3FNCA

Crystal structure of a putative acetyltransferase from listeria innocua
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
160
structure length
160
Chain Sequence
MDFHIRKATNSDAEAIQHVATTSWHHTYQDLIPSDVQDDFLKRFYNVETLHNRISATPFAVLEQADKVIGFANFIELEKGKSELAAFYLLPEVTQRGLGTELLEVGMTLFHVPLPMFVNVEKGNETAIHFYKAKGFVQVEEFTEDFYGYPLETIRFNLNH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Putative acetyltransferase
publication title The structure of a putative acetyltransferase from Listeria innocua.
rcsb
source organism Listeria innocua
total genus 47
structure length 160
sequence length 160
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-12-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13673 Acetyltransf_10 Acetyltransferase (GNAT) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 3fncA00
2FS5A 3B8GA 2Y0MA 3ZZIA 1NMTA 1QSNA 2OZUA 4ORFA 2GE3A 4NF1A 3TT2A 4Y49B 2B4BA 4KOYA 2C27A 2CNMA 3E0KA 3LODA 5IV0A 1KUYA 4PK3A 4ONUA 2G0BA 1MK4A 2ARHA 2PDOA 3R9GA 1YX0A 4HNXB 4NCZA 5I0CA 1OZPA 4II9A 2B5GA 4JWPA 4YRHA 3GKRA 2REEA 2B4DB 3I3GA 4QB9A 4U9ZA 1P4NA 2ZW4A 1YVOA 5F49A 2CNSA 1CM0A 3D8PA 4PV6A 2PRBA 3R1KA 2Q04A 2Z10A 4KZTA 2VXKA 2ZXVA 4XNHC 4HNYB 2I79A 1FY7A 1YLEA 4JLYA 1B6BA 4IF5A 2HV2A 4NSQA 3MGDA 2VBQA 1Q2CA 2AE6A 4UWJA 4OAEA 4IUSA 1Z9UA 4XPLA 1BOBA 3TTHA 1XMTA 2FE7A 2PSWA 3TOBA 3DNSA 4R3LA 1V0CA 4JXRA 4DNCA 2HUZA 1S7NA 3DSBA 2HQYA 4E2AA 1KUXA 1I12A 2B3VA 3OWCA 3SHPA 4FD7A 4J3GA 1VKCA 2WPWA 4GS4A 3FBUA 4KUAA 4UA3A 4CRZB 2GIVA 2FXFA 1S7FA 1MJAA 3I9SA 4KORA 3W6XA 2FT0A 4KOVA 2Q4YA 3BLNA 1M4DA 2FIWA 1Y7RA 4B5PB 3ZJ0A 3PZJA 4QUSA 3T90A 4MJ8A 3TE4A 4PSXA 3KKWA 1S3ZA 5F46A 2B58A 2B5GB 1U6MA 3N7ZA 3TCVA 4BMHA 3BJ8A 1YVKA 3C26A 5CNPA 2PC1A 5C82A 1RXTA 1ON0A 3R95A 3IWGA 2AJ6A 4OLLA 4KLWA 3FRMA 2J8RA 1J4JA 3FIXA 2R1IA 5E96A 3F5BA 3TFYA 4CS0B 1VHSA 2NMTA 2P0WA 5KTAA 2ZW7A 3FYNA 2ATRA 5FVJA 1RO5A 2OZGA 1S7KA 2JDDA 3F8KA 1YGHA 4B5PA 3CXPA 4NEXA 3EO4A 4H89A 1S60A 4LX9A 5IX3A 1Q2YA 5HH1A 3D3SA 1XEBA 4MHDA 5GCNA 1R57A 3DR6A 4KOSA 1Z4RA 4JJXA 2P6GA 2Q4VA 2CY2A 2G3AA 4M85A 3GY9A 4AVCA 2Q44A 5EBVA 3NE7A 3R9FA 2D4OA 2J8NA 4OADA 3V8IA 2VQYA 4ZBGA 3EXNA 3G3SA 4X5KA 1UFHA 3R96A 4MBUA 4YFJA 4AVAA 3FB3A 3P2FA 5F48A 2FL4A 2R7HA 3VWDA 2VEZA 3FXTA 4KOUA 2JDCA 5JPHA 1CJWA 1M1DA 3PP9A 2CNTA 4FD5A 1I1DA 4XPDC 4HKFA 5KTDA 4AVBA 1YK3A 1IB1E 1XE4A 1XF8A 4L8AA 4YGOA 3RYOA 4Y49C 3QAHA 5C88A 1B87A 3DDDA 2BL1A 5JQ4A 4CAXA 3SXOA 2Q0YA 4KOXA 4KLVA 1NSLA 3FNCA 1N71A 3TOAA 4KVXA 2DXQA 3PGPA 5DWMA 5ISVA 1PU9A 2OB0A 2RC4A 5J8CA 2P6FA 3T9YA 4K30A 4FD4A 3K9UA 4XNHB 3EFAA 4AB7A 2VZYA 2BUEA 2OH1A 3S6HA 3IGRA 2FIAA 5EC4A 1YREA 2Z11A 2PR8A 3F0AA 2ZW5A 2REFA 4R57A 1KZFA 4JXQA 4AG9A 4I49A 2FSRA 1IYLA 1LRZA 5J8FA 2ZPAA 4H6ZA 2Q7BA 4XPKA 4CRYB 1M4IA 2P6EA 1MJ9A 2OU2A 2R98A 4AG7A 3D2PA 2EVNA 2VZZA 2H5MA 4MY0A 4XPDB 4KVME 2OZHA 4QBJA 2O28A 1IIDA 1MJBA 4KVOE 2PR1A 1GHEA 4U9YA 3BJ7A 1XIXA 2FCKA 1SQHA 1QSOA 4UWIA 5DWNA 2VI7A 1WWZA 3VWEA 5HMNA 2R8VA 4KOWA 1Y9KA 3EC4A 2A4NA 4QVTA 2ZW6A 3G8WA 3P2HA 4EVYA 1M4GA 1PUAA 3TO9A 4PK2A 3DR8A 4R87A 3S6GA 2D4PA 3UY5A 3CXSA 2BSWA 4NXYA 3JUWA 5KTCA 4RS2A 5H84A 5H86A 1Y9WA 3LD2A 4F0YA 4CAVA 4HNWB 1I21A 4KOTA 4R3KA 2I00A 2BEIA 1K4JA 4MY3A 2QIRA 3QB8A 2IL4A 4E8OA 2PQ8A 1QSMA 1WK4A 2GANA 1QSRA 2F5IA 3TO6A 1L0CA 4LUAA 1M44A 4PSWA 1IYKA 3R9EA 2X7BA 2JLMA 3D2MA 2K5TA 2KCWA 3W91A 5F47A 1NE9A 3S6FA 4RI1A 2B3UA 1BO4A 1S7LA 3S6KA 5IB0A 1P0HA 4KUBA 2EUIA 3WR7A 1TIQA 3GYAA 1S5KA 2JEVA 4E0AA 1IICA 4FD6A 1QSTA 3SXNA 4F6AA 3EY5A 2B4DA 2G3TA 2WPXA 4QC6A 4MI4A 3TO7A 3JVNA 3W6SA 1Z4EA 4L89A 1Q2DA 4M3SA 4JD6A 4CAWA 2QMLA 3CXQA 2J8MA 4B5OA 4H6UA 2Z0ZA 4R9MA 2QECA 3H4QA 4U5YA 1KUVA 1YR0A 4UBRA
chains in the Genus database with same CATH superfamily
4OMEA 4GM5A 2FS5A 3B8GA 2DPSA 2Y0MA 3B3VA 4NGMA 4P4IA 4UCNA 3ZZIA 1NMTA 5THWA 2G9DA 5D8NA 3VH9A 1QSNA 2OZUA 4A37A 2PCUA 3K2KA 2PJAA 2GE3A 4ORFA 3IFEA 4NF1A 4Q38A 5JGFA 4M6HA 1EE3P 3PBBA 3B7IA 2F7VA 1TKFA 1BPNA 3TT2A 4Y49B 2C6PA 2ZENA 1FT7A 2B4BA 4KOYA 2C27A 2RFHA 2XEFA 2CNMA 5A27A 3E0KA 3LODA 5IV0A 2WSAA 1KUYA 4IHMA 2CIJA 4PK3A 4NGPA 2BO9A 4ONUA 2G0BA 4NGRA 1MK4A 1PCAA 2AFSA 2PJ6A 5DS0A 2ARHA 2PDOA 4JZ0A 2Q43A 1BLLE 1Y0YA 3R9GA 4B14A 1YX0A 4HNXB 4NCZA 3BXMA 2PJBA 5I0CA 3CT9A 3HUVA 1OZPA 2J9AA 1Z8WA 4OIDA 1YW4A 3BI0A 3FF3A 4P44A 3LWUA 4II9A 2B5GA 1YQEA 4JWPA 4YRHA 3GKRA 2Z3PA 2PIYA 1LCPA 2B4DB 2REEA 3H8FA 2HB6A 3I3GA 4QB9A 1P4NA 2ZW4A 1YVOA 4U9ZA 5F49A 2CNSA 2OR4A 1CM0A 1GYTA 3D8PA 4PV6A 2PRBA 3R1KA 2Q04A 2Z10A 4MFLA 1ZO0A 4KZTA 2VXKA 4ZY0A 1IGBA 2ZXVA 4XNHC 4HNYB 2I79A 3NH8A 1FY7A 4UEEA 4A31A 4DUKA 1YLEA 4CGMA 3RAMA 1XFOA 3KASA 4JLYA 3GIUA 1B6BA 4IF5A 2HV2A 4NSQA 2ABZA 3MGDA 4MXUA 4OP4A 2VBQA 3IWWA 1Q2CA 2AE6A 2ZEOA 4UWJA 4A30A 4OAEA 5G21A 1YW6A 2RB7A 3T8WA 4IUSA 1Z9UA 4XPLA 1BOBA 3WC5A 4NGNA 3TTHA 1XMTA 2AFWA 2PJ0A 2YNCC 3MRUA 5D29A 2FE7A 2PSWA 3TOBA 2GREA 3DNSA 5HVGA 4R3LA 1V0CA 4JXRA 4UCPA 4DNCA 2HUZA 3KHZA 2C6GA 3WABA 4CAFA 1S7NA 3DSBA 2HQYA 4E2AA 3PFEA 1KUXA 1I12A 2B3VA 3OWCA 4OC0A 4FD7A 3S9MA 3SHPA 3V38A 4J3GA 1VKCA 2WPWA 4GS4A 2PJ2A 1CP7A 2IMOA 5HXDA 3FBUA 4B12A 4KUAA 4UA3A 2PVVA 1TF9A 4CRZB 3FH4A 4C2YA 4EFDA 4LQGA 2GIVA 1H8LA 1PYTB 2FXFA 3PEIA 3FEEA 4M6GA 2NSMA 1S7FA 1MJAA 1VHEA 3I9SA 4KORA 3TX8A 3W6XA 4PXCA 2FT0A 4KOVA 3KR4A 2Q4YA 3BLNA 3SJGA 1IOIA 3B35A 1M4DA 2POKA 2FIWA 1Y7RA 4UIBA 4UFWA 1RTQA 4B5PB 3ZJ0A 1XMBA 3PZJA 4QUSA 3H8GA 2ODFA 3IWEA 1YMEA 2IJZA 4MJ8A 4R76A 4UIAA 4PSXA 2XEJA 1S3ZA 2ZEDA 2B58A 3KKWA 4MHPA 4ZGYB 5F46A 2B5GB 1U6MA 3KL9A 5IB9A 3N7ZA 5K8NA 3TCVA 4BMHA 2HC9A 3BJ8A 4NGSA 2QJ8A 5J1QA 1YVKA 3C26A 4Z65A 5CNPA 2PC1A 2Z3MA 3D7HA 5C82A 2V8HA 4IAVA 3NH5A 4P4FA 4CAEA 1RXTA 1LOKA 2C6CA 3QNVA 4IK2A 1ON0A 1XJOA 3R95A 3DLJA 3FEDA 3IWGA 1HDQA 3BI1A 3PB8X 2BCOA 3ISXA 2AJ6A 4OLLA 4PPZA 4UEFA 4YU9A 1X10A 4KLWA 3FRMA 4R8FA 2J8RA 2WZNA 1J4JA 3FIXA 1ARMA 4Q7AA 5LRKA 1R43A 2PJ5A 2R1IA 3VARA 5E96A 5AG4A 1ARLA 3F5BA 5HVHA 3TFYA 3SI2A 4A94A 4C2ZA 4CS0B 1AYEA 4TWEA 5AG6A 1VHSA 1YSJA 4P4BA 2NMTA 3NE8A 2P0WA 1ELLP 2ZEGA 4MFZA 4ONWA 5KTAA 1CP6A 2ZW7A 3FYNA 2F8HA 3RNZA 2ATRA 5FVJA 4MHNA 1RO5A 4MFKA 2V8DA 2OZGA 5K8OA 4NFRA 1S7KA 2JDDA 3F8KA 4OC4A 4OC1A 4CYNA 1YGHA 4B5PA 3CXPA 4NEXA 5G22A 3FVLA 3EO4A 2Z3NA 1IY7A 4H89A 1S60A 4LX9A 5IX3A 4MFQA 1Q2YA 5HH1A 4OC5A 3D3SA 2JBKA 1XEBA 2Q4ZA 3CPXA 1FNOA 4MHDA 3RBUA 4NJRA 5GCNA 4C7IA 5AG7A 4H2KA 1R57A 4KS9A 4WJBA 3DR6A 1LANA 3PBEA 1BPMA 2DPTA 1Z4RA 2PJ7A 4KOSA 1HEEA 4JJXA 4F0XA 2P6GA 4BBHA 1CX8A 1UWYA 2Q4VA 3SI1A 2CY2A 3B3SA 3FX6A 5LYLA 3S9LA 3KR5A 4P6YA 2G3AA 4M85A 3GY9A 4UCMA 1Q7LA 4AVCA 1F2PA 2Q44A 5EBVA 3CDXA 3L2NA 3NE7A 4P4EA 3R9FA 4X8IA 1ZG7A 5CBMA 2D4OA 2J8NA 4OADA 5G1ZA 3V8IA 2CXAA 2VQYA 4ZBGA 3KHXA 4RUHA 2YNEA 2DF5A 5JM6A 3EXNA 3G3SA 4X5KA 4ZYQA 4ZI6A 1UFHA 1QMUA 1CPXA 1BAVA 2NYQA 2PIZA 2YNCA 4MFPA 1VHOA 3R96A 4X3RA 4MBUA 4MHZA 3FECA 2EO8A 5AG5A 4YFJA 2PJ8A 3D7FA 4ZX9A 5LYIA 4AVAA 3FB3A 3P2FA 5F48A 2FL4A 4GXHA 2R7HA 4MCRA 4O23A 3VWDA 2VEZA 2I3CA 3FXTA 4KOUA 2JDCA 2QVPA 4UFXA 1CJWA 4F9UA 5JPHA 3BHXA 4FWUA 1M1DA 3PP9A 8CPAA 4TNUA 2CNTA 4FD5A 1I1DA 3GLJA 4XPDC 1X12A 4CGNA 4HKFA 5KTDA 4AVBA 2OOTA 1YK3A 2V8GA 2ZEPA 1ZLIA 5F09A 1IB1E 1XE4A 3D4UA 1IOFA 1XF8A 4L8AA 4YGOA 1DTDA 1TF8A 3RYOA 4Y49C 2EBJA 1VGYA 4A2ZA 3QAHA 5C88A 1B87A 3DDDA 4OC2A 3PFOA 2GLJA 2Z3OA 2BL1A 3I1UA 5LYDA 4CAXA 3SXOA 2Q0YA 4C68A 5JQ4A 4KOXA 3WT4A 3WC7A 7CPAA 3KI9A 3CZXA 4KLVA 4MCQA 1NSLA 3HLPA 2AFXA 2Q51A 3D67A 4UFVA 3FNCA 3A9LA 3SJXA 2WUUA 1N71A 4HPSA 3TOAA 4KVXA 4B6ZA 2DXQA 2CTBA 2PJ9A 3PGPA 5DWMA 5LYFA 3S9NA 5ISVA 1PU9A 2AFZA 3H8EA 3B3WA 3KQXA 2OB0A 2RC4A 5J8CA 2P6FA 3N5FA 3T9YA 4FD4A 4K30A 4FBEA 3FMCA 3K9UA 4XNHB 3B3CA 3EFAA 4KSFA 4AB7A 3KGQA 3QAYA 2Q7SA 4CGOA 4F9VA 1LAPA 2VZYA 4KSAA 2BUEA 2OH1A 3S6HA 3IGRA 1AUGA 4C7HA 2FIAA 5EC4A 4P45A 1YREA 3D7DA 2Z11A 3IC1A 5HVFA 2PR8A 4A33A 4WWVA 3F0AA 2ZW5A 4PQAA 1VIXA 2REFA 4R57A 1KZFA 4JXQA 4B11A 4AG9A 4C2XA 4I49A 2FSRA 1IYLA 3LMSA 1LRZA 3TE4A 5J8FA 2ZPAA 4H6ZA 4JYWA 2Q7BA 3V7ZA 3GB0A 4FAIA 4XPKA 3IO1A 1M4IA 4CRYB 2P6EA 1MJ9A 4OIWA 2OU2A 2R98A 4BINA 3D66A 4AG7A 3D2PA 2EVNA 2VZZA 3KQZA 4CPAA 2XEGA 2H5MA 4MY0A 3IEHA 4OC3A 1KWMA 4NJQA 4A95A 4XPDB 4KVME 4P4JA 2OZHA 4QBJA 2O28A 4MRIA 1IIDA 1MJBA 4KVOE 2PR1A 5BWAB 1GHEA 1Y7EA 1Z5RA 4U9YA 1JQGA 2O4HA 1NSAA 3BJ7A 4CGPA 1XIXA 2FCKA 1SQHA 1QSOA 4UWIA 5DWNA 3PB7X 2VI7A 1WWZA 4P10A 2ZEMA 1OBRA 2ZEEA 4MFJA 1Z8LA 3B3TA 3KZWA 3VWEA 5HMNA 2AFOA 3NFZA 2R8VA 2PVWA 4KOWA 2EK8A 1Y9KA 2ZEHA 3EC4A 2A4NA 4YWYA 4QVTA 3MN8A 3RO0A 4K3NA 2PJ3A 4NGQA 2ZW6A 4PXDA 2PRQA 3G8WA 1JWQA 3P2HA 4EVYA 2FVGA 1CPSA 1M4GA 1PUAA 2ZOFA 4Q36A 2CF4A 3TO9A 3SI0A 4PK2A 2ZOGA 3DR8A 3DGVA 1F57A 4R87A 5K8PA 3S6GA 2D4PA 3UY5A 4B10A 4CYPA 3PB4X 3CXSA 3LACA 2V8VA 4MCPA 2YNDA 3JRUA 1TKHA 2BSWA 1XRYA 3IIBA 4NXYA 3JUWA 5A28A 4RS2A 5KTCA 4DYOA 5H84A 5H86A 5G20A 1Y9WA 3LD2A 4F0YA 4UEZA 4G1PA 3T90A 2VL1A 3FJUA 4CAVA 2YGWA 4HNWB 1I21A 4KOTA 4NGTA 4R3KA 4W9YA 3IU1A 2I00A 3NH4A 2BEIA 1ELMP 4RN7A 1K4JA 2PJCA 4MY3A 4ZX8A 1TXRA 5EMIA 2QIRA 3QB8A 1XOVA 2IL4A 3WC6A 4E8OA 2PQ8A 1ZG8A 4ZY2A 1QSMA 4MCSA 4CYOA 1WK4A 2GANA 1QSRA 2AFMA 2F5IA 2WYRA 1L0CA 3TO6A 2O53A 4EWTA 4LUAA 1AMPA 4LQ6A 2JEWA 3JTKA 1M44A 2GU2A 4FUUA 4P4DA 4PSWA 1IYKA 4X2TA 2PJ4A 3B2YA 3R9EA 2JBJA 2JLMA 2X7BA 3D2MA 2K5TA 1ZLHA 2KCWA 1HDUA 3W91A 5F47A 1NE9A 1Z8TA 3S6FA 4RI1A 4A32A 2B3UA 4MMOA 3CPAA 1BO4A 2ZELA 3PB9X 3IU2A 2CTCA 1LFWA 1S7LA 3D7GA 3S6KA 5IB0A 1CBXA 1P0HA 2AFUA 4KUBA 4R6TA 2EUIA 3WR7A 1TIQA 3ISZA 3GYAA 4CYQA 2DEAA 2QYVA 3D68A 4R7MA 1S5KA 2JEVA 4E0AA 1IICA 4UF4A 1LAMA 1XBUA 4DJLA 1Z8XA 4FD6A 1QSTA 3SXNA 4F6AA 3EY5A 1M4LA 1TKJA 1Y0RA 2B4DA 2G3TA 2WPXA 2BOAA 4F8ZA 1A2ZA 3TC8A 1QQ9A 4AXVA 4ZY1A 2EK9A 4QC6A 4M6IA 4MI4A 2Z3LA 3TO7A 3JVNA 1Z2LA 4KSIA 3W6SA 5I4MA 2ANPA 3GUXA 4MHYA 5AGEA 5ELYA 3NA6A 5CPAA 4EMEA 4BD9A 1Z4EA 4L89A 1F2OA 2C1CA 1R3NA 2GFQA 4CGLA 6CPAA 4PXEA 4A39A 1CG2A 3IJ3A 3SJEA 4A38A 2PJ1A 1YLOA 2IQ6A 1Q2DA 4M3SA 4JD6A 4CAWA 2ZEFA 2QMLA 3K9TA 3CXQA 2J8MA 3H5ZA 1ZG9A 1IU8A 3PRTA 4B5OA 4H6UA 2Z3KA 2Z0ZA 3PB6X 5K8MA 2EWBA 3RZAA 2V77A 4OKOA 4R9MA 5LRJA 2QECA 1DE4C 2XEIA 3H4QA 4U5YA 1KUVA 1YR0A 2PE3A 4B13A 4UBRA 4PXBA 5JH9A 3SJFA 3VATA 5LRGA 2GLFA
chains in the Genus database with same CATH topology
2FS5A 3B8GA 2DPSA 2Y0MA 4UCNA 3ZZIA 1NMTA 1QSNA 2OZUA 4ORFA 2GE3A 4NF1A 4Q38A 3TT2A 4Y49B 2B4BA 4KOYA 2C27A 2CNMA 5A27A 3E0KA 3LODA 5IV0A 2WSAA 1KUYA 4PK3A 4ONUA 2G0BA 1MK4A 2ARHA 2PDOA 3R9GA 4B14A 1YX0A 4HNXB 4NCZA 5I0CA 1OZPA 4II9A 2B5GA 4JWPA 4YRHA 3GKRA 2Z3PA 2REEA 2B4DB 3I3GA 4QB9A 4U9ZA 1P4NA 2ZW4A 1YVOA 5F49A 2CNSA 1CM0A 3D8PA 4PV6A 2PRBA 3R1KA 2Q04A 2Z10A 4MFLA 1ZO0A 4KZTA 2VXKA 2ZXVA 4XNHC 4HNYB 2I79A 1FY7A 4A31A 1YLEA 4CGMA 4JLYA 1B6BA 4IF5A 2HV2A 4NSQA 3MGDA 2VBQA 1Q2CA 2AE6A 4UWJA 4A30A 4OAEA 5G21A 4IUSA 1Z9UA 4XPLA 1BOBA 3TTHA 1XMTA 2YNCC 2FE7A 2PSWA 3TOBA 3DNSA 4R3LA 1V0CA 4JXRA 4UCPA 4DNCA 2HUZA 4CAFA 1S7NA 3DSBA 2HQYA 4E2AA 1KUXA 1I12A 2B3VA 3OWCA 3SHPA 4FD7A 4J3GA 1VKCA 2WPWA 4GS4A 3FBUA 4B12A 4KUAA 4UA3A 4CRZB 4C2YA 2GIVA 2FXFA 1S7FA 1MJAA 3I9SA 4KORA 3W6XA 2FT0A 4KOVA 2Q4YA 3BLNA 1M4DA 2FIWA 1Y7RA 4UFWA 4B5PB 3ZJ0A 3PZJA 4QUSA 3IWEA 3T90A 4MJ8A 3TE4A 4ZGYB 4PSXA 3KKWA 1S3ZA 5F46A 2B58A 2B5GB 1U6MA 3N7ZA 3TCVA 4BMHA 3BJ8A 1YVKA 3C26A 5CNPA 2PC1A 2Z3MA 5C82A 4CAEA 1RXTA 1ON0A 3R95A 3IWGA 2AJ6A 4OLLA 4KLWA 3FRMA 2J8RA 1J4JA 3FIXA 2R1IA 5AG4A 5E96A 3F5BA 3TFYA 4C2ZA 4CS0B 5AG6A 1VHSA 2NMTA 2P0WA 4MFZA 5KTAA 2ZW7A 3FYNA 2ATRA 5FVJA 1RO5A 4MFKA 2OZGA 1S7KA 2JDDA 3F8KA 4CYNA 1YGHA 4B5PA 3CXPA 4NEXA 5G22A 3EO4A 2Z3NA 4H89A 1S60A 4LX9A 5IX3A 4MFQA 1Q2YA 5HH1A 3D3SA 1XEBA 4MHDA 5GCNA 4C7IA 5AG7A 1R57A 4KS9A 3DR6A 2DPTA 4KOSA 1Z4RA 4JJXA 4F0XA 2P6GA 4BBHA 2Q4VA 2CY2A 2G3AA 4M85A 3GY9A 4UCMA 4AVCA 2Q44A 5EBVA 3NE7A 3R9FA 2D4OA 2J8NA 4OADA 5G1ZA 3V8IA 2CXAA 2VQYA 4ZBGA 2YNEA 3EXNA 3G3SA 4X5KA 1UFHA 2YNCA 4MFPA 3R96A 4MBUA 5AG5A 4YFJA 4AVAA 3FB3A 3P2FA 5F48A 2FL4A 2R7HA 3VWDA 2VEZA 3FXTA 4KOUA 4UFXA 2JDCA 5JPHA 1CJWA 1M1DA 3PP9A 2CNTA 4FD5A 1I1DA 4CGNA 4XPDC 4HKFA 5KTDA 4AVBA 1YK3A 1IB1E 1XE4A 1XF8A 4L8AA 4YGOA 3RYOA 4Y49C 4A2ZA 3QAHA 5C88A 1B87A 3DDDA 2Z3OA 2BL1A 5JQ4A 4CAXA 3SXOA 2Q0YA 4C68A 4KOXA 4KLVA 1NSLA 4UFVA 3FNCA 3A9LA 2WUUA 1N71A 3TOAA 4KVXA 2DXQA 3PGPA 5DWMA 5ISVA 1PU9A 2OB0A 2RC4A 5J8CA 2P6FA 3T9YA 4FD4A 4K30A 3K9UA 4XNHB 3EFAA 4KSFA 4AB7A 4CGOA 2VZYA 4KSAA 2BUEA 2OH1A 3S6HA 3IGRA 4C7HA 2FIAA 5EC4A 1YREA 4A33A 2Z11A 2PR8A 3F0AA 2ZW5A 2REFA 4R57A 1KZFA 4JXQA 4B11A 4AG9A 4C2XA 4I49A 2FSRA 1IYLA 1LRZA 5J8FA 2ZPAA 4H6ZA 2Q7BA 4XPKA 4CRYB 1M4IA 2P6EA 1MJ9A 2OU2A 2R98A 4AG7A 3D2PA 2EVNA 2VZZA 2H5MA 4MY0A 4A95A 4XPDB 4KVME 2OZHA 4QBJA 2O28A 1IIDA 1MJBA 4KVOE 2PR1A 5BWAB 1GHEA 4U9YA 3BJ7A 4CGPA 1XIXA 2FCKA 1SQHA 1QSOA 4UWIA 5DWNA 2VI7A 1WWZA 4MFJA 3VWEA 5HMNA 2R8VA 4KOWA 1Y9KA 3EC4A 2A4NA 4QVTA 2ZW6A 3G8WA 3P2HA 4EVYA 1M4GA 1PUAA 4Q36A 3TO9A 4PK2A 3DR8A 4R87A 3S6GA 2D4PA 3UY5A 4B10A 4CYPA 3CXSA 2YNDA 2BSWA 4NXYA 3JUWA 5A28A 4RS2A 5KTCA 5H84A 5H86A 5G20A 1Y9WA 3LD2A 4F0YA 4CAVA 2YGWA 4HNWB 1I21A 4KOTA 4R3KA 3IU1A 2I00A 2BEIA 1K4JA 4MY3A 2QIRA 3QB8A 2IL4A 4E8OA 2PQ8A 1QSMA 4CYOA 1WK4A 2GANA 1QSRA 2F5IA 3TO6A 1L0CA 4LUAA 3JTKA 1M44A 4PSWA 1IYKA 3R9EA 2X7BA 2JLMA 3D2MA 2K5TA 2KCWA 3W91A 5F47A 1NE9A 3S6FA 4RI1A 4A32A 2B3UA 1BO4A 3IU2A 1S7LA 3S6KA 5IB0A 1P0HA 4KUBA 2EUIA 3WR7A 1TIQA 3GYAA 4CYQA 1S5KA 2JEVA 4E0AA 1IICA 4FD6A 1QSTA 3SXNA 4F6AA 3EY5A 2B4DA 2G3TA 2WPXA 4QC6A 4MI4A 3TO7A 2Z3LA 3JVNA 3W6SA 5AGEA 1Z4EA 4L89A 4CGLA 1Q2DA 4M3SA 4JD6A 4CAWA 2QMLA 3CXQA 2J8MA 3H5ZA 4B5OA 4H6UA 2Z3KA 2Z0ZA 4R9MA 2QECA 3H4QA 4U5YA 1KUVA 1YR0A 4B13A 4UBRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FS5 A;  3B8G A;  2Y0M A;  3ZZI A;  1NMT A;  1QSN A;  2OZU A;  4ORF A;  2GE3 A;  4NF1 A;  3TT2 A;  4Y49 B;  2B4B A;  4KOY A;  2C27 A;  2CNM A;  3E0K A;  3LOD A;  5IV0 A;  1KUY A;  4PK3 A;  4ONU A;  2G0B A;  1MK4 A;  2ARH A;  2PDO A;  3R9G A;  1YX0 A;  4HNX B;  4NCZ A;  5I0C A;  1OZP A;  4II9 A;  2B5G A;  4JWP A;  4YRH A;  3GKR A;  2REE A;  2B4D B;  3I3G A;  4QB9 A;  4U9Z A;  1P4N A;  2ZW4 A;  1YVO A;  5F49 A;  2CNS A;  1CM0 A;  3D8P A;  4PV6 A;  2PRB A;  3R1K A;  2Q04 A;  2Z10 A;  4KZT A;  2VXK A;  2ZXV A;  4XNH C;  4HNY B;  2I79 A;  1FY7 A;  1YLE A;  4JLY A;  1B6B A;  4IF5 A;  2HV2 A;  4NSQ A;  3MGD A;  2VBQ A;  1Q2C A;  2AE6 A;  4UWJ A;  4OAE A;  4IUS A;  1Z9U A;  4XPL A;  1BOB A;  3TTH A;  1XMT A;  2FE7 A;  2PSW A;  3TOB A;  3DNS A;  4R3L A;  1V0C A;  4JXR A;  4DNC A;  2HUZ A;  1S7N A;  3DSB A;  2HQY A;  4E2A A;  1KUX A;  1I12 A;  2B3V A;  3OWC A;  3SHP A;  4FD7 A;  4J3G A;  1VKC A;  2WPW A;  4GS4 A;  3FBU A;  4KUA A;  4UA3 A;  4CRZ B;  2GIV A;  2FXF A;  1S7F A;  1MJA A;  3I9S A;  4KOR A;  3W6X A;  2FT0 A;  4KOV A;  2Q4Y A;  3BLN A;  1M4D A;  2FIW A;  1Y7R A;  4B5P B;  3ZJ0 A;  3PZJ A;  4QUS A;  3T90 A;  4MJ8 A;  3TE4 A;  4PSX A;  3KKW A;  1S3Z A;  5F46 A;  2B58 A;  2B5G B;  1U6M A;  3N7Z A;  3TCV A;  4BMH A;  3BJ8 A;  1YVK A;  3C26 A;  5CNP A;  2PC1 A;  5C82 A;  1RXT A;  1ON0 A;  3R95 A;  3IWG A;  2AJ6 A;  4OLL A;  4KLW A;  3FRM A;  2J8R A;  1J4J A;  3FIX A;  2R1I A;  5E96 A;  3F5B A;  3TFY A;  4CS0 B;  1VHS A;  2NMT A;  2P0W A;  5KTA A;  2ZW7 A;  3FYN A;  2ATR A;  5FVJ A;  1RO5 A;  2OZG A;  1S7K A;  2JDD A;  3F8K A;  1YGH A;  4B5P A;  3CXP A;  4NEX A;  3EO4 A;  4H89 A;  1S60 A;  4LX9 A;  5IX3 A;  1Q2Y A;  5HH1 A;  3D3S A;  1XEB A;  4MHD A;  5GCN A;  1R57 A;  3DR6 A;  4KOS A;  1Z4R A;  4JJX A;  2P6G A;  2Q4V A;  2CY2 A;  2G3A A;  4M85 A;  3GY9 A;  4AVC A;  2Q44 A;  5EBV A;  3NE7 A;  3R9F A;  2D4O A;  2J8N A;  4OAD A;  3V8I A;  2VQY A;  4ZBG A;  3EXN A;  3G3S A;  4X5K A;  1UFH A;  3R96 A;  4MBU A;  4YFJ A;  4AVA A;  3FB3 A;  3P2F A;  5F48 A;  2FL4 A;  2R7H A;  3VWD A;  2VEZ A;  3FXT A;  4KOU A;  2JDC A;  5JPH A;  1CJW A;  1M1D A;  3PP9 A;  2CNT A;  4FD5 A;  1I1D A;  4XPD C;  4HKF A;  5KTD A;  4AVB A;  1YK3 A;  1IB1 E;  1XE4 A;  1XF8 A;  4L8A A;  4YGO A;  3RYO A;  4Y49 C;  3QAH A;  5C88 A;  1B87 A;  3DDD A;  2BL1 A;  5JQ4 A;  4CAX A;  3SXO A;  2Q0Y A;  4KOX A;  4KLV A;  1NSL A;  3FNC A;  1N71 A;  3TOA A;  4KVX A;  2DXQ A;  3PGP A;  5DWM A;  5ISV A;  1PU9 A;  2OB0 A;  2RC4 A;  5J8C A;  2P6F A;  3T9Y A;  4K30 A;  4FD4 A;  3K9U A;  4XNH B;  3EFA A;  4AB7 A;  2VZY A;  2BUE A;  2OH1 A;  3S6H A;  3IGR A;  2FIA A;  5EC4 A;  1YRE A;  2Z11 A;  2PR8 A;  3F0A A;  2ZW5 A;  2REF A;  4R57 A;  1KZF A;  4JXQ A;  4AG9 A;  4I49 A;  2FSR A;  1IYL A;  1LRZ A;  5J8F A;  2ZPA A;  4H6Z A;  2Q7B A;  4XPK A;  4CRY B;  1M4I A;  2P6E A;  1MJ9 A;  2OU2 A;  2R98 A;  4AG7 A;  3D2P A;  2EVN A;  2VZZ A;  2H5M A;  4MY0 A;  4XPD B;  4KVM E;  2OZH A;  4QBJ A;  2O28 A;  1IID A;  1MJB A;  4KVO E;  2PR1 A;  1GHE A;  4U9Y A;  3BJ7 A;  1XIX A;  2FCK A;  1SQH A;  1QSO A;  4UWI A;  5DWN A;  2VI7 A;  1WWZ A;  3VWE A;  5HMN A;  2R8V A;  4KOW A;  1Y9K A;  3EC4 A;  2A4N A;  4QVT A;  2ZW6 A;  3G8W A;  3P2H A;  4EVY A;  1M4G A;  1PUA A;  3TO9 A;  4PK2 A;  3DR8 A;  4R87 A;  3S6G A;  2D4P A;  3UY5 A;  3CXS A;  2BSW A;  4NXY A;  3JUW A;  5KTC A;  4RS2 A;  5H84 A;  5H86 A;  1Y9W A;  3LD2 A;  4F0Y A;  4CAV A;  4HNW B;  1I21 A;  4KOT A;  4R3K A;  2I00 A;  2BEI A;  1K4J A;  4MY3 A;  2QIR A;  3QB8 A;  2IL4 A;  4E8O A;  2PQ8 A;  1QSM A;  1WK4 A;  2GAN A;  1QSR A;  2F5I A;  3TO6 A;  1L0C A;  4LUA A;  1M44 A;  4PSW A;  1IYK A;  3R9E A;  2X7B A;  2JLM A;  3D2M A;  2K5T A;  2KCW A;  3W91 A;  5F47 A;  1NE9 A;  3S6F A;  4RI1 A;  2B3U A;  1BO4 A;  1S7L A;  3S6K A;  5IB0 A;  1P0H A;  4KUB A;  2EUI A;  3WR7 A;  1TIQ A;  3GYA A;  1S5K A;  2JEV A;  4E0A A;  1IIC A;  4FD6 A;  1QST A;  3SXN A;  4F6A A;  3EY5 A;  2B4D A;  2G3T A;  2WPX A;  4QC6 A;  4MI4 A;  3TO7 A;  3JVN A;  3W6S A;  1Z4E A;  4L89 A;  1Q2D A;  4M3S A;  4JD6 A;  4CAW A;  2QML A;  3CXQ A;  2J8M A;  4B5O A;  4H6U A;  2Z0Z A;  4R9M A;  2QEC A;  3H4Q A;  4U5Y A;  1KUV A;  1YR0 A;  4UBR A; 
#chains in the Genus database with same CATH topology
 4OME A;  4GM5 A;  2FS5 A;  3B8G A;  2DPS A;  2Y0M A;  3B3V A;  4NGM A;  4P4I A;  4UCN A;  3ZZI A;  1NMT A;  5THW A;  2G9D A;  5D8N A;  3VH9 A;  1QSN A;  2OZU A;  4A37 A;  2PCU A;  3K2K A;  2PJA A;  2GE3 A;  4ORF A;  3IFE A;  4NF1 A;  4Q38 A;  5JGF A;  4M6H A;  1EE3 P;  3PBB A;  3B7I A;  2F7V A;  1TKF A;  1BPN A;  3TT2 A;  4Y49 B;  2C6P A;  2ZEN A;  1FT7 A;  2B4B A;  4KOY A;  2C27 A;  2RFH A;  2XEF A;  2CNM A;  5A27 A;  3E0K A;  3LOD A;  5IV0 A;  2WSA A;  1KUY A;  4IHM A;  2CIJ A;  4PK3 A;  4NGP A;  2BO9 A;  4ONU A;  2G0B A;  4NGR A;  1MK4 A;  1PCA A;  2AFS A;  2PJ6 A;  5DS0 A;  2ARH A;  2PDO A;  4JZ0 A;  2Q43 A;  1BLL E;  1Y0Y A;  3R9G A;  4B14 A;  1YX0 A;  4HNX B;  4NCZ A;  3BXM A;  2PJB A;  5I0C A;  3CT9 A;  3HUV A;  1OZP A;  2J9A A;  1Z8W A;  4OID A;  1YW4 A;  3BI0 A;  3FF3 A;  4P44 A;  3LWU A;  4II9 A;  2B5G A;  1YQE A;  4JWP A;  4YRH A;  3GKR A;  2Z3P A;  2PIY A;  1LCP A;  2B4D B;  2REE A;  3H8F A;  2HB6 A;  3I3G A;  4QB9 A;  1P4N A;  2ZW4 A;  1YVO A;  4U9Z A;  5F49 A;  2CNS A;  2OR4 A;  1CM0 A;  1GYT A;  3D8P A;  4PV6 A;  2PRB A;  3R1K A;  2Q04 A;  2Z10 A;  4MFL A;  1ZO0 A;  4KZT A;  2VXK A;  4ZY0 A;  1IGB A;  2ZXV A;  4XNH C;  4HNY B;  2I79 A;  3NH8 A;  1FY7 A;  4UEE A;  4A31 A;  4DUK A;  1YLE A;  4CGM A;  3RAM A;  1XFO A;  3KAS A;  4JLY A;  3GIU A;  1B6B A;  4IF5 A;  2HV2 A;  4NSQ A;  2ABZ A;  3MGD A;  4MXU A;  4OP4 A;  2VBQ A;  3IWW A;  1Q2C A;  2AE6 A;  2ZEO A;  4UWJ A;  4A30 A;  4OAE A;  5G21 A;  1YW6 A;  2RB7 A;  3T8W A;  4IUS A;  1Z9U A;  4XPL A;  1BOB A;  3WC5 A;  4NGN A;  3TTH A;  1XMT A;  2AFW A;  2PJ0 A;  2YNC C;  3MRU A;  5D29 A;  2FE7 A;  2PSW A;  3TOB A;  2GRE A;  3DNS A;  5HVG A;  4R3L A;  1V0C A;  4JXR A;  4UCP A;  4DNC A;  2HUZ A;  3KHZ A;  2C6G A;  3WAB A;  4CAF A;  1S7N A;  3DSB A;  2HQY A;  4E2A A;  3PFE A;  1KUX A;  1I12 A;  2B3V A;  3OWC A;  4OC0 A;  4FD7 A;  3S9M A;  3SHP A;  3V38 A;  4J3G A;  1VKC A;  2WPW A;  4GS4 A;  2PJ2 A;  1CP7 A;  2IMO A;  5HXD A;  3FBU A;  4B12 A;  4KUA A;  4UA3 A;  2PVV A;  1TF9 A;  4CRZ B;  3FH4 A;  4C2Y A;  4EFD A;  4LQG A;  2GIV A;  1H8L A;  1PYT B;  2FXF A;  3PEI A;  3FEE A;  4M6G A;  2NSM A;  1S7F A;  1MJA A;  1VHE A;  3I9S A;  4KOR A;  3TX8 A;  3W6X A;  4PXC A;  2FT0 A;  4KOV A;  3KR4 A;  2Q4Y A;  3BLN A;  3SJG A;  1IOI A;  3B35 A;  1M4D A;  2POK A;  2FIW A;  1Y7R A;  4UIB A;  4UFW A;  1RTQ A;  4B5P B;  3ZJ0 A;  1XMB A;  3PZJ A;  4QUS A;  3H8G A;  2ODF A;  3IWE A;  1YME A;  2IJZ A;  4MJ8 A;  4R76 A;  4UIA A;  4PSX A;  2XEJ A;  1S3Z A;  2ZED A;  2B58 A;  3KKW A;  4MHP A;  4ZGY B;  5F46 A;  2B5G B;  1U6M A;  3KL9 A;  5IB9 A;  3N7Z A;  5K8N A;  3TCV A;  4BMH A;  2HC9 A;  3BJ8 A;  4NGS A;  2QJ8 A;  5J1Q A;  1YVK A;  3C26 A;  4Z65 A;  5CNP A;  2PC1 A;  2Z3M A;  3D7H A;  5C82 A;  2V8H A;  4IAV A;  3NH5 A;  4P4F A;  4CAE A;  1RXT A;  1LOK A;  2C6C A;  3QNV A;  4IK2 A;  1ON0 A;  1XJO A;  3R95 A;  3DLJ A;  3FED A;  3IWG A;  1HDQ A;  3BI1 A;  3PB8 X;  2BCO A;  3ISX A;  2AJ6 A;  4OLL A;  4PPZ A;  4UEF A;  4YU9 A;  1X10 A;  4KLW A;  3FRM A;  4R8F A;  2J8R A;  2WZN A;  1J4J A;  3FIX A;  1ARM A;  4Q7A A;  5LRK A;  1R43 A;  2PJ5 A;  2R1I A;  3VAR A;  5E96 A;  5AG4 A;  1ARL A;  3F5B A;  5HVH A;  3TFY A;  3SI2 A;  4A94 A;  4C2Z A;  4CS0 B;  1AYE A;  4TWE A;  5AG6 A;  1VHS A;  1YSJ A;  4P4B A;  2NMT A;  3NE8 A;  2P0W A;  1ELL P;  2ZEG A;  4MFZ A;  4ONW A;  5KTA A;  1CP6 A;  2ZW7 A;  3FYN A;  2F8H A;  3RNZ A;  2ATR A;  5FVJ A;  4MHN A;  1RO5 A;  4MFK A;  2V8D A;  2OZG A;  5K8O A;  4NFR A;  1S7K A;  2JDD A;  3F8K A;  4OC4 A;  4OC1 A;  4CYN A;  1YGH A;  4B5P A;  3CXP A;  4NEX A;  5G22 A;  3FVL A;  3EO4 A;  2Z3N A;  1IY7 A;  4H89 A;  1S60 A;  4LX9 A;  5IX3 A;  4MFQ A;  1Q2Y A;  5HH1 A;  4OC5 A;  3D3S A;  2JBK A;  1XEB A;  2Q4Z A;  3CPX A;  1FNO A;  4MHD A;  3RBU A;  4NJR A;  5GCN A;  4C7I A;  5AG7 A;  4H2K A;  1R57 A;  4KS9 A;  4WJB A;  3DR6 A;  1LAN A;  3PBE A;  1BPM A;  2DPT A;  1Z4R A;  2PJ7 A;  4KOS A;  1HEE A;  4JJX A;  4F0X A;  2P6G A;  4BBH A;  1CX8 A;  1UWY A;  2Q4V A;  3SI1 A;  2CY2 A;  3B3S A;  3FX6 A;  5LYL A;  3S9L A;  3KR5 A;  4P6Y A;  2G3A A;  4M85 A;  3GY9 A;  4UCM A;  1Q7L A;  4AVC A;  1F2P A;  2Q44 A;  5EBV A;  3CDX A;  3L2N A;  3NE7 A;  4P4E A;  3R9F A;  4X8I A;  1ZG7 A;  5CBM A;  2D4O A;  2J8N A;  4OAD A;  5G1Z A;  3V8I A;  2CXA A;  2VQY A;  4ZBG A;  3KHX A;  4RUH A;  2YNE A;  2DF5 A;  5JM6 A;  3EXN A;  3G3S A;  4X5K A;  4ZYQ A;  4ZI6 A;  1UFH A;  1QMU A;  1CPX A;  1BAV A;  2NYQ A;  2PIZ A;  2YNC A;  4MFP A;  1VHO A;  3R96 A;  4X3R A;  4MBU A;  4MHZ A;  3FEC A;  2EO8 A;  5AG5 A;  4YFJ A;  2PJ8 A;  3D7F A;  4ZX9 A;  5LYI A;  4AVA A;  3FB3 A;  3P2F A;  5F48 A;  2FL4 A;  4GXH A;  2R7H A;  4MCR A;  4O23 A;  3VWD A;  2VEZ A;  2I3C A;  3FXT A;  4KOU A;  2JDC A;  2QVP A;  4UFX A;  1CJW A;  4F9U A;  5JPH A;  3BHX A;  4FWU A;  1M1D A;  3PP9 A;  8CPA A;  4TNU A;  2CNT A;  4FD5 A;  1I1D A;  3GLJ A;  4XPD C;  1X12 A;  4CGN A;  4HKF A;  5KTD A;  4AVB A;  2OOT A;  1YK3 A;  2V8G A;  2ZEP A;  1ZLI A;  5F09 A;  1IB1 E;  1XE4 A;  3D4U A;  1IOF A;  1XF8 A;  4L8A A;  4YGO A;  1DTD A;  1TF8 A;  3RYO A;  4Y49 C;  2EBJ A;  1VGY A;  4A2Z A;  3QAH A;  5C88 A;  1B87 A;  3DDD A;  4OC2 A;  3PFO A;  2GLJ A;  2Z3O A;  2BL1 A;  3I1U A;  5LYD A;  4CAX A;  3SXO A;  2Q0Y A;  4C68 A;  5JQ4 A;  4KOX A;  3WT4 A;  3WC7 A;  7CPA A;  3KI9 A;  3CZX A;  4KLV A;  4MCQ A;  1NSL A;  3HLP A;  2AFX A;  2Q51 A;  3D67 A;  4UFV A;  3FNC A;  3A9L A;  3SJX A;  2WUU A;  1N71 A;  4HPS A;  3TOA A;  4KVX A;  4B6Z A;  2DXQ A;  2CTB A;  2PJ9 A;  3PGP A;  5DWM A;  5LYF A;  3S9N A;  5ISV A;  1PU9 A;  2AFZ A;  3H8E A;  3B3W A;  3KQX A;  2OB0 A;  2RC4 A;  5J8C A;  2P6F A;  3N5F A;  3T9Y A;  4FD4 A;  4K30 A;  4FBE A;  3FMC A;  3K9U A;  4XNH B;  3B3C A;  3EFA A;  4KSF A;  4AB7 A;  3KGQ A;  3QAY A;  2Q7S A;  4CGO A;  4F9V A;  1LAP A;  2VZY A;  4KSA A;  2BUE A;  2OH1 A;  3S6H A;  3IGR A;  1AUG A;  4C7H A;  2FIA A;  5EC4 A;  4P45 A;  1YRE A;  3D7D A;  2Z11 A;  3IC1 A;  5HVF A;  2PR8 A;  4A33 A;  4WWV A;  3F0A A;  2ZW5 A;  4PQA A;  1VIX A;  2REF A;  4R57 A;  1KZF A;  4JXQ A;  4B11 A;  4AG9 A;  4C2X A;  4I49 A;  2FSR A;  1IYL A;  3LMS A;  1LRZ A;  3TE4 A;  5J8F A;  2ZPA A;  4H6Z A;  4JYW A;  2Q7B A;  3V7Z A;  3GB0 A;  4FAI A;  4XPK A;  3IO1 A;  1M4I A;  4CRY B;  2P6E A;  1MJ9 A;  4OIW A;  2OU2 A;  2R98 A;  4BIN A;  3D66 A;  4AG7 A;  3D2P A;  2EVN A;  2VZZ A;  3KQZ A;  4CPA A;  2XEG A;  2H5M A;  4MY0 A;  3IEH A;  4OC3 A;  1KWM A;  4NJQ A;  4A95 A;  4XPD B;  4KVM E;  4P4J A;  2OZH A;  4QBJ A;  2O28 A;  4MRI A;  1IID A;  1MJB A;  4KVO E;  2PR1 A;  5BWA B;  1GHE A;  1Y7E A;  1Z5R A;  4U9Y A;  1JQG A;  2O4H A;  1NSA A;  3BJ7 A;  4CGP A;  1XIX A;  2FCK A;  1SQH A;  1QSO A;  4UWI A;  5DWN A;  3PB7 X;  2VI7 A;  1WWZ A;  4P10 A;  2ZEM A;  1OBR A;  2ZEE A;  4MFJ A;  1Z8L A;  3B3T A;  3KZW A;  3VWE A;  5HMN A;  2AFO A;  3NFZ A;  2R8V A;  2PVW A;  4KOW A;  2EK8 A;  1Y9K A;  2ZEH A;  3EC4 A;  2A4N A;  4YWY A;  4QVT A;  3MN8 A;  3RO0 A;  4K3N A;  2PJ3 A;  4NGQ A;  2ZW6 A;  4PXD A;  2PRQ A;  3G8W A;  1JWQ A;  3P2H A;  4EVY A;  2FVG A;  1CPS A;  1M4G A;  1PUA A;  2ZOF A;  4Q36 A;  2CF4 A;  3TO9 A;  3SI0 A;  4PK2 A;  2ZOG A;  3DR8 A;  3DGV A;  1F57 A;  4R87 A;  5K8P A;  3S6G A;  2D4P A;  3UY5 A;  4B10 A;  4CYP A;  3PB4 X;  3CXS A;  3LAC A;  2V8V A;  4MCP A;  2YND A;  3JRU A;  1TKH A;  2BSW A;  1XRY A;  3IIB A;  4NXY A;  3JUW A;  5A28 A;  4RS2 A;  5KTC A;  4DYO A;  5H84 A;  5H86 A;  5G20 A;  1Y9W A;  3LD2 A;  4F0Y A;  4UEZ A;  4G1P A;  3T90 A;  2VL1 A;  3FJU A;  4CAV A;  2YGW A;  4HNW B;  1I21 A;  4KOT A;  4NGT A;  4R3K A;  4W9Y A;  3IU1 A;  2I00 A;  3NH4 A;  2BEI A;  1ELM P;  4RN7 A;  1K4J A;  2PJC A;  4MY3 A;  4ZX8 A;  1TXR A;  5EMI A;  2QIR A;  3QB8 A;  1XOV A;  2IL4 A;  3WC6 A;  4E8O A;  2PQ8 A;  1ZG8 A;  4ZY2 A;  1QSM A;  4MCS A;  4CYO A;  1WK4 A;  2GAN A;  1QSR A;  2AFM A;  2F5I A;  2WYR A;  1L0C A;  3TO6 A;  2O53 A;  4EWT A;  4LUA A;  1AMP A;  4LQ6 A;  2JEW A;  3JTK A;  1M44 A;  2GU2 A;  4FUU A;  4P4D A;  4PSW A;  1IYK A;  4X2T A;  2PJ4 A;  3B2Y A;  3R9E A;  2JBJ A;  2JLM A;  2X7B A;  3D2M A;  2K5T A;  1ZLH A;  2KCW A;  1HDU A;  3W91 A;  5F47 A;  1NE9 A;  1Z8T A;  3S6F A;  4RI1 A;  4A32 A;  2B3U A;  4MMO A;  3CPA A;  1BO4 A;  2ZEL A;  3PB9 X;  3IU2 A;  2CTC A;  1LFW A;  1S7L A;  3D7G A;  3S6K A;  5IB0 A;  1CBX A;  1P0H A;  2AFU A;  4KUB A;  4R6T A;  2EUI A;  3WR7 A;  1TIQ A;  3ISZ A;  3GYA A;  4CYQ A;  2DEA A;  2QYV A;  3D68 A;  4R7M A;  1S5K A;  2JEV A;  4E0A A;  1IIC A;  4UF4 A;  1LAM A;  1XBU A;  4DJL A;  1Z8X A;  4FD6 A;  1QST A;  3SXN A;  4F6A A;  3EY5 A;  1M4L A;  1TKJ A;  1Y0R A;  2B4D A;  2G3T A;  2WPX A;  2BOA A;  4F8Z A;  1A2Z A;  3TC8 A;  1QQ9 A;  4AXV A;  4ZY1 A;  2EK9 A;  4QC6 A;  4M6I A;  4MI4 A;  2Z3L A;  3TO7 A;  3JVN A;  1Z2L A;  4KSI A;  3W6S A;  5I4M A;  2ANP A;  3GUX A;  4MHY A;  5AGE A;  5ELY A;  3NA6 A;  5CPA A;  4EME A;  4BD9 A;  1Z4E A;  4L89 A;  1F2O A;  2C1C A;  1R3N A;  2GFQ A;  4CGL A;  6CPA A;  4PXE A;  4A39 A;  1CG2 A;  3IJ3 A;  3SJE A;  4A38 A;  2PJ1 A;  1YLO A;  2IQ6 A;  1Q2D A;  4M3S A;  4JD6 A;  4CAW A;  2ZEF A;  2QML A;  3K9T A;  3CXQ A;  2J8M A;  3H5Z A;  1ZG9 A;  1IU8 A;  3PRT A;  4B5O A;  4H6U A;  2Z3K A;  2Z0Z A;  3PB6 X;  5K8M A;  2EWB A;  3RZA A;  2V77 A;  4OKO A;  4R9M A;  5LRJ A;  2QEC A;  1DE4 C;  2XEI A;  3H4Q A;  4U5Y A;  1KUV A;  1YR0 A;  2PE3 A;  4B13 A;  4UBR A;  4PXB A;  5JH9 A;  3SJF A;  3VAT A;  5LRG A;  2GLF A; 
#chains in the Genus database with same CATH homology
 2FS5 A;  3B8G A;  2DPS A;  2Y0M A;  4UCN A;  3ZZI A;  1NMT A;  1QSN A;  2OZU A;  4ORF A;  2GE3 A;  4NF1 A;  4Q38 A;  3TT2 A;  4Y49 B;  2B4B A;  4KOY A;  2C27 A;  2CNM A;  5A27 A;  3E0K A;  3LOD A;  5IV0 A;  2WSA A;  1KUY A;  4PK3 A;  4ONU A;  2G0B A;  1MK4 A;  2ARH A;  2PDO A;  3R9G A;  4B14 A;  1YX0 A;  4HNX B;  4NCZ A;  5I0C A;  1OZP A;  4II9 A;  2B5G A;  4JWP A;  4YRH A;  3GKR A;  2Z3P A;  2REE A;  2B4D B;  3I3G A;  4QB9 A;  4U9Z A;  1P4N A;  2ZW4 A;  1YVO A;  5F49 A;  2CNS A;  1CM0 A;  3D8P A;  4PV6 A;  2PRB A;  3R1K A;  2Q04 A;  2Z10 A;  4MFL A;  1ZO0 A;  4KZT A;  2VXK A;  2ZXV A;  4XNH C;  4HNY B;  2I79 A;  1FY7 A;  4A31 A;  1YLE A;  4CGM A;  4JLY A;  1B6B A;  4IF5 A;  2HV2 A;  4NSQ A;  3MGD A;  2VBQ A;  1Q2C A;  2AE6 A;  4UWJ A;  4A30 A;  4OAE A;  5G21 A;  4IUS A;  1Z9U A;  4XPL A;  1BOB A;  3TTH A;  1XMT A;  2YNC C;  2FE7 A;  2PSW A;  3TOB A;  3DNS A;  4R3L A;  1V0C A;  4JXR A;  4UCP A;  4DNC A;  2HUZ A;  4CAF A;  1S7N A;  3DSB A;  2HQY A;  4E2A A;  1KUX A;  1I12 A;  2B3V A;  3OWC A;  3SHP A;  4FD7 A;  4J3G A;  1VKC A;  2WPW A;  4GS4 A;  3FBU A;  4B12 A;  4KUA A;  4UA3 A;  4CRZ B;  4C2Y A;  2GIV A;  2FXF A;  1S7F A;  1MJA A;  3I9S A;  4KOR A;  3W6X A;  2FT0 A;  4KOV A;  2Q4Y A;  3BLN A;  1M4D A;  2FIW A;  1Y7R A;  4UFW A;  4B5P B;  3ZJ0 A;  3PZJ A;  4QUS A;  3IWE A;  3T90 A;  4MJ8 A;  3TE4 A;  4ZGY B;  4PSX A;  3KKW A;  1S3Z A;  5F46 A;  2B58 A;  2B5G B;  1U6M A;  3N7Z A;  3TCV A;  4BMH A;  3BJ8 A;  1YVK A;  3C26 A;  5CNP A;  2PC1 A;  2Z3M A;  5C82 A;  4CAE A;  1RXT A;  1ON0 A;  3R95 A;  3IWG A;  2AJ6 A;  4OLL A;  4KLW A;  3FRM A;  2J8R A;  1J4J A;  3FIX A;  2R1I A;  5AG4 A;  5E96 A;  3F5B A;  3TFY A;  4C2Z A;  4CS0 B;  5AG6 A;  1VHS A;  2NMT A;  2P0W A;  4MFZ A;  5KTA A;  2ZW7 A;  3FYN A;  2ATR A;  5FVJ A;  1RO5 A;  4MFK A;  2OZG A;  1S7K A;  2JDD A;  3F8K A;  4CYN A;  1YGH A;  4B5P A;  3CXP A;  4NEX A;  5G22 A;  3EO4 A;  2Z3N A;  4H89 A;  1S60 A;  4LX9 A;  5IX3 A;  4MFQ A;  1Q2Y A;  5HH1 A;  3D3S A;  1XEB A;  4MHD A;  5GCN A;  4C7I A;  5AG7 A;  1R57 A;  4KS9 A;  3DR6 A;  2DPT A;  4KOS A;  1Z4R A;  4JJX A;  4F0X A;  2P6G A;  4BBH A;  2Q4V A;  2CY2 A;  2G3A A;  4M85 A;  3GY9 A;  4UCM A;  4AVC A;  2Q44 A;  5EBV A;  3NE7 A;  3R9F A;  2D4O A;  2J8N A;  4OAD A;  5G1Z A;  3V8I A;  2CXA A;  2VQY A;  4ZBG A;  2YNE A;  3EXN A;  3G3S A;  4X5K A;  1UFH A;  2YNC A;  4MFP A;  3R96 A;  4MBU A;  5AG5 A;  4YFJ A;  4AVA A;  3FB3 A;  3P2F A;  5F48 A;  2FL4 A;  2R7H A;  3VWD A;  2VEZ A;  3FXT A;  4KOU A;  4UFX A;  2JDC A;  5JPH A;  1CJW A;  1M1D A;  3PP9 A;  2CNT A;  4FD5 A;  1I1D A;  4CGN A;  4XPD C;  4HKF A;  5KTD A;  4AVB A;  1YK3 A;  1IB1 E;  1XE4 A;  1XF8 A;  4L8A A;  4YGO A;  3RYO A;  4Y49 C;  4A2Z A;  3QAH A;  5C88 A;  1B87 A;  3DDD A;  2Z3O A;  2BL1 A;  5JQ4 A;  4CAX A;  3SXO A;  2Q0Y A;  4C68 A;  4KOX A;  4KLV A;  1NSL A;  4UFV A;  3FNC A;  3A9L A;  2WUU A;  1N71 A;  3TOA A;  4KVX A;  2DXQ A;  3PGP A;  5DWM A;  5ISV A;  1PU9 A;  2OB0 A;  2RC4 A;  5J8C A;  2P6F A;  3T9Y A;  4FD4 A;  4K30 A;  3K9U A;  4XNH B;  3EFA A;  4KSF A;  4AB7 A;  4CGO A;  2VZY A;  4KSA A;  2BUE A;  2OH1 A;  3S6H A;  3IGR A;  4C7H A;  2FIA A;  5EC4 A;  1YRE A;  4A33 A;  2Z11 A;  2PR8 A;  3F0A A;  2ZW5 A;  2REF A;  4R57 A;  1KZF A;  4JXQ A;  4B11 A;  4AG9 A;  4C2X A;  4I49 A;  2FSR A;  1IYL A;  1LRZ A;  5J8F A;  2ZPA A;  4H6Z A;  2Q7B A;  4XPK A;  4CRY B;  1M4I A;  2P6E A;  1MJ9 A;  2OU2 A;  2R98 A;  4AG7 A;  3D2P A;  2EVN A;  2VZZ A;  2H5M A;  4MY0 A;  4A95 A;  4XPD B;  4KVM E;  2OZH A;  4QBJ A;  2O28 A;  1IID A;  1MJB A;  4KVO E;  2PR1 A;  5BWA B;  1GHE A;  4U9Y A;  3BJ7 A;  4CGP A;  1XIX A;  2FCK A;  1SQH A;  1QSO A;  4UWI A;  5DWN A;  2VI7 A;  1WWZ A;  4MFJ A;  3VWE A;  5HMN A;  2R8V A;  4KOW A;  1Y9K A;  3EC4 A;  2A4N A;  4QVT A;  2ZW6 A;  3G8W A;  3P2H A;  4EVY A;  1M4G A;  1PUA A;  4Q36 A;  3TO9 A;  4PK2 A;  3DR8 A;  4R87 A;  3S6G A;  2D4P A;  3UY5 A;  4B10 A;  4CYP A;  3CXS A;  2YND A;  2BSW A;  4NXY A;  3JUW A;  5A28 A;  4RS2 A;  5KTC A;  5H84 A;  5H86 A;  5G20 A;  1Y9W A;  3LD2 A;  4F0Y A;  4CAV A;  2YGW A;  4HNW B;  1I21 A;  4KOT A;  4R3K A;  3IU1 A;  2I00 A;  2BEI A;  1K4J A;  4MY3 A;  2QIR A;  3QB8 A;  2IL4 A;  4E8O A;  2PQ8 A;  1QSM A;  4CYO A;  1WK4 A;  2GAN A;  1QSR A;  2F5I A;  3TO6 A;  1L0C A;  4LUA A;  3JTK A;  1M44 A;  4PSW A;  1IYK A;  3R9E A;  2X7B A;  2JLM A;  3D2M A;  2K5T A;  2KCW A;  3W91 A;  5F47 A;  1NE9 A;  3S6F A;  4RI1 A;  4A32 A;  2B3U A;  1BO4 A;  3IU2 A;  1S7L A;  3S6K A;  5IB0 A;  1P0H A;  4KUB A;  2EUI A;  3WR7 A;  1TIQ A;  3GYA A;  4CYQ A;  1S5K A;  2JEV A;  4E0A A;  1IIC A;  4FD6 A;  1QST A;  3SXN A;  4F6A A;  3EY5 A;  2B4D A;  2G3T A;  2WPX A;  4QC6 A;  4MI4 A;  3TO7 A;  2Z3L A;  3JVN A;  3W6S A;  5AGE A;  1Z4E A;  4L89 A;  4CGL A;  1Q2D A;  4M3S A;  4JD6 A;  4CAW A;  2QML A;  3CXQ A;  2J8M A;  3H5Z A;  4B5O A;  4H6U A;  2Z3K A;  2Z0Z A;  4R9M A;  2QEC A;  3H4Q A;  4U5Y A;  1KUV A;  1YR0 A;  4B13 A;  4UBR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...