5G21A

Leishmania major n-myristoyltransferase in complex with a quinoline inhibitor (compound 26).
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
411
structure length
410
Chain Sequence
AHAFWSTQPVPQTEDETEKIVFAGPMDEPKTVADIPEEPYPIASTFEWWTPNMEAADDIHAIYELLRDNYVEDDDSMFRFNYSEEFLQWALCPPNYIPDWHVAVRRKADKKLLAFIAGVPVTLRMGTPKYMKVKAQEKGEGEEAAKYDEPRHICEINFLCVHKQLREKRLAPILIKEATRRVNRTNVWQAVYTAGVLLPTPYASGQYFHRSLNPEKLVEIRFSGIPAQYQKFQNPMAMLKRNYQLPSAPKNSGLREMKPSDVPQVRRILNYLDSFDVGPVFSDAEISHYLLPRDGVVFTYVVENDKKVTDFFSFYRIPSTVIGNSNYNLLNAAYVHYYAATSIPLHQLILDLLIVAHSRGFDVCNMVEILDNRSFVEQLKFGAGDGHLRYYFYNWAYPKIKPSQVALVML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure-guided optimization of quinoline inhibitors of Plasmodium N-myristoyltransferase.
pubmed doi rcsb
source organism Leishmania major
molecule tags Transferase
molecule keywords GLYCYLPEPTIDE N-TETRADECANOYLTRANSFERASE
total genus 126
structure length 410
sequence length 411
ec nomenclature ec 2.3.1.97: Glycylpeptide N-tetradecanoyltransferase.
pdb deposition date 2016-04-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01233 NMT Myristoyl-CoA:protein N-myristoyltransferase, N-terminal domain
A PF02799 NMT_C Myristoyl-CoA:protein N-myristoyltransferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.170 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 5g21A00
4C7IA 4C7HA 5G21A 4CGMA 4B10A 4A95A 2YNCC 3IU1A 4CGNA 4C68A 5AG4A 4UCPA 4A33A 4C2ZA 4A32A 4B12A 4UFWA 3IU2A 4A31A 5G22A 4B13A 4CGPA 5AG5A 4B14A 4CAEA 4UFVA 5AGEA 5G1ZA 2YNCA 5AG6A 4CGLA 4CYQA 4C2XA 4UCNA 4CYNA 2YNEA 4A2ZA 4CGOA 5AG7A 2WSAA 5G20A 4BBHA 4CYPA 3JTKA 4A30A 5A28A 4CAFA 4UFXA 4CYOA 3H5ZA 4C2YA 5A27A 2WUUA 4UCMA 3IWEA 4B11A 2YNDA
chains in the Genus database with same CATH superfamily
1K4JA 3C26A 4M6IA 4HNXB 2FT0A 4MY0A 4A38A 4C2ZA 3MRUA 2HV2A 4A32A 2EWBA 1IGBA 3PP9A 3TE4A 1B87A 1TF9A 1ZG7A 3D7FA 3BI0A 3KHXA 4KOSA 3TOAA 4UEEA 4JZ0A 3EFAA 2HC9A 3DDDA 4XPDC 4A2ZA 4K30A 2AFWA 3IWGA 1UFHA 2REEA 5ISVA 3TTHA 3IJ3A 2ZENA 2F7VA 4IUSA 3SXNA 3T90A 3BHXA 3VATA 3JVNA 4F0XA 1VHSA 2Q04A 3F0AA 2AFUA 3B7IA 3PB7X 4UF4A 3PB6X 4FAIA 1LOKA 3B3VA 3H5ZA 1YLOA 2OU2A 3GLJA 3D66A 5F48A 4PK2A 5G21A 1WWZA 4NCZA 4G1PA 4MY3A 3SI0A 2RB7A 3WABA 4CPAA 5AG4A 2H5MA 4UWIA 4A94A 4R76A 4MHPA 4KVOE 3CDXA 5LYIA 1XJOA 3JUWA 2BOAA 4AG7A 1CJWA 2V8GA 3D3SA 3EXNA 2AJ6A 3S6GA 3SXOA 4BD9A 4JLYA 2AFZA 2CIJA 1N71A 4MFZA 1VKCA 2PJ6A 3VWDA 4KOYA 8CPAA 5J8CA 2KCWA 4PXEA 1P4NA 2DXQA 2HB6A 2Q4VA 1X12A 5H84A 5C82A 3TT2A 1LAPA 3FB3A 4UFXA 4OKOA 1TKHA 2NMTA 1YLEA 2Z3KA 3PB8X 4MCQA 2X7BA 2C6PA 4NSQA 3V38A 3E0KA 4C7IA 4KOXA 1M1DA 2QECA 3FYNA 4X2TA 1Z8WA 1Z8LA 3KGQA 4MMOA 3LWUA 1S7NA 4X3RA 1GYTA 2NYQA 3NA6A 2Q44A 4I49A 2CNSA 4KZTA 3TO9A 4C2XA 4F6AA 1NSAA 2QJ8A 1RTQA 2R98A 1M44A 4IF5A 4KOUA 4YGOA 3K2KA 4IK2A 4R3LA 4OC3A 1MJBA 2VI7A 3WR7A 1M4GA 1YQEA 2ZEOA 4JYWA 4YWYA 1Q7LA 1YREA 4H6UA 1F2OA 3K9UA 2B5GB 3KQZA 1PUAA 5F47A 3DLJA 1NE9A 1ON0A 4YFJA 4ONWA 3PZJA 3S6KA 2IL4A 1CP7A 4NJQA 1YW6A 2OZGA 2WPXA 2PJ3A 1PCAA 4NGMA 1LCPA 5EC4A 5K8MA 1ZG9A 1EE3P 4KLVA 2REFA 4CGPA 4H2KA 3W6XA 4AVAA 1BAVA 2PJ0A 4UA3A 4PXDA 2PJ8A 4ORFA 3ISXA 2ZEPA 1Q2DA 4JJXA 4AXVA 1XE4A 5IB9A 4U9ZA 4XNHC 3S6HA 2ARHA 3EY5A 4OMEA 3CXSA 4JXQA 1H8LA 4F9VA 3FH4A 4NGNA 4P4JA 3NH5A 2G9DA 4R57A 4K3NA 1I1DA 4IAVA 1IOFA 3FEDA 3I9SA 1VIXA 1A2ZA 1FT7A 1S60A 4P4EA 3ZZIA 2OR4A 3FXTA 1KWMA 2OB0A 1XBUA 2I00A 1XRYA 2B3VA 2PJ4A 5I4MA 3S9NA 4P10A 1F2PA 2JLMA 1YW4A 3LMSA 1TKJA 1AUGA 4U5YA 3H8EA 3BI1A 2J8RA 3NE7A 2RFHA 1BPMA 1S7FA 3PFEA 5EMIA 3FMCA 3B3SA 4R87A 4MXUA 2VXKA 5IV0A 2ZEHA 1XF8A 2XEFA 1RXTA 2PDOA 2YGWA 4KVME 3TO6A 1S7LA 2WSAA 4CS0B 4ZI6A 5ELYA 2C6CA 3CT9A 3MN8A 2A4NA 2JBJA 4NJRA 4R7MA 5F49A 4BBHA 4CYOA 2FIAA 2GANA 1F57A 3B35A 4OC0A 4H89A 4P44A 4RN7A 4C2YA 1Y7EA 1CBXA 2PJ1A 2FIWA 1PYTB 1Z8TA 3FX6A 2CNTA 2YNCC 1ZO0A 2PQ8A 4EVYA 1GHEA 2Z3MA 4KSIA 2EUIA 3DR8A 1FNOA 3CXQA 4BMHA 3L2NA 4QUSA 1QMUA 2ZPAA 3TCVA 1MJ9A 3DSBA 3KR5A 5AGEA 2R7HA 2R8VA 2FE7A 2YNCA 4EWTA 3R9EA 4CGLA 1KUYA 2BO9A 2EVNA 4LQ6A 4B5PA 2G3TA 4UCNA 4UBRA 2GREA 1HEEA 3PBBA 4KOWA 1OZPA 1Q2CA 2G0BA 3KI9A 3PFOA 5HXDA 1TIQA 4HNWB 4HKFA 4WWVA 5LRJA 3GIUA 3FECA 2IQ6A 2P6FA 4E0AA 2GIVA 2PJAA 4UIAA 3I3GA 1IYKA 3IU1A 3FJUA 1IIDA 5EBVA 1Z4EA 3CPAA 5K8OA 4P6YA 3PB4X 2JEVA 2HQYA 5IX3A 4AB7A 2CTBA 2Z11A 3GKRA 4E2AA 1CM0A 1VHEA 2J8NA 2PR8A 4W9YA 5CNPA 1ARMA 3HUVA 2EK8A 4P4DA 4FBEA 4M85A 1IB1E 5GCNA 3D2MA 4MFJA 4P4FA 4NEXA 3QB8A 5CBMA 4MI4A 4KSFA 4MHNA 3WC5A 1QSMA 2OOTA 4AG9A 4QC6A 5LYDA 2O28A 2XEJA 2Z0ZA 3BLNA 2Q0YA 3H8FA 2IMOA 4MHYA 2O4HA 4Q7AA 2CY2A 1QSTA 3LD2A 2V77A 4OC1A 1ZLIA 4NGSA 4MFKA 4ZX8A 2Q43A 3K9TA 4DJLA 2ZEFA 2O53A 3SJEA 3V7ZA 4CAXA 2AFOA 1VHOA 1Z4RA 2VBQA 1J4JA 1XMTA 4YU9A 1Y9KA 2ZELA 2Z3PA 1JQGA 4QBJA 5LYFA 5HH1A 5LRGA 1YX0A 4NGQA 2GFQA 1IYLA 1Y9WA 3IEHA 2PJ7A 4E8OA 4ZY0A 6CPAA 2B5GA 4MFLA 4L89A 3FNCA 4MJ8A 5JH9A 5K8PA 2YNDA 4QB9A 4OIWA 2JDCA 4TWEA 1NMTA 2PSWA 2FVGA 2AFSA 1ELLP 2Y0MA 2ZEEA 3PEIA 1MK4A 5HVGA 3GY9A 4B13A 2CXAA 1PU9A 5AG5A 4H6ZA 4KSAA 3CPXA 1YVOA 3GYAA 2Z3NA 2Z3OA 2OZUA 1XOVA 3NH8A 3B3TA 4MCPA 2XEIA 4A37A 2BL1A 4II9A 1Z8XA 1OBRA 4ZBGA 1IOIA 4M6GA 3KQXA 5J1QA 3IWWA 3SJFA 2JEWA 2AFXA 4OLLA 4QVTA 4AVBA 2FS5A 2QIRA 2ZOFA 3F8KA 3FBUA 4OC5A 2Q7SA 4PXCA 1LFWA 2CF4A 5G20A 3JTKA 4CYPA 1ELMP 1P0HA 4OAEA 1M4LA 3ZJ0A 2PIYA 2CTCA 1CX8A 3F5BA 3TO7A 1YR0A 4MRIA 1ZLHA 2I3CA 2EBJA 2PJCA 4PSXA 2DPSA 2PIZA 3HLPA 3WC6A 4KUAA 3VH9A 4MHZA 1X10A 1LANA 4GM5A 4DNCA 2ZW5A 2PJ5A 5LYLA 2G3AA 2OZHA 3SI2A 4Q36A 1HDQA 1ARLA 2QMLA 1XIXA 2F8HA 3LODA 3PB9X 4Q38A 4UFVA 1RO5A 3DGVA 4XPLA 5AG6A 4A39A 1YSJA 2HUZA 3IFEA 4R9MA 4ZGYB 4P4BA 1KUXA 4P4IA 3CXPA 4CGOA 3SJGA 2BSWA 1TKFA 3KKWA 2VQYA 4EFDA 3RO0A 1AYEA 1Z2LA 2ZXVA 3B8GA 2JDDA 3EO4A 2ODFA 3GUXA 2B58A 3KHZA 3MGDA 5BWAB 4NF1A 1S7KA 2R1IA 1YMEA 2NSMA 3H8GA 4PV6A 4Y49C 1Y7RA 3IGRA 3TX8A 1CP6A 3RYOA 4B6ZA 4KOTA 4FUUA 4UIBA 3IWEA 2V8HA 2C27A 4R3KA 4XNHB 2FCKA 5DS0A 3B2YA 1S5KA 2ZEDA 5K8NA 3FVLA 2PJ9A 2ZEGA 1WK4A 4C68A 4DUKA 3VARA 2PRBA 3FIXA 4B12A 4UFWA 3IU2A 2ZOGA 3D8PA 2Q4YA 2DPTA 1IY7A 4GS4A 4A31A 5I0CA 3T8WA 4CAEA 2P0WA 2XEGA 3IC1A 4MCSA 3KZWA 3G8WA 1R43A 4B5PB 2Q51A 2PCUA 5KTAA 1I12A 1LRZA 2B3UA 4JWPA 3D7HA 3KASA 1DE4C 7CPAA 4Z65A 1VGYA 5E96A 4A30A 5FVJA 3TFYA 4RUHA 3DNSA 1QQ9A 4O23A 3GB0A 3S6FA 2ZEMA 3BJ8A 4RI1A 1Q2YA 2B4DA 1BPNA 2Q4ZA 3D2PA 4GXHA 4EMEA 4P45A 3R9FA 2C1CA 3QAHA 3KL9A 2GU2A 2PR1A 2DF5A 2CNMA 1M4DA 4UCPA 4AVCA 4M3SA 4UEFA 2PRQA 3N7ZA 4OC4A 4RS2A 3W6SA 2PJ2A 3FEEA 3A9LA 2J8MA 2J9AA 2AFMA 4PPZA 1Y0RA 2V8VA 4LUAA 2ANPA 3NE8A 3BXMA 4J3GA 5KTCA 4HNYB 5D29A 3D68A 2POKA 1SQHA 1YVKA 4KS9A 5HVFA 2Z10A 2PC1A 4PQAA 4FWUA 3OWCA 4F9UA 2VEZA 4FD5A 1ZG8A 3RBUA 2D4PA 1FY7A 4OIDA 3S9MA 4PK3A 3V8IA 2VL1A 4B10A 3SHPA 4A95A 1BO4A 2PVVA 4JXRA 2JBKA 2P6EA 3N5FA 4TNUA 2PVWA 3R95A 3TC8A 2FXFA 3RZAA 2ABZA 1V0CA 4KORA 2VZZA 3I1UA 1DTDA 3DR6A 4KVXA 4R6TA 4U9YA 5JGFA 3NFZA 5AG7A 3W91A 3R1KA 2DEAA 2GLFA 4NGPA 3RAMA 3UY5A 2WPWA 5KTDA 5A27A 5G22A 2IJZA 4KUBA 4B11A 2EO8A 3PBEA 2F5IA 3PRTA 4MHDA 3ISZA 1YGHA 4CGNA 4PXBA 1XEBA 3SI1A 2AE6A 4A33A 1IU8A 4FD6A 1IICA 1M4IA 3H4QA 1CPXA 2PJBA 5DWNA 3R9GA 4ZX9A 4FD4A 5HVHA 3PGPA 4R8FA 1U6MA 2FL4A 4CYQA 4B5OA 1TXRA 4CAVA 4M6HA 1B6BA 1NSLA 1QSNA 4XPKA 4NGTA 5H86A 2D4OA 3D67A 4CAWA 3VWEA 2FSRA 4LX9A 4WJBA 4CAFA 4MFPA 4NGRA 1AMPA 3LACA 1CG2A 4MFQA 4OC2A 3WT4A 1XMBA 3B3WA 4CRYB 2VZYA 1R3NA 4NXYA 4C7HA 4CGMA 4OADA 3KR4A 3BJ7A 1UWYA 2V8DA 3T9YA 4ZY1A 4MCRA 2ZW4A 1KZFA 3IIBA 1S3ZA 2GLJA 1QSRA 2P6GA 3D7GA 4BINA 1KUVA 5C88A 4YRHA 1CPSA 2BCOA 4F0YA 2WYRA 1TF8A 1Z9UA 5HMNA 5LRKA 4X5KA 3QAYA 4KLWA 1BLLE 2ZW7A 3D4UA 3FF3A 4ONUA 4KOVA 5D8NA 2WZNA 3RNZA 2Q7BA 5JPHA 4CRZB 2BEIA 3EC4A 4X8IA 2PE3A 2RC4A 4ZY2A 4OP4A 5A28A 1BOBA 2I79A 1Z5RA 2QYVA 5J8FA 2EK9A 3G3SA 4IHMA 2OH1A 2WUUA 4Y49B 4PSWA 1HDUA 1L0CA 5DWMA 3SJXA 5F46A 2GE3A 2K5TA 3S9LA 3NH4A 5JQ4A 4MBUA 3WC7A 3B3CA 1Y0YA 4FD7A 4XPDB 4B14A 2ZW6A 4LQGA 2BUEA 3P2FA 1XFOA 3QNVA 5THWA 3TOBA 3FRMA 1I21A 2ATRA 5G1ZA 1JWQA 5CPAA 2QVPA 4DYOA 2Z3LA 3IO1A 4UWJA 5F09A 4CYNA 2YNEA 3JRUA 4NFRA 4L8AA 1QSOA 3CZXA 3R96A 5IB0A 4HPSA 4JD6A 2C6GA 3P2HA 4UEZA 5JM6A 1LAMA 2B4BA 1MJAA 2B4DB 4F8ZA 1R57A 1YK3A 4ZYQA 4UCMA 3D7DA
chains in the Genus database with same CATH topology
1K4JA 3C26A 4HNXB 2FT0A 4MY0A 4C2ZA 2HV2A 4A32A 3TE4A 3PP9A 1B87A 4KOSA 3TOAA 3EFAA 3DDDA 4XPDC 4A2ZA 4K30A 3IWGA 1UFHA 2REEA 5ISVA 3TTHA 4IUSA 3SXNA 3T90A 3JVNA 4F0XA 1VHSA 2Q04A 3F0AA 3H5ZA 2OU2A 5F48A 4PK2A 5G21A 1WWZA 4NCZA 4MY3A 5AG4A 2H5MA 4UWIA 4KVOE 3JUWA 4AG7A 1CJWA 3D3SA 3EXNA 2AJ6A 3S6GA 3SXOA 4JLYA 1N71A 4MFZA 1VKCA 3VWDA 4KOYA 5J8CA 2KCWA 1P4NA 2DXQA 2Q4VA 5H84A 5C82A 3TT2A 4UFXA 3FB3A 2NMTA 1YLEA 2Z3KA 2X7BA 4NSQA 3E0KA 4C7IA 4KOXA 1M1DA 2QECA 3FYNA 1S7NA 2Q44A 4I49A 2CNSA 4KZTA 3TO9A 4C2XA 4F6AA 4IF5A 2R98A 4KOUA 1M44A 4YGOA 4R3LA 1MJBA 2VI7A 3WR7A 1M4GA 1YREA 4H6UA 3K9UA 2B5GB 5F47A 1PUAA 1ON0A 1NE9A 4YFJA 3PZJA 3S6KA 2IL4A 2WPXA 2OZGA 5EC4A 4KLVA 2REFA 4CGPA 3W6XA 4AVAA 4UA3A 4ORFA 4JJXA 1Q2DA 1XE4A 4U9ZA 4XNHC 3S6HA 2ARHA 3EY5A 3CXSA 4JXQA 4R57A 1I1DA 3I9SA 3ZZIA 1S60A 3FXTA 2OB0A 2I00A 2B3VA 2JLMA 4U5YA 2J8RA 3NE7A 1S7FA 4R87A 2VXKA 1XF8A 1RXTA 2PDOA 2YGWA 4KVME 3TO6A 1S7LA 2WSAA 4CS0B 4BBHA 2A4NA 5F49A 4CYOA 2FIAA 2GANA 4H89A 4C2YA 2FIWA 2CNTA 2YNCC 1ZO0A 2PQ8A 4EVYA 1GHEA 2Z3MA 2EUIA 3DR8A 3CXQA 4BMHA 3TCVA 4QUSA 2ZPAA 1MJ9A 3DSBA 5AGEA 2R7HA 2R8VA 2FE7A 2YNCA 3R9EA 4CGLA 1KUYA 2EVNA 4B5PA 2G3TA 4UCNA 4UBRA 4KOWA 1OZPA 1Q2CA 2G0BA 1TIQA 4HNWB 4HKFA 2P6FA 4E0AA 2GIVA 3I3GA 1IYKA 3IU1A 1IIDA 5EBVA 1Z4EA 2JEVA 2HQYA 4AB7A 2Z11A 3GKRA 4E2AA 1CM0A 2J8NA 2PR8A 5CNPA 4M85A 1IB1E 5GCNA 3D2MA 4MFJA 4NEXA 3QB8A 4MI4A 4KSFA 1QSMA 4AG9A 4QC6A 2O28A 2Z0ZA 3BLNA 2Q0YA 2CY2A 1QSTA 3LD2A 4MFKA 4CAXA 1Z4RA 2VBQA 1J4JA 1XMTA 1Y9KA 2Z3PA 4QBJA 5HH1A 1YX0A 1IYLA 1Y9WA 4E8OA 2B5GA 4MFLA 4L89A 3FNCA 4MJ8A 2YNDA 4QB9A 2JDCA 1NMTA 2PSWA 2Y0MA 1MK4A 3GY9A 4B13A 2CXAA 1PU9A 5AG5A 4H6ZA 4KSAA 1YVOA 3GYAA 2Z3NA 2Z3OA 2OZUA 4II9A 2BL1A 4ZBGA 4OLLA 4QVTA 4AVBA 2FS5A 2QIRA 3F8KA 3FBUA 5IX3A 5G20A 4CYPA 3JTKA 1P0HA 4OAEA 3ZJ0A 3F5BA 3TO7A 1YR0A 4PSXA 2DPSA 4KUAA 4DNCA 2ZW5A 2G3AA 2OZHA 4Q36A 3LODA 2QMLA 1XIXA 4Q38A 4UFVA 1RO5A 4XPLA 5AG6A 2HUZA 4R9MA 4ZGYB 1KUXA 3CXPA 4CGOA 2BSWA 3KKWA 2VQYA 2ZXVA 3B8GA 4KOTA 5BWAB 2JDDA 3EO4A 5IV0A 2B58A 3MGDA 4NF1A 1S7KA 2R1IA 4PV6A 4Y49C 1Y7RA 3IGRA 3RYOA 3IWEA 4XNHB 2C27A 4R3KA 2FCKA 1S5KA 1WK4A 4C68A 2PRBA 3FIXA 4B12A 4UFWA 3IU2A 4A31A 3D8PA 2Q4YA 2DPTA 4GS4A 5I0CA 4CAEA 2P0WA 3G8WA 4B5PB 5KTAA 1I12A 1LRZA 2B3UA 4JWPA 5E96A 4A30A 5FVJA 3TFYA 3DNSA 3S6FA 3BJ8A 4RI1A 1Q2YA 2B4DA 3D2PA 3R9FA 3QAHA 2PR1A 2CNMA 1M4DA 4UCPA 4AVCA 4M3SA 3N7ZA 4RS2A 3W6SA 3A9LA 2J8MA 4LUAA 4J3GA 5KTCA 4HNYB 4KS9A 1SQHA 1YVKA 2Z10A 2PC1A 3OWCA 2VEZA 4FD5A 2D4PA 1FY7A 4PK3A 3V8IA 4B10A 3SHPA 4A95A 1BO4A 4JXRA 2P6EA 3R95A 2FXFA 1V0CA 4KORA 2VZZA 3DR6A 4KVXA 4U9YA 5AG7A 3W91A 3R1KA 3UY5A 2WPWA 5KTDA 5A27A 5G22A 4B11A 4KUBA 4MHDA 2F5IA 1YGHA 4CGNA 1XEBA 2AE6A 4A33A 4FD6A 1IICA 1M4IA 3H4QA 5DWNA 3R9GA 4FD4A 3PGPA 1U6MA 2FL4A 4CYQA 4B5OA 4CAVA 1B6BA 1NSLA 1QSNA 4XPKA 5H86A 2D4OA 4CAWA 3VWEA 2FSRA 4LX9A 4CAFA 4MFPA 4MFQA 4CRYB 2VZYA 4NXYA 4C7HA 4CGMA 4OADA 3BJ7A 3T9YA 2ZW4A 1KZFA 1S3ZA 1QSRA 2P6GA 1KUVA 5C88A 4YRHA 4F0YA 5HMNA 1Z9UA 4X5KA 4KLWA 2ZW7A 4ONUA 4KOVA 2Q7BA 5JPHA 4CRZB 2BEIA 3EC4A 5A28A 2RC4A 1BOBA 2I79A 5J8FA 3G3SA 2OH1A 2WUUA 4Y49B 4PSWA 1L0CA 5DWMA 5F46A 2GE3A 2K5TA 5JQ4A 4MBUA 4FD7A 4XPDB 4B14A 2ZW6A 2BUEA 3P2FA 3TOBA 3FRMA 1I21A 2ATRA 5G1ZA 2Z3LA 4UWJA 4CYNA 2YNEA 4L8AA 1QSOA 3R96A 5IB0A 4JD6A 3P2HA 2B4BA 1MJAA 2B4DB 1R57A 1YK3A 4UCMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4C7I A;  4C7H A;  5G21 A;  4CGM A;  4B10 A;  4A95 A;  2YNC C;  3IU1 A;  4CGN A;  4C68 A;  5AG4 A;  4UCP A;  4A33 A;  4C2Z A;  4A32 A;  4B12 A;  4UFW A;  3IU2 A;  4A31 A;  5G22 A;  4B13 A;  4CGP A;  5AG5 A;  4B14 A;  4CAE A;  4UFV A;  5AGE A;  5G1Z A;  2YNC A;  5AG6 A;  4CGL A;  4CYQ A;  4C2X A;  4UCN A;  4CYN A;  2YNE A;  4A2Z A;  4CGO A;  5AG7 A;  2WSA A;  5G20 A;  4BBH A;  4CYP A;  3JTK A;  4A30 A;  5A28 A;  4CAF A;  4UFX A;  4CYO A;  3H5Z A;  4C2Y A;  5A27 A;  2WUU A;  4UCM A;  3IWE A;  4B11 A;  2YND A; 
#chains in the Genus database with same CATH topology
 1K4J A;  3C26 A;  4M6I A;  4HNX B;  2FT0 A;  4MY0 A;  4A38 A;  4C2Z A;  3MRU A;  2HV2 A;  4A32 A;  2EWB A;  1IGB A;  3PP9 A;  3TE4 A;  1B87 A;  1TF9 A;  1ZG7 A;  3D7F A;  3BI0 A;  3KHX A;  4KOS A;  3TOA A;  4UEE A;  4JZ0 A;  3EFA A;  2HC9 A;  3DDD A;  4XPD C;  4A2Z A;  4K30 A;  2AFW A;  3IWG A;  1UFH A;  2REE A;  5ISV A;  3TTH A;  3IJ3 A;  2ZEN A;  2F7V A;  4IUS A;  3SXN A;  3T90 A;  3BHX A;  3VAT A;  3JVN A;  4F0X A;  1VHS A;  2Q04 A;  3F0A A;  2AFU A;  3B7I A;  3PB7 X;  4UF4 A;  3PB6 X;  4FAI A;  1LOK A;  3B3V A;  3H5Z A;  1YLO A;  2OU2 A;  3GLJ A;  3D66 A;  5F48 A;  4PK2 A;  5G21 A;  1WWZ A;  4NCZ A;  4G1P A;  4MY3 A;  3SI0 A;  2RB7 A;  3WAB A;  4CPA A;  5AG4 A;  2H5M A;  4UWI A;  4A94 A;  4R76 A;  4MHP A;  4KVO E;  3CDX A;  5LYI A;  1XJO A;  3JUW A;  2BOA A;  4AG7 A;  1CJW A;  2V8G A;  3D3S A;  3EXN A;  2AJ6 A;  3S6G A;  3SXO A;  4BD9 A;  4JLY A;  2AFZ A;  2CIJ A;  1N71 A;  4MFZ A;  1VKC A;  2PJ6 A;  3VWD A;  4KOY A;  8CPA A;  5J8C A;  2KCW A;  4PXE A;  1P4N A;  2DXQ A;  2HB6 A;  2Q4V A;  1X12 A;  5H84 A;  5C82 A;  3TT2 A;  1LAP A;  3FB3 A;  4UFX A;  4OKO A;  1TKH A;  2NMT A;  1YLE A;  2Z3K A;  3PB8 X;  4MCQ A;  2X7B A;  2C6P A;  4NSQ A;  3V38 A;  3E0K A;  4C7I A;  4KOX A;  1M1D A;  2QEC A;  3FYN A;  4X2T A;  1Z8W A;  1Z8L A;  3KGQ A;  4MMO A;  3LWU A;  1S7N A;  4X3R A;  1GYT A;  2NYQ A;  3NA6 A;  2Q44 A;  4I49 A;  2CNS A;  4KZT A;  3TO9 A;  4C2X A;  4F6A A;  1NSA A;  2QJ8 A;  1RTQ A;  2R98 A;  1M44 A;  4IF5 A;  4KOU A;  4YGO A;  3K2K A;  4IK2 A;  4R3L A;  4OC3 A;  1MJB A;  2VI7 A;  3WR7 A;  1M4G A;  1YQE A;  2ZEO A;  4JYW A;  4YWY A;  1Q7L A;  1YRE A;  4H6U A;  1F2O A;  3K9U A;  2B5G B;  3KQZ A;  1PUA A;  5F47 A;  3DLJ A;  1NE9 A;  1ON0 A;  4YFJ A;  4ONW A;  3PZJ A;  3S6K A;  2IL4 A;  1CP7 A;  4NJQ A;  1YW6 A;  2OZG A;  2WPX A;  2PJ3 A;  1PCA A;  4NGM A;  1LCP A;  5EC4 A;  5K8M A;  1ZG9 A;  1EE3 P;  4KLV A;  2REF A;  4CGP A;  4H2K A;  3W6X A;  4AVA A;  1BAV A;  2PJ0 A;  4UA3 A;  4PXD A;  2PJ8 A;  4ORF A;  3ISX A;  2ZEP A;  1Q2D A;  4JJX A;  4AXV A;  1XE4 A;  5IB9 A;  4U9Z A;  4XNH C;  3S6H A;  2ARH A;  3EY5 A;  4OME A;  3CXS A;  4JXQ A;  1H8L A;  4F9V A;  3FH4 A;  4NGN A;  4P4J A;  3NH5 A;  2G9D A;  4R57 A;  4K3N A;  1I1D A;  4IAV A;  1IOF A;  3FED A;  3I9S A;  1VIX A;  1A2Z A;  1FT7 A;  1S60 A;  4P4E A;  3ZZI A;  2OR4 A;  3FXT A;  1KWM A;  2OB0 A;  1XBU A;  2I00 A;  1XRY A;  2B3V A;  2PJ4 A;  5I4M A;  3S9N A;  4P10 A;  1F2P A;  2JLM A;  1YW4 A;  3LMS A;  1TKJ A;  1AUG A;  4U5Y A;  3H8E A;  3BI1 A;  2J8R A;  3NE7 A;  2RFH A;  1BPM A;  1S7F A;  3PFE A;  5EMI A;  3FMC A;  3B3S A;  4R87 A;  4MXU A;  2VXK A;  5IV0 A;  2ZEH A;  1XF8 A;  2XEF A;  1RXT A;  2PDO A;  2YGW A;  4KVM E;  3TO6 A;  1S7L A;  2WSA A;  4CS0 B;  4ZI6 A;  5ELY A;  2C6C A;  3CT9 A;  3MN8 A;  2A4N A;  2JBJ A;  4NJR A;  4R7M A;  5F49 A;  4BBH A;  4CYO A;  2FIA A;  2GAN A;  1F57 A;  3B35 A;  4OC0 A;  4H89 A;  4P44 A;  4RN7 A;  4C2Y A;  1Y7E A;  1CBX A;  2PJ1 A;  2FIW A;  1PYT B;  1Z8T A;  3FX6 A;  2CNT A;  2YNC C;  1ZO0 A;  2PQ8 A;  4EVY A;  1GHE A;  2Z3M A;  4KSI A;  2EUI A;  3DR8 A;  1FNO A;  3CXQ A;  4BMH A;  3L2N A;  4QUS A;  1QMU A;  2ZPA A;  3TCV A;  1MJ9 A;  3DSB A;  3KR5 A;  5AGE A;  2R7H A;  2R8V A;  2FE7 A;  2YNC A;  4EWT A;  3R9E A;  4CGL A;  1KUY A;  2BO9 A;  2EVN A;  4LQ6 A;  4B5P A;  2G3T A;  4UCN A;  4UBR A;  2GRE A;  1HEE A;  3PBB A;  4KOW A;  1OZP A;  1Q2C A;  2G0B A;  3KI9 A;  3PFO A;  5HXD A;  1TIQ A;  4HNW B;  4HKF A;  4WWV A;  5LRJ A;  3GIU A;  3FEC A;  2IQ6 A;  2P6F A;  4E0A A;  2GIV A;  2PJA A;  4UIA A;  3I3G A;  1IYK A;  3IU1 A;  3FJU A;  1IID A;  5EBV A;  1Z4E A;  3CPA A;  5K8O A;  4P6Y A;  3PB4 X;  2JEV A;  2HQY A;  5IX3 A;  4AB7 A;  2CTB A;  2Z11 A;  3GKR A;  4E2A A;  1CM0 A;  1VHE A;  2J8N A;  2PR8 A;  4W9Y A;  5CNP A;  1ARM A;  3HUV A;  2EK8 A;  4P4D A;  4FBE A;  4M85 A;  1IB1 E;  5GCN A;  3D2M A;  4MFJ A;  4P4F A;  4NEX A;  3QB8 A;  5CBM A;  4MI4 A;  4KSF A;  4MHN A;  3WC5 A;  1QSM A;  2OOT A;  4AG9 A;  4QC6 A;  5LYD A;  2O28 A;  2XEJ A;  2Z0Z A;  3BLN A;  2Q0Y A;  3H8F A;  2IMO A;  4MHY A;  2O4H A;  4Q7A A;  2CY2 A;  1QST A;  3LD2 A;  2V77 A;  4OC1 A;  1ZLI A;  4NGS A;  4MFK A;  4ZX8 A;  2Q43 A;  3K9T A;  4DJL A;  2ZEF A;  2O53 A;  3SJE A;  3V7Z A;  4CAX A;  2AFO A;  1VHO A;  1Z4R A;  2VBQ A;  1J4J A;  1XMT A;  4YU9 A;  1Y9K A;  2ZEL A;  2Z3P A;  1JQG A;  4QBJ A;  5LYF A;  5HH1 A;  5LRG A;  1YX0 A;  4NGQ A;  2GFQ A;  1IYL A;  1Y9W A;  3IEH A;  2PJ7 A;  4E8O A;  4ZY0 A;  6CPA A;  2B5G A;  4MFL A;  4L89 A;  3FNC A;  4MJ8 A;  5JH9 A;  5K8P A;  2YND A;  4QB9 A;  4OIW A;  2JDC A;  4TWE A;  1NMT A;  2PSW A;  2FVG A;  2AFS A;  1ELL P;  2Y0M A;  2ZEE A;  3PEI A;  1MK4 A;  5HVG A;  3GY9 A;  4B13 A;  2CXA A;  1PU9 A;  5AG5 A;  4H6Z A;  4KSA A;  3CPX A;  1YVO A;  3GYA A;  2Z3N A;  2Z3O A;  2OZU A;  1XOV A;  3NH8 A;  3B3T A;  4MCP A;  2XEI A;  4A37 A;  2BL1 A;  4II9 A;  1Z8X A;  1OBR A;  4ZBG A;  1IOI A;  4M6G A;  3KQX A;  5J1Q A;  3IWW A;  3SJF A;  2JEW A;  2AFX A;  4OLL A;  4QVT A;  4AVB A;  2FS5 A;  2QIR A;  2ZOF A;  3F8K A;  3FBU A;  4OC5 A;  2Q7S A;  4PXC A;  1LFW A;  2CF4 A;  5G20 A;  3JTK A;  4CYP A;  1ELM P;  1P0H A;  4OAE A;  1M4L A;  3ZJ0 A;  2PIY A;  2CTC A;  1CX8 A;  3F5B A;  3TO7 A;  1YR0 A;  4MRI A;  1ZLH A;  2I3C A;  2EBJ A;  2PJC A;  4PSX A;  2DPS A;  2PIZ A;  3HLP A;  3WC6 A;  4KUA A;  3VH9 A;  4MHZ A;  1X10 A;  1LAN A;  4GM5 A;  4DNC A;  2ZW5 A;  2PJ5 A;  5LYL A;  2G3A A;  2OZH A;  3SI2 A;  4Q36 A;  1HDQ A;  1ARL A;  2QML A;  1XIX A;  2F8H A;  3LOD A;  3PB9 X;  4Q38 A;  4UFV A;  1RO5 A;  3DGV A;  4XPL A;  5AG6 A;  4A39 A;  1YSJ A;  2HUZ A;  3IFE A;  4R9M A;  4ZGY B;  4P4B A;  1KUX A;  4P4I A;  3CXP A;  4CGO A;  3SJG A;  2BSW A;  1TKF A;  3KKW A;  2VQY A;  4EFD A;  3RO0 A;  1AYE A;  1Z2L A;  2ZXV A;  3B8G A;  2JDD A;  3EO4 A;  2ODF A;  3GUX A;  2B58 A;  3KHZ A;  3MGD A;  5BWA B;  4NF1 A;  1S7K A;  2R1I A;  1YME A;  2NSM A;  3H8G A;  4PV6 A;  4Y49 C;  1Y7R A;  3IGR A;  3TX8 A;  1CP6 A;  3RYO A;  4B6Z A;  4KOT A;  4FUU A;  4UIB A;  3IWE A;  2V8H A;  2C27 A;  4R3K A;  4XNH B;  2FCK A;  5DS0 A;  3B2Y A;  1S5K A;  2ZED A;  5K8N A;  3FVL A;  2PJ9 A;  2ZEG A;  1WK4 A;  4C68 A;  4DUK A;  3VAR A;  2PRB A;  3FIX A;  4B12 A;  4UFW A;  3IU2 A;  2ZOG A;  3D8P A;  2Q4Y A;  2DPT A;  1IY7 A;  4GS4 A;  4A31 A;  5I0C A;  3T8W A;  4CAE A;  2P0W A;  2XEG A;  3IC1 A;  4MCS A;  3KZW A;  3G8W A;  1R43 A;  4B5P B;  2Q51 A;  2PCU A;  5KTA A;  1I12 A;  1LRZ A;  2B3U A;  4JWP A;  3D7H A;  3KAS A;  1DE4 C;  7CPA A;  4Z65 A;  1VGY A;  5E96 A;  4A30 A;  5FVJ A;  3TFY A;  4RUH A;  3DNS A;  1QQ9 A;  4O23 A;  3GB0 A;  3S6F A;  2ZEM A;  3BJ8 A;  4RI1 A;  1Q2Y A;  2B4D A;  1BPN A;  2Q4Z A;  3D2P A;  4GXH A;  4EME A;  4P45 A;  3R9F A;  2C1C A;  3QAH A;  3KL9 A;  2GU2 A;  2PR1 A;  2DF5 A;  2CNM A;  1M4D A;  4UCP A;  4AVC A;  4M3S A;  4UEF A;  2PRQ A;  3N7Z A;  4OC4 A;  4RS2 A;  3W6S A;  2PJ2 A;  3FEE A;  3A9L A;  2J8M A;  2J9A A;  2AFM A;  4PPZ A;  1Y0R A;  2V8V A;  4LUA A;  2ANP A;  3NE8 A;  3BXM A;  4J3G A;  5KTC A;  4HNY B;  5D29 A;  3D68 A;  2POK A;  1SQH A;  1YVK A;  4KS9 A;  5HVF A;  2Z10 A;  2PC1 A;  4PQA A;  4FWU A;  3OWC A;  4F9U A;  2VEZ A;  4FD5 A;  1ZG8 A;  3RBU A;  2D4P A;  1FY7 A;  4OID A;  3S9M A;  4PK3 A;  3V8I A;  2VL1 A;  4B10 A;  3SHP A;  4A95 A;  1BO4 A;  2PVV A;  4JXR A;  2JBK A;  2P6E A;  3N5F A;  4TNU A;  2PVW A;  3R95 A;  3TC8 A;  2FXF A;  3RZA A;  2ABZ A;  1V0C A;  4KOR A;  2VZZ A;  3I1U A;  1DTD A;  3DR6 A;  4KVX A;  4R6T A;  4U9Y A;  5JGF A;  3NFZ A;  5AG7 A;  3W91 A;  3R1K A;  2DEA A;  2GLF A;  4NGP A;  3RAM A;  3UY5 A;  2WPW A;  5KTD A;  5A27 A;  5G22 A;  2IJZ A;  4KUB A;  4B11 A;  2EO8 A;  3PBE A;  2F5I A;  3PRT A;  4MHD A;  3ISZ A;  1YGH A;  4CGN A;  4PXB A;  1XEB A;  3SI1 A;  2AE6 A;  4A33 A;  1IU8 A;  4FD6 A;  1IIC A;  1M4I A;  3H4Q A;  1CPX A;  2PJB A;  5DWN A;  3R9G A;  4ZX9 A;  4FD4 A;  5HVH A;  3PGP A;  4R8F A;  1U6M A;  2FL4 A;  4CYQ A;  4B5O A;  1TXR A;  4CAV A;  4M6H A;  1B6B A;  1NSL A;  1QSN A;  4XPK A;  4NGT A;  5H86 A;  2D4O A;  3D67 A;  4CAW A;  3VWE A;  2FSR A;  4LX9 A;  4WJB A;  4CAF A;  4MFP A;  4NGR A;  1AMP A;  3LAC A;  1CG2 A;  4MFQ A;  4OC2 A;  3WT4 A;  1XMB A;  3B3W A;  4CRY B;  2VZY A;  1R3N A;  4NXY A;  4C7H A;  4CGM A;  4OAD A;  3KR4 A;  3BJ7 A;  1UWY A;  2V8D A;  3T9Y A;  4ZY1 A;  4MCR A;  2ZW4 A;  1KZF A;  3IIB A;  1S3Z A;  2GLJ A;  1QSR A;  2P6G A;  3D7G A;  4BIN A;  1KUV A;  5C88 A;  4YRH A;  1CPS A;  2BCO A;  4F0Y A;  2WYR A;  1TF8 A;  1Z9U A;  5HMN A;  5LRK A;  4X5K A;  3QAY A;  4KLW A;  1BLL E;  2ZW7 A;  3D4U A;  3FF3 A;  4ONU A;  4KOV A;  5D8N A;  2WZN A;  3RNZ A;  2Q7B A;  5JPH A;  4CRZ B;  2BEI A;  3EC4 A;  4X8I A;  2PE3 A;  2RC4 A;  4ZY2 A;  4OP4 A;  5A28 A;  1BOB A;  2I79 A;  1Z5R A;  2QYV A;  5J8F A;  2EK9 A;  3G3S A;  4IHM A;  2OH1 A;  2WUU A;  4Y49 B;  4PSW A;  1HDU A;  1L0C A;  5DWM A;  3SJX A;  5F46 A;  2GE3 A;  2K5T A;  3S9L A;  3NH4 A;  5JQ4 A;  4MBU A;  3WC7 A;  3B3C A;  1Y0Y A;  4FD7 A;  4XPD B;  4B14 A;  2ZW6 A;  4LQG A;  2BUE A;  3P2F A;  1XFO A;  3QNV A;  5THW A;  3TOB A;  3FRM A;  1I21 A;  2ATR A;  5G1Z A;  1JWQ A;  5CPA A;  2QVP A;  4DYO A;  2Z3L A;  3IO1 A;  4UWJ A;  5F09 A;  4CYN A;  2YNE A;  3JRU A;  4NFR A;  4L8A A;  1QSO A;  3CZX A;  3R96 A;  5IB0 A;  4HPS A;  4JD6 A;  2C6G A;  3P2H A;  4UEZ A;  5JM6 A;  1LAM A;  2B4B A;  1MJA A;  2B4D B;  4F8Z A;  1R57 A;  1YK3 A;  4ZYQ A;  4UCM A;  3D7D A; 
#chains in the Genus database with same CATH homology
 1K4J A;  3C26 A;  4HNX B;  2FT0 A;  4MY0 A;  4C2Z A;  2HV2 A;  4A32 A;  3TE4 A;  3PP9 A;  1B87 A;  4KOS A;  3TOA A;  3EFA A;  3DDD A;  4XPD C;  4A2Z A;  4K30 A;  3IWG A;  1UFH A;  2REE A;  5ISV A;  3TTH A;  4IUS A;  3SXN A;  3T90 A;  3JVN A;  4F0X A;  1VHS A;  2Q04 A;  3F0A A;  3H5Z A;  2OU2 A;  5F48 A;  4PK2 A;  5G21 A;  1WWZ A;  4NCZ A;  4MY3 A;  5AG4 A;  2H5M A;  4UWI A;  4KVO E;  3JUW A;  4AG7 A;  1CJW A;  3D3S A;  3EXN A;  2AJ6 A;  3S6G A;  3SXO A;  4JLY A;  1N71 A;  4MFZ A;  1VKC A;  3VWD A;  4KOY A;  5J8C A;  2KCW A;  1P4N A;  2DXQ A;  2Q4V A;  5H84 A;  5C82 A;  3TT2 A;  4UFX A;  3FB3 A;  2NMT A;  1YLE A;  2Z3K A;  2X7B A;  4NSQ A;  3E0K A;  4C7I A;  4KOX A;  1M1D A;  2QEC A;  3FYN A;  1S7N A;  2Q44 A;  4I49 A;  2CNS A;  4KZT A;  3TO9 A;  4C2X A;  4F6A A;  4IF5 A;  2R98 A;  4KOU A;  1M44 A;  4YGO A;  4R3L A;  1MJB A;  2VI7 A;  3WR7 A;  1M4G A;  1YRE A;  4H6U A;  3K9U A;  2B5G B;  5F47 A;  1PUA A;  1ON0 A;  1NE9 A;  4YFJ A;  3PZJ A;  3S6K A;  2IL4 A;  2WPX A;  2OZG A;  5EC4 A;  4KLV A;  2REF A;  4CGP A;  3W6X A;  4AVA A;  4UA3 A;  4ORF A;  4JJX A;  1Q2D A;  1XE4 A;  4U9Z A;  4XNH C;  3S6H A;  2ARH A;  3EY5 A;  3CXS A;  4JXQ A;  4R57 A;  1I1D A;  3I9S A;  3ZZI A;  1S60 A;  3FXT A;  2OB0 A;  2I00 A;  2B3V A;  2JLM A;  4U5Y A;  2J8R A;  3NE7 A;  1S7F A;  4R87 A;  2VXK A;  1XF8 A;  1RXT A;  2PDO A;  2YGW A;  4KVM E;  3TO6 A;  1S7L A;  2WSA A;  4CS0 B;  4BBH A;  2A4N A;  5F49 A;  4CYO A;  2FIA A;  2GAN A;  4H89 A;  4C2Y A;  2FIW A;  2CNT A;  2YNC C;  1ZO0 A;  2PQ8 A;  4EVY A;  1GHE A;  2Z3M A;  2EUI A;  3DR8 A;  3CXQ A;  4BMH A;  3TCV A;  4QUS A;  2ZPA A;  1MJ9 A;  3DSB A;  5AGE A;  2R7H A;  2R8V A;  2FE7 A;  2YNC A;  3R9E A;  4CGL A;  1KUY A;  2EVN A;  4B5P A;  2G3T A;  4UCN A;  4UBR A;  4KOW A;  1OZP A;  1Q2C A;  2G0B A;  1TIQ A;  4HNW B;  4HKF A;  2P6F A;  4E0A A;  2GIV A;  3I3G A;  1IYK A;  3IU1 A;  1IID A;  5EBV A;  1Z4E A;  2JEV A;  2HQY A;  4AB7 A;  2Z11 A;  3GKR A;  4E2A A;  1CM0 A;  2J8N A;  2PR8 A;  5CNP A;  4M85 A;  1IB1 E;  5GCN A;  3D2M A;  4MFJ A;  4NEX A;  3QB8 A;  4MI4 A;  4KSF A;  1QSM A;  4AG9 A;  4QC6 A;  2O28 A;  2Z0Z A;  3BLN A;  2Q0Y A;  2CY2 A;  1QST A;  3LD2 A;  4MFK A;  4CAX A;  1Z4R A;  2VBQ A;  1J4J A;  1XMT A;  1Y9K A;  2Z3P A;  4QBJ A;  5HH1 A;  1YX0 A;  1IYL A;  1Y9W A;  4E8O A;  2B5G A;  4MFL A;  4L89 A;  3FNC A;  4MJ8 A;  2YND A;  4QB9 A;  2JDC A;  1NMT A;  2PSW A;  2Y0M A;  1MK4 A;  3GY9 A;  4B13 A;  2CXA A;  1PU9 A;  5AG5 A;  4H6Z A;  4KSA A;  1YVO A;  3GYA A;  2Z3N A;  2Z3O A;  2OZU A;  4II9 A;  2BL1 A;  4ZBG A;  4OLL A;  4QVT A;  4AVB A;  2FS5 A;  2QIR A;  3F8K A;  3FBU A;  5IX3 A;  5G20 A;  4CYP A;  3JTK A;  1P0H A;  4OAE A;  3ZJ0 A;  3F5B A;  3TO7 A;  1YR0 A;  4PSX A;  2DPS A;  4KUA A;  4DNC A;  2ZW5 A;  2G3A A;  2OZH A;  4Q36 A;  3LOD A;  2QML A;  1XIX A;  4Q38 A;  4UFV A;  1RO5 A;  4XPL A;  5AG6 A;  2HUZ A;  4R9M A;  4ZGY B;  1KUX A;  3CXP A;  4CGO A;  2BSW A;  3KKW A;  2VQY A;  2ZXV A;  3B8G A;  4KOT A;  5BWA B;  2JDD A;  3EO4 A;  5IV0 A;  2B58 A;  3MGD A;  4NF1 A;  1S7K A;  2R1I A;  4PV6 A;  4Y49 C;  1Y7R A;  3IGR A;  3RYO A;  3IWE A;  4XNH B;  2C27 A;  4R3K A;  2FCK A;  1S5K A;  1WK4 A;  4C68 A;  2PRB A;  3FIX A;  4B12 A;  4UFW A;  3IU2 A;  4A31 A;  3D8P A;  2Q4Y A;  2DPT A;  4GS4 A;  5I0C A;  4CAE A;  2P0W A;  3G8W A;  4B5P B;  5KTA A;  1I12 A;  1LRZ A;  2B3U A;  4JWP A;  5E96 A;  4A30 A;  5FVJ A;  3TFY A;  3DNS A;  3S6F A;  3BJ8 A;  4RI1 A;  1Q2Y A;  2B4D A;  3D2P A;  3R9F A;  3QAH A;  2PR1 A;  2CNM A;  1M4D A;  4UCP A;  4AVC A;  4M3S A;  3N7Z A;  4RS2 A;  3W6S A;  3A9L A;  2J8M A;  4LUA A;  4J3G A;  5KTC A;  4HNY B;  4KS9 A;  1SQH A;  1YVK A;  2Z10 A;  2PC1 A;  3OWC A;  2VEZ A;  4FD5 A;  2D4P A;  1FY7 A;  4PK3 A;  3V8I A;  4B10 A;  3SHP A;  4A95 A;  1BO4 A;  4JXR A;  2P6E A;  3R95 A;  2FXF A;  1V0C A;  4KOR A;  2VZZ A;  3DR6 A;  4KVX A;  4U9Y A;  5AG7 A;  3W91 A;  3R1K A;  3UY5 A;  2WPW A;  5KTD A;  5A27 A;  5G22 A;  4B11 A;  4KUB A;  4MHD A;  2F5I A;  1YGH A;  4CGN A;  1XEB A;  2AE6 A;  4A33 A;  4FD6 A;  1IIC A;  1M4I A;  3H4Q A;  5DWN A;  3R9G A;  4FD4 A;  3PGP A;  1U6M A;  2FL4 A;  4CYQ A;  4B5O A;  4CAV A;  1B6B A;  1NSL A;  1QSN A;  4XPK A;  5H86 A;  2D4O A;  4CAW A;  3VWE A;  2FSR A;  4LX9 A;  4CAF A;  4MFP A;  4MFQ A;  4CRY B;  2VZY A;  4NXY A;  4C7H A;  4CGM A;  4OAD A;  3BJ7 A;  3T9Y A;  2ZW4 A;  1KZF A;  1S3Z A;  1QSR A;  2P6G A;  1KUV A;  5C88 A;  4YRH A;  4F0Y A;  5HMN A;  1Z9U A;  4X5K A;  4KLW A;  2ZW7 A;  4ONU A;  4KOV A;  2Q7B A;  5JPH A;  4CRZ B;  2BEI A;  3EC4 A;  5A28 A;  2RC4 A;  1BOB A;  2I79 A;  5J8F A;  3G3S A;  2OH1 A;  2WUU A;  4Y49 B;  4PSW A;  1L0C A;  5DWM A;  5F46 A;  2GE3 A;  2K5T A;  5JQ4 A;  4MBU A;  4FD7 A;  4XPD B;  4B14 A;  2ZW6 A;  2BUE A;  3P2F A;  3TOB A;  3FRM A;  1I21 A;  2ATR A;  5G1Z A;  2Z3L A;  4UWJ A;  4CYN A;  2YNE A;  4L8A A;  1QSO A;  3R96 A;  5IB0 A;  4JD6 A;  3P2H A;  2B4B A;  1MJA A;  2B4D B;  1R57 A;  1YK3 A;  4UCM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...