;  4NEX A;  1QSR A;  2REF A;  1K4J A;  2R1I A;  3F5B A;  2FSR A;  3G3S A;  5DWM A;  4LX9 A;  1QSN A;  2PR8 A;  1Y9K A;  1PU9 A;  2P0W A;  4H6Z A;  1RXT A;  4II9 A;  4QUS A;  2ZW7 A;  1MJ9 A;  3F8K A;  3FNC A;  4XNH B;  2AE6 A;  3D2M A;  4BMH A;  2D4P A;  2BL1 A;  1IID A;  1S7N A;  4B5P A;  3EC4 A;  3ZZI A;  5J8C A;  3KKW A;  3R9E A;  2VI7 A;  3UY5 A;  2OZG A;  3MGD A;  4M3S A;  4EVY A;  3FRM A;  3TT2 A;  2B58 A;  1NE9 A;  3DNS A;  1QST A;  2FCK A;  2ZW5 A;  4KOV A;  4AG9 A;  1KZF A;  5FVJ A;  4U5Y A;  2B3V A;  3QB8 A;  3GYA A;  2F5I A;  3SXO A;  1B87 A;  3DR8 A;  2IL4 A;  1MJA A;  4KVX A;  1YX0 A;  3FBU A;  4QB9 A;  2A4N A;  3EY5 A;  4PK2 A;  2B3U A;  2FS5 A;  3TCV A;  2ZPA A;  3TOB A;  2H5M A;  1IYL A;  2FL4 A;  4UBR A;  2OH1 A;  3G8W A;  4JLY A;  1QSO A;  3V8I A;  2ZW4 A;  4CS0 B;  4AVA A;  1FY7 A;  3JVN A;  3P2F A;  5H86 A;  4AVC A;  4CRY B;  2NMT A;  4Y49 B;  4KLV A;  1YGH A;  3S6G A;  3TO6 A; 
#chains in the Genus database with same CATH topology
 4YFJ A;  1S5K A;  3WC7 A;  4HNY B;  4AB7 A;  4CYP A;  4XPD B;  1Q2Y A;  5CNP A;  1X10 A;  3RYO A;  1X12 A;  4MBU A;  3R9G A;  2XEF A;  1I12 A;  1Z4R A;  1UWY A;  3QAY A;  1XIX A;  4ONW A;  3LOD A;  5F47 A;  5ELY A;  4UFW A;  3FYN A;  8CPA A;  2PVV A;  2RB7 A;  2JBK A;  1HEE A;  1Q7L A;  4HNW B;  1QSM A;  2HUZ A;  2G0B A;  2BO9 A;  1LAP A;  1R57 A;  2R7H A;  2I3C A;  4IUS A;  4KS9 A;  4UF4 A;  1TKH A;  2O53 A;  2V8H A;  3V7Z A;  2JEV A;  1F2O A;  2OOT A;  1GHE A;  3NA6 A;  3CPA A;  1TXR A;  1ZO0 A;  3CXP A;  4O23 A;  2CNS A;  2ZEG A;  4AVB A;  2BSW A;  4B11 A;  1XE4 A;  2ZEH A;  3T90 A;  3FF3 A;  1ZG8 A;  4Q38 A;  1P4N A;  5K8O A;  3D67 A;  3KI9 A;  5F49 A;  4YRH A;  1XBU A;  4A31 A;  1XFO A;  4PSW A;  5KTA A;  3NH4 A;  2G3T A;  2Q51 A;  3CPX A;  2EVN A;  1XMT A;  4P45 A;  4CAX A;  3EXN A;  1XOV A;  4HKF A;  3CT9 A;  2O28 A;  4MHN A;  3DDD A;  4UIA A;  4MY3 A;  1V0C A;  1CP6 A;  4X8I A;  4CYO A;  1ELM P;  4JD6 A;  1CM0 A;  4PXE A;  3LD2 A;  4QBJ A;  5E96 A;  4HNX B;  2FIW A;  4MHY A;  1Y7E A;  4CGM A;  4B10 A;  2AFS A;  2QML A;  4K30 A;  3R96 A;  4H6U A;  3VAR A;  2IQ6 A;  1TKF A;  2CIJ A;  4OAD A;  1CJW A;  3FX6 A;  3NE7 A;  3ISZ A;  2VEZ A;  2ZEN A;  3BXM A;  3WAB A;  2BEI A;  2GIV A;  3A9L A;  3ZJ0 A;  5BWA B;  2PVW A;  1OZP A;  4UFX A;  5C88 A;  3LWU A;  3VWD A;  4ZY1 A;  2B5G B;  4CGN A;  1S7K A;  1CP7 A;  2PJB A;  1AMP A;  1WWZ A;  4TNU A;  2J9A A;  1QMU A;  1YRE A;  3H8E A;  3F0A A;  4CGO A;  1BPN A;  4KVO E;  1VHS A;  1YVO A;  4X2T A;  2EO8 A;  4NCZ A;  2F7V A;  4FUU A;  4NF1 A;  2PJ6 A;  4I49 A;  4MFL A;  4ZBG A;  1IOF A;  4B13 A;  1MJB A;  1I1D A;  1LFW A;  2PDO A;  3PZJ A;  4UCM A;  1Y0Y A;  2AJ6 A;  4F9V A;  4KVM E;  4E2A A;  2GE3 A;  3PB9 X;  1Y7R A;  4BD9 A;  5LYF A;  2P6E A;  3D8P A;  5G22 A;  4JXR A;  4WJB A;  2JDD A;  2R98 A;  4EME A;  3S9L A;  2PJ3 A;  1IYK A;  2V8D A;  5AG6 A;  1DTD A;  2OU2 A;  4KSF A;  4R87 A;  1HDQ A;  5A28 A;  4IF5 A;  4C2Z A;  4MCR A;  3B8G A;  5JGF A;  1CG2 A;  3B3V A;  4OC5 A;  1FT7 A;  3KR4 A;  2PJ7 A;  2V8G A;  2PSW A;  4MHP A;  1YK3 A;  2OB0 A;  4P4E A;  5DWN A;  1HDU A;  4EFD A;  2ZW6 A;  4F0Y A;  4KUB A;  3FEC A;  2PJ9 A;  3B3T A;  2GAN A;  2AFM A;  2Q04 A;  3KZW A;  4LUA A;  5JM6 A;  3PB8 X;  2PJ2 A;  3D7G A;  4RI1 A;  2ZEP A;  4ORF A;  2ZEE A;  2R8V A;  2YGW A;  3VWE A;  1NSA A;  2BOA A;  5H84 A;  4NJR A;  3ISX A;  4XNH C;  4MFK A;  1LOK A;  4BIN A;  1JQG A;  3GY9 A;  5HH1 A;  4OC2 A;  2XEJ A;  3PFE A;  2VXK A;  3SHP A;  2Q0Y A;  4UWJ A;  4JJX A;  4A94 A;  3KHZ A;  3BHX A;  1ELL P;  5IV0 A;  1YQE A;  2VZY A;  3D3S A;  4FD4 A;  4UIB A;  1YVK A;  4NFR A;  1CPS A;  1PUA A;  1L0C A;  1IB1 E;  2PC1 A;  2PRQ A;  1AUG A;  1MK4 A;  2WPX A;  4ZYQ A;  4K3N A;  4MCQ A;  3KHX A;  4P4J A;  5K8P A;  1Z8W A;  2ZED A;  2GFQ A;  4FWU A;  1FNO A;  4XPK A;  5F09 A;  3PGP A;  3NH8 A;  3WT4 A;  5HVH A;  4QC6 A;  4UCN A;  3W6S A;  4WWV A;  4KOY A;  4OID A;  3QAH A;  1UFH A;  4CRZ B;  2Z3M A;  4UEF A;  4LQG A;  2B4B A;  5IB0 A;  5K8N A;  4IHM A;  2J8R A;  2FE7 A;  4UEE A;  1JWQ A;  2GLF A;  3CXQ A;  1M4D A;  4CAV A;  5F46 A;  1F2P A;  2CTB A;  4CGP A;  5I0C A;  2GLJ A;  3D66 A;  1BOB A;  1J4J A;  1YLE A;  3H4Q A;  2FVG A;  2I79 A;  1Y0R A;  2Z3N A;  1SQH A;  4MJ8 A;  1N71 A;  3BI0 A;  4L89 A;  3SJE A;  1CBX A;  1PCA A;  2B4D B;  1WK4 A;  4IK2 A;  5D8N A;  2PIY A;  3L2N A;  4NSQ A;  4KLW A;  3B2Y A;  3SI0 A;  4MHD A;  2GRE A;  4MY0 A;  4C7H A;  3OWC A;  3S6H A;  5JQ4 A;  3SJG A;  2DPS A;  3IWE A;  3FED A;  3WC5 A;  3VH9 A;  2ABZ A;  4A38 A;  3DR6 A;  4CPA A;  3TOA A;  3TFY A;  3FIX A;  2CNM A;  3MRU A;  4FD7 A;  5LYI A;  4JZ0 A;  3S9M A;  5AG7 A;  3GB0 A;  4F9U A;  4B12 A;  2CTC A;  3D7H A;  4GXH A;  4U9Y A;  1M1D A;  4JXQ A;  2ZXV A;  4PXC A;  4H2K A;  2QYV A;  3R95 A;  3BJ8 A;  3WR7 A;  1YW6 A;  2PQ8 A;  3N5F A;  4MFQ A;  4NGM A;  1BPM A;  4Y49 C;  4P4D A;  5CBM A;  1KUV A;  2HC9 A;  2O4H A;  3FH4 A;  1S7F A;  2PJ8 A;  4F6A A;  3KGQ A;  2QIR A;  3PRT A;  2P6G A;  4NGQ A;  2HV2 A;  1Z8L A;  5AG5 A;  4OKO A;  2Q4Y A;  4OME A;  4XPD C;  4B6Z A;  2WZN A;  1NSL A;  1Z4E A;  3TTH A;  5LYL A;  2B5G A;  1P0H A;  4NGT A;  4P4B A;  3S6K A;  3TO7 A;  1S60 A;  4R3L A;  4CYQ A;  1XEB A;  2C1C A;  3FB3 A;  5EC4 A;  4KZT A;  1KUY A;  5A27 A;  3K9T A;  1Q2C A;  5K8M A;  2AFW A;  2FXF A;  2JDC A;  2Q43 A;  2Z3P A;  4GS4 A;  4TWE A;  2XEI A;  5GCN A;  4ZX9 A;  3K9U A;  4KOT A;  5EMI A;  2OZU A;  1ARL A;  4KOS A;  6CPA A;  4NGP A;  2Z10 A;  2REE A;  1Z8X A;  3S6F A;  1ARM A;  5C82 A;  2DPT A;  2PR1 A;  3KAS A;  2ARH A;  2Z11 A;  3PB7 X;  4PV6 A;  5I4M A;  4P4I A;  4LQ6 A;  4MCP A;  1B6B A;  1H8L A;  4C7I A;  1LAN A;  3C26 A;  2C27 A;  2F8H A;  4FD6 A;  5D29 A;  3KR5 A;  4AXV A;  1YR0 A;  2C6C A;  2ZEO A;  3I1U A;  4ZI6 A;  1IIC A;  3CZX A;  1BLL E;  1IY7 A;  4E8O A;  4DNC A;  2BCO A;  2RC4 A;  4NJQ A;  3H5Z A;  3H8G A;  3RNZ A;  3FVL A;  3D68 A;  2EWB A;  1RTQ A;  2ATR A;  4QVT A;  3S9N A;  5AG4 A;  3JUW A;  3LMS A;  1M4I A;  3EO4 A;  5F48 A;  1ZG7 A;  2PJ0 A;  4UEZ A;  2WPW A;  1S7L A;  3GLJ A;  4NGR A;  2JLM A;  1EE3 P;  1VHE A;  4MFZ A;  2QVP A;  2XEG A;  4KOR A;  4CAW A;  3D7D A;  1QQ9 A;  2Q7B A;  3FJU A;  5J8F A;  1M44 A;  2K5T A;  4B5P B;  2Q44 A;  1TIQ A;  2HQY A;  2Q4Z A;  4MI4 A;  4RS2 A;  4C68 A;  4B14 A;  5IX3 A;  3IFE A;  2ZEM A;  2PJC A;  3NE8 A;  2AFZ A;  1F57 A;  3B7I A;  4UCP A;  1CX8 A;  4X3R A;  3KQX A;  2IJZ A;  3EFA A;  2J8N A;  2CNT A;  3IU1 A;  2ZEF A;  4ZY2 A;  3IWW A;  3SJX A;  2ZOF A;  5G20 A;  2G3A A;  1Z8T A;  2FIA A;  4DUK A;  4OAE A;  3V38 A;  3PFO A;  4OC1 A;  4KOU A;  4ZY0 A;  4X5K A;  4R76 A;  2WUU A;  4JYW A;  4FBE A;  4UWI A;  4RN7 A;  4PSX A;  4MFJ A;  1M4G A;  3DGV A;  5HMN A;  1CPX A;  3T9Y A;  5DS0 A;  2PCU A;  2EUI A;  1RO5 A;  1YSJ A;  3BLN A;  3FMC A;  4OIW A;  1XMB A;  3BJ7 A;  3GUX A;  3FXT A;  4KUA A;  2B4D A;  5G21 A;  1VKC A;  4G1P A;  3CXS A;  4M6H A;  4Z65 A;  4CAF A;  5JPH A;  4KSA A;  3E0K A;  3DSB A;  1IU8 A;  2DEA A;  3TE4 A;  5KTD A;  4NXY A;  5LRJ A;  4MFP A;  2Y0M A;  1LRZ A;  1LCP A;  1BAV A;  2DXQ A;  1NMT A;  4R57 A;  4OLL A;  2ANP A;  3IGR A;  4OC4 A;  4U9Z A;  4RUH A;  3W91 A;  3D2P A;  1I21 A;  3QNV A;  4M85 A;  2KCW A;  4W9Y A;  3TC8 A;  1ON0 A;  3IU2 A;  4UFV A;  1TF9 A;  4A32 A;  2J8M A;  1BO4 A;  4JWP A;  4M6I A;  2V77 A;  3N7Z A;  2VL1 A;  2FT0 A;  3SXN A;  3PB4 X;  4KOX A;  2I00 A;  2PJ4 A;  2VBQ A;  2VZZ A;  2YNC A;  3IWG A;  4L8A A;  4MXU A;  4AG7 A;  2G9D A;  3I3G A;  4DYO A;  3TO9 A;  4MHZ A;  4ONU A;  4HPS A;  2PJ5 A;  4KSI A;  5AGE A;  5HVG A;  1PYT B;  2P6F A;  4J3G A;  4KOW A;  5LRK A;  4H89 A;  2ZEL A;  3LAC A;  2QEC A;  2D4O A;  4FD5 A;  4XPL A;  3D7F A;  2VQY A;  3IEH A;  3R9F A;  1U6M A;  3P2H A;  4A95 A;  5ISV A;  2OZH A;  3CDX A;  2Z3L A;  1TKJ A;  2EBJ A;  4R3K A;  5J1Q A;  1Q2D A;  2BUE A;  1LAM A;  4PK3 A;  2Z0Z A;  3R1K A;  2Q4V A;  3GKR A;  2JEW A;  1XF8 A;  1VIX A;  2PRB A;  7CPA A;  3PB6 X;  3NH5 A;  2DF5 A;  4P4F A;  5EBV A;  4A2Z A;  3TX8 A;  3PP9 A;  4P44 A;  5KTC A;  3SI2 A;  4B5O A;  3I9S A;  4E0A A;  4Q7A A;  1GYT A;  1Z2L A;  2C6G A;  2NSM A;  4R9M A;  4MRI A;  4UA3 A;  4YGO A;  3HLP A;  4R8F A;  3W6X A;  3B3S A;  2RFH A;  4A30 A;  3T8W A;  4FAI A;  2X7B A;  1KUX A;  2CY2 A;  1VHO A;  4DJL A;  4CYN A;  1S3Z A;  1Y9W A;  5CPA A;  1Z9U A;  4NEX A;  2PE3 A;  1ZG9 A;  1QSR A;  2REF A;  3H8F A;  4M6G A;  1K4J A;  2R1I A;  3F5B A;  2FSR A;  3G3S A;  5DWM A;  1XJO A;  3SJF A;  4LX9 A;  2JBJ A;  3SI1 A;  4BBH A;  1QSN A;  3KQZ A;  2AFO A;  4PPZ A;  2PR8 A;  3FEE A;  1Y9K A;  1IOI A;  1YME A;  2EK8 A;  1PU9 A;  2P0W A;  5LRG A;  4H6Z A;  3RBU A;  1DE4 C;  2YNC C;  3KL9 A;  5IB9 A;  1RXT A;  2ODF A;  4II9 A;  4A33 A;  4C2Y A;  4QUS A;  2ZW7 A;  1MJ9 A;  3F8K A;  3FNC A;  3NFZ A;  4MCS A;  3MN8 A;  4OP4 A;  4XNH B;  2AE6 A;  3D2M A;  5THW A;  4BMH A;  2D4P A;  2V8V A;  2BL1 A;  1IID A;  1S7N A;  4B5P A;  4F8Z A;  3EC4 A;  3JTK A;  2QJ8 A;  2AFU A;  2OR4 A;  3ZZI A;  5HXD A;  1ZLH A;  3RZA A;  5J8C A;  1OBR A;  3KKW A;  3IC1 A;  3R9E A;  4CAE A;  1VGY A;  2VI7 A;  4C2X A;  3UY5 A;  2C6P A;  2OZG A;  4PXD A;  3MGD A;  2YNE A;  4M3S A;  4R6T A;  2GU2 A;  2PIZ A;  4ZX8 A;  4EVY A;  1YW4 A;  3FRM A;  1IGB A;  3TT2 A;  2B58 A;  1NE9 A;  4NGN A;  3DNS A;  1QST A;  4A37 A;  3B3W A;  4OC0 A;  2FCK A;  2ZW5 A;  4KOV A;  4AG9 A;  1XRY A;  1KZF A;  1Z5R A;  4U5Y A;  5FVJ A;  2NYQ A;  2Z3K A;  5JH9 A;  2B3V A;  2IMO A;  3QB8 A;  4YU9 A;  4PQA A;  3GYA A;  4Q36 A;  2F5I A;  3PEI A;  1ZLI A;  2EK9 A;  3SXO A;  3JRU A;  1B87 A;  4PXB A;  2CF4 A;  4EWT A;  3DR8 A;  4P6Y A;  2Z3O A;  2IL4 A;  2HB6 A;  1TF8 A;  1MJA A;  4KVX A;  5LYD A;  1R43 A;  2AFX A;  1AYE A;  4OC3 A;  1YX0 A;  2POK A;  4R7M A;  3IIB A;  3FBU A;  3DLJ A;  4QB9 A;  4F0X A;  2A4N A;  4NGS A;  3EY5 A;  2WYR A;  2CXA A;  2Q7S A;  2B3U A;  2FS5 A;  3IJ3 A;  3K2K A;  4MMO A;  4PK2 A;  2ZPA A;  3TCV A;  3TOB A;  2H5M A;  1IYL A;  2FL4 A;  2WSA A;  2PJA A;  4IAV A;  4UBR A;  2ZOG A;  3HUV A;  2PJ1 A;  3IO1 A;  2OH1 A;  3G8W A;  4JLY A;  3RAM A;  1QSO A;  3V8I A;  3WC6 A;  1A2Z A;  5G1Z A;  3RO0 A;  4ZGY B;  5HVF A;  3BI1 A;  2ZW4 A;  4CS0 B;  4P10 A;  4AVA A;  1FY7 A;  3JVN A;  1M4L A;  3P2F A;  1R3N A;  5H86 A;  4AVC A;  1YLO A;  2YND A;  4GM5 A;  4CRY B;  1KWM A;  3PBE A;  3B35 A;  2NMT A;  3D4U A;  4Y49 B;  4YWY A;  4KLV A;  3VAT A;  4CGL A;  1YGH A;  3GIU A;  3B3C A;  3S6G A;  3PBB A;  3TO6 A;  4A39 A; 
#chains in the Genus database with same CATH homology
 4YFJ A;  1S5K A;  4HNY B;  4AB7 A;  4CYP A;  4XPD B;  1Q2Y A;  5CNP A;  3RYO A;  4MBU A;  3R9G A;  1I12 A;  1Z4R A;  5F47 A;  1XIX A;  3LOD A;  4UFW A;  3FYN A;  4HNW B;  1QSM A;  2HUZ A;  2G0B A;  4IUS A;  4KS9 A;  1R57 A;  2R7H A;  2JEV A;  1GHE A;  1ZO0 A;  3CXP A;  4AVB A;  2CNS A;  2BSW A;  4B11 A;  1XE4 A;  3T90 A;  4Q38 A;  1P4N A;  5F49 A;  4YRH A;  4A31 A;  4PSW A;  5KTA A;  2G3T A;  4CAX A;  2EVN A;  1XMT A;  3EXN A;  4HKF A;  2O28 A;  3DDD A;  4MY3 A;  1V0C A;  4CYO A;  4JD6 A;  1CM0 A;  3LD2 A;  4QBJ A;  5E96 A;  4HNX B;  2FIW A;  4CGM A;  4B10 A;  2QML A;  4K30 A;  3R96 A;  4H6U A;  4OAD A;  1CJW A;  3NE7 A;  2VEZ A;  3ZJ0 A;  2BEI A;  2GIV A;  3A9L A;  5BWA B;  1OZP A;  4UFX A;  5C88 A;  3VWD A;  2B5G B;  4CGN A;  1S7K A;  1WWZ A;  1YRE A;  3F0A A;  4CGO A;  4KVO E;  1VHS A;  1YVO A;  4NCZ A;  4NF1 A;  4I49 A;  4ZBG A;  4MFL A;  4B13 A;  1MJB A;  1I1D A;  2PDO A;  3PZJ A;  4UCM A;  2AJ6 A;  4KVM E;  4E2A A;  2GE3 A;  1Y7R A;  2P6E A;  3D8P A;  5G22 A;  4JXR A;  2JDD A;  2R98 A;  1IYK A;  5AG6 A;  2OU2 A;  4KSF A;  4R87 A;  5A28 A;  4IF5 A;  4C2Z A;  3B8G A;  2PSW A;  1YK3 A;  2OB0 A;  5DWN A;  2ZW6 A;  4F0Y A;  4KUB A;  2GAN A;  2Q04 A;  4LUA A;  4RI1 A;  4ORF A;  2R8V A;  2YGW A;  3VWE A;  4XNH C;  4MFK A;  3GY9 A;  5HH1 A;  2VXK A;  3SHP A;  2Q0Y A;  4UWJ A;  4JJX A;  5IV0 A;  2VZY A;  3D3S A;  4FD4 A;  1YVK A;  1PUA A;  1L0C A;  1IB1 E;  2PC1 A;  2WPX A;  1MK4 A;  4XPK A;  3PGP A;  4QC6 A;  4UCN A;  3W6S A;  4KOY A;  3QAH A;  1UFH A;  4CRZ B;  2Z3M A;  2B4B A;  5IB0 A;  2J8R A;  2FE7 A;  4CAV A;  3CXQ A;  1M4D A;  5F46 A;  5I0C A;  4CGP A;  1BOB A;  1J4J A;  1YLE A;  3H4Q A;  2I79 A;  2Z3N A;  1SQH A;  4MJ8 A;  1N71 A;  4L89 A;  2B4D B;  1WK4 A;  4NSQ A;  4KLW A;  4MHD A;  4MY0 A;  4C7H A;  3OWC A;  3S6H A;  5JQ4 A;  2DPS A;  3IWE A;  3DR6 A;  3TOA A;  3TFY A;  3FIX A;  2CNM A;  4FD7 A;  5AG7 A;  4B12 A;  4U9Y A;  1M1D A;  4JXQ A;  2ZXV A;  3R95 A;  3WR7 A;  3BJ8 A;  2PQ8 A;  4MFQ A;  4Y49 C;  1KUV A;  1S7F A;  4F6A A;  2QIR A;  2P6G A;  2HV2 A;  5AG5 A;  2Q4Y A;  4XPD C;  1NSL A;  1Z4E A;  3TTH A;  2B5G A;  1P0H A;  3S6K A;  3TO7 A;  1S60 A;  4R3L A;  4CYQ A;  1XEB A;  3FB3 A;  5EC4 A;  4KZT A;  1KUY A;  5A27 A;  1Q2C A;  2FXF A;  2JDC A;  2Z3P A;  4GS4 A;  5GCN A;  3K9U A;  4KOT A;  2OZU A;  4KOS A;  2Z10 A;  2REE A;  3S6F A;  5C82 A;  2DPT A;  2PR1 A;  2ARH A;  2Z11 A;  4PV6 A;  1B6B A;  4C7I A;  4FD6 A;  3C26 A;  2C27 A;  1YR0 A;  1IIC A;  4E8O A;  4DNC A;  2RC4 A;  3H5Z A;  2ATR A;  4QVT A;  5AG4 A;  3JUW A;  1M4I A;  3EO4 A;  5F48 A;  2WPW A;  1S7L A;  2JLM A;  4MFZ A;  4CAW A;  4KOR A;  2Q7B A;  5J8F A;  1M44 A;  2K5T A;  4B5P B;  2Q44 A;  1TIQ A;  2HQY A;  4MI4 A;  4RS2 A;  4C68 A;  4B14 A;  5IX3 A;  4UCP A;  3EFA A;  2J8N A;  2CNT A;  3IU1 A;  5G20 A;  2G3A A;  2FIA A;  4OAE A;  4KOU A;  4X5K A;  2WUU A;  4UWI A;  4PSX A;  4MFJ A;  1M4G A;  5HMN A;  3T9Y A;  2EUI A;  1RO5 A;  3BLN A;  3BJ7 A;  3FXT A;  4KUA A;  2B4D A;  5G21 A;  1VKC A;  3CXS A;  4CAF A;  5JPH A;  4KSA A;  3E0K A;  3DSB A;  3TE4 A;  5KTD A;  4NXY A;  4MFP A;  2Y0M A;  1LRZ A;  2DXQ A;  4R57 A;  1NMT A;  4OLL A;  3IGR A;  4U9Z A;  3W91 A;  3D2P A;  1I21 A;  4M85 A;  2KCW A;  1ON0 A;  3IU2 A;  4UFV A;  4A32 A;  2J8M A;  1BO4 A;  4JWP A;  3N7Z A;  2FT0 A;  3SXN A;  4KOX A;  4L8A A;  2I00 A;  2VBQ A;  2VZZ A;  2YNC A;  3IWG A;  5H84 A;  4AG7 A;  3I3G A;  3TO9 A;  4ONU A;  5AGE A;  2P6F A;  4J3G A;  4KOW A;  4H89 A;  2QEC A;  2D4O A;  4FD5 A;  4XPL A;  2VQY A;  3R9F A;  1U6M A;  3P2H A;  4A95 A;  5ISV A;  2OZH A;  2Z3L A;  4R3K A;  1Q2D A;  2BUE A;  4PK3 A;  2Z0Z A;  3R1K A;  2Q4V A;  3GKR A;  1XF8 A;  2PRB A;  5EBV A;  4A2Z A;  3PP9 A;  5KTC A;  4B5O A;  3I9S A;  4E0A A;  4R9M A;  4UA3 A;  4YGO A;  3W6X A;  4A30 A;  2X7B A;  1KUX A;  2CY2 A;  4CYN A;  1S3Z A;  1Y9W A;  1Z9U A;  4NEX A;  1QSR A;  2REF A;  1K4J A;  2R1I A;  3F5B A;  2FSR A;  3G3S A;  5DWM A;  4LX9 A;  4BBH A;  1QSN A;  2PR8 A;  1Y9K A;  1PU9 A;  2P0W A;  4H6Z A;  2YNC C;  1RXT A;  4II9 A;  4A33 A;  4C2Y A;  4QUS A;  2ZW7 A;  1MJ9 A;  3F8K A;  3FNC A;  4XNH B;  2AE6 A;  3D2M A;  4BMH A;  2D4P A;  2BL1 A;  1IID A;  1S7N A;  4B5P A;  3EC4 A;  3JTK A;  3ZZI A;  5J8C A;  3KKW A;  3R9E A;  4CAE A;  2VI7 A;  4C2X A;  3UY5 A;  2OZG A;  3MGD A;  2YNE A;  4M3S A;  4EVY A;  3FRM A;  3TT2 A;  2B58 A;  1NE9 A;  3DNS A;  1QST A;  2FCK A;  2ZW5 A;  4KOV A;  4AG9 A;  1KZF A;  5FVJ A;  4U5Y A;  2Z3K A;  2B3V A;  3QB8 A;  3GYA A;  4Q36 A;  2F5I A;  3SXO A;  1B87 A;  3DR8 A;  2Z3O A;  2IL4 A;  1MJA A;  4KVX A;  1YX0 A;  3FBU A;  4QB9 A;  4F0X A;  2A4N A;  3EY5 A;  2CXA A;  4PK2 A;  2B3U A;  2FS5 A;  3TCV A;  2ZPA A;  3TOB A;  2H5M A;  1IYL A;  2FL4 A;  2WSA A;  4UBR A;  2OH1 A;  3G8W A;  4JLY A;  1QSO A;  3V8I A;  5G1Z A;  4ZGY B;  2ZW4 A;  4CS0 B;  4AVA A;  1FY7 A;  3JVN A;  3P2F A;  5H86 A;  4AVC A;  2YND A;  4CRY B;  2NMT A;  4Y49 B;  4KLV A;  4CGL A;  1YGH A;  3S6G A;  3TO6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...