3FNCA

Crystal structure of a putative acetyltransferase from listeria innocua
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
160
structure length
160
Chain Sequence
MDFHIRKATNSDAEAIQHVATTSWHHTYQDLIPSDVQDDFLKRFYNVETLHNRISATPFAVLEQADKVIGFANFIELEKGKSELAAFYLLPEVTQRGLGTELLEVGMTLFHVPLPMFVNVEKGNETAIHFYKAKGFVQVEEFTEDFYGYPLETIRFNLNH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative acetyltransferase
publication title The structure of a putative acetyltransferase from Listeria innocua.
rcsb
source organism Listeria innocua
molecule tags Transferase
total genus 47
structure length 160
sequence length 160
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-12-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13673 Acetyltransf_10 Acetyltransferase (GNAT) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 3fncA00
4M3SA 1XF8A 2PR1A 2REEA 4XNHB 3S6FA 2BUEA 5ISVA 4R87A 4F6AA 2B5GB 4BMHA 2FIAA 5EBVA 1B87A 4YFJA 3GYAA 1RXTA 1Z4EA 1IICA 3KKWA 2EUIA 4PK2A 4H6ZA 2VZZA 4QC6A 2Q0YA 1S7KA 2Y0MA 2B4DA 3EFAA 3GKRA 2JDCA 3S6GA 2PDOA 2FE7A 2G3AA 2PQ8A 2WPXA 2PSWA 2OZUA 4YRHA 1MJ9A 1I21A 4K30A 3BLNA 4L89A 3NE7A 4I49A 3F8KA 2P6FA 3UY5A 3IGRA 1YGHA 1S7LA 3EXNA 3VWDA 3R9EA 3TCVA 1GHEA 3MGDA 3TE4A 3PP9A 3BJ7A 2R7HA 1CM0A 2QIRA 4HNXB 4KOSA 2CNTA 1TIQA 5EC4A 2B3UA 5HH1A 4E2AA 1MK4A 2VZYA 2ZPAA 3CXSA 4JD6A 4YGOA 3D3SA 4LX9A 5H86A 2B5GA 2NMTA 3B8GA 2RC4A 4R57A 5KTCA 4KVXA 2OH1A 3T90A 4MHDA 1S60A 4UBRA 4JWPA 3TOBA 2REFA 3LD2A 2FXFA 2KCWA 1KUYA 4KUAA 1J4JA 5J8FA 4R3KA 3DSBA 1VKCA 4OAEA 3K9UA 4NSQA 3T9YA 2B58A 1YX0A 1XIXA 2PR8A 3FB3A 5I0CA 4H89A 3IWGA 5F47A 3F0AA 4AVCA 4L8AA 4EVYA 3TO7A 2X7BA 4FD7A 2K5TA 4FD5A 1FY7A 1M4GA 5C82A 2J8NA 4CRZB 2ZW6A 1CJWA 2QECA 4MJ8A 4Y49B 3VWEA 1RO5A 2OZGA 1NSLA 4IF5A 4MBUA 2CY2A 2Z11A 5GCNA 4QUSA 1XEBA 1OZPA 2D4PA 1S7NA 4NCZA 2AJ6A 2EVNA 2JLMA 1YREA 2R98A 4MY0A 1BO4A 3F5BA 4OLLA 4QB9A 2Z10A 2Q04A 3FIXA 1WK4A 1Z4RA 1B6BA 2ZW7A 1M4IA 2GANA 5J8CA 3D8PA 4B5OA 3FYNA 3R9FA 4CS0B 3EO4A 3PZJA 5E96A 4XPLA 4CAVA 1YK3A 4J3GA 4UWJA 1QSOA 3CXPA 4ONUA 5DWMA 3W6XA 1XE4A 2JEVA 3R9GA 5IB0A 4JLYA 2O28A 4QBJA 4RS2A 3W6SA 4KLWA 3G3SA 3TO6A 4PK3A 1I1DA 4NXYA 2JDDA 3E0KA 2G0BA 5F46A 2FT0A 1S5KA 2H5MA 3ZJ0A 2ZW4A 4KORA 2ZXVA 2BL1A 4JJXA 2I79A 3ZZIA 4DNCA 1XMTA 4CRYB 3TO9A 3S6KA 5IV0A 4AB7A 1YVKA 2B4BA 1QSMA 2ARHA 4MI4A 4PSWA 4XNHC 2BSWA 3SXOA 1M1DA 1VHSA 2Q4YA 3FNCA 4KOWA 1SQHA 3G8WA 2F5IA 3EC4A 4RI1A 3EY5A 3FBUA 1P0HA 4HNYB 4AVBA 4KZTA 5F48A 3TTHA 1UFHA 1KZFA 3SXNA 1Y9KA 3H4QA 1Z9UA 4B5PA 5H84A 1NMTA 3C26A 1WWZA 1MJBA 5C88A 5KTAA 1YVOA 2CNSA 3D2MA 1LRZA 4HNWB 2Z0ZA 4E8OA 4NEXA 4KOVA 1S7FA 1R57A 4PV6A 1QSNA 2FCKA 3QB8A 3R95A 4AG7A 4F0YA 4MY3A 2FS5A 4CAWA 1V0CA 4KUBA 3BJ8A 1Q2YA 3DNSA 4OADA 1M4DA 3CXQA 3WR7A 2Q44A 4R3LA 1IYKA 3D2PA 2P6GA 1KUVA 2VEZA 2R1IA 4HKFA 3V8IA 2FSRA 4U5YA 2HV2A 2B3VA 1NE9A 2GIVA 2ZW5A 3R96A 4FD6A 1YLEA 2DXQA 2AE6A 1YR0A 3N7ZA 4M85A 2VQYA 2VXKA 4AG9A 3LODA 5FVJA 2ATRA 2GE3A 4H6UA 5DWNA 1S3ZA 4B5PB 2J8RA 2OB0A 3I9SA 1N71A 2R8VA 3I3GA 3DDDA 3FXTA 2WPWA 1QSTA 1IIDA 4XPKA 1PU9A 4ZBGA 2FL4A 2OZHA 1KUXA 3DR8A 4XPDC 2G3TA 4KOYA 5HMNA 1Q2DA 4KOUA 5JPHA 4KOTA 4X5KA 1MJAA 2J8MA 3R1KA 4KVOE 3TFYA 5JQ4A 1QSRA 4JXRA 1U6MA 4KOXA 3JVNA 1Y9WA 4Y49C 3TOAA 4QVTA 4IUSA 4NF1A 3P2HA 4FD4A 2P6EA 3OWCA 4KVME 2Q7BA 2HQYA 4KLVA 3PGPA 2Q4VA 4E0AA 1L0CA 3S6HA 4CAXA 4U9YA 5F49A 1P4NA 3SHPA 2A4NA 4JXQA 4GS4A 1Q2CA 3P2FA 4UWIA 1PUAA 5IX3A 2B4DB 2PRBA 2P0WA 2IL4A 3DR6A 5KTDA 1I12A 2QMLA 4ORFA 1IB1E 1K4JA 1IYLA 2PC1A 3QAHA 4PSXA 1ON0A 4XPDB 1Y7RA 2I00A 4R9MA 2C27A 1BOBA 2OU2A 4AVAA 2FIWA 2VI7A 2D4OA 3FRMA 2HUZA 2VBQA 4U9ZA 2BEIA 4UA3A 3RYOA 4LUAA 3TT2A 3W91A 4II9A 5CNPA 1M44A 3GY9A 2CNMA 3JUWA
chains in the Genus database with same CATH superfamily
2EWBA 4M3SA 1XF8A 2PR1A 2REEA 2ANPA 4PPZA 4XNHB 3B7IA 5D8NA 3QNVA 3S6FA 2BUEA 5ISVA 4R87A 4F6AA 2CTBA 5AG4A 2B5GB 4BMHA 1AUGA 5CBMA 2FIAA 5EBVA 2ODFA 3CT9A 3S9NA 1B87A 4YFJA 4MFZA 4P4EA 3GIUA 4A33A 3CPAA 3NH8A 1CPSA 4MMOA 3GYAA 1RXTA 1VIXA 2ABZA 4MCQA 1Z4EA 1IICA 3KKWA 2EUIA 1LAPA 3GUXA 4PK2A 4H6ZA 1LAMA 4EWTA 3MRUA 2VZZA 4QC6A 4OC1A 2Q0YA 3B3VA 4H2KA 1S7KA 1XRYA 2V8HA 5I4MA 2ZEPA 3RNZA 2Y0MA 2B4DA 3LWUA 4ZY1A 3EFAA 1H8LA 3GKRA 2JDCA 3VATA 3S6GA 2PDOA 2FE7A 4RN7A 4JZ0A 2CXAA 1DTDA 4OKOA 3D7HA 2G3AA 5K8MA 3FF3A 2PJ1A 2PQ8A 2CIJA 3S9LA 3SJGA 3KL9A 1R43A 2WPXA 2PSWA 2YNCC 3D7DA 1TKHA 4CAFA 4MCRA 4MHNA 2OZUA 3H8EA 3WT4A 4YRHA 1MJ9A 4OC4A 4NJRA 2PJ3A 4EFDA 1I21A 4K30A 3PFEA 5LYIA 4B12A 4RUHA 1IU8A 3BLNA 4L89A 3NE7A 4UF4A 4UFXA 2YNEA 4I49A 3F8KA 2P6FA 2PJ4A 3BI1A 3FJUA 3IGRA 1YGHA 3NH5A 2J9AA 2POKA 5G21A 3UY5A 3VH9A 4UFVA 3S9MA 3IO1A 1S7LA 3EXNA 4MHZA 4X3RA 3VWDA 1CBXA 4X2TA 1ARMA 3R9EA 3TCVA 1GHEA 3MGDA 3TE4A 3KR5A 3PP9A 1Z2LA 2DF5A 4R7MA 3BJ7A 2R7HA 2O4HA 1CM0A 1X12A 2QIRA 2Z3NA 4HNXB 4KOSA 4A37A 2CNTA 2YNDA 1TIQA 3CZXA 4NFRA 3N5FA 4TWEA 4ZY0A 4NGNA 3KQXA 5EC4A 2AFOA 2B3UA 5HH1A 4BBHA 1XFOA 4E2AA 4F9VA 1MK4A 2VZYA 2ZPAA 1YW6A 3CXSA 4JD6A 4YGOA 5G22A 4B13A 3D3SA 5A28A 4LX9A 2PJ8A 3H8FA 5H86A 4KSIA 2PIYA 2B5GA 2QJ8A 2NMTA 2G9DA 3B8GA 4R76A 2Q7SA 4MFKA 2RC4A 2Z3OA 1DE4C 4R57A 4ZI6A 5KTCA 3BI0A 2F7VA 5HVGA 2C6GA 4KVXA 4R8FA 2OH1A 5K8OA 3T90A 4MHDA 4KSAA 5EMIA 1S60A 4UBRA 4JWPA 3TOBA 5AGEA 2REFA 3LD2A 2FXFA 2KCWA 4MFJA 4A31A 4OIWA 1KUYA 2RB7A 4OC5A 4KUAA 1XMBA 4F0XA 1J4JA 3H8GA 2PRQA 4UCNA 1JQGA 4K3NA 5J8FA 4R3KA 4A39A 1TKFA 3K2KA 3PB7X 3DSBA 4DJLA 1KWMA 1VKCA 3SJEA 4MCSA 4OAEA 5AG7A 3K9UA 4NSQA 3FMCA 2C6CA 2B58A 1YX0A 4LQ6A 4UCPA 3T9YA 1XIXA 4AXVA 2PR8A 2V8GA 5LYFA 4UEEA 3FB3A 4P4BA 4M6GA 5I0CA 4H89A 3IWGA 1Y0RA 5F47A 3F0AA 4AVCA 4L8AA 1EE3P 3DGVA 5ELYA 4Q36A 1FT7A 4EVYA 3TO7A 2X7BA 4FD7A 1CPXA 4OC0A 2K5TA 1ZG7A 3CDXA 4FD5A 1FY7A 3VARA 1M4GA 5C82A 4EMEA 4IK2A 2J8NA 1AYEA 4CRZB 2ZW6A 1CJWA 1ZO0A 2QECA 4MJ8A 3NFZA 4Y49B 3VWEA 3KASA 3KI9A 1RO5A 3D4UA 1BLLE 2OZGA 3KHXA 5DS0A 1NSLA 4A32A 4IF5A 4IHMA 2ZEDA 4MBUA 2CY2A 2Z11A 3HLPA 1Z8TA 5GCNA 4QUSA 1A2ZA 1XEBA 4FAIA 1OZPA 5LRKA 2D4PA 3IEHA 1S7NA 3PB9X 2ZENA 4NCZA 8CPAA 3TX8A 2AJ6A 2EVNA 2JLMA 4OP4A 1LANA 4GM5A 1VGYA 1YREA 2GLJA 2R98A 4MY0A 4OC2A 1BO4A 5D29A 3RO0A 3F5BA 3IU2A 4OLLA 4JYWA 4P44A 4Q7AA 4QB9A 2JEWA 2Z10A 2Q04A 3FIXA 5G1ZA 1WK4A 1Z4RA 1B6BA 2ZW7A 1XJOA 4MXUA 1XBUA 3WC6A 1M4IA 2GANA 5J8CA 3D8PA 2C1CA 3NA6A 4MFQA 4B5OA 3FYNA 4X8IA 4CYNA 3R9FA 4CS0B 3EO4A 1VHEA 3PZJA 2IJZA 3HUVA 4CYOA 4OC3A 1ZG9A 2NSMA 3MN8A 2Z3LA 1OBRA 1QQ9A 3PBBA 4P4IA 2YGWA 3JRUA 5E96A 5JM6A 2I3CA 2VL1A 2YNCA 4XPLA 4CAVA 3PEIA 4CGOA 4HPSA 1Z8WA 1X10A 1YK3A 4J3GA 3ISZA 4PQAA 1LOKA 2WUUA 4UWJA 5LRJA 2PVVA 1QSOA 1BPMA 3CXPA 4ONUA 5DWMA 2EBJA 3W6XA 3CPXA 1TXRA 1BPNA 1XE4A 2JEVA 3R9GA 6CPAA 4PXEA 4NGQA 4C2ZA 4GXHA 3KGQA 4NGSA 5F09A 4ZGYB 4NGMA 2ZEEA 3RZAA 5IB0A 4JLYA 2O28A 3PB6X 4QBJA 2WZNA 4R6TA 5J1QA 4NGRA 2FVGA 2IMOA 2RFHA 2PJCA 4RS2A 3W6SA 4KLWA 2XEJA 4NGTA 4W9YA 3G3SA 3B3WA 3TO6A 4PK3A 1HDUA 4WWVA 3FEEA 1I1DA 5HXDA 2XEFA 4A30A 4NXYA 4A2ZA 2JDDA 4DUKA 3E0KA 2G0BA 3WABA 1HDQA 4FUUA 5F46A 3K9TA 2FT0A 2PIZA 3SJFA 3FECA 5AG6A 1S5KA 1R3NA 2H5MA 2EK9A 4M6IA 2ZW4A 4KORA 4MHYA 2ZXVA 5THWA 1VHOA 3ZJ0A 4B10A 4CGLA 2BL1A 4JJXA 2I79A 5HVFA 3ZZIA 4DNCA 1XMTA 4MHPA 4CRYB 1PCAA 3SI0A 3TO9A 7CPAA 3S6KA 2EK8A 5IV0A 1ARLA 1Z5RA 4CGMA 5LYLA 5HVHA 4MFLA 4AB7A 1YVKA 2B4BA 1QSMA 4MRIA 2ARHA 1Y7EA 1YW4A 4MI4A 4PSWA 4XNHC 2BSWA 3SXOA 3ISXA 5LRGA 1YSJA 3A9LA 2PVWA 1ZG8A 4MCPA 2GU2A 4P10A 1Q7LA 1M1DA 3TC8A 3KR4A 2EO8A 1VHSA 2PJ2A 2BO9A 2Q4YA 3FNCA 4KOWA 1F57A 1SQHA 2AFSA 3G8WA 2F5IA 3EC4A 4RI1A 2Q4ZA 3EY5A 3FBUA 1P0HA 4HNYB 2DPSA 1ELLP 3V38A 3IWEA 4AVBA 4DYOA 1F2PA 3RAMA 4KZTA 5F48A 4FBEA 2JBJA 3TTHA 1UFHA 1KZFA 4C68A 5K8PA 3SXNA 1Y9KA 4ZY2A 2OR4A 2Z3MA 3H4QA 1Z9UA 4YWYA 4UEZA 1LFWA 4B5PA 4LQGA 4A38A 5H84A 3H5ZA 1NMTA 3I1UA 2IQ6A 3C26A 1WWZA 2GFQA 2PJ6A 1MJBA 4CPAA 5C88A 5KTAA 3SI1A 2AFWA 5A27A 1YVOA 1YMEA 2CNSA 2QYVA 3D2MA 2QVPA 1LRZA 3RBUA 4BINA 4HNWB 2Z0ZA 4C7HA 4E8OA 4NEXA 4ONWA 4KOVA 3WC5A 3PFOA 1S7FA 1R57A 4PV6A 3LMSA 1QSNA 2FCKA 3QB8A 3R95A 4AG7A 1TF8A 2GLFA 4P4FA 4MY3A 2AFZA 4F0YA 1IY7A 2Q51A 3D7GA 3IWWA 4B6ZA 4F8ZA 1M4LA 2FS5A 4CAWA 1V0CA 4KUBA 3B3CA 2NYQA 3BJ8A 1Q2YA 3DNSA 1JWQA 1Z8LA 4OADA 1M4DA 3CXQA 2XEGA 3IU1A 3PBEA 3WR7A 2Q44A 4R3LA 2AFMA 2CTCA 4P4DA 3D68A 1CP7A 1IYKA 3D2PA 2P6GA 3PB4X 1KUVA 2ZOFA 2VEZA 1RTQA 2R1IA 4HKFA 3V8IA 2FSRA 4U5YA 3NH4A 2ZEHA 2HV2A 2B3VA 1NE9A 1NSAA 2PE3A 4A95A 2GIVA 1YQEA 2Q43A 4P6YA 1CG2A 4B11A 3PRTA 2ZW5A 3PB8X 3R96A 1F2OA 4UFWA 4FD6A 5JGFA 4IAVA 3NE8A 3T8WA 1YLEA 2DXQA 4A94A 4Q38A 2AE6A 3V7ZA 4OIDA 1YR0A 1BAVA 3N7ZA 4M85A 4PXBA 4CAEA 2VQYA 2VXKA 4AG9A 3LODA 2JBKA 1CX8A 2DPTA 2ATRA 3KQZA 5FVJA 4NGPA 2PJBA 5K8NA 3LACA 2PJ7A 2GE3A 4H6UA 4KSFA 5DWNA 1S3ZA 4B5PB 4P4JA 4UIAA 2J8RA 2OB0A 2ZEFA 3I9SA 1N71A 2BCOA 2GREA 3B3TA 3BHXA 4P45A 2R8VA 3I3GA 3DDDA 1TKJA 3FXTA 3KZWA 3DLJA 1Z8XA 2WPWA 1QSTA 2PJ9A 5LYDA 1IIDA 1UWYA 4XPKA 1PU9A 3GLJA 4ZBGA 3IJ3A 2FL4A 2F8HA 2OZHA 1KUXA 2ZOGA 3DR8A 4XPDC 3SJXA 5JH9A 4OMEA 3B35A 2G3TA 3FX6A 4KOYA 5HMNA 2Z3PA 1Q2DA 4KOUA 2OOTA 5JPHA 2DEAA 4KOTA 3BXMA 4X5KA 1MJAA 3D66A 2J8MA 3L2NA 4UCMA 4UIBA 3R1KA 4KVOE 4B14A 3FH4A 2CF4A 2PJAA 3TFYA 5JQ4A 1QSRA 4JXRA 2V8VA 1U6MA 4KOXA 3JVNA 1Y9WA 4NJQA 4Y49C 3TOAA 1ELMP 1HEEA 3B2YA 2Z3KA 4QVTA 4IUSA 4NF1A 1AMPA 3P2HA 4FD4A 4KS9A 2P6EA 2WYRA 5BWAB 3IIBA 4O23A 3OWCA 4KVME 2Q7BA 2AFUA 2XEIA 2HQYA 5AG5A 4KLVA 3PGPA 2Q4VA 4E0AA 1L0CA 3D7FA 3JTKA 1ZLHA 4WJBA 5G20A 3S6HA 2C6PA 4CAXA 5CPAA 4U9YA 5F49A 4CGNA 1P4NA 3SHPA 2ZEGA 1GYTA 2A4NA 3SI2A 4JXQA 4GS4A 1Q2CA 3IC1A 2PCUA 3P2FA 4UWIA 1PUAA 5IX3A 2PJ5A 4PXDA 5IB9A 2B4DB 1FNOA 2PRBA 1CP6A 2P0WA 4CYPA 2IL4A 3DR6A 2ZEOA 2ZEMA 5KTDA 1I12A 4Z65A 4MFPA 2QMLA 4CGPA 4ORFA 1IGBA 1YLOA 1IB1E 2AFXA 1K4JA 1IYLA 4PXCA 2HB6A 1IOFA 2PC1A 3QAHA 4ZX8A 3QAYA 2O53A 1ON0A 2HC9A 2ZELA 1Y7RA 4PSXA 4XPDB 3KHZA 4CYQA 2V8DA 2I00A 4C7IA 4R9MA 4UEFA 1LCPA 2C27A 2WSAA 3IFEA 1BOBA 2OU2A 1ZLIA 4AVAA 2FIWA 2V77A 2VI7A 1QMUA 2D4OA 3FRMA 4M6HA 2HUZA 4C2XA 2VBQA 4TNUA 1Y0YA 4ZX9A 3WC7A 4FWUA 4BD9A 4ZYQA 4U9ZA 2BEIA 4UA3A 2BOAA 4LUAA 3RYOA 3TT2A 3W91A 3FVLA 4C2YA 4II9A 1IOIA 3FEDA 4YU9A 1XOVA 1TF9A 4F9UA 5CNPA 1M44A 3GY9A 1PYTB 3B3SA 3GB0A 2CNMA 3JUWA 3D67A 2PJ0A 4G1PA
chains in the Genus database with same CATH topology
4M3SA 1XF8A 2PR1A 2REEA 4XNHB 3S6FA 2BUEA 5ISVA 4R87A 4F6AA 5AG4A 2B5GB 4BMHA 2FIAA 5EBVA 1B87A 4YFJA 4MFZA 4A33A 5G20A 3GYAA 1RXTA 1Z4EA 1IICA 3KKWA 2EUIA 4PK2A 4H6ZA 2VZZA 4QC6A 2Q0YA 1S7KA 2Y0MA 2B4DA 3EFAA 3GKRA 2JDCA 3S6GA 2PDOA 2FE7A 2CXAA 2G3AA 2PQ8A 2WPXA 2PSWA 2YNCC 4CAFA 2OZUA 4YRHA 1MJ9A 1I21A 4K30A 4B12A 3BLNA 4L89A 3NE7A 4UFXA 2YNEA 4I49A 3F8KA 2P6FA 3UY5A 3IGRA 1YGHA 5G21A 4UFVA 1S7LA 3EXNA 3VWDA 3R9EA 3TCVA 1GHEA 3MGDA 3TE4A 3PP9A 3BJ7A 2R7HA 1CM0A 2QIRA 2Z3NA 4HNXB 4KOSA 2CNTA 2YNDA 1TIQA 5EC4A 2B3UA 5HH1A 4BBHA 4E2AA 1MK4A 2VZYA 2ZPAA 3CXSA 4JD6A 4YGOA 5G22A 4B13A 3D3SA 5A28A 4LX9A 5H86A 2B5GA 2NMTA 3B8GA 4MFKA 2RC4A 2Z3OA 4R57A 5KTCA 4KVXA 2OH1A 3T90A 4MHDA 4KSAA 1S60A 4UBRA 4JWPA 3TOBA 5AGEA 2REFA 3LD2A 2FXFA 2KCWA 4MFJA 4A31A 1KUYA 4KUAA 4F0XA 1J4JA 4UCNA 5J8FA 4R3KA 3DSBA 1VKCA 4OAEA 5AG7A 3K9UA 4NSQA 3T9YA 4UCPA 2B58A 1YX0A 1XIXA 2PR8A 3FB3A 5I0CA 4H89A 3IWGA 5F47A 3F0AA 4AVCA 4L8AA 4EVYA 4Q36A 3TO7A 2X7BA 4FD7A 2K5TA 4FD5A 1FY7A 1M4GA 5C82A 2J8NA 4CRZB 2ZW6A 1CJWA 1ZO0A 2QECA 4MJ8A 4Y49B 3VWEA 1RO5A 2OZGA 1NSLA 4A32A 4IF5A 4MBUA 2CY2A 2Z11A 5GCNA 4QUSA 1XEBA 1OZPA 2D4PA 1S7NA 4NCZA 2AJ6A 2EVNA 2JLMA 1YREA 2R98A 4MY0A 1BO4A 3F5BA 3IU2A 4OLLA 4QB9A 2Z10A 2Q04A 3FIXA 5G1ZA 1WK4A 1Z4RA 1B6BA 2ZW7A 1M4IA 2GANA 5J8CA 3D8PA 4MFQA 4B5OA 3FYNA 4CYNA 3R9FA 4CS0B 3EO4A 3PZJA 4CYOA 2Z3LA 2YGWA 5E96A 2YNCA 4XPLA 4CGOA 4CAVA 1YK3A 4J3GA 4UWJA 2WUUA 1QSOA 3CXPA 4ONUA 5DWMA 3W6XA 1XE4A 2JEVA 3R9GA 4C2ZA 4ZGYB 5IB0A 4JLYA 2O28A 4QBJA 4RS2A 3W6SA 4KLWA 3G3SA 3TO6A 4PK3A 1I1DA 4A30A 4NXYA 4A2ZA 2JDDA 3E0KA 2G0BA 5F46A 2FT0A 5AG6A 1S5KA 2H5MA 3ZJ0A 2ZW4A 4KORA 2ZXVA 4B10A 4CGLA 2BL1A 4JJXA 2I79A 3ZZIA 4DNCA 1XMTA 4CRYB 3TO9A 3S6KA 5IV0A 4CGMA 4MFLA 4AB7A 1YVKA 2B4BA 1QSMA 2ARHA 4MI4A 4PSWA 4XNHC 2BSWA 3SXOA 3A9LA 1M1DA 1VHSA 2Q4YA 3FNCA 4KOWA 1SQHA 3G8WA 2F5IA 3EC4A 4RI1A 3EY5A 3FBUA 1P0HA 4HNYB 2DPSA 3IWEA 4AVBA 4KZTA 5F48A 3TTHA 1UFHA 1KZFA 4C68A 3SXNA 1Y9KA 2Z3MA 3H4QA 1Z9UA 4B5PA 5H84A 3H5ZA 1NMTA 3C26A 1WWZA 1MJBA 5C88A 5KTAA 5A27A 1YVOA 2CNSA 3D2MA 1LRZA 4HNWB 2Z0ZA 4C7HA 4E8OA 4NEXA 4KOVA 1S7FA 1R57A 4PV6A 1QSNA 2FCKA 3QB8A 3R95A 4AG7A 4F0YA 4MY3A 2FS5A 4CAWA 1V0CA 4KUBA 3BJ8A 1Q2YA 3DNSA 4OADA 1M4DA 3CXQA 3IU1A 3WR7A 2Q44A 4R3LA 1IYKA 3D2PA 2P6GA 1KUVA 2VEZA 2R1IA 4HKFA 3V8IA 2FSRA 4U5YA 2HV2A 2B3VA 1NE9A 4A95A 2GIVA 4B11A 2ZW5A 3R96A 4UFWA 4FD6A 1YLEA 2DXQA 4Q38A 2AE6A 1YR0A 3N7ZA 4M85A 4CAEA 2VQYA 2VXKA 4AG9A 3LODA 2DPTA 5FVJA 2ATRA 2GE3A 4H6UA 4KSFA 5DWNA 1S3ZA 4B5PB 2J8RA 2OB0A 3I9SA 1N71A 2R8VA 3I3GA 3DDDA 3FXTA 2WPWA 1QSTA 1IIDA 4XPKA 1PU9A 4ZBGA 2FL4A 2OZHA 1KUXA 3DR8A 4XPDC 2G3TA 4KOYA 5HMNA 2Z3PA 1Q2DA 4KOUA 5JPHA 4KOTA 4X5KA 1MJAA 2J8MA 4UCMA 3R1KA 4KVOE 4B14A 3TFYA 5JQ4A 1QSRA 4JXRA 1U6MA 4KOXA 3JVNA 1Y9WA 4Y49C 3TOAA 2Z3KA 4QVTA 4IUSA 4NF1A 3P2HA 4FD4A 4KS9A 2P6EA 5BWAB 3OWCA 4KVME 2Q7BA 2HQYA 5AG5A 4KLVA 3PGPA 2Q4VA 4E0AA 1L0CA 3JTKA 3S6HA 4CAXA 4CGNA 4U9YA 5F49A 1P4NA 3SHPA 2A4NA 4JXQA 4GS4A 1Q2CA 3P2FA 4UWIA 1PUAA 5IX3A 2B4DB 2PRBA 2P0WA 4CYPA 2IL4A 3DR6A 5KTDA 1I12A 4MFPA 2QMLA 4CGPA 4ORFA 1IB1E 1K4JA 1IYLA 2PC1A 3QAHA 4PSXA 1ON0A 4XPDB 1Y7RA 4CYQA 2I00A 4C7IA 4R9MA 2C27A 2WSAA 1BOBA 2OU2A 4AVAA 2FIWA 4C2XA 2VI7A 2D4OA 3FRMA 2HUZA 2VBQA 4U9ZA 2BEIA 4UA3A 3RYOA 4LUAA 3TT2A 3W91A 4C2YA 4II9A 5CNPA 1M44A 3GY9A 2CNMA 3JUWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4M3S A;  1XF8 A;  2PR1 A;  2REE A;  4XNH B;  3S6F A;  2BUE A;  5ISV A;  4R87 A;  4F6A A;  2B5G B;  4BMH A;  2FIA A;  5EBV A;  1B87 A;  4YFJ A;  3GYA A;  1RXT A;  1Z4E A;  1IIC A;  3KKW A;  2EUI A;  4PK2 A;  4H6Z A;  2VZZ A;  4QC6 A;  2Q0Y A;  1S7K A;  2Y0M A;  2B4D A;  3EFA A;  3GKR A;  2JDC A;  3S6G A;  2PDO A;  2FE7 A;  2G3A A;  2PQ8 A;  2WPX A;  2PSW A;  2OZU A;  4YRH A;  1MJ9 A;  1I21 A;  4K30 A;  3BLN A;  4L89 A;  3NE7 A;  4I49 A;  3F8K A;  2P6F A;  3UY5 A;  3IGR A;  1YGH A;  1S7L A;  3EXN A;  3VWD A;  3R9E A;  3TCV A;  1GHE A;  3MGD A;  3TE4 A;  3PP9 A;  3BJ7 A;  2R7H A;  1CM0 A;  2QIR A;  4HNX B;  4KOS A;  2CNT A;  1TIQ A;  5EC4 A;  2B3U A;  5HH1 A;  4E2A A;  1MK4 A;  2VZY A;  2ZPA A;  3CXS A;  4JD6 A;  4YGO A;  3D3S A;  4LX9 A;  5H86 A;  2B5G A;  2NMT A;  3B8G A;  2RC4 A;  4R57 A;  5KTC A;  4KVX A;  2OH1 A;  3T90 A;  4MHD A;  1S60 A;  4UBR A;  4JWP A;  3TOB A;  2REF A;  3LD2 A;  2FXF A;  2KCW A;  1KUY A;  4KUA A;  1J4J A;  5J8F A;  4R3K A;  3DSB A;  1VKC A;  4OAE A;  3K9U A;  4NSQ A;  3T9Y A;  2B58 A;  1YX0 A;  1XIX A;  2PR8 A;  3FB3 A;  5I0C A;  4H89 A;  3IWG A;  5F47 A;  3F0A A;  4AVC A;  4L8A A;  4EVY A;  3TO7 A;  2X7B A;  4FD7 A;  2K5T A;  4FD5 A;  1FY7 A;  1M4G A;  5C82 A;  2J8N A;  4CRZ B;  2ZW6 A;  1CJW A;  2QEC A;  4MJ8 A;  4Y49 B;  3VWE A;  1RO5 A;  2OZG A;  1NSL A;  4IF5 A;  4MBU A;  2CY2 A;  2Z11 A;  5GCN A;  4QUS A;  1XEB A;  1OZP A;  2D4P A;  1S7N A;  4NCZ A;  2AJ6 A;  2EVN A;  2JLM A;  1YRE A;  2R98 A;  4MY0 A;  1BO4 A;  3F5B A;  4OLL A;  4QB9 A;  2Z10 A;  2Q04 A;  3FIX A;  1WK4 A;  1Z4R A;  1B6B A;  2ZW7 A;  1M4I A;  2GAN A;  5J8C A;  3D8P A;  4B5O A;  3FYN A;  3R9F A;  4CS0 B;  3EO4 A;  3PZJ A;  5E96 A;  4XPL A;  4CAV A;  1YK3 A;  4J3G A;  4UWJ A;  1QSO A;  3CXP A;  4ONU A;  5DWM A;  3W6X A;  1XE4 A;  2JEV A;  3R9G A;  5IB0 A;  4JLY A;  2O28 A;  4QBJ A;  4RS2 A;  3W6S A;  4KLW A;  3G3S A;  3TO6 A;  4PK3 A;  1I1D A;  4NXY A;  2JDD A;  3E0K A;  2G0B A;  5F46 A;  2FT0 A;  1S5K A;  2H5M A;  3ZJ0 A;  2ZW4 A;  4KOR A;  2ZXV A;  2BL1 A;  4JJX A;  2I79 A;  3ZZI A;  4DNC A;  1XMT A;  4CRY B;  3TO9 A;  3S6K A;  5IV0 A;  4AB7 A;  1YVK A;  2B4B A;  1QSM A;  2ARH A;  4MI4 A;  4PSW A;  4XNH C;  2BSW A;  3SXO A;  1M1D A;  1VHS A;  2Q4Y A;  3FNC A;  4KOW A;  1SQH A;  3G8W A;  2F5I A;  3EC4 A;  4RI1 A;  3EY5 A;  3FBU A;  1P0H A;  4HNY B;  4AVB A;  4KZT A;  5F48 A;  3TTH A;  1UFH A;  1KZF A;  3SXN A;  1Y9K A;  3H4Q A;  1Z9U A;  4B5P A;  5H84 A;  1NMT A;  3C26 A;  1WWZ A;  1MJB A;  5C88 A;  5KTA A;  1YVO A;  2CNS A;  3D2M A;  1LRZ A;  4HNW B;  2Z0Z A;  4E8O A;  4NEX A;  4KOV A;  1S7F A;  1R57 A;  4PV6 A;  1QSN A;  2FCK A;  3QB8 A;  3R95 A;  4AG7 A;  4F0Y A;  4MY3 A;  2FS5 A;  4CAW A;  1V0C A;  4KUB A;  3BJ8 A;  1Q2Y A;  3DNS A;  4OAD A;  1M4D A;  3CXQ A;  3WR7 A;  2Q44 A;  4R3L A;  1IYK A;  3D2P A;  2P6G A;  1KUV A;  2VEZ A;  2R1I A;  4HKF A;  3V8I A;  2FSR A;  4U5Y A;  2HV2 A;  2B3V A;  1NE9 A;  2GIV A;  2ZW5 A;  3R96 A;  4FD6 A;  1YLE A;  2DXQ A;  2AE6 A;  1YR0 A;  3N7Z A;  4M85 A;  2VQY A;  2VXK A;  4AG9 A;  3LOD A;  5FVJ A;  2ATR A;  2GE3 A;  4H6U A;  5DWN A;  1S3Z A;  4B5P B;  2J8R A;  2OB0 A;  3I9S A;  1N71 A;  2R8V A;  3I3G A;  3DDD A;  3FXT A;  2WPW A;  1QST A;  1IID A;  4XPK A;  1PU9 A;  4ZBG A;  2FL4 A;  2OZH A;  1KUX A;  3DR8 A;  4XPD C;  2G3T A;  4KOY A;  5HMN A;  1Q2D A;  4KOU A;  5JPH A;  4KOT A;  4X5K A;  1MJA A;  2J8M A;  3R1K A;  4KVO E;  3TFY A;  5JQ4 A;  1QSR A;  4JXR A;  1U6M A;  4KOX A;  3JVN A;  1Y9W A;  4Y49 C;  3TOA A;  4QVT A;  4IUS A;  4NF1 A;  3P2H A;  4FD4 A;  2P6E A;  3OWC A;  4KVM E;  2Q7B A;  2HQY A;  4KLV A;  3PGP A;  2Q4V A;  4E0A A;  1L0C A;  3S6H A;  4CAX A;  4U9Y A;  5F49 A;  1P4N A;  3SHP A;  2A4N A;  4JXQ A;  4GS4 A;  1Q2C A;  3P2F A;  4UWI A;  1PUA A;  5IX3 A;  2B4D B;  2PRB A;  2P0W A;  2IL4 A;  3DR6 A;  5KTD A;  1I12 A;  2QML A;  4ORF A;  1IB1 E;  1K4J A;  1IYL A;  2PC1 A;  3QAH A;  4PSX A;  1ON0 A;  4XPD B;  1Y7R A;  2I00 A;  4R9M A;  2C27 A;  1BOB A;  2OU2 A;  4AVA A;  2FIW A;  2VI7 A;  2D4O A;  3FRM A;  2HUZ A;  2VBQ A;  4U9Z A;  2BEI A;  4UA3 A;  3RYO A;  4LUA A;  3TT2 A;  3W91 A;  4II9 A;  5CNP A;  1M44 A;  3GY9 A;  2CNM A;  3JUW A; 
#chains in the Genus database with same CATH topology
 2EWB A;  4M3S A;  1XF8 A;  2PR1 A;  2REE A;  2ANP A;  4PPZ A;  4XNH B;  3B7I A;  5D8N A;  3QNV A;  3S6F A;  2BUE A;  5ISV A;  4R87 A;  4F6A A;  2CTB A;  5AG4 A;  2B5G B;  4BMH A;  1AUG A;  5CBM A;  2FIA A;  5EBV A;  2ODF A;  3CT9 A;  3S9N A;  1B87 A;  4YFJ A;  4MFZ A;  4P4E A;  3GIU A;  4A33 A;  3CPA A;  3NH8 A;  1CPS A;  4MMO A;  3GYA A;  1RXT A;  1VIX A;  2ABZ A;  4MCQ A;  1Z4E A;  1IIC A;  3KKW A;  2EUI A;  1LAP A;  3GUX A;  4PK2 A;  4H6Z A;  1LAM A;  4EWT A;  3MRU A;  2VZZ A;  4QC6 A;  4OC1 A;  2Q0Y A;  3B3V A;  4H2K A;  1S7K A;  1XRY A;  2V8H A;  5I4M A;  2ZEP A;  3RNZ A;  2Y0M A;  2B4D A;  3LWU A;  4ZY1 A;  3EFA A;  1H8L A;  3GKR A;  2JDC A;  3VAT A;  3S6G A;  2PDO A;  2FE7 A;  4RN7 A;  4JZ0 A;  2CXA A;  1DTD A;  4OKO A;  3D7H A;  2G3A A;  5K8M A;  3FF3 A;  2PJ1 A;  2PQ8 A;  2CIJ A;  3S9L A;  3SJG A;  3KL9 A;  1R43 A;  2WPX A;  2PSW A;  2YNC C;  3D7D A;  1TKH A;  4CAF A;  4MCR A;  4MHN A;  2OZU A;  3H8E A;  3WT4 A;  4YRH A;  1MJ9 A;  4OC4 A;  4NJR A;  2PJ3 A;  4EFD A;  1I21 A;  4K30 A;  3PFE A;  5LYI A;  4B12 A;  4RUH A;  1IU8 A;  3BLN A;  4L89 A;  3NE7 A;  4UF4 A;  4UFX A;  2YNE A;  4I49 A;  3F8K A;  2P6F A;  2PJ4 A;  3BI1 A;  3FJU A;  3IGR A;  1YGH A;  3NH5 A;  2J9A A;  2POK A;  5G21 A;  3UY5 A;  3VH9 A;  4UFV A;  3S9M A;  3IO1 A;  1S7L A;  3EXN A;  4MHZ A;  4X3R A;  3VWD A;  1CBX A;  4X2T A;  1ARM A;  3R9E A;  3TCV A;  1GHE A;  3MGD A;  3TE4 A;  3KR5 A;  3PP9 A;  1Z2L A;  2DF5 A;  4R7M A;  3BJ7 A;  2R7H A;  2O4H A;  1CM0 A;  1X12 A;  2QIR A;  2Z3N A;  4HNX B;  4KOS A;  4A37 A;  2CNT A;  2YND A;  1TIQ A;  3CZX A;  4NFR A;  3N5F A;  4TWE A;  4ZY0 A;  4NGN A;  3KQX A;  5EC4 A;  2AFO A;  2B3U A;  5HH1 A;  4BBH A;  1XFO A;  4E2A A;  4F9V A;  1MK4 A;  2VZY A;  2ZPA A;  1YW6 A;  3CXS A;  4JD6 A;  4YGO A;  5G22 A;  4B13 A;  3D3S A;  5A28 A;  4LX9 A;  2PJ8 A;  3H8F A;  5H86 A;  4KSI A;  2PIY A;  2B5G A;  2QJ8 A;  2NMT A;  2G9D A;  3B8G A;  4R76 A;  2Q7S A;  4MFK A;  2RC4 A;  2Z3O A;  1DE4 C;  4R57 A;  4ZI6 A;  5KTC A;  3BI0 A;  2F7V A;  5HVG A;  2C6G A;  4KVX A;  4R8F A;  2OH1 A;  5K8O A;  3T90 A;  4MHD A;  4KSA A;  5EMI A;  1S60 A;  4UBR A;  4JWP A;  3TOB A;  5AGE A;  2REF A;  3LD2 A;  2FXF A;  2KCW A;  4MFJ A;  4A31 A;  4OIW A;  1KUY A;  2RB7 A;  4OC5 A;  4KUA A;  1XMB A;  4F0X A;  1J4J A;  3H8G A;  2PRQ A;  4UCN A;  1JQG A;  4K3N A;  5J8F A;  4R3K A;  4A39 A;  1TKF A;  3K2K A;  3PB7 X;  3DSB A;  4DJL A;  1KWM A;  1VKC A;  3SJE A;  4MCS A;  4OAE A;  5AG7 A;  3K9U A;  4NSQ A;  3FMC A;  2C6C A;  2B58 A;  1YX0 A;  4LQ6 A;  4UCP A;  3T9Y A;  1XIX A;  4AXV A;  2PR8 A;  2V8G A;  5LYF A;  4UEE A;  3FB3 A;  4P4B A;  4M6G A;  5I0C A;  4H89 A;  3IWG A;  1Y0R A;  5F47 A;  3F0A A;  4AVC A;  4L8A A;  1EE3 P;  3DGV A;  5ELY A;  4Q36 A;  1FT7 A;  4EVY A;  3TO7 A;  2X7B A;  4FD7 A;  1CPX A;  4OC0 A;  2K5T A;  1ZG7 A;  3CDX A;  4FD5 A;  1FY7 A;  3VAR A;  1M4G A;  5C82 A;  4EME A;  4IK2 A;  2J8N A;  1AYE A;  4CRZ B;  2ZW6 A;  1CJW A;  1ZO0 A;  2QEC A;  4MJ8 A;  3NFZ A;  4Y49 B;  3VWE A;  3KAS A;  3KI9 A;  1RO5 A;  3D4U A;  1BLL E;  2OZG A;  3KHX A;  5DS0 A;  1NSL A;  4A32 A;  4IF5 A;  4IHM A;  2ZED A;  4MBU A;  2CY2 A;  2Z11 A;  3HLP A;  1Z8T A;  5GCN A;  4QUS A;  1A2Z A;  1XEB A;  4FAI A;  1OZP A;  5LRK A;  2D4P A;  3IEH A;  1S7N A;  3PB9 X;  2ZEN A;  4NCZ A;  8CPA A;  3TX8 A;  2AJ6 A;  2EVN A;  2JLM A;  4OP4 A;  1LAN A;  4GM5 A;  1VGY A;  1YRE A;  2GLJ A;  2R98 A;  4MY0 A;  4OC2 A;  1BO4 A;  5D29 A;  3RO0 A;  3F5B A;  3IU2 A;  4OLL A;  4JYW A;  4P44 A;  4Q7A A;  4QB9 A;  2JEW A;  2Z10 A;  2Q04 A;  3FIX A;  5G1Z A;  1WK4 A;  1Z4R A;  1B6B A;  2ZW7 A;  1XJO A;  4MXU A;  1XBU A;  3WC6 A;  1M4I A;  2GAN A;  5J8C A;  3D8P A;  2C1C A;  3NA6 A;  4MFQ A;  4B5O A;  3FYN A;  4X8I A;  4CYN A;  3R9F A;  4CS0 B;  3EO4 A;  1VHE A;  3PZJ A;  2IJZ A;  3HUV A;  4CYO A;  4OC3 A;  1ZG9 A;  2NSM A;  3MN8 A;  2Z3L A;  1OBR A;  1QQ9 A;  3PBB A;  4P4I A;  2YGW A;  3JRU A;  5E96 A;  5JM6 A;  2I3C A;  2VL1 A;  2YNC A;  4XPL A;  4CAV A;  3PEI A;  4CGO A;  4HPS A;  1Z8W A;  1X10 A;  1YK3 A;  4J3G A;  3ISZ A;  4PQA A;  1LOK A;  2WUU A;  4UWJ A;  5LRJ A;  2PVV A;  1QSO A;  1BPM A;  3CXP A;  4ONU A;  5DWM A;  2EBJ A;  3W6X A;  3CPX A;  1TXR A;  1BPN A;  1XE4 A;  2JEV A;  3R9G A;  6CPA A;  4PXE A;  4NGQ A;  4C2Z A;  4GXH A;  3KGQ A;  4NGS A;  5F09 A;  4ZGY B;  4NGM A;  2ZEE A;  3RZA A;  5IB0 A;  4JLY A;  2O28 A;  3PB6 X;  4QBJ A;  2WZN A;  4R6T A;  5J1Q A;  4NGR A;  2FVG A;  2IMO A;  2RFH A;  2PJC A;  4RS2 A;  3W6S A;  4KLW A;  2XEJ A;  4NGT A;  4W9Y A;  3G3S A;  3B3W A;  3TO6 A;  4PK3 A;  1HDU A;  4WWV A;  3FEE A;  1I1D A;  5HXD A;  2XEF A;  4A30 A;  4NXY A;  4A2Z A;  2JDD A;  4DUK A;  3E0K A;  2G0B A;  3WAB A;  1HDQ A;  4FUU A;  5F46 A;  3K9T A;  2FT0 A;  2PIZ A;  3SJF A;  3FEC A;  5AG6 A;  1S5K A;  1R3N A;  2H5M A;  2EK9 A;  4M6I A;  2ZW4 A;  4KOR A;  4MHY A;  2ZXV A;  5THW A;  1VHO A;  3ZJ0 A;  4B10 A;  4CGL A;  2BL1 A;  4JJX A;  2I79 A;  5HVF A;  3ZZI A;  4DNC A;  1XMT A;  4MHP A;  4CRY B;  1PCA A;  3SI0 A;  3TO9 A;  7CPA A;  3S6K A;  2EK8 A;  5IV0 A;  1ARL A;  1Z5R A;  4CGM A;  5LYL A;  5HVH A;  4MFL A;  4AB7 A;  1YVK A;  2B4B A;  1QSM A;  4MRI A;  2ARH A;  1Y7E A;  1YW4 A;  4MI4 A;  4PSW A;  4XNH C;  2BSW A;  3SXO A;  3ISX A;  5LRG A;  1YSJ A;  3A9L A;  2PVW A;  1ZG8 A;  4MCP A;  2GU2 A;  4P10 A;  1Q7L A;  1M1D A;  3TC8 A;  3KR4 A;  2EO8 A;  1VHS A;  2PJ2 A;  2BO9 A;  2Q4Y A;  3FNC A;  4KOW A;  1F57 A;  1SQH A;  2AFS A;  3G8W A;  2F5I A;  3EC4 A;  4RI1 A;  2Q4Z A;  3EY5 A;  3FBU A;  1P0H A;  4HNY B;  2DPS A;  1ELL P;  3V38 A;  3IWE A;  4AVB A;  4DYO A;  1F2P A;  3RAM A;  4KZT A;  5F48 A;  4FBE A;  2JBJ A;  3TTH A;  1UFH A;  1KZF A;  4C68 A;  5K8P A;  3SXN A;  1Y9K A;  4ZY2 A;  2OR4 A;  2Z3M A;  3H4Q A;  1Z9U A;  4YWY A;  4UEZ A;  1LFW A;  4B5P A;  4LQG A;  4A38 A;  5H84 A;  3H5Z A;  1NMT A;  3I1U A;  2IQ6 A;  3C26 A;  1WWZ A;  2GFQ A;  2PJ6 A;  1MJB A;  4CPA A;  5C88 A;  5KTA A;  3SI1 A;  2AFW A;  5A27 A;  1YVO A;  1YME A;  2CNS A;  2QYV A;  3D2M A;  2QVP A;  1LRZ A;  3RBU A;  4BIN A;  4HNW B;  2Z0Z A;  4C7H A;  4E8O A;  4NEX A;  4ONW A;  4KOV A;  3WC5 A;  3PFO A;  1S7F A;  1R57 A;  4PV6 A;  3LMS A;  1QSN A;  2FCK A;  3QB8 A;  3R95 A;  4AG7 A;  1TF8 A;  2GLF A;  4P4F A;  4MY3 A;  2AFZ A;  4F0Y A;  1IY7 A;  2Q51 A;  3D7G A;  3IWW A;  4B6Z A;  4F8Z A;  1M4L A;  2FS5 A;  4CAW A;  1V0C A;  4KUB A;  3B3C A;  2NYQ A;  3BJ8 A;  1Q2Y A;  3DNS A;  1JWQ A;  1Z8L A;  4OAD A;  1M4D A;  3CXQ A;  2XEG A;  3IU1 A;  3PBE A;  3WR7 A;  2Q44 A;  4R3L A;  2AFM A;  2CTC A;  4P4D A;  3D68 A;  1CP7 A;  1IYK A;  3D2P A;  2P6G A;  3PB4 X;  1KUV A;  2ZOF A;  2VEZ A;  1RTQ A;  2R1I A;  4HKF A;  3V8I A;  2FSR A;  4U5Y A;  3NH4 A;  2ZEH A;  2HV2 A;  2B3V A;  1NE9 A;  1NSA A;  2PE3 A;  4A95 A;  2GIV A;  1YQE A;  2Q43 A;  4P6Y A;  1CG2 A;  4B11 A;  3PRT A;  2ZW5 A;  3PB8 X;  3R96 A;  1F2O A;  4UFW A;  4FD6 A;  5JGF A;  4IAV A;  3NE8 A;  3T8W A;  1YLE A;  2DXQ A;  4A94 A;  4Q38 A;  2AE6 A;  3V7Z A;  4OID A;  1YR0 A;  1BAV A;  3N7Z A;  4M85 A;  4PXB A;  4CAE A;  2VQY A;  2VXK A;  4AG9 A;  3LOD A;  2JBK A;  1CX8 A;  2DPT A;  2ATR A;  3KQZ A;  5FVJ A;  4NGP A;  2PJB A;  5K8N A;  3LAC A;  2PJ7 A;  2GE3 A;  4H6U A;  4KSF A;  5DWN A;  1S3Z A;  4B5P B;  4P4J A;  4UIA A;  2J8R A;  2OB0 A;  2ZEF A;  3I9S A;  1N71 A;  2BCO A;  2GRE A;  3B3T A;  3BHX A;  4P45 A;  2R8V A;  3I3G A;  3DDD A;  1TKJ A;  3FXT A;  3KZW A;  3DLJ A;  1Z8X A;  2WPW A;  1QST A;  2PJ9 A;  5LYD A;  1IID A;  1UWY A;  4XPK A;  1PU9 A;  3GLJ A;  4ZBG A;  3IJ3 A;  2FL4 A;  2F8H A;  2OZH A;  1KUX A;  2ZOG A;  3DR8 A;  4XPD C;  3SJX A;  5JH9 A;  4OME A;  3B35 A;  2G3T A;  3FX6 A;  4KOY A;  5HMN A;  2Z3P A;  1Q2D A;  4KOU A;  2OOT A;  5JPH A;  2DEA A;  4KOT A;  3BXM A;  4X5K A;  1MJA A;  3D66 A;  2J8M A;  3L2N A;  4UCM A;  4UIB A;  3R1K A;  4KVO E;  4B14 A;  3FH4 A;  2CF4 A;  2PJA A;  3TFY A;  5JQ4 A;  1QSR A;  4JXR A;  2V8V A;  1U6M A;  4KOX A;  3JVN A;  1Y9W A;  4NJQ A;  4Y49 C;  3TOA A;  1ELM P;  1HEE A;  3B2Y A;  2Z3K A;  4QVT A;  4IUS A;  4NF1 A;  1AMP A;  3P2H A;  4FD4 A;  4KS9 A;  2P6E A;  2WYR A;  5BWA B;  3IIB A;  4O23 A;  3OWC A;  4KVM E;  2Q7B A;  2AFU A;  2XEI A;  2HQY A;  5AG5 A;  4KLV A;  3PGP A;  2Q4V A;  4E0A A;  1L0C A;  3D7F A;  3JTK A;  1ZLH A;  4WJB A;  5G20 A;  3S6H A;  2C6P A;  4CAX A;  5CPA A;  4U9Y A;  5F49 A;  4CGN A;  1P4N A;  3SHP A;  2ZEG A;  1GYT A;  2A4N A;  3SI2 A;  4JXQ A;  4GS4 A;  1Q2C A;  3IC1 A;  2PCU A;  3P2F A;  4UWI A;  1PUA A;  5IX3 A;  2PJ5 A;  4PXD A;  5IB9 A;  2B4D B;  1FNO A;  2PRB A;  1CP6 A;  2P0W A;  4CYP A;  2IL4 A;  3DR6 A;  2ZEO A;  2ZEM A;  5KTD A;  1I12 A;  4Z65 A;  4MFP A;  2QML A;  4CGP A;  4ORF A;  1IGB A;  1YLO A;  1IB1 E;  2AFX A;  1K4J A;  1IYL A;  4PXC A;  2HB6 A;  1IOF A;  2PC1 A;  3QAH A;  4ZX8 A;  3QAY A;  2O53 A;  1ON0 A;  2HC9 A;  2ZEL A;  1Y7R A;  4PSX A;  4XPD B;  3KHZ A;  4CYQ A;  2V8D A;  2I00 A;  4C7I A;  4R9M A;  4UEF A;  1LCP A;  2C27 A;  2WSA A;  3IFE A;  1BOB A;  2OU2 A;  1ZLI A;  4AVA A;  2FIW A;  2V77 A;  2VI7 A;  1QMU A;  2D4O A;  3FRM A;  4M6H A;  2HUZ A;  4C2X A;  2VBQ A;  4TNU A;  1Y0Y A;  4ZX9 A;  3WC7 A;  4FWU A;  4BD9 A;  4ZYQ A;  4U9Z A;  2BEI A;  4UA3 A;  2BOA A;  4LUA A;  3RYO A;  3TT2 A;  3W91 A;  3FVL A;  4C2Y A;  4II9 A;  1IOI A;  3FED A;  4YU9 A;  1XOV A;  1TF9 A;  4F9U A;  5CNP A;  1M44 A;  3GY9 A;  1PYT B;  3B3S A;  3GB0 A;  2CNM A;  3JUW A;  3D67 A;  2PJ0 A;  4G1P A; 
#chains in the Genus database with same CATH homology
 4M3S A;  1XF8 A;  2PR1 A;  2REE A;  4XNH B;  3S6F A;  2BUE A;  5ISV A;  4R87 A;  4F6A A;  5AG4 A;  2B5G B;  4BMH A;  2FIA A;  5EBV A;  1B87 A;  4YFJ A;  4MFZ A;  4A33 A;  5G20 A;  3GYA A;  1RXT A;  1Z4E A;  1IIC A;  3KKW A;  2EUI A;  4PK2 A;  4H6Z A;  2VZZ A;  4QC6 A;  2Q0Y A;  1S7K A;  2Y0M A;  2B4D A;  3EFA A;  3GKR A;  2JDC A;  3S6G A;  2PDO A;  2FE7 A;  2CXA A;  2G3A A;  2PQ8 A;  2WPX A;  2PSW A;  2YNC C;  4CAF A;  2OZU A;  4YRH A;  1MJ9 A;  1I21 A;  4K30 A;  4B12 A;  3BLN A;  4L89 A;  3NE7 A;  4UFX A;  2YNE A;  4I49 A;  3F8K A;  2P6F A;  3UY5 A;  3IGR A;  1YGH A;  5G21 A;  4UFV A;  1S7L A;  3EXN A;  3VWD A;  3R9E A;  3TCV A;  1GHE A;  3MGD A;  3TE4 A;  3PP9 A;  3BJ7 A;  2R7H A;  1CM0 A;  2QIR A;  2Z3N A;  4HNX B;  4KOS A;  2CNT A;  2YND A;  1TIQ A;  5EC4 A;  2B3U A;  5HH1 A;  4BBH A;  4E2A A;  1MK4 A;  2VZY A;  2ZPA A;  3CXS A;  4JD6 A;  4YGO A;  5G22 A;  4B13 A;  3D3S A;  5A28 A;  4LX9 A;  5H86 A;  2B5G A;  2NMT A;  3B8G A;  4MFK A;  2RC4 A;  2Z3O A;  4R57 A;  5KTC A;  4KVX A;  2OH1 A;  3T90 A;  4MHD A;  4KSA A;  1S60 A;  4UBR A;  4JWP A;  3TOB A;  5AGE A;  2REF A;  3LD2 A;  2FXF A;  2KCW A;  4MFJ A;  4A31 A;  1KUY A;  4KUA A;  4F0X A;  1J4J A;  4UCN A;  5J8F A;  4R3K A;  3DSB A;  1VKC A;  4OAE A;  5AG7 A;  3K9U A;  4NSQ A;  3T9Y A;  4UCP A;  2B58 A;  1YX0 A;  1XIX A;  2PR8 A;  3FB3 A;  5I0C A;  4H89 A;  3IWG A;  5F47 A;  3F0A A;  4AVC A;  4L8A A;  4EVY A;  4Q36 A;  3TO7 A;  2X7B A;  4FD7 A;  2K5T A;  4FD5 A;  1FY7 A;  1M4G A;  5C82 A;  2J8N A;  4CRZ B;  2ZW6 A;  1CJW A;  1ZO0 A;  2QEC A;  4MJ8 A;  4Y49 B;  3VWE A;  1RO5 A;  2OZG A;  1NSL A;  4A32 A;  4IF5 A;  4MBU A;  2CY2 A;  2Z11 A;  5GCN A;  4QUS A;  1XEB A;  1OZP A;  2D4P A;  1S7N A;  4NCZ A;  2AJ6 A;  2EVN A;  2JLM A;  1YRE A;  2R98 A;  4MY0 A;  1BO4 A;  3F5B A;  3IU2 A;  4OLL A;  4QB9 A;  2Z10 A;  2Q04 A;  3FIX A;  5G1Z A;  1WK4 A;  1Z4R A;  1B6B A;  2ZW7 A;  1M4I A;  2GAN A;  5J8C A;  3D8P A;  4MFQ A;  4B5O A;  3FYN A;  4CYN A;  3R9F A;  4CS0 B;  3EO4 A;  3PZJ A;  4CYO A;  2Z3L A;  2YGW A;  5E96 A;  2YNC A;  4XPL A;  4CGO A;  4CAV A;  1YK3 A;  4J3G A;  4UWJ A;  2WUU A;  1QSO A;  3CXP A;  4ONU A;  5DWM A;  3W6X A;  1XE4 A;  2JEV A;  3R9G A;  4C2Z A;  4ZGY B;  5IB0 A;  4JLY A;  2O28 A;  4QBJ A;  4RS2 A;  3W6S A;  4KLW A;  3G3S A;  3TO6 A;  4PK3 A;  1I1D A;  4A30 A;  4NXY A;  4A2Z A;  2JDD A;  3E0K A;  2G0B A;  5F46 A;  2FT0 A;  5AG6 A;  1S5K A;  2H5M A;  3ZJ0 A;  2ZW4 A;  4KOR A;  2ZXV A;  4B10 A;  4CGL A;  2BL1 A;  4JJX A;  2I79 A;  3ZZI A;  4DNC A;  1XMT A;  4CRY B;  3TO9 A;  3S6K A;  5IV0 A;  4CGM A;  4MFL A;  4AB7 A;  1YVK A;  2B4B A;  1QSM A;  2ARH A;  4MI4 A;  4PSW A;  4XNH C;  2BSW A;  3SXO A;  3A9L A;  1M1D A;  1VHS A;  2Q4Y A;  3FNC A;  4KOW A;  1SQH A;  3G8W A;  2F5I A;  3EC4 A;  4RI1 A;  3EY5 A;  3FBU A;  1P0H A;  4HNY B;  2DPS A;  3IWE A;  4AVB A;  4KZT A;  5F48 A;  3TTH A;  1UFH A;  1KZF A;  4C68 A;  3SXN A;  1Y9K A;  2Z3M A;  3H4Q A;  1Z9U A;  4B5P A;  5H84 A;  3H5Z A;  1NMT A;  3C26 A;  1WWZ A;  1MJB A;  5C88 A;  5KTA A;  5A27 A;  1YVO A;  2CNS A;  3D2M A;  1LRZ A;  4HNW B;  2Z0Z A;  4C7H A;  4E8O A;  4NEX A;  4KOV A;  1S7F A;  1R57 A;  4PV6 A;  1QSN A;  2FCK A;  3QB8 A;  3R95 A;  4AG7 A;  4F0Y A;  4MY3 A;  2FS5 A;  4CAW A;  1V0C A;  4KUB A;  3BJ8 A;  1Q2Y A;  3DNS A;  4OAD A;  1M4D A;  3CXQ A;  3IU1 A;  3WR7 A;  2Q44 A;  4R3L A;  1IYK A;  3D2P A;  2P6G A;  1KUV A;  2VEZ A;  2R1I A;  4HKF A;  3V8I A;  2FSR A;  4U5Y A;  2HV2 A;  2B3V A;  1NE9 A;  4A95 A;  2GIV A;  4B11 A;  2ZW5 A;  3R96 A;  4UFW A;  4FD6 A;  1YLE A;  2DXQ A;  4Q38 A;  2AE6 A;  1YR0 A;  3N7Z A;  4M85 A;  4CAE A;  2VQY A;  2VXK A;  4AG9 A;  3LOD A;  2DPT A;  5FVJ A;  2ATR A;  2GE3 A;  4H6U A;  4KSF A;  5DWN A;  1S3Z A;  4B5P B;  2J8R A;  2OB0 A;  3I9S A;  1N71 A;  2R8V A;  3I3G A;  3DDD A;  3FXT A;  2WPW A;  1QST A;  1IID A;  4XPK A;  1PU9 A;  4ZBG A;  2FL4 A;  2OZH A;  1KUX A;  3DR8 A;  4XPD C;  2G3T A;  4KOY A;  5HMN A;  2Z3P A;  1Q2D A;  4KOU A;  5JPH A;  4KOT A;  4X5K A;  1MJA A;  2J8M A;  4UCM A;  3R1K A;  4KVO E;  4B14 A;  3TFY A;  5JQ4 A;  1QSR A;  4JXR A;  1U6M A;  4KOX A;  3JVN A;  1Y9W A;  4Y49 C;  3TOA A;  2Z3K A;  4QVT A;  4IUS A;  4NF1 A;  3P2H A;  4FD4 A;  4KS9 A;  2P6E A;  5BWA B;  3OWC A;  4KVM E;  2Q7B A;  2HQY A;  5AG5 A;  4KLV A;  3PGP A;  2Q4V A;  4E0A A;  1L0C A;  3JTK A;  3S6H A;  4CAX A;  4CGN A;  4U9Y A;  5F49 A;  1P4N A;  3SHP A;  2A4N A;  4JXQ A;  4GS4 A;  1Q2C A;  3P2F A;  4UWI A;  1PUA A;  5IX3 A;  2B4D B;  2PRB A;  2P0W A;  4CYP A;  2IL4 A;  3DR6 A;  5KTD A;  1I12 A;  4MFP A;  2QML A;  4CGP A;  4ORF A;  1IB1 E;  1K4J A;  1IYL A;  2PC1 A;  3QAH A;  4PSX A;  1ON0 A;  4XPD B;  1Y7R A;  4CYQ A;  2I00 A;  4C7I A;  4R9M A;  2C27 A;  2WSA A;  1BOB A;  2OU2 A;  4AVA A;  2FIW A;  4C2X A;  2VI7 A;  2D4O A;  3FRM A;  2HUZ A;  2VBQ A;  4U9Z A;  2BEI A;  4UA3 A;  3RYO A;  4LUA A;  3TT2 A;  3W91 A;  4C2Y A;  4II9 A;  5CNP A;  1M44 A;  3GY9 A;  2CNM A;  3JUW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...