3PBEA

Crystal structure of the mutant w207f of human secretory glutaminyl cyclase
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
329
structure length
323
Chain Sequence
b'ASAWPEEKNYHQPAILNSSALRQIAEGTSISEMWQNDLQPLLIERYPGSPGSYAARQHIMQRIQRLQADWVLEIDTFLSQTPYGYRSFSNIISTLNPTAKRHLVLACHYDSKYFSHWNNRVFVGATDSAVPCAMMLELARALDKKLLSLKPDLSLQLIFFDGEEAFLHFSPQDSLYGSRHLAAKMASTPHPPGARGTSQLHGMDLLVLLDLIGAPNPTFPNFFPNSARWFERLQAIEHELHELGLLKDHSLEGRYFQNYSYGGVIQDDHIPFLRRGVPVLHLIPSPFPEVWHTMDDNEENLDESTIDNLNKILQVFVLEYLHL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glutaminyl-peptide cyclotransferase
molecule tags Transferase
source organism Homo sapiens
publication title Structures of human Golgi-resident glutaminyl cyclase and its complexes with inhibitors reveal a large loop movement upon inhibitor binding
pubmed doi rcsb
total genus 110
structure length 323
sequence length 329
chains with identical sequence B
ec nomenclature ec 2.3.2.5: Glutaminyl-peptide cyclotransferase.
pdb deposition date 2010-10-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 3pbeA00
4P44A 3D7GA 2HB6A 3HUVA 3D67A 2ZOFA 3ISXA 1R3NA 3VH9A 4X8IA 1Z8LA 1F2PA 5JM6A 3D7DA 2WZNA 2POKA 5K8OA 3LMSA 1BAVA 3PBBA 4G1PA 4X3RA 1R43A 4WJBA 1TKHA 5THWA 2ZEFA 3T8WA 3FX6A 2VL1A 4FUUA 2Q4ZA 1XBUA 2PJ9A 4NGTA 1AYEA 2IMOA 3N5FA 3QNVA 3MN8A 2O53A 1NSAA 6CPAA 1F2OA 4F9UA 4FWUA 4OC5A 2F8HA 4K3NA 4ZI6A 2PIZA 1JQGA 2O4HA 1LAPA 3B35A 2ZEMA 4NJRA 2V8GA 1YW4A 3MRUA 4P4BA 2NSMA 1XMBA 4MCRA 4JZ0A 4OIDA 2ANPA 4TNUA 2PJ2A 1UWYA 2V8VA 4Z65A 4ZX9A 5J1QA 2ZEHA 1VHOA 4MCQA 2AFWA 8CPAA 1GYTA 1LANA 4BD9A 3FMCA 3HLPA 1FNOA 4OC0A 4NGSA 2PJAA 1H8LA 4O23A 4R6TA 5HVHA 2AFZA 3S9NA 2GREA 1XFOA 2ZENA 4EFDA 3V7ZA 1Y0YA 3GUXA 3B3SA 2FVGA 1M4LA 3PB6X 5LYIA 4ZY2A 2WYRA 3BI0A 5JH9A 2RFHA 1Y0RA 5D8NA 3B3WA 4NGNA 3H8EA 2PJ7A 3IFEA 4OP4A 2ZEOA 3NA6A 1YLOA 4NGQA 5HXDA 3IIBA 3S9MA 1CP7A 4R76A 1HDQA 2PJ1A 1BPMA 1YMEA 2AFOA 2V8HA 2AFMA 1CG2A 1LCPA 4TWEA 2PJBA 3SJXA 3VATA 4AXVA 5HVGA 4NGPA 3KHXA 1QMUA 3SI1A 3IJ3A 4JYWA 1ELMP 2XEIA 4P4DA 3KGQA 1PYTB 4PXBA 3WC6A 3D68A 3B2YA 2QJ8A 3RZAA 4MRIA 3NH8A 4DYOA 3WC7A 5IB9A 1CP6A 1LOKA 4FAIA 3PB9X 4P4FA 2XEJA 1ARMA 5D29A 4DUKA 4OC4A 1ZG7A 3KI9A 4OC3A 2PJ6A 4NGMA 2ZELA 2IJZA 2PIYA 3VARA 4OIWA 3H8GA 2EK8A 2V8DA 4MCSA 2IQ6A 3SJGA 5HVFA 1HEEA 3FF3A 3WABA 4ZYQA 3B3CA 5LYFA 1CPSA 4MHPA 4LQGA 4PXDA 2CTCA 2HC9A 3TX8A 3PFOA 4H2KA 2PE3A 1AMPA 3KR5A 5LYDA 3KQXA 4A38A 5LRKA 1IY7A 3GB0A 4P4IA 1HDUA 2CIJA 2ZEDA 4ZY1A 7CPAA 5ELYA 4P10A 3DLJA 4UIAA 4P4JA 2PVWA 4IK2A 2J9AA 1TF9A 4KSIA 3D66A 2PJ0A 3CPXA 4A94A 2ZEGA 3FECA 3CDXA 4OC2A 4CPAA 3WT4A 3V38A 2OOTA 2DEAA 4NGRA 4EMEA 1IGBA 2EWBA 4IHMA 5JGFA 3PBEA 4NFRA 2XEFA 2PJ3A 1PCAA 4X2TA 2I3CA 1XRYA 3NH5A 4UEFA 4UIBA 1LAMA 2G9DA 3SI2A 4B6ZA 3FEDA 3CT9A 3PB7X 2PRQA 1VIXA 1BPNA 1BLLE 2QVPA 3BI1A 1ZG9A 4FBEA 3D4UA 4P4EA 4Q7AA 2GLFA 5LYLA 2ABZA 3K2KA 2OR4A 3NFZA 3B3VA 5K8NA 4MCPA 2PJ5A 3IO1A 1ZG8A 2PJ8A 3FH4A 2V77A 2CF4A 1Z5RA 4DJLA 2PCUA 5CPAA 4UF4A 2XEGA 3K9TA 4GM5A 1XJOA 4MMOA 3KL9A 4EWTA 5DS0A 4A39A 2JEWA 1TKFA 1CPXA 2AFSA 2C6PA 2BO9A 1VGYA 2Q51A 1TXRA 5I4MA 1F57A 3FEEA 4RUHA 3PFEA 1CX8A 2GLJA 3KHZA 4P45A 3ISZA 4OC1A 3H8FA 2JBJA 4NJQA 3IWWA 3I1UA 4R8FA 3SJFA 2AFUA 3GLJA 4PXEA 4MHYA 2AFXA 3IC1A 2F7VA 4PPZA 4MHNA 4R7MA 1ARLA 2C6GA 5K8PA 1Q7LA 3D7FA 2ZEPA 1DTDA 1LFWA 2C6CA 3KASA 2PVVA 3SI0A 2ZEEA 4UEEA 3NH4A 3PEIA 4MHZA 3KZWA 1DE4C 4MXUA 3B3TA 3LWUA 3WC5A 3TC8A 1ZLHA 1TF8A 3SJEA 4P6YA 4PXCA 3BXMA 3KR4A 2C1CA 3FJUA 5K8MA 3CPAA 3IEHA 1CBXA 4W9YA 1FT7A 4F9VA 2CTBA 3PB4X 2JBKA 4F8ZA 4YU9A 3BHXA 4IAVA 1ELLP 1Z2LA 4WWVA 2PJCA 3D7HA 1YSJA 1Y7EA 4ZY0A 3JRUA 4PQAA 2QYVA 3PRTA 3S9LA 2NYQA 2Q43A 2ZOGA 3PB8X 4ZX8A 1QQ9A 2BOAA 2PJ4A 5CBMA 1VHEA 1YW6A 3FVLA 1EE3P 3DGVA 1KWMA 4YWYA 4OMEA 5LRGA 1OBRA 3L2NA 4UEZA 1RTQA 3KQZA 3RBUA 3RAMA 1TKJA 2BCOA 5LRJA 1ZLIA 2EK9A 5F09A 3B7IA 2RB7A 2GU2A 4A37A 4OKOA 4ONWA
chains in the Genus database with same CATH superfamily
4P44A 3FNCA 2BSWA 2O28A 2HB6A 3D7GA 3HUVA 2BL1A 3CXPA 2Q0YA 1UFHA 4YGOA 1QSRA 3D67A 2YNDA 2BEIA 2ZOFA 4CGOA 3ISXA 1R3NA 2P6GA 4PK3A 3VH9A 3QAHA 1Z8LA 4X8IA 1F2PA 4CS0B 5JM6A 3D7DA 2WZNA 4KORA 4A30A 2POKA 2VEZA 5K8OA 3LMSA 1BAVA 3PBBA 4G1PA 4KOYA 2OB0A 4X3RA 4B5OA 2WSAA 4CAFA 1AUGA 3EO4A 2B4DA 1R43A 3FXTA 4FD5A 1TKHA 4WJBA 5THWA 3S6KA 2ZEFA 4I49A 4NXYA 4MY3A 3QB8A 3R96A 2FIWA 3FX6A 4KLWA 3T8WA 4GS4A 1TIQA 2VL1A 4FUUA 2Q4ZA 4E8OA 1XBUA 3A9LA 3EFAA 4L89A 3B8GA 3TT2A 2PJ9A 4NGTA 1S7NA 1ON0A 3DR6A 1AYEA 4B12A 2IMOA 2PR8A 2REFA 1IICA 3N5FA 3LACA 4C7HA 3QNVA 3TO6A 3MN8A 2O53A 2GFQA 4HNXB 1XIXA 4QB9A 1NSAA 6CPAA 1F2OA 4F9UA 4FWUA 4OC5A 4FD6A 1J4JA 2Q04A 4XPKA 4UWIA 3ZJ0A 4B5PB 1XF8A 3EXNA 2F8HA 1MJ9A 4K3NA 4ZI6A 4CGLA 2PIZA 4CYQA 4UFWA 2PQ8A 1JQGA 2B5GB 2O4HA 4U9ZA 4UA3A 2YGWA 1LAPA 2R1IA 5F47A 2Z3PA 1NSLA 3B35A 3GKRA 2ZEMA 4NJRA 5J8CA 2V8GA 1YW4A 4UWJA 3SXOA 3MRUA 4M6HA 5A28A 2QECA 5F46A 3TCVA 3D8PA 1IYKA 2F5IA 4P4BA 2NSMA 1XMBA 4MCRA 4JZ0A 4QBJA 4OIDA 3TTHA 2ANPA 4OAEA 4JD6A 4TNUA 2G3TA 2PJ2A 3V8IA 1UWYA 3PP9A 3DR8A 2V8VA 4KS9A 4Z65A 4ZX9A 4JXRA 3W6XA 4BBHA 5J1QA 2ZEHA 1VHOA 1U6MA 2GIVA 5IB0A 1Q2DA 4MCQA 3FBUA 2AFWA 2FSRA 1M4GA 8CPAA 1GYTA 3FYNA 1LANA 4BD9A 3FMCA 1YK3A 3HLPA 4AVBA 1ZO0A 1FNOA 2P6EA 4KVME 2AJ6A 1IYLA 1S7KA 4OC0A 2VBQA 4NGSA 2PJAA 2FL4A 5DWMA 1YQEA 1H8LA 1Z4EA 4KOVA 2REEA 2X7BA 4O23A 4R6TA 4BINA 2AFZA 5HVHA 3S9NA 2GREA 1XFOA 1YVOA 2DF5A 2ZENA 1S7LA 4JJXA 3F8KA 4AG7A 4C7IA 1Q2CA 4EFDA 5IV0A 3TO7A 3KKWA 3W6SA 2EUIA 1KZFA 1Y0YA 3V7ZA 2VI7A 3GUXA 4R57A 3R9GA 3B3SA 4XPLA 4DNCA 2FVGA 1M4LA 1S60A 3PB6X 3VWEA 3BLNA 5LYIA 3BJ7A 1YGHA 4ZY2A 1V0CA 2WYRA 3BI0A 4NCZA 2RFHA 5JH9A 4F6AA 1Y0RA 5D8NA 3B3WA 4NGNA 1IB1E 4MBUA 3H8EA 4YRHA 4Y49C 2Q7BA 4MFKA 2I79A 4KSFA 2PJ7A 2YNEA 2RC4A 3IFEA 1PU9A 2B3VA 4OP4A 2G3AA 4F0YA 2Z0ZA 2ZEOA 1YLOA 3NA6A 4NGQA 3R9FA 3R9EA 3IIBA 3S9MA 1IOIA 2Y0MA 3RYOA 1CP7A 5EMIA 4R76A 1HDQA 2PJ1A 3TOAA 1BPMA 1YMEA 2AFOA 1X12A 4B10A 2V8HA 5AG7A 5H84A 4II9A 5I0CA 3CXQA 2AFMA 1CG2A 1LCPA 2Q7SA 4TWEA 4AG9A 2PJBA 5HH1A 3SJXA 2B4BA 3VATA 4AXVA 5HVGA 4KVXA 4NGPA 2C27A 3KHXA 1P0HA 3IWGA 4YFJA 1QMUA 3SI1A 3IJ3A 1Z9UA 4UFXA 3P2HA 3GIUA 4JYWA 4JWPA 1ELMP 2JEVA 2XEIA 2EBJA 3D3SA 4CGNA 5KTCA 4P4DA 3KGQA 1PYTB 2PR1A 4PXBA 3WC6A 3D68A 4LUAA 4FD4A 1Q2YA 3JVNA 3B2YA 2IL4A 5FVJA 2Z3OA 1Y9WA 2QJ8A 3G8WA 4UBRA 3RNZA 3RZAA 5DWNA 2Z3MA 2ZW6A 4MFZA 4MY0A 4MRIA 3NH8A 4DYOA 2FE7A 3WC7A 1QSOA 4BMHA 1CP6A 1LOKA 4NEXA 5IB9A 5C88A 2VZZA 4FAIA 3PB9X 4P4FA 2XEJA 4R87A 5C82A 2B3UA 2VQYA 2CNMA 4E2AA 1ARMA 5D29A 4DUKA 3D2MA 4C68A 4OC4A 2HV2A 1ZG7A 2Q44A 3KI9A 4OC3A 4X5KA 4PK2A 2PJ6A 4MJ8A 5BWAB 1BOBA 5KTDA 4NGMA 4XNHB 4C2YA 2FT0A 3IU1A 2OH1A 2D4PA 2IJZA 2PIYA 3G3SA 3NE7A 4MFQA 2JLMA 4OIWA 3VARA 5G20A 5CNPA 3H8GA 5H86A 4LQ6A 3S6FA 2EK8A 2V8DA 4CAVA 4U9YA 4M3SA 1Z4RA 4MCSA 2IQ6A 2R8VA 3SJGA 1I12A 5HVFA 1HEEA 3FF3A 3WABA 4K30A 4ZYQA 3C26A 2DPTA 3B3CA 2HUZA 5LYFA 1CPSA 2OZGA 4MHPA 4LQGA 2EVNA 4PXDA 2CTCA 3DNSA 2OU2A 4UCMA 2HC9A 3TX8A 4FD7A 3PFOA 4EVYA 2J8MA 1PUAA 1N71A 4H2KA 2PE3A 1AMPA 2VZYA 3KR5A 3R1KA 5LYDA 3T9YA 2YNCC 5JQ4A 3KQXA 4A38A 5LRKA 1QSNA 2H5MA 1S3ZA 1IY7A 1RO5A 1M44A 3GB0A 4P4IA 1HDUA 1M4IA 2CIJA 1VKCA 2ZEDA 4ZY1A 7CPAA 1B6BA 2I00A 3DSBA 5ELYA 4P10A 3DLJA 4Y49B 4IUSA 4A33A 4UIAA 3PGPA 1S5KA 2PVWA 4P4JA 5EBVA 2HQYA 4IK2A 2J9AA 4QC6A 4HNWB 4R9MA 1TF9A 4KSIA 3D66A 4KVOE 2YNCA 2PJ0A 4OLLA 1FY7A 3CPXA 4A94A 4CAXA 2OZHA 2ZEGA 5AGEA 3FECA 3CDXA 1GHEA 4OC2A 4CPAA 3EC4A 4NSQA 3WT4A 2CNTA 3V38A 5GCNA 2OOTA 2DEAA 3N7ZA 4NGRA 4EMEA 4KOUA 1XOVA 4KZTA 1IGBA 4R3LA 2EWBA 2CNSA 4IHMA 5JGFA 1MJBA 3PBEA 4KUBA 2QMLA 4NFRA 4RI1A 2XEFA 2PJ3A 2WUUA 3MGDA 1PCAA 4B11A 2JDDA 4RN7A 1VHSA 1Z8WA 3D2PA 2I3CA 4X2TA 1XRYA 3NH5A 4UEFA 4UIBA 1LAMA 2P0WA 4ZBGA 2A4NA 2G9DA 3SI2A 3TE4A 4HPSA 4B6ZA 3FEDA 1NMTA 1MK4A 4KSAA 4A95A 2EO8A 4E0AA 3CT9A 3PB7X 4Q38A 2PRQA 1VIXA 2NMTA 1BPNA 3DDDA 3JUWA 1BLLE 2QVPA 3BI1A 3QAYA 4ONUA 1ZG9A 3SXNA 3WR7A 5HXDA 4FBEA 3IU2A 5G21A 4L8AA 2J8NA 2QIRA 3F5BA 4KOSA 3D4UA 4P4EA 4C2ZA 2Z10A 2Z3NA 4Q7AA 2GLFA 2K5TA 2PSWA 3H4QA 5AG6A 4F0XA 5LYLA 2ABZA 3LODA 3K2KA 5AG5A 2OR4A 3NFZA 4MFLA 1X10A 3B3VA 5K8NA 4MCPA 1Y7RA 2PJ5A 3IO1A 1ZG8A 2PJ8A 3FH4A 1B87A 2V77A 3F0AA 2CF4A 4CRZB 1Z5RA 5E96A 2ZW4A 4DJLA 2PCUA 2B5GA 2ARHA 4HKFA 5CPAA 2CXAA 1L0CA 2XEGA 2Z3LA 4UF4A 2FXFA 3NE8A 4PSXA 1XE4A 3K9TA 4GM5A 3S6GA 3W91A 5JPHA 3RO0A 5J8FA 1XJOA 4KUAA 3I3GA 3KL9A 4MMOA 4ZGYB 1A2ZA 4EWTA 5DS0A 4A39A 2JEWA 1TKFA 1CPXA 2AFSA 2C6PA 2ZW7A 2BO9A 1VGYA 2Q51A 1BO4A 1TXRA 3GYAA 4ONWA 5I4MA 4U5YA 5F48A 4XPDC 1F57A 2Z3KA 3FEEA 1YX0A 2PDOA 4RUHA 3PFEA 1CX8A 4PSWA 4CYPA 2GLJA 2P6FA 2JDCA 3KHZA 4P45A 1YREA 3ISZA 4LX9A 4OC1A 3H8FA 5KTAA 2JBJA 3CZXA 2DPSA 1QSTA 4NJQA 4PV6A 2CY2A 2WPXA 3IWWA 5F49A 4A2ZA 3I1UA 1CJWA 4R3KA 2ZW5A 4H6UA 4KOWA 4B5PA 3R95A 3ZZIA 2Z11A 4R8FA 5EC4A 4M6GA 5ISVA 3SJFA 2AFUA 2ODFA 1P4NA 3GLJA 1XMTA 4PXEA 4ORFA 1KUYA 4MHYA 1Z8TA 1Y9KA 2GANA 4QUSA 2AFXA 3TFYA 2PRBA 2FCKA 4CYNA 3IC1A 2VXKA 1OZPA 1KUXA 2F7VA 4JLYA 4PPZA 4KLVA 4MHNA 4R7MA 3BJ8A 1ARLA 2C6GA 1WK4A 4M85A 5K8PA 1Q7LA 3D7FA 2ZEPA 1DTDA 1LFWA 2B58A 2C6CA 3K9UA 3KASA 5HMNA 1SQHA 2PVVA 1IIDA 3SI0A 2KCWA 3TOBA 2FS5A 2ZEEA 4UEEA 3H5ZA 3NH4A 3PEIA 4HNYB 4MHZA 3KZWA 1DE4C 4MXUA 3B3TA 3LWUA 4QVTA 4KOTA 4CGPA 1RXTA 4UCPA 2ZXVA 1YLEA 3IWEA 3WC5A 4CAWA 1JWQA 3TC8A 4OADA 4CRYB 1ZLHA 1TF8A 4M6IA 3SJEA 1QSMA 4AVAA 4CYOA 1CM0A 4P6YA 4UFVA 4PXCA 3BXMA 3KR4A 1XEBA 1M4DA 2C1CA 3P2FA 3FJUA 4B14A 1MJAA 4MHDA 2DXQA 2ZPAA 2G0BA 3CPAA 3IEHA 1CBXA 3LD2A 3UY5A 5K8MA 4W9YA 1FT7A 2D4OA 3FIXA 1M1DA 4AVCA 4KOXA 4F9VA 2J8RA 3IGRA 4C2XA 1I21A 2CTBA 3PB4X 2WPWA 1KUVA 2JBKA 4F8ZA 4B13A 1LRZA 4YU9A 3S6HA 3BHXA 4IAVA 4XPDB 1ELLP 1Z2LA 4MFPA 4WWVA 2AE6A 2BUEA 2PJCA 4H89A 3D7HA 1YSJA 4H6ZA 2GE3A 4RS2A 5G22A 1Y7EA 1S7FA 4ZY0A 1R57A 1K4JA 1WWZA 2QYVA 3JRUA 4PQAA 4A32A 2R98A 4XNHC 4GXHA 4CAEA 3PRTA 3S9LA 4NF1A 2NYQA 2Q43A 2ZOGA 3I9SA 3JTKA 3OWCA 3PB8X 4ZX8A 1QQ9A 1IOFA 2ATRA 2BOAA 2PJ4A 5CBMA 2PC1A 1VHEA 1YR0A 1YW6A 3SHPA 2Q4VA 3FVLA 3FB3A 3E0KA 1I1DA 4OKOA 1EE3P 1NE9A 4IF5A 3EY5A 4JXQA 3FRMA 4AB7A 5AG4A 2Q4YA 4MI4A 1IU8A 3DGVA 1KWMA 4YWYA 4J3GA 3PZJA 4OMEA 5LRGA 3TO9A 1OBRA 3T90A 3L2NA 3CXSA 3GY9A 4UEZA 2R7HA 5IX3A 1RTQA 3KQZA 3RBUA 3RAMA 4Q36A 4UCNA 1TKJA 1Z8XA 5A27A 2BCOA 5LRJA 1ZLIA 2B4DB 2EK9A 5F09A 1YVKA 3VWDA 2OZUA 3B7IA 4MFJA 4CGMA 2RB7A 2GU2A 4A37A 5G1ZA 2ZELA 2FIAA 4A31A
chains in the Genus database with same CATH topology
4P44A 3D7GA 2HB6A 3HUVA 3D67A 2ZOFA 3ISXA 1R3NA 3VH9A 4X8IA 1Z8LA 1F2PA 5JM6A 3D7DA 2WZNA 2POKA 5K8OA 3LMSA 1BAVA 3PBBA 4G1PA 4X3RA 1R43A 4WJBA 1TKHA 5THWA 2ZEFA 3T8WA 3FX6A 2VL1A 4FUUA 2Q4ZA 1XBUA 2PJ9A 4NGTA 1AYEA 2IMOA 3N5FA 3QNVA 3MN8A 2O53A 1NSAA 6CPAA 1F2OA 4F9UA 4FWUA 4OC5A 2F8HA 4K3NA 4ZI6A 2PIZA 1JQGA 2O4HA 1LAPA 3B35A 2ZEMA 4NJRA 2V8GA 1YW4A 3MRUA 4P4BA 2NSMA 1XMBA 4MCRA 4JZ0A 4OIDA 2ANPA 4TNUA 2PJ2A 1UWYA 2V8VA 4Z65A 4ZX9A 5J1QA 2ZEHA 1VHOA 4MCQA 2AFWA 8CPAA 1GYTA 1LANA 4BD9A 3FMCA 3HLPA 1FNOA 4OC0A 4NGSA 2PJAA 1H8LA 4O23A 4R6TA 5HVHA 2AFZA 3S9NA 2GREA 1XFOA 2ZENA 4EFDA 3V7ZA 1Y0YA 3GUXA 3B3SA 2FVGA 1M4LA 3PB6X 5LYIA 4ZY2A 2WYRA 3BI0A 5JH9A 2RFHA 1Y0RA 5D8NA 3B3WA 4NGNA 3H8EA 2PJ7A 3IFEA 4OP4A 2ZEOA 3NA6A 1YLOA 4NGQA 5HXDA 3IIBA 3S9MA 1CP7A 4R76A 1HDQA 2PJ1A 1BPMA 1YMEA 2AFOA 2V8HA 2AFMA 1CG2A 1LCPA 4TWEA 2PJBA 3SJXA 3VATA 4AXVA 5HVGA 4NGPA 3KHXA 1QMUA 3SI1A 3IJ3A 4JYWA 1ELMP 2XEIA 4P4DA 3KGQA 1PYTB 4PXBA 3WC6A 3D68A 3B2YA 2QJ8A 3RZAA 4MRIA 3NH8A 4DYOA 3WC7A 5IB9A 1CP6A 1LOKA 4FAIA 3PB9X 4P4FA 2XEJA 1ARMA 5D29A 4DUKA 4OC4A 1ZG7A 3KI9A 4OC3A 2PJ6A 4NGMA 2ZELA 2IJZA 2PIYA 3VARA 4OIWA 3H8GA 2EK8A 2V8DA 4MCSA 2IQ6A 3SJGA 5HVFA 1HEEA 3FF3A 3WABA 4ZYQA 3B3CA 5LYFA 1CPSA 4MHPA 4LQGA 4PXDA 2CTCA 2HC9A 3TX8A 3PFOA 4H2KA 2PE3A 1AMPA 3KR5A 5LYDA 3KQXA 4A38A 5LRKA 1IY7A 3GB0A 4P4IA 1HDUA 2CIJA 2ZEDA 4ZY1A 7CPAA 5ELYA 4P10A 3DLJA 4UIAA 4P4JA 2PVWA 4IK2A 2J9AA 1TF9A 4KSIA 3D66A 2PJ0A 3CPXA 4A94A 2ZEGA 3FECA 3CDXA 4OC2A 4CPAA 3WT4A 3V38A 2OOTA 2DEAA 4NGRA 4EMEA 1IGBA 2EWBA 4IHMA 5JGFA 3PBEA 4NFRA 2XEFA 2PJ3A 1PCAA 4X2TA 2I3CA 1XRYA 3NH5A 4UEFA 4UIBA 1LAMA 2G9DA 3SI2A 4B6ZA 3FEDA 3CT9A 3PB7X 2PRQA 1VIXA 1BPNA 1BLLE 2QVPA 3BI1A 1ZG9A 4FBEA 3D4UA 4P4EA 4Q7AA 2GLFA 5LYLA 2ABZA 3K2KA 2OR4A 3NFZA 3B3VA 5K8NA 4MCPA 2PJ5A 3IO1A 1ZG8A 2PJ8A 3FH4A 2V77A 2CF4A 1Z5RA 4DJLA 2PCUA 5CPAA 4UF4A 2XEGA 3K9TA 4GM5A 1XJOA 4MMOA 3KL9A 4EWTA 5DS0A 4A39A 2JEWA 1TKFA 1CPXA 2AFSA 2C6PA 2BO9A 1VGYA 2Q51A 1TXRA 5I4MA 1F57A 3FEEA 4RUHA 3PFEA 1CX8A 2GLJA 3KHZA 4P45A 3ISZA 4OC1A 3H8FA 2JBJA 4NJQA 3IWWA 3I1UA 4R8FA 3SJFA 2AFUA 3GLJA 4PXEA 4MHYA 2AFXA 3IC1A 2F7VA 4PPZA 4MHNA 4R7MA 1ARLA 2C6GA 5K8PA 1Q7LA 3D7FA 2ZEPA 1DTDA 1LFWA 2C6CA 3KASA 2PVVA 3SI0A 2ZEEA 4UEEA 3NH4A 3PEIA 4MHZA 3KZWA 1DE4C 4MXUA 3B3TA 3LWUA 3WC5A 3TC8A 1ZLHA 1TF8A 3SJEA 4P6YA 4PXCA 3BXMA 3KR4A 2C1CA 3FJUA 5K8MA 3CPAA 3IEHA 1CBXA 4W9YA 1FT7A 4F9VA 2CTBA 3PB4X 2JBKA 4F8ZA 4YU9A 3BHXA 4IAVA 1ELLP 1Z2LA 4WWVA 2PJCA 3D7HA 1YSJA 1Y7EA 4ZY0A 3JRUA 4PQAA 2QYVA 3PRTA 3S9LA 2NYQA 2Q43A 2ZOGA 3PB8X 4ZX8A 1QQ9A 2BOAA 2PJ4A 5CBMA 1VHEA 1YW6A 3FVLA 1EE3P 3DGVA 1KWMA 4YWYA 4OMEA 5LRGA 1OBRA 3L2NA 4UEZA 1RTQA 3KQZA 3RBUA 3RAMA 1TKJA 2BCOA 5LRJA 1ZLIA 2EK9A 5F09A 3B7IA 2RB7A 2GU2A 4A37A 4OKOA 4ONWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4P44 A;  3D7G A;  2HB6 A;  3HUV A;  3D67 A;  2ZOF A;  3ISX A;  1R3N A;  3VH9 A;  4X8I A;  1Z8L A;  1F2P A;  5JM6 A;  3D7D A;  2WZN A;  2POK A;  5K8O A;  3LMS A;  1BAV A;  3PBB A;  4G1P A;  4X3R A;  1R43 A;  4WJB A;  1TKH A;  5THW A;  2ZEF A;  3T8W A;  3FX6 A;  2VL1 A;  4FUU A;  2Q4Z A;  1XBU A;  2PJ9 A;  4NGT A;  1AYE A;  2IMO A;  3N5F A;  3QNV A;  3MN8 A;  2O53 A;  1NSA A;  6CPA A;  1F2O A;  4F9U A;  4FWU A;  4OC5 A;  2F8H A;  4K3N A;  4ZI6 A;  2PIZ A;  1JQG A;  2O4H A;  1LAP A;  3B35 A;  2ZEM A;  4NJR A;  2V8G A;  1YW4 A;  3MRU A;  4P4B A;  2NSM A;  1XMB A;  4MCR A;  4JZ0 A;  4OID A;  2ANP A;  4TNU A;  2PJ2 A;  1UWY A;  2V8V A;  4Z65 A;  4ZX9 A;  5J1Q A;  2ZEH A;  1VHO A;  4MCQ A;  2AFW A;  8CPA A;  1GYT A;  1LAN A;  4BD9 A;  3FMC A;  3HLP A;  1FNO A;  4OC0 A;  4NGS A;  2PJA A;  1H8L A;  4O23 A;  4R6T A;  5HVH A;  2AFZ A;  3S9N A;  2GRE A;  1XFO A;  2ZEN A;  4EFD A;  3V7Z A;  1Y0Y A;  3GUX A;  3B3S A;  2FVG A;  1M4L A;  3PB6 X;  5LYI A;  4ZY2 A;  2WYR A;  3BI0 A;  5JH9 A;  2RFH A;  1Y0R A;  5D8N A;  3B3W A;  4NGN A;  3H8E A;  2PJ7 A;  3IFE A;  4OP4 A;  2ZEO A;  3NA6 A;  1YLO A;  4NGQ A;  5HXD A;  3IIB A;  3S9M A;  1CP7 A;  4R76 A;  1HDQ A;  2PJ1 A;  1BPM A;  1YME A;  2AFO A;  2V8H A;  2AFM A;  1CG2 A;  1LCP A;  4TWE A;  2PJB A;  3SJX A;  3VAT A;  4AXV A;  5HVG A;  4NGP A;  3KHX A;  1QMU A;  3SI1 A;  3IJ3 A;  4JYW A;  1ELM P;  2XEI A;  4P4D A;  3KGQ A;  1PYT B;  4PXB A;  3WC6 A;  3D68 A;  3B2Y A;  2QJ8 A;  3RZA A;  4MRI A;  3NH8 A;  4DYO A;  3WC7 A;  5IB9 A;  1CP6 A;  1LOK A;  4FAI A;  3PB9 X;  4P4F A;  2XEJ A;  1ARM A;  5D29 A;  4DUK A;  4OC4 A;  1ZG7 A;  3KI9 A;  4OC3 A;  2PJ6 A;  4NGM A;  2ZEL A;  2IJZ A;  2PIY A;  3VAR A;  4OIW A;  3H8G A;  2EK8 A;  2V8D A;  4MCS A;  2IQ6 A;  3SJG A;  5HVF A;  1HEE A;  3FF3 A;  3WAB A;  4ZYQ A;  3B3C A;  5LYF A;  1CPS A;  4MHP A;  4LQG A;  4PXD A;  2CTC A;  2HC9 A;  3TX8 A;  3PFO A;  4H2K A;  2PE3 A;  1AMP A;  3KR5 A;  5LYD A;  3KQX A;  4A38 A;  5LRK A;  1IY7 A;  3GB0 A;  4P4I A;  1HDU A;  2CIJ A;  2ZED A;  4ZY1 A;  7CPA A;  5ELY A;  4P10 A;  3DLJ A;  4UIA A;  4P4J A;  2PVW A;  4IK2 A;  2J9A A;  1TF9 A;  4KSI A;  3D66 A;  2PJ0 A;  3CPX A;  4A94 A;  2ZEG A;  3FEC A;  3CDX A;  4OC2 A;  4CPA A;  3WT4 A;  3V38 A;  2OOT A;  2DEA A;  4NGR A;  4EME A;  1IGB A;  2EWB A;  4IHM A;  5JGF A;  3PBE A;  4NFR A;  2XEF A;  2PJ3 A;  1PCA A;  4X2T A;  2I3C A;  1XRY A;  3NH5 A;  4UEF A;  4UIB A;  1LAM A;  2G9D A;  3SI2 A;  4B6Z A;  3FED A;  3CT9 A;  3PB7 X;  2PRQ A;  1VIX A;  1BPN A;  1BLL E;  2QVP A;  3BI1 A;  1ZG9 A;  4FBE A;  3D4U A;  4P4E A;  4Q7A A;  2GLF A;  5LYL A;  2ABZ A;  3K2K A;  2OR4 A;  3NFZ A;  3B3V A;  5K8N A;  4MCP A;  2PJ5 A;  3IO1 A;  1ZG8 A;  2PJ8 A;  3FH4 A;  2V77 A;  2CF4 A;  1Z5R A;  4DJL A;  2PCU A;  5CPA A;  4UF4 A;  2XEG A;  3K9T A;  4GM5 A;  1XJO A;  4MMO A;  3KL9 A;  4EWT A;  5DS0 A;  4A39 A;  2JEW A;  1TKF A;  1CPX A;  2AFS A;  2C6P A;  2BO9 A;  1VGY A;  2Q51 A;  1TXR A;  5I4M A;  1F57 A;  3FEE A;  4RUH A;  3PFE A;  1CX8 A;  2GLJ A;  3KHZ A;  4P45 A;  3ISZ A;  4OC1 A;  3H8F A;  2JBJ A;  4NJQ A;  3IWW A;  3I1U A;  4R8F A;  3SJF A;  2AFU A;  3GLJ A;  4PXE A;  4MHY A;  2AFX A;  3IC1 A;  2F7V A;  4PPZ A;  4MHN A;  4R7M A;  1ARL A;  2C6G A;  5K8P A;  1Q7L A;  3D7F A;  2ZEP A;  1DTD A;  1LFW A;  2C6C A;  3KAS A;  2PVV A;  3SI0 A;  2ZEE A;  4UEE A;  3NH4 A;  3PEI A;  4MHZ A;  3KZW A;  1DE4 C;  4MXU A;  3B3T A;  3LWU A;  3WC5 A;  3TC8 A;  1ZLH A;  1TF8 A;  3SJE A;  4P6Y A;  4PXC A;  3BXM A;  3KR4 A;  2C1C A;  3FJU A;  5K8M A;  3CPA A;  3IEH A;  1CBX A;  4W9Y A;  1FT7 A;  4F9V A;  2CTB A;  3PB4 X;  2JBK A;  4F8Z A;  4YU9 A;  3BHX A;  4IAV A;  1ELL P;  1Z2L A;  4WWV A;  2PJC A;  3D7H A;  1YSJ A;  1Y7E A;  4ZY0 A;  3JRU A;  4PQA A;  2QYV A;  3PRT A;  3S9L A;  2NYQ A;  2Q43 A;  2ZOG A;  3PB8 X;  4ZX8 A;  1QQ9 A;  2BOA A;  2PJ4 A;  5CBM A;  1VHE A;  1YW6 A;  3FVL A;  1EE3 P;  3DGV A;  1KWM A;  4YWY A;  4OME A;  5LRG A;  1OBR A;  3L2N A;  4UEZ A;  1RTQ A;  3KQZ A;  3RBU A;  3RAM A;  1TKJ A;  2BCO A;  5LRJ A;  1ZLI A;  2EK9 A;  5F09 A;  3B7I A;  2RB7 A;  2GU2 A;  4A37 A;  4OKO A;  4ONW A; 
#chains in the Genus database with same CATH topology
 4P44 A;  3FNC A;  2BSW A;  2O28 A;  2HB6 A;  3D7G A;  3HUV A;  2BL1 A;  3CXP A;  2Q0Y A;  1UFH A;  4YGO A;  1QSR A;  3D67 A;  2YND A;  2BEI A;  2ZOF A;  4CGO A;  3ISX A;  1R3N A;  2P6G A;  4PK3 A;  3VH9 A;  3QAH A;  1Z8L A;  4X8I A;  1F2P A;  4CS0 B;  5JM6 A;  3D7D A;  2WZN A;  4KOR A;  4A30 A;  2POK A;  2VEZ A;  5K8O A;  3LMS A;  1BAV A;  3PBB A;  4G1P A;  4KOY A;  2OB0 A;  4X3R A;  4B5O A;  2WSA A;  4CAF A;  1AUG A;  3EO4 A;  2B4D A;  1R43 A;  3FXT A;  4FD5 A;  1TKH A;  4WJB A;  5THW A;  3S6K A;  2ZEF A;  4I49 A;  4NXY A;  4MY3 A;  3QB8 A;  3R96 A;  2FIW A;  3FX6 A;  4KLW A;  3T8W A;  4GS4 A;  1TIQ A;  2VL1 A;  4FUU A;  2Q4Z A;  4E8O A;  1XBU A;  3A9L A;  3EFA A;  4L89 A;  3B8G A;  3TT2 A;  2PJ9 A;  4NGT A;  1S7N A;  1ON0 A;  3DR6 A;  1AYE A;  4B12 A;  2IMO A;  2PR8 A;  2REF A;  1IIC A;  3N5F A;  3LAC A;  4C7H A;  3QNV A;  3TO6 A;  3MN8 A;  2O53 A;  2GFQ A;  4HNX B;  1XIX A;  4QB9 A;  1NSA A;  6CPA A;  1F2O A;  4F9U A;  4FWU A;  4OC5 A;  4FD6 A;  1J4J A;  2Q04 A;  4XPK A;  4UWI A;  3ZJ0 A;  4B5P B;  1XF8 A;  3EXN A;  2F8H A;  1MJ9 A;  4K3N A;  4ZI6 A;  4CGL A;  2PIZ A;  4CYQ A;  4UFW A;  2PQ8 A;  1JQG A;  2B5G B;  2O4H A;  4U9Z A;  4UA3 A;  2YGW A;  1LAP A;  2R1I A;  5F47 A;  2Z3P A;  1NSL A;  3B35 A;  3GKR A;  2ZEM A;  4NJR A;  5J8C A;  2V8G A;  1YW4 A;  4UWJ A;  3SXO A;  3MRU A;  4M6H A;  5A28 A;  2QEC A;  5F46 A;  3TCV A;  3D8P A;  1IYK A;  2F5I A;  4P4B A;  2NSM A;  1XMB A;  4MCR A;  4JZ0 A;  4QBJ A;  4OID A;  3TTH A;  2ANP A;  4OAE A;  4JD6 A;  4TNU A;  2G3T A;  2PJ2 A;  3V8I A;  1UWY A;  3PP9 A;  3DR8 A;  2V8V A;  4KS9 A;  4Z65 A;  4ZX9 A;  4JXR A;  3W6X A;  4BBH A;  5J1Q A;  2ZEH A;  1VHO A;  1U6M A;  2GIV A;  5IB0 A;  1Q2D A;  4MCQ A;  3FBU A;  2AFW A;  2FSR A;  1M4G A;  8CPA A;  1GYT A;  3FYN A;  1LAN A;  4BD9 A;  3FMC A;  1YK3 A;  3HLP A;  4AVB A;  1ZO0 A;  1FNO A;  2P6E A;  4KVM E;  2AJ6 A;  1IYL A;  1S7K A;  4OC0 A;  2VBQ A;  4NGS A;  2PJA A;  2FL4 A;  5DWM A;  1YQE A;  1H8L A;  1Z4E A;  4KOV A;  2REE A;  2X7B A;  4O23 A;  4R6T A;  4BIN A;  2AFZ A;  5HVH A;  3S9N A;  2GRE A;  1XFO A;  1YVO A;  2DF5 A;  2ZEN A;  1S7L A;  4JJX A;  3F8K A;  4AG7 A;  4C7I A;  1Q2C A;  4EFD A;  5IV0 A;  3TO7 A;  3KKW A;  3W6S A;  2EUI A;  1KZF A;  1Y0Y A;  3V7Z A;  2VI7 A;  3GUX A;  4R57 A;  3R9G A;  3B3S A;  4XPL A;  4DNC A;  2FVG A;  1M4L A;  1S60 A;  3PB6 X;  3VWE A;  3BLN A;  5LYI A;  3BJ7 A;  1YGH A;  4ZY2 A;  1V0C A;  2WYR A;  3BI0 A;  4NCZ A;  2RFH A;  5JH9 A;  4F6A A;  1Y0R A;  5D8N A;  3B3W A;  4NGN A;  1IB1 E;  4MBU A;  3H8E A;  4YRH A;  4Y49 C;  2Q7B A;  4MFK A;  2I79 A;  4KSF A;  2PJ7 A;  2YNE A;  2RC4 A;  3IFE A;  1PU9 A;  2B3V A;  4OP4 A;  2G3A A;  4F0Y A;  2Z0Z A;  2ZEO A;  1YLO A;  3NA6 A;  4NGQ A;  3R9F A;  3R9E A;  3IIB A;  3S9M A;  1IOI A;  2Y0M A;  3RYO A;  1CP7 A;  5EMI A;  4R76 A;  1HDQ A;  2PJ1 A;  3TOA A;  1BPM A;  1YME A;  2AFO A;  1X12 A;  4B10 A;  2V8H A;  5AG7 A;  5H84 A;  4II9 A;  5I0C A;  3CXQ A;  2AFM A;  1CG2 A;  1LCP A;  2Q7S A;  4TWE A;  4AG9 A;  2PJB A;  5HH1 A;  3SJX A;  2B4B A;  3VAT A;  4AXV A;  5HVG A;  4KVX A;  4NGP A;  2C27 A;  3KHX A;  1P0H A;  3IWG A;  4YFJ A;  1QMU A;  3SI1 A;  3IJ3 A;  1Z9U A;  4UFX A;  3P2H A;  3GIU A;  4JYW A;  4JWP A;  1ELM P;  2JEV A;  2XEI A;  2EBJ A;  3D3S A;  4CGN A;  5KTC A;  4P4D A;  3KGQ A;  1PYT B;  2PR1 A;  4PXB A;  3WC6 A;  3D68 A;  4LUA A;  4FD4 A;  1Q2Y A;  3JVN A;  3B2Y A;  2IL4 A;  5FVJ A;  2Z3O A;  1Y9W A;  2QJ8 A;  3G8W A;  4UBR A;  3RNZ A;  3RZA A;  5DWN A;  2Z3M A;  2ZW6 A;  4MFZ A;  4MY0 A;  4MRI A;  3NH8 A;  4DYO A;  2FE7 A;  3WC7 A;  1QSO A;  4BMH A;  1CP6 A;  1LOK A;  4NEX A;  5IB9 A;  5C88 A;  2VZZ A;  4FAI A;  3PB9 X;  4P4F A;  2XEJ A;  4R87 A;  5C82 A;  2B3U A;  2VQY A;  2CNM A;  4E2A A;  1ARM A;  5D29 A;  4DUK A;  3D2M A;  4C68 A;  4OC4 A;  2HV2 A;  1ZG7 A;  2Q44 A;  3KI9 A;  4OC3 A;  4X5K A;  4PK2 A;  2PJ6 A;  4MJ8 A;  5BWA B;  1BOB A;  5KTD A;  4NGM A;  4XNH B;  4C2Y A;  2FT0 A;  3IU1 A;  2OH1 A;  2D4P A;  2IJZ A;  2PIY A;  3G3S A;  3NE7 A;  4MFQ A;  2JLM A;  4OIW A;  3VAR A;  5G20 A;  5CNP A;  3H8G A;  5H86 A;  4LQ6 A;  3S6F A;  2EK8 A;  2V8D A;  4CAV A;  4U9Y A;  4M3S A;  1Z4R A;  4MCS A;  2IQ6 A;  2R8V A;  3SJG A;  1I12 A;  5HVF A;  1HEE A;  3FF3 A;  3WAB A;  4K30 A;  4ZYQ A;  3C26 A;  2DPT A;  3B3C A;  2HUZ A;  5LYF A;  1CPS A;  2OZG A;  4MHP A;  4LQG A;  2EVN A;  4PXD A;  2CTC A;  3DNS A;  2OU2 A;  4UCM A;  2HC9 A;  3TX8 A;  4FD7 A;  3PFO A;  4EVY A;  2J8M A;  1PUA A;  1N71 A;  4H2K A;  2PE3 A;  1AMP A;  2VZY A;  3KR5 A;  3R1K A;  5LYD A;  3T9Y A;  2YNC C;  5JQ4 A;  3KQX A;  4A38 A;  5LRK A;  1QSN A;  2H5M A;  1S3Z A;  1IY7 A;  1RO5 A;  1M44 A;  3GB0 A;  4P4I A;  1HDU A;  1M4I A;  2CIJ A;  1VKC A;  2ZED A;  4ZY1 A;  7CPA A;  1B6B A;  2I00 A;  3DSB A;  5ELY A;  4P10 A;  3DLJ A;  4Y49 B;  4IUS A;  4A33 A;  4UIA A;  3PGP A;  1S5K A;  2PVW A;  4P4J A;  5EBV A;  2HQY A;  4IK2 A;  2J9A A;  4QC6 A;  4HNW B;  4R9M A;  1TF9 A;  4KSI A;  3D66 A;  4KVO E;  2YNC A;  2PJ0 A;  4OLL A;  1FY7 A;  3CPX A;  4A94 A;  4CAX A;  2OZH A;  2ZEG A;  5AGE A;  3FEC A;  3CDX A;  1GHE A;  4OC2 A;  4CPA A;  3EC4 A;  4NSQ A;  3WT4 A;  2CNT A;  3V38 A;  5GCN A;  2OOT A;  2DEA A;  3N7Z A;  4NGR A;  4EME A;  4KOU A;  1XOV A;  4KZT A;  1IGB A;  4R3L A;  2EWB A;  2CNS A;  4IHM A;  5JGF A;  1MJB A;  3PBE A;  4KUB A;  2QML A;  4NFR A;  4RI1 A;  2XEF A;  2PJ3 A;  2WUU A;  3MGD A;  1PCA A;  4B11 A;  2JDD A;  4RN7 A;  1VHS A;  1Z8W A;  3D2P A;  2I3C A;  4X2T A;  1XRY A;  3NH5 A;  4UEF A;  4UIB A;  1LAM A;  2P0W A;  4ZBG A;  2A4N A;  2G9D A;  3SI2 A;  3TE4 A;  4HPS A;  4B6Z A;  3FED A;  1NMT A;  1MK4 A;  4KSA A;  4A95 A;  2EO8 A;  4E0A A;  3CT9 A;  3PB7 X;  4Q38 A;  2PRQ A;  1VIX A;  2NMT A;  1BPN A;  3DDD A;  3JUW A;  1BLL E;  2QVP A;  3BI1 A;  3QAY A;  4ONU A;  1ZG9 A;  3SXN A;  3WR7 A;  5HXD A;  4FBE A;  3IU2 A;  5G21 A;  4L8A A;  2J8N A;  2QIR A;  3F5B A;  4KOS A;  3D4U A;  4P4E A;  4C2Z A;  2Z10 A;  2Z3N A;  4Q7A A;  2GLF A;  2K5T A;  2PSW A;  3H4Q A;  5AG6 A;  4F0X A;  5LYL A;  2ABZ A;  3LOD A;  3K2K A;  5AG5 A;  2OR4 A;  3NFZ A;  4MFL A;  1X10 A;  3B3V A;  5K8N A;  4MCP A;  1Y7R A;  2PJ5 A;  3IO1 A;  1ZG8 A;  2PJ8 A;  3FH4 A;  1B87 A;  2V77 A;  3F0A A;  2CF4 A;  4CRZ B;  1Z5R A;  5E96 A;  2ZW4 A;  4DJL A;  2PCU A;  2B5G A;  2ARH A;  4HKF A;  5CPA A;  2CXA A;  1L0C A;  2XEG A;  2Z3L A;  4UF4 A;  2FXF A;  3NE8 A;  4PSX A;  1XE4 A;  3K9T A;  4GM5 A;  3S6G A;  3W91 A;  5JPH A;  3RO0 A;  5J8F A;  1XJO A;  4KUA A;  3I3G A;  3KL9 A;  4MMO A;  4ZGY B;  1A2Z A;  4EWT A;  5DS0 A;  4A39 A;  2JEW A;  1TKF A;  1CPX A;  2AFS A;  2C6P A;  2ZW7 A;  2BO9 A;  1VGY A;  2Q51 A;  1BO4 A;  1TXR A;  3GYA A;  4ONW A;  5I4M A;  4U5Y A;  5F48 A;  4XPD C;  1F57 A;  2Z3K A;  3FEE A;  1YX0 A;  2PDO A;  4RUH A;  3PFE A;  1CX8 A;  4PSW A;  4CYP A;  2GLJ A;  2P6F A;  2JDC A;  3KHZ A;  4P45 A;  1YRE A;  3ISZ A;  4LX9 A;  4OC1 A;  3H8F A;  5KTA A;  2JBJ A;  3CZX A;  2DPS A;  1QST A;  4NJQ A;  4PV6 A;  2CY2 A;  2WPX A;  3IWW A;  5F49 A;  4A2Z A;  3I1U A;  1CJW A;  4R3K A;  2ZW5 A;  4H6U A;  4KOW A;  4B5P A;  3R95 A;  3ZZI A;  2Z11 A;  4R8F A;  5EC4 A;  4M6G A;  5ISV A;  3SJF A;  2AFU A;  2ODF A;  1P4N A;  3GLJ A;  1XMT A;  4PXE A;  4ORF A;  1KUY A;  4MHY A;  1Z8T A;  1Y9K A;  2GAN A;  4QUS A;  2AFX A;  3TFY A;  2PRB A;  2FCK A;  4CYN A;  3IC1 A;  2VXK A;  1OZP A;  1KUX A;  2F7V A;  4JLY A;  4PPZ A;  4KLV A;  4MHN A;  4R7M A;  3BJ8 A;  1ARL A;  2C6G A;  1WK4 A;  4M85 A;  5K8P A;  1Q7L A;  3D7F A;  2ZEP A;  1DTD A;  1LFW A;  2B58 A;  2C6C A;  3K9U A;  3KAS A;  5HMN A;  1SQH A;  2PVV A;  1IID A;  3SI0 A;  2KCW A;  3TOB A;  2FS5 A;  2ZEE A;  4UEE A;  3H5Z A;  3NH4 A;  3PEI A;  4HNY B;  4MHZ A;  3KZW A;  1DE4 C;  4MXU A;  3B3T A;  3LWU A;  4QVT A;  4KOT A;  4CGP A;  1RXT A;  4UCP A;  2ZXV A;  1YLE A;  3IWE A;  3WC5 A;  4CAW A;  1JWQ A;  3TC8 A;  4OAD A;  4CRY B;  1ZLH A;  1TF8 A;  4M6I A;  3SJE A;  1QSM A;  4AVA A;  4CYO A;  1CM0 A;  4P6Y A;  4UFV A;  4PXC A;  3BXM A;  3KR4 A;  1XEB A;  1M4D A;  2C1C A;  3P2F A;  3FJU A;  4B14 A;  1MJA A;  4MHD A;  2DXQ A;  2ZPA A;  2G0B A;  3CPA A;  3IEH A;  1CBX A;  3LD2 A;  3UY5 A;  5K8M A;  4W9Y A;  1FT7 A;  2D4O A;  3FIX A;  1M1D A;  4AVC A;  4KOX A;  4F9V A;  2J8R A;  3IGR A;  4C2X A;  1I21 A;  2CTB A;  3PB4 X;  2WPW A;  1KUV A;  2JBK A;  4F8Z A;  4B13 A;  1LRZ A;  4YU9 A;  3S6H A;  3BHX A;  4IAV A;  4XPD B;  1ELL P;  1Z2L A;  4MFP A;  4WWV A;  2AE6 A;  2BUE A;  2PJC A;  4H89 A;  3D7H A;  1YSJ A;  4H6Z A;  2GE3 A;  4RS2 A;  5G22 A;  1Y7E A;  1S7F A;  4ZY0 A;  1R57 A;  1K4J A;  1WWZ A;  2QYV A;  3JRU A;  4PQA A;  4A32 A;  2R98 A;  4XNH C;  4GXH A;  4CAE A;  3PRT A;  3S9L A;  4NF1 A;  2NYQ A;  2Q43 A;  2ZOG A;  3I9S A;  3JTK A;  3OWC A;  3PB8 X;  4ZX8 A;  1QQ9 A;  1IOF A;  2ATR A;  2BOA A;  2PJ4 A;  5CBM A;  2PC1 A;  1VHE A;  1YR0 A;  1YW6 A;  3SHP A;  2Q4V A;  3FVL A;  3FB3 A;  3E0K A;  1I1D A;  4OKO A;  1EE3 P;  1NE9 A;  4IF5 A;  3EY5 A;  4JXQ A;  3FRM A;  4AB7 A;  5AG4 A;  2Q4Y A;  4MI4 A;  1IU8 A;  3DGV A;  1KWM A;  4YWY A;  4J3G A;  3PZJ A;  4OME A;  5LRG A;  3TO9 A;  1OBR A;  3T90 A;  3L2N A;  3CXS A;  3GY9 A;  4UEZ A;  2R7H A;  5IX3 A;  1RTQ A;  3KQZ A;  3RBU A;  3RAM A;  4Q36 A;  4UCN A;  1TKJ A;  1Z8X A;  5A27 A;  2BCO A;  5LRJ A;  1ZLI A;  2B4D B;  2EK9 A;  5F09 A;  1YVK A;  3VWD A;  2OZU A;  3B7I A;  4MFJ A;  4CGM A;  2RB7 A;  2GU2 A;  4A37 A;  5G1Z A;  2ZEL A;  2FIA A;  4A31 A; 
#chains in the Genus database with same CATH homology
 4P44 A;  3D7G A;  2HB6 A;  3HUV A;  3D67 A;  2ZOF A;  3ISX A;  1R3N A;  3VH9 A;  4X8I A;  1Z8L A;  1F2P A;  5JM6 A;  3D7D A;  2WZN A;  2POK A;  5K8O A;  3LMS A;  1BAV A;  3PBB A;  4G1P A;  4X3R A;  1R43 A;  4WJB A;  1TKH A;  5THW A;  2ZEF A;  3T8W A;  3FX6 A;  2VL1 A;  4FUU A;  2Q4Z A;  1XBU A;  2PJ9 A;  4NGT A;  1AYE A;  2IMO A;  3N5F A;  3QNV A;  3MN8 A;  2O53 A;  1NSA A;  6CPA A;  1F2O A;  4F9U A;  4FWU A;  4OC5 A;  2F8H A;  4K3N A;  4ZI6 A;  2PIZ A;  1JQG A;  2O4H A;  1LAP A;  3B35 A;  2ZEM A;  4NJR A;  2V8G A;  1YW4 A;  3MRU A;  4P4B A;  2NSM A;  1XMB A;  4MCR A;  4JZ0 A;  4OID A;  2ANP A;  4TNU A;  2PJ2 A;  1UWY A;  2V8V A;  4Z65 A;  4ZX9 A;  5J1Q A;  2ZEH A;  1VHO A;  4MCQ A;  2AFW A;  8CPA A;  1GYT A;  1LAN A;  4BD9 A;  3FMC A;  3HLP A;  1FNO A;  4OC0 A;  4NGS A;  2PJA A;  1H8L A;  4O23 A;  4R6T A;  5HVH A;  2AFZ A;  3S9N A;  2GRE A;  1XFO A;  2ZEN A;  4EFD A;  3V7Z A;  1Y0Y A;  3GUX A;  3B3S A;  2FVG A;  1M4L A;  3PB6 X;  5LYI A;  4ZY2 A;  2WYR A;  3BI0 A;  5JH9 A;  2RFH A;  1Y0R A;  5D8N A;  3B3W A;  4NGN A;  3H8E A;  2PJ7 A;  3IFE A;  4OP4 A;  2ZEO A;  3NA6 A;  1YLO A;  4NGQ A;  5HXD A;  3IIB A;  3S9M A;  1CP7 A;  4R76 A;  1HDQ A;  2PJ1 A;  1BPM A;  1YME A;  2AFO A;  2V8H A;  2AFM A;  1CG2 A;  1LCP A;  4TWE A;  2PJB A;  3SJX A;  3VAT A;  4AXV A;  5HVG A;  4NGP A;  3KHX A;  1QMU A;  3SI1 A;  3IJ3 A;  4JYW A;  1ELM P;  2XEI A;  4P4D A;  3KGQ A;  1PYT B;  4PXB A;  3WC6 A;  3D68 A;  3B2Y A;  2QJ8 A;  3RZA A;  4MRI A;  3NH8 A;  4DYO A;  3WC7 A;  5IB9 A;  1CP6 A;  1LOK A;  4FAI A;  3PB9 X;  4P4F A;  2XEJ A;  1ARM A;  5D29 A;  4DUK A;  4OC4 A;  1ZG7 A;  3KI9 A;  4OC3 A;  2PJ6 A;  4NGM A;  2ZEL A;  2IJZ A;  2PIY A;  3VAR A;  4OIW A;  3H8G A;  2EK8 A;  2V8D A;  4MCS A;  2IQ6 A;  3SJG A;  5HVF A;  1HEE A;  3FF3 A;  3WAB A;  4ZYQ A;  3B3C A;  5LYF A;  1CPS A;  4MHP A;  4LQG A;  4PXD A;  2CTC A;  2HC9 A;  3TX8 A;  3PFO A;  4H2K A;  2PE3 A;  1AMP A;  3KR5 A;  5LYD A;  3KQX A;  4A38 A;  5LRK A;  1IY7 A;  3GB0 A;  4P4I A;  1HDU A;  2CIJ A;  2ZED A;  4ZY1 A;  7CPA A;  5ELY A;  4P10 A;  3DLJ A;  4UIA A;  4P4J A;  2PVW A;  4IK2 A;  2J9A A;  1TF9 A;  4KSI A;  3D66 A;  2PJ0 A;  3CPX A;  4A94 A;  2ZEG A;  3FEC A;  3CDX A;  4OC2 A;  4CPA A;  3WT4 A;  3V38 A;  2OOT A;  2DEA A;  4NGR A;  4EME A;  1IGB A;  2EWB A;  4IHM A;  5JGF A;  3PBE A;  4NFR A;  2XEF A;  2PJ3 A;  1PCA A;  4X2T A;  2I3C A;  1XRY A;  3NH5 A;  4UEF A;  4UIB A;  1LAM A;  2G9D A;  3SI2 A;  4B6Z A;  3FED A;  3CT9 A;  3PB7 X;  2PRQ A;  1VIX A;  1BPN A;  1BLL E;  2QVP A;  3BI1 A;  1ZG9 A;  4FBE A;  3D4U A;  4P4E A;  4Q7A A;  2GLF A;  5LYL A;  2ABZ A;  3K2K A;  2OR4 A;  3NFZ A;  3B3V A;  5K8N A;  4MCP A;  2PJ5 A;  3IO1 A;  1ZG8 A;  2PJ8 A;  3FH4 A;  2V77 A;  2CF4 A;  1Z5R A;  4DJL A;  2PCU A;  5CPA A;  4UF4 A;  2XEG A;  3K9T A;  4GM5 A;  1XJO A;  4MMO A;  3KL9 A;  4EWT A;  5DS0 A;  4A39 A;  2JEW A;  1TKF A;  1CPX A;  2AFS A;  2C6P A;  2BO9 A;  1VGY A;  2Q51 A;  1TXR A;  5I4M A;  1F57 A;  3FEE A;  4RUH A;  3PFE A;  1CX8 A;  2GLJ A;  3KHZ A;  4P45 A;  3ISZ A;  4OC1 A;  3H8F A;  2JBJ A;  4NJQ A;  3IWW A;  3I1U A;  4R8F A;  3SJF A;  2AFU A;  3GLJ A;  4PXE A;  4MHY A;  2AFX A;  3IC1 A;  2F7V A;  4PPZ A;  4MHN A;  4R7M A;  1ARL A;  2C6G A;  5K8P A;  1Q7L A;  3D7F A;  2ZEP A;  1DTD A;  1LFW A;  2C6C A;  3KAS A;  2PVV A;  3SI0 A;  2ZEE A;  4UEE A;  3NH4 A;  3PEI A;  4MHZ A;  3KZW A;  1DE4 C;  4MXU A;  3B3T A;  3LWU A;  3WC5 A;  3TC8 A;  1ZLH A;  1TF8 A;  3SJE A;  4P6Y A;  4PXC A;  3BXM A;  3KR4 A;  2C1C A;  3FJU A;  5K8M A;  3CPA A;  3IEH A;  1CBX A;  4W9Y A;  1FT7 A;  4F9V A;  2CTB A;  3PB4 X;  2JBK A;  4F8Z A;  4YU9 A;  3BHX A;  4IAV A;  1ELL P;  1Z2L A;  4WWV A;  2PJC A;  3D7H A;  1YSJ A;  1Y7E A;  4ZY0 A;  3JRU A;  4PQA A;  2QYV A;  3PRT A;  3S9L A;  2NYQ A;  2Q43 A;  2ZOG A;  3PB8 X;  4ZX8 A;  1QQ9 A;  2BOA A;  2PJ4 A;  5CBM A;  1VHE A;  1YW6 A;  3FVL A;  1EE3 P;  3DGV A;  1KWM A;  4YWY A;  4OME A;  5LRG A;  1OBR A;  3L2N A;  4UEZ A;  1RTQ A;  3KQZ A;  3RBU A;  3RAM A;  1TKJ A;  2BCO A;  5LRJ A;  1ZLI A;  2EK9 A;  5F09 A;  3B7I A;  2RB7 A;  2GU2 A;  4A37 A;  4OKO A;  4ONW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...