3FNCA

Crystal structure of a putative acetyltransferase from listeria innocua
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
160
structure length
160
Chain Sequence
MDFHIRKATNSDAEAIQHVATTSWHHTYQDLIPSDVQDDFLKRFYNVETLHNRISATPFAVLEQADKVIGFANFIELEKGKSELAAFYLLPEVTQRGLGTELLEVGMTLFHVPLPMFVNVEKGNETAIHFYKAKGFVQVEEFTEDFYGYPLETIRFNLNH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative acetyltransferase
publication title The structure of a putative acetyltransferase from Listeria innocua.
rcsb
source organism Listeria innocua
molecule tags Transferase
total genus 47
structure length 160
sequence length 160
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-12-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13673 Acetyltransf_10 Acetyltransferase (GNAT) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 3fncA00
3G8WA 1S7FA 4FD4A 1IYLA 5CNPA 1Y9WA 2VI7A 4MBUA 5JPHA 4E2AA 4B5OA 3S6GA 2B5GA 4PSXA 2ZW5A 4XPDB 3C26A 2J8NA 1KUXA 3TE4A 4HNXB 4NXYA 5H86A 1I1DA 2ATRA 2HV2A 2VEZA 3G3SA 3GYAA 4H6UA 5HH1A 4MY0A 2Q7BA 4QBJA 2GIVA 4KVXA 3N7ZA 2PRBA 4Y49C 2VXKA 4KOVA 3DR8A 1Q2YA 2PC1A 1IB1E 2JDDA 4FD7A 3R1KA 1PU9A 4B5PB 3QAHA 1P0HA 4F6AA 3TO7A 3CXQA 3DNSA 3I9SA 1P4NA 4XPKA 1MJBA 2J8RA 4QVTA 4I49A 3BJ8A 1YGHA 2CNTA 1XMTA 4KOUA 2H5MA 4JWPA 3LODA 3T9YA 2B4BA 4GS4A 2G3TA 2B5GB 3FRMA 4U9ZA 4IUSA 2I79A 4XNHC 5KTCA 5HMNA 1WK4A 2PR8A 1K4JA 1MJAA 1V0CA 3EO4A 4R9MA 4MJ8A 3RYOA 4CAXA 2OH1A 3VWDA 1Z4RA 1S5KA 4U9YA 2FT0A 3TO9A 4ZBGA 2B3VA 3R9FA 2OZUA 4X5KA 3NE7A 4RS2A 2Z11A 5E96A 3PGPA 3TTHA 3R95A 5KTAA 1YLEA 3DR6A 2HUZA 3K9UA 3R9GA 1XF8A 2C27A 1S7KA 3F8KA 3CXPA 2ZW4A 1MK4A 3QB8A 4CAWA 2G3AA 1QSMA 4XPLA 1Q2DA 2G0BA 2FSRA 4Y49B 2O28A 4QC6A 5FVJA 2ZW7A 2P6GA 1KUVA 4H89A 4FD6A 1S3ZA 4IF5A 1RO5A 2Q44A 3EFAA 2X7BA 2OB0A 5F46A 2BUEA 4NSQA 2CNMA 2GANA 3FNCA 4E0AA 3FB3A 4AVBA 2FIWA 2FE7A 2VZYA 2Q4VA 5H84A 4KUAA 4M85A 3UY5A 2JEVA 3S6HA 4RI1A 5J8FA 5I0CA 2D4PA 2EUIA 4F0YA 3R9EA 2HQYA 1LRZA 2ARHA 2DXQA 4PSWA 2BSWA 4XNHB 4JD6A 3ZZIA 4OLLA 1BOBA 3TT2A 2P6EA 4CAVA 4FD5A 1YVOA 2CNSA 3D2MA 4U5YA 1NSLA 3KKWA 1PUAA 1YR0A 1NE9A 1MJ9A 5DWMA 1FY7A 2QIRA 4JLYA 3R96A 4JXRA 4MHDA 1Q2CA 2REFA 2QMLA 1GHEA 2WPXA 3TO6A 4PV6A 3JVNA 4HNYB 5JQ4A 3P2HA 4PK3A 3EC4A 2QECA 4UBRA 1QSOA 2BL1A 2FIAA 2OZHA 3DSBA 4L89A 2Z0ZA 1IIDA 2ZXVA 2D4OA 3FBUA 3E0KA 2FCKA 1QSRA 4KOWA 1M4GA 1TIQA 4AG7A 3FYNA 2I00A 5IB0A 4AG9A 2FL4A 2Q4YA 3I3GA 1I21A 3PZJA 3BLNA 4PK2A 3MGDA 4KVME 1IICA 1M1DA 4CRZB 5F49A 4AVCA 1B6BA 5IV0A 3GY9A 4YRHA 3D8PA 3IGRA 2Z10A 1S7NA 1XE4A 3TFYA 4KLWA 2K5TA 5IX3A 4R57A 1ON0A 3H4QA 1KUYA 3W6SA 3W91A 2KCWA 1YREA 1S7LA 1XEBA 1KZFA 4UWIA 2BEIA 5ISVA 1R57A 3S6KA 2P0WA 5C82A 3TOBA 1QSTA 4OAEA 4R3LA 3PP9A 4R3KA 5DWNA 1YX0A 4KOTA 4YFJA 1YVKA 4AVAA 4UWJA 2JLMA 2NMTA 4L8AA 4KVOE 2RC4A 3D3SA 4NF1A 2ZW6A 4CRYB 3SHPA 5J8CA 3F5BA 2A4NA 2F5IA 4R87A 2OZGA 4NEXA 5F47A 1NMTA 4KOXA 1Y7RA 4MY3A 1I12A 2Q04A 1IYKA 3SXNA 4DNCA 4KZTA 1CM0A 4YGOA 3EY5A 2R7HA 1B87A 4XPDC 3S6FA 2R1IA 1Z9UA 3IWGA 3FXTA 2EVNA 4QUSA 1Y9KA 3TCVA 1U6MA 1YK3A 4KOYA 1M4IA 2REEA 1M4DA 3VWEA 2B4DA 4CS0B 4ONUA 2JDCA 3D2PA 4BMHA 1RXTA 2FXFA 4EVYA 2ZPAA 2FS5A 5F48A 3BJ7A 1QSNA 5EBVA 5EC4A 2GE3A 4LUAA 2PDOA 3CXSA 4JXQA 3ZJ0A 3FIXA 2B3UA 2AJ6A 2J8MA 3TOAA 3JUWA 3W6XA 2R8VA 3B8GA 4KOSA 3LD2A 3OWCA 5C88A 2VBQA 2Q0YA 2PR1A 3WR7A 1OZPA 1J4JA 4OADA 3T90A 2VQYA 1BO4A 4UA3A 2PQ8A 1XIXA 2AE6A 4KLVA 4AB7A 4JJXA 4K30A 4HKFA 1VHSA 4M3SA 4II9A 2P6FA 4NCZA 2VZZA 4KUBA 2PSWA 1L0CA 3DDDA 2B58A 2B4DB 4H6ZA 2OU2A 4LX9A 3GKRA 3P2FA 3V8IA 1N71A 4HNWB 4KORA 5GCNA 1CJWA 1M44A 4QB9A 1SQHA 5KTDA 2Y0MA 1VKCA 2IL4A 2WPWA 4MI4A 1S60A 4B5PA 3SXOA 4J3GA 4E8OA 1UFHA 2CY2A 3EXNA 1Z4EA 3F0AA 1WWZA 2R98A 4ORFA
chains in the Genus database with same CATH superfamily
2GLJA 1IGBA 3G8WA 3KGQA 1S7FA 2CIJA 3NFZA 4K3NA 1KWMA 4FD4A 1IYLA 3KASA 4YWYA 5CNPA 3N5FA 1VHEA 1Y9WA 2VI7A 3L2NA 4IK2A 4MBUA 3WC6A 1UWYA 4E2AA 3HLPA 4B5OA 5JPHA 1Z8XA 4MHYA 3S6GA 3B7IA 1ZG9A 2B5GA 2ZW5A 4PSXA 3C26A 1XOVA 2J8NA 4XPDB 1ARMA 1KUXA 1Z8TA 3PFOA 3TE4A 3PBBA 3GUXA 4HNXB 4NXYA 1YQEA 5H86A 1I1DA 4ZYQA 2ATRA 2HV2A 5AG7A 4CGOA 2FVGA 3V38A 4AXVA 4ZX9A 5K8NA 2VEZA 1YW4A 3G3SA 3GYAA 3KR5A 4H6UA 4MY0A 5HH1A 2GIVA 4KVXA 3IC1A 4C2XA 4QBJA 3N7ZA 2PRBA 2XEGA 2GREA 1ELLP 2ANPA 2DPTA 4Y49C 2VXKA 4WJBA 4KOVA 5HXDA 3DR8A 1XMBA 1Q2YA 5CPAA 5IB9A 2PC1A 1IB1E 3RAMA 2JDDA 4FD7A 5DS0A 4MRIA 3R1KA 3VATA 1PU9A 4B5PB 3QAHA 1P0HA 2AFWA 4PQAA 4F6AA 3TO7A 4FBEA 1AUGA 1X10A 5J1QA 1FNOA 3CXQA 3DNSA 3I9SA 1P4NA 1CP6A 3NA6A 4XPKA 1MJBA 2J8RA 2Q43A 2CTCA 4KSFA 4QVTA 4I49A 1CPXA 3BJ8A 3VARA 1YGHA 2CNTA 1XMTA 4KOUA 3CPXA 2H5MA 3K2KA 4NGRA 5JM6A 4JWPA 2ZEFA 5K8PA 3GIUA 2ZEGA 2YNEA 3IU1A 3B3SA 3LODA 4YU9A 2PJ8A 2JBJA 4HPSA 4P4DA 3PB6X 5LYIA 5A28A 4ZX8A 3IEHA 4OC1A 3T9YA 2B4BA 4GS4A 2G3TA 2B5GB 3FRMA 1Y0YA 4U9ZA 1JWQA 1F57A 4P45A 3BI1A 3PB8X 1Y0RA 4IUSA 2I79A 4XNHC 5KTCA 1NSAA 4BD9A 2NYQA 2V8HA 4UCMA 1JQGA 1VHOA 5HMNA 1WK4A 2PR8A 1K4JA 2PVVA 2PCUA 1MJAA 2PIZA 5HVGA 1V0CA 2Q51A 3EO4A 4R9MA 4MJ8A 3D67A 2F8HA 4X2TA 3RYOA 3ISZA 4C68A 4A31A 1BPNA 1R3NA 2WYRA 2PJ9A 4CPAA 4CYQA 4CAXA 4CYPA 3D7HA 2WUUA 2OH1A 3VWDA 4B6ZA 1ZO0A 1BPMA 1TF8A 1Z4RA 3KL9A 4MFJA 1S5KA 3KHXA 4U9YA 4CYNA 5LRKA 2FT0A 3D4UA 3TO9A 4UEEA 3PB9X 2CTBA 4ZBGA 2B3VA 1GYTA 2Z3KA 1F2OA 3PBEA 3R9FA 2OZUA 4NGSA 4X5KA 3NE7A 4PXBA 4RS2A 2Z11A 5E96A 3PGPA 3TTHA 3GB0A 3WT4A 3R95A 5KTAA 1YLEA 4EFDA 1XRYA 3DR6A 3NH8A 1ZG8A 3S9NA 1ZLIA 4NJRA 1XFOA 5LYLA 4OC4A 2XEFA 2HUZA 7CPAA 3K9UA 4A39A 3R9GA 3RNZA 1XF8A 1AYEA 2C27A 2WSAA 3KHZA 3B3WA 1S7KA 2PJ5A 3F8KA 2OOTA 3CXPA 2ZW4A 1MK4A 3QB8A 3WC5A 4CAWA 2G3AA 4LQGA 1TKFA 1QSMA 4P4EA 3PRTA 4XPLA 4R8FA 2PRQA 4MCSA 5ELYA 1Q2DA 2EO8A 4A38A 2G0BA 4EWTA 5EMIA 4FUUA 4OKOA 2FSRA 4OP4A 4Y49B 3TC8A 4A94A 1TKJA 2IQ6A 1F2PA 2O28A 4QC6A 5AG4A 5FVJA 2ZEMA 4C7IA 5CBMA 3LMSA 4B14A 2ZW7A 3QNVA 1ELMP 1DTDA 1KUVA 2P6GA 4H89A 4WWVA 4A33A 2V77A 4FD6A 4PPZA 2V8VA 3DGVA 1S3ZA 4IF5A 1RO5A 2Q44A 3EFAA 2X7BA 3LACA 2OB0A 1PYTB 5F46A 3NE8A 5HVHA 2C6PA 2BUEA 2EK9A 4UFXA 2PJ6A 3B3TA 4NSQA 2CNMA 4P44A 2PIYA 4F0XA 2AFSA 2RB7A 2GANA 3FNCA 4UEFA 4E0AA 2YNDA 3FB3A 1ZG7A 4H2KA 4AVBA 2FIWA 2FE7A 2VZYA 4ONWA 2Q4VA 3PB7X 1CBXA 2YNCC 4KUAA 4M85A 2JEVA 5H84A 4RI1A 3S6HA 3UY5A 5I0CA 3FH4A 5AG5A 5J8FA 3B35A 2D4PA 2EUIA 4TWEA 2AFUA 1XJOA 4BINA 3GLJA 4F0YA 3D7FA 3R9EA 2AFOA 2HQYA 1LRZA 4ZGYB 2ARHA 2DXQA 4PSWA 2BSWA 5JGFA 4XNHB 3FVLA 4PXCA 4UCNA 3V7ZA 4JD6A 4ZY1A 3SI0A 3SJFA 3ZZIA 4OLLA 3MRUA 4KS9A 1BOBA 3TT2A 1ZLHA 3A9LA 4MMOA 4EMEA 2P6EA 2PJ7A 4CAVA 4FD5A 4OC5A 4NGNA 4MCPA 1RTQA 3D68A 4B10A 1YVOA 5D29A 2CNSA 1Z8LA 3D2MA 4U5YA 1NSLA 2Z3PA 3KKWA 1PUAA 4Q7AA 3JTKA 5G1ZA 1YR0A 3KZWA 1NE9A 4NGMA 2Z3MA 4B13A 3PFEA 2PJ2A 1MJ9A 3KI9A 5DWMA 1FY7A 2QIRA 4IHMA 4O23A 2DEAA 4JLYA 3R96A 1QQ9A 4JXRA 4P6YA 4MHDA 1Q2CA 4C2YA 2REFA 3CPAA 2QMLA 1GHEA 2WPXA 2HB6A 3TO6A 1YLOA 4PV6A 2QYVA 4R76A 2RFHA 2ZEDA 2DPSA 3JVNA 4OC0A 4C2ZA 5IV0A 4HNYB 5JQ4A 4F9UA 4PXEA 3P2HA 2YNCA 4PK3A 3EC4A 2QECA 4UBRA 2Z3LA 2ODFA 4MCQA 1LAPA 1QSOA 2AFXA 2C1CA 2PJCA 2BL1A 2FIAA 2OZHA 1R43A 2IJZA 4M6GA 3VH9A 4B12A 4A32A 3DSBA 4MHZA 4L89A 2Z0ZA 1HDQA 1IIDA 1TKHA 1AMPA 4Q36A 1LANA 2ZXVA 2D4OA 2Q7SA 2V8DA 2BO9A 3FBUA 3E0KA 4A95A 2PJ1A 2FCKA 1QSRA 4KOWA 1M4GA 3FEDA 1TIQA 4AG7A 3FYNA 2I00A 5IB0A 1X12A 4AG9A 3SJEA 1HEEA 4TNUA 2FL4A 2Q4YA 3I3GA 1I21A 3PZJA 5LRGA 3BLNA 4GM5A 1Y7EA 4PK2A 3MGDA 1QMUA 4PXDA 3BXMA 1FT7A 4KVME 1IICA 4CGMA 4BBHA 2POKA 1M1DA 5LYDA 4CRZB 1IOIA 1H8LA 1BLLE 4X3RA 5F49A 1YMEA 4DYOA 4AVCA 4OIDA 1B6BA 2V8GA 3GY9A 2ZELA 3D8PA 4GXHA 3IGRA 4KSAA 4X8IA 4YRHA 3SI1A 2Z10A 3PEIA 4CGLA 4ZY0A 3D66A 1S7NA 1XE4A 3TFYA 4KLWA 4CAFA 2K5TA 5IX3A 4R57A 3HUVA 2WZNA 5LYFA 1ON0A 2Q4ZA 2PJ3A 3H4QA 4OC2A 4ZY2A 3T8WA 1KUYA 4UFWA 3W6SA 2PE3A 3WC7A 3W91A 2O53A 2KCWA 5AG6A 1EE3P 1YREA 1S7LA 1XEBA 5K8OA 2ZEEA 1KZFA 4UWIA 2BEIA 4P4FA 2HC9A 4FWUA 1R57A 5ISVA 3S6KA 4P4JA 5F09A 2P0WA 4Q38A 4A2ZA 5C82A 3JRUA 4NFRA 3TOBA 1QSTA 4F8ZA 4OAEA 4OIWA 4R3LA 3PP9A 3D7DA 4G1PA 4JYWA 4UIBA 4R3KA 2PJAA 3BI0A 5DWNA 2Z3OA 3DLJA 1YX0A 3FJUA 5AGEA 1Z5RA 4C7HA 2XEIA 4KOTA 2NSMA 4YFJA 1YVKA 1TF9A 4AVAA 2BCOA 1Z2LA 3IWWA 4UWJA 1LFWA 2JLMA 1PCAA 2NMTA 1YW6A 4L8AA 2ZEHA 3WABA 3H8EA 4NGPA 4KVOE 2DF5A 4R7MA 2RC4A 3FX6A 5LRJA 3CT9A 3D3SA 4NF1A 2ZW6A 4IAVA 3SHPA 4CRYB 5J8CA 2GFQA 3F5BA 2GLFA 4KSIA 2A4NA 4RUHA 2F5IA 4CGNA 4R87A 2OZGA 4NEXA 4DUKA 1IY7A 3D7GA 3IFEA 3BHXA 3FEEA 5F47A 1NMTA 1VIXA 2EWBA 4KOXA 3SJXA 5D8NA 3B3CA 1Q7LA 1Y7RA 4UEZA 3RBUA 4MY3A 1I12A 2Q04A 2ZEOA 4A37A 1IYKA 2QJ8A 4P10A 1Z8WA 3SXNA 4DNCA 5JH9A 4KZTA 1CM0A 4YGOA 3EY5A 1IOFA 4MFKA 4UFVA 2EBJA 2R7HA 3H8GA 1B87A 5THWA 2ZOGA 3MN8A 3KQZA 2ABZA 3KQXA 4XPDC 2Q7BA 2R1IA 1Z9UA 2C6GA 3S6FA 4CAEA 4P4IA 4ZI6A 1CX8A 3IWGA 6CPAA 3FXTA 3IWEA 2G9DA 2EVNA 4M6HA 4NGTA 4QUSA 3SJGA 1Y9KA 3IO1A 4A30A 3TCVA 4CYOA 1U6MA 1YK3A 4KOYA 1M4IA 4R6TA 4UIAA 2I3CA 2REEA 3B3VA 1M4DA 2C6CA 2B4DA 3VWEA 4ONUA 4CS0B 3CZXA 2JDCA 3D2PA 4BMHA 1RXTA 2FXFA 3CDXA 3NH4A 1CG2A 2QVPA 1LOKA 2ZPAA 4EVYA 4MFLA 2ZEPA 2FS5A 3IJ3A 5F48A 3H5ZA 3BJ7A 4MFQA 1QSNA 3LWUA 3B2YA 4RN7A 5I4MA 5EBVA 1XBUA 2XEJA 3S9MA 5EC4A 2GE3A 4LUAA 2Z3NA 4MFPA 4F9VA 2YGWA 2PDOA 3CXSA 4JXQA 1YSJA 5G22A 3ZJ0A 3FIXA 1ARLA 2B3UA 1LAMA 3NH5A 2AJ6A 2PVWA 2J8MA 3TOAA 3SI2A 2JEWA 3FMCA 3JUWA 3W6XA 3H8FA 2AFMA 2R8VA 4UCPA 2VL1A 2O4HA 3B8GA 4KOSA 3LD2A 4MFZA 3TX8A 1CP7A 3OWCA 2F7VA 4NJQA 5C88A 2VBQA 2PJ4A 1IU8A 2Q0YA 4Z65A 2PR1A 1DE4C 2GU2A 3FECA 3ISXA 4M6IA 3WR7A 1OZPA 1J4JA 2EK8A 4OADA 3T90A 3RO0A 5BWAB 4B11A 1VGYA 2VQYA 1BO4A 4UA3A 2PQ8A 4MHPA 2BOAA 4CGPA 1XIXA 2AE6A 5G20A 4KLVA 4AB7A 3QAYA 2AFZA 2JBKA 4JJXA 4K30A 4HKFA 2J9AA 3K9TA 1VHSA 3KR4A 4LQ6A 5G21A 4M3SA 2IMOA 4II9A 4P4BA 2P6FA 4NCZA 5K8MA 4DJLA 2VZZA 4KUBA 4MCRA 2PSWA 3S9LA 2CF4A 1L0CA 3DDDA 1OBRA 2B58A 3I1UA 1HDUA 2B4DB 2ZENA 4H6ZA 2OU2A 4W9YA 4LX9A 3GKRA 3P2FA 3V8IA 1N71A 4HNWB 4KORA 4OC3A 1CJWA 5GCNA 4MHNA 1M44A 4QB9A 1SQHA 2CXAA 5HVFA 5KTDA 1A2ZA 2Y0MA 1VKCA 2IL4A 2WPWA 4FAIA 3IU2A 4MI4A 1S60A 4UF4A 3SXOA 4B5PA 8CPAA 5A27A 2ZOFA 4J3GA 1LCPA 2OR4A 4NGQA 4MXUA 4OMEA 4E8OA 1BAVA 1UFHA 2PJ0A 2CY2A 3EXNA 3RZAA 1Z4EA 3F0AA 4JZ0A 3IIBA 3PB4X 1WWZA 3FF3A 2PJBA 2R98A 1TXRA 4ORFA 1M4LA 1CPSA
chains in the Genus database with same CATH topology
3G8WA 1S7FA 4FD4A 1IYLA 5CNPA 1Y9WA 2VI7A 4MBUA 5JPHA 4E2AA 4B5OA 3S6GA 2B5GA 4PSXA 2ZW5A 4XPDB 3C26A 2J8NA 1KUXA 3TE4A 4HNXB 4NXYA 5H86A 1I1DA 2ATRA 2HV2A 5AG7A 4CGOA 2VEZA 3G3SA 3GYAA 4H6UA 5HH1A 4MY0A 2Q7BA 4QBJA 2GIVA 4KVXA 4C2XA 3N7ZA 2PRBA 4Y49C 2DPTA 2VXKA 4KOVA 3DR8A 1Q2YA 2PC1A 1IB1E 2JDDA 4FD7A 3R1KA 1PU9A 4B5PB 3QAHA 1P0HA 4F6AA 3TO7A 3CXQA 3DNSA 3I9SA 1P4NA 4XPKA 1MJBA 2J8RA 4QVTA 4KSFA 4I49A 3BJ8A 1YGHA 2CNTA 1XMTA 4KOUA 2H5MA 4JWPA 2YNEA 3IU1A 3LODA 5A28A 3T9YA 2B4BA 4GS4A 2G3TA 2B5GB 3FRMA 4U9ZA 4IUSA 2I79A 4XNHC 5KTCA 4UCMA 5HMNA 1WK4A 2PR8A 1K4JA 1MJAA 1V0CA 3EO4A 4R9MA 4MJ8A 3RYOA 4C68A 4A31A 4CYPA 4CYQA 4CAXA 2WUUA 2OH1A 3VWDA 1ZO0A 1Z4RA 4MFJA 4CYNA 1S5KA 4U9YA 2FT0A 3TO9A 4ZBGA 2B3VA 2Z3KA 3R9FA 2OZUA 4X5KA 3NE7A 4RS2A 2Z11A 5E96A 3PGPA 3TTHA 3R95A 5KTAA 1YLEA 3DR6A 2HUZA 3K9UA 3R9GA 1XF8A 2C27A 2WSAA 1S7KA 3F8KA 3CXPA 2ZW4A 1MK4A 3QB8A 4CAWA 2G3AA 1QSMA 4XPLA 1Q2DA 2G0BA 2FSRA 4Y49B 2O28A 4QC6A 5AG4A 5FVJA 4C7IA 4B14A 2ZW7A 2P6GA 1KUVA 4H89A 4A33A 4FD6A 1S3ZA 4IF5A 1RO5A 2Q44A 3EFAA 2X7BA 2OB0A 5F46A 2BUEA 4UFXA 4NSQA 2CNMA 4F0XA 2GANA 3FNCA 4E0AA 2YNDA 3FB3A 4AVBA 2FIWA 2FE7A 2VZYA 2Q4VA 5H84A 4KUAA 2YNCC 4M85A 3UY5A 2JEVA 3S6HA 4RI1A 5J8FA 5I0CA 5AG5A 2D4PA 2EUIA 4F0YA 3R9EA 2HQYA 1LRZA 4ZGYB 2ARHA 2DXQA 4PSWA 2BSWA 4XNHB 4UCNA 4JD6A 3ZZIA 4OLLA 4KS9A 1BOBA 3TT2A 3A9LA 2P6EA 4CAVA 4FD5A 4B10A 1YVOA 2CNSA 3D2MA 4U5YA 1NSLA 2Z3PA 3KKWA 1PUAA 3JTKA 5G1ZA 1YR0A 1NE9A 2Z3MA 4B13A 1MJ9A 5DWMA 1FY7A 2QIRA 4JLYA 3R96A 4JXRA 4MHDA 1Q2CA 4C2YA 2REFA 2QMLA 1GHEA 2WPXA 3TO6A 4PV6A 2DPSA 3JVNA 4C2ZA 4HNYB 5JQ4A 3P2HA 2YNCA 4PK3A 3EC4A 2QECA 4UBRA 2Z3LA 1QSOA 2BL1A 2FIAA 2OZHA 4B12A 4A32A 3DSBA 4L89A 2Z0ZA 1IIDA 4Q36A 2ZXVA 2D4OA 3FBUA 3E0KA 4A95A 2FCKA 1QSRA 4KOWA 1M4GA 1TIQA 4AG7A 3FYNA 2I00A 5IB0A 4AG9A 2FL4A 2Q4YA 3I3GA 1I21A 3PZJA 3BLNA 4PK2A 3MGDA 4KVME 1IICA 4CGMA 4BBHA 1M1DA 4CRZB 5F49A 4AVCA 1B6BA 5IV0A 3GY9A 4YRHA 3D8PA 4KSAA 3IGRA 2Z10A 4CGLA 1S7NA 1XE4A 3TFYA 4KLWA 4CAFA 2K5TA 5IX3A 4R57A 1ON0A 3H4QA 1KUYA 4UFWA 3W6SA 3W91A 2KCWA 5AG6A 1YREA 1S7LA 1XEBA 1KZFA 4UWIA 2BEIA 5ISVA 1R57A 3S6KA 2P0WA 4Q38A 4A2ZA 5C82A 3TOBA 1QSTA 4OAEA 4R3LA 3PP9A 4R3KA 5DWNA 2Z3OA 5AGEA 1YX0A 4C7HA 4KOTA 4YFJA 1YVKA 4AVAA 4UWJA 2JLMA 2NMTA 4L8AA 4KVOE 2RC4A 3D3SA 4NF1A 2ZW6A 4CRYB 3SHPA 5J8CA 3F5BA 2A4NA 2F5IA 4CGNA 4R87A 2OZGA 4NEXA 5F47A 1NMTA 4KOXA 1Y7RA 4MY3A 1I12A 2Q04A 1IYKA 3SXNA 4DNCA 4KZTA 1CM0A 4YGOA 3EY5A 4MFKA 4UFVA 2R7HA 1B87A 4XPDC 4CAEA 3S6FA 2R1IA 1Z9UA 3IWGA 3FXTA 3IWEA 2EVNA 4QUSA 4A30A 4CYOA 1Y9KA 3TCVA 1U6MA 1YK3A 4KOYA 1M4IA 2REEA 1M4DA 3VWEA 2B4DA 4CS0B 4ONUA 2JDCA 3D2PA 4BMHA 1RXTA 2FXFA 4EVYA 2ZPAA 4MFLA 2FS5A 5F48A 3H5ZA 3BJ7A 4MFQA 1QSNA 5EBVA 5EC4A 2GE3A 4LUAA 2Z3NA 4MFPA 2YGWA 2PDOA 3CXSA 4JXQA 5G22A 3ZJ0A 3FIXA 2B3UA 2AJ6A 2J8MA 3TOAA 3JUWA 3W6XA 2R8VA 4UCPA 3B8GA 4KOSA 3LD2A 4MFZA 3OWCA 5C88A 2VBQA 2Q0YA 2PR1A 3WR7A 1OZPA 1J4JA 4OADA 5BWAB 3T90A 4B11A 2VQYA 1BO4A 4UA3A 2PQ8A 4CGPA 1XIXA 2AE6A 5G20A 4KLVA 4AB7A 4JJXA 4K30A 4HKFA 1VHSA 5G21A 4M3SA 4II9A 2P6FA 4NCZA 2VZZA 4KUBA 2PSWA 1L0CA 3DDDA 2B58A 2B4DB 4H6ZA 2OU2A 4LX9A 3GKRA 3P2FA 3V8IA 1N71A 4HNWB 4KORA 5GCNA 1CJWA 1M44A 4QB9A 1SQHA 2CXAA 5KTDA 2Y0MA 1VKCA 2IL4A 2WPWA 3IU2A 4MI4A 1S60A 4B5PA 3SXOA 5A27A 4J3GA 4E8OA 1UFHA 2CY2A 3EXNA 1Z4EA 3F0AA 1WWZA 2R98A 4ORFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3G8W A;  1S7F A;  4FD4 A;  1IYL A;  5CNP A;  1Y9W A;  2VI7 A;  4MBU A;  5JPH A;  4E2A A;  4B5O A;  3S6G A;  2B5G A;  4PSX A;  2ZW5 A;  4XPD B;  3C26 A;  2J8N A;  1KUX A;  3TE4 A;  4HNX B;  4NXY A;  5H86 A;  1I1D A;  2ATR A;  2HV2 A;  2VEZ A;  3G3S A;  3GYA A;  4H6U A;  5HH1 A;  4MY0 A;  2Q7B A;  4QBJ A;  2GIV A;  4KVX A;  3N7Z A;  2PRB A;  4Y49 C;  2VXK A;  4KOV A;  3DR8 A;  1Q2Y A;  2PC1 A;  1IB1 E;  2JDD A;  4FD7 A;  3R1K A;  1PU9 A;  4B5P B;  3QAH A;  1P0H A;  4F6A A;  3TO7 A;  3CXQ A;  3DNS A;  3I9S A;  1P4N A;  4XPK A;  1MJB A;  2J8R A;  4QVT A;  4I49 A;  3BJ8 A;  1YGH A;  2CNT A;  1XMT A;  4KOU A;  2H5M A;  4JWP A;  3LOD A;  3T9Y A;  2B4B A;  4GS4 A;  2G3T A;  2B5G B;  3FRM A;  4U9Z A;  4IUS A;  2I79 A;  4XNH C;  5KTC A;  5HMN A;  1WK4 A;  2PR8 A;  1K4J A;  1MJA A;  1V0C A;  3EO4 A;  4R9M A;  4MJ8 A;  3RYO A;  4CAX A;  2OH1 A;  3VWD A;  1Z4R A;  1S5K A;  4U9Y A;  2FT0 A;  3TO9 A;  4ZBG A;  2B3V A;  3R9F A;  2OZU A;  4X5K A;  3NE7 A;  4RS2 A;  2Z11 A;  5E96 A;  3PGP A;  3TTH A;  3R95 A;  5KTA A;  1YLE A;  3DR6 A;  2HUZ A;  3K9U A;  3R9G A;  1XF8 A;  2C27 A;  1S7K A;  3F8K A;  3CXP A;  2ZW4 A;  1MK4 A;  3QB8 A;  4CAW A;  2G3A A;  1QSM A;  4XPL A;  1Q2D A;  2G0B A;  2FSR A;  4Y49 B;  2O28 A;  4QC6 A;  5FVJ A;  2ZW7 A;  2P6G A;  1KUV A;  4H89 A;  4FD6 A;  1S3Z A;  4IF5 A;  1RO5 A;  2Q44 A;  3EFA A;  2X7B A;  2OB0 A;  5F46 A;  2BUE A;  4NSQ A;  2CNM A;  2GAN A;  3FNC A;  4E0A A;  3FB3 A;  4AVB A;  2FIW A;  2FE7 A;  2VZY A;  2Q4V A;  5H84 A;  4KUA A;  4M85 A;  3UY5 A;  2JEV A;  3S6H A;  4RI1 A;  5J8F A;  5I0C A;  2D4P A;  2EUI A;  4F0Y A;  3R9E A;  2HQY A;  1LRZ A;  2ARH A;  2DXQ A;  4PSW A;  2BSW A;  4XNH B;  4JD6 A;  3ZZI A;  4OLL A;  1BOB A;  3TT2 A;  2P6E A;  4CAV A;  4FD5 A;  1YVO A;  2CNS A;  3D2M A;  4U5Y A;  1NSL A;  3KKW A;  1PUA A;  1YR0 A;  1NE9 A;  1MJ9 A;  5DWM A;  1FY7 A;  2QIR A;  4JLY A;  3R96 A;  4JXR A;  4MHD A;  1Q2C A;  2REF A;  2QML A;  1GHE A;  2WPX A;  3TO6 A;  4PV6 A;  3JVN A;  4HNY B;  5JQ4 A;  3P2H A;  4PK3 A;  3EC4 A;  2QEC A;  4UBR A;  1QSO A;  2BL1 A;  2FIA A;  2OZH A;  3DSB A;  4L89 A;  2Z0Z A;  1IID A;  2ZXV A;  2D4O A;  3FBU A;  3E0K A;  2FCK A;  1QSR A;  4KOW A;  1M4G A;  1TIQ A;  4AG7 A;  3FYN A;  2I00 A;  5IB0 A;  4AG9 A;  2FL4 A;  2Q4Y A;  3I3G A;  1I21 A;  3PZJ A;  3BLN A;  4PK2 A;  3MGD A;  4KVM E;  1IIC A;  1M1D A;  4CRZ B;  5F49 A;  4AVC A;  1B6B A;  5IV0 A;  3GY9 A;  4YRH A;  3D8P A;  3IGR A;  2Z10 A;  1S7N A;  1XE4 A;  3TFY A;  4KLW A;  2K5T A;  5IX3 A;  4R57 A;  1ON0 A;  3H4Q A;  1KUY A;  3W6S A;  3W91 A;  2KCW A;  1YRE A;  1S7L A;  1XEB A;  1KZF A;  4UWI A;  2BEI A;  5ISV A;  1R57 A;  3S6K A;  2P0W A;  5C82 A;  3TOB A;  1QST A;  4OAE A;  4R3L A;  3PP9 A;  4R3K A;  5DWN A;  1YX0 A;  4KOT A;  4YFJ A;  1YVK A;  4AVA A;  4UWJ A;  2JLM A;  2NMT A;  4L8A A;  4KVO E;  2RC4 A;  3D3S A;  4NF1 A;  2ZW6 A;  4CRY B;  3SHP A;  5J8C A;  3F5B A;  2A4N A;  2F5I A;  4R87 A;  2OZG A;  4NEX A;  5F47 A;  1NMT A;  4KOX A;  1Y7R A;  4MY3 A;  1I12 A;  2Q04 A;  1IYK A;  3SXN A;  4DNC A;  4KZT A;  1CM0 A;  4YGO A;  3EY5 A;  2R7H A;  1B87 A;  4XPD C;  3S6F A;  2R1I A;  1Z9U A;  3IWG A;  3FXT A;  2EVN A;  4QUS A;  1Y9K A;  3TCV A;  1U6M A;  1YK3 A;  4KOY A;  1M4I A;  2REE A;  1M4D A;  3VWE A;  2B4D A;  4CS0 B;  4ONU A;  2JDC A;  3D2P A;  4BMH A;  1RXT A;  2FXF A;  4EVY A;  2ZPA A;  2FS5 A;  5F48 A;  3BJ7 A;  1QSN A;  5EBV A;  5EC4 A;  2GE3 A;  4LUA A;  2PDO A;  3CXS A;  4JXQ A;  3ZJ0 A;  3FIX A;  2B3U A;  2AJ6 A;  2J8M A;  3TOA A;  3JUW A;  3W6X A;  2R8V A;  3B8G A;  4KOS A;  3LD2 A;  3OWC A;  5C88 A;  2VBQ A;  2Q0Y A;  2PR1 A;  3WR7 A;  1OZP A;  1J4J A;  4OAD A;  3T90 A;  2VQY A;  1BO4 A;  4UA3 A;  2PQ8 A;  1XIX A;  2AE6 A;  4KLV A;  4AB7 A;  4JJX A;  4K30 A;  4HKF A;  1VHS A;  4M3S A;  4II9 A;  2P6F A;  4NCZ A;  2VZZ A;  4KUB A;  2PSW A;  1L0C A;  3DDD A;  2B58 A;  2B4D B;  4H6Z A;  2OU2 A;  4LX9 A;  3GKR A;  3P2F A;  3V8I A;  1N71 A;  4HNW B;  4KOR A;  5GCN A;  1CJW A;  1M44 A;  4QB9 A;  1SQH A;  5KTD A;  2Y0M A;  1VKC A;  2IL4 A;  2WPW A;  4MI4 A;  1S60 A;  4B5P A;  3SXO A;  4J3G A;  4E8O A;  1UFH A;  2CY2 A;  3EXN A;  1Z4E A;  3F0A A;  1WWZ A;  2R98 A;  4ORF A; 
#chains in the Genus database with same CATH topology
 2GLJ A;  1IGB A;  3G8W A;  3KGQ A;  1S7F A;  2CIJ A;  3NFZ A;  4K3N A;  1KWM A;  4FD4 A;  1IYL A;  3KAS A;  4YWY A;  5CNP A;  3N5F A;  1VHE A;  1Y9W A;  2VI7 A;  3L2N A;  4IK2 A;  4MBU A;  3WC6 A;  1UWY A;  4E2A A;  3HLP A;  4B5O A;  5JPH A;  1Z8X A;  4MHY A;  3S6G A;  3B7I A;  1ZG9 A;  2B5G A;  2ZW5 A;  4PSX A;  3C26 A;  1XOV A;  2J8N A;  4XPD B;  1ARM A;  1KUX A;  1Z8T A;  3PFO A;  3TE4 A;  3PBB A;  3GUX A;  4HNX B;  4NXY A;  1YQE A;  5H86 A;  1I1D A;  4ZYQ A;  2ATR A;  2HV2 A;  5AG7 A;  4CGO A;  2FVG A;  3V38 A;  4AXV A;  4ZX9 A;  5K8N A;  2VEZ A;  1YW4 A;  3G3S A;  3GYA A;  3KR5 A;  4H6U A;  4MY0 A;  5HH1 A;  2GIV A;  4KVX A;  3IC1 A;  4C2X A;  4QBJ A;  3N7Z A;  2PRB A;  2XEG A;  2GRE A;  1ELL P;  2ANP A;  2DPT A;  4Y49 C;  2VXK A;  4WJB A;  4KOV A;  5HXD A;  3DR8 A;  1XMB A;  1Q2Y A;  5CPA A;  5IB9 A;  2PC1 A;  1IB1 E;  3RAM A;  2JDD A;  4FD7 A;  5DS0 A;  4MRI A;  3R1K A;  3VAT A;  1PU9 A;  4B5P B;  3QAH A;  1P0H A;  2AFW A;  4PQA A;  4F6A A;  3TO7 A;  4FBE A;  1AUG A;  1X10 A;  5J1Q A;  1FNO A;  3CXQ A;  3DNS A;  3I9S A;  1P4N A;  1CP6 A;  3NA6 A;  4XPK A;  1MJB A;  2J8R A;  2Q43 A;  2CTC A;  4KSF A;  4QVT A;  4I49 A;  1CPX A;  3BJ8 A;  3VAR A;  1YGH A;  2CNT A;  1XMT A;  4KOU A;  3CPX A;  2H5M A;  3K2K A;  4NGR A;  5JM6 A;  4JWP A;  2ZEF A;  5K8P A;  3GIU A;  2ZEG A;  2YNE A;  3IU1 A;  3B3S A;  3LOD A;  4YU9 A;  2PJ8 A;  2JBJ A;  4HPS A;  4P4D A;  3PB6 X;  5LYI A;  5A28 A;  4ZX8 A;  3IEH A;  4OC1 A;  3T9Y A;  2B4B A;  4GS4 A;  2G3T A;  2B5G B;  3FRM A;  1Y0Y A;  4U9Z A;  1JWQ A;  1F57 A;  4P45 A;  3BI1 A;  3PB8 X;  1Y0R A;  4IUS A;  2I79 A;  4XNH C;  5KTC A;  1NSA A;  4BD9 A;  2NYQ A;  2V8H A;  4UCM A;  1JQG A;  1VHO A;  5HMN A;  1WK4 A;  2PR8 A;  1K4J A;  2PVV A;  2PCU A;  1MJA A;  2PIZ A;  5HVG A;  1V0C A;  2Q51 A;  3EO4 A;  4R9M A;  4MJ8 A;  3D67 A;  2F8H A;  4X2T A;  3RYO A;  3ISZ A;  4C68 A;  4A31 A;  1BPN A;  1R3N A;  2WYR A;  2PJ9 A;  4CPA A;  4CYQ A;  4CAX A;  4CYP A;  3D7H A;  2WUU A;  2OH1 A;  3VWD A;  4B6Z A;  1ZO0 A;  1BPM A;  1TF8 A;  1Z4R A;  3KL9 A;  4MFJ A;  1S5K A;  3KHX A;  4U9Y A;  4CYN A;  5LRK A;  2FT0 A;  3D4U A;  3TO9 A;  4UEE A;  3PB9 X;  2CTB A;  4ZBG A;  2B3V A;  1GYT A;  2Z3K A;  1F2O A;  3PBE A;  3R9F A;  2OZU A;  4NGS A;  4X5K A;  3NE7 A;  4PXB A;  4RS2 A;  2Z11 A;  5E96 A;  3PGP A;  3TTH A;  3GB0 A;  3WT4 A;  3R95 A;  5KTA A;  1YLE A;  4EFD A;  1XRY A;  3DR6 A;  3NH8 A;  1ZG8 A;  3S9N A;  1ZLI A;  4NJR A;  1XFO A;  5LYL A;  4OC4 A;  2XEF A;  2HUZ A;  7CPA A;  3K9U A;  4A39 A;  3R9G A;  3RNZ A;  1XF8 A;  1AYE A;  2C27 A;  2WSA A;  3KHZ A;  3B3W A;  1S7K A;  2PJ5 A;  3F8K A;  2OOT A;  3CXP A;  2ZW4 A;  1MK4 A;  3QB8 A;  3WC5 A;  4CAW A;  2G3A A;  4LQG A;  1TKF A;  1QSM A;  4P4E A;  3PRT A;  4XPL A;  4R8F A;  2PRQ A;  4MCS A;  5ELY A;  1Q2D A;  2EO8 A;  4A38 A;  2G0B A;  4EWT A;  5EMI A;  4FUU A;  4OKO A;  2FSR A;  4OP4 A;  4Y49 B;  3TC8 A;  4A94 A;  1TKJ A;  2IQ6 A;  1F2P A;  2O28 A;  4QC6 A;  5AG4 A;  5FVJ A;  2ZEM A;  4C7I A;  5CBM A;  3LMS A;  4B14 A;  2ZW7 A;  3QNV A;  1ELM P;  1DTD A;  1KUV A;  2P6G A;  4H89 A;  4WWV A;  4A33 A;  2V77 A;  4FD6 A;  4PPZ A;  2V8V A;  3DGV A;  1S3Z A;  4IF5 A;  1RO5 A;  2Q44 A;  3EFA A;  2X7B A;  3LAC A;  2OB0 A;  1PYT B;  5F46 A;  3NE8 A;  5HVH A;  2C6P A;  2BUE A;  2EK9 A;  4UFX A;  2PJ6 A;  3B3T A;  4NSQ A;  2CNM A;  4P44 A;  2PIY A;  4F0X A;  2AFS A;  2RB7 A;  2GAN A;  3FNC A;  4UEF A;  4E0A A;  2YND A;  3FB3 A;  1ZG7 A;  4H2K A;  4AVB A;  2FIW A;  2FE7 A;  2VZY A;  4ONW A;  2Q4V A;  3PB7 X;  1CBX A;  2YNC C;  4KUA A;  4M85 A;  2JEV A;  5H84 A;  4RI1 A;  3S6H A;  3UY5 A;  5I0C A;  3FH4 A;  5AG5 A;  5J8F A;  3B35 A;  2D4P A;  2EUI A;  4TWE A;  2AFU A;  1XJO A;  4BIN A;  3GLJ A;  4F0Y A;  3D7F A;  3R9E A;  2AFO A;  2HQY A;  1LRZ A;  4ZGY B;  2ARH A;  2DXQ A;  4PSW A;  2BSW A;  5JGF A;  4XNH B;  3FVL A;  4PXC A;  4UCN A;  3V7Z A;  4JD6 A;  4ZY1 A;  3SI0 A;  3SJF A;  3ZZI A;  4OLL A;  3MRU A;  4KS9 A;  1BOB A;  3TT2 A;  1ZLH A;  3A9L A;  4MMO A;  4EME A;  2P6E A;  2PJ7 A;  4CAV A;  4FD5 A;  4OC5 A;  4NGN A;  4MCP A;  1RTQ A;  3D68 A;  4B10 A;  1YVO A;  5D29 A;  2CNS A;  1Z8L A;  3D2M A;  4U5Y A;  1NSL A;  2Z3P A;  3KKW A;  1PUA A;  4Q7A A;  3JTK A;  5G1Z A;  1YR0 A;  3KZW A;  1NE9 A;  4NGM A;  2Z3M A;  4B13 A;  3PFE A;  2PJ2 A;  1MJ9 A;  3KI9 A;  5DWM A;  1FY7 A;  2QIR A;  4IHM A;  4O23 A;  2DEA A;  4JLY A;  3R96 A;  1QQ9 A;  4JXR A;  4P6Y A;  4MHD A;  1Q2C A;  4C2Y A;  2REF A;  3CPA A;  2QML A;  1GHE A;  2WPX A;  2HB6 A;  3TO6 A;  1YLO A;  4PV6 A;  2QYV A;  4R76 A;  2RFH A;  2ZED A;  2DPS A;  3JVN A;  4OC0 A;  4C2Z A;  5IV0 A;  4HNY B;  5JQ4 A;  4F9U A;  4PXE A;  3P2H A;  2YNC A;  4PK3 A;  3EC4 A;  2QEC A;  4UBR A;  2Z3L A;  2ODF A;  4MCQ A;  1LAP A;  1QSO A;  2AFX A;  2C1C A;  2PJC A;  2BL1 A;  2FIA A;  2OZH A;  1R43 A;  2IJZ A;  4M6G A;  3VH9 A;  4B12 A;  4A32 A;  3DSB A;  4MHZ A;  4L89 A;  2Z0Z A;  1HDQ A;  1IID A;  1TKH A;  1AMP A;  4Q36 A;  1LAN A;  2ZXV A;  2D4O A;  2Q7S A;  2V8D A;  2BO9 A;  3FBU A;  3E0K A;  4A95 A;  2PJ1 A;  2FCK A;  1QSR A;  4KOW A;  1M4G A;  3FED A;  1TIQ A;  4AG7 A;  3FYN A;  2I00 A;  5IB0 A;  1X12 A;  4AG9 A;  3SJE A;  1HEE A;  4TNU A;  2FL4 A;  2Q4Y A;  3I3G A;  1I21 A;  3PZJ A;  5LRG A;  3BLN A;  4GM5 A;  1Y7E A;  4PK2 A;  3MGD A;  1QMU A;  4PXD A;  3BXM A;  1FT7 A;  4KVM E;  1IIC A;  4CGM A;  4BBH A;  2POK A;  1M1D A;  5LYD A;  4CRZ B;  1IOI A;  1H8L A;  1BLL E;  4X3R A;  5F49 A;  1YME A;  4DYO A;  4AVC A;  4OID A;  1B6B A;  2V8G A;  3GY9 A;  2ZEL A;  3D8P A;  4GXH A;  3IGR A;  4KSA A;  4X8I A;  4YRH A;  3SI1 A;  2Z10 A;  3PEI A;  4CGL A;  4ZY0 A;  3D66 A;  1S7N A;  1XE4 A;  3TFY A;  4KLW A;  4CAF A;  2K5T A;  5IX3 A;  4R57 A;  3HUV A;  2WZN A;  5LYF A;  1ON0 A;  2Q4Z A;  2PJ3 A;  3H4Q A;  4OC2 A;  4ZY2 A;  3T8W A;  1KUY A;  4UFW A;  3W6S A;  2PE3 A;  3WC7 A;  3W91 A;  2O53 A;  2KCW A;  5AG6 A;  1EE3 P;  1YRE A;  1S7L A;  1XEB A;  5K8O A;  2ZEE A;  1KZF A;  4UWI A;  2BEI A;  4P4F A;  2HC9 A;  4FWU A;  1R57 A;  5ISV A;  3S6K A;  4P4J A;  5F09 A;  2P0W A;  4Q38 A;  4A2Z A;  5C82 A;  3JRU A;  4NFR A;  3TOB A;  1QST A;  4F8Z A;  4OAE A;  4OIW A;  4R3L A;  3PP9 A;  3D7D A;  4G1P A;  4JYW A;  4UIB A;  4R3K A;  2PJA A;  3BI0 A;  5DWN A;  2Z3O A;  3DLJ A;  1YX0 A;  3FJU A;  5AGE A;  1Z5R A;  4C7H A;  2XEI A;  4KOT A;  2NSM A;  4YFJ A;  1YVK A;  1TF9 A;  4AVA A;  2BCO A;  1Z2L A;  3IWW A;  4UWJ A;  1LFW A;  2JLM A;  1PCA A;  2NMT A;  1YW6 A;  4L8A A;  2ZEH A;  3WAB A;  3H8E A;  4NGP A;  4KVO E;  2DF5 A;  4R7M A;  2RC4 A;  3FX6 A;  5LRJ A;  3CT9 A;  3D3S A;  4NF1 A;  2ZW6 A;  4IAV A;  3SHP A;  4CRY B;  5J8C A;  2GFQ A;  3F5B A;  2GLF A;  4KSI A;  2A4N A;  4RUH A;  2F5I A;  4CGN A;  4R87 A;  2OZG A;  4NEX A;  4DUK A;  1IY7 A;  3D7G A;  3IFE A;  3BHX A;  3FEE A;  5F47 A;  1NMT A;  1VIX A;  2EWB A;  4KOX A;  3SJX A;  5D8N A;  3B3C A;  1Q7L A;  1Y7R A;  4UEZ A;  3RBU A;  4MY3 A;  1I12 A;  2Q04 A;  2ZEO A;  4A37 A;  1IYK A;  2QJ8 A;  4P10 A;  1Z8W A;  3SXN A;  4DNC A;  5JH9 A;  4KZT A;  1CM0 A;  4YGO A;  3EY5 A;  1IOF A;  4MFK A;  4UFV A;  2EBJ A;  2R7H A;  3H8G A;  1B87 A;  5THW A;  2ZOG A;  3MN8 A;  3KQZ A;  2ABZ A;  3KQX A;  4XPD C;  2Q7B A;  2R1I A;  1Z9U A;  2C6G A;  3S6F A;  4CAE A;  4P4I A;  4ZI6 A;  1CX8 A;  3IWG A;  6CPA A;  3FXT A;  3IWE A;  2G9D A;  2EVN A;  4M6H A;  4NGT A;  4QUS A;  3SJG A;  1Y9K A;  3IO1 A;  4A30 A;  3TCV A;  4CYO A;  1U6M A;  1YK3 A;  4KOY A;  1M4I A;  4R6T A;  4UIA A;  2I3C A;  2REE A;  3B3V A;  1M4D A;  2C6C A;  2B4D A;  3VWE A;  4ONU A;  4CS0 B;  3CZX A;  2JDC A;  3D2P A;  4BMH A;  1RXT A;  2FXF A;  3CDX A;  3NH4 A;  1CG2 A;  2QVP A;  1LOK A;  2ZPA A;  4EVY A;  4MFL A;  2ZEP A;  2FS5 A;  3IJ3 A;  5F48 A;  3H5Z A;  3BJ7 A;  4MFQ A;  1QSN A;  3LWU A;  3B2Y A;  4RN7 A;  5I4M A;  5EBV A;  1XBU A;  2XEJ A;  3S9M A;  5EC4 A;  2GE3 A;  4LUA A;  2Z3N A;  4MFP A;  4F9V A;  2YGW A;  2PDO A;  3CXS A;  4JXQ A;  1YSJ A;  5G22 A;  3ZJ0 A;  3FIX A;  1ARL A;  2B3U A;  1LAM A;  3NH5 A;  2AJ6 A;  2PVW A;  2J8M A;  3TOA A;  3SI2 A;  2JEW A;  3FMC A;  3JUW A;  3W6X A;  3H8F A;  2AFM A;  2R8V A;  4UCP A;  2VL1 A;  2O4H A;  3B8G A;  4KOS A;  3LD2 A;  4MFZ A;  3TX8 A;  1CP7 A;  3OWC A;  2F7V A;  4NJQ A;  5C88 A;  2VBQ A;  2PJ4 A;  1IU8 A;  2Q0Y A;  4Z65 A;  2PR1 A;  1DE4 C;  2GU2 A;  3FEC A;  3ISX A;  4M6I A;  3WR7 A;  1OZP A;  1J4J A;  2EK8 A;  4OAD A;  3T90 A;  3RO0 A;  5BWA B;  4B11 A;  1VGY A;  2VQY A;  1BO4 A;  4UA3 A;  2PQ8 A;  4MHP A;  2BOA A;  4CGP A;  1XIX A;  2AE6 A;  5G20 A;  4KLV A;  4AB7 A;  3QAY A;  2AFZ A;  2JBK A;  4JJX A;  4K30 A;  4HKF A;  2J9A A;  3K9T A;  1VHS A;  3KR4 A;  4LQ6 A;  5G21 A;  4M3S A;  2IMO A;  4II9 A;  4P4B A;  2P6F A;  4NCZ A;  5K8M A;  4DJL A;  2VZZ A;  4KUB A;  4MCR A;  2PSW A;  3S9L A;  2CF4 A;  1L0C A;  3DDD A;  1OBR A;  2B58 A;  3I1U A;  1HDU A;  2B4D B;  2ZEN A;  4H6Z A;  2OU2 A;  4W9Y A;  4LX9 A;  3GKR A;  3P2F A;  3V8I A;  1N71 A;  4HNW B;  4KOR A;  4OC3 A;  1CJW A;  5GCN A;  4MHN A;  1M44 A;  4QB9 A;  1SQH A;  2CXA A;  5HVF A;  5KTD A;  1A2Z A;  2Y0M A;  1VKC A;  2IL4 A;  2WPW A;  4FAI A;  3IU2 A;  4MI4 A;  1S60 A;  4UF4 A;  3SXO A;  4B5P A;  8CPA A;  5A27 A;  2ZOF A;  4J3G A;  1LCP A;  2OR4 A;  4NGQ A;  4MXU A;  4OME A;  4E8O A;  1BAV A;  1UFH A;  2PJ0 A;  2CY2 A;  3EXN A;  3RZA A;  1Z4E A;  3F0A A;  4JZ0 A;  3IIB A;  3PB4 X;  1WWZ A;  3FF3 A;  2PJB A;  2R98 A;  1TXR A;  4ORF A;  1M4L A;  1CPS A; 
#chains in the Genus database with same CATH homology
 3G8W A;  1S7F A;  4FD4 A;  1IYL A;  5CNP A;  1Y9W A;  2VI7 A;  4MBU A;  5JPH A;  4E2A A;  4B5O A;  3S6G A;  2B5G A;  4PSX A;  2ZW5 A;  4XPD B;  3C26 A;  2J8N A;  1KUX A;  3TE4 A;  4HNX B;  4NXY A;  5H86 A;  1I1D A;  2ATR A;  2HV2 A;  5AG7 A;  4CGO A;  2VEZ A;  3G3S A;  3GYA A;  4H6U A;  5HH1 A;  4MY0 A;  2Q7B A;  4QBJ A;  2GIV A;  4KVX A;  4C2X A;  3N7Z A;  2PRB A;  4Y49 C;  2DPT A;  2VXK A;  4KOV A;  3DR8 A;  1Q2Y A;  2PC1 A;  1IB1 E;  2JDD A;  4FD7 A;  3R1K A;  1PU9 A;  4B5P B;  3QAH A;  1P0H A;  4F6A A;  3TO7 A;  3CXQ A;  3DNS A;  3I9S A;  1P4N A;  4XPK A;  1MJB A;  2J8R A;  4QVT A;  4KSF A;  4I49 A;  3BJ8 A;  1YGH A;  2CNT A;  1XMT A;  4KOU A;  2H5M A;  4JWP A;  2YNE A;  3IU1 A;  3LOD A;  5A28 A;  3T9Y A;  2B4B A;  4GS4 A;  2G3T A;  2B5G B;  3FRM A;  4U9Z A;  4IUS A;  2I79 A;  4XNH C;  5KTC A;  4UCM A;  5HMN A;  1WK4 A;  2PR8 A;  1K4J A;  1MJA A;  1V0C A;  3EO4 A;  4R9M A;  4MJ8 A;  3RYO A;  4C68 A;  4A31 A;  4CYP A;  4CYQ A;  4CAX A;  2WUU A;  2OH1 A;  3VWD A;  1ZO0 A;  1Z4R A;  4MFJ A;  4CYN A;  1S5K A;  4U9Y A;  2FT0 A;  3TO9 A;  4ZBG A;  2B3V A;  2Z3K A;  3R9F A;  2OZU A;  4X5K A;  3NE7 A;  4RS2 A;  2Z11 A;  5E96 A;  3PGP A;  3TTH A;  3R95 A;  5KTA A;  1YLE A;  3DR6 A;  2HUZ A;  3K9U A;  3R9G A;  1XF8 A;  2C27 A;  2WSA A;  1S7K A;  3F8K A;  3CXP A;  2ZW4 A;  1MK4 A;  3QB8 A;  4CAW A;  2G3A A;  1QSM A;  4XPL A;  1Q2D A;  2G0B A;  2FSR A;  4Y49 B;  2O28 A;  4QC6 A;  5AG4 A;  5FVJ A;  4C7I A;  4B14 A;  2ZW7 A;  2P6G A;  1KUV A;  4H89 A;  4A33 A;  4FD6 A;  1S3Z A;  4IF5 A;  1RO5 A;  2Q44 A;  3EFA A;  2X7B A;  2OB0 A;  5F46 A;  2BUE A;  4UFX A;  4NSQ A;  2CNM A;  4F0X A;  2GAN A;  3FNC A;  4E0A A;  2YND A;  3FB3 A;  4AVB A;  2FIW A;  2FE7 A;  2VZY A;  2Q4V A;  5H84 A;  4KUA A;  2YNC C;  4M85 A;  3UY5 A;  2JEV A;  3S6H A;  4RI1 A;  5J8F A;  5I0C A;  5AG5 A;  2D4P A;  2EUI A;  4F0Y A;  3R9E A;  2HQY A;  1LRZ A;  4ZGY B;  2ARH A;  2DXQ A;  4PSW A;  2BSW A;  4XNH B;  4UCN A;  4JD6 A;  3ZZI A;  4OLL A;  4KS9 A;  1BOB A;  3TT2 A;  3A9L A;  2P6E A;  4CAV A;  4FD5 A;  4B10 A;  1YVO A;  2CNS A;  3D2M A;  4U5Y A;  1NSL A;  2Z3P A;  3KKW A;  1PUA A;  3JTK A;  5G1Z A;  1YR0 A;  1NE9 A;  2Z3M A;  4B13 A;  1MJ9 A;  5DWM A;  1FY7 A;  2QIR A;  4JLY A;  3R96 A;  4JXR A;  4MHD A;  1Q2C A;  4C2Y A;  2REF A;  2QML A;  1GHE A;  2WPX A;  3TO6 A;  4PV6 A;  2DPS A;  3JVN A;  4C2Z A;  4HNY B;  5JQ4 A;  3P2H A;  2YNC A;  4PK3 A;  3EC4 A;  2QEC A;  4UBR A;  2Z3L A;  1QSO A;  2BL1 A;  2FIA A;  2OZH A;  4B12 A;  4A32 A;  3DSB A;  4L89 A;  2Z0Z A;  1IID A;  4Q36 A;  2ZXV A;  2D4O A;  3FBU A;  3E0K A;  4A95 A;  2FCK A;  1QSR A;  4KOW A;  1M4G A;  1TIQ A;  4AG7 A;  3FYN A;  2I00 A;  5IB0 A;  4AG9 A;  2FL4 A;  2Q4Y A;  3I3G A;  1I21 A;  3PZJ A;  3BLN A;  4PK2 A;  3MGD A;  4KVM E;  1IIC A;  4CGM A;  4BBH A;  1M1D A;  4CRZ B;  5F49 A;  4AVC A;  1B6B A;  5IV0 A;  3GY9 A;  4YRH A;  3D8P A;  4KSA A;  3IGR A;  2Z10 A;  4CGL A;  1S7N A;  1XE4 A;  3TFY A;  4KLW A;  4CAF A;  2K5T A;  5IX3 A;  4R57 A;  1ON0 A;  3H4Q A;  1KUY A;  4UFW A;  3W6S A;  3W91 A;  2KCW A;  5AG6 A;  1YRE A;  1S7L A;  1XEB A;  1KZF A;  4UWI A;  2BEI A;  5ISV A;  1R57 A;  3S6K A;  2P0W A;  4Q38 A;  4A2Z A;  5C82 A;  3TOB A;  1QST A;  4OAE A;  4R3L A;  3PP9 A;  4R3K A;  5DWN A;  2Z3O A;  5AGE A;  1YX0 A;  4C7H A;  4KOT A;  4YFJ A;  1YVK A;  4AVA A;  4UWJ A;  2JLM A;  2NMT A;  4L8A A;  4KVO E;  2RC4 A;  3D3S A;  4NF1 A;  2ZW6 A;  4CRY B;  3SHP A;  5J8C A;  3F5B A;  2A4N A;  2F5I A;  4CGN A;  4R87 A;  2OZG A;  4NEX A;  5F47 A;  1NMT A;  4KOX A;  1Y7R A;  4MY3 A;  1I12 A;  2Q04 A;  1IYK A;  3SXN A;  4DNC A;  4KZT A;  1CM0 A;  4YGO A;  3EY5 A;  4MFK A;  4UFV A;  2R7H A;  1B87 A;  4XPD C;  4CAE A;  3S6F A;  2R1I A;  1Z9U A;  3IWG A;  3FXT A;  3IWE A;  2EVN A;  4QUS A;  4A30 A;  4CYO A;  1Y9K A;  3TCV A;  1U6M A;  1YK3 A;  4KOY A;  1M4I A;  2REE A;  1M4D A;  3VWE A;  2B4D A;  4CS0 B;  4ONU A;  2JDC A;  3D2P A;  4BMH A;  1RXT A;  2FXF A;  4EVY A;  2ZPA A;  4MFL A;  2FS5 A;  5F48 A;  3H5Z A;  3BJ7 A;  4MFQ A;  1QSN A;  5EBV A;  5EC4 A;  2GE3 A;  4LUA A;  2Z3N A;  4MFP A;  2YGW A;  2PDO A;  3CXS A;  4JXQ A;  5G22 A;  3ZJ0 A;  3FIX A;  2B3U A;  2AJ6 A;  2J8M A;  3TOA A;  3JUW A;  3W6X A;  2R8V A;  4UCP A;  3B8G A;  4KOS A;  3LD2 A;  4MFZ A;  3OWC A;  5C88 A;  2VBQ A;  2Q0Y A;  2PR1 A;  3WR7 A;  1OZP A;  1J4J A;  4OAD A;  5BWA B;  3T90 A;  4B11 A;  2VQY A;  1BO4 A;  4UA3 A;  2PQ8 A;  4CGP A;  1XIX A;  2AE6 A;  5G20 A;  4KLV A;  4AB7 A;  4JJX A;  4K30 A;  4HKF A;  1VHS A;  5G21 A;  4M3S A;  4II9 A;  2P6F A;  4NCZ A;  2VZZ A;  4KUB A;  2PSW A;  1L0C A;  3DDD A;  2B58 A;  2B4D B;  4H6Z A;  2OU2 A;  4LX9 A;  3GKR A;  3P2F A;  3V8I A;  1N71 A;  4HNW B;  4KOR A;  5GCN A;  1CJW A;  1M44 A;  4QB9 A;  1SQH A;  2CXA A;  5KTD A;  2Y0M A;  1VKC A;  2IL4 A;  2WPW A;  3IU2 A;  4MI4 A;  1S60 A;  4B5P A;  3SXO A;  5A27 A;  4J3G A;  4E8O A;  1UFH A;  2CY2 A;  3EXN A;  1Z4E A;  3F0A A;  1WWZ A;  2R98 A;  4ORF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...