5G21A

Leishmania major n-myristoyltransferase in complex with a quinoline inhibitor (compound 26).
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
411
structure length
410
Chain Sequence
AHAFWSTQPVPQTEDETEKIVFAGPMDEPKTVADIPEEPYPIASTFEWWTPNMEAADDIHAIYELLRDNYVEDDDSMFRFNYSEEFLQWALCPPNYIPDWHVAVRRKADKKLLAFIAGVPVTLRMGTPKYMKVKAQEKGEGEEAAKYDEPRHICEINFLCVHKQLREKRLAPILIKEATRRVNRTNVWQAVYTAGVLLPTPYASGQYFHRSLNPEKLVEIRFSGIPAQYQKFQNPMAMLKRNYQLPSAPKNSGLREMKPSDVPQVRRILNYLDSFDVGPVFSDAEISHYLLPRDGVVFTYVVENDKKVTDFFSFYRIPSTVIGNSNYNLLNAAYVHYYAATSIPLHQLILDLLIVAHSRGFDVCNMVEILDNRSFVEQLKFGAGDGHLRYYFYNWAYPKIKPSQVALVML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLYCYLPEPTIDE N-TETRADECANOYLTRANSFERASE
publication title Structure-guided optimization of quinoline inhibitors of Plasmodium N-myristoyltransferase.
pubmed doi rcsb
source organism Leishmania major
molecule tags Transferase
total genus 126
structure length 410
sequence length 411
ec nomenclature ec 2.3.1.97: Glycylpeptide N-tetradecanoyltransferase.
pdb deposition date 2016-04-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01233 NMT Myristoyl-CoA:protein N-myristoyltransferase, N-terminal domain
A PF02799 NMT_C Myristoyl-CoA:protein N-myristoyltransferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.170 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 5g21A00
2YNCA 5G1ZA 2YNDA 5AG5A 2WSAA 5A28A 4C7IA 5A27A 5AGEA 4CGMA 2WUUA 4A95A 4B14A 4A31A 3JTKA 4UFWA 4CGOA 4A33A 4B10A 4CAFA 5AG7A 4C2YA 4CGLA 4CYQA 4UCPA 4CAEA 5G22A 4BBHA 4CYOA 3IWEA 4UFXA 4B13A 5AG6A 4B11A 4CYNA 4CYPA 4A32A 5AG4A 3IU2A 3H5ZA 4B12A 4A2ZA 4CGNA 4C68A 4UCMA 5G20A 5G21A 2YNEA 4C2XA 4A30A 4UCNA 4CGPA 3IU1A 4C7HA 2YNCC 4C2ZA 4UFVA
chains in the Genus database with same CATH superfamily
2YNCA 4MY0A 4M85A 5G1ZA 4E0AA 4M3SA 3S9MA 4KVME 2VZZA 3GYAA 5CBMA 3CDXA 3TOAA 2FIWA 3JTKA 3WC6A 4II9A 3V38A 2B58A 2CF4A 3MN8A 1R43A 5IB9A 1PCAA 2DF5A 2J8RA 3A9LA 4UCPA 2X7BA 4EMEA 1I1DA 4CYOA 2FE7A 4UFXA 3DLJA 3VATA 1Q7LA 3ISXA 2PC1A 4U9ZA 4OC5A 3G8WA 3N5FA 1TKFA 2Z3MA 4OP4A 1NSAA 2Q51A 1X12A 3TC8A 2EVNA 3BI0A 3WR7A 2G9DA 3D7HA 3S6GA 2PIYA 2PRQA 4DYOA 4MFQA 1Z8WA 4EWTA 6CPAA 4B5PA 2IL4A 2PE3A 3VH9A 3BJ8A 4H2KA 4QC6A 2GU2A 3SI0A 2FXFA 2BSWA 3IIBA 2P6EA 4O23A 3K9TA 4PXCA 2XEGA 4FD4A 4A33A 4K30A 4R87A 4MHZA 4ZGYB 1NMTA 3BLNA 3B8GA 5LRKA 3T8WA 1CPSA 2JEVA 4LQ6A 3FH4A 3NFZA 4A38A 2D4OA 5HMNA 4MXUA 4UCMA 3TO7A 2AFXA 4P4DA 2HC9A 4KSIA 4PK3A 4UWIA 2WPXA 2AJ6A 2GIVA 4R8FA 3RBUA 1VGYA 3IU1A 3KKWA 3PB7X 4C7HA 2F8HA 4JWPA 1YVOA 2DPTA 5A28A 4KSFA 2ZEDA 3JRUA 3PB8X 5K8MA 3PP9A 5F46A 2EUIA 2Q7SA 4NGNA 5JGFA 5KTAA 4HNYB 2GLFA 4CAVA 4RI1A 1BPNA 3DSBA 1MK4A 1VHSA 3QAYA 4P45A 2ZEGA 1DE4C 2AFZA 2V8GA 3KGQA 5EMIA 3TTHA 1XFOA 3ZZIA 5THWA 3GY9A 1LFWA 1TKJA 1R3NA 4YU9A 4ONUA 3IU2A 2G3AA 4MHNA 3D68A 4ORFA 2FCKA 4KOTA 3CXPA 3N7ZA 5G20A 2XEFA 5G21A 2ZELA 4XNHB 1BPMA 4P4BA 2PRBA 2ZENA 3B35A 4Q38A 3WC7A 2Q4YA 2I79A 1SQHA 2EK8A 2PJ0A 3GB0A 3KI9A 3FECA 5IB0A 3H8EA 2B3UA 2BEIA 2VI7A 4NGRA 3SI1A 3NH5A 3S9NA 3FBUA 4X8IA 2OU2A 2ARHA 4UFWA 2C1CA 1YSJA 1YLEA 1S60A 1S3ZA 4IUSA 2C27A 4XPLA 5AG7A 3TO9A 4QB9A 3SXNA 1GHEA 4TNUA 3EO4A 3UY5A 2JBJA 4BBHA 2EBJA 1Y0RA 4R3KA 4DNCA 3KR4A 4KOWA 4FBEA 1YW6A 1XRYA 5JM6A 4KOSA 4FAIA 3H8FA 2G0BA 1XOVA 4A39A 2ZEEA 2IQ6A 4NGQA 2VBQA 1ZG7A 3IJ3A 2RB7A 4JZ0A 1NE9A 3NE8A 1UFHA 2FSRA 2V8VA 3SJFA 2HQYA 3WABA 4J3GA 5KTDA 3I9SA 2DXQA 1XE4A 4UEEA 1ZG8A 4MFPA 4OIDA 1PYTB 2ATRA 5A27A 1K4JA 2OH1A 2WUUA 5J8FA 3IWGA 1YVKA 3TT2A 2Z3KA 4R6TA 5GCNA 1LCPA 3DGVA 3PZJA 4JXRA 4MCPA 2QMLA 1FT7A 4NJQA 3D2PA 1F2PA 4G1PA 4OAEA 5IX3A 4PPZA 3TO6A 1IOIA 2GLJA 3P2HA 5J1QA 4A2ZA 1S7FA 3NE7A 3TE4A 3FRMA 3CXSA 4RS2A 4LUAA 2PSWA 2Q4ZA 1Y7EA 2ABZA 4UEFA 2J9AA 5HVFA 1ZG9A 2JBKA 2O4HA 5F09A 4GS4A 4MFJA 3ZJ0A 1N71A 1YK3A 5F48A 3RNZA 4Y49B 3D7DA 4AXVA 4DUKA 2R8VA 2ANPA 2AFUA 5K8OA 4UIAA 2HUZA 4JJXA 2KCWA 3H8GA 3L2NA 1UWYA 4A95A 5CNPA 4U9YA 1KUYA 2ZEPA 3GUXA 3S6KA 2PJ7A 1Y9KA 2OR4A 2RC4A 2C6PA 3WT4A 1TIQA 2REFA 1CM0A 1XEBA 5LRJA 4CAEA 2Z10A 1Y9WA 4NXYA 5H86A 3K9UA 4AVBA 5EBVA 3PB4X 3TFYA 4CYNA 1NSLA 1XIXA 2ZEFA 1Z4EA 5FVJA 4WWVA 4KZTA 4MFZA 4UWJA 1XMBA 3PRTA 4KOXA 1S5KA 1S7NA 2QIRA 2R98A 3R96A 5C88A 3FB3A 2DPSA 1IU8A 1XF8A 4R3LA 4MI4A 2EO8A 3IWWA 4NCZA 4R57A 1S7LA 2YNDA 3FIXA 5F49A 4BMHA 2HB6A 2B4DA 5H84A 2Q44A 1LAPA 3I1UA 1M4LA 4F6AA 5C82A 1FNOA 1IB1E 1U6MA 4RN7A 4AVAA 5HVGA 3B3WA 3LMSA 4B10A 2DEAA 1P0HA 2WPWA 1TXRA 4MFLA 1WWZA 2Z3NA 3R9FA 3D2MA 4KLWA 3D7FA 4HNWB 3MRUA 1J4JA 2PJAA 3FF3A 4MFKA 4QUSA 2CNSA 1CJWA 4PXDA 4ZBGA 5ELYA 5E96A 2FIAA 2Z11A 4MHYA 3FEEA 4K3NA 3RO0A 3FVLA 3PB9X 2ZOFA 4MY3A 5HXDA 1TF9A 3HUVA 5LYLA 4KUBA 1KUXA 4OKOA 3TOBA 4YFJA 2F7VA 4E8OA 1QSOA 2OOTA 4P4EA 1CBXA 1ELMP 2Y0MA 3HLPA 2ZW5A 3GIUA 1TF8A 4IAVA 2PR8A 3D67A 5G22A 4KORA 3IWEA 4CAWA 3T9YA 4KSAA 1M4GA 4MCQA 4QBJA 3DDDA 4EVYA 1HDQA 1ARMA 1Q2CA 1ZLHA 2OZUA 4ZYQA 1KUVA 2CTCA 2OZHA 1MJBA 3PB6X 1Q2DA 2P6GA 4XPDB 1PU9A 3CT9A 2ZW6A 3ISZA 1Q2YA 4CGPA 2AFWA 4NJRA 4AG7A 3SJXA 1QSMA 1LANA 4OC0A 5J8CA 1IGBA 5HVHA 3BXMA 3D66A 5AG5A 5K8PA 2PR1A 3B3VA 2VZYA 3CXQA 5JH9A 3FNCA 4W9YA 3B7IA 1AUGA 3V7ZA 2EWBA 1Z8TA 3FEDA 2Q7BA 3S9LA 2B4BA 2REEA 2PJ5A 3SXOA 1Z4RA 1I21A 4R9MA 1TKHA 2OB0A 2BL1A 3D7GA 4B11A 4CYPA 4ZY1A 5DWMA 3LD2A 3FJUA 4CGNA 1Z8XA 2FS5A 1JWQA 1WK4A 2OZGA 3VWDA 3KHXA 2K5TA 4UEZA 1R57A 1VKCA 3JUWA 1QMUA 3V8IA 2AFMA 1ON0A 2PJ2A 3JVNA 2B5GB 4UF4A 3KR5A 4MHDA 3BHXA 4KUAA 2V77A 3R9GA 1IY7A 3W6XA 4F0YA 3DNSA 3H4QA 4LQGA 4NEXA 4X3RA 3RYOA 2B3VA 1Y7RA 1FY7A 3C26A 3D4UA 4CGOA 2ODFA 4XNHC 1CP6A 4CGLA 1HEEA 1YLOA 2F5IA 4CYQA 3BI1A 4AG9A 4I49A 3CPAA 2PJCA 1B6BA 5DS0A 3GKRA 4E2AA 3DR8A 5IV0A 3S6FA 1Y0YA 2Q4VA 4UA3A 4LX9A 3EXNA 4R76A 4OC4A 1RXTA 3CPXA 4KLVA 1M4IA 1YGHA 3OWCA 5JQ4A 2PJ8A 1ELLP 3G3SA 1RTQA 3I3GA 1P4NA 3KL9A 3R1KA 5CPAA 5F47A 2P6FA 1I12A 1YW4A 3LACA 4P4JA 4UIBA 2C6GA 2D4PA 3KQXA 4P10A 4BD9A 4C7IA 3FX6A 3FYNA 3SJGA 1M44A 2AFSA 2YGWA 2BOAA 3PFEA 2Q43A 2GE3A 2Q04A 2XEJA 1DTDA 2NYQA 4ONWA 4B5PB 1ZLIA 3LODA 5AG6A 4EFDA 2J8MA 2ZXVA 2PIZA 3PEIA 4NSQA 1BLLE 3MGDA 2GREA 2PJ1A 5LYFA 1IIDA 2I3CA 4AVCA 4JXQA 4L8AA 2V8HA 2O53A 5D29A 3EFAA 4YWYA 4OADA 4Q36A 4MCRA 2ZOGA 4C2ZA 2FL4A 4NGPA 2PCUA 4MRIA 4QVTA 4KS9A 1ZO0A 3EC4A 2PJ9A 2ZEOA 4CGMA 3VARA 1VHEA 1H8LA 1YREA 3D3SA 5LRGA 4A94A 3IGRA 2BO9A 3BJ7A 1RO5A 3QNVA 4FWUA 2VXKA 2Z3OA 2CIJA 2PJBA 2POKA 4FD7A 1XJOA 4ZI6A 2HV2A 4FUUA 4KOVA 4ZX9A 4DJLA 4P6YA 4OC1A 1AMPA 2FVGA 4U5YA 3NA6A 2ZEHA 4HKFA 4KOYA 2QYVA 3H5ZA 4Y49C 1KZFA 3QAHA 4R7MA 4IHMA 1PUAA 2PVVA 7CPAA 3E0KA 4HNXB 1CX8A 4M6GA 2R7HA 4H6ZA 1S7KA 4CRYB 4FD6A 4P4FA 4B6ZA 2QJ8A 3GLJA 4YRHA 2CNMA 2GFQA 1Z9UA 4B5OA 3DR6A 1QSTA 8CPAA 2XEIA 3P2FA 5DWNA 5JPHA 1L0CA 1M1DA 1IICA 4JD6A 4CAFA 4NGMA 3SI2A 2PVWA 1CP7A 3PBEA 4JYWA 3R95A 4C2YA 2H5MA 5I4MA 1Z8LA 4H89A 3KASA 2IMOA 4NFRA 1Z2LA 2WZNA 4IK2A 4B13A 2ZPAA 2A4NA 3IFEA 5AG4A 3IC1A 1V0CA 3KHZA 2CTBA 4UBRA 4C68A 4P44A 4PV6A 4OC2A 1OBRA 2EK9A 2YNEA 2CY2A 1QSRA 4KVOE 4X5KA 3CZXA 2Z3PA 3B3CA 2VQYA 3F0AA 3SJEA 4A30A 3EY5A 5ISVA 4OIWA 3B3TA 3RAMA 2Z3LA 1X10A 4KVXA 4ZX8A 3PFOA 5LYDA 5HH1A 1LRZA 1Z5RA 2ZEMA 4ZY0A 3PBBA 4A31A 4OC3A 4M6HA 4AB7A 2RFHA 3TCVA 2PDOA 5BWAB 2JEWA 5EC4A 4PK2A 4F9UA 3VWEA 5KTCA 4IF5A 2V8DA 3PGPA 2AE6A 1EE3P 4A32A 1IYKA 1HDUA 4B12A 1ARLA 3NH4A 2VL1A 1CPXA 1KWMA 3IO1A 2BCOA 4MJ8A 1YMEA 4KOUA 4F0XA 2PJ4A 4CS0B 3QB8A 2G3TA 1B87A 3LWUA 1JQGA 4UCNA 3T90A 4UFVA 3R9EA 1IYLA 2JDCA 4MHPA 3S6HA 4CAXA 4TWEA 2CXAA 1MJAA 4L89A 1LOKA 2WSAA 3KZWA 4PSWA 5LYIA 5AGEA 4NF1A 4OMEA 1MJ9A 3F5BA 1XBUA 1AYEA 1OZPA 2PQ8A 5I0CA 5K8NA 1BOBA 1GYTA 4XPDC 4MCSA 4F9VA 1CG2A 3B3SA 4CRZB 5D8NA 3SHPA 2NSMA 2Z0ZA 2ZW7A 4NGTA 4YGOA 2FT0A 2QVPA 1F57A 3F8KA 4ZY2A 2AFOA 2IJZA 4FD5A 2Q0YA 3KQZA 4HPSA 4PQAA 2CNTA 1QQ9A 2I00A 3K2KA 2VEZA 1M4DA 4WJBA 3W91A 2C6CA 4P4IA 4RUHA 4M6IA 1YX0A 4GM5A 1QSNA 1XMTA 2PJ3A 4NGSA 4X2TA 1A2ZA 4CPAA 4PSXA 1VHOA 4B14A 4Q7AA 1BO4A 3D8PA 4XPKA 3WC5A 4Z65A 2WYRA 2JLMA 4F8ZA 1LAMA 2QECA 4PXEA 3B2YA 2NMTA 2B4DB 2GANA 3FMCA 2O28A 3IEHA 2B5GA 2J8NA 4GXHA 2P0WA 4MMOA 4JLYA 4A37A 1BAVA 1F2OA 2PJ6A 1YR0A 1YQEA 2ZW4A 3RZAA 4MBUA 3FXTA 2JDDA 4H6UA 3NH8A 2R1IA 1IOFA 4OLLA 4PXBA 4BINA 4C2XA 3W6SA 2BUEA 2YNCC 1VIXA 3TX8A
chains in the Genus database with same CATH topology
2YNCA 4MY0A 4M85A 5G1ZA 4E0AA 4M3SA 4KVME 2VZZA 3GYAA 3TOAA 2FIWA 3JTKA 4II9A 2B58A 3A9LA 4UCPA 2J8RA 2X7BA 1I1DA 4CYOA 2FE7A 4UFXA 2PC1A 4U9ZA 3G8WA 2Z3MA 2EVNA 3WR7A 3S6GA 4MFQA 4B5PA 2IL4A 3BJ8A 4QC6A 2FXFA 2BSWA 2P6EA 4FD4A 4A33A 4K30A 4R87A 4ZGYB 1NMTA 3BLNA 3B8GA 2JEVA 2D4OA 5HMNA 3TO7A 4UCMA 4UWIA 4PK3A 2WPXA 2AJ6A 2GIVA 3IU1A 3KKWA 4C7HA 4JWPA 1YVOA 2DPTA 5A28A 4KSFA 3PP9A 5F46A 2EUIA 5KTAA 4HNYB 4CAVA 4RI1A 3DSBA 1MK4A 1VHSA 3TTHA 3ZZIA 3GY9A 4ONUA 3IU2A 2G3AA 4ORFA 2FCKA 4KOTA 3CXPA 3N7ZA 5G20A 5G21A 4XNHB 2PRBA 4Q38A 2Q4YA 2I79A 1SQHA 5IB0A 2B3UA 2BEIA 2VI7A 3FBUA 2OU2A 2ARHA 4UFWA 1YLEA 1S60A 1S3ZA 4IUSA 2C27A 4XPLA 5AG7A 3TO9A 4QB9A 3SXNA 1GHEA 3EO4A 3UY5A 4BBHA 4R3KA 4DNCA 4KOWA 4KOSA 2G0BA 2VBQA 1NE9A 1UFHA 2FSRA 2HQYA 4J3GA 5KTDA 3I9SA 2DXQA 1XE4A 5A27A 4MFPA 2ATRA 1K4JA 2OH1A 2WUUA 5J8FA 3IWGA 1YVKA 3TT2A 2Z3KA 5GCNA 4JXRA 3PZJA 2QMLA 3D2PA 5IX3A 4OAEA 3TO6A 3P2HA 4A2ZA 1S7FA 3NE7A 3TE4A 3FRMA 3CXSA 4RS2A 4LUAA 2PSWA 4GS4A 4MFJA 3ZJ0A 1N71A 1YK3A 5F48A 4Y49B 2R8VA 2HUZA 4JJXA 2KCWA 4A95A 5CNPA 4U9YA 1KUYA 3S6KA 1Y9KA 2RC4A 1TIQA 2REFA 1CM0A 1XEBA 4CAEA 2Z10A 1Y9WA 4NXYA 5H86A 3K9UA 4AVBA 5EBVA 4CYNA 1NSLA 1XIXA 5FVJA 1Z4EA 4KZTA 4MFZA 4UWJA 4KOXA 1S5KA 1S7NA 2QIRA 2R98A 3R96A 5C88A 3FB3A 2DPSA 1XF8A 4R3LA 4MI4A 4NCZA 4R57A 1S7LA 2YNDA 3FIXA 5F49A 4BMHA 2B4DA 5H84A 2Q44A 4F6AA 5C82A 3TFYA 1IB1E 1U6MA 4AVAA 4B10A 1P0HA 2WPWA 4MFLA 1WWZA 2Z3NA 3R9FA 3D2MA 4KLWA 4HNWB 1J4JA 4MFKA 4QUSA 2CNSA 1CJWA 4ZBGA 5E96A 2FIAA 2Z11A 4MY3A 4KUBA 1KUXA 3TOBA 4YFJA 4E8OA 1QSOA 2Y0MA 2ZW5A 2PR8A 5G22A 4KORA 3IWEA 4CAWA 3T9YA 4KSAA 1M4GA 4QBJA 3DDDA 4EVYA 1Q2CA 2OZUA 1KUVA 2OZHA 1MJBA 1Q2DA 2P6GA 4XPDB 1PU9A 2ZW6A 1Q2YA 4CGPA 4AG7A 1QSMA 5J8CA 5AG5A 2PR1A 2VZYA 3CXQA 3FNCA 2Q7BA 2B4BA 2REEA 3SXOA 1Z4RA 1I21A 4R9MA 2OB0A 2BL1A 4B11A 4CYPA 5DWMA 3LD2A 4CGNA 2FS5A 2OZGA 1WK4A 3VWDA 2K5TA 1R57A 1VKCA 3JUWA 3V8IA 1ON0A 3JVNA 2B5GB 4MHDA 3R9GA 4KUAA 3W6XA 4F0YA 3DNSA 3H4QA 4NEXA 3RYOA 2B3VA 1Y7RA 1FY7A 3C26A 4CGOA 4XNHC 4CGLA 2F5IA 4CYQA 4AG9A 4I49A 1B6BA 3GKRA 4E2AA 3DR8A 5IV0A 3S6FA 2Q4VA 4UA3A 4LX9A 3EXNA 1RXTA 4KLVA 1M4IA 1YGHA 3OWCA 5JQ4A 3G3SA 3I3GA 3R1KA 1P4NA 5F47A 2P6FA 1I12A 4C7IA 2D4PA 3FYNA 1M44A 2YGWA 2GE3A 2Q04A 4B5PB 3LODA 5AG6A 2J8MA 2ZXVA 4NSQA 3MGDA 1IIDA 4AVCA 4JXQA 4L8AA 3EFAA 4OADA 4Q36A 4C2ZA 2FL4A 4QVTA 4KS9A 1ZO0A 3EC4A 4CGMA 1YREA 3D3SA 3IGRA 3BJ7A 1RO5A 2VXKA 2Z3OA 4FD7A 2HV2A 4KOVA 4U5YA 4HKFA 4KOYA 3H5ZA 4Y49C 1KZFA 3QAHA 1PUAA 3E0KA 4HNXB 2R7HA 4H6ZA 1S7KA 4CRYB 4FD6A 4YRHA 2CNMA 1Z9UA 4B5OA 3DR6A 1QSTA 5JPHA 3P2FA 5DWNA 1L0CA 1M1DA 1IICA 4JD6A 4CAFA 3R95A 4C2YA 2H5MA 4H89A 4B13A 2ZPAA 2A4NA 5AG4A 1V0CA 4UBRA 4C68A 4PV6A 2YNEA 2CY2A 1QSRA 4KVOE 4X5KA 2Z3PA 2VQYA 3F0AA 4A30A 3EY5A 5ISVA 2Z3LA 4KVXA 5HH1A 1LRZA 4A31A 4AB7A 3TCVA 2PDOA 5BWAB 5EC4A 4PK2A 3VWEA 5KTCA 4IF5A 3PGPA 2AE6A 4A32A 1IYKA 4B12A 4MJ8A 4KOUA 4F0XA 4CS0B 3QB8A 2G3TA 1B87A 4UCNA 3T90A 4UFVA 3R9EA 1IYLA 2JDCA 3S6HA 4CAXA 2CXAA 1MJAA 4L89A 4PSWA 2WSAA 5AGEA 4NF1A 1MJ9A 3F5BA 1OZPA 2PQ8A 5I0CA 1BOBA 4XPDC 4CRZB 3SHPA 2Z0ZA 2ZW7A 4YGOA 2FT0A 3F8KA 4FD5A 2Q0YA 2CNTA 2I00A 2VEZA 1M4DA 3W91A 1YX0A 1QSNA 1XMTA 4PSXA 4B14A 1BO4A 3D8PA 4XPKA 2JLMA 2QECA 2NMTA 2B4DB 2GANA 2O28A 2B5GA 2J8NA 2P0WA 4JLYA 2ZW4A 1YR0A 4MBUA 3FXTA 2JDDA 4H6UA 2R1IA 4OLLA 4C2XA 3W6SA 2BUEA 2YNCC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YNC A;  5G1Z A;  2YND A;  5AG5 A;  2WSA A;  5A28 A;  4C7I A;  5A27 A;  5AGE A;  4CGM A;  2WUU A;  4A95 A;  4B14 A;  4A31 A;  3JTK A;  4UFW A;  4CGO A;  4A33 A;  4B10 A;  4CAF A;  5AG7 A;  4C2Y A;  4CGL A;  4CYQ A;  4UCP A;  4CAE A;  5G22 A;  4BBH A;  4CYO A;  3IWE A;  4UFX A;  4B13 A;  5AG6 A;  4B11 A;  4CYN A;  4CYP A;  4A32 A;  5AG4 A;  3IU2 A;  3H5Z A;  4B12 A;  4A2Z A;  4CGN A;  4C68 A;  4UCM A;  5G20 A;  5G21 A;  2YNE A;  4C2X A;  4A30 A;  4UCN A;  4CGP A;  3IU1 A;  4C7H A;  2YNC C;  4C2Z A;  4UFV A; 
#chains in the Genus database with same CATH topology
 2YNC A;  4MY0 A;  4M85 A;  5G1Z A;  4E0A A;  4M3S A;  3S9M A;  4KVM E;  2VZZ A;  3GYA A;  5CBM A;  3CDX A;  3TOA A;  2FIW A;  3JTK A;  3WC6 A;  4II9 A;  3V38 A;  2B58 A;  2CF4 A;  3MN8 A;  1R43 A;  5IB9 A;  1PCA A;  2DF5 A;  2J8R A;  3A9L A;  4UCP A;  2X7B A;  4EME A;  1I1D A;  4CYO A;  2FE7 A;  4UFX A;  3DLJ A;  3VAT A;  1Q7L A;  3ISX A;  2PC1 A;  4U9Z A;  4OC5 A;  3G8W A;  3N5F A;  1TKF A;  2Z3M A;  4OP4 A;  1NSA A;  2Q51 A;  1X12 A;  3TC8 A;  2EVN A;  3BI0 A;  3WR7 A;  2G9D A;  3D7H A;  3S6G A;  2PIY A;  2PRQ A;  4DYO A;  4MFQ A;  1Z8W A;  4EWT A;  6CPA A;  4B5P A;  2IL4 A;  2PE3 A;  3VH9 A;  3BJ8 A;  4H2K A;  4QC6 A;  2GU2 A;  3SI0 A;  2FXF A;  2BSW A;  3IIB A;  2P6E A;  4O23 A;  3K9T A;  4PXC A;  2XEG A;  4FD4 A;  4A33 A;  4K30 A;  4R87 A;  4MHZ A;  4ZGY B;  1NMT A;  3BLN A;  3B8G A;  5LRK A;  3T8W A;  1CPS A;  2JEV A;  4LQ6 A;  3FH4 A;  3NFZ A;  4A38 A;  2D4O A;  5HMN A;  4MXU A;  4UCM A;  3TO7 A;  2AFX A;  4P4D A;  2HC9 A;  4KSI A;  4PK3 A;  4UWI A;  2WPX A;  2AJ6 A;  2GIV A;  4R8F A;  3RBU A;  1VGY A;  3IU1 A;  3KKW A;  3PB7 X;  4C7H A;  2F8H A;  4JWP A;  1YVO A;  2DPT A;  5A28 A;  4KSF A;  2ZED A;  3JRU A;  3PB8 X;  5K8M A;  3PP9 A;  5F46 A;  2EUI A;  2Q7S A;  4NGN A;  5JGF A;  5KTA A;  4HNY B;  2GLF A;  4CAV A;  4RI1 A;  1BPN A;  3DSB A;  1MK4 A;  1VHS A;  3QAY A;  4P45 A;  2ZEG A;  1DE4 C;  2AFZ A;  2V8G A;  3KGQ A;  5EMI A;  3TTH A;  1XFO A;  3ZZI A;  5THW A;  3GY9 A;  1LFW A;  1TKJ A;  1R3N A;  4YU9 A;  4ONU A;  3IU2 A;  2G3A A;  4MHN A;  3D68 A;  4ORF A;  2FCK A;  4KOT A;  3CXP A;  3N7Z A;  5G20 A;  2XEF A;  5G21 A;  2ZEL A;  4XNH B;  1BPM A;  4P4B A;  2PRB A;  2ZEN A;  3B35 A;  4Q38 A;  3WC7 A;  2Q4Y A;  2I79 A;  1SQH A;  2EK8 A;  2PJ0 A;  3GB0 A;  3KI9 A;  3FEC A;  5IB0 A;  3H8E A;  2B3U A;  2BEI A;  2VI7 A;  4NGR A;  3SI1 A;  3NH5 A;  3S9N A;  3FBU A;  4X8I A;  2OU2 A;  2ARH A;  4UFW A;  2C1C A;  1YSJ A;  1YLE A;  1S60 A;  1S3Z A;  4IUS A;  2C27 A;  4XPL A;  5AG7 A;  3TO9 A;  4QB9 A;  3SXN A;  1GHE A;  4TNU A;  3EO4 A;  3UY5 A;  2JBJ A;  4BBH A;  2EBJ A;  1Y0R A;  4R3K A;  4DNC A;  3KR4 A;  4KOW A;  4FBE A;  1YW6 A;  1XRY A;  5JM6 A;  4KOS A;  4FAI A;  3H8F A;  2G0B A;  1XOV A;  4A39 A;  2ZEE A;  2IQ6 A;  4NGQ A;  2VBQ A;  1ZG7 A;  3IJ3 A;  2RB7 A;  4JZ0 A;  1NE9 A;  3NE8 A;  1UFH A;  2FSR A;  2V8V A;  3SJF A;  2HQY A;  3WAB A;  4J3G A;  5KTD A;  3I9S A;  2DXQ A;  1XE4 A;  4UEE A;  1ZG8 A;  4MFP A;  4OID A;  1PYT B;  2ATR A;  5A27 A;  1K4J A;  2OH1 A;  2WUU A;  5J8F A;  3IWG A;  1YVK A;  3TT2 A;  2Z3K A;  4R6T A;  5GCN A;  1LCP A;  3DGV A;  3PZJ A;  4JXR A;  4MCP A;  2QML A;  1FT7 A;  4NJQ A;  3D2P A;  1F2P A;  4G1P A;  4OAE A;  5IX3 A;  4PPZ A;  3TO6 A;  1IOI A;  2GLJ A;  3P2H A;  5J1Q A;  4A2Z A;  1S7F A;  3NE7 A;  3TE4 A;  3FRM A;  3CXS A;  4RS2 A;  4LUA A;  2PSW A;  2Q4Z A;  1Y7E A;  2ABZ A;  4UEF A;  2J9A A;  5HVF A;  1ZG9 A;  2JBK A;  2O4H A;  5F09 A;  4GS4 A;  4MFJ A;  3ZJ0 A;  1N71 A;  1YK3 A;  5F48 A;  3RNZ A;  4Y49 B;  3D7D A;  4AXV A;  4DUK A;  2R8V A;  2ANP A;  2AFU A;  5K8O A;  4UIA A;  2HUZ A;  4JJX A;  2KCW A;  3H8G A;  3L2N A;  1UWY A;  4A95 A;  5CNP A;  4U9Y A;  1KUY A;  2ZEP A;  3GUX A;  3S6K A;  2PJ7 A;  1Y9K A;  2OR4 A;  2RC4 A;  2C6P A;  3WT4 A;  1TIQ A;  2REF A;  1CM0 A;  1XEB A;  5LRJ A;  4CAE A;  2Z10 A;  1Y9W A;  4NXY A;  5H86 A;  3K9U A;  4AVB A;  5EBV A;  3PB4 X;  3TFY A;  4CYN A;  1NSL A;  1XIX A;  2ZEF A;  1Z4E A;  5FVJ A;  4WWV A;  4KZT A;  4MFZ A;  4UWJ A;  1XMB A;  3PRT A;  4KOX A;  1S5K A;  1S7N A;  2QIR A;  2R98 A;  3R96 A;  5C88 A;  3FB3 A;  2DPS A;  1IU8 A;  1XF8 A;  4R3L A;  4MI4 A;  2EO8 A;  3IWW A;  4NCZ A;  4R57 A;  1S7L A;  2YND A;  3FIX A;  5F49 A;  4BMH A;  2HB6 A;  2B4D A;  5H84 A;  2Q44 A;  1LAP A;  3I1U A;  1M4L A;  4F6A A;  5C82 A;  1FNO A;  1IB1 E;  1U6M A;  4RN7 A;  4AVA A;  5HVG A;  3B3W A;  3LMS A;  4B10 A;  2DEA A;  1P0H A;  2WPW A;  1TXR A;  4MFL A;  1WWZ A;  2Z3N A;  3R9F A;  3D2M A;  4KLW A;  3D7F A;  4HNW B;  3MRU A;  1J4J A;  2PJA A;  3FF3 A;  4MFK A;  4QUS A;  2CNS A;  1CJW A;  4PXD A;  4ZBG A;  5ELY A;  5E96 A;  2FIA A;  2Z11 A;  4MHY A;  3FEE A;  4K3N A;  3RO0 A;  3FVL A;  3PB9 X;  2ZOF A;  4MY3 A;  5HXD A;  1TF9 A;  3HUV A;  5LYL A;  4KUB A;  1KUX A;  4OKO A;  3TOB A;  4YFJ A;  2F7V A;  4E8O A;  1QSO A;  2OOT A;  4P4E A;  1CBX A;  1ELM P;  2Y0M A;  3HLP A;  2ZW5 A;  3GIU A;  1TF8 A;  4IAV A;  2PR8 A;  3D67 A;  5G22 A;  4KOR A;  3IWE A;  4CAW A;  3T9Y A;  4KSA A;  1M4G A;  4MCQ A;  4QBJ A;  3DDD A;  4EVY A;  1HDQ A;  1ARM A;  1Q2C A;  1ZLH A;  2OZU A;  4ZYQ A;  1KUV A;  2CTC A;  2OZH A;  1MJB A;  3PB6 X;  1Q2D A;  2P6G A;  4XPD B;  1PU9 A;  3CT9 A;  2ZW6 A;  3ISZ A;  1Q2Y A;  4CGP A;  2AFW A;  4NJR A;  4AG7 A;  3SJX A;  1QSM A;  1LAN A;  4OC0 A;  5J8C A;  1IGB A;  5HVH A;  3BXM A;  3D66 A;  5AG5 A;  5K8P A;  2PR1 A;  3B3V A;  2VZY A;  3CXQ A;  5JH9 A;  3FNC A;  4W9Y A;  3B7I A;  1AUG A;  3V7Z A;  2EWB A;  1Z8T A;  3FED A;  2Q7B A;  3S9L A;  2B4B A;  2REE A;  2PJ5 A;  3SXO A;  1Z4R A;  1I21 A;  4R9M A;  1TKH A;  2OB0 A;  2BL1 A;  3D7G A;  4B11 A;  4CYP A;  4ZY1 A;  5DWM A;  3LD2 A;  3FJU A;  4CGN A;  1Z8X A;  2FS5 A;  1JWQ A;  1WK4 A;  2OZG A;  3VWD A;  3KHX A;  2K5T A;  4UEZ A;  1R57 A;  1VKC A;  3JUW A;  1QMU A;  3V8I A;  2AFM A;  1ON0 A;  2PJ2 A;  3JVN A;  2B5G B;  4UF4 A;  3KR5 A;  4MHD A;  3BHX A;  4KUA A;  2V77 A;  3R9G A;  1IY7 A;  3W6X A;  4F0Y A;  3DNS A;  3H4Q A;  4LQG A;  4NEX A;  4X3R A;  3RYO A;  2B3V A;  1Y7R A;  1FY7 A;  3C26 A;  3D4U A;  4CGO A;  2ODF A;  4XNH C;  1CP6 A;  4CGL A;  1HEE A;  1YLO A;  2F5I A;  4CYQ A;  3BI1 A;  4AG9 A;  4I49 A;  3CPA A;  2PJC A;  1B6B A;  5DS0 A;  3GKR A;  4E2A A;  3DR8 A;  5IV0 A;  3S6F A;  1Y0Y A;  2Q4V A;  4UA3 A;  4LX9 A;  3EXN A;  4R76 A;  4OC4 A;  1RXT A;  3CPX A;  4KLV A;  1M4I A;  1YGH A;  3OWC A;  5JQ4 A;  2PJ8 A;  1ELL P;  3G3S A;  1RTQ A;  3I3G A;  1P4N A;  3KL9 A;  3R1K A;  5CPA A;  5F47 A;  2P6F A;  1I12 A;  1YW4 A;  3LAC A;  4P4J A;  4UIB A;  2C6G A;  2D4P A;  3KQX A;  4P10 A;  4BD9 A;  4C7I A;  3FX6 A;  3FYN A;  3SJG A;  1M44 A;  2AFS A;  2YGW A;  2BOA A;  3PFE A;  2Q43 A;  2GE3 A;  2Q04 A;  2XEJ A;  1DTD A;  2NYQ A;  4ONW A;  4B5P B;  1ZLI A;  3LOD A;  5AG6 A;  4EFD A;  2J8M A;  2ZXV A;  2PIZ A;  3PEI A;  4NSQ A;  1BLL E;  3MGD A;  2GRE A;  2PJ1 A;  5LYF A;  1IID A;  2I3C A;  4AVC A;  4JXQ A;  4L8A A;  2V8H A;  2O53 A;  5D29 A;  3EFA A;  4YWY A;  4OAD A;  4Q36 A;  4MCR A;  2ZOG A;  4C2Z A;  2FL4 A;  4NGP A;  2PCU A;  4MRI A;  4QVT A;  4KS9 A;  1ZO0 A;  3EC4 A;  2PJ9 A;  2ZEO A;  4CGM A;  3VAR A;  1VHE A;  1H8L A;  1YRE A;  3D3S A;  5LRG A;  4A94 A;  3IGR A;  2BO9 A;  3BJ7 A;  1RO5 A;  3QNV A;  4FWU A;  2VXK A;  2Z3O A;  2CIJ A;  2PJB A;  2POK A;  4FD7 A;  1XJO A;  4ZI6 A;  2HV2 A;  4FUU A;  4KOV A;  4ZX9 A;  4DJL A;  4P6Y A;  4OC1 A;  1AMP A;  2FVG A;  4U5Y A;  3NA6 A;  2ZEH A;  4HKF A;  4KOY A;  2QYV A;  3H5Z A;  4Y49 C;  1KZF A;  3QAH A;  4R7M A;  4IHM A;  1PUA A;  2PVV A;  7CPA A;  3E0K A;  4HNX B;  1CX8 A;  4M6G A;  2R7H A;  4H6Z A;  1S7K A;  4CRY B;  4FD6 A;  4P4F A;  4B6Z A;  2QJ8 A;  3GLJ A;  4YRH A;  2CNM A;  2GFQ A;  1Z9U A;  4B5O A;  3DR6 A;  1QST A;  8CPA A;  2XEI A;  3P2F A;  5DWN A;  5JPH A;  1L0C A;  1M1D A;  1IIC A;  4JD6 A;  4CAF A;  4NGM A;  3SI2 A;  2PVW A;  1CP7 A;  3PBE A;  4JYW A;  3R95 A;  4C2Y A;  2H5M A;  5I4M A;  1Z8L A;  4H89 A;  3KAS A;  2IMO A;  4NFR A;  1Z2L A;  2WZN A;  4IK2 A;  4B13 A;  2ZPA A;  2A4N A;  3IFE A;  5AG4 A;  3IC1 A;  1V0C A;  3KHZ A;  2CTB A;  4UBR A;  4C68 A;  4P44 A;  4PV6 A;  4OC2 A;  1OBR A;  2EK9 A;  2YNE A;  2CY2 A;  1QSR A;  4KVO E;  4X5K A;  3CZX A;  2Z3P A;  3B3C A;  2VQY A;  3F0A A;  3SJE A;  4A30 A;  3EY5 A;  5ISV A;  4OIW A;  3B3T A;  3RAM A;  2Z3L A;  1X10 A;  4KVX A;  4ZX8 A;  3PFO A;  5LYD A;  5HH1 A;  1LRZ A;  1Z5R A;  2ZEM A;  4ZY0 A;  3PBB A;  4A31 A;  4OC3 A;  4M6H A;  4AB7 A;  2RFH A;  3TCV A;  2PDO A;  5BWA B;  2JEW A;  5EC4 A;  4PK2 A;  4F9U A;  3VWE A;  5KTC A;  4IF5 A;  2V8D A;  3PGP A;  2AE6 A;  1EE3 P;  4A32 A;  1IYK A;  1HDU A;  4B12 A;  1ARL A;  3NH4 A;  2VL1 A;  1CPX A;  1KWM A;  3IO1 A;  2BCO A;  4MJ8 A;  1YME A;  4KOU A;  4F0X A;  2PJ4 A;  4CS0 B;  3QB8 A;  2G3T A;  1B87 A;  3LWU A;  1JQG A;  4UCN A;  3T90 A;  4UFV A;  3R9E A;  1IYL A;  2JDC A;  4MHP A;  3S6H A;  4CAX A;  4TWE A;  2CXA A;  1MJA A;  4L89 A;  1LOK A;  2WSA A;  3KZW A;  4PSW A;  5LYI A;  5AGE A;  4NF1 A;  4OME A;  1MJ9 A;  3F5B A;  1XBU A;  1AYE A;  1OZP A;  2PQ8 A;  5I0C A;  5K8N A;  1BOB A;  1GYT A;  4XPD C;  4MCS A;  4F9V A;  1CG2 A;  3B3S A;  4CRZ B;  5D8N A;  3SHP A;  2NSM A;  2Z0Z A;  2ZW7 A;  4NGT A;  4YGO A;  2FT0 A;  2QVP A;  1F57 A;  3F8K A;  4ZY2 A;  2AFO A;  2IJZ A;  4FD5 A;  2Q0Y A;  3KQZ A;  4HPS A;  4PQA A;  2CNT A;  1QQ9 A;  2I00 A;  3K2K A;  2VEZ A;  1M4D A;  4WJB A;  3W91 A;  2C6C A;  4P4I A;  4RUH A;  4M6I A;  1YX0 A;  4GM5 A;  1QSN A;  1XMT A;  2PJ3 A;  4NGS A;  4X2T A;  1A2Z A;  4CPA A;  4PSX A;  1VHO A;  4B14 A;  4Q7A A;  1BO4 A;  3D8P A;  4XPK A;  3WC5 A;  4Z65 A;  2WYR A;  2JLM A;  4F8Z A;  1LAM A;  2QEC A;  4PXE A;  3B2Y A;  2NMT A;  2B4D B;  2GAN A;  3FMC A;  2O28 A;  3IEH A;  2B5G A;  2J8N A;  4GXH A;  2P0W A;  4MMO A;  4JLY A;  4A37 A;  1BAV A;  1F2O A;  2PJ6 A;  1YR0 A;  1YQE A;  2ZW4 A;  3RZA A;  4MBU A;  3FXT A;  2JDD A;  4H6U A;  3NH8 A;  2R1I A;  1IOF A;  4OLL A;  4PXB A;  4BIN A;  4C2X A;  3W6S A;  2BUE A;  2YNC C;  1VIX A;  3TX8 A; 
#chains in the Genus database with same CATH homology
 2YNC A;  4MY0 A;  4M85 A;  5G1Z A;  4E0A A;  4M3S A;  4KVM E;  2VZZ A;  3GYA A;  3TOA A;  2FIW A;  3JTK A;  4II9 A;  2B58 A;  3A9L A;  4UCP A;  2J8R A;  2X7B A;  1I1D A;  4CYO A;  2FE7 A;  4UFX A;  2PC1 A;  4U9Z A;  3G8W A;  2Z3M A;  2EVN A;  3WR7 A;  3S6G A;  4MFQ A;  4B5P A;  2IL4 A;  3BJ8 A;  4QC6 A;  2FXF A;  2BSW A;  2P6E A;  4FD4 A;  4A33 A;  4K30 A;  4R87 A;  4ZGY B;  1NMT A;  3BLN A;  3B8G A;  2JEV A;  2D4O A;  5HMN A;  3TO7 A;  4UCM A;  4UWI A;  4PK3 A;  2WPX A;  2AJ6 A;  2GIV A;  3IU1 A;  3KKW A;  4C7H A;  4JWP A;  1YVO A;  2DPT A;  5A28 A;  4KSF A;  3PP9 A;  5F46 A;  2EUI A;  5KTA A;  4HNY B;  4CAV A;  4RI1 A;  3DSB A;  1MK4 A;  1VHS A;  3TTH A;  3ZZI A;  3GY9 A;  4ONU A;  3IU2 A;  2G3A A;  4ORF A;  2FCK A;  4KOT A;  3CXP A;  3N7Z A;  5G20 A;  5G21 A;  4XNH B;  2PRB A;  4Q38 A;  2Q4Y A;  2I79 A;  1SQH A;  5IB0 A;  2B3U A;  2BEI A;  2VI7 A;  3FBU A;  2OU2 A;  2ARH A;  4UFW A;  1YLE A;  1S60 A;  1S3Z A;  4IUS A;  2C27 A;  4XPL A;  5AG7 A;  3TO9 A;  4QB9 A;  3SXN A;  1GHE A;  3EO4 A;  3UY5 A;  4BBH A;  4R3K A;  4DNC A;  4KOW A;  4KOS A;  2G0B A;  2VBQ A;  1NE9 A;  1UFH A;  2FSR A;  2HQY A;  4J3G A;  5KTD A;  3I9S A;  2DXQ A;  1XE4 A;  5A27 A;  4MFP A;  2ATR A;  1K4J A;  2OH1 A;  2WUU A;  5J8F A;  3IWG A;  1YVK A;  3TT2 A;  2Z3K A;  5GCN A;  4JXR A;  3PZJ A;  2QML A;  3D2P A;  5IX3 A;  4OAE A;  3TO6 A;  3P2H A;  4A2Z A;  1S7F A;  3NE7 A;  3TE4 A;  3FRM A;  3CXS A;  4RS2 A;  4LUA A;  2PSW A;  4GS4 A;  4MFJ A;  3ZJ0 A;  1N71 A;  1YK3 A;  5F48 A;  4Y49 B;  2R8V A;  2HUZ A;  4JJX A;  2KCW A;  4A95 A;  5CNP A;  4U9Y A;  1KUY A;  3S6K A;  1Y9K A;  2RC4 A;  1TIQ A;  2REF A;  1CM0 A;  1XEB A;  4CAE A;  2Z10 A;  1Y9W A;  4NXY A;  5H86 A;  3K9U A;  4AVB A;  5EBV A;  4CYN A;  1NSL A;  1XIX A;  5FVJ A;  1Z4E A;  4KZT A;  4MFZ A;  4UWJ A;  4KOX A;  1S5K A;  1S7N A;  2QIR A;  2R98 A;  3R96 A;  5C88 A;  3FB3 A;  2DPS A;  1XF8 A;  4R3L A;  4MI4 A;  4NCZ A;  4R57 A;  1S7L A;  2YND A;  3FIX A;  5F49 A;  4BMH A;  2B4D A;  5H84 A;  2Q44 A;  4F6A A;  5C82 A;  3TFY A;  1IB1 E;  1U6M A;  4AVA A;  4B10 A;  1P0H A;  2WPW A;  4MFL A;  1WWZ A;  2Z3N A;  3R9F A;  3D2M A;  4KLW A;  4HNW B;  1J4J A;  4MFK A;  4QUS A;  2CNS A;  1CJW A;  4ZBG A;  5E96 A;  2FIA A;  2Z11 A;  4MY3 A;  4KUB A;  1KUX A;  3TOB A;  4YFJ A;  4E8O A;  1QSO A;  2Y0M A;  2ZW5 A;  2PR8 A;  5G22 A;  4KOR A;  3IWE A;  4CAW A;  3T9Y A;  4KSA A;  1M4G A;  4QBJ A;  3DDD A;  4EVY A;  1Q2C A;  2OZU A;  1KUV A;  2OZH A;  1MJB A;  1Q2D A;  2P6G A;  4XPD B;  1PU9 A;  2ZW6 A;  1Q2Y A;  4CGP A;  4AG7 A;  1QSM A;  5J8C A;  5AG5 A;  2PR1 A;  2VZY A;  3CXQ A;  3FNC A;  2Q7B A;  2B4B A;  2REE A;  3SXO A;  1Z4R A;  1I21 A;  4R9M A;  2OB0 A;  2BL1 A;  4B11 A;  4CYP A;  5DWM A;  3LD2 A;  4CGN A;  2FS5 A;  2OZG A;  1WK4 A;  3VWD A;  2K5T A;  1R57 A;  1VKC A;  3JUW A;  3V8I A;  1ON0 A;  3JVN A;  2B5G B;  4MHD A;  3R9G A;  4KUA A;  3W6X A;  4F0Y A;  3DNS A;  3H4Q A;  4NEX A;  3RYO A;  2B3V A;  1Y7R A;  1FY7 A;  3C26 A;  4CGO A;  4XNH C;  4CGL A;  2F5I A;  4CYQ A;  4AG9 A;  4I49 A;  1B6B A;  3GKR A;  4E2A A;  3DR8 A;  5IV0 A;  3S6F A;  2Q4V A;  4UA3 A;  4LX9 A;  3EXN A;  1RXT A;  4KLV A;  1M4I A;  1YGH A;  3OWC A;  5JQ4 A;  3G3S A;  3I3G A;  3R1K A;  1P4N A;  5F47 A;  2P6F A;  1I12 A;  4C7I A;  2D4P A;  3FYN A;  1M44 A;  2YGW A;  2GE3 A;  2Q04 A;  4B5P B;  3LOD A;  5AG6 A;  2J8M A;  2ZXV A;  4NSQ A;  3MGD A;  1IID A;  4AVC A;  4JXQ A;  4L8A A;  3EFA A;  4OAD A;  4Q36 A;  4C2Z A;  2FL4 A;  4QVT A;  4KS9 A;  1ZO0 A;  3EC4 A;  4CGM A;  1YRE A;  3D3S A;  3IGR A;  3BJ7 A;  1RO5 A;  2VXK A;  2Z3O A;  4FD7 A;  2HV2 A;  4KOV A;  4U5Y A;  4HKF A;  4KOY A;  3H5Z A;  4Y49 C;  1KZF A;  3QAH A;  1PUA A;  3E0K A;  4HNX B;  2R7H A;  4H6Z A;  1S7K A;  4CRY B;  4FD6 A;  4YRH A;  2CNM A;  1Z9U A;  4B5O A;  3DR6 A;  1QST A;  5JPH A;  3P2F A;  5DWN A;  1L0C A;  1M1D A;  1IIC A;  4JD6 A;  4CAF A;  3R95 A;  4C2Y A;  2H5M A;  4H89 A;  4B13 A;  2ZPA A;  2A4N A;  5AG4 A;  1V0C A;  4UBR A;  4C68 A;  4PV6 A;  2YNE A;  2CY2 A;  1QSR A;  4KVO E;  4X5K A;  2Z3P A;  2VQY A;  3F0A A;  4A30 A;  3EY5 A;  5ISV A;  2Z3L A;  4KVX A;  5HH1 A;  1LRZ A;  4A31 A;  4AB7 A;  3TCV A;  2PDO A;  5BWA B;  5EC4 A;  4PK2 A;  3VWE A;  5KTC A;  4IF5 A;  3PGP A;  2AE6 A;  4A32 A;  1IYK A;  4B12 A;  4MJ8 A;  4KOU A;  4F0X A;  4CS0 B;  3QB8 A;  2G3T A;  1B87 A;  4UCN A;  3T90 A;  4UFV A;  3R9E A;  1IYL A;  2JDC A;  3S6H A;  4CAX A;  2CXA A;  1MJA A;  4L89 A;  4PSW A;  2WSA A;  5AGE A;  4NF1 A;  1MJ9 A;  3F5B A;  1OZP A;  2PQ8 A;  5I0C A;  1BOB A;  4XPD C;  4CRZ B;  3SHP A;  2Z0Z A;  2ZW7 A;  4YGO A;  2FT0 A;  3F8K A;  4FD5 A;  2Q0Y A;  2CNT A;  2I00 A;  2VEZ A;  1M4D A;  3W91 A;  1YX0 A;  1QSN A;  1XMT A;  4PSX A;  4B14 A;  1BO4 A;  3D8P A;  4XPK A;  2JLM A;  2QEC A;  2NMT A;  2B4D B;  2GAN A;  2O28 A;  2B5G A;  2J8N A;  2P0W A;  4JLY A;  2ZW4 A;  1YR0 A;  4MBU A;  3FXT A;  2JDD A;  4H6U A;  2R1I A;  4OLL A;  4C2X A;  3W6S A;  2BUE A;  2YNC C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...