4H6ZA

Tubulin acetyltransferase
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
188
structure length
147
Chain Sequence
SFTMDFPYDLNALFPERISVLDSTTVIDELGKARHHLYLLKDGEGRGVIVGFLKVGYKKLFLLDQRGAHLETEPLCVLDFYVTETLQRHGYGSELFDFMLKHKQVEPAQMAYDRPSPKFLSFLEKRYDLRNSVPQVNNFVVFAGFFQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Alpha-tubulin N-acetyltransferase
publication title Crystal structures of tubulin acetyltransferase reveal a conserved catalytic core and the plasticity of the essential N terminus.
pubmed doi rcsb
source organism Danio rerio
molecule tags Transferase
total genus 30
structure length 147
sequence length 188
chains with identical sequence B
ec nomenclature ec 2.3.1.108: Alpha-tubulin N-acetyltransferase.
pdb deposition date 2012-09-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05301 Acetyltransf_16 GNAT acetyltransferase, Mec-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4h6zA02
4KOTA 4CAXA 3PGPA 5KTAA 1B6BA 2P6GA 2QMLA 3IGRA 4AG7A 4HKFA 4YRHA 4CAVA 1RO5A 4M85A 2HUZA 4M3SA 3JVNA 4HNYB 1XF8A 4R3KA 4FD7A 2CY2A 2ZW5A 2FIWA 2ATRA 4OADA 5ISVA 1CJWA 4R87A 3S6FA 3F0AA 4E2AA 4OAEA 1M4GA 2X7BA 4KLWA 3TCVA 1QSNA 1YLEA 2PR1A 4ZBGA 3FYNA 1M4DA 3TO6A 5E96A 3FXTA 1KUXA 1P0HA 3TOBA 2B3VA 2FS5A 4DNCA 4CRZB 2EVNA 3ZJ0A 2QECA 4EVYA 1KUYA 5I0CA 3EFAA 2FCKA 2G3AA 4HNWB 2PR8A 4JWPA 2BL1A 4QBJA 4LUAA 1Y7RA 3JUWA 2FXFA 5EC4A 4II9A 4KZTA 2REFA 4XPDB 1MK4A 3GY9A 2B58A 2J8RA 3R1KA 4JJXA 3FBUA 3GKRA 3I9SA 4H89A 2P6FA 2IL4A 2VI7A 3W91A 5JQ4A 2HV2A 3W6XA 1PU9A 4PSWA 1MJAA 4U5YA 4NSQA 4E8OA 4FD4A 3C26A 2DXQA 2I00A 1SQHA 2GIVA 3CXPA 3WR7A 4B5OA 1V0CA 2OZGA 3CXQA 2Q4VA 2RC4A 1OZPA 3QB8A 2I79A 5KTDA 3P2FA 4J3GA 3G8WA 4Y49B 2VQYA 3LD2A 5C82A 4IUSA 2A4NA 2Q4YA 4PK3A 2PC1A 5KTCA 2VXKA 4QB9A 1XE4A 4CS0B 4JXQA 2NMTA 4QC6A 1IICA 4B5PB 2BUEA 3I3GA 1XMTA 1K4JA 2P0WA 4B5PA 1GHEA 4XNHB 4K30A 5JPHA 3SXOA 3R95A 1BOBA 5DWNA 5CNPA 4KOWA 4KUBA 4RS2A 1YVKA 3BJ8A 3N7ZA 4NEXA 4AVAA 3PZJA 2WPXA 2ZW4A 5J8FA 4MI4A 2G0BA 4UWJA 2Z11A 3BLNA 2PSWA 4ORFA 4MJ8A 2B3UA 4HNXB 2FT0A 4PK2A 4IF5A 4XPKA 1M44A 4UBRA 1QSOA 4JD6A 3D2MA 3FRMA 5H86A 2FSRA 1KZFA 3TT2A 3H4QA 3SHPA 1I1DA 1YVOA 1FY7A 1YX0A 1LRZA 4U9ZA 4YFJA 4FD6A 3EXNA 2K5TA 4NXYA 1M1DA 3V8IA 1ON0A 3GYAA 2B4BA 2F5IA 2HQYA 2ZXVA 1S60A 2OZHA 3W6SA 1VHSA 4MBUA 1Q2YA 5HMNA 4CRYB 3S6GA 3DSBA 4GS4A 3FIXA 3R9GA 2JEVA 2VZZA 4FD5A 1NMTA 1IIDA 2FE7A 2JLMA 2AE6A 1QSRA 2O28A 1YR0A 5H84A 2ZPAA 5F47A 1S3ZA 2J8NA 2BSWA 2Y0MA 5F46A 1Y9WA 3R96A 3TOAA 1PUAA 4LX9A 2CNMA 3DR6A 1P4NA 4L89A 4BMHA 4JLYA 1XIXA 2B4DB 3OWCA 4RI1A 1IYKA 1BO4A 3DDDA 2H5MA 4KOXA 4AVBA 4QVTA 2R1IA 2JDCA 2AJ6A 3R9EA 2Q44A 5GCNA 3EO4A 3S6HA 1S7LA 1WK4A 3IWGA 2OB0A 4KOVA 3EC4A 1NE9A 4R3LA 5J8CA 4F0YA 1YK3A 1MJ9A 3S6KA 4ONUA 3ZZIA 1N71A 3BJ7A 5C88A 4KLVA 1NSLA 2C27A 3TTHA 2R7HA 3RYOA 5IX3A 2PQ8A 1YREA 2JDDA 1XEBA 4KOYA 4XPDC 3PP9A 3R9FA 3G3SA 2BEIA 3NE7A 1S5KA 1I21A 3DNSA 4PSXA 4KVXA 4H6UA 4MY3A 1Z9UA 1J4JA 4QUSA 1Q2CA 2Q0YA 4F6AA 1RXTA 1M4IA 1L0CA 5HH1A 3FNCA 4KORA 1KUVA 4KUAA 2P6EA 1Z4EA 1TIQA 4AB7A 4Y49C 1Y9KA 2Z10A 3P2HA 2B5GB 1B87A 4X5KA 4KVOE 2VZYA 1I12A 4CAWA 4E0AA 2D4OA 3TO9A 2B5GA 2PDOA 1QSMA 1VKCA 1MJBA 1IYLA 1U6MA 5F48A 3QAHA 1QSTA 3EY5A 2VEZA 3SXNA 2KCWA 4XNHC 3VWEA 4AG9A 3CXSA 2D4PA 3T9YA 5IB0A 2R98A 4UA3A 3TFYA 2OH1A 4JXRA 3VWDA 3D8PA 4U9YA 3K9UA 1S7KA 2GANA 4AVCA 5FVJA 2R8VA 1Z4RA 5DWMA 2ARHA 1S7NA 2QIRA 4UWIA 2J8MA 1S7FA 3KKWA 2G3TA 4PV6A 2ZW6A 1CM0A 2Z0ZA 4L8AA 3D2PA 3LODA 4NCZA 1WWZA 3E0KA 2Q04A 2FL4A 4H6ZA 3TE4A 2B4DA 2PRBA 2CNSA 2FIAA 3F8KA 4KOUA 4NF1A 2GE3A 4XPLA 5IV0A 4YGOA 1UFHA 2VBQA 2CNTA 2WPWA 3TO7A 3MGDA 4MY0A 5EBVA 3DR8A 3UY5A 2OZUA 4MHDA 1Q2DA 1R57A 4KOSA 4KVME 5F49A 2EUIA 2REEA 2OU2A 3F5BA 3FB3A 4R57A 4R9MA 3B8GA 1IB1E 3D3SA 2ZW7A 1YGHA 3T90A 4I49A 4OLLA 2Q7BA
chains in the Genus database with same CATH superfamily
4KOTA 1Y7EA 2YNCC 4X2TA 3PGPA 1R43A 4GXHA 4NGQA 4CAXA 5KTAA 1B6BA 2PJCA 4P10A 2P6GA 4IAVA 2QMLA 3IGRA 4AG7A 3V7ZA 4HKFA 4MCSA 1ZO0A 2ZEHA 4MFPA 3KR5A 4YRHA 4B11A 4CAEA 4CAVA 1RO5A 1JWQA 4M85A 2PJ0A 2ZOFA 2HUZA 4M3SA 4P4DA 3JVNA 4F8ZA 1FT7A 2EO8A 4HPSA 4HNYB 1XF8A 2PRQA 2V8VA 3N5FA 4LQGA 5HVGA 2EK9A 3HUVA 4R3KA 4FD7A 2CY2A 2ZW5A 4W9YA 4F0XA 2F8HA 2V8HA 2FIWA 4OKOA 2AFOA 2FVGA 3A9LA 3VH9A 4B12A 5JM6A 4P4BA 5G22A 2ATRA 3CPXA 2WSAA 4OADA 5ISVA 4NGNA 1CJWA 4JYWA 3B3SA 1R3NA 4R87A 3S6FA 4P4JA 4UCMA 3F0AA 4E2AA 5J1QA 4OAEA 1M4GA 2GFQA 1ZLIA 2X7BA 4KLWA 3TCVA 1QSNA 2C6CA 1YLEA 2PR1A 3PB6X 1Y0YA 5ELYA 3VARA 4ZBGA 1KWMA 3FYNA 1XJOA 4BD9A 3CDXA 1M4DA 3TO6A 5E96A 1VGYA 3FXTA 1KUXA 1P0HA 3TOBA 2B3VA 2FS5A 4DNCA 4CRZB 2EVNA 3ZJ0A 2CTCA 2QECA 5G1ZA 4CAFA 4EVYA 3I1UA 1KUYA 5I0CA 3EFAA 4UEEA 2FCKA 2G3AA 4CGOA 3CPAA 1M4LA 4HNWB 1CPSA 3PBBA 2PR8A 5LYLA 2NYQA 3KASA 4FBEA 4JWPA 1IOFA 5LYFA 3KHXA 2BL1A 2Z3NA 4QBJA 4LUAA 1Y7RA 1CP7A 4OIWA 3JUWA 2FXFA 2GREA 3IFEA 5EC4A 4II9A 4KZTA 4A2ZA 3D66A 3D7GA 2REFA 1BPMA 4P6YA 4XPDB 2ZELA 2PJ3A 1MK4A 4A38A 2ZEMA 3KZWA 3GY9A 5K8PA 5LRKA 2F7VA 2B58A 2J8RA 2Z3PA 3R1KA 4JJXA 1FNOA 1LANA 3FBUA 4P4FA 4UIAA 2PJ2A 3GKRA 4TWEA 4X8IA 4M6GA 3I9SA 4OP4A 4A33A 4UEZA 4H89A 3KR4A 2P6FA 2IL4A 2VI7A 1NSAA 3W91A 4RUHA 2PJ9A 4Q36A 3RZAA 5JQ4A 1Z8WA 1TF9A 2HV2A 3W6XA 1PU9A 3PB8X 4PSWA 4GM5A 1MJAA 4U5YA 2Q43A 4NSQA 4R8FA 4FD4A 4IK2A 3C26A 5LRGA 3RAMA 4E8OA 2PJ7A 2DXQA 4C7IA 4C68A 2I00A 1SQHA 2GIVA 3CXPA 3WR7A 4B5OA 1V0CA 2OZGA 4MHZA 5LRJA 3CXQA 7CPAA 2Q4VA 2RC4A 3GB0A 1OZPA 3QB8A 2I79A 4CYNA 3P2FA 5KTDA 4J3GA 3G8WA 4DUKA 4A95A 1YW4A 4Y49B 3KI9A 2VQYA 2PVVA 2PIYA 3LD2A 5C82A 4IUSA 2A4NA 4MCPA 2HB6A 2Q4YA 4MCQA 4PK3A 2PC1A 5KTCA 2VXKA 3PRTA 3FX6A 4MFKA 4QB9A 4UFVA 1XE4A 4K3NA 4C2XA 2PJBA 4CS0B 3NH4A 2NMTA 4JXQA 4QC6A 4A32A 1DTDA 1IICA 4B5PB 2HC9A 5JH9A 1GYTA 2BUEA 4OC0A 3I3GA 1XMTA 1VHEA 1K4JA 2ZEDA 4B10A 2P0WA 3FVLA 4B5PA 1GHEA 3HLPA 4XNHB 4A30A 3FEEA 4K30A 4LQ6A 3IIBA 4PXDA 1HDUA 3T8WA 1XMBA 3SXOA 5JPHA 4MMOA 3R95A 2XEGA 4IHMA 1BOBA 2PJ4A 5DWNA 2OR4A 2V8GA 2Q51A 1CX8A 2ODFA 5CNPA 4KOWA 4KUBA 4KS9A 4RS2A 1YVKA 4MFLA 4UCNA 4CYQA 3BJ8A 3N7ZA 3H8EA 2QJ8A 4NEXA 5THWA 1CPXA 4UIBA 4AVAA 2Z3LA 3PZJA 2WPXA 4UCPA 2AFMA 2ZW4A 3BI0A 5J8FA 4KSAA 4MI4A 1TF8A 4ZY1A 2G0BA 3B7IA 4UWJA 1TKJA 4P44A 5G21A 2Z11A 4O23A 3BLNA 2PSWA 5JGFA 4ORFA 1F2OA 2GLFA 4A37A 1BPNA 3CZXA 4OC3A 4MJ8A 2B3UA 4HNXB 2FT0A 1XFOA 1UWYA 4BINA 4PK2A 3IWEA 3IJ3A 4JZ0A 2AFSA 2I3CA 2C6GA 4NJRA 4IF5A 3DGVA 4XPKA 5HXDA 1Y0RA 4R7MA 1M44A 3SI0A 4F9VA 1HDQA 4UBRA 1QSOA 1AYEA 5K8OA 2VL1A 3KQXA 4JD6A 3K2KA 2CF4A 3D2MA 2C6PA 4YWYA 3FRMA 3FF3A 2PCUA 4Q38A 3WABA 3RNZA 5H86A 5F09A 3VATA 2FSRA 2IQ6A 1KZFA 3TT2A 3KL9A 1LFWA 5AG4A 3H4QA 3SHPA 1TKFA 1Q7LA 1RTQA 2JBKA 3TX8A 1I1DA 1YVOA 1FY7A 2YGWA 1YX0A 3PB4X 1LRZA 1JQGA 4U9ZA 4YFJA 4FD6A 3LACA 4FUUA 4C2YA 4MHNA 3EXNA 2K5TA 4UF4A 4NXYA 1QMUA 1M1DA 2DF5A 2PJ1A 2CTBA 2YNEA 5CBMA 3ISZA 3V8IA 3BI1A 4UEFA 1ON0A 5G20A 4A31A 2IMOA 3GYAA 2B4BA 2ZEGA 2V77A 5HVFA 2F5IA 2AFWA 2HQYA 2ZXVA 1S60A 2OZHA 3W6SA 1VHSA 4MBUA 1Q2YA 4MHPA 5HMNA 4ZX9A 3DLJA 4CRYB 3NA6A 4FWUA 1AUGA 3DSBA 3FJUA 2DPSA 4GS4A 3S6GA 4R76A 3FIXA 1BAVA 5I4MA 3R9GA 2JEVA 2VZZA 2AFXA 5AG5A 4FD5A 3B3CA 3LMSA 1TKHA 4MFJA 1NMTA 1IIDA 2FE7A 2JLMA 2AE6A 1QSRA 2O28A 1YR0A 5H84A 2ZPAA 5F47A 1S3ZA 2J8NA 3S9LA 1IU8A 2BSWA 1ZG9A 2Y0MA 2PJ5A 2ZEPA 1ZLHA 2YNDA 5F46A 2CIJA 1Y9WA 3R96A 2QYVA 4C2ZA 2RB7A 3TOAA 1CG2A 1PUAA 1VIXA 3MRUA 4LX9A 2CNMA 3DR6A 4Q7AA 2ANPA 4WJBA 1P4NA 4L89A 4BMHA 4JLYA 3KHZA 1XIXA 2PIZA 3V38A 2B4DB 5EMIA 3CT9A 3OWCA 2GLJA 3KGQA 4RI1A 2ZEOA 3BHXA 1ARLA 1IYKA 1Z5RA 3PB7X 1BO4A 3DDDA 2H5MA 4KOXA 2WYRA 4AVBA 3NH8A 3S9NA 3D7DA 4QVTA 1CP6A 2AFZA 2JDCA 2R1IA 3JTKA 2AJ6A 3R9EA 2Q44A 4B6ZA 1ARMA 1IGBA 1X12A 3L2NA 3EO4A 5GCNA 2JEWA 2POKA 4ZX8A 4OMEA 3MN8A 3S6HA 4NGTA 5BWAB 1S7LA 1WK4A 3IWGA 1X10A 4CYPA 4MRIA 2Z3MA 2Z3OA 3FECA 4MCRA 2OB0A 2V8DA 4KOVA 4NGMA 4A39A 6CPAA 4KSIA 3EC4A 1NE9A 3IC1A 3TC8A 4R3LA 3FEDA 5AG6A 5IB9A 5J8CA 4F0YA 1YK3A 4KSFA 1MJ9A 2ZOGA 3GLJA 3ISXA 4FAIA 3S6KA 3WT4A 4ONUA 4CGMA 3ZZIA 1N71A 3D4UA 3BJ7A 5C88A 4OC2A 2DPTA 4ZYQA 4KLVA 1NSLA 2C27A 1Z8LA 3TTHA 2JBJA 4OC4A 2R7HA 3RYOA 5IX3A 2PQ8A 1YREA 2JDDA 4CPAA 1QQ9A 1XEBA 4KOYA 3PP9A 4XPDC 3R9FA 5LYIA 4RN7A 3G3SA 2BEIA 3NE7A 3RO0A 1S5KA 3IO1A 1I21A 3DNSA 4PSXA 4KVXA 4NGPA 5A27A 2PJ8A 4H6UA 4P4EA 5HVHA 4MY3A 2EWBA 3IU2A 4X3RA 2BCOA 1Z9UA 1J4JA 3NH5A 4QUSA 1Z2LA 5IV0A 5K8MA 2PE3A 1Q2CA 2Q0YA 5AGEA 1YW6A 1LCPA 4P4IA 2WZNA 1XRYA 3B35A 4YU9A 5K8NA 3B3WA 4WWVA 3NFZA 2EBJA 4F6AA 4DYOA 1RXTA 3B3VA 1Z8XA 1M4IA 1Z8TA 1L0CA 2ABZA 3H8GA 5HH1A 1TXRA 3B2YA 3H5ZA 1OBRA 3FNCA 1LAPA 4KORA 1ZG8A 1KUVA 4A94A 4ZGYB 1CBXA 4KUAA 2P6EA 1Z4EA 3NE8A 1TIQA 4EMEA 4B13A 4AB7A 4Y49C 4OIDA 2EK8A 3PFOA 1Y9KA 2Z10A 3P2HA 1IY7A 4G1PA 3SJEA 4C7HA 2B5GB 2NSMA 1B87A 3FMCA 4PXEA 4EFDA 4X5KA 4KVOE 2VZYA 1I12A 2C1CA 3PB9X 4CAWA 4E0AA 2D4OA 3WC7A 1IOIA 3TO9A 3BXMA 2B5GA 2XEFA 2PDOA 4ZY2A 1QSMA 1VKCA 2DEAA 1PCAA 1MJBA 1IYLA 4CYOA 1U6MA 2ZEFA 5F48A 4AXVA 3QAHA 1QSTA 4PXCA 3EY5A 2VEZA 3IU1A 3SXNA 2XEIA 2ZENA 2BOAA 2OOTA 1AMPA 2KCWA 4XNHC 3VWEA 1DE4C 2Q4ZA 4AG9A 3CXSA 2BO9A 2D4PA 3T9YA 4B14A 5IB0A 2R98A 3IWWA 4UA3A 3TFYA 4PXBA 2OH1A 4JXRA 4MHYA 3VWDA 3LWUA 3D8PA 3QNVA 4U9YA 1YLOA 4CGNA 3K9UA 1S7KA 2GANA 3IEHA 4MFQA 3B3TA 4AVCA 2YNCA 3D68A 3S9MA 1YSJA 4UFWA 5FVJA 4PPZA 4EWTA 2R8VA 1ZG7A 1Z4RA 1F57A 4NFRA 5DWMA 2ARHA 1LOKA 3SI2A 2O53A 5DS0A 4M6HA 1S7NA 2QIRA 4UWIA 1XBUA 4ZY0A 3FH4A 1YMEA 4ONWA 2J8MA 1A2ZA 5LYDA 1S7FA 3KKWA 2G3TA 3PBEA 4PV6A 2ZW6A 1CM0A 1ELMP 2Z0ZA 1YQEA 2O4HA 5AG7A 3KQZA 3D2PA 4L8AA 3LODA 4NCZA 2J9AA 3PEIA 3GUXA 1WWZA 3E0KA 5D8NA 2Q04A 2FL4A 2XEJA 4H6ZA 2B4DA 4M6IA 3TE4A 2PRBA 3GIUA 3D7FA 2CNSA 2FIAA 3F8KA 4R6TA 3SI1A 4KOUA 2IJZA 2WUUA 4NF1A 3D67A 2GE3A 4XPLA 4F9UA 1F2PA 3SJXA 2QVPA 4NGRA 3WC5A 1BLLE 1UFHA 2VBQA 4YGOA 3SJFA 3WC6A 4NJQA 2CNTA 5D29A 2G9DA 1HEEA 4UFXA 4MFZA 4OC5A 2WPWA 4P45A 3TO7A 3MGDA 4MY0A 5EBVA 3DR8A 3UY5A 1LAMA 4CGLA 2OZUA 4DJLA 4MHDA 2CXAA 2ZEEA 1Q2DA 2GU2A 3QAYA 3D7HA 3K9TA 2PJ6A 4H2KA 2RFHA 1R57A 8CPAA 4KOSA 1PYTB 4KVME 5F49A 2EUIA 2PVWA 2REEA 4ZI6A 4TNUA 2OU2A 1ELLP 3F5BA 3SJGA 4BBHA 3RBUA 3FB3A 2Q7SA 3H8FA 4NGSA 4R57A 4PQAA 1VHOA 4Z65A 4R9MA 3B8GA 1H8LA 1XOVA 5CPAA 1IB1E 4MXUA 2PJAA 3D3SA 2ZW7A 1YGHA 2AFUA 3T90A 1EE3P 4I49A 3PFEA 4OC1A 5A28A 4CGPA 4OLLA 3JRUA 2Q7BA 2Z3KA
chains in the Genus database with same CATH topology
4KOTA 2YNCC 4CAXA 3PGPA 5KTAA 1B6BA 2P6GA 2QMLA 3IGRA 4AG7A 4HKFA 1ZO0A 4MFPA 4YRHA 4B11A 4CAEA 4CAVA 1RO5A 4M85A 2HUZA 4M3SA 3JVNA 4HNYB 1XF8A 4R3KA 4FD7A 2CY2A 2ZW5A 4F0XA 2FIWA 3A9LA 4B12A 5G22A 2ATRA 2WSAA 4OADA 5ISVA 1CJWA 4R87A 3S6FA 4UCMA 3F0AA 4E2AA 4OAEA 1M4GA 2X7BA 4KLWA 3TCVA 1QSNA 1YLEA 2PR1A 4ZBGA 3FYNA 1M4DA 3TO6A 5E96A 3FXTA 1KUXA 1P0HA 3TOBA 2B3VA 2FS5A 4DNCA 4CRZB 2EVNA 3ZJ0A 2QECA 5G1ZA 4CAFA 4EVYA 1KUYA 5I0CA 3EFAA 2FCKA 2G3AA 4CGOA 4HNWB 2PR8A 4JWPA 2BL1A 2Z3NA 4QBJA 4LUAA 1Y7RA 3JUWA 2FXFA 5EC4A 4II9A 4KZTA 4A2ZA 2REFA 4XPDB 1MK4A 3GY9A 2B58A 2J8RA 2Z3PA 3R1KA 4JJXA 3FBUA 4CGNA 3GKRA 3I9SA 4A33A 4H89A 2P6FA 2IL4A 2VI7A 3W91A 4Q36A 5JQ4A 2HV2A 3W6XA 1PU9A 4PSWA 1MJAA 4U5YA 4NSQA 4E8OA 4FD4A 3C26A 2DXQA 4C7IA 4C68A 2I00A 1SQHA 2GIVA 3CXPA 3WR7A 4B5OA 1V0CA 2OZGA 3CXQA 2Q4VA 2RC4A 1OZPA 3QB8A 2I79A 4CYNA 3P2FA 5KTDA 4J3GA 3G8WA 4A95A 4Y49B 2VQYA 3LD2A 5C82A 4IUSA 2A4NA 2Q4YA 4PK3A 2PC1A 5KTCA 2VXKA 4MFKA 4QB9A 4UFVA 1XE4A 4C2XA 4CS0B 4JXQA 2NMTA 4QC6A 4A32A 1IICA 4B5PB 2BUEA 3I3GA 1XMTA 1K4JA 4B10A 2P0WA 4B5PA 1GHEA 4XNHB 4A30A 4K30A 5JPHA 3SXOA 3R95A 1BOBA 5DWNA 5CNPA 4KOWA 4KUBA 4KS9A 4RS2A 1YVKA 4MFLA 4UCNA 4CYQA 3BJ8A 3N7ZA 4NEXA 4AVAA 2Z3LA 3PZJA 2WPXA 4UCPA 2ZW4A 5J8FA 4KSAA 4MI4A 2G0BA 4UWJA 5G21A 2Z11A 3BLNA 2PSWA 4ORFA 4MJ8A 2B3UA 4HNXB 2FT0A 4PK2A 3IWEA 4IF5A 4XPKA 1M44A 4UBRA 1QSOA 4JD6A 3D2MA 3FRMA 4Q38A 5H86A 2FSRA 1KZFA 3TT2A 5AG4A 3H4QA 3SHPA 1I1DA 1YVOA 1FY7A 2YGWA 1YX0A 1LRZA 4U9ZA 4YFJA 4FD6A 4C2YA 3EXNA 2K5TA 4NXYA 1M1DA 2YNEA 3V8IA 4A31A 5G20A 1ON0A 3GYAA 2B4BA 2F5IA 2HQYA 2ZXVA 1S60A 2OZHA 3W6SA 1VHSA 4MBUA 1Q2YA 5HMNA 4CRYB 3S6GA 3DSBA 4GS4A 2DPSA 3FIXA 3R9GA 2JEVA 2VZZA 5AG5A 4FD5A 4MFJA 1NMTA 1IIDA 2FE7A 2JLMA 2AE6A 1QSRA 2O28A 1YR0A 5H84A 2ZPAA 5F47A 1S3ZA 2J8NA 2BSWA 2Y0MA 2YNDA 5F46A 1Y9WA 3R96A 4C2ZA 3TOAA 1PUAA 4LX9A 2CNMA 3DR6A 1P4NA 4L89A 4BMHA 4JLYA 1XIXA 2B4DB 3OWCA 4RI1A 1IYKA 1BO4A 3DDDA 2H5MA 4KOXA 4AVBA 4QVTA 3JTKA 2R1IA 2JDCA 2AJ6A 3R9EA 2Q44A 5GCNA 3EO4A 3S6HA 5BWAB 1S7LA 1WK4A 3IWGA 4CYPA 2Z3MA 2Z3OA 2OB0A 4KOVA 3EC4A 1NE9A 4R3LA 5AG6A 5J8CA 4F0YA 1YK3A 4KSFA 1MJ9A 3S6KA 4ONUA 4CGMA 3ZZIA 1N71A 3BJ7A 5C88A 2DPTA 4KLVA 1NSLA 2C27A 3TTHA 2R7HA 3RYOA 5IX3A 2PQ8A 1YREA 2JDDA 1XEBA 4KOYA 4XPDC 3PP9A 3R9FA 3G3SA 2BEIA 3NE7A 1S5KA 1I21A 3DNSA 4PSXA 4KVXA 5A27A 4H6UA 4MY3A 3IU2A 1Z9UA 1J4JA 4QUSA 1Q2CA 2Q0YA 5AGEA 4F6AA 1RXTA 1M4IA 1L0CA 5HH1A 3H5ZA 3FNCA 4KORA 1KUVA 4ZGYB 4KUAA 2P6EA 1Z4EA 1TIQA 4B13A 4AB7A 4Y49C 1Y9KA 2Z10A 3P2HA 2B5GB 1B87A 4X5KA 4KVOE 2VZYA 1I12A 4CAWA 4E0AA 2D4OA 4C7HA 3TO9A 2B5GA 2PDOA 1QSMA 1VKCA 1MJBA 1IYLA 4CYOA 1U6MA 5F48A 3QAHA 1QSTA 3EY5A 2VEZA 3IU1A 3SXNA 2KCWA 4XNHC 3VWEA 4AG9A 3CXSA 2D4PA 3T9YA 4B14A 5IB0A 2R98A 4UA3A 3TFYA 2OH1A 4JXRA 3VWDA 3D8PA 4U9YA 3K9UA 1S7KA 2GANA 4MFQA 4AVCA 2YNCA 4UFWA 5FVJA 2R8VA 1Z4RA 5DWMA 2ARHA 1S7NA 2QIRA 4UWIA 2J8MA 1S7FA 3KKWA 2G3TA 4PV6A 2ZW6A 1CM0A 2Z0ZA 5AG7A 4L8AA 3D2PA 3LODA 4NCZA 1WWZA 3E0KA 2Q04A 2FL4A 4H6ZA 3TE4A 2B4DA 2PRBA 5A28A 2CNSA 2FIAA 3F8KA 4KOUA 2WUUA 4NF1A 2GE3A 4XPLA 5IV0A 4YGOA 1UFHA 2VBQA 2CNTA 4UFXA 4MFZA 2WPWA 3TO7A 3MGDA 4MY0A 5EBVA 3DR8A 3UY5A 4CGLA 2OZUA 4MHDA 2CXAA 1Q2DA 1R57A 4KOSA 4KVME 5F49A 2EUIA 2REEA 2OU2A 3F5BA 4BBHA 3FB3A 4R57A 4R9MA 3B8GA 1IB1E 3D3SA 2ZW7A 1YGHA 3T90A 4I49A 4CGPA 4OLLA 2Q7BA 2Z3KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KOT A;  4CAX A;  3PGP A;  5KTA A;  1B6B A;  2P6G A;  2QML A;  3IGR A;  4AG7 A;  4HKF A;  4YRH A;  4CAV A;  1RO5 A;  4M85 A;  2HUZ A;  4M3S A;  3JVN A;  4HNY B;  1XF8 A;  4R3K A;  4FD7 A;  2CY2 A;  2ZW5 A;  2FIW A;  2ATR A;  4OAD A;  5ISV A;  1CJW A;  4R87 A;  3S6F A;  3F0A A;  4E2A A;  4OAE A;  1M4G A;  2X7B A;  4KLW A;  3TCV A;  1QSN A;  1YLE A;  2PR1 A;  4ZBG A;  3FYN A;  1M4D A;  3TO6 A;  5E96 A;  3FXT A;  1KUX A;  1P0H A;  3TOB A;  2B3V A;  2FS5 A;  4DNC A;  4CRZ B;  2EVN A;  3ZJ0 A;  2QEC A;  4EVY A;  1KUY A;  5I0C A;  3EFA A;  2FCK A;  2G3A A;  4HNW B;  2PR8 A;  4JWP A;  2BL1 A;  4QBJ A;  4LUA A;  1Y7R A;  3JUW A;  2FXF A;  5EC4 A;  4II9 A;  4KZT A;  2REF A;  4XPD B;  1MK4 A;  3GY9 A;  2B58 A;  2J8R A;  3R1K A;  4JJX A;  3FBU A;  3GKR A;  3I9S A;  4H89 A;  2P6F A;  2IL4 A;  2VI7 A;  3W91 A;  5JQ4 A;  2HV2 A;  3W6X A;  1PU9 A;  4PSW A;  1MJA A;  4U5Y A;  4NSQ A;  4E8O A;  4FD4 A;  3C26 A;  2DXQ A;  2I00 A;  1SQH A;  2GIV A;  3CXP A;  3WR7 A;  4B5O A;  1V0C A;  2OZG A;  3CXQ A;  2Q4V A;  2RC4 A;  1OZP A;  3QB8 A;  2I79 A;  5KTD A;  3P2F A;  4J3G A;  3G8W A;  4Y49 B;  2VQY A;  3LD2 A;  5C82 A;  4IUS A;  2A4N A;  2Q4Y A;  4PK3 A;  2PC1 A;  5KTC A;  2VXK A;  4QB9 A;  1XE4 A;  4CS0 B;  4JXQ A;  2NMT A;  4QC6 A;  1IIC A;  4B5P B;  2BUE A;  3I3G A;  1XMT A;  1K4J A;  2P0W A;  4B5P A;  1GHE A;  4XNH B;  4K30 A;  5JPH A;  3SXO A;  3R95 A;  1BOB A;  5DWN A;  5CNP A;  4KOW A;  4KUB A;  4RS2 A;  1YVK A;  3BJ8 A;  3N7Z A;  4NEX A;  4AVA A;  3PZJ A;  2WPX A;  2ZW4 A;  5J8F A;  4MI4 A;  2G0B A;  4UWJ A;  2Z11 A;  3BLN A;  2PSW A;  4ORF A;  4MJ8 A;  2B3U A;  4HNX B;  2FT0 A;  4PK2 A;  4IF5 A;  4XPK A;  1M44 A;  4UBR A;  1QSO A;  4JD6 A;  3D2M A;  3FRM A;  5H86 A;  2FSR A;  1KZF A;  3TT2 A;  3H4Q A;  3SHP A;  1I1D A;  1YVO A;  1FY7 A;  1YX0 A;  1LRZ A;  4U9Z A;  4YFJ A;  4FD6 A;  3EXN A;  2K5T A;  4NXY A;  1M1D A;  3V8I A;  1ON0 A;  3GYA A;  2B4B A;  2F5I A;  2HQY A;  2ZXV A;  1S60 A;  2OZH A;  3W6S A;  1VHS A;  4MBU A;  1Q2Y A;  5HMN A;  4CRY B;  3S6G A;  3DSB A;  4GS4 A;  3FIX A;  3R9G A;  2JEV A;  2VZZ A;  4FD5 A;  1NMT A;  1IID A;  2FE7 A;  2JLM A;  2AE6 A;  1QSR A;  2O28 A;  1YR0 A;  5H84 A;  2ZPA A;  5F47 A;  1S3Z A;  2J8N A;  2BSW A;  2Y0M A;  5F46 A;  1Y9W A;  3R96 A;  3TOA A;  1PUA A;  4LX9 A;  2CNM A;  3DR6 A;  1P4N A;  4L89 A;  4BMH A;  4JLY A;  1XIX A;  2B4D B;  3OWC A;  4RI1 A;  1IYK A;  1BO4 A;  3DDD A;  2H5M A;  4KOX A;  4AVB A;  4QVT A;  2R1I A;  2JDC A;  2AJ6 A;  3R9E A;  2Q44 A;  5GCN A;  3EO4 A;  3S6H A;  1S7L A;  1WK4 A;  3IWG A;  2OB0 A;  4KOV A;  3EC4 A;  1NE9 A;  4R3L A;  5J8C A;  4F0Y A;  1YK3 A;  1MJ9 A;  3S6K A;  4ONU A;  3ZZI A;  1N71 A;  3BJ7 A;  5C88 A;  4KLV A;  1NSL A;  2C27 A;  3TTH A;  2R7H A;  3RYO A;  5IX3 A;  2PQ8 A;  1YRE A;  2JDD A;  1XEB A;  4KOY A;  4XPD C;  3PP9 A;  3R9F A;  3G3S A;  2BEI A;  3NE7 A;  1S5K A;  1I21 A;  3DNS A;  4PSX A;  4KVX A;  4H6U A;  4MY3 A;  1Z9U A;  1J4J A;  4QUS A;  1Q2C A;  2Q0Y A;  4F6A A;  1RXT A;  1M4I A;  1L0C A;  5HH1 A;  3FNC A;  4KOR A;  1KUV A;  4KUA A;  2P6E A;  1Z4E A;  1TIQ A;  4AB7 A;  4Y49 C;  1Y9K A;  2Z10 A;  3P2H A;  2B5G B;  1B87 A;  4X5K A;  4KVO E;  2VZY A;  1I12 A;  4CAW A;  4E0A A;  2D4O A;  3TO9 A;  2B5G A;  2PDO A;  1QSM A;  1VKC A;  1MJB A;  1IYL A;  1U6M A;  5F48 A;  3QAH A;  1QST A;  3EY5 A;  2VEZ A;  3SXN A;  2KCW A;  4XNH C;  3VWE A;  4AG9 A;  3CXS A;  2D4P A;  3T9Y A;  5IB0 A;  2R98 A;  4UA3 A;  3TFY A;  2OH1 A;  4JXR A;  3VWD A;  3D8P A;  4U9Y A;  3K9U A;  1S7K A;  2GAN A;  4AVC A;  5FVJ A;  2R8V A;  1Z4R A;  5DWM A;  2ARH A;  1S7N A;  2QIR A;  4UWI A;  2J8M A;  1S7F A;  3KKW A;  2G3T A;  4PV6 A;  2ZW6 A;  1CM0 A;  2Z0Z A;  4L8A A;  3D2P A;  3LOD A;  4NCZ A;  1WWZ A;  3E0K A;  2Q04 A;  2FL4 A;  4H6Z A;  3TE4 A;  2B4D A;  2PRB A;  2CNS A;  2FIA A;  3F8K A;  4KOU A;  4NF1 A;  2GE3 A;  4XPL A;  5IV0 A;  4YGO A;  1UFH A;  2VBQ A;  2CNT A;  2WPW A;  3TO7 A;  3MGD A;  4MY0 A;  5EBV A;  3DR8 A;  3UY5 A;  2OZU A;  4MHD A;  1Q2D A;  1R57 A;  4KOS A;  4KVM E;  5F49 A;  2EUI A;  2REE A;  2OU2 A;  3F5B A;  3FB3 A;  4R57 A;  4R9M A;  3B8G A;  1IB1 E;  3D3S A;  2ZW7 A;  1YGH A;  3T90 A;  4I49 A;  4OLL A;  2Q7B A; 
#chains in the Genus database with same CATH topology
 4KOT A;  1Y7E A;  2YNC C;  4X2T A;  3PGP A;  1R43 A;  4GXH A;  4NGQ A;  4CAX A;  5KTA A;  1B6B A;  2PJC A;  4P10 A;  2P6G A;  4IAV A;  2QML A;  3IGR A;  4AG7 A;  3V7Z A;  4HKF A;  4MCS A;  1ZO0 A;  2ZEH A;  4MFP A;  3KR5 A;  4YRH A;  4B11 A;  4CAE A;  4CAV A;  1RO5 A;  1JWQ A;  4M85 A;  2PJ0 A;  2ZOF A;  2HUZ A;  4M3S A;  4P4D A;  3JVN A;  4F8Z A;  1FT7 A;  2EO8 A;  4HPS A;  4HNY B;  1XF8 A;  2PRQ A;  2V8V A;  3N5F A;  4LQG A;  5HVG A;  2EK9 A;  3HUV A;  4R3K A;  4FD7 A;  2CY2 A;  2ZW5 A;  4W9Y A;  4F0X A;  2F8H A;  2V8H A;  2FIW A;  4OKO A;  2AFO A;  2FVG A;  3A9L A;  3VH9 A;  4B12 A;  5JM6 A;  4P4B A;  5G22 A;  2ATR A;  3CPX A;  2WSA A;  4OAD A;  5ISV A;  4NGN A;  1CJW A;  4JYW A;  3B3S A;  1R3N A;  4R87 A;  3S6F A;  4P4J A;  4UCM A;  3F0A A;  4E2A A;  5J1Q A;  4OAE A;  1M4G A;  2GFQ A;  1ZLI A;  2X7B A;  4KLW A;  3TCV A;  1QSN A;  2C6C A;  1YLE A;  2PR1 A;  3PB6 X;  1Y0Y A;  5ELY A;  3VAR A;  4ZBG A;  1KWM A;  3FYN A;  1XJO A;  4BD9 A;  3CDX A;  1M4D A;  3TO6 A;  5E96 A;  1VGY A;  3FXT A;  1KUX A;  1P0H A;  3TOB A;  2B3V A;  2FS5 A;  4DNC A;  4CRZ B;  2EVN A;  3ZJ0 A;  2CTC A;  2QEC A;  5G1Z A;  4CAF A;  4EVY A;  3I1U A;  1KUY A;  5I0C A;  3EFA A;  4UEE A;  2FCK A;  2G3A A;  4CGO A;  3CPA A;  1M4L A;  4HNW B;  1CPS A;  3PBB A;  2PR8 A;  5LYL A;  2NYQ A;  3KAS A;  4FBE A;  4JWP A;  1IOF A;  5LYF A;  3KHX A;  2BL1 A;  2Z3N A;  4QBJ A;  4LUA A;  1Y7R A;  1CP7 A;  4OIW A;  3JUW A;  2FXF A;  2GRE A;  3IFE A;  5EC4 A;  4II9 A;  4KZT A;  4A2Z A;  3D66 A;  3D7G A;  2REF A;  1BPM A;  4P6Y A;  4XPD B;  2ZEL A;  2PJ3 A;  1MK4 A;  4A38 A;  2ZEM A;  3KZW A;  3GY9 A;  5K8P A;  5LRK A;  2F7V A;  2B58 A;  2J8R A;  2Z3P A;  3R1K A;  4JJX A;  1FNO A;  1LAN A;  3FBU A;  4P4F A;  4UIA A;  2PJ2 A;  3GKR A;  4TWE A;  4X8I A;  4M6G A;  3I9S A;  4OP4 A;  4A33 A;  4UEZ A;  4H89 A;  3KR4 A;  2P6F A;  2IL4 A;  2VI7 A;  1NSA A;  3W91 A;  4RUH A;  2PJ9 A;  4Q36 A;  3RZA A;  5JQ4 A;  1Z8W A;  1TF9 A;  2HV2 A;  3W6X A;  1PU9 A;  3PB8 X;  4PSW A;  4GM5 A;  1MJA A;  4U5Y A;  2Q43 A;  4NSQ A;  4R8F A;  4FD4 A;  4IK2 A;  3C26 A;  5LRG A;  3RAM A;  4E8O A;  2PJ7 A;  2DXQ A;  4C7I A;  4C68 A;  2I00 A;  1SQH A;  2GIV A;  3CXP A;  3WR7 A;  4B5O A;  1V0C A;  2OZG A;  4MHZ A;  5LRJ A;  3CXQ A;  7CPA A;  2Q4V A;  2RC4 A;  3GB0 A;  1OZP A;  3QB8 A;  2I79 A;  4CYN A;  3P2F A;  5KTD A;  4J3G A;  3G8W A;  4DUK A;  4A95 A;  1YW4 A;  4Y49 B;  3KI9 A;  2VQY A;  2PVV A;  2PIY A;  3LD2 A;  5C82 A;  4IUS A;  2A4N A;  4MCP A;  2HB6 A;  2Q4Y A;  4MCQ A;  4PK3 A;  2PC1 A;  5KTC A;  2VXK A;  3PRT A;  3FX6 A;  4MFK A;  4QB9 A;  4UFV A;  1XE4 A;  4K3N A;  4C2X A;  2PJB A;  4CS0 B;  3NH4 A;  2NMT A;  4JXQ A;  4QC6 A;  4A32 A;  1DTD A;  1IIC A;  4B5P B;  2HC9 A;  5JH9 A;  1GYT A;  2BUE A;  4OC0 A;  3I3G A;  1XMT A;  1VHE A;  1K4J A;  2ZED A;  4B10 A;  2P0W A;  3FVL A;  4B5P A;  1GHE A;  3HLP A;  4XNH B;  4A30 A;  3FEE A;  4K30 A;  4LQ6 A;  3IIB A;  4PXD A;  1HDU A;  3T8W A;  1XMB A;  3SXO A;  5JPH A;  4MMO A;  3R95 A;  2XEG A;  4IHM A;  1BOB A;  2PJ4 A;  5DWN A;  2OR4 A;  2V8G A;  2Q51 A;  1CX8 A;  2ODF A;  5CNP A;  4KOW A;  4KUB A;  4KS9 A;  4RS2 A;  1YVK A;  4MFL A;  4UCN A;  4CYQ A;  3BJ8 A;  3N7Z A;  3H8E A;  2QJ8 A;  4NEX A;  5THW A;  1CPX A;  4UIB A;  4AVA A;  2Z3L A;  3PZJ A;  2WPX A;  4UCP A;  2AFM A;  2ZW4 A;  3BI0 A;  5J8F A;  4KSA A;  4MI4 A;  1TF8 A;  4ZY1 A;  2G0B A;  3B7I A;  4UWJ A;  1TKJ A;  4P44 A;  5G21 A;  2Z11 A;  4O23 A;  3BLN A;  2PSW A;  5JGF A;  4ORF A;  1F2O A;  2GLF A;  4A37 A;  1BPN A;  3CZX A;  4OC3 A;  4MJ8 A;  2B3U A;  4HNX B;  2FT0 A;  1XFO A;  1UWY A;  4BIN A;  4PK2 A;  3IWE A;  3IJ3 A;  4JZ0 A;  2AFS A;  2I3C A;  2C6G A;  4NJR A;  4IF5 A;  3DGV A;  4XPK A;  5HXD A;  1Y0R A;  4R7M A;  1M44 A;  3SI0 A;  4F9V A;  1HDQ A;  4UBR A;  1QSO A;  1AYE A;  5K8O A;  2VL1 A;  3KQX A;  4JD6 A;  3K2K A;  2CF4 A;  3D2M A;  2C6P A;  4YWY A;  3FRM A;  3FF3 A;  2PCU A;  4Q38 A;  3WAB A;  3RNZ A;  5H86 A;  5F09 A;  3VAT A;  2FSR A;  2IQ6 A;  1KZF A;  3TT2 A;  3KL9 A;  1LFW A;  5AG4 A;  3H4Q A;  3SHP A;  1TKF A;  1Q7L A;  1RTQ A;  2JBK A;  3TX8 A;  1I1D A;  1YVO A;  1FY7 A;  2YGW A;  1YX0 A;  3PB4 X;  1LRZ A;  1JQG A;  4U9Z A;  4YFJ A;  4FD6 A;  3LAC A;  4FUU A;  4C2Y A;  4MHN A;  3EXN A;  2K5T A;  4UF4 A;  4NXY A;  1QMU A;  1M1D A;  2DF5 A;  2PJ1 A;  2CTB A;  2YNE A;  5CBM A;  3ISZ A;  3V8I A;  3BI1 A;  4UEF A;  1ON0 A;  5G20 A;  4A31 A;  2IMO A;  3GYA A;  2B4B A;  2ZEG A;  2V77 A;  5HVF A;  2F5I A;  2AFW A;  2HQY A;  2ZXV A;  1S60 A;  2OZH A;  3W6S A;  1VHS A;  4MBU A;  1Q2Y A;  4MHP A;  5HMN A;  4ZX9 A;  3DLJ A;  4CRY B;  3NA6 A;  4FWU A;  1AUG A;  3DSB A;  3FJU A;  2DPS A;  4GS4 A;  3S6G A;  4R76 A;  3FIX A;  1BAV A;  5I4M A;  3R9G A;  2JEV A;  2VZZ A;  2AFX A;  5AG5 A;  4FD5 A;  3B3C A;  3LMS A;  1TKH A;  4MFJ A;  1NMT A;  1IID A;  2FE7 A;  2JLM A;  2AE6 A;  1QSR A;  2O28 A;  1YR0 A;  5H84 A;  2ZPA A;  5F47 A;  1S3Z A;  2J8N A;  3S9L A;  1IU8 A;  2BSW A;  1ZG9 A;  2Y0M A;  2PJ5 A;  2ZEP A;  1ZLH A;  2YND A;  5F46 A;  2CIJ A;  1Y9W A;  3R96 A;  2QYV A;  4C2Z A;  2RB7 A;  3TOA A;  1CG2 A;  1PUA A;  1VIX A;  3MRU A;  4LX9 A;  2CNM A;  3DR6 A;  4Q7A A;  2ANP A;  4WJB A;  1P4N A;  4L89 A;  4BMH A;  4JLY A;  3KHZ A;  1XIX A;  2PIZ A;  3V38 A;  2B4D B;  5EMI A;  3CT9 A;  3OWC A;  2GLJ A;  3KGQ A;  4RI1 A;  2ZEO A;  3BHX A;  1ARL A;  1IYK A;  1Z5R A;  3PB7 X;  1BO4 A;  3DDD A;  2H5M A;  4KOX A;  2WYR A;  4AVB A;  3NH8 A;  3S9N A;  3D7D A;  4QVT A;  1CP6 A;  2AFZ A;  2JDC A;  2R1I A;  3JTK A;  2AJ6 A;  3R9E A;  2Q44 A;  4B6Z A;  1ARM A;  1IGB A;  1X12 A;  3L2N A;  3EO4 A;  5GCN A;  2JEW A;  2POK A;  4ZX8 A;  4OME A;  3MN8 A;  3S6H A;  4NGT A;  5BWA B;  1S7L A;  1WK4 A;  3IWG A;  1X10 A;  4CYP A;  4MRI A;  2Z3M A;  2Z3O A;  3FEC A;  4MCR A;  2OB0 A;  2V8D A;  4KOV A;  4NGM A;  4A39 A;  6CPA A;  4KSI A;  3EC4 A;  1NE9 A;  3IC1 A;  3TC8 A;  4R3L A;  3FED A;  5AG6 A;  5IB9 A;  5J8C A;  4F0Y A;  1YK3 A;  4KSF A;  1MJ9 A;  2ZOG A;  3GLJ A;  3ISX A;  4FAI A;  3S6K A;  3WT4 A;  4ONU A;  4CGM A;  3ZZI A;  1N71 A;  3D4U A;  3BJ7 A;  5C88 A;  4OC2 A;  2DPT A;  4ZYQ A;  4KLV A;  1NSL A;  2C27 A;  1Z8L A;  3TTH A;  2JBJ A;  4OC4 A;  2R7H A;  3RYO A;  5IX3 A;  2PQ8 A;  1YRE A;  2JDD A;  4CPA A;  1QQ9 A;  1XEB A;  4KOY A;  3PP9 A;  4XPD C;  3R9F A;  5LYI A;  4RN7 A;  3G3S A;  2BEI A;  3NE7 A;  3RO0 A;  1S5K A;  3IO1 A;  1I21 A;  3DNS A;  4PSX A;  4KVX A;  4NGP A;  5A27 A;  2PJ8 A;  4H6U A;  4P4E A;  5HVH A;  4MY3 A;  2EWB A;  3IU2 A;  4X3R A;  2BCO A;  1Z9U A;  1J4J A;  3NH5 A;  4QUS A;  1Z2L A;  5IV0 A;  5K8M A;  2PE3 A;  1Q2C A;  2Q0Y A;  5AGE A;  1YW6 A;  1LCP A;  4P4I A;  2WZN A;  1XRY A;  3B35 A;  4YU9 A;  5K8N A;  3B3W A;  4WWV A;  3NFZ A;  2EBJ A;  4F6A A;  4DYO A;  1RXT A;  3B3V A;  1Z8X A;  1M4I A;  1Z8T A;  1L0C A;  2ABZ A;  3H8G A;  5HH1 A;  1TXR A;  3B2Y A;  3H5Z A;  1OBR A;  3FNC A;  1LAP A;  4KOR A;  1ZG8 A;  1KUV A;  4A94 A;  4ZGY B;  1CBX A;  4KUA A;  2P6E A;  1Z4E A;  3NE8 A;  1TIQ A;  4EME A;  4B13 A;  4AB7 A;  4Y49 C;  4OID A;  2EK8 A;  3PFO A;  1Y9K A;  2Z10 A;  3P2H A;  1IY7 A;  4G1P A;  3SJE A;  4C7H A;  2B5G B;  2NSM A;  1B87 A;  3FMC A;  4PXE A;  4EFD A;  4X5K A;  4KVO E;  2VZY A;  1I12 A;  2C1C A;  3PB9 X;  4CAW A;  4E0A A;  2D4O A;  3WC7 A;  1IOI A;  3TO9 A;  3BXM A;  2B5G A;  2XEF A;  2PDO A;  4ZY2 A;  1QSM A;  1VKC A;  2DEA A;  1PCA A;  1MJB A;  1IYL A;  4CYO A;  1U6M A;  2ZEF A;  5F48 A;  4AXV A;  3QAH A;  1QST A;  4PXC A;  3EY5 A;  2VEZ A;  3IU1 A;  3SXN A;  2XEI A;  2ZEN A;  2BOA A;  2OOT A;  1AMP A;  2KCW A;  4XNH C;  3VWE A;  1DE4 C;  2Q4Z A;  4AG9 A;  3CXS A;  2BO9 A;  2D4P A;  3T9Y A;  4B14 A;  5IB0 A;  2R98 A;  3IWW A;  4UA3 A;  3TFY A;  4PXB A;  2OH1 A;  4JXR A;  4MHY A;  3VWD A;  3LWU A;  3D8P A;  3QNV A;  4U9Y A;  1YLO A;  4CGN A;  3K9U A;  1S7K A;  2GAN A;  3IEH A;  4MFQ A;  3B3T A;  4AVC A;  2YNC A;  3D68 A;  3S9M A;  1YSJ A;  4UFW A;  5FVJ A;  4PPZ A;  4EWT A;  2R8V A;  1ZG7 A;  1Z4R A;  1F57 A;  4NFR A;  5DWM A;  2ARH A;  1LOK A;  3SI2 A;  2O53 A;  5DS0 A;  4M6H A;  1S7N A;  2QIR A;  4UWI A;  1XBU A;  4ZY0 A;  3FH4 A;  1YME A;  4ONW A;  2J8M A;  1A2Z A;  5LYD A;  1S7F A;  3KKW A;  2G3T A;  3PBE A;  4PV6 A;  2ZW6 A;  1CM0 A;  1ELM P;  2Z0Z A;  1YQE A;  2O4H A;  5AG7 A;  3KQZ A;  3D2P A;  4L8A A;  3LOD A;  4NCZ A;  2J9A A;  3PEI A;  3GUX A;  1WWZ A;  3E0K A;  5D8N A;  2Q04 A;  2FL4 A;  2XEJ A;  4H6Z A;  2B4D A;  4M6I A;  3TE4 A;  2PRB A;  3GIU A;  3D7F A;  2CNS A;  2FIA A;  3F8K A;  4R6T A;  3SI1 A;  4KOU A;  2IJZ A;  2WUU A;  4NF1 A;  3D67 A;  2GE3 A;  4XPL A;  4F9U A;  1F2P A;  3SJX A;  2QVP A;  4NGR A;  3WC5 A;  1BLL E;  1UFH A;  2VBQ A;  4YGO A;  3SJF A;  3WC6 A;  4NJQ A;  2CNT A;  5D29 A;  2G9D A;  1HEE A;  4UFX A;  4MFZ A;  4OC5 A;  2WPW A;  4P45 A;  3TO7 A;  3MGD A;  4MY0 A;  5EBV A;  3DR8 A;  3UY5 A;  1LAM A;  4CGL A;  2OZU A;  4DJL A;  4MHD A;  2CXA A;  2ZEE A;  1Q2D A;  2GU2 A;  3QAY A;  3D7H A;  3K9T A;  2PJ6 A;  4H2K A;  2RFH A;  1R57 A;  8CPA A;  4KOS A;  1PYT B;  4KVM E;  5F49 A;  2EUI A;  2PVW A;  2REE A;  4ZI6 A;  4TNU A;  2OU2 A;  1ELL P;  3F5B A;  3SJG A;  4BBH A;  3RBU A;  3FB3 A;  2Q7S A;  3H8F A;  4NGS A;  4R57 A;  4PQA A;  1VHO A;  4Z65 A;  4R9M A;  3B8G A;  1H8L A;  1XOV A;  5CPA A;  1IB1 E;  4MXU A;  2PJA A;  3D3S A;  2ZW7 A;  1YGH A;  2AFU A;  3T90 A;  1EE3 P;  4I49 A;  3PFE A;  4OC1 A;  5A28 A;  4CGP A;  4OLL A;  3JRU A;  2Q7B A;  2Z3K A; 
#chains in the Genus database with same CATH homology
 4KOT A;  2YNC C;  4CAX A;  3PGP A;  5KTA A;  1B6B A;  2P6G A;  2QML A;  3IGR A;  4AG7 A;  4HKF A;  1ZO0 A;  4MFP A;  4YRH A;  4B11 A;  4CAE A;  4CAV A;  1RO5 A;  4M85 A;  2HUZ A;  4M3S A;  3JVN A;  4HNY B;  1XF8 A;  4R3K A;  4FD7 A;  2CY2 A;  2ZW5 A;  4F0X A;  2FIW A;  3A9L A;  4B12 A;  5G22 A;  2ATR A;  2WSA A;  4OAD A;  5ISV A;  1CJW A;  4R87 A;  3S6F A;  4UCM A;  3F0A A;  4E2A A;  4OAE A;  1M4G A;  2X7B A;  4KLW A;  3TCV A;  1QSN A;  1YLE A;  2PR1 A;  4ZBG A;  3FYN A;  1M4D A;  3TO6 A;  5E96 A;  3FXT A;  1KUX A;  1P0H A;  3TOB A;  2B3V A;  2FS5 A;  4DNC A;  4CRZ B;  2EVN A;  3ZJ0 A;  2QEC A;  5G1Z A;  4CAF A;  4EVY A;  1KUY A;  5I0C A;  3EFA A;  2FCK A;  2G3A A;  4CGO A;  4HNW B;  2PR8 A;  4JWP A;  2BL1 A;  2Z3N A;  4QBJ A;  4LUA A;  1Y7R A;  3JUW A;  2FXF A;  5EC4 A;  4II9 A;  4KZT A;  4A2Z A;  2REF A;  4XPD B;  1MK4 A;  3GY9 A;  2B58 A;  2J8R A;  2Z3P A;  3R1K A;  4JJX A;  3FBU A;  4CGN A;  3GKR A;  3I9S A;  4A33 A;  4H89 A;  2P6F A;  2IL4 A;  2VI7 A;  3W91 A;  4Q36 A;  5JQ4 A;  2HV2 A;  3W6X A;  1PU9 A;  4PSW A;  1MJA A;  4U5Y A;  4NSQ A;  4E8O A;  4FD4 A;  3C26 A;  2DXQ A;  4C7I A;  4C68 A;  2I00 A;  1SQH A;  2GIV A;  3CXP A;  3WR7 A;  4B5O A;  1V0C A;  2OZG A;  3CXQ A;  2Q4V A;  2RC4 A;  1OZP A;  3QB8 A;  2I79 A;  4CYN A;  3P2F A;  5KTD A;  4J3G A;  3G8W A;  4A95 A;  4Y49 B;  2VQY A;  3LD2 A;  5C82 A;  4IUS A;  2A4N A;  2Q4Y A;  4PK3 A;  2PC1 A;  5KTC A;  2VXK A;  4MFK A;  4QB9 A;  4UFV A;  1XE4 A;  4C2X A;  4CS0 B;  4JXQ A;  2NMT A;  4QC6 A;  4A32 A;  1IIC A;  4B5P B;  2BUE A;  3I3G A;  1XMT A;  1K4J A;  4B10 A;  2P0W A;  4B5P A;  1GHE A;  4XNH B;  4A30 A;  4K30 A;  5JPH A;  3SXO A;  3R95 A;  1BOB A;  5DWN A;  5CNP A;  4KOW A;  4KUB A;  4KS9 A;  4RS2 A;  1YVK A;  4MFL A;  4UCN A;  4CYQ A;  3BJ8 A;  3N7Z A;  4NEX A;  4AVA A;  2Z3L A;  3PZJ A;  2WPX A;  4UCP A;  2ZW4 A;  5J8F A;  4KSA A;  4MI4 A;  2G0B A;  4UWJ A;  5G21 A;  2Z11 A;  3BLN A;  2PSW A;  4ORF A;  4MJ8 A;  2B3U A;  4HNX B;  2FT0 A;  4PK2 A;  3IWE A;  4IF5 A;  4XPK A;  1M44 A;  4UBR A;  1QSO A;  4JD6 A;  3D2M A;  3FRM A;  4Q38 A;  5H86 A;  2FSR A;  1KZF A;  3TT2 A;  5AG4 A;  3H4Q A;  3SHP A;  1I1D A;  1YVO A;  1FY7 A;  2YGW A;  1YX0 A;  1LRZ A;  4U9Z A;  4YFJ A;  4FD6 A;  4C2Y A;  3EXN A;  2K5T A;  4NXY A;  1M1D A;  2YNE A;  3V8I A;  4A31 A;  5G20 A;  1ON0 A;  3GYA A;  2B4B A;  2F5I A;  2HQY A;  2ZXV A;  1S60 A;  2OZH A;  3W6S A;  1VHS A;  4MBU A;  1Q2Y A;  5HMN A;  4CRY B;  3S6G A;  3DSB A;  4GS4 A;  2DPS A;  3FIX A;  3R9G A;  2JEV A;  2VZZ A;  5AG5 A;  4FD5 A;  4MFJ A;  1NMT A;  1IID A;  2FE7 A;  2JLM A;  2AE6 A;  1QSR A;  2O28 A;  1YR0 A;  5H84 A;  2ZPA A;  5F47 A;  1S3Z A;  2J8N A;  2BSW A;  2Y0M A;  2YND A;  5F46 A;  1Y9W A;  3R96 A;  4C2Z A;  3TOA A;  1PUA A;  4LX9 A;  2CNM A;  3DR6 A;  1P4N A;  4L89 A;  4BMH A;  4JLY A;  1XIX A;  2B4D B;  3OWC A;  4RI1 A;  1IYK A;  1BO4 A;  3DDD A;  2H5M A;  4KOX A;  4AVB A;  4QVT A;  3JTK A;  2R1I A;  2JDC A;  2AJ6 A;  3R9E A;  2Q44 A;  5GCN A;  3EO4 A;  3S6H A;  5BWA B;  1S7L A;  1WK4 A;  3IWG A;  4CYP A;  2Z3M A;  2Z3O A;  2OB0 A;  4KOV A;  3EC4 A;  1NE9 A;  4R3L A;  5AG6 A;  5J8C A;  4F0Y A;  1YK3 A;  4KSF A;  1MJ9 A;  3S6K A;  4ONU A;  4CGM A;  3ZZI A;  1N71 A;  3BJ7 A;  5C88 A;  2DPT A;  4KLV A;  1NSL A;  2C27 A;  3TTH A;  2R7H A;  3RYO A;  5IX3 A;  2PQ8 A;  1YRE A;  2JDD A;  1XEB A;  4KOY A;  4XPD C;  3PP9 A;  3R9F A;  3G3S A;  2BEI A;  3NE7 A;  1S5K A;  1I21 A;  3DNS A;  4PSX A;  4KVX A;  5A27 A;  4H6U A;  4MY3 A;  3IU2 A;  1Z9U A;  1J4J A;  4QUS A;  1Q2C A;  2Q0Y A;  5AGE A;  4F6A A;  1RXT A;  1M4I A;  1L0C A;  5HH1 A;  3H5Z A;  3FNC A;  4KOR A;  1KUV A;  4ZGY B;  4KUA A;  2P6E A;  1Z4E A;  1TIQ A;  4B13 A;  4AB7 A;  4Y49 C;  1Y9K A;  2Z10 A;  3P2H A;  2B5G B;  1B87 A;  4X5K A;  4KVO E;  2VZY A;  1I12 A;  4CAW A;  4E0A A;  2D4O A;  4C7H A;  3TO9 A;  2B5G A;  2PDO A;  1QSM A;  1VKC A;  1MJB A;  1IYL A;  4CYO A;  1U6M A;  5F48 A;  3QAH A;  1QST A;  3EY5 A;  2VEZ A;  3IU1 A;  3SXN A;  2KCW A;  4XNH C;  3VWE A;  4AG9 A;  3CXS A;  2D4P A;  3T9Y A;  4B14 A;  5IB0 A;  2R98 A;  4UA3 A;  3TFY A;  2OH1 A;  4JXR A;  3VWD A;  3D8P A;  4U9Y A;  3K9U A;  1S7K A;  2GAN A;  4MFQ A;  4AVC A;  2YNC A;  4UFW A;  5FVJ A;  2R8V A;  1Z4R A;  5DWM A;  2ARH A;  1S7N A;  2QIR A;  4UWI A;  2J8M A;  1S7F A;  3KKW A;  2G3T A;  4PV6 A;  2ZW6 A;  1CM0 A;  2Z0Z A;  5AG7 A;  4L8A A;  3D2P A;  3LOD A;  4NCZ A;  1WWZ A;  3E0K A;  2Q04 A;  2FL4 A;  4H6Z A;  3TE4 A;  2B4D A;  2PRB A;  5A28 A;  2CNS A;  2FIA A;  3F8K A;  4KOU A;  2WUU A;  4NF1 A;  2GE3 A;  4XPL A;  5IV0 A;  4YGO A;  1UFH A;  2VBQ A;  2CNT A;  4UFX A;  4MFZ A;  2WPW A;  3TO7 A;  3MGD A;  4MY0 A;  5EBV A;  3DR8 A;  3UY5 A;  4CGL A;  2OZU A;  4MHD A;  2CXA A;  1Q2D A;  1R57 A;  4KOS A;  4KVM E;  5F49 A;  2EUI A;  2REE A;  2OU2 A;  3F5B A;  4BBH A;  3FB3 A;  4R57 A;  4R9M A;  3B8G A;  1IB1 E;  3D3S A;  2ZW7 A;  1YGH A;  3T90 A;  4I49 A;  4CGP A;  4OLL A;  2Q7B A;  2Z3K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...