5G21A

Leishmania major n-myristoyltransferase in complex with a quinoline inhibitor (compound 26).
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
411
structure length
410
Chain Sequence
AHAFWSTQPVPQTEDETEKIVFAGPMDEPKTVADIPEEPYPIASTFEWWTPNMEAADDIHAIYELLRDNYVEDDDSMFRFNYSEEFLQWALCPPNYIPDWHVAVRRKADKKLLAFIAGVPVTLRMGTPKYMKVKAQEKGEGEEAAKYDEPRHICEINFLCVHKQLREKRLAPILIKEATRRVNRTNVWQAVYTAGVLLPTPYASGQYFHRSLNPEKLVEIRFSGIPAQYQKFQNPMAMLKRNYQLPSAPKNSGLREMKPSDVPQVRRILNYLDSFDVGPVFSDAEISHYLLPRDGVVFTYVVENDKKVTDFFSFYRIPSTVIGNSNYNLLNAAYVHYYAATSIPLHQLILDLLIVAHSRGFDVCNMVEILDNRSFVEQLKFGAGDGHLRYYFYNWAYPKIKPSQVALVML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLYCYLPEPTIDE N-TETRADECANOYLTRANSFERASE
publication title Structure-guided optimization of quinoline inhibitors of Plasmodium N-myristoyltransferase.
pubmed doi rcsb
source organism Leishmania major
molecule tags Transferase
total genus 126
structure length 410
sequence length 411
ec nomenclature ec 2.3.1.97: Glycylpeptide N-tetradecanoyltransferase.
pdb deposition date 2016-04-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01233 NMT Myristoyl-CoA:protein N-myristoyltransferase, N-terminal domain
A PF02799 NMT_C Myristoyl-CoA:protein N-myristoyltransferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.170 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 5g21A00
4B10A 3IU2A 4UFWA 4UCPA 4UFXA 4B13A 4BBHA 4C2ZA 4CGOA 5AG4A 4CYOA 5AG5A 4B11A 2WSAA 5G21A 4A30A 4A95A 4CGPA 5G1ZA 4CGLA 5A28A 3IWEA 4UCMA 4C2XA 4A32A 4C68A 4CGNA 4CYQA 5G22A 4CYPA 4A31A 4C7HA 5G20A 5A27A 4A2ZA 5AG7A 4UCNA 2YNDA 2YNCC 4C2YA 4CGMA 3H5ZA 4B12A 4UFVA 3JTKA 4C7IA 2YNEA 4CAFA 2WUUA 5AG6A 4CYNA 3IU1A 5AGEA 4A33A 2YNCA 4B14A 4CAEA
chains in the Genus database with same CATH superfamily
4M85A 2IMOA 1QSRA 4LX9A 3FEDA 3SI1A 5FVJA 4OIDA 2PJBA 1A2ZA 1QSTA 1R3NA 3SI0A 4FD5A 2IL4A 1M44A 2OZHA 3BJ8A 4AVBA 3FVLA 1DE4C 3B8GA 4IAVA 4QUSA 4R87A 4AXVA 4DNCA 1ZG7A 2GLFA 2FE7A 2P6GA 3FYNA 5K8PA 5LYDA 4OC4A 1Y9WA 2Q7SA 4H6UA 4ZY2A 3TO6A 1WK4A 4KOXA 4NGTA 3K9TA 4KVOE 2Q4VA 5IB9A 3TOBA 1XE4A 4FBEA 1UWYA 4F6AA 3IEHA 4KOUA 2QIRA 2WUUA 1K4JA 2FVGA 3G8WA 1Y7RA 2HC9A 2JEVA 2CTBA 2FL4A 2R7HA 3KI9A 3NFZA 4J3GA 1ELMP 3C26A 4XPKA 1S3ZA 3GIUA 4W9YA 2KCWA 1LFWA 4MFKA 4TWEA 4A37A 3F5BA 1GYTA 1VKCA 5K8MA 5LYFA 5KTCA 4NEXA 4MCSA 5G21A 1RTQA 3R96A 3S6FA 4L89A 4CGNA 4ORFA 1YX0A 2OZGA 4C68A 1M4DA 3W6SA 2OB0A 1X10A 1XIXA 2FSRA 3JUWA 2FIWA 3FB3A 1MK4A 2ZOGA 2QYVA 4P4EA 3WC6A 4B5PB 4R76A 5ISVA 2B5GB 4JD6A 4PSXA 2GIVA 3N7ZA 2YGWA 5D29A 3FNCA 4ZY1A 2PJ5A 3TX8A 2YNEA 4WJBA 1TF8A 2VBQA 4M6IA 4WWVA 4UBRA 3P2FA 3WT4A 3BXMA 4P4JA 3PB7X 5DWNA 4P10A 1ELLP 4R57A 4UEZA 4MFJA 3OWCA 1PYTB 3CXSA 1IOFA 1XRYA 4MCPA 2Q7BA 2POKA 3GY9A 1BOBA 2EWBA 4M6GA 2PIYA 1QSNA 1TIQA 2I00A 2VXKA 4HPSA 3S9MA 2OR4A 4ZY0A 4M3SA 3FJUA 4FD6A 2I79A 4EWTA 1LAMA 1MJ9A 2CIJA 2ZEEA 4A38A 4CRZB 4UEFA 1U6MA 2G9DA 2J8NA 4UCNA 3DR8A 5EMIA 5LRGA 1AMPA 2PJ0A 4NGRA 4PXDA 4OLLA 4KUBA 2PRQA 3TT2A 4ZYQA 4F0YA 4KOSA 2JDDA 4FD7A 3H4QA 2D4PA 2B58A 4L8AA 2VZYA 4YU9A 3KHZA 4OAEA 3TE4A 4YFJA 4B10A 2DF5A 5CPAA 1KUVA 3RBUA 3B7IA 4M6HA 4JZ0A 4BD9A 2ZW5A 4XNHB 1XMBA 5F09A 1VIXA 3IGRA 4HKFA 5H84A 1IY7A 4EMEA 4GXHA 1KUXA 1YVOA 2ATRA 4P4DA 1XOVA 1S5KA 3FH4A 1KZFA 1XMTA 4KUAA 1Z8LA 1NE9A 1M4IA 2VZZA 3GUXA 4NGNA 2YNDA 3ISZA 5ELYA 2J8MA 1ARLA 1IYLA 3B3VA 4OP4A 2V8VA 2PR1A 5H86A 3RYOA 4E2AA 2C1CA 5KTAA 2V77A 3DSBA 2Z10A 2I3CA 4ONWA 4PXEA 3RAMA 2GFQA 1Z4RA 4UEEA 2C6PA 3W91A 3QAYA 2BL1A 2PJ9A 4P44A 4F0XA 3TC8A 3N5FA 1XJOA 4UFWA 4UCPA 5THWA 3KASA 4B11A 4NGMA 2NYQA 5G1ZA 5I4MA 1ON0A 2QVPA 3FXTA 1M4LA 3SJFA 2FT0A 3S9LA 3B3SA 1UFHA 2XEJA 2IQ6A 2ZW6A 4JYWA 4KS9A 4Q38A 4KOWA 4PSWA 4ZBGA 1S7LA 3FBUA 3K9UA 5EC4A 2G0BA 4DUKA 4UWJA 4NXYA 2CNTA 2CXAA 5JM6A 1S7KA 5LYLA 3EC4A 4MHYA 4CRYB 4OKOA 3V7ZA 2HV2A 1LOKA 3MRUA 3VATA 4Q36A 2FXFA 2PJCA 2JEWA 5D8NA 3GB0A 3I9SA 5J1QA 4JXRA 4UWIA 2EUIA 1I21A 4MBUA 3GKRA 3H8EA 1B87A 4H89A 2PJ2A 5F47A 4BBHA 4YRHA 8CPAA 5E96A 4MRIA 4OC2A 3H8GA 2ARHA 3PB6X 4KLVA 2PSWA 4UIBA 4CYQA 1QQ9A 3D7FA 2AJ6A 2PE3A 4P4IA 3NE8A 4CAXA 2JBJA 2ZPAA 1X12A 3QB8A 4H2KA 4OC3A 1TKJA 3SXOA 4PXCA 5HMNA 5I0CA 4DJLA 1NSLA 1BPMA 2ZEMA 2AFSA 4A33A 4B14A 3R9GA 4MFQA 3CZXA 4BMHA 2ZEHA 1VHOA 2O4HA 4KSAA 2J8RA 2CTCA 3IU2A 1Z8XA 2JBKA 1M4GA 4HNWB 3MN8A 4G1PA 2GE3A 2BOAA 3WC5A 1VHSA 3CDXA 4KZTA 1QSMA 1B6BA 3SJGA 4B6ZA 4P4FA 2PJ7A 4CS0B 4HNXB 4FD4A 3EXNA 3D68A 4KVME 5IX3A 3TFYA 3PB4X 1Y0YA 3DNSA 4X8IA 3S6GA 2J9AA 3KHXA 3MGDA 4ZGYB 2B4DB 3D2MA 3D67A 3D7DA 3FMCA 2PC1A 4UF4A 5JGFA 1LANA 2ZEGA 1LAPA 1P0HA 2EBJA 2WYRA 2P6FA 2ZEDA 3B35A 2VQYA 5GCNA 2Z11A 5LRJA 3PBEA 2OU2A 2ZXVA 2AFMA 4PPZA 4CGOA 1CG2A 3I3GA 4I49A 5AG5A 3CXQA 4MJ8A 3W6XA 5A28A 1YW6A 3B3TA 4PV6A 4U5YA 1Q2DA 1RXTA 4IUSA 4PXBA 2C6GA 2Q44A 2K5TA 3G3SA 4KVXA 4MCRA 5HVGA 3GYAA 3PGPA 3RO0A 3JRUA 5EBVA 4CAWA 1M1DA 3S9NA 3R9EA 4LUAA 1CM0A 2FS5A 1ZG9A 2PCUA 2RB7A 4MMOA 4PQAA 3IWWA 2PJAA 7CPAA 3TOAA 1XFOA 2B4BA 1NMTA 3EFAA 4MHDA 3RNZA 3IU1A 3BHXA 1QMUA 2AFOA 2ZELA 2BUEA 4K30A 4MHZA 4GM5A 2ZEOA 2CF4A 2O28A 3VWEA 1Z4EA 3HLPA 2AFZA 4AG7A 4OMEA 3SHPA 1IYKA 3T90A 3V8IA 5AG4A 4A30A 4AVAA 4R8FA 4RS2A 1BLLE 2FCKA 2B3UA 3PFOA 4C2XA 3KKWA 3NH4A 1CP7A 2EK9A 2F7VA 1YGHA 3L2NA 4A31A 4C7HA 4CYPA 2XEIA 4H6ZA 5C82A 3D2PA 4IHMA 2ZEFA 1TKFA 1AYEA 4KOTA 3I1UA 3SI2A 5K8OA 2Q51A 4C7IA 5JQ4A 3ZJ0A 4R6TA 2ZW7A 3TO7A 3PB9X 3QAHA 2NMTA 4FAIA 1JWQA 4NGPA 4CYNA 3KQXA 4A94A 1GHEA 2YNCA 1CX8A 1Q2CA 4MY0A 2QJ8A 3BLNA 2PJ1A 2PRBA 4B13A 5JH9A 2JDCA 1ZG8A 2QMLA 3ZZIA 2WZNA 3S6KA 5KTDA 3TCVA 2HQYA 4RUHA 2V8HA 4JXQA 4OC1A 3WABA 2Z3PA 2F5IA 1YR0A 2PDOA 2AFWA 1YLOA 3BI0A 2ANPA 3KR5A 3FF3A 4NJRA 2DEAA 2ZEPA 3EO4A 1Z8WA 3LACA 3QNVA 3VWDA 4E8OA 4O23A 3DLJA 4AVCA 1BAVA 1J4JA 2PJ6A 2PVWA 4R3LA 3K2KA 1Y0RA 3IIBA 4TNUA 1BO4A 1YW4A 4AB7A 2HB6A 2R1IA 3JVNA 1CPSA 2CNMA 5LYIA 1XBUA 4MFPA 2P0WA 4QBJA 3LMSA 4KORA 3S6HA 5J8FA 2EVNA 3ISXA 4HNYB 4CGPA 3CXPA 4GS4A 4MHPA 1V0CA 4JWPA 1TKHA 3PZJA 4X2TA 4II9A 5A27A 1OBRA 3FX6A 2O53A 3CT9A 1EE3P 1Y9KA 3KGQA 3F8KA 3PFEA 3V38A 4UIAA 3LD2A 4P45A 2B3VA 2IJZA 3IJ3A 1AUGA 2R98A 2WPWA 1NSAA 3DDDA 5IV0A 2VL1A 1F2OA 2V8GA 1ZLHA 1Z2LA 1N71A 1OZPA 4KSFA 2EO8A 1IB1E 4OC5A 4IK2A 4ZX9A 1VGYA 2A4NA 4ONUA 3UY5A 1P4NA 1Q7LA 2WPXA 1MJBA 2Q4YA 4MXUA 3IO1A 4P4BA 2PJ4A 2D4OA 4BINA 2G3AA 4UCMA 5HH1A 4DYOA 2Q0YA 3NH5A 2F8HA 4P6YA 2CNSA 4JJXA 1FNOA 1F2PA 1IIDA 3SJEA 1YQEA 4C2YA 1LCPA 2GREA 3WC7A 2Z3KA 4ZI6A 3D7GA 5F49A 5BWAB 4NGQA 1DTDA 1ZO0A 1RO5A 4CAFA 1MJAA 3RZAA 1FY7A 2Q43A 1HDUA 1TXRA 4FUUA 4QB9A 2OZUA 4CAEA 2RC4A 4ZX8A 3B3CA 1IU8A 3E0KA 4MFZA 2EK8A 4NF1A 2RFHA 3DGVA 1Q2YA 1Z5RA 3F0AA 1L0CA 3T9YA 4CYOA 3D8PA 2Z3MA 4A95A 4MHNA 2BEIA 3LWUA 3SXNA 5DS0A 2OOTA 4MCQA 4R7MA 5G22A 2REFA 3FIXA 4CAVA 2PIZA 4QC6A 3P2HA 1XEBA 2PJ8A 1HEEA 4MI4A 2G3TA 4KSIA 4AG9A 2VI7A 3KL9A 5JPHA 4R9MA 2DXQA 3B3WA 1VHEA 3NA6A 4XPDB 2R8VA 1WWZA 3TO9A 5AGEA 3TTHA 4F9VA 4B5PA 4XPDC 2B5GA 2ODFA 5F48A 2Z3LA 1ARMA 1R57A 3BJ7A 3DR6A 2NSMA 5HVFA 3FECA 4KOVA 2OH1A 2B4DA 2CY2A 1LRZA 2V8DA 2QECA 2ZW4A 3KZWA 2GANA 4C2ZA 1TF9A 5HVHA 4UA3A 3H8FA 3KR4A 3R1KA 4LQ6A 5DWMA 4YWYA 4PK3A 3IWEA 3A9LA 1JQGA 1KWMA 1YREA 3PEIA 3R95A 5G20A 1CP6A 3LODA 1I1DA 4NCZA 4NFRA 2YNCC 4X5KA 1FT7A 5K8NA 3PRTA 4B12A 1CJWA 4UFVA 1R43A 3EY5A 4Q7AA 4R3KA 2AFUA 4U9ZA 6CPAA 1BPNA 1S7NA 1PU9A 3VARA 1YMEA 4F8ZA 1YSJA 5J8CA 3BI1A 4KOYA 2FIAA 3IFEA 4B5OA 4F9UA 4K3NA 5LRKA 1YVKA 2X7BA 2VEZA 3D7HA 4Z65A 2Y0MA 4RI1A 2GLJA 2HUZA 3D3SA 3FRMA 4UFXA 2PVVA 1YLEA 3FEEA 4XNHC 3R9FA 2WSAA 4CGLA 5C88A 2PR8A 2Z0ZA 4U9YA 4NJQA 2ZOFA 3IC1A 3GLJA 1Z8TA 4FWUA 4MY3A 1ZLIA 3SJXA 4EFDA 3KQZA 3VH9A 5F46A 4CPAA 4A2ZA 1KUYA 5AG7A 1Y7EA 1H8LA 2GU2A 2Z3NA 1F57A 4CGMA 1I12A 3H5ZA 5IB0A 3WR7A 3CPXA 1XF8A 2Z3OA 2AE6A 5AG6A 4NSQA 1S60A 2AFXA 4LQGA 4MFLA 4IF5A 1IGBA 5HXDA 4QVTA 1QSOA 2H5MA 4OC0A 4PK2A 5CNPA 4A39A 2Q4ZA 3PP9A 2XEFA 4EVYA 1HDQA 4XPLA 2JLMA 1Z9UA 2PQ8A 3NE7A 3IWGA 3PBBA 2C27A 1PUAA 2C6CA 4NGSA 4E0AA 4OADA 2DPSA 4A32A 1PCAA 2REEA 4OIWA 2BSWA 2DPTA 3HUVA 3T8WA 3B2YA 1IOIA 1IICA 2BO9A 4RN7A 1SQHA 4Y49B 4JLYA 2ZENA 2P6EA 3NH8A 2ABZA 4KLWA 4YGOA 4Y49C 3JTKA 2XEGA 5CBMA 1S7FA 3D4UA 3CPAA 3D66A 4X3RA 2PJ3A 1CBXA 1CPXA 1YK3A 2Q04A 2BCOA 3PB8X
chains in the Genus database with same CATH topology
4M85A 1QSRA 4LX9A 5FVJA 1QSTA 4FD5A 2IL4A 1M44A 2OZHA 3BJ8A 4AVBA 4DNCA 3B8GA 4R87A 4QUSA 2FE7A 2P6GA 3FYNA 1Y9WA 4H6UA 3TO6A 1WK4A 4KOXA 4KVOE 2Q4VA 3TOBA 1XE4A 4F6AA 4KOUA 2QIRA 2WUUA 1K4JA 3G8WA 1Y7RA 2JEVA 2R7HA 2FL4A 4J3GA 3C26A 4XPKA 1S3ZA 2KCWA 4MFKA 3F5BA 1VKCA 5KTCA 4NEXA 5G21A 3R96A 3S6FA 4L89A 4CGNA 4ORFA 1YX0A 2OZGA 4C68A 1M4DA 3W6SA 2OB0A 1XIXA 2FSRA 3JUWA 2FIWA 3FB3A 1MK4A 4B5PB 5ISVA 2B5GB 4JD6A 4PSXA 2GIVA 3N7ZA 2YGWA 3FNCA 2YNEA 2VBQA 4UBRA 3P2FA 5DWNA 4R57A 4MFJA 3OWCA 3CXSA 2Q7BA 3GY9A 1BOBA 1QSNA 1TIQA 2I00A 2VXKA 4M3SA 4FD6A 2I79A 1MJ9A 4CRZB 1U6MA 2J8NA 4UCNA 3DR8A 4OLLA 4KUBA 3TT2A 4F0YA 4KOSA 2JDDA 4FD7A 3H4QA 2D4PA 2B58A 4L8AA 2VZYA 4OAEA 3TE4A 4YFJA 4B10A 1KUVA 2ZW5A 4XNHB 3IGRA 4HKFA 5H84A 1KUXA 1YVOA 2ATRA 1S5KA 1KZFA 1XMTA 4KUAA 1NE9A 1M4IA 2VZZA 2YNDA 2J8MA 1IYLA 5H86A 2PR1A 3RYOA 4E2AA 5KTAA 3DSBA 2Z10A 1Z4RA 3W91A 2BL1A 4F0XA 4UFWA 4UCPA 4B11A 5G1ZA 1ON0A 3FXTA 2FT0A 1UFHA 2ZW6A 4KS9A 4Q38A 4KOWA 4PSWA 4ZBGA 1S7LA 3FBUA 3K9UA 5EC4A 2G0BA 4UWJA 4NXYA 2CNTA 2CXAA 1S7KA 3EC4A 4CRYB 2HV2A 4Q36A 2FXFA 3I9SA 4JXRA 4UWIA 2EUIA 1I21A 4MBUA 3GKRA 1B87A 4H89A 5F47A 4BBHA 4YRHA 5E96A 2ARHA 4KLVA 2PSWA 4CYQA 2AJ6A 4CAXA 2ZPAA 3QB8A 3SXOA 5HMNA 5I0CA 1NSLA 4A33A 4B14A 4BMHA 3R9GA 4MFQA 4KSAA 2J8RA 3IU2A 1M4GA 4HNWB 2GE3A 1VHSA 4KZTA 1QSMA 1B6BA 4CS0B 4HNXB 4FD4A 3EXNA 4KVME 5IX3A 3TFYA 3DNSA 3S6GA 3MGDA 4ZGYB 2B4DB 3D2MA 2PC1A 1P0HA 2P6FA 2VQYA 5GCNA 2Z11A 2OU2A 2ZXVA 4CGOA 3I3GA 4I49A 5AG5A 3CXQA 4MJ8A 3W6XA 5A28A 4PV6A 4U5YA 1Q2DA 1RXTA 4IUSA 2Q44A 2K5TA 3G3SA 4KVXA 3GYAA 3PGPA 5EBVA 4CAWA 1M1DA 3R9EA 4LUAA 1CM0A 2FS5A 3TOAA 2B4BA 1NMTA 3EFAA 4MHDA 3IU1A 2BUEA 4K30A 3VWEA 2O28A 1Z4EA 4AG7A 3T90A 3SHPA 1IYKA 3V8IA 5AG4A 4A30A 4AVAA 4RS2A 2FCKA 2B3UA 4C2XA 3KKWA 4CYPA 1YGHA 4A31A 4C7HA 4H6ZA 5C82A 3D2PA 4KOTA 4C7IA 5JQ4A 3ZJ0A 3TO7A 2ZW7A 3QAHA 2NMTA 4CYNA 1GHEA 2YNCA 1Q2CA 4MY0A 3BLNA 2PRBA 4B13A 2JDCA 2QMLA 3ZZIA 3S6KA 5KTDA 3TCVA 2HQYA 4JXQA 2Z3PA 2F5IA 1YR0A 2PDOA 3EO4A 4E8OA 3VWDA 4AVCA 1J4JA 4R3LA 1BO4A 4AB7A 2R1IA 3JVNA 2CNMA 4MFPA 2P0WA 4QBJA 3S6HA 4KORA 5J8FA 2EVNA 4HNYB 4CGPA 3CXPA 4GS4A 1V0CA 4JWPA 3PZJA 4II9A 5A27A 1Y9KA 3F8KA 3LD2A 2B3VA 2R98A 2WPWA 3DDDA 5IV0A 1N71A 1OZPA 4KSFA 1IB1E 2A4NA 4ONUA 3UY5A 1P4NA 2WPXA 1MJBA 2Q4YA 2D4OA 2G3AA 4UCMA 5HH1A 2Q0YA 2CNSA 4JJXA 1IIDA 4C2YA 2Z3KA 5F49A 5BWAB 1ZO0A 1RO5A 4CAFA 1MJAA 1FY7A 4QB9A 2OZUA 4CAEA 2RC4A 3E0KA 4MFZA 4NF1A 1Q2YA 4CYOA 3F0AA 1L0CA 3T9YA 3D8PA 2Z3MA 4A95A 2BEIA 3SXNA 5G22A 2REFA 3FIXA 4CAVA 4QC6A 3P2HA 1XEBA 4MI4A 2G3TA 2VI7A 5JPHA 4R9MA 2DXQA 3TO9A 4XPDB 2R8VA 1WWZA 5AGEA 3TTHA 4B5PA 4XPDC 2B5GA 5F48A 2Z3LA 1R57A 3BJ7A 3DR6A 4KOVA 2OH1A 2B4DA 2CY2A 1LRZA 2ZW4A 2QECA 4C2ZA 2GANA 4UA3A 3R1KA 5DWMA 4PK3A 3IWEA 3A9LA 3R95A 1YREA 5G20A 3LODA 1I1DA 4NCZA 2YNCC 4X5KA 4B12A 1CJWA 4UFVA 3EY5A 4R3KA 4U9ZA 1S7NA 1PU9A 5J8CA 4KOYA 2FIAA 4B5OA 1YVKA 2X7BA 2VEZA 2Y0MA 4RI1A 4UFXA 2HUZA 3D3SA 3FRMA 4XNHC 3R9FA 1YLEA 4AG9A 2WSAA 4CGLA 5C88A 2PR8A 2Z0ZA 4U9YA 4MY3A 5F46A 4A2ZA 1KUYA 5AG7A 2Z3NA 4CGMA 1I12A 3H5ZA 5IB0A 3WR7A 1XF8A 2Z3OA 2AE6A 5AG6A 4NSQA 1S60A 4MFLA 4IF5A 4QVTA 1QSOA 2H5MA 4PK2A 5CNPA 3PP9A 4EVYA 4XPLA 2JLMA 1Z9UA 2PQ8A 3NE7A 3IWGA 2C27A 1PUAA 4E0AA 4OADA 2DPSA 4A32A 2REEA 2BSWA 2DPTA 1IICA 1SQHA 4Y49B 4JLYA 2P6EA 4KLWA 4YGOA 4Y49C 3JTKA 1S7FA 1YK3A 2Q04A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4B10 A;  3IU2 A;  4UFW A;  4UCP A;  4UFX A;  4B13 A;  4BBH A;  4C2Z A;  4CGO A;  5AG4 A;  4CYO A;  5AG5 A;  4B11 A;  2WSA A;  5G21 A;  4A30 A;  4A95 A;  4CGP A;  5G1Z A;  4CGL A;  5A28 A;  3IWE A;  4UCM A;  4C2X A;  4A32 A;  4C68 A;  4CGN A;  4CYQ A;  5G22 A;  4CYP A;  4A31 A;  4C7H A;  5G20 A;  5A27 A;  4A2Z A;  5AG7 A;  4UCN A;  2YND A;  2YNC C;  4C2Y A;  4CGM A;  3H5Z A;  4B12 A;  4UFV A;  3JTK A;  4C7I A;  2YNE A;  4CAF A;  2WUU A;  5AG6 A;  4CYN A;  3IU1 A;  5AGE A;  4A33 A;  2YNC A;  4B14 A;  4CAE A; 
#chains in the Genus database with same CATH topology
 4M85 A;  2IMO A;  1QSR A;  4LX9 A;  3FED A;  3SI1 A;  5FVJ A;  4OID A;  2PJB A;  1A2Z A;  1QST A;  1R3N A;  3SI0 A;  4FD5 A;  2IL4 A;  1M44 A;  2OZH A;  3BJ8 A;  4AVB A;  3FVL A;  1DE4 C;  3B8G A;  4IAV A;  4QUS A;  4R87 A;  4AXV A;  4DNC A;  1ZG7 A;  2GLF A;  2FE7 A;  2P6G A;  3FYN A;  5K8P A;  5LYD A;  4OC4 A;  1Y9W A;  2Q7S A;  4H6U A;  4ZY2 A;  3TO6 A;  1WK4 A;  4KOX A;  4NGT A;  3K9T A;  4KVO E;  2Q4V A;  5IB9 A;  3TOB A;  1XE4 A;  4FBE A;  1UWY A;  4F6A A;  3IEH A;  4KOU A;  2QIR A;  2WUU A;  1K4J A;  2FVG A;  3G8W A;  1Y7R A;  2HC9 A;  2JEV A;  2CTB A;  2FL4 A;  2R7H A;  3KI9 A;  3NFZ A;  4J3G A;  1ELM P;  3C26 A;  4XPK A;  1S3Z A;  3GIU A;  4W9Y A;  2KCW A;  1LFW A;  4MFK A;  4TWE A;  4A37 A;  3F5B A;  1GYT A;  1VKC A;  5K8M A;  5LYF A;  5KTC A;  4NEX A;  4MCS A;  5G21 A;  1RTQ A;  3R96 A;  3S6F A;  4L89 A;  4CGN A;  4ORF A;  1YX0 A;  2OZG A;  4C68 A;  1M4D A;  3W6S A;  2OB0 A;  1X10 A;  1XIX A;  2FSR A;  3JUW A;  2FIW A;  3FB3 A;  1MK4 A;  2ZOG A;  2QYV A;  4P4E A;  3WC6 A;  4B5P B;  4R76 A;  5ISV A;  2B5G B;  4JD6 A;  4PSX A;  2GIV A;  3N7Z A;  2YGW A;  5D29 A;  3FNC A;  4ZY1 A;  2PJ5 A;  3TX8 A;  2YNE A;  4WJB A;  1TF8 A;  2VBQ A;  4M6I A;  4WWV A;  4UBR A;  3P2F A;  3WT4 A;  3BXM A;  4P4J A;  3PB7 X;  5DWN A;  4P10 A;  1ELL P;  4R57 A;  4UEZ A;  4MFJ A;  3OWC A;  1PYT B;  3CXS A;  1IOF A;  1XRY A;  4MCP A;  2Q7B A;  2POK A;  3GY9 A;  1BOB A;  2EWB A;  4M6G A;  2PIY A;  1QSN A;  1TIQ A;  2I00 A;  2VXK A;  4HPS A;  3S9M A;  2OR4 A;  4ZY0 A;  4M3S A;  3FJU A;  4FD6 A;  2I79 A;  4EWT A;  1LAM A;  1MJ9 A;  2CIJ A;  2ZEE A;  4A38 A;  4CRZ B;  4UEF A;  1U6M A;  2G9D A;  2J8N A;  4UCN A;  3DR8 A;  5EMI A;  5LRG A;  1AMP A;  2PJ0 A;  4NGR A;  4PXD A;  4OLL A;  4KUB A;  2PRQ A;  3TT2 A;  4ZYQ A;  4F0Y A;  4KOS A;  2JDD A;  4FD7 A;  3H4Q A;  2D4P A;  2B58 A;  4L8A A;  2VZY A;  4YU9 A;  3KHZ A;  4OAE A;  3TE4 A;  4YFJ A;  4B10 A;  2DF5 A;  5CPA A;  1KUV A;  3RBU A;  3B7I A;  4M6H A;  4JZ0 A;  4BD9 A;  2ZW5 A;  4XNH B;  1XMB A;  5F09 A;  1VIX A;  3IGR A;  4HKF A;  5H84 A;  1IY7 A;  4EME A;  4GXH A;  1KUX A;  1YVO A;  2ATR A;  4P4D A;  1XOV A;  1S5K A;  3FH4 A;  1KZF A;  1XMT A;  4KUA A;  1Z8L A;  1NE9 A;  1M4I A;  2VZZ A;  3GUX A;  4NGN A;  2YND A;  3ISZ A;  5ELY A;  2J8M A;  1ARL A;  1IYL A;  3B3V A;  4OP4 A;  2V8V A;  2PR1 A;  5H86 A;  3RYO A;  4E2A A;  2C1C A;  5KTA A;  2V77 A;  3DSB A;  2Z10 A;  2I3C A;  4ONW A;  4PXE A;  3RAM A;  2GFQ A;  1Z4R A;  4UEE A;  2C6P A;  3W91 A;  3QAY A;  2BL1 A;  2PJ9 A;  4P44 A;  4F0X A;  3TC8 A;  3N5F A;  1XJO A;  4UFW A;  4UCP A;  5THW A;  3KAS A;  4B11 A;  4NGM A;  2NYQ A;  5G1Z A;  5I4M A;  1ON0 A;  2QVP A;  3FXT A;  1M4L A;  3SJF A;  2FT0 A;  3S9L A;  3B3S A;  1UFH A;  2XEJ A;  2IQ6 A;  2ZW6 A;  4JYW A;  4KS9 A;  4Q38 A;  4KOW A;  4PSW A;  4ZBG A;  1S7L A;  3FBU A;  3K9U A;  5EC4 A;  2G0B A;  4DUK A;  4UWJ A;  4NXY A;  2CNT A;  2CXA A;  5JM6 A;  1S7K A;  5LYL A;  3EC4 A;  4MHY A;  4CRY B;  4OKO A;  3V7Z A;  2HV2 A;  1LOK A;  3MRU A;  3VAT A;  4Q36 A;  2FXF A;  2PJC A;  2JEW A;  5D8N A;  3GB0 A;  3I9S A;  5J1Q A;  4JXR A;  4UWI A;  2EUI A;  1I21 A;  4MBU A;  3GKR A;  3H8E A;  1B87 A;  4H89 A;  2PJ2 A;  5F47 A;  4BBH A;  4YRH A;  8CPA A;  5E96 A;  4MRI A;  4OC2 A;  3H8G A;  2ARH A;  3PB6 X;  4KLV A;  2PSW A;  4UIB A;  4CYQ A;  1QQ9 A;  3D7F A;  2AJ6 A;  2PE3 A;  4P4I A;  3NE8 A;  4CAX A;  2JBJ A;  2ZPA A;  1X12 A;  3QB8 A;  4H2K A;  4OC3 A;  1TKJ A;  3SXO A;  4PXC A;  5HMN A;  5I0C A;  4DJL A;  1NSL A;  1BPM A;  2ZEM A;  2AFS A;  4A33 A;  4B14 A;  3R9G A;  4MFQ A;  3CZX A;  4BMH A;  2ZEH A;  1VHO A;  2O4H A;  4KSA A;  2J8R A;  2CTC A;  3IU2 A;  1Z8X A;  2JBK A;  1M4G A;  4HNW B;  3MN8 A;  4G1P A;  2GE3 A;  2BOA A;  3WC5 A;  1VHS A;  3CDX A;  4KZT A;  1QSM A;  1B6B A;  3SJG A;  4B6Z A;  4P4F A;  2PJ7 A;  4CS0 B;  4HNX B;  4FD4 A;  3EXN A;  3D68 A;  4KVM E;  5IX3 A;  3TFY A;  3PB4 X;  1Y0Y A;  3DNS A;  4X8I A;  3S6G A;  2J9A A;  3KHX A;  3MGD A;  4ZGY B;  2B4D B;  3D2M A;  3D67 A;  3D7D A;  3FMC A;  2PC1 A;  4UF4 A;  5JGF A;  1LAN A;  2ZEG A;  1LAP A;  1P0H A;  2EBJ A;  2WYR A;  2P6F A;  2ZED A;  3B35 A;  2VQY A;  5GCN A;  2Z11 A;  5LRJ A;  3PBE A;  2OU2 A;  2ZXV A;  2AFM A;  4PPZ A;  4CGO A;  1CG2 A;  3I3G A;  4I49 A;  5AG5 A;  3CXQ A;  4MJ8 A;  3W6X A;  5A28 A;  1YW6 A;  3B3T A;  4PV6 A;  4U5Y A;  1Q2D A;  1RXT A;  4IUS A;  4PXB A;  2C6G A;  2Q44 A;  2K5T A;  3G3S A;  4KVX A;  4MCR A;  5HVG A;  3GYA A;  3PGP A;  3RO0 A;  3JRU A;  5EBV A;  4CAW A;  1M1D A;  3S9N A;  3R9E A;  4LUA A;  1CM0 A;  2FS5 A;  1ZG9 A;  2PCU A;  2RB7 A;  4MMO A;  4PQA A;  3IWW A;  2PJA A;  7CPA A;  3TOA A;  1XFO A;  2B4B A;  1NMT A;  3EFA A;  4MHD A;  3RNZ A;  3IU1 A;  3BHX A;  1QMU A;  2AFO A;  2ZEL A;  2BUE A;  4K30 A;  4MHZ A;  4GM5 A;  2ZEO A;  2CF4 A;  2O28 A;  3VWE A;  1Z4E A;  3HLP A;  2AFZ A;  4AG7 A;  4OME A;  3SHP A;  1IYK A;  3T90 A;  3V8I A;  5AG4 A;  4A30 A;  4AVA A;  4R8F A;  4RS2 A;  1BLL E;  2FCK A;  2B3U A;  3PFO A;  4C2X A;  3KKW A;  3NH4 A;  1CP7 A;  2EK9 A;  2F7V A;  1YGH A;  3L2N A;  4A31 A;  4C7H A;  4CYP A;  2XEI A;  4H6Z A;  5C82 A;  3D2P A;  4IHM A;  2ZEF A;  1TKF A;  1AYE A;  4KOT A;  3I1U A;  3SI2 A;  5K8O A;  2Q51 A;  4C7I A;  5JQ4 A;  3ZJ0 A;  4R6T A;  2ZW7 A;  3TO7 A;  3PB9 X;  3QAH A;  2NMT A;  4FAI A;  1JWQ A;  4NGP A;  4CYN A;  3KQX A;  4A94 A;  1GHE A;  2YNC A;  1CX8 A;  1Q2C A;  4MY0 A;  2QJ8 A;  3BLN A;  2PJ1 A;  2PRB A;  4B13 A;  5JH9 A;  2JDC A;  1ZG8 A;  2QML A;  3ZZI A;  2WZN A;  3S6K A;  5KTD A;  3TCV A;  2HQY A;  4RUH A;  2V8H A;  4JXQ A;  4OC1 A;  3WAB A;  2Z3P A;  2F5I A;  1YR0 A;  2PDO A;  2AFW A;  1YLO A;  3BI0 A;  2ANP A;  3KR5 A;  3FF3 A;  4NJR A;  2DEA A;  2ZEP A;  3EO4 A;  1Z8W A;  3LAC A;  3QNV A;  3VWD A;  4E8O A;  4O23 A;  3DLJ A;  4AVC A;  1BAV A;  1J4J A;  2PJ6 A;  2PVW A;  4R3L A;  3K2K A;  1Y0R A;  3IIB A;  4TNU A;  1BO4 A;  1YW4 A;  4AB7 A;  2HB6 A;  2R1I A;  3JVN A;  1CPS A;  2CNM A;  5LYI A;  1XBU A;  4MFP A;  2P0W A;  4QBJ A;  3LMS A;  4KOR A;  3S6H A;  5J8F A;  2EVN A;  3ISX A;  4HNY B;  4CGP A;  3CXP A;  4GS4 A;  4MHP A;  1V0C A;  4JWP A;  1TKH A;  3PZJ A;  4X2T A;  4II9 A;  5A27 A;  1OBR A;  3FX6 A;  2O53 A;  3CT9 A;  1EE3 P;  1Y9K A;  3KGQ A;  3F8K A;  3PFE A;  3V38 A;  4UIA A;  3LD2 A;  4P45 A;  2B3V A;  2IJZ A;  3IJ3 A;  1AUG A;  2R98 A;  2WPW A;  1NSA A;  3DDD A;  5IV0 A;  2VL1 A;  1F2O A;  2V8G A;  1ZLH A;  1Z2L A;  1N71 A;  1OZP A;  4KSF A;  2EO8 A;  1IB1 E;  4OC5 A;  4IK2 A;  4ZX9 A;  1VGY A;  2A4N A;  4ONU A;  3UY5 A;  1P4N A;  1Q7L A;  2WPX A;  1MJB A;  2Q4Y A;  4MXU A;  3IO1 A;  4P4B A;  2PJ4 A;  2D4O A;  4BIN A;  2G3A A;  4UCM A;  5HH1 A;  4DYO A;  2Q0Y A;  3NH5 A;  2F8H A;  4P6Y A;  2CNS A;  4JJX A;  1FNO A;  1F2P A;  1IID A;  3SJE A;  1YQE A;  4C2Y A;  1LCP A;  2GRE A;  3WC7 A;  2Z3K A;  4ZI6 A;  3D7G A;  5F49 A;  5BWA B;  4NGQ A;  1DTD A;  1ZO0 A;  1RO5 A;  4CAF A;  1MJA A;  3RZA A;  1FY7 A;  2Q43 A;  1HDU A;  1TXR A;  4FUU A;  4QB9 A;  2OZU A;  4CAE A;  2RC4 A;  4ZX8 A;  3B3C A;  1IU8 A;  3E0K A;  4MFZ A;  2EK8 A;  4NF1 A;  2RFH A;  3DGV A;  1Q2Y A;  1Z5R A;  3F0A A;  1L0C A;  3T9Y A;  4CYO A;  3D8P A;  2Z3M A;  4A95 A;  4MHN A;  2BEI A;  3LWU A;  3SXN A;  5DS0 A;  2OOT A;  4MCQ A;  4R7M A;  5G22 A;  2REF A;  3FIX A;  4CAV A;  2PIZ A;  4QC6 A;  3P2H A;  1XEB A;  2PJ8 A;  1HEE A;  4MI4 A;  2G3T A;  4KSI A;  4AG9 A;  2VI7 A;  3KL9 A;  5JPH A;  4R9M A;  2DXQ A;  3B3W A;  1VHE A;  3NA6 A;  4XPD B;  2R8V A;  1WWZ A;  3TO9 A;  5AGE A;  3TTH A;  4F9V A;  4B5P A;  4XPD C;  2B5G A;  2ODF A;  5F48 A;  2Z3L A;  1ARM A;  1R57 A;  3BJ7 A;  3DR6 A;  2NSM A;  5HVF A;  3FEC A;  4KOV A;  2OH1 A;  2B4D A;  2CY2 A;  1LRZ A;  2V8D A;  2QEC A;  2ZW4 A;  3KZW A;  2GAN A;  4C2Z A;  1TF9 A;  5HVH A;  4UA3 A;  3H8F A;  3KR4 A;  3R1K A;  4LQ6 A;  5DWM A;  4YWY A;  4PK3 A;  3IWE A;  3A9L A;  1JQG A;  1KWM A;  1YRE A;  3PEI A;  3R95 A;  5G20 A;  1CP6 A;  3LOD A;  1I1D A;  4NCZ A;  4NFR A;  2YNC C;  4X5K A;  1FT7 A;  5K8N A;  3PRT A;  4B12 A;  1CJW A;  4UFV A;  1R43 A;  3EY5 A;  4Q7A A;  4R3K A;  2AFU A;  4U9Z A;  6CPA A;  1BPN A;  1S7N A;  1PU9 A;  3VAR A;  1YME A;  4F8Z A;  1YSJ A;  5J8C A;  3BI1 A;  4KOY A;  2FIA A;  3IFE A;  4B5O A;  4F9U A;  4K3N A;  5LRK A;  1YVK A;  2X7B A;  2VEZ A;  3D7H A;  4Z65 A;  2Y0M A;  4RI1 A;  2GLJ A;  2HUZ A;  3D3S A;  3FRM A;  4UFX A;  2PVV A;  1YLE A;  3FEE A;  4XNH C;  3R9F A;  2WSA A;  4CGL A;  5C88 A;  2PR8 A;  2Z0Z A;  4U9Y A;  4NJQ A;  2ZOF A;  3IC1 A;  3GLJ A;  1Z8T A;  4FWU A;  4MY3 A;  1ZLI A;  3SJX A;  4EFD A;  3KQZ A;  3VH9 A;  5F46 A;  4CPA A;  4A2Z A;  1KUY A;  5AG7 A;  1Y7E A;  1H8L A;  2GU2 A;  2Z3N A;  1F57 A;  4CGM A;  1I12 A;  3H5Z A;  5IB0 A;  3WR7 A;  3CPX A;  1XF8 A;  2Z3O A;  2AE6 A;  5AG6 A;  4NSQ A;  1S60 A;  2AFX A;  4LQG A;  4MFL A;  4IF5 A;  1IGB A;  5HXD A;  4QVT A;  1QSO A;  2H5M A;  4OC0 A;  4PK2 A;  5CNP A;  4A39 A;  2Q4Z A;  3PP9 A;  2XEF A;  4EVY A;  1HDQ A;  4XPL A;  2JLM A;  1Z9U A;  2PQ8 A;  3NE7 A;  3IWG A;  3PBB A;  2C27 A;  1PUA A;  2C6C A;  4NGS A;  4E0A A;  4OAD A;  2DPS A;  4A32 A;  1PCA A;  2REE A;  4OIW A;  2BSW A;  2DPT A;  3HUV A;  3T8W A;  3B2Y A;  1IOI A;  1IIC A;  2BO9 A;  4RN7 A;  1SQH A;  4Y49 B;  4JLY A;  2ZEN A;  2P6E A;  3NH8 A;  2ABZ A;  4KLW A;  4YGO A;  4Y49 C;  3JTK A;  2XEG A;  5CBM A;  1S7F A;  3D4U A;  3CPA A;  3D66 A;  4X3R A;  2PJ3 A;  1CBX A;  1CPX A;  1YK3 A;  2Q04 A;  2BCO A;  3PB8 X; 
#chains in the Genus database with same CATH homology
 4M85 A;  1QSR A;  4LX9 A;  5FVJ A;  1QST A;  4FD5 A;  2IL4 A;  1M44 A;  2OZH A;  3BJ8 A;  4AVB A;  4DNC A;  3B8G A;  4R87 A;  4QUS A;  2FE7 A;  2P6G A;  3FYN A;  1Y9W A;  4H6U A;  3TO6 A;  1WK4 A;  4KOX A;  4KVO E;  2Q4V A;  3TOB A;  1XE4 A;  4F6A A;  4KOU A;  2QIR A;  2WUU A;  1K4J A;  3G8W A;  1Y7R A;  2JEV A;  2R7H A;  2FL4 A;  4J3G A;  3C26 A;  4XPK A;  1S3Z A;  2KCW A;  4MFK A;  3F5B A;  1VKC A;  5KTC A;  4NEX A;  5G21 A;  3R96 A;  3S6F A;  4L89 A;  4CGN A;  4ORF A;  1YX0 A;  2OZG A;  4C68 A;  1M4D A;  3W6S A;  2OB0 A;  1XIX A;  2FSR A;  3JUW A;  2FIW A;  3FB3 A;  1MK4 A;  4B5P B;  5ISV A;  2B5G B;  4JD6 A;  4PSX A;  2GIV A;  3N7Z A;  2YGW A;  3FNC A;  2YNE A;  2VBQ A;  4UBR A;  3P2F A;  5DWN A;  4R57 A;  4MFJ A;  3OWC A;  3CXS A;  2Q7B A;  3GY9 A;  1BOB A;  1QSN A;  1TIQ A;  2I00 A;  2VXK A;  4M3S A;  4FD6 A;  2I79 A;  1MJ9 A;  4CRZ B;  1U6M A;  2J8N A;  4UCN A;  3DR8 A;  4OLL A;  4KUB A;  3TT2 A;  4F0Y A;  4KOS A;  2JDD A;  4FD7 A;  3H4Q A;  2D4P A;  2B58 A;  4L8A A;  2VZY A;  4OAE A;  3TE4 A;  4YFJ A;  4B10 A;  1KUV A;  2ZW5 A;  4XNH B;  3IGR A;  4HKF A;  5H84 A;  1KUX A;  1YVO A;  2ATR A;  1S5K A;  1KZF A;  1XMT A;  4KUA A;  1NE9 A;  1M4I A;  2VZZ A;  2YND A;  2J8M A;  1IYL A;  5H86 A;  2PR1 A;  3RYO A;  4E2A A;  5KTA A;  3DSB A;  2Z10 A;  1Z4R A;  3W91 A;  2BL1 A;  4F0X A;  4UFW A;  4UCP A;  4B11 A;  5G1Z A;  1ON0 A;  3FXT A;  2FT0 A;  1UFH A;  2ZW6 A;  4KS9 A;  4Q38 A;  4KOW A;  4PSW A;  4ZBG A;  1S7L A;  3FBU A;  3K9U A;  5EC4 A;  2G0B A;  4UWJ A;  4NXY A;  2CNT A;  2CXA A;  1S7K A;  3EC4 A;  4CRY B;  2HV2 A;  4Q36 A;  2FXF A;  3I9S A;  4JXR A;  4UWI A;  2EUI A;  1I21 A;  4MBU A;  3GKR A;  1B87 A;  4H89 A;  5F47 A;  4BBH A;  4YRH A;  5E96 A;  2ARH A;  4KLV A;  2PSW A;  4CYQ A;  2AJ6 A;  4CAX A;  2ZPA A;  3QB8 A;  3SXO A;  5HMN A;  5I0C A;  1NSL A;  4A33 A;  4B14 A;  4BMH A;  3R9G A;  4MFQ A;  4KSA A;  2J8R A;  3IU2 A;  1M4G A;  4HNW B;  2GE3 A;  1VHS A;  4KZT A;  1QSM A;  1B6B A;  4CS0 B;  4HNX B;  4FD4 A;  3EXN A;  4KVM E;  5IX3 A;  3TFY A;  3DNS A;  3S6G A;  3MGD A;  4ZGY B;  2B4D B;  3D2M A;  2PC1 A;  1P0H A;  2P6F A;  2VQY A;  5GCN A;  2Z11 A;  2OU2 A;  2ZXV A;  4CGO A;  3I3G A;  4I49 A;  5AG5 A;  3CXQ A;  4MJ8 A;  3W6X A;  5A28 A;  4PV6 A;  4U5Y A;  1Q2D A;  1RXT A;  4IUS A;  2Q44 A;  2K5T A;  3G3S A;  4KVX A;  3GYA A;  3PGP A;  5EBV A;  4CAW A;  1M1D A;  3R9E A;  4LUA A;  1CM0 A;  2FS5 A;  3TOA A;  2B4B A;  1NMT A;  3EFA A;  4MHD A;  3IU1 A;  2BUE A;  4K30 A;  3VWE A;  2O28 A;  1Z4E A;  4AG7 A;  3T90 A;  3SHP A;  1IYK A;  3V8I A;  5AG4 A;  4A30 A;  4AVA A;  4RS2 A;  2FCK A;  2B3U A;  4C2X A;  3KKW A;  4CYP A;  1YGH A;  4A31 A;  4C7H A;  4H6Z A;  5C82 A;  3D2P A;  4KOT A;  4C7I A;  5JQ4 A;  3ZJ0 A;  3TO7 A;  2ZW7 A;  3QAH A;  2NMT A;  4CYN A;  1GHE A;  2YNC A;  1Q2C A;  4MY0 A;  3BLN A;  2PRB A;  4B13 A;  2JDC A;  2QML A;  3ZZI A;  3S6K A;  5KTD A;  3TCV A;  2HQY A;  4JXQ A;  2Z3P A;  2F5I A;  1YR0 A;  2PDO A;  3EO4 A;  4E8O A;  3VWD A;  4AVC A;  1J4J A;  4R3L A;  1BO4 A;  4AB7 A;  2R1I A;  3JVN A;  2CNM A;  4MFP A;  2P0W A;  4QBJ A;  3S6H A;  4KOR A;  5J8F A;  2EVN A;  4HNY B;  4CGP A;  3CXP A;  4GS4 A;  1V0C A;  4JWP A;  3PZJ A;  4II9 A;  5A27 A;  1Y9K A;  3F8K A;  3LD2 A;  2B3V A;  2R98 A;  2WPW A;  3DDD A;  5IV0 A;  1N71 A;  1OZP A;  4KSF A;  1IB1 E;  2A4N A;  4ONU A;  3UY5 A;  1P4N A;  2WPX A;  1MJB A;  2Q4Y A;  2D4O A;  2G3A A;  4UCM A;  5HH1 A;  2Q0Y A;  2CNS A;  4JJX A;  1IID A;  4C2Y A;  2Z3K A;  5F49 A;  5BWA B;  1ZO0 A;  1RO5 A;  4CAF A;  1MJA A;  1FY7 A;  4QB9 A;  2OZU A;  4CAE A;  2RC4 A;  3E0K A;  4MFZ A;  4NF1 A;  1Q2Y A;  4CYO A;  3F0A A;  1L0C A;  3T9Y A;  3D8P A;  2Z3M A;  4A95 A;  2BEI A;  3SXN A;  5G22 A;  2REF A;  3FIX A;  4CAV A;  4QC6 A;  3P2H A;  1XEB A;  4MI4 A;  2G3T A;  2VI7 A;  5JPH A;  4R9M A;  2DXQ A;  3TO9 A;  4XPD B;  2R8V A;  1WWZ A;  5AGE A;  3TTH A;  4B5P A;  4XPD C;  2B5G A;  5F48 A;  2Z3L A;  1R57 A;  3BJ7 A;  3DR6 A;  4KOV A;  2OH1 A;  2B4D A;  2CY2 A;  1LRZ A;  2ZW4 A;  2QEC A;  4C2Z A;  2GAN A;  4UA3 A;  3R1K A;  5DWM A;  4PK3 A;  3IWE A;  3A9L A;  3R95 A;  1YRE A;  5G20 A;  3LOD A;  1I1D A;  4NCZ A;  2YNC C;  4X5K A;  4B12 A;  1CJW A;  4UFV A;  3EY5 A;  4R3K A;  4U9Z A;  1S7N A;  1PU9 A;  5J8C A;  4KOY A;  2FIA A;  4B5O A;  1YVK A;  2X7B A;  2VEZ A;  2Y0M A;  4RI1 A;  4UFX A;  2HUZ A;  3D3S A;  3FRM A;  4XNH C;  3R9F A;  1YLE A;  4AG9 A;  2WSA A;  4CGL A;  5C88 A;  2PR8 A;  2Z0Z A;  4U9Y A;  4MY3 A;  5F46 A;  4A2Z A;  1KUY A;  5AG7 A;  2Z3N A;  4CGM A;  1I12 A;  3H5Z A;  5IB0 A;  3WR7 A;  1XF8 A;  2Z3O A;  2AE6 A;  5AG6 A;  4NSQ A;  1S60 A;  4MFL A;  4IF5 A;  4QVT A;  1QSO A;  2H5M A;  4PK2 A;  5CNP A;  3PP9 A;  4EVY A;  4XPL A;  2JLM A;  1Z9U A;  2PQ8 A;  3NE7 A;  3IWG A;  2C27 A;  1PUA A;  4E0A A;  4OAD A;  2DPS A;  4A32 A;  2REE A;  2BSW A;  2DPT A;  1IIC A;  1SQH A;  4Y49 B;  4JLY A;  2P6E A;  4KLW A;  4YGO A;  4Y49 C;  3JTK A;  1S7F A;  1YK3 A;  2Q04 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...