3FNCA

Crystal structure of a putative acetyltransferase from listeria innocua
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
160
structure length
160
Chain Sequence
b'MDFHIRKATNSDAEAIQHVATTSWHHTYQDLIPSDVQDDFLKRFYNVETLHNRISATPFAVLEQADKVIGFANFIELEKGKSELAAFYLLPEVTQRGLGTELLEVGMTLFHVPLPMFVNVEKGNETAIHFYKAKGFVQVEEFTEDFYGYPLETIRFNLNH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative acetyltransferase
publication title The structure of a putative acetyltransferase from Listeria innocua.
rcsb
source organism Listeria innocua
molecule tags Transferase
total genus 47
structure length 160
sequence length 160
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-12-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13673 Acetyltransf_10 Acetyltransferase (GNAT) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 3fncA00
2B4BA 4U5YA 4XNHB 1Q2YA 2VEZA 5IB0A 4AVBA 3F5BA 5EBVA 1UFHA 2PRBA 2JLMA 2J8NA 3B8GA 4NF1A 3R96A 4KOTA 3I3GA 1Y9KA 3QB8A 4X5KA 3S6HA 2ZXVA 4RS2A 3FXTA 5C88A 1KUXA 2CNMA 1YVOA 4KORA 2OZHA 2VZZA 1XMTA 2Z11A 3W6XA 2PDOA 1N71A 3EFAA 3S6FA 1XEBA 2VZYA 2Y0MA 1NSLA 4I49A 2R1IA 1BO4A 4MBUA 3GYAA 1KUYA 3E0KA 1KUVA 1KZFA 4KOWA 3BJ7A 3T9YA 1CJWA 3CXSA 5JPHA 2PR8A 1MJBA 5E96A 2Q7BA 2P0WA 4LUAA 5IX3A 1Z4EA 4KZTA 5HMNA 3TE4A 2JDCA 3QAHA 3TTHA 3D3SA 1RO5A 2B58A 3FRMA 4R3LA 2AJ6A 4E0AA 2CNTA 4XPDC 1YVKA 1P0HA 2REFA 3DDDA 4CAWA 3R1KA 3FB3A 1BOBA 1L0CA 1MJAA 4MY3A 4QUSA 4HNWB 3PZJA 4AVAA 2Q4YA 4JJXA 3CXPA 3TO6A 4UWIA 3SXOA 3H4QA 4CAVA 2B4DA 2B3VA 4R3KA 5DWNA 4IUSA 2FT0A 4RI1A 2O28A 4MJ8A 2ZW6A 1PU9A 1I1DA 1M4DA 2QIRA 3BJ8A 2NMTA 1ON0A 4PK3A 1XIXA 3V8IA 4JWPA 3DR8A 4M85A 3FNCA 4Y49B 4AG9A 4II9A 3IGRA 2A4NA 5GCNA 4KOVA 3WR7A 1S7FA 4KOYA 1V0CA 2Q0YA 4YFJA 5KTDA 4E8OA 1S60A 2P6GA 4U9YA 5KTAA 3G3SA 4QC6A 2OH1A 2PR1A 1M1DA 3FYNA 4BMHA 1IYLA 4MI4A 3R9EA 1YREA 2D4PA 2HV2A 3VWDA 2PQ8A 2OB0A 4XNHC 1M4GA 3R95A 4E2AA 3P2HA 4HNYB 3PGPA 2FE7A 4NEXA 1VKCA 2VI7A 3EXNA 5IV0A 2HUZA 4F0YA 2BSWA 4PV6A 2G0BA 2FS5A 4PSXA 3G8WA 4B5OA 2CY2A 3D2MA 1B6BA 5DWMA 1NMTA 2I00A 4NCZA 3IWGA 5H84A 4DNCA 1U6MA 2JDDA 2R7HA 2X7BA 1R57A 4PSWA 4AVCA 2FIAA 4FD5A 1XF8A 3OWCA 2EUIA 2P6EA 1QSMA 1I21A 4XPKA 2F5IA 4AB7A 4HNXB 2OZGA 5F49A 3JUWA 4KLWA 4QBJA 2G3AA 5F46A 1M44A 4H89A 3LODA 1WK4A 3DNSA 1Y7RA 3W6SA 2REEA 2GIVA 3C26A 2BUEA 3MGDA 1FY7A 1MJ9A 2AE6A 1IB1E 2BEIA 4KVOE 2JEVA 5ISVA 3ZZIA 4B5PA 3VWEA 2I79A 4J3GA 3S6GA 4KVXA 4CRZB 5F48A 1XE4A 2OU2A 4L8AA 1VHSA 2IL4A 2FXFA 1S3ZA 4KOUA 5EC4A 4R87A 5C82A 4CS0B 1OZPA 1NE9A 3W91A 4KLVA 1SQHA 1YGHA 1S5KA 4YGOA 4Y49C 4CRYB 3EC4A 2Q4VA 2GE3A 4B5PB 4JXQA 4NSQA 2HQYA 3I9SA 1QSRA 2PC1A 2WPXA 4MY0A 3SXNA 2B3UA 4UWJA 2OZUA 5KTCA 1TIQA 4HKFA 2ZW7A 3TFYA 2J8RA 1YLEA 3D8PA 2KCWA 3GKRA 2FCKA 4OAEA 4KOXA 3R9GA 4FD4A 5J8FA 1Q2CA 1Z4RA 2FL4A 1WWZA 3LD2A 1S7NA 3NE7A 4JD6A 3JVNA 2PSWA 1B87A 1GHEA 4U9ZA 1S7LA 5JQ4A 3GY9A 1CM0A 4KUBA 1IICA 3EY5A 3FBUA 2ATRA 5I0CA 3TOBA 3TOAA 2C27A 1LRZA 2P6FA 4QB9A 4CAXA 3ZJ0A 4FD7A 2RC4A 1S7KA 1PUAA 2Z0ZA 4UA3A 2D4OA 4ORFA 4JLYA 4R57A 1QSOA 2B5GA 5F47A 4XPLA 1I12A 3F0AA 2J8MA 2CNSA 2K5TA 2DXQA 2Q44A 1K4JA 1IIDA 3S6KA 1QSNA 2GANA 2EVNA 4L89A 4NXYA 4XPDB 4JXRA 4KOSA 2QECA 3TCVA 1Y9WA 1YX0A 4QVTA 1J4JA 2H5MA 4GS4A 3K9UA 5CNPA 2ARHA 3FIXA 4PK2A 2G3TA 2FSRA 4ONUA 5J8CA 1YR0A 1Q2DA 1MK4A 1Z9UA 3SHPA 2B5GB 4KVME 3DSBA 1RXTA 3PP9A 3TO7A 1M4IA 3EO4A 1YK3A 2R98A 4KUAA 4OLLA 2Z10A 5H86A 4OADA 4LX9A 2ZW4A 2VQYA 3D2PA 4ZBGA 4UBRA 2VBQA 3TO9A 2VXKA 3N7ZA 3CXQA 3R9FA 2BL1A 2Q04A 2FIWA 5FVJA 4M3SA 3UY5A 3TT2A 3P2FA 4AG7A 1IYKA 1QSTA 4MHDA 3T90A 5HH1A 3RYOA 4EVYA 2QMLA 4H6ZA 4IF5A 3DR6A 4YRHA 1P4NA 4FD6A 4F6AA 4H6UA 2ZPAA 3F8KA 3KKWA 3BLNA 2WPWA 2ZW5A 2R8VA 2B4DB 4R9MA 4K30A
chains in the Genus database with same CATH superfamily
2B4BA 4NGRA 4U5YA 2YNCC 3WC6A 1F2OA 4MXUA 1FNOA 1BLLE 4XNHB 4ZY1A 4MFZA 1JWQA 1Q2YA 2VEZA 5IB0A 1IU8A 3WC7A 4AVBA 4UIBA 3BHXA 3F5BA 4C7HA 5EBVA 1UFHA 2PRBA 3HUVA 2JLMA 3H8GA 2J8NA 1AMPA 3B8GA 3QAYA 4NF1A 3SJEA 1ARLA 3R96A 5LRJA 4KOTA 3VH9A 1ZG8A 3I3GA 1Y9KA 3QB8A 4X5KA 4FUUA 3S6HA 2ZXVA 1R3NA 2ANPA 3WT4A 4RS2A 4JYWA 3FXTA 3PB4X 4CGPA 1KUXA 5C88A 2CNMA 5AG6A 1YVOA 2C1CA 4KORA 2BO9A 4UCMA 2OZHA 2VZZA 1XMTA 2Z11A 2ZEEA 3W6XA 4C2YA 2PDOA 1N71A 3EFAA 3FECA 4ZGYB 3S6FA 5JGFA 4R6TA 3RO0A 1XEBA 5CPAA 4F9UA 2VZYA 2Y0MA 3PEIA 1NSLA 4I49A 1CG2A 2R1IA 8CPAA 1CX8A 3I1UA 2QJ8A 3KZWA 1BO4A 1F57A 4C2XA 4MBUA 4ZYQA 3GYAA 1KUYA 2FVGA 3E0KA 1KUVA 1KZFA 2C6PA 4KOWA 3IU1A 1X12A 5J1QA 3H8FA 2PJ0A 1Z2LA 2PJ2A 1HDQA 4CYNA 3PB7X 2GU2A 1YLOA 3BJ7A 3T9YA 1CJWA 3CXSA 4B11A 4YU9A 5JPHA 1YQEA 2PR8A 1MJBA 5E96A 2ZOFA 2Z3PA 1QQ9A 2Q7BA 4A95A 2P0WA 2C6GA 4LUAA 1LANA 4NGPA 4YWYA 4CAEA 2BOAA 2CTCA 1Z8TA 5IX3A 1VHOA 1Z4EA 2PRQA 4KZTA 4B12A 5HMNA 3TE4A 2JDCA 2PJAA 3QAHA 4P6YA 1NSAA 3PB9X 3TTHA 3D3SA 1RO5A 2ABZA 1X10A 2B58A 3FRMA 4MCSA 2PVWA 5G22A 4R3LA 2AJ6A 4E0AA 2CNTA 4UIAA 4XPDC 1YVKA 1M4LA 4IAVA 2ZELA 1TKFA 1P0HA 2V8VA 2REFA 3DDDA 4CAWA 3R1KA 4FWUA 5AGEA 1PCAA 3FB3A 4P4EA 3QNVA 1BOBA 1L0CA 1MJAA 4MY3A 3CPXA 4AXVA 5D29A 5BWAB 2PJ8A 4QUSA 4PXDA 4A94A 5G21A 4HNWB 5A28A 4BBHA 2AFSA 3GUXA 4R9MA 2PIZA 3PZJA 4OP4A 4AVAA 2Q4YA 1CPXA 4JJXA 5LYIA 3CXPA 4NJQA 2GREA 3IIBA 4ONWA 3TO6A 4UWIA 3SXOA 3H4QA 4CAVA 2B4DA 2B3VA 4A39A 1IGBA 3IEHA 4R3KA 2Q4ZA 3FEDA 1LCPA 1IOIA 2PE3A 3BI1A 2BCOA 3B7IA 2C6CA 3KQXA 3MRUA 4IUSA 4K3NA 5DWNA 4EFDA 2V77A 4M6HA 2FT0A 2PJBA 3DLJA 4RI1A 2O28A 4MJ8A 4MCQA 2ZW6A 1PU9A 1I1DA 1M4DA 2QIRA 1XRYA 3BJ8A 2DF5A 3TC8A 1Z5RA 3H8EA 3RNZA 3D7GA 4FBEA 2NMTA 1ON0A 4MHYA 4PPZA 3S9NA 4PK3A 1XIXA 4MFQA 3V8IA 5LRKA 3KGQA 4JWPA 4G1PA 3DR8A 4PQAA 4IK2A 4DYOA 4ZI6A 4M85A 3KQZA 3FNCA 4Y49B 4AG9A 4II9A 4KSIA 4GM5A 2WYRA 3IGRA 3S9MA 2A4NA 2NYQA 1XMBA 5GCNA 4MFJA 4KOVA 4Q7AA 2PJ7A 1S7FA 4OIDA 4WJBA 3WR7A 4KOYA 4F8ZA 1Z8LA 1V0CA 2Q0YA 4ZY2A 4YFJA 5KTDA 4E8OA 1S60A 2P6GA 3B35A 4C2ZA 4MHNA 4F0XA 4U9YA 3B3WA 3K9TA 5EMIA 5KTAA 2EK9A 1VHEA 3G3SA 4GXHA 2ZEHA 1ZG9A 2DPTA 2OH1A 2PR1A 1M1DA 4P4DA 4QC6A 1XJOA 3FYNA 4TWEA 5G20A 3PBBA 3GB0A 4BMHA 2EK8A 4FAIA 2IMOA 1IYLA 4MI4A 2PJCA 4ZX9A 3R9EA 1YREA 2ZEMA 4P10A 3JTKA 2D4PA 2HV2A 3NH4A 3VWDA 2PQ8A 3MN8A 2OB0A 3WABA 2I3CA 4XNHC 1M4GA 3PB8X 3R95A 4E2AA 3P2HA 3A9LA 1HDUA 4NGSA 4HNYB 2XEJA 3PGPA 2FE7A 2PCUA 4NEXA 2JEWA 1VKCA 1ZO0A 2VI7A 3EXNA 2PJ6A 5IV0A 2J9AA 2HUZA 3CDXA 4F0YA 2BSWA 2Z3MA 2CIJA 3B3VA 1VGYA 4PV6A 5HVGA 4CGNA 4H2KA 2G0BA 1PYTB 3NH8A 4MFLA 1AYEA 2FS5A 3KHZA 4PSXA 1LFWA 3G8WA 4CGMA 5K8PA 4B5OA 1TF8A 2CY2A 5ELYA 3KI9A 1Q7LA 1B6BA 3D2MA 4OMEA 3SI2A 4Q36A 3T8WA 5DWMA 2WZNA 1NMTA 3IC1A 2I00A 4NCZA 4A38A 4B14A 3IWGA 5H84A 4DNCA 1U6MA 3IFEA 3VATA 2JDDA 4A37A 2R7HA 4HPSA 1TXRA 1R57A 2Q51A 2X7BA 4MCRA 4PSWA 4IHMA 4TNUA 4CGLA 5F09A 2Z3NA 4AVCA 2FIAA 4FD5A 2Q43A 4A33A 1XF8A 3OWCA 4JZ0A 2F8HA 1R43A 3D7FA 5K8NA 2EUIA 4B10A 2PJ9A 4CAFA 4X2TA 2V8GA 2P6EA 1QSMA 1I21A 3KR5A 4NGNA 4XPKA 1IOFA 3KASA 1H8LA 2F5IA 4CYPA 2EBJA 2CXAA 4HNXB 4AB7A 2OZGA 2QYVA 1CBXA 1CP7A 4CYQA 3CPAA 5F49A 1TF9A 3FVLA 4Q38A 3JUWA 4KLWA 4QBJA 1DTDA 2G3AA 1RTQA 2ZENA 1M44A 4RUHA 5F46A 1LAPA 2JBJA 2DEAA 3NH5A 3PB6X 4H89A 3SJXA 2Z3LA 3LODA 1WK4A 2EO8A 2XEIA 4OC5A 3DNSA 1Y7RA 3W6SA 2REEA 2GIVA 3C26A 2BUEA 3MGDA 4KS9A 4P4IA 4CYOA 1FY7A 1MJ9A 2AE6A 1IB1E 3GIUA 2BEIA 4KVOE 2JEVA 5ISVA 5HXDA 3LMSA 6CPAA 3ZZIA 1GYTA 3D66A 1KWMA 4B5PA 3VWEA 3NE8A 2I79A 4J3GA 4P4JA 5THWA 3TX8A 3RBUA 3S6GA 5K8MA 4KVXA 3VARA 4OC3A 2YNCA 3KHXA 5F48A 4CRZB 5A27A 3PFEA 3D4UA 4P45A 2F7VA 1XE4A 2HB6A 2OU2A 4L8AA 1VHSA 4OC4A 2XEGA 3RZAA 2IL4A 5LRGA 2FXFA 4OC1A 3PBEA 1S3ZA 4KOUA 1Y7EA 2AFUA 4R87A 5EC4A 5C82A 5LYFA 2Q7SA 4ZX8A 1OZPA 1NE9A 4CGOA 4CS0B 3W91A 4UEFA 1OBRA 2PIYA 2ZEPA 1CP6A 4KLVA 2OOTA 1SQHA 1YGHA 1UWYA 1S5KA 4YGOA 2AFOA 2PJ4A 3KL9A 1Z8XA 3LACA 4Y49C 4KSAA 4CRYB 3EC4A 2EWBA 2NSMA 2Q4VA 4MFPA 4LQ6A 2GE3A 2AFWA 2POKA 3KR4A 4O23A 4P4BA 4B5PB 1BAVA 4JXQA 4UCPA 2HC9A 4NSQA 4EMEA 2HQYA 3I9SA 1QSRA 2PC1A 2PJ3A 2WPXA 1BPMA 4MY0A 1IY7A 4R7MA 3SXNA 4NGTA 2B3UA 1F2PA 1XBUA 3K2KA 2YGWA 3BI0A 4UWJA 2OZUA 4WWVA 4X3RA 5I4MA 5KTCA 2PJ1A 1TIQA 5HVFA 4HKFA 2ZW7A 3TFYA 5AG5A 3LWUA 1LOKA 2J8RA 5DS0A 1LAMA 3IWWA 1YLEA 3D8PA 4M6IA 1QMUA 1ZG7A 2KCWA 3GKRA 4A30A 2JBKA 5LYLA 1DE4C 2FCKA 3N5FA 2AFZA 4DJLA 4UEZA 4C68A 4OAEA 4UFXA 4UCNA 5D8NA 2Z3OA 4KOXA 3SJGA 3PFOA 4P4FA 3R9GA 2DPSA 4FD4A 4M6GA 2GLFA 1TKJA 5J8FA 4LQGA 4P44A 1Q2CA 1Z4RA 2FL4A 1WWZA 4B13A 3LD2A 4W9YA 4UF4A 1S7NA 3NE7A 4BINA 4JD6A 3JVNA 3CZXA 2PSWA 4A32A 1B87A 1GHEA 2QVPA 1S7LA 3B3TA 4U9ZA 5JQ4A 1XOVA 3GY9A 1CM0A 1CPSA 4R76A 4KUBA 2OR4A 1IICA 2O53A 2RB7A 3EY5A 3FBUA 4MRIA 7CPAA 5JM6A 3D68A 2ZOGA 2IQ6A 2VL1A 4OIWA 5AG4A 2ATRA 5I0CA 3TOBA 3TOAA 1Z8WA 2WUUA 3FF3A 2C27A 1LRZA 3SJFA 2P6FA 4QB9A 5LYDA 4CAXA 3ZJ0A 3JRUA 1Y0YA 2RC4A 4FD7A 4NFRA 1S7KA 4OC2A 1PUAA 2Z0ZA 3SI1A 4R8FA 2G9DA 1JQGA 4UA3A 2D4OA 1HEEA 4ORFA 4MMOA 4JLYA 3FX6A 4R57A 3ISZA 1QSOA 3S9LA 2RFHA 2B5GA 5F47A 4XPLA 2CTBA 1I12A 1Y0RA 4PXBA 2Z3KA 3F0AA 3GLJA 3HLPA 2J8MA 2CNSA 4UEEA 3V38A 2V8HA 2K5TA 2DXQA 2Q44A 1K4JA 1ARMA 5HVHA 5IB9A 1AUGA 1ZLHA 1IIDA 3S6KA 1QSNA 2GANA 2EVNA 4L89A 4NXYA 5G1ZA 4XPDB 1ELMP 4JXRA 4KOSA 2QECA 3TCVA 1Y9WA 4C7IA 4ZY0A 2AFXA 4BD9A 1YX0A 3B3CA 2YNEA 4A2ZA 4KSFA 4MHPA 1YSJA 4QVTA 2ZEDA 1J4JA 2H5MA 2ZEOA 3FMCA 2XEFA 4GS4A 3K9UA 5CNPA 3D7HA 2ARHA 3IWEA 1A2ZA 3PRTA 4PXCA 3FIXA 4PK2A 4B6ZA 1ZLIA 1YW6A 4DUKA 2G3TA 2FSRA 2ZEFA 4ONUA 3B3SA 5J8CA 1EE3P 1YR0A 4EWTA 1Q2DA 1MK4A 1Z9UA 4MCPA 4Z65A 3RAMA 4MFKA 4OKOA 2PVVA 3D67A 3SHPA 4MHZA 2B5GB 3BXMA 4KVME 1YW4A 3DSBA 1RXTA 2GLJA 3PP9A 3TO7A 4UFWA 4CPAA 3WC5A 1M4IA 1XFOA 3B2YA 2GFQA 3FJUA 5AG7A 3EO4A 1YK3A 2R98A 3NFZA 4KUAA 2Z10A 1YMEA 3FEEA 3ISXA 2O4HA 4LX9A 2PJ5A 4OADA 5H86A 2ZW4A 2VQYA 3D2PA 4ZBGA 4UBRA 2VBQA 3TO9A 2VXKA 3N7ZA 3CXQA 2CF4A 3R9FA 4OLLA 5K8OA 3FH4A 2BL1A 2WSAA 4PXEA 4RN7A 1TKHA 2YNDA 2Q04A 4OC0A 4NGMA 4F9VA 3V7ZA 2FIWA 2IJZA 5FVJA 4M3SA 2ODFA 1FT7A 4UFVA 3NA6A 3UY5A 5JH9A 3D7DA 3TT2A 3P2FA 4AG7A 3IO1A 1IYKA 1QSTA 4MHDA 3T90A 3DGVA 4A31A 5HH1A 2AFMA 3RYOA 4EVYA 2QMLA 4H6ZA 4IF5A 1BPNA 4NJRA 3DR6A 4YRHA 1P4NA 4FD6A 4F6AA 2ZEGA 3F8KA 2ZPAA 3IU2A 3IJ3A 4H6UA 3KKWA 3SI0A 1VIXA 3BLNA 3L2NA 4X8IA 2WPWA 4NGQA 5CBMA 2ZW5A 2V8DA 1ELLP 3CT9A 2R8VA 2B4DB 3H5ZA 4K30A
chains in the Genus database with same CATH topology
2B4BA 4U5YA 2YNCC 4XNHB 4MFZA 1Q2YA 2VEZA 5IB0A 4AVBA 3F5BA 4C7HA 5EBVA 1UFHA 2PRBA 2JLMA 2J8NA 3B8GA 4NF1A 3R96A 4KOTA 3I3GA 1Y9KA 3QB8A 4X5KA 3S6HA 2ZXVA 4RS2A 3FXTA 4CGPA 1KUXA 5C88A 2CNMA 5AG6A 1YVOA 4KORA 4UCMA 2OZHA 2VZZA 1XMTA 2Z11A 3W6XA 4C2YA 2PDOA 1N71A 3EFAA 4ZGYB 3S6FA 1XEBA 2VZYA 2Y0MA 1NSLA 4I49A 2R1IA 1BO4A 4C2XA 4MBUA 3GYAA 1KUYA 3E0KA 1KUVA 1KZFA 4KOWA 3IU1A 4CYNA 3BJ7A 3T9YA 1CJWA 3CXSA 4B11A 5JPHA 2PR8A 1MJBA 5E96A 2Z3PA 2Q7BA 4A95A 2P0WA 4LUAA 4CAEA 5IX3A 1Z4EA 4KZTA 4B12A 5HMNA 3TE4A 2JDCA 3QAHA 3TTHA 3D3SA 1RO5A 2B58A 3FRMA 5G22A 4R3LA 2AJ6A 4E0AA 2CNTA 4XPDC 1YVKA 1P0HA 2REFA 3DDDA 4CAWA 3R1KA 5AGEA 3FB3A 1BOBA 1L0CA 1MJAA 4MY3A 5BWAB 4QUSA 5G21A 4HNWB 5A28A 4BBHA 4R9MA 3PZJA 4AVAA 2Q4YA 4JJXA 3CXPA 3TO6A 4UWIA 3SXOA 3H4QA 4CAVA 2B4DA 2B3VA 4R3KA 5DWNA 4IUSA 2FT0A 4RI1A 2O28A 4MJ8A 2ZW6A 1PU9A 1I1DA 1M4DA 2QIRA 3BJ8A 2NMTA 1ON0A 4PK3A 1XIXA 4MFQA 3V8IA 4JWPA 3DR8A 4M85A 3FNCA 4Y49B 4AG9A 4II9A 3IGRA 2A4NA 5GCNA 4MFJA 4KOVA 3WR7A 1S7FA 4KOYA 1V0CA 2Q0YA 4YFJA 5KTDA 4E8OA 1S60A 2P6GA 4C2ZA 4F0XA 4U9YA 5KTAA 3G3SA 2DPTA 4QC6A 2OH1A 2PR1A 1M1DA 3FYNA 5G20A 4BMHA 1IYLA 4MI4A 3R9EA 1YREA 3JTKA 2D4PA 2HV2A 3VWDA 2PQ8A 2OB0A 4XNHC 1M4GA 3R95A 4E2AA 3P2HA 3A9LA 4HNYB 3PGPA 2FE7A 4NEXA 1VKCA 1ZO0A 2VI7A 3EXNA 5IV0A 2HUZA 4F0YA 2BSWA 2Z3MA 4PV6A 4CGNA 2G0BA 4MFLA 2FS5A 4PSXA 3G8WA 4CGMA 4B5OA 2CY2A 3D2MA 1B6BA 4Q36A 5DWMA 1NMTA 2I00A 4NCZA 4B14A 3IWGA 5H84A 4DNCA 1U6MA 2JDDA 2R7HA 2X7BA 1R57A 4PSWA 4CGLA 2Z3NA 4AVCA 2FIAA 4FD5A 4A33A 1XF8A 3OWCA 2EUIA 4B10A 4CAFA 2P6EA 1QSMA 1I21A 4XPKA 2F5IA 4CYPA 2CXAA 4HNXB 4AB7A 2OZGA 4CYQA 5F49A 4Q38A 3JUWA 4KLWA 4QBJA 2G3AA 5F46A 1M44A 4H89A 2Z3LA 3LODA 1WK4A 3DNSA 1Y7RA 3W6SA 2REEA 2GIVA 3C26A 2BUEA 3MGDA 4KS9A 4CYOA 1FY7A 1MJ9A 2AE6A 1IB1E 2BEIA 4KVOE 2JEVA 5ISVA 3ZZIA 4B5PA 3VWEA 2I79A 4J3GA 3S6GA 4KVXA 2YNCA 5F48A 4CRZB 5A27A 1XE4A 2OU2A 4L8AA 1VHSA 2IL4A 2FXFA 1S3ZA 4KOUA 5EC4A 4R87A 5C82A 4CS0B 1OZPA 1NE9A 4CGOA 3W91A 4KLVA 1SQHA 1YGHA 1S5KA 4YGOA 4Y49C 4KSAA 4CRYB 3EC4A 2Q4VA 4MFPA 2GE3A 4B5PB 4JXQA 4UCPA 4NSQA 2HQYA 3I9SA 1QSRA 2PC1A 2WPXA 4MY0A 3SXNA 2B3UA 2YGWA 4UWJA 2OZUA 5KTCA 1TIQA 4HKFA 2ZW7A 3TFYA 5AG5A 2J8RA 1YLEA 3D8PA 2KCWA 3GKRA 4A30A 2FCKA 4C68A 4OAEA 4UFXA 4UCNA 2Z3OA 4KOXA 3R9GA 2DPSA 4FD4A 5J8FA 1Q2CA 1Z4RA 2FL4A 1WWZA 4B13A 3LD2A 1S7NA 3NE7A 4JD6A 3JVNA 2PSWA 4A32A 1B87A 1GHEA 4U9ZA 1S7LA 5JQ4A 3GY9A 1CM0A 4KUBA 1IICA 3EY5A 3FBUA 5AG4A 2ATRA 5I0CA 3TOBA 3TOAA 2WUUA 2C27A 1LRZA 2P6FA 4QB9A 4CAXA 3ZJ0A 4FD7A 2RC4A 1S7KA 1PUAA 2Z0ZA 4UA3A 2D4OA 4ORFA 4JLYA 4R57A 1QSOA 2B5GA 5F47A 4XPLA 1I12A 2Z3KA 3F0AA 2J8MA 2CNSA 2K5TA 2DXQA 2Q44A 1K4JA 1IIDA 3S6KA 1QSNA 2GANA 2EVNA 4L89A 4NXYA 5G1ZA 4XPDB 4JXRA 4KOSA 2QECA 3TCVA 1Y9WA 4C7IA 1YX0A 2YNEA 4A2ZA 4KSFA 4QVTA 1J4JA 2H5MA 4GS4A 3K9UA 5CNPA 3IWEA 2ARHA 3FIXA 4PK2A 2G3TA 2FSRA 4ONUA 5J8CA 1YR0A 1Q2DA 1MK4A 1Z9UA 4MFKA 3SHPA 2B5GB 4KVME 3DSBA 1RXTA 3PP9A 3TO7A 4UFWA 1M4IA 5AG7A 3EO4A 1YK3A 2R98A 4KUAA 4OLLA 2Z10A 5H86A 4OADA 4LX9A 2ZW4A 2VQYA 3D2PA 4ZBGA 4UBRA 2VBQA 3TO9A 2VXKA 3N7ZA 3CXQA 3R9FA 2BL1A 2WSAA 2YNDA 2Q04A 2FIWA 5FVJA 4M3SA 4UFVA 3UY5A 3TT2A 3P2FA 4AG7A 1IYKA 1QSTA 4MHDA 3T90A 4A31A 5HH1A 3RYOA 4EVYA 2QMLA 4H6ZA 4IF5A 3DR6A 4YRHA 1P4NA 4FD6A 4F6AA 3IU2A 4H6UA 2ZPAA 3F8KA 3KKWA 3BLNA 2WPWA 2ZW5A 2R8VA 2B4DB 3H5ZA 4K30A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2B4B A;  4U5Y A;  4XNH B;  1Q2Y A;  2VEZ A;  5IB0 A;  4AVB A;  3F5B A;  5EBV A;  1UFH A;  2PRB A;  2JLM A;  2J8N A;  3B8G A;  4NF1 A;  3R96 A;  4KOT A;  3I3G A;  1Y9K A;  3QB8 A;  4X5K A;  3S6H A;  2ZXV A;  4RS2 A;  3FXT A;  5C88 A;  1KUX A;  2CNM A;  1YVO A;  4KOR A;  2OZH A;  2VZZ A;  1XMT A;  2Z11 A;  3W6X A;  2PDO A;  1N71 A;  3EFA A;  3S6F A;  1XEB A;  2VZY A;  2Y0M A;  1NSL A;  4I49 A;  2R1I A;  1BO4 A;  4MBU A;  3GYA A;  1KUY A;  3E0K A;  1KUV A;  1KZF A;  4KOW A;  3BJ7 A;  3T9Y A;  1CJW A;  3CXS A;  5JPH A;  2PR8 A;  1MJB A;  5E96 A;  2Q7B A;  2P0W A;  4LUA A;  5IX3 A;  1Z4E A;  4KZT A;  5HMN A;  3TE4 A;  2JDC A;  3QAH A;  3TTH A;  3D3S A;  1RO5 A;  2B58 A;  3FRM A;  4R3L A;  2AJ6 A;  4E0A A;  2CNT A;  4XPD C;  1YVK A;  1P0H A;  2REF A;  3DDD A;  4CAW A;  3R1K A;  3FB3 A;  1BOB A;  1L0C A;  1MJA A;  4MY3 A;  4QUS A;  4HNW B;  3PZJ A;  4AVA A;  2Q4Y A;  4JJX A;  3CXP A;  3TO6 A;  4UWI A;  3SXO A;  3H4Q A;  4CAV A;  2B4D A;  2B3V A;  4R3K A;  5DWN A;  4IUS A;  2FT0 A;  4RI1 A;  2O28 A;  4MJ8 A;  2ZW6 A;  1PU9 A;  1I1D A;  1M4D A;  2QIR A;  3BJ8 A;  2NMT A;  1ON0 A;  4PK3 A;  1XIX A;  3V8I A;  4JWP A;  3DR8 A;  4M85 A;  3FNC A;  4Y49 B;  4AG9 A;  4II9 A;  3IGR A;  2A4N A;  5GCN A;  4KOV A;  3WR7 A;  1S7F A;  4KOY A;  1V0C A;  2Q0Y A;  4YFJ A;  5KTD A;  4E8O A;  1S60 A;  2P6G A;  4U9Y A;  5KTA A;  3G3S A;  4QC6 A;  2OH1 A;  2PR1 A;  1M1D A;  3FYN A;  4BMH A;  1IYL A;  4MI4 A;  3R9E A;  1YRE A;  2D4P A;  2HV2 A;  3VWD A;  2PQ8 A;  2OB0 A;  4XNH C;  1M4G A;  3R95 A;  4E2A A;  3P2H A;  4HNY B;  3PGP A;  2FE7 A;  4NEX A;  1VKC A;  2VI7 A;  3EXN A;  5IV0 A;  2HUZ A;  4F0Y A;  2BSW A;  4PV6 A;  2G0B A;  2FS5 A;  4PSX A;  3G8W A;  4B5O A;  2CY2 A;  3D2M A;  1B6B A;  5DWM A;  1NMT A;  2I00 A;  4NCZ A;  3IWG A;  5H84 A;  4DNC A;  1U6M A;  2JDD A;  2R7H A;  2X7B A;  1R57 A;  4PSW A;  4AVC A;  2FIA A;  4FD5 A;  1XF8 A;  3OWC A;  2EUI A;  2P6E A;  1QSM A;  1I21 A;  4XPK A;  2F5I A;  4AB7 A;  4HNX B;  2OZG A;  5F49 A;  3JUW A;  4KLW A;  4QBJ A;  2G3A A;  5F46 A;  1M44 A;  4H89 A;  3LOD A;  1WK4 A;  3DNS A;  1Y7R A;  3W6S A;  2REE A;  2GIV A;  3C26 A;  2BUE A;  3MGD A;  1FY7 A;  1MJ9 A;  2AE6 A;  1IB1 E;  2BEI A;  4KVO E;  2JEV A;  5ISV A;  3ZZI A;  4B5P A;  3VWE A;  2I79 A;  4J3G A;  3S6G A;  4KVX A;  4CRZ B;  5F48 A;  1XE4 A;  2OU2 A;  4L8A A;  1VHS A;  2IL4 A;  2FXF A;  1S3Z A;  4KOU A;  5EC4 A;  4R87 A;  5C82 A;  4CS0 B;  1OZP A;  1NE9 A;  3W91 A;  4KLV A;  1SQH A;  1YGH A;  1S5K A;  4YGO A;  4Y49 C;  4CRY B;  3EC4 A;  2Q4V A;  2GE3 A;  4B5P B;  4JXQ A;  4NSQ A;  2HQY A;  3I9S A;  1QSR A;  2PC1 A;  2WPX A;  4MY0 A;  3SXN A;  2B3U A;  4UWJ A;  2OZU A;  5KTC A;  1TIQ A;  4HKF A;  2ZW7 A;  3TFY A;  2J8R A;  1YLE A;  3D8P A;  2KCW A;  3GKR A;  2FCK A;  4OAE A;  4KOX A;  3R9G A;  4FD4 A;  5J8F A;  1Q2C A;  1Z4R A;  2FL4 A;  1WWZ A;  3LD2 A;  1S7N A;  3NE7 A;  4JD6 A;  3JVN A;  2PSW A;  1B87 A;  1GHE A;  4U9Z A;  1S7L A;  5JQ4 A;  3GY9 A;  1CM0 A;  4KUB A;  1IIC A;  3EY5 A;  3FBU A;  2ATR A;  5I0C A;  3TOB A;  3TOA A;  2C27 A;  1LRZ A;  2P6F A;  4QB9 A;  4CAX A;  3ZJ0 A;  4FD7 A;  2RC4 A;  1S7K A;  1PUA A;  2Z0Z A;  4UA3 A;  2D4O A;  4ORF A;  4JLY A;  4R57 A;  1QSO A;  2B5G A;  5F47 A;  4XPL A;  1I12 A;  3F0A A;  2J8M A;  2CNS A;  2K5T A;  2DXQ A;  2Q44 A;  1K4J A;  1IID A;  3S6K A;  1QSN A;  2GAN A;  2EVN A;  4L89 A;  4NXY A;  4XPD B;  4JXR A;  4KOS A;  2QEC A;  3TCV A;  1Y9W A;  1YX0 A;  4QVT A;  1J4J A;  2H5M A;  4GS4 A;  3K9U A;  5CNP A;  2ARH A;  3FIX A;  4PK2 A;  2G3T A;  2FSR A;  4ONU A;  5J8C A;  1YR0 A;  1Q2D A;  1MK4 A;  1Z9U A;  3SHP A;  2B5G B;  4KVM E;  3DSB A;  1RXT A;  3PP9 A;  3TO7 A;  1M4I A;  3EO4 A;  1YK3 A;  2R98 A;  4KUA A;  4OLL A;  2Z10 A;  5H86 A;  4OAD A;  4LX9 A;  2ZW4 A;  2VQY A;  3D2P A;  4ZBG A;  4UBR A;  2VBQ A;  3TO9 A;  2VXK A;  3N7Z A;  3CXQ A;  3R9F A;  2BL1 A;  2Q04 A;  2FIW A;  5FVJ A;  4M3S A;  3UY5 A;  3TT2 A;  3P2F A;  4AG7 A;  1IYK A;  1QST A;  4MHD A;  3T90 A;  5HH1 A;  3RYO A;  4EVY A;  2QML A;  4H6Z A;  4IF5 A;  3DR6 A;  4YRH A;  1P4N A;  4FD6 A;  4F6A A;  4H6U A;  2ZPA A;  3F8K A;  3KKW A;  3BLN A;  2WPW A;  2ZW5 A;  2R8V A;  2B4D B;  4R9M A;  4K30 A; 
#chains in the Genus database with same CATH topology
 2B4B A;  4NGR A;  4U5Y A;  2YNC C;  3WC6 A;  1F2O A;  4MXU A;  1FNO A;  1BLL E;  4XNH B;  4ZY1 A;  4MFZ A;  1JWQ A;  1Q2Y A;  2VEZ A;  5IB0 A;  1IU8 A;  3WC7 A;  4AVB A;  4UIB A;  3BHX A;  3F5B A;  4C7H A;  5EBV A;  1UFH A;  2PRB A;  3HUV A;  2JLM A;  3H8G A;  2J8N A;  1AMP A;  3B8G A;  3QAY A;  4NF1 A;  3SJE A;  1ARL A;  3R96 A;  5LRJ A;  4KOT A;  3VH9 A;  1ZG8 A;  3I3G A;  1Y9K A;  3QB8 A;  4X5K A;  4FUU A;  3S6H A;  2ZXV A;  1R3N A;  2ANP A;  3WT4 A;  4RS2 A;  4JYW A;  3FXT A;  3PB4 X;  4CGP A;  1KUX A;  5C88 A;  2CNM A;  5AG6 A;  1YVO A;  2C1C A;  4KOR A;  2BO9 A;  4UCM A;  2OZH A;  2VZZ A;  1XMT A;  2Z11 A;  2ZEE A;  3W6X A;  4C2Y A;  2PDO A;  1N71 A;  3EFA A;  3FEC A;  4ZGY B;  3S6F A;  5JGF A;  4R6T A;  3RO0 A;  1XEB A;  5CPA A;  4F9U A;  2VZY A;  2Y0M A;  3PEI A;  1NSL A;  4I49 A;  1CG2 A;  2R1I A;  8CPA A;  1CX8 A;  3I1U A;  2QJ8 A;  3KZW A;  1BO4 A;  1F57 A;  4C2X A;  4MBU A;  4ZYQ A;  3GYA A;  1KUY A;  2FVG A;  3E0K A;  1KUV A;  1KZF A;  2C6P A;  4KOW A;  3IU1 A;  1X12 A;  5J1Q A;  3H8F A;  2PJ0 A;  1Z2L A;  2PJ2 A;  1HDQ A;  4CYN A;  3PB7 X;  2GU2 A;  1YLO A;  3BJ7 A;  3T9Y A;  1CJW A;  3CXS A;  4B11 A;  4YU9 A;  5JPH A;  1YQE A;  2PR8 A;  1MJB A;  5E96 A;  2ZOF A;  2Z3P A;  1QQ9 A;  2Q7B A;  4A95 A;  2P0W A;  2C6G A;  4LUA A;  1LAN A;  4NGP A;  4YWY A;  4CAE A;  2BOA A;  2CTC A;  1Z8T A;  5IX3 A;  1VHO A;  1Z4E A;  2PRQ A;  4KZT A;  4B12 A;  5HMN A;  3TE4 A;  2JDC A;  2PJA A;  3QAH A;  4P6Y A;  1NSA A;  3PB9 X;  3TTH A;  3D3S A;  1RO5 A;  2ABZ A;  1X10 A;  2B58 A;  3FRM A;  4MCS A;  2PVW A;  5G22 A;  4R3L A;  2AJ6 A;  4E0A A;  2CNT A;  4UIA A;  4XPD C;  1YVK A;  1M4L A;  4IAV A;  2ZEL A;  1TKF A;  1P0H A;  2V8V A;  2REF A;  3DDD A;  4CAW A;  3R1K A;  4FWU A;  5AGE A;  1PCA A;  3FB3 A;  4P4E A;  3QNV A;  1BOB A;  1L0C A;  1MJA A;  4MY3 A;  3CPX A;  4AXV A;  5D29 A;  5BWA B;  2PJ8 A;  4QUS A;  4PXD A;  4A94 A;  5G21 A;  4HNW B;  5A28 A;  4BBH A;  2AFS A;  3GUX A;  4R9M A;  2PIZ A;  3PZJ A;  4OP4 A;  4AVA A;  2Q4Y A;  1CPX A;  4JJX A;  5LYI A;  3CXP A;  4NJQ A;  2GRE A;  3IIB A;  4ONW A;  3TO6 A;  4UWI A;  3SXO A;  3H4Q A;  4CAV A;  2B4D A;  2B3V A;  4A39 A;  1IGB A;  3IEH A;  4R3K A;  2Q4Z A;  3FED A;  1LCP A;  1IOI A;  2PE3 A;  3BI1 A;  2BCO A;  3B7I A;  2C6C A;  3KQX A;  3MRU A;  4IUS A;  4K3N A;  5DWN A;  4EFD A;  2V77 A;  4M6H A;  2FT0 A;  2PJB A;  3DLJ A;  4RI1 A;  2O28 A;  4MJ8 A;  4MCQ A;  2ZW6 A;  1PU9 A;  1I1D A;  1M4D A;  2QIR A;  1XRY A;  3BJ8 A;  2DF5 A;  3TC8 A;  1Z5R A;  3H8E A;  3RNZ A;  3D7G A;  4FBE A;  2NMT A;  1ON0 A;  4MHY A;  4PPZ A;  3S9N A;  4PK3 A;  1XIX A;  4MFQ A;  3V8I A;  5LRK A;  3KGQ A;  4JWP A;  4G1P A;  3DR8 A;  4PQA A;  4IK2 A;  4DYO A;  4ZI6 A;  4M85 A;  3KQZ A;  3FNC A;  4Y49 B;  4AG9 A;  4II9 A;  4KSI A;  4GM5 A;  2WYR A;  3IGR A;  3S9M A;  2A4N A;  2NYQ A;  1XMB A;  5GCN A;  4MFJ A;  4KOV A;  4Q7A A;  2PJ7 A;  1S7F A;  4OID A;  4WJB A;  3WR7 A;  4KOY A;  4F8Z A;  1Z8L A;  1V0C A;  2Q0Y A;  4ZY2 A;  4YFJ A;  5KTD A;  4E8O A;  1S60 A;  2P6G A;  3B35 A;  4C2Z A;  4MHN A;  4F0X A;  4U9Y A;  3B3W A;  3K9T A;  5EMI A;  5KTA A;  2EK9 A;  1VHE A;  3G3S A;  4GXH A;  2ZEH A;  1ZG9 A;  2DPT A;  2OH1 A;  2PR1 A;  1M1D A;  4P4D A;  4QC6 A;  1XJO A;  3FYN A;  4TWE A;  5G20 A;  3PBB A;  3GB0 A;  4BMH A;  2EK8 A;  4FAI A;  2IMO A;  1IYL A;  4MI4 A;  2PJC A;  4ZX9 A;  3R9E A;  1YRE A;  2ZEM A;  4P10 A;  3JTK A;  2D4P A;  2HV2 A;  3NH4 A;  3VWD A;  2PQ8 A;  3MN8 A;  2OB0 A;  3WAB A;  2I3C A;  4XNH C;  1M4G A;  3PB8 X;  3R95 A;  4E2A A;  3P2H A;  3A9L A;  1HDU A;  4NGS A;  4HNY B;  2XEJ A;  3PGP A;  2FE7 A;  2PCU A;  4NEX A;  2JEW A;  1VKC A;  1ZO0 A;  2VI7 A;  3EXN A;  2PJ6 A;  5IV0 A;  2J9A A;  2HUZ A;  3CDX A;  4F0Y A;  2BSW A;  2Z3M A;  2CIJ A;  3B3V A;  1VGY A;  4PV6 A;  5HVG A;  4CGN A;  4H2K A;  2G0B A;  1PYT B;  3NH8 A;  4MFL A;  1AYE A;  2FS5 A;  3KHZ A;  4PSX A;  1LFW A;  3G8W A;  4CGM A;  5K8P A;  4B5O A;  1TF8 A;  2CY2 A;  5ELY A;  3KI9 A;  1Q7L A;  1B6B A;  3D2M A;  4OME A;  3SI2 A;  4Q36 A;  3T8W A;  5DWM A;  2WZN A;  1NMT A;  3IC1 A;  2I00 A;  4NCZ A;  4A38 A;  4B14 A;  3IWG A;  5H84 A;  4DNC A;  1U6M A;  3IFE A;  3VAT A;  2JDD A;  4A37 A;  2R7H A;  4HPS A;  1TXR A;  1R57 A;  2Q51 A;  2X7B A;  4MCR A;  4PSW A;  4IHM A;  4TNU A;  4CGL A;  5F09 A;  2Z3N A;  4AVC A;  2FIA A;  4FD5 A;  2Q43 A;  4A33 A;  1XF8 A;  3OWC A;  4JZ0 A;  2F8H A;  1R43 A;  3D7F A;  5K8N A;  2EUI A;  4B10 A;  2PJ9 A;  4CAF A;  4X2T A;  2V8G A;  2P6E A;  1QSM A;  1I21 A;  3KR5 A;  4NGN A;  4XPK A;  1IOF A;  3KAS A;  1H8L A;  2F5I A;  4CYP A;  2EBJ A;  2CXA A;  4HNX B;  4AB7 A;  2OZG A;  2QYV A;  1CBX A;  1CP7 A;  4CYQ A;  3CPA A;  5F49 A;  1TF9 A;  3FVL A;  4Q38 A;  3JUW A;  4KLW A;  4QBJ A;  1DTD A;  2G3A A;  1RTQ A;  2ZEN A;  1M44 A;  4RUH A;  5F46 A;  1LAP A;  2JBJ A;  2DEA A;  3NH5 A;  3PB6 X;  4H89 A;  3SJX A;  2Z3L A;  3LOD A;  1WK4 A;  2EO8 A;  2XEI A;  4OC5 A;  3DNS A;  1Y7R A;  3W6S A;  2REE A;  2GIV A;  3C26 A;  2BUE A;  3MGD A;  4KS9 A;  4P4I A;  4CYO A;  1FY7 A;  1MJ9 A;  2AE6 A;  1IB1 E;  3GIU A;  2BEI A;  4KVO E;  2JEV A;  5ISV A;  5HXD A;  3LMS A;  6CPA A;  3ZZI A;  1GYT A;  3D66 A;  1KWM A;  4B5P A;  3VWE A;  3NE8 A;  2I79 A;  4J3G A;  4P4J A;  5THW A;  3TX8 A;  3RBU A;  3S6G A;  5K8M A;  4KVX A;  3VAR A;  4OC3 A;  2YNC A;  3KHX A;  5F48 A;  4CRZ B;  5A27 A;  3PFE A;  3D4U A;  4P45 A;  2F7V A;  1XE4 A;  2HB6 A;  2OU2 A;  4L8A A;  1VHS A;  4OC4 A;  2XEG A;  3RZA A;  2IL4 A;  5LRG A;  2FXF A;  4OC1 A;  3PBE A;  1S3Z A;  4KOU A;  1Y7E A;  2AFU A;  4R87 A;  5EC4 A;  5C82 A;  5LYF A;  2Q7S A;  4ZX8 A;  1OZP A;  1NE9 A;  4CGO A;  4CS0 B;  3W91 A;  4UEF A;  1OBR A;  2PIY A;  2ZEP A;  1CP6 A;  4KLV A;  2OOT A;  1SQH A;  1YGH A;  1UWY A;  1S5K A;  4YGO A;  2AFO A;  2PJ4 A;  3KL9 A;  1Z8X A;  3LAC A;  4Y49 C;  4KSA A;  4CRY B;  3EC4 A;  2EWB A;  2NSM A;  2Q4V A;  4MFP A;  4LQ6 A;  2GE3 A;  2AFW A;  2POK A;  3KR4 A;  4O23 A;  4P4B A;  4B5P B;  1BAV A;  4JXQ A;  4UCP A;  2HC9 A;  4NSQ A;  4EME A;  2HQY A;  3I9S A;  1QSR A;  2PC1 A;  2PJ3 A;  2WPX A;  1BPM A;  4MY0 A;  1IY7 A;  4R7M A;  3SXN A;  4NGT A;  2B3U A;  1F2P A;  1XBU A;  3K2K A;  2YGW A;  3BI0 A;  4UWJ A;  2OZU A;  4WWV A;  4X3R A;  5I4M A;  5KTC A;  2PJ1 A;  1TIQ A;  5HVF A;  4HKF A;  2ZW7 A;  3TFY A;  5AG5 A;  3LWU A;  1LOK A;  2J8R A;  5DS0 A;  1LAM A;  3IWW A;  1YLE A;  3D8P A;  4M6I A;  1QMU A;  1ZG7 A;  2KCW A;  3GKR A;  4A30 A;  2JBK A;  5LYL A;  1DE4 C;  2FCK A;  3N5F A;  2AFZ A;  4DJL A;  4UEZ A;  4C68 A;  4OAE A;  4UFX A;  4UCN A;  5D8N A;  2Z3O A;  4KOX A;  3SJG A;  3PFO A;  4P4F A;  3R9G A;  2DPS A;  4FD4 A;  4M6G A;  2GLF A;  1TKJ A;  5J8F A;  4LQG A;  4P44 A;  1Q2C A;  1Z4R A;  2FL4 A;  1WWZ A;  4B13 A;  3LD2 A;  4W9Y A;  4UF4 A;  1S7N A;  3NE7 A;  4BIN A;  4JD6 A;  3JVN A;  3CZX A;  2PSW A;  4A32 A;  1B87 A;  1GHE A;  2QVP A;  1S7L A;  3B3T A;  4U9Z A;  5JQ4 A;  1XOV A;  3GY9 A;  1CM0 A;  1CPS A;  4R76 A;  4KUB A;  2OR4 A;  1IIC A;  2O53 A;  2RB7 A;  3EY5 A;  3FBU A;  4MRI A;  7CPA A;  5JM6 A;  3D68 A;  2ZOG A;  2IQ6 A;  2VL1 A;  4OIW A;  5AG4 A;  2ATR A;  5I0C A;  3TOB A;  3TOA A;  1Z8W A;  2WUU A;  3FF3 A;  2C27 A;  1LRZ A;  3SJF A;  2P6F A;  4QB9 A;  5LYD A;  4CAX A;  3ZJ0 A;  3JRU A;  1Y0Y A;  2RC4 A;  4FD7 A;  4NFR A;  1S7K A;  4OC2 A;  1PUA A;  2Z0Z A;  3SI1 A;  4R8F A;  2G9D A;  1JQG A;  4UA3 A;  2D4O A;  1HEE A;  4ORF A;  4MMO A;  4JLY A;  3FX6 A;  4R57 A;  3ISZ A;  1QSO A;  3S9L A;  2RFH A;  2B5G A;  5F47 A;  4XPL A;  2CTB A;  1I12 A;  1Y0R A;  4PXB A;  2Z3K A;  3F0A A;  3GLJ A;  3HLP A;  2J8M A;  2CNS A;  4UEE A;  3V38 A;  2V8H A;  2K5T A;  2DXQ A;  2Q44 A;  1K4J A;  1ARM A;  5HVH A;  5IB9 A;  1AUG A;  1ZLH A;  1IID A;  3S6K A;  1QSN A;  2GAN A;  2EVN A;  4L89 A;  4NXY A;  5G1Z A;  4XPD B;  1ELM P;  4JXR A;  4KOS A;  2QEC A;  3TCV A;  1Y9W A;  4C7I A;  4ZY0 A;  2AFX A;  4BD9 A;  1YX0 A;  3B3C A;  2YNE A;  4A2Z A;  4KSF A;  4MHP A;  1YSJ A;  4QVT A;  2ZED A;  1J4J A;  2H5M A;  2ZEO A;  3FMC A;  2XEF A;  4GS4 A;  3K9U A;  5CNP A;  3D7H A;  2ARH A;  3IWE A;  1A2Z A;  3PRT A;  4PXC A;  3FIX A;  4PK2 A;  4B6Z A;  1ZLI A;  1YW6 A;  4DUK A;  2G3T A;  2FSR A;  2ZEF A;  4ONU A;  3B3S A;  5J8C A;  1EE3 P;  1YR0 A;  4EWT A;  1Q2D A;  1MK4 A;  1Z9U A;  4MCP A;  4Z65 A;  3RAM A;  4MFK A;  4OKO A;  2PVV A;  3D67 A;  3SHP A;  4MHZ A;  2B5G B;  3BXM A;  4KVM E;  1YW4 A;  3DSB A;  1RXT A;  2GLJ A;  3PP9 A;  3TO7 A;  4UFW A;  4CPA A;  3WC5 A;  1M4I A;  1XFO A;  3B2Y A;  2GFQ A;  3FJU A;  5AG7 A;  3EO4 A;  1YK3 A;  2R98 A;  3NFZ A;  4KUA A;  2Z10 A;  1YME A;  3FEE A;  3ISX A;  2O4H A;  4LX9 A;  2PJ5 A;  4OAD A;  5H86 A;  2ZW4 A;  2VQY A;  3D2P A;  4ZBG A;  4UBR A;  2VBQ A;  3TO9 A;  2VXK A;  3N7Z A;  3CXQ A;  2CF4 A;  3R9F A;  4OLL A;  5K8O A;  3FH4 A;  2BL1 A;  2WSA A;  4PXE A;  4RN7 A;  1TKH A;  2YND A;  2Q04 A;  4OC0 A;  4NGM A;  4F9V A;  3V7Z A;  2FIW A;  2IJZ A;  5FVJ A;  4M3S A;  2ODF A;  1FT7 A;  4UFV A;  3NA6 A;  3UY5 A;  5JH9 A;  3D7D A;  3TT2 A;  3P2F A;  4AG7 A;  3IO1 A;  1IYK A;  1QST A;  4MHD A;  3T90 A;  3DGV A;  4A31 A;  5HH1 A;  2AFM A;  3RYO A;  4EVY A;  2QML A;  4H6Z A;  4IF5 A;  1BPN A;  4NJR A;  3DR6 A;  4YRH A;  1P4N A;  4FD6 A;  4F6A A;  2ZEG A;  3F8K A;  2ZPA A;  3IU2 A;  3IJ3 A;  4H6U A;  3KKW A;  3SI0 A;  1VIX A;  3BLN A;  3L2N A;  4X8I A;  2WPW A;  4NGQ A;  5CBM A;  2ZW5 A;  2V8D A;  1ELL P;  3CT9 A;  2R8V A;  2B4D B;  3H5Z A;  4K30 A; 
#chains in the Genus database with same CATH homology
 2B4B A;  4U5Y A;  2YNC C;  4XNH B;  4MFZ A;  1Q2Y A;  2VEZ A;  5IB0 A;  4AVB A;  3F5B A;  4C7H A;  5EBV A;  1UFH A;  2PRB A;  2JLM A;  2J8N A;  3B8G A;  4NF1 A;  3R96 A;  4KOT A;  3I3G A;  1Y9K A;  3QB8 A;  4X5K A;  3S6H A;  2ZXV A;  4RS2 A;  3FXT A;  4CGP A;  1KUX A;  5C88 A;  2CNM A;  5AG6 A;  1YVO A;  4KOR A;  4UCM A;  2OZH A;  2VZZ A;  1XMT A;  2Z11 A;  3W6X A;  4C2Y A;  2PDO A;  1N71 A;  3EFA A;  4ZGY B;  3S6F A;  1XEB A;  2VZY A;  2Y0M A;  1NSL A;  4I49 A;  2R1I A;  1BO4 A;  4C2X A;  4MBU A;  3GYA A;  1KUY A;  3E0K A;  1KUV A;  1KZF A;  4KOW A;  3IU1 A;  4CYN A;  3BJ7 A;  3T9Y A;  1CJW A;  3CXS A;  4B11 A;  5JPH A;  2PR8 A;  1MJB A;  5E96 A;  2Z3P A;  2Q7B A;  4A95 A;  2P0W A;  4LUA A;  4CAE A;  5IX3 A;  1Z4E A;  4KZT A;  4B12 A;  5HMN A;  3TE4 A;  2JDC A;  3QAH A;  3TTH A;  3D3S A;  1RO5 A;  2B58 A;  3FRM A;  5G22 A;  4R3L A;  2AJ6 A;  4E0A A;  2CNT A;  4XPD C;  1YVK A;  1P0H A;  2REF A;  3DDD A;  4CAW A;  3R1K A;  5AGE A;  3FB3 A;  1BOB A;  1L0C A;  1MJA A;  4MY3 A;  5BWA B;  4QUS A;  5G21 A;  4HNW B;  5A28 A;  4BBH A;  4R9M A;  3PZJ A;  4AVA A;  2Q4Y A;  4JJX A;  3CXP A;  3TO6 A;  4UWI A;  3SXO A;  3H4Q A;  4CAV A;  2B4D A;  2B3V A;  4R3K A;  5DWN A;  4IUS A;  2FT0 A;  4RI1 A;  2O28 A;  4MJ8 A;  2ZW6 A;  1PU9 A;  1I1D A;  1M4D A;  2QIR A;  3BJ8 A;  2NMT A;  1ON0 A;  4PK3 A;  1XIX A;  4MFQ A;  3V8I A;  4JWP A;  3DR8 A;  4M85 A;  3FNC A;  4Y49 B;  4AG9 A;  4II9 A;  3IGR A;  2A4N A;  5GCN A;  4MFJ A;  4KOV A;  3WR7 A;  1S7F A;  4KOY A;  1V0C A;  2Q0Y A;  4YFJ A;  5KTD A;  4E8O A;  1S60 A;  2P6G A;  4C2Z A;  4F0X A;  4U9Y A;  5KTA A;  3G3S A;  2DPT A;  4QC6 A;  2OH1 A;  2PR1 A;  1M1D A;  3FYN A;  5G20 A;  4BMH A;  1IYL A;  4MI4 A;  3R9E A;  1YRE A;  3JTK A;  2D4P A;  2HV2 A;  3VWD A;  2PQ8 A;  2OB0 A;  4XNH C;  1M4G A;  3R95 A;  4E2A A;  3P2H A;  3A9L A;  4HNY B;  3PGP A;  2FE7 A;  4NEX A;  1VKC A;  1ZO0 A;  2VI7 A;  3EXN A;  5IV0 A;  2HUZ A;  4F0Y A;  2BSW A;  2Z3M A;  4PV6 A;  4CGN A;  2G0B A;  4MFL A;  2FS5 A;  4PSX A;  3G8W A;  4CGM A;  4B5O A;  2CY2 A;  3D2M A;  1B6B A;  4Q36 A;  5DWM A;  1NMT A;  2I00 A;  4NCZ A;  4B14 A;  3IWG A;  5H84 A;  4DNC A;  1U6M A;  2JDD A;  2R7H A;  2X7B A;  1R57 A;  4PSW A;  4CGL A;  2Z3N A;  4AVC A;  2FIA A;  4FD5 A;  4A33 A;  1XF8 A;  3OWC A;  2EUI A;  4B10 A;  4CAF A;  2P6E A;  1QSM A;  1I21 A;  4XPK A;  2F5I A;  4CYP A;  2CXA A;  4HNX B;  4AB7 A;  2OZG A;  4CYQ A;  5F49 A;  4Q38 A;  3JUW A;  4KLW A;  4QBJ A;  2G3A A;  5F46 A;  1M44 A;  4H89 A;  2Z3L A;  3LOD A;  1WK4 A;  3DNS A;  1Y7R A;  3W6S A;  2REE A;  2GIV A;  3C26 A;  2BUE A;  3MGD A;  4KS9 A;  4CYO A;  1FY7 A;  1MJ9 A;  2AE6 A;  1IB1 E;  2BEI A;  4KVO E;  2JEV A;  5ISV A;  3ZZI A;  4B5P A;  3VWE A;  2I79 A;  4J3G A;  3S6G A;  4KVX A;  2YNC A;  5F48 A;  4CRZ B;  5A27 A;  1XE4 A;  2OU2 A;  4L8A A;  1VHS A;  2IL4 A;  2FXF A;  1S3Z A;  4KOU A;  5EC4 A;  4R87 A;  5C82 A;  4CS0 B;  1OZP A;  1NE9 A;  4CGO A;  3W91 A;  4KLV A;  1SQH A;  1YGH A;  1S5K A;  4YGO A;  4Y49 C;  4KSA A;  4CRY B;  3EC4 A;  2Q4V A;  4MFP A;  2GE3 A;  4B5P B;  4JXQ A;  4UCP A;  4NSQ A;  2HQY A;  3I9S A;  1QSR A;  2PC1 A;  2WPX A;  4MY0 A;  3SXN A;  2B3U A;  2YGW A;  4UWJ A;  2OZU A;  5KTC A;  1TIQ A;  4HKF A;  2ZW7 A;  3TFY A;  5AG5 A;  2J8R A;  1YLE A;  3D8P A;  2KCW A;  3GKR A;  4A30 A;  2FCK A;  4C68 A;  4OAE A;  4UFX A;  4UCN A;  2Z3O A;  4KOX A;  3R9G A;  2DPS A;  4FD4 A;  5J8F A;  1Q2C A;  1Z4R A;  2FL4 A;  1WWZ A;  4B13 A;  3LD2 A;  1S7N A;  3NE7 A;  4JD6 A;  3JVN A;  2PSW A;  4A32 A;  1B87 A;  1GHE A;  4U9Z A;  1S7L A;  5JQ4 A;  3GY9 A;  1CM0 A;  4KUB A;  1IIC A;  3EY5 A;  3FBU A;  5AG4 A;  2ATR A;  5I0C A;  3TOB A;  3TOA A;  2WUU A;  2C27 A;  1LRZ A;  2P6F A;  4QB9 A;  4CAX A;  3ZJ0 A;  4FD7 A;  2RC4 A;  1S7K A;  1PUA A;  2Z0Z A;  4UA3 A;  2D4O A;  4ORF A;  4JLY A;  4R57 A;  1QSO A;  2B5G A;  5F47 A;  4XPL A;  1I12 A;  2Z3K A;  3F0A A;  2J8M A;  2CNS A;  2K5T A;  2DXQ A;  2Q44 A;  1K4J A;  1IID A;  3S6K A;  1QSN A;  2GAN A;  2EVN A;  4L89 A;  4NXY A;  5G1Z A;  4XPD B;  4JXR A;  4KOS A;  2QEC A;  3TCV A;  1Y9W A;  4C7I A;  1YX0 A;  2YNE A;  4A2Z A;  4KSF A;  4QVT A;  1J4J A;  2H5M A;  4GS4 A;  3K9U A;  5CNP A;  3IWE A;  2ARH A;  3FIX A;  4PK2 A;  2G3T A;  2FSR A;  4ONU A;  5J8C A;  1YR0 A;  1Q2D A;  1MK4 A;  1Z9U A;  4MFK A;  3SHP A;  2B5G B;  4KVM E;  3DSB A;  1RXT A;  3PP9 A;  3TO7 A;  4UFW A;  1M4I A;  5AG7 A;  3EO4 A;  1YK3 A;  2R98 A;  4KUA A;  4OLL A;  2Z10 A;  5H86 A;  4OAD A;  4LX9 A;  2ZW4 A;  2VQY A;  3D2P A;  4ZBG A;  4UBR A;  2VBQ A;  3TO9 A;  2VXK A;  3N7Z A;  3CXQ A;  3R9F A;  2BL1 A;  2WSA A;  2YND A;  2Q04 A;  2FIW A;  5FVJ A;  4M3S A;  4UFV A;  3UY5 A;  3TT2 A;  3P2F A;  4AG7 A;  1IYK A;  1QST A;  4MHD A;  3T90 A;  4A31 A;  5HH1 A;  3RYO A;  4EVY A;  2QML A;  4H6Z A;  4IF5 A;  3DR6 A;  4YRH A;  1P4N A;  4FD6 A;  4F6A A;  3IU2 A;  4H6U A;  2ZPA A;  3F8K A;  3KKW A;  3BLN A;  2WPW A;  2ZW5 A;  2R8V A;  2B4D B;  3H5Z A;  4K30 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...