4KUBA

Crystal structure of a gnat superfamily acetyltransferase pa4794 in complex with coa
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
160
structure length
160
Chain Sequence
HMQLSHRPAETGDLETVAGFPQDRDELFYCYPKAIWPFSVAQLAAAIAERRGSTVAVHDGQVLGFANFYQWQHGDFCALGNMMVAPAARGLGVARYLIGVMENLAREQYKARLMKISCFNANAAGLLLYTQLGYQPRAIAERHDPDGRRVALIQMDKPLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords GNAT superfamily acetyltransferase PA4794
publication title Structural, functional, and inhibition studies of a Gcn5-related N-acetyltransferase (GNAT) superfamily protein PA4794: a new C-terminal lysine protein acetyltransferase from pseudomonas aeruginosa.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
total genus 46
structure length 160
sequence length 160
ec nomenclature
pdb deposition date 2013-05-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4kubA00
5I0CA 1IICA 4M85A 3TO7A 4XNHC 2Z10A 2BEIA 2EVNA 2Z0ZA 4CRYB 1IB1E 4IF5A 1J4JA 2QIRA 4AVAA 1BOBA 2DXQA 4KOTA 4FD5A 1KUYA 1S7KA 4KOYA 4AG7A 4J3GA 3TOAA 2JDDA 3LD2A 1K4JA 3PP9A 4H6ZA 4NCZA 4KVOE 2B4BA 4X5KA 2NMTA 4JXQA 4MBUA 4R9MA 2FCKA 4HNWB 1XIXA 3F0AA 3K9UA 3S6HA 4NF1A 2D4OA 5E96A 3BJ8A 3CXPA 5IB0A 4KOWA 4U9YA 1S7NA 2FE7A 3EC4A 4U9ZA 4CAWA 4MHDA 4R57A 4CAVA 4PK3A 1M4GA 2Q4YA 1I1DA 2FIWA 2FSRA 2ZW6A 4KVME 2H5MA 3G3SA 4QUSA 1QSOA 2ZPAA 3GYAA 3FBUA 4ONUA 3IWGA 2VXKA 3P2FA 3LODA 1Y7RA 4KVXA 4AG9A 2ZW5A 2RC4A 2EUIA 2WPWA 4H6UA 2P6GA 3VWEA 1M4DA 1MJAA 3CXSA 1B6BA 3TFYA 2ZW4A 2KCWA 4K30A 3WR7A 2VI7A 1NMTA 4FD6A 1YREA 4E8OA 4OAEA 3UY5A 4MY3A 3GKRA 1XE4A 3TE4A 4XNHB 5H86A 3VWDA 3QAHA 5F47A 3PZJA 5C88A 5KTCA 4GS4A 1KZFA 2ZXVA 4M3SA 2B4DA 1XF8A 1MK4A 1NSLA 1YVOA 2OU2A 4JWPA 3FRMA 1WWZA 5KTAA 4FD4A 1YGHA 1MJ9A 4HNXB 1P4NA 3V8IA 3I3GA 5J8FA 2VEZA 3F5BA 1Q2CA 4B5OA 5IX3A 5JQ4A 1Z4RA 4QB9A 2G3TA 2JEVA 3R1KA 2B4DB 3H4QA 1P0HA 2J8RA 4E0AA 1R57A 2VQYA 1Q2DA 3S6KA 2PC1A 4RI1A 2REFA 4RS2A 2OZHA 3R96A 4LX9A 5FVJA 4Y49C 3D2MA 2I79A 1IYKA 2AE6A 3EXNA 4NXYA 2VZYA 4FD7A 3FYNA 3BJ7A 1IYLA 4PSWA 3R9EA 5DWNA 4LUAA 3D3SA 4HKFA 2Q04A 5KTDA 3I9SA 3EY5A 2R1IA 4YFJA 2REEA 2J8MA 5C82A 1NE9A 1I12A 5DWMA 2FT0A 3DR8A 3N7ZA 2I00A 1RXTA 5GCNA 3JVNA 1S60A 1YR0A 4KUBA 4AVCA 3NE7A 2CNSA 1OZPA 4ORFA 1QSRA 2CNMA 2HV2A 1PUAA 4EVYA 2P0WA 2C27A 3TOBA 2FL4A 1S7FA 1YK3A 3FB3A 3KKWA 3G8WA 4JJXA 1MJBA 4U5YA 4E2AA 4QBJA 1UFHA 3DDDA 3S6GA 3SXOA 2A4NA 2B3UA 4CS0B 4AB7A 4H89A 3R95A 5EBVA 2D4PA 5JPHA 4CRZB 3FNCA 3TCVA 2B3VA 3D2PA 2Q7BA 3FIXA 2WPXA 1CM0A 4NSQA 3F8KA 2P6FA 1PU9A 2G3AA 1N71A 2QMLA 4JLYA 2CNTA 4KOUA 3T90A 4DNCA 4YRHA 2Z11A 2PSWA 1IIDA 2ARHA 3TO9A 2ZW7A 1XMTA 4KORA 3RYOA 1FY7A 5IV0A 2VZZA 2FXFA 2R8VA 5HH1A 1QSMA 5F46A 1VHSA 4UWIA 2GANA 4Y49B 2OZGA 4KLVA 1S7LA 3SXNA 4R3LA 3JUWA 3FXTA 2VBQA 4UA3A 1SQHA 3SHPA 4MY0A 4L8AA 2Q4VA 4BMHA 3GY9A 2GIVA 2PR1A 1YVKA 4L89A 4UBRA 1Z4EA 2B58A 3DNSA 3P2HA 3E0KA 3R9GA 1BO4A 2HUZA 1M1DA 1ON0A 5F48A 1YX0A 2X7BA 2P6EA 5J8CA 1LRZA 2Q44A 3C26A 4XPLA 2FS5A 4XPDB 4ZBGA 4JXRA 4OADA 2OZUA 3T9YA 4MJ8A 3EFAA 1RO5A 3OWCA 4NEXA 4OLLA 3TT2A 2FIAA 1CJWA 1I21A 1XEBA 4HNYB 1V0CA 2R7HA 2Q0YA 3ZJ0A 4R3KA 1VKCA 4YGOA 4XPDC 2PDOA 2Y0MA 5EC4A 4IUSA 4KLWA 4MI4A 1QSTA 4KUAA 1TIQA 3ZZIA 3IGRA 4JD6A 4QVTA 4XPKA 2K5TA 4PSXA 3W6SA 5H84A 1GHEA 4F0YA 2IL4A 4CAXA 4F6AA 5ISVA 4B5PA 2J8NA 1YLEA 2PQ8A 1B87A 3R9FA 4II9A 1M4IA 1Y9KA 1S3ZA 1KUVA 4AVBA 2CY2A 1WK4A 2PRBA 3CXQA 4KOVA 2QECA 1Y9WA 3S6FA 4R87A 3QB8A 3DR6A 2G0BA 2GE3A 3D8PA 3DSBA 3EO4A 2JDCA 3BLNA 2R98A 3TTHA 2O28A 4B5PB 2HQYA 4PK2A 2B5GA 4QC6A 2ATRA 4KZTA 3W6XA 2BUEA 2F5IA 5F49A 1QSNA 1Q2YA 5HMNA 5CNPA 2BL1A 3MGDA 1S5KA 3B8GA 2OB0A 1Z9UA 2JLMA 4UWJA 1U6MA 3TO6A 4I49A 1KUXA 1M44A 3W91A 2OH1A 3PGPA 2AJ6A 4KOSA 2B5GB 2BSWA 1L0CA 2PR8A 4KOXA 4PV6A
chains in the Genus database with same CATH superfamily
4FBEA 5I0CA 1LCPA 1Z8WA 1IICA 4M85A 4UFVA 2ZEOA 3TO7A 5D29A 4XNHC 2WUUA 2ODFA 2Z10A 2BEIA 3SJXA 5LYLA 2EVNA 2OOTA 2Z0ZA 4CRYB 1IB1E 4IF5A 1J4JA 2CXAA 2QIRA 4AVAA 2DPTA 3GB0A 3KL9A 4P45A 2PJ1A 4MFZA 4R7MA 1BOBA 2DXQA 4KOTA 3V38A 4FD5A 4NGQA 2PJ4A 4KSFA 1KUYA 1XMBA 1S7KA 4KOYA 4AG7A 4NGTA 4J3GA 3TOAA 5A28A 2DF5A 4PXEA 5EMIA 2JDDA 3LD2A 1K4JA 3PP9A 4CYNA 4H6ZA 2PJ0A 3WC5A 3KR4A 4NCZA 4P4BA 4UFWA 3SI1A 4KVOE 1QQ9A 2B4BA 2WSAA 3PFEA 1VIXA 4X5KA 3RZAA 2NMTA 4JXQA 4UCMA 4MBUA 4R9MA 3T8WA 2EWBA 1BLLE 3K9TA 4RUHA 2FCKA 3NH5A 4HNWB 2CTBA 3PB9X 4P6YA 1CP7A 2DEAA 2YNCC 4OC5A 1XIXA 8CPAA 3F0AA 3K9UA 3VATA 3H5ZA 1ZO0A 3S6HA 1KWMA 1YSJA 3FMCA 3KASA 4NF1A 2D4OA 3B2YA 3B3TA 4NFRA 4JZ0A 5E96A 4NJRA 3BJ8A 3CXPA 2DPSA 4MCPA 3VARA 1LAPA 5IB0A 4KOWA 4KSIA 4A30A 4U9YA 5K8NA 4NGMA 1S7NA 4OC0A 2FE7A 3EC4A 2QJ8A 4U9ZA 3FJUA 2CF4A 1JQGA 4UEEA 3QNVA 4W9YA 1IY7A 4R8FA 4CAWA 4MHDA 2AFXA 2QYVA 4R57A 4CAVA 2XEGA 1FNOA 4OC3A 4PK3A 5J1QA 1Y0RA 3D7FA 1M4GA 3N5FA 3S9LA 4EFDA 2Q4YA 1I1DA 2FIWA 1TF9A 3WC6A 2Z3KA 2FSRA 1PCAA 2ZW6A 3FEDA 2H5MA 4KVME 3G3SA 1TF8A 4QUSA 3WT4A 2OR4A 1QSOA 2ZPAA 3GYAA 3FBUA 4A37A 4ONUA 4HPSA 4K3NA 5JH9A 1YQEA 1XFOA 2ABZA 3HUVA 2PVWA 1CPSA 2AFOA 1Y7EA 2GLFA 4MFLA 2Z3OA 3IWGA 2VXKA 3P2FA 3LODA 1DTDA 1Y7RA 1YLOA 4PXDA 4F8ZA 1ZG7A 4KVXA 4AG9A 2ZW5A 4M6GA 2RC4A 4A94A 2EUIA 2RFHA 2WPWA 2Z3NA 5HVGA 4H6UA 1ELMP 2JBJA 2P6GA 1M4DA 2BCOA 2BOAA 2PCUA 3VWEA 7CPAA 1MJAA 3CXSA 1B6BA 1AYEA 2O4HA 3KGQA 3MN8A 4MXUA 3FECA 3TFYA 3RNZA 4ZY2A 2ZW4A 2KCWA 4K30A 3DGVA 3WR7A 2Q4ZA 3RBUA 2VI7A 1HEEA 1NMTA 4FD6A 4F0XA 1YREA 4E8OA 1R3NA 4C2XA 5K8PA 4MFJA 5D8NA 1TXRA 2Z3MA 4OAEA 3UY5A 1GYTA 4B11A 4ZX8A 4MY3A 2PJ7A 2FVGA 2GLJA 3GKRA 1Z8LA 1XE4A 2PJ8A 1XOVA 1Y0YA 3TE4A 4NJQA 4XNHB 5H86A 2Q43A 5G1ZA 1LAMA 3VWDA 3IJ3A 3QAHA 2XEJA 2ZEHA 4NGPA 5HXDA 5F47A 2PE3A 3PZJA 5C88A 5KTCA 2J9AA 4WWVA 4GS4A 1KZFA 2ZXVA 4P4IA 4M3SA 2B4DA 4UIBA 4MRIA 5G21A 2ZEEA 4P4DA 3V7ZA 1Z2LA 1M4LA 1XF8A 1MK4A 4MFKA 1NSLA 1YVOA 2OU2A 4OC1A 3ISXA 4JWPA 3FRMA 1BPNA 1WWZA 1EE3P 4FAIA 5KTAA 4DUKA 3FH4A 2V8DA 4B6ZA 2QVPA 2PRQA 3KHXA 4Q36A 4FD4A 4CGLA 2PIYA 1YGHA 3FF3A 1F2OA 1MJ9A 1AMPA 4HNXB 1P4NA 4UEZA 3KR5A 5BWAB 3V8IA 4UCPA 3I3GA 5J8FA 2VEZA 3F5BA 1Q2CA 4CGNA 1ZLHA 4B5OA 4A38A 5IX3A 4GXHA 5JQ4A 2PJ2A 3RAMA 1Z4RA 4BBHA 4OC2A 1F2PA 4QB9A 2G3TA 2V8VA 2EK8A 2JEVA 4MHNA 4F9UA 3R1KA 2B4DB 3CT9A 3H4QA 4CAEA 4H2KA 3WC7A 1P0HA 3LACA 3A9LA 2J8RA 4YWYA 4E0AA 1X10A 3BXMA 4DYOA 1R57A 2VQYA 6CPAA 4EWTA 2ZELA 1Q2DA 2VL1A 5LRKA 2AFMA 3TX8A 3S6KA 3SI0A 2PC1A 3PRTA 3K2KA 4RI1A 2BO9A 4BINA 2EK9A 2REFA 3KHZA 3CDXA 1Z8TA 4RS2A 2GFQA 2OZHA 3R96A 3D7DA 4LX9A 2Z3PA 5FVJA 3B7IA 4Y49C 1LOKA 3NE8A 3D2MA 2PJ5A 2I79A 1VHEA 3D7HA 1IYKA 3CPXA 3JRUA 2AE6A 4MHZA 2NSMA 3EXNA 4NXYA 2VZYA 3DLJA 4R6TA 4UCNA 4OIWA 4ZY1A 5G22A 4OIDA 1H8LA 1LANA 4NGNA 3MRUA 3L2NA 3FX6A 4BD9A 4FD7A 3FYNA 3BJ7A 1IYLA 4PSWA 2JEWA 3IIBA 2C6CA 1XRYA 3R9EA 4Q38A 1R43A 5DWNA 3D3SA 4HKFA 4LUAA 2ZEMA 2Q04A 2C1CA 2PJAA 4TNUA 5KTDA 3I9SA 3EY5A 3NH4A 4A31A 4MCQA 4C68A 2R1IA 4YFJA 2REEA 2J8MA 5C82A 1NE9A 1I12A 5DWMA 2FT0A 3DR8A 3H8EA 3N7ZA 2HC9A 3H8GA 2I00A 4DJLA 2Z3LA 1RXTA 5GCNA 3SJGA 3JVNA 1S60A 1ELLP 5HVFA 1YR0A 4KUBA 3D67A 3NE7A 3QAYA 4AVCA 2CNSA 3NFZA 1OZPA 1Z8XA 4MMOA 4ORFA 3GUXA 1QSRA 1F57A 2CNMA 4CPAA 2HV2A 1PUAA 2G9DA 1ZG8A 4EVYA 2P0WA 2C27A 1CX8A 1AUGA 4CGPA 4P4FA 1VGYA 2FL4A 3KQXA 2PJ6A 1S7FA 3TOBA 2Q51A 2YNDA 2PJ9A 2YGWA 3FEEA 4CYPA 1YK3A 3FB3A 3KKWA 3G8WA 4JJXA 1MJBA 4U5YA 2WYRA 4E2AA 4QBJA 2ZOFA 1UFHA 4KSAA 5AG4A 3DDDA 3S6GA 3IWWA 1UWYA 2A4NA 3SXOA 2B3UA 2F7VA 4CS0B 4AB7A 4IAVA 4H89A 4EMEA 2GREA 1IOIA 1BAVA 4FWUA 3LMSA 3R95A 4P4JA 1A2ZA 5CBMA 5EBVA 4A39A 2D4PA 4UIAA 5JGFA 5JPHA 4CRZB 2V77A 3FNCA 3IU1A 4CGMA 3IWEA 2PIZA 4PXCA 3TCVA 4B12A 2B3VA 3D2PA 4C7IA 4M6HA 1ZLIA 4P10A 2Q7BA 1OBRA 2WZNA 1CP6A 2WPXA 3FIXA 1CM0A 1DE4C 3IFEA 3SJFA 2NYQA 2C6GA 4NSQA 3F8KA 2P6FA 4CGOA 5AG6A 3KQZA 1PU9A 3NH8A 1VHOA 2G3AA 4AXVA 1N71A 2QMLA 3ISZA 4JLYA 2CNTA 4KOUA 4A95A 3S9MA 4NGSA 2PJBA 3T90A 4C2ZA 4DNCA 3CZXA 4JYWA 4YRHA 2Q7SA 2Z11A 2PSWA 1IIDA 2ARHA 3TO9A 2ZW7A 3CPAA 4TWEA 4ZX9A 1XMTA 4KORA 3RYOA 5I4MA 4PPZA 1FY7A 3B35A 3IO1A 5IV0A 1TKHA 2VZZA 4RN7A 2FXFA 2R8VA 5AG7A 4C2YA 5HH1A 2HB6A 4CAFA 1QSMA 2ANPA 4MCSA 5F46A 4IHMA 1VHSA 3BHXA 2GANA 4UWIA 2OZGA 4X3RA 1HDUA 3D4UA 4Y49B 4KLVA 4ZY0A 5LYFA 1S7LA 3KI9A 4R3LA 4LQGA 3SXNA 3JUWA 2PVVA 5LRJA 3FXTA 3IEHA 4OKOA 3PBBA 3D68A 2VBQA 4ONWA 4UA3A 1SQHA 1ARLA 3SHPA 4OMEA 2ZENA 4MY0A 1TKJA 4L8AA 4A33A 2Q4VA 4BMHA 4CYOA 4X8IA 5A27A 3GY9A 2GIVA 2PR1A 1YVKA 4L89A 4UBRA 2V8GA 1YW6A 1Z4EA 2B58A 3DNSA 2AFZA 3E0KA 3JTKA 3P2HA 3R9GA 5HVHA 1BO4A 2HUZA 3B3WA 4MFPA 4Z65A 3IC1A 3PFOA 4M6IA 1M1DA 1ON0A 5F48A 1YX0A 4B10A 5JM6A 2V8HA 4P4EA 2X7BA 1TKFA 2YNEA 4Q7AA 2P6EA 5LYDA 4B14A 1LRZA 5J8CA 2Q44A 3C26A 1X12A 2POKA 4XPLA 2FS5A 2O53A 4XPDB 4ZBGA 4JXRA 4OADA 2JBKA 2OZUA 3T9YA 4MJ8A 3D66A 2CTCA 3EFAA 1RO5A 3H8FA 3OWCA 4NEXA 4OLLA 2FIAA 3TT2A 4A32A 2I3CA 2ZEFA 1CJWA 1I21A 5K8MA 1XEBA 4HNYB 5K8OA 1V0CA 2ZOGA 3IU2A 2R7HA 3BI1A 2Q0YA 4ZI6A 3ZJ0A 4G1PA 3S9NA 4O23A 4R3KA 1NSAA 1VKCA 4GM5A 4LQ6A 4ZYQA 4YGOA 4XPDC 2PDOA 2ZEPA 4PXBA 3PB8X 1CPXA 2Y0MA 5EC4A 4IUSA 4F9VA 2XEIA 4KLWA 2PJ3A 4MI4A 1QSTA 3HLPA 4KUAA 1TIQA 3VH9A 1Q7LA 1CG2A 3ZZIA 3IGRA 3NA6A 4JD6A 4QVTA 1QMUA 4XPKA 3RO0A 2K5TA 4PSXA 2ZEGA 1XBUA 3PBEA 1LFWA 3TC8A 3WABA 3W6SA 4P44A 5H84A 1GHEA 3BI0A 4F0YA 1HDQA 2IL4A 4WJBA 4KS9A 4CAXA 4F6AA 3GIUA 5ISVA 4B5PA 4R76A 4MCRA 2CIJA 2J8NA 1YLEA 3SJEA 2RB7A 2PQ8A 1B87A 1YW4A 3R9FA 4UF4A 4II9A 5IB9A 1M4IA 1Y9KA 2AFWA 1S3ZA 1ARMA 1KUVA 2AFSA 3PEIA 4AVBA 2CY2A 4IK2A 4MFQA 1WK4A 2PRBA 3CXQA 4KOVA 2AFUA 2QECA 1Y9WA 4NGRA 1JWQA 1Z5RA 3S6FA 4R87A 2C6PA 3QB8A 5DS0A 4ZGYB 1FT7A 3DR6A 2XEFA 3PB4X 1IOFA 2G0BA 4PQAA 4UEFA 1PYTB 2GE3A 3B3VA 3D8PA 3DSBA 3EO4A 4CYQA 2JDCA 5F09A 3BLNA 2R98A 3TTHA 1ZG9A 5THWA 2EBJA 2O28A 4B5PB 2HQYA 1BPMA 3GLJA 4MHPA 4OC4A 4PK2A 3I1UA 5AG5A 2B5GA 3PB7X 4B13A 1YMEA 4QC6A 2ATRA 3KZWA 4KZTA 3SI2A 2IQ6A 3W6XA 5LYIA 3PB6X 4A2ZA 2BUEA 2F8HA 2F5IA 1XJOA 1IU8A 3LWUA 4FUUA 3FVLA 2IMOA 5F49A 1QSNA 1Q2YA 5HMNA 1CBXA 4UFXA 5CNPA 5LRGA 2BL1A 2GU2A 5CPAA 3MGDA 1S5KA 3D7GA 3B8GA 2OB0A 1Z9UA 2IJZA 2JLMA 4UWJA 1U6MA 4OP4A 4X2TA 3TO6A 1IGBA 1KUXA 1M44A 4I49A 3W91A 5G20A 2OH1A 3PGPA 2AJ6A 4MHYA 3B3CA 3B3SA 4KOSA 5ELYA 2B5GB 4C7HA 2BSWA 1L0CA 2YNCA 5AGEA 4YU9A 1RTQA 2EO8A 2PR8A 4KOXA 2ZEDA 4PV6A 2PJCA
chains in the Genus database with same CATH topology
5I0CA 1IICA 4M85A 4UFVA 3TO7A 4XNHC 2WUUA 2Z10A 2BEIA 2EVNA 2Z0ZA 4CRYB 1IB1E 4IF5A 1J4JA 2CXAA 2QIRA 4AVAA 2DPTA 4MFZA 1BOBA 2DXQA 4KOTA 4FD5A 4KSFA 1KUYA 1S7KA 4KOYA 4AG7A 5A28A 4J3GA 3TOAA 2JDDA 3LD2A 1K4JA 3PP9A 4CYNA 4H6ZA 4UFWA 4NCZA 4KVOE 2B4BA 2WSAA 4X5KA 2NMTA 4JXQA 4UCMA 4MBUA 4R9MA 2FCKA 4HNWB 2YNCC 1XIXA 3F0AA 3K9UA 3H5ZA 1ZO0A 3S6HA 4NF1A 2D4OA 5E96A 3BJ8A 3CXPA 2DPSA 5IB0A 4KOWA 4A30A 4U9YA 1S7NA 2FE7A 3EC4A 4U9ZA 4CAWA 4MHDA 4R57A 4CAVA 4PK3A 1M4GA 2Q4YA 1I1DA 2FIWA 2Z3KA 2FSRA 2ZW6A 4KVME 2H5MA 3G3SA 4QUSA 1QSOA 2ZPAA 3GYAA 3FBUA 4ONUA 4MFLA 2Z3OA 3IWGA 2VXKA 3P2FA 3LODA 1Y7RA 4KVXA 4AG9A 2ZW5A 2RC4A 2EUIA 2WPWA 2Z3NA 4H6UA 2P6GA 3VWEA 1M4DA 1MJAA 3CXSA 1B6BA 3TFYA 2ZW4A 2KCWA 4K30A 3WR7A 2VI7A 1NMTA 4FD6A 4F0XA 1YREA 4E8OA 4C2XA 4MFJA 2Z3MA 4OAEA 3UY5A 4B11A 4MY3A 3GKRA 1XE4A 3TE4A 4XNHB 5H86A 5G1ZA 3VWDA 3QAHA 5F47A 3PZJA 5C88A 5KTCA 4GS4A 1KZFA 2ZXVA 4M3SA 2B4DA 5G21A 1XF8A 1MK4A 4MFKA 1NSLA 1YVOA 2OU2A 4JWPA 3FRMA 1WWZA 5KTAA 4CGLA 4Q36A 4FD4A 1YGHA 1MJ9A 4HNXB 1P4NA 5BWAB 3V8IA 4UCPA 3I3GA 5J8FA 2VEZA 3F5BA 1Q2CA 4CGNA 4B5OA 5IX3A 5JQ4A 1Z4RA 4BBHA 4QB9A 2G3TA 2JEVA 3R1KA 2B4DB 3H4QA 4CAEA 1P0HA 3A9LA 2J8RA 4E0AA 1R57A 2VQYA 1Q2DA 3S6KA 2PC1A 4RI1A 2REFA 4RS2A 2OZHA 3R96A 4LX9A 2Z3PA 5FVJA 4Y49C 3D2MA 2I79A 1IYKA 2AE6A 3EXNA 4NXYA 2VZYA 4UCNA 5G22A 4FD7A 3FYNA 3BJ7A 1IYLA 4PSWA 3R9EA 4Q38A 5DWNA 3D3SA 4HKFA 4LUAA 2Q04A 5KTDA 3I9SA 3EY5A 4A31A 4C68A 2R1IA 4YFJA 2REEA 2J8MA 5C82A 1NE9A 1I12A 5DWMA 2FT0A 3DR8A 3N7ZA 2I00A 2Z3LA 1RXTA 5GCNA 3JVNA 1S60A 1YR0A 4KUBA 4AVCA 3NE7A 2CNSA 1OZPA 4ORFA 1QSRA 2CNMA 2HV2A 1PUAA 4EVYA 2P0WA 2C27A 4CGPA 3TOBA 2FL4A 1S7FA 2YNDA 2YGWA 4CYPA 1YK3A 3FB3A 3KKWA 3G8WA 4JJXA 1MJBA 4U5YA 4E2AA 4QBJA 1UFHA 4KSAA 5AG4A 3DDDA 3S6GA 3SXOA 2A4NA 2B3UA 4CS0B 4AB7A 4H89A 3R95A 5EBVA 2D4PA 5JPHA 4CRZB 3FNCA 3IU1A 4CGMA 3IWEA 4C7IA 3TCVA 4B12A 2B3VA 3D2PA 2Q7BA 3FIXA 2WPXA 1CM0A 4NSQA 3F8KA 2P6FA 4CGOA 5AG6A 1PU9A 2G3AA 1N71A 2QMLA 4JLYA 2CNTA 4KOUA 4A95A 3T90A 4C2ZA 4DNCA 4YRHA 2Z11A 2PSWA 1IIDA 2ARHA 3TO9A 2ZW7A 1XMTA 4KORA 3RYOA 1FY7A 5IV0A 2VZZA 2FXFA 2R8VA 5AG7A 4C2YA 5HH1A 4CAFA 1QSMA 5F46A 1VHSA 4UWIA 2GANA 4Y49B 2OZGA 4KLVA 1S7LA 3SXNA 4R3LA 3JUWA 3FXTA 2VBQA 4UA3A 1SQHA 3SHPA 4MY0A 4L8AA 4A33A 2Q4VA 4BMHA 4CYOA 5A27A 3GY9A 2GIVA 2PR1A 1YVKA 4L89A 4UBRA 1Z4EA 2B58A 3DNSA 3P2HA 3E0KA 3JTKA 3R9GA 1BO4A 2HUZA 4MFPA 1M1DA 1ON0A 5F48A 1YX0A 4B10A 2X7BA 2YNEA 2P6EA 4B14A 5J8CA 1LRZA 2Q44A 3C26A 4XPLA 2FS5A 4XPDB 4ZBGA 4JXRA 4OADA 2OZUA 3T9YA 4MJ8A 3EFAA 1RO5A 3OWCA 4NEXA 4OLLA 3TT2A 2FIAA 4A32A 1CJWA 1I21A 1XEBA 4HNYB 1V0CA 3IU2A 2R7HA 2Q0YA 3ZJ0A 4R3KA 1VKCA 4YGOA 4XPDC 2PDOA 2Y0MA 5EC4A 4IUSA 4KLWA 4MI4A 1QSTA 4KUAA 1TIQA 3ZZIA 3IGRA 4JD6A 4QVTA 4XPKA 2K5TA 4PSXA 3W6SA 5H84A 1GHEA 4F0YA 2IL4A 4KS9A 4CAXA 4F6AA 5ISVA 4B5PA 2J8NA 1YLEA 2PQ8A 1B87A 3R9FA 4II9A 1M4IA 1Y9KA 1S3ZA 1KUVA 4AVBA 2CY2A 4MFQA 1WK4A 2PRBA 3CXQA 4KOVA 2QECA 1Y9WA 3S6FA 4R87A 3QB8A 4ZGYB 3DR6A 2G0BA 2GE3A 3D8PA 3DSBA 3EO4A 4CYQA 2JDCA 3BLNA 2R98A 3TTHA 2O28A 4B5PB 2HQYA 4PK2A 5AG5A 2B5GA 4B13A 4QC6A 2ATRA 4KZTA 3W6XA 4A2ZA 2BUEA 2F5IA 5F49A 1QSNA 1Q2YA 5HMNA 4UFXA 5CNPA 2BL1A 3MGDA 1S5KA 3B8GA 2OB0A 1Z9UA 2JLMA 4UWJA 1U6MA 3TO6A 4I49A 1KUXA 1M44A 3W91A 5G20A 2OH1A 3PGPA 2AJ6A 4KOSA 2B5GB 4C7HA 2BSWA 1L0CA 2YNCA 5AGEA 2PR8A 4KOXA 4PV6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5I0C A;  1IIC A;  4M85 A;  3TO7 A;  4XNH C;  2Z10 A;  2BEI A;  2EVN A;  2Z0Z A;  4CRY B;  1IB1 E;  4IF5 A;  1J4J A;  2QIR A;  4AVA A;  1BOB A;  2DXQ A;  4KOT A;  4FD5 A;  1KUY A;  1S7K A;  4KOY A;  4AG7 A;  4J3G A;  3TOA A;  2JDD A;  3LD2 A;  1K4J A;  3PP9 A;  4H6Z A;  4NCZ A;  4KVO E;  2B4B A;  4X5K A;  2NMT A;  4JXQ A;  4MBU A;  4R9M A;  2FCK A;  4HNW B;  1XIX A;  3F0A A;  3K9U A;  3S6H A;  4NF1 A;  2D4O A;  5E96 A;  3BJ8 A;  3CXP A;  5IB0 A;  4KOW A;  4U9Y A;  1S7N A;  2FE7 A;  3EC4 A;  4U9Z A;  4CAW A;  4MHD A;  4R57 A;  4CAV A;  4PK3 A;  1M4G A;  2Q4Y A;  1I1D A;  2FIW A;  2FSR A;  2ZW6 A;  4KVM E;  2H5M A;  3G3S A;  4QUS A;  1QSO A;  2ZPA A;  3GYA A;  3FBU A;  4ONU A;  3IWG A;  2VXK A;  3P2F A;  3LOD A;  1Y7R A;  4KVX A;  4AG9 A;  2ZW5 A;  2RC4 A;  2EUI A;  2WPW A;  4H6U A;  2P6G A;  3VWE A;  1M4D A;  1MJA A;  3CXS A;  1B6B A;  3TFY A;  2ZW4 A;  2KCW A;  4K30 A;  3WR7 A;  2VI7 A;  1NMT A;  4FD6 A;  1YRE A;  4E8O A;  4OAE A;  3UY5 A;  4MY3 A;  3GKR A;  1XE4 A;  3TE4 A;  4XNH B;  5H86 A;  3VWD A;  3QAH A;  5F47 A;  3PZJ A;  5C88 A;  5KTC A;  4GS4 A;  1KZF A;  2ZXV A;  4M3S A;  2B4D A;  1XF8 A;  1MK4 A;  1NSL A;  1YVO A;  2OU2 A;  4JWP A;  3FRM A;  1WWZ A;  5KTA A;  4FD4 A;  1YGH A;  1MJ9 A;  4HNX B;  1P4N A;  3V8I A;  3I3G A;  5J8F A;  2VEZ A;  3F5B A;  1Q2C A;  4B5O A;  5IX3 A;  5JQ4 A;  1Z4R A;  4QB9 A;  2G3T A;  2JEV A;  3R1K A;  2B4D B;  3H4Q A;  1P0H A;  2J8R A;  4E0A A;  1R57 A;  2VQY A;  1Q2D A;  3S6K A;  2PC1 A;  4RI1 A;  2REF A;  4RS2 A;  2OZH A;  3R96 A;  4LX9 A;  5FVJ A;  4Y49 C;  3D2M A;  2I79 A;  1IYK A;  2AE6 A;  3EXN A;  4NXY A;  2VZY A;  4FD7 A;  3FYN A;  3BJ7 A;  1IYL A;  4PSW A;  3R9E A;  5DWN A;  4LUA A;  3D3S A;  4HKF A;  2Q04 A;  5KTD A;  3I9S A;  3EY5 A;  2R1I A;  4YFJ A;  2REE A;  2J8M A;  5C82 A;  1NE9 A;  1I12 A;  5DWM A;  2FT0 A;  3DR8 A;  3N7Z A;  2I00 A;  1RXT A;  5GCN A;  3JVN A;  1S60 A;  1YR0 A;  4KUB A;  4AVC A;  3NE7 A;  2CNS A;  1OZP A;  4ORF A;  1QSR A;  2CNM A;  2HV2 A;  1PUA A;  4EVY A;  2P0W A;  2C27 A;  3TOB A;  2FL4 A;  1S7F A;  1YK3 A;  3FB3 A;  3KKW A;  3G8W A;  4JJX A;  1MJB A;  4U5Y A;  4E2A A;  4QBJ A;  1UFH A;  3DDD A;  3S6G A;  3SXO A;  2A4N A;  2B3U A;  4CS0 B;  4AB7 A;  4H89 A;  3R95 A;  5EBV A;  2D4P A;  5JPH A;  4CRZ B;  3FNC A;  3TCV A;  2B3V A;  3D2P A;  2Q7B A;  3FIX A;  2WPX A;  1CM0 A;  4NSQ A;  3F8K A;  2P6F A;  1PU9 A;  2G3A A;  1N71 A;  2QML A;  4JLY A;  2CNT A;  4KOU A;  3T90 A;  4DNC A;  4YRH A;  2Z11 A;  2PSW A;  1IID A;  2ARH A;  3TO9 A;  2ZW7 A;  1XMT A;  4KOR A;  3RYO A;  1FY7 A;  5IV0 A;  2VZZ A;  2FXF A;  2R8V A;  5HH1 A;  1QSM A;  5F46 A;  1VHS A;  4UWI A;  2GAN A;  4Y49 B;  2OZG A;  4KLV A;  1S7L A;  3SXN A;  4R3L A;  3JUW A;  3FXT A;  2VBQ A;  4UA3 A;  1SQH A;  3SHP A;  4MY0 A;  4L8A A;  2Q4V A;  4BMH A;  3GY9 A;  2GIV A;  2PR1 A;  1YVK A;  4L89 A;  4UBR A;  1Z4E A;  2B58 A;  3DNS A;  3P2H A;  3E0K A;  3R9G A;  1BO4 A;  2HUZ A;  1M1D A;  1ON0 A;  5F48 A;  1YX0 A;  2X7B A;  2P6E A;  5J8C A;  1LRZ A;  2Q44 A;  3C26 A;  4XPL A;  2FS5 A;  4XPD B;  4ZBG A;  4JXR A;  4OAD A;  2OZU A;  3T9Y A;  4MJ8 A;  3EFA A;  1RO5 A;  3OWC A;  4NEX A;  4OLL A;  3TT2 A;  2FIA A;  1CJW A;  1I21 A;  1XEB A;  4HNY B;  1V0C A;  2R7H A;  2Q0Y A;  3ZJ0 A;  4R3K A;  1VKC A;  4YGO A;  4XPD C;  2PDO A;  2Y0M A;  5EC4 A;  4IUS A;  4KLW A;  4MI4 A;  1QST A;  4KUA A;  1TIQ A;  3ZZI A;  3IGR A;  4JD6 A;  4QVT A;  4XPK A;  2K5T A;  4PSX A;  3W6S A;  5H84 A;  1GHE A;  4F0Y A;  2IL4 A;  4CAX A;  4F6A A;  5ISV A;  4B5P A;  2J8N A;  1YLE A;  2PQ8 A;  1B87 A;  3R9F A;  4II9 A;  1M4I A;  1Y9K A;  1S3Z A;  1KUV A;  4AVB A;  2CY2 A;  1WK4 A;  2PRB A;  3CXQ A;  4KOV A;  2QEC A;  1Y9W A;  3S6F A;  4R87 A;  3QB8 A;  3DR6 A;  2G0B A;  2GE3 A;  3D8P A;  3DSB A;  3EO4 A;  2JDC A;  3BLN A;  2R98 A;  3TTH A;  2O28 A;  4B5P B;  2HQY A;  4PK2 A;  2B5G A;  4QC6 A;  2ATR A;  4KZT A;  3W6X A;  2BUE A;  2F5I A;  5F49 A;  1QSN A;  1Q2Y A;  5HMN A;  5CNP A;  2BL1 A;  3MGD A;  1S5K A;  3B8G A;  2OB0 A;  1Z9U A;  2JLM A;  4UWJ A;  1U6M A;  3TO6 A;  4I49 A;  1KUX A;  1M44 A;  3W91 A;  2OH1 A;  3PGP A;  2AJ6 A;  4KOS A;  2B5G B;  2BSW A;  1L0C A;  2PR8 A;  4KOX A;  4PV6 A; 
#chains in the Genus database with same CATH topology
 4FBE A;  5I0C A;  1LCP A;  1Z8W A;  1IIC A;  4M85 A;  4UFV A;  2ZEO A;  3TO7 A;  5D29 A;  4XNH C;  2WUU A;  2ODF A;  2Z10 A;  2BEI A;  3SJX A;  5LYL A;  2EVN A;  2OOT A;  2Z0Z A;  4CRY B;  1IB1 E;  4IF5 A;  1J4J A;  2CXA A;  2QIR A;  4AVA A;  2DPT A;  3GB0 A;  3KL9 A;  4P45 A;  2PJ1 A;  4MFZ A;  4R7M A;  1BOB A;  2DXQ A;  4KOT A;  3V38 A;  4FD5 A;  4NGQ A;  2PJ4 A;  4KSF A;  1KUY A;  1XMB A;  1S7K A;  4KOY A;  4AG7 A;  4NGT A;  4J3G A;  3TOA A;  5A28 A;  2DF5 A;  4PXE A;  5EMI A;  2JDD A;  3LD2 A;  1K4J A;  3PP9 A;  4CYN A;  4H6Z A;  2PJ0 A;  3WC5 A;  3KR4 A;  4NCZ A;  4P4B A;  4UFW A;  3SI1 A;  4KVO E;  1QQ9 A;  2B4B A;  2WSA A;  3PFE A;  1VIX A;  4X5K A;  3RZA A;  2NMT A;  4JXQ A;  4UCM A;  4MBU A;  4R9M A;  3T8W A;  2EWB A;  1BLL E;  3K9T A;  4RUH A;  2FCK A;  3NH5 A;  4HNW B;  2CTB A;  3PB9 X;  4P6Y A;  1CP7 A;  2DEA A;  2YNC C;  4OC5 A;  1XIX A;  8CPA A;  3F0A A;  3K9U A;  3VAT A;  3H5Z A;  1ZO0 A;  3S6H A;  1KWM A;  1YSJ A;  3FMC A;  3KAS A;  4NF1 A;  2D4O A;  3B2Y A;  3B3T A;  4NFR A;  4JZ0 A;  5E96 A;  4NJR A;  3BJ8 A;  3CXP A;  2DPS A;  4MCP A;  3VAR A;  1LAP A;  5IB0 A;  4KOW A;  4KSI A;  4A30 A;  4U9Y A;  5K8N A;  4NGM A;  1S7N A;  4OC0 A;  2FE7 A;  3EC4 A;  2QJ8 A;  4U9Z A;  3FJU A;  2CF4 A;  1JQG A;  4UEE A;  3QNV A;  4W9Y A;  1IY7 A;  4R8F A;  4CAW A;  4MHD A;  2AFX A;  2QYV A;  4R57 A;  4CAV A;  2XEG A;  1FNO A;  4OC3 A;  4PK3 A;  5J1Q A;  1Y0R A;  3D7F A;  1M4G A;  3N5F A;  3S9L A;  4EFD A;  2Q4Y A;  1I1D A;  2FIW A;  1TF9 A;  3WC6 A;  2Z3K A;  2FSR A;  1PCA A;  2ZW6 A;  3FED A;  2H5M A;  4KVM E;  3G3S A;  1TF8 A;  4QUS A;  3WT4 A;  2OR4 A;  1QSO A;  2ZPA A;  3GYA A;  3FBU A;  4A37 A;  4ONU A;  4HPS A;  4K3N A;  5JH9 A;  1YQE A;  1XFO A;  2ABZ A;  3HUV A;  2PVW A;  1CPS A;  2AFO A;  1Y7E A;  2GLF A;  4MFL A;  2Z3O A;  3IWG A;  2VXK A;  3P2F A;  3LOD A;  1DTD A;  1Y7R A;  1YLO A;  4PXD A;  4F8Z A;  1ZG7 A;  4KVX A;  4AG9 A;  2ZW5 A;  4M6G A;  2RC4 A;  4A94 A;  2EUI A;  2RFH A;  2WPW A;  2Z3N A;  5HVG A;  4H6U A;  1ELM P;  2JBJ A;  2P6G A;  1M4D A;  2BCO A;  2BOA A;  2PCU A;  3VWE A;  7CPA A;  1MJA A;  3CXS A;  1B6B A;  1AYE A;  2O4H A;  3KGQ A;  3MN8 A;  4MXU A;  3FEC A;  3TFY A;  3RNZ A;  4ZY2 A;  2ZW4 A;  2KCW A;  4K30 A;  3DGV A;  3WR7 A;  2Q4Z A;  3RBU A;  2VI7 A;  1HEE A;  1NMT A;  4FD6 A;  4F0X A;  1YRE A;  4E8O A;  1R3N A;  4C2X A;  5K8P A;  4MFJ A;  5D8N A;  1TXR A;  2Z3M A;  4OAE A;  3UY5 A;  1GYT A;  4B11 A;  4ZX8 A;  4MY3 A;  2PJ7 A;  2FVG A;  2GLJ A;  3GKR A;  1Z8L A;  1XE4 A;  2PJ8 A;  1XOV A;  1Y0Y A;  3TE4 A;  4NJQ A;  4XNH B;  5H86 A;  2Q43 A;  5G1Z A;  1LAM A;  3VWD A;  3IJ3 A;  3QAH A;  2XEJ A;  2ZEH A;  4NGP A;  5HXD A;  5F47 A;  2PE3 A;  3PZJ A;  5C88 A;  5KTC A;  2J9A A;  4WWV A;  4GS4 A;  1KZF A;  2ZXV A;  4P4I A;  4M3S A;  2B4D A;  4UIB A;  4MRI A;  5G21 A;  2ZEE A;  4P4D A;  3V7Z A;  1Z2L A;  1M4L A;  1XF8 A;  1MK4 A;  4MFK A;  1NSL A;  1YVO A;  2OU2 A;  4OC1 A;  3ISX A;  4JWP A;  3FRM A;  1BPN A;  1WWZ A;  1EE3 P;  4FAI A;  5KTA A;  4DUK A;  3FH4 A;  2V8D A;  4B6Z A;  2QVP A;  2PRQ A;  3KHX A;  4Q36 A;  4FD4 A;  4CGL A;  2PIY A;  1YGH A;  3FF3 A;  1F2O A;  1MJ9 A;  1AMP A;  4HNX B;  1P4N A;  4UEZ A;  3KR5 A;  5BWA B;  3V8I A;  4UCP A;  3I3G A;  5J8F A;  2VEZ A;  3F5B A;  1Q2C A;  4CGN A;  1ZLH A;  4B5O A;  4A38 A;  5IX3 A;  4GXH A;  5JQ4 A;  2PJ2 A;  3RAM A;  1Z4R A;  4BBH A;  4OC2 A;  1F2P A;  4QB9 A;  2G3T A;  2V8V A;  2EK8 A;  2JEV A;  4MHN A;  4F9U A;  3R1K A;  2B4D B;  3CT9 A;  3H4Q A;  4CAE A;  4H2K A;  3WC7 A;  1P0H A;  3LAC A;  3A9L A;  2J8R A;  4YWY A;  4E0A A;  1X10 A;  3BXM A;  4DYO A;  1R57 A;  2VQY A;  6CPA A;  4EWT A;  2ZEL A;  1Q2D A;  2VL1 A;  5LRK A;  2AFM A;  3TX8 A;  3S6K A;  3SI0 A;  2PC1 A;  3PRT A;  3K2K A;  4RI1 A;  2BO9 A;  4BIN A;  2EK9 A;  2REF A;  3KHZ A;  3CDX A;  1Z8T A;  4RS2 A;  2GFQ A;  2OZH A;  3R96 A;  3D7D A;  4LX9 A;  2Z3P A;  5FVJ A;  3B7I A;  4Y49 C;  1LOK A;  3NE8 A;  3D2M A;  2PJ5 A;  2I79 A;  1VHE A;  3D7H A;  1IYK A;  3CPX A;  3JRU A;  2AE6 A;  4MHZ A;  2NSM A;  3EXN A;  4NXY A;  2VZY A;  3DLJ A;  4R6T A;  4UCN A;  4OIW A;  4ZY1 A;  5G22 A;  4OID A;  1H8L A;  1LAN A;  4NGN A;  3MRU A;  3L2N A;  3FX6 A;  4BD9 A;  4FD7 A;  3FYN A;  3BJ7 A;  1IYL A;  4PSW A;  2JEW A;  3IIB A;  2C6C A;  1XRY A;  3R9E A;  4Q38 A;  1R43 A;  5DWN A;  3D3S A;  4HKF A;  4LUA A;  2ZEM A;  2Q04 A;  2C1C A;  2PJA A;  4TNU A;  5KTD A;  3I9S A;  3EY5 A;  3NH4 A;  4A31 A;  4MCQ A;  4C68 A;  2R1I A;  4YFJ A;  2REE A;  2J8M A;  5C82 A;  1NE9 A;  1I12 A;  5DWM A;  2FT0 A;  3DR8 A;  3H8E A;  3N7Z A;  2HC9 A;  3H8G A;  2I00 A;  4DJL A;  2Z3L A;  1RXT A;  5GCN A;  3SJG A;  3JVN A;  1S60 A;  1ELL P;  5HVF A;  1YR0 A;  4KUB A;  3D67 A;  3NE7 A;  3QAY A;  4AVC A;  2CNS A;  3NFZ A;  1OZP A;  1Z8X A;  4MMO A;  4ORF A;  3GUX A;  1QSR A;  1F57 A;  2CNM A;  4CPA A;  2HV2 A;  1PUA A;  2G9D A;  1ZG8 A;  4EVY A;  2P0W A;  2C27 A;  1CX8 A;  1AUG A;  4CGP A;  4P4F A;  1VGY A;  2FL4 A;  3KQX A;  2PJ6 A;  1S7F A;  3TOB A;  2Q51 A;  2YND A;  2PJ9 A;  2YGW A;  3FEE A;  4CYP A;  1YK3 A;  3FB3 A;  3KKW A;  3G8W A;  4JJX A;  1MJB A;  4U5Y A;  2WYR A;  4E2A A;  4QBJ A;  2ZOF A;  1UFH A;  4KSA A;  5AG4 A;  3DDD A;  3S6G A;  3IWW A;  1UWY A;  2A4N A;  3SXO A;  2B3U A;  2F7V A;  4CS0 B;  4AB7 A;  4IAV A;  4H89 A;  4EME A;  2GRE A;  1IOI A;  1BAV A;  4FWU A;  3LMS A;  3R95 A;  4P4J A;  1A2Z A;  5CBM A;  5EBV A;  4A39 A;  2D4P A;  4UIA A;  5JGF A;  5JPH A;  4CRZ B;  2V77 A;  3FNC A;  3IU1 A;  4CGM A;  3IWE A;  2PIZ A;  4PXC A;  3TCV A;  4B12 A;  2B3V A;  3D2P A;  4C7I A;  4M6H A;  1ZLI A;  4P10 A;  2Q7B A;  1OBR A;  2WZN A;  1CP6 A;  2WPX A;  3FIX A;  1CM0 A;  1DE4 C;  3IFE A;  3SJF A;  2NYQ A;  2C6G A;  4NSQ A;  3F8K A;  2P6F A;  4CGO A;  5AG6 A;  3KQZ A;  1PU9 A;  3NH8 A;  1VHO A;  2G3A A;  4AXV A;  1N71 A;  2QML A;  3ISZ A;  4JLY A;  2CNT A;  4KOU A;  4A95 A;  3S9M A;  4NGS A;  2PJB A;  3T90 A;  4C2Z A;  4DNC A;  3CZX A;  4JYW A;  4YRH A;  2Q7S A;  2Z11 A;  2PSW A;  1IID A;  2ARH A;  3TO9 A;  2ZW7 A;  3CPA A;  4TWE A;  4ZX9 A;  1XMT A;  4KOR A;  3RYO A;  5I4M A;  4PPZ A;  1FY7 A;  3B35 A;  3IO1 A;  5IV0 A;  1TKH A;  2VZZ A;  4RN7 A;  2FXF A;  2R8V A;  5AG7 A;  4C2Y A;  5HH1 A;  2HB6 A;  4CAF A;  1QSM A;  2ANP A;  4MCS A;  5F46 A;  4IHM A;  1VHS A;  3BHX A;  2GAN A;  4UWI A;  2OZG A;  4X3R A;  1HDU A;  3D4U A;  4Y49 B;  4KLV A;  4ZY0 A;  5LYF A;  1S7L A;  3KI9 A;  4R3L A;  4LQG A;  3SXN A;  3JUW A;  2PVV A;  5LRJ A;  3FXT A;  3IEH A;  4OKO A;  3PBB A;  3D68 A;  2VBQ A;  4ONW A;  4UA3 A;  1SQH A;  1ARL A;  3SHP A;  4OME A;  2ZEN A;  4MY0 A;  1TKJ A;  4L8A A;  4A33 A;  2Q4V A;  4BMH A;  4CYO A;  4X8I A;  5A27 A;  3GY9 A;  2GIV A;  2PR1 A;  1YVK A;  4L89 A;  4UBR A;  2V8G A;  1YW6 A;  1Z4E A;  2B58 A;  3DNS A;  2AFZ A;  3E0K A;  3JTK A;  3P2H A;  3R9G A;  5HVH A;  1BO4 A;  2HUZ A;  3B3W A;  4MFP A;  4Z65 A;  3IC1 A;  3PFO A;  4M6I A;  1M1D A;  1ON0 A;  5F48 A;  1YX0 A;  4B10 A;  5JM6 A;  2V8H A;  4P4E A;  2X7B A;  1TKF A;  2YNE A;  4Q7A A;  2P6E A;  5LYD A;  4B14 A;  1LRZ A;  5J8C A;  2Q44 A;  3C26 A;  1X12 A;  2POK A;  4XPL A;  2FS5 A;  2O53 A;  4XPD B;  4ZBG A;  4JXR A;  4OAD A;  2JBK A;  2OZU A;  3T9Y A;  4MJ8 A;  3D66 A;  2CTC A;  3EFA A;  1RO5 A;  3H8F A;  3OWC A;  4NEX A;  4OLL A;  2FIA A;  3TT2 A;  4A32 A;  2I3C A;  2ZEF A;  1CJW A;  1I21 A;  5K8M A;  1XEB A;  4HNY B;  5K8O A;  1V0C A;  2ZOG A;  3IU2 A;  2R7H A;  3BI1 A;  2Q0Y A;  4ZI6 A;  3ZJ0 A;  4G1P A;  3S9N A;  4O23 A;  4R3K A;  1NSA A;  1VKC A;  4GM5 A;  4LQ6 A;  4ZYQ A;  4YGO A;  4XPD C;  2PDO A;  2ZEP A;  4PXB A;  3PB8 X;  1CPX A;  2Y0M A;  5EC4 A;  4IUS A;  4F9V A;  2XEI A;  4KLW A;  2PJ3 A;  4MI4 A;  1QST A;  3HLP A;  4KUA A;  1TIQ A;  3VH9 A;  1Q7L A;  1CG2 A;  3ZZI A;  3IGR A;  3NA6 A;  4JD6 A;  4QVT A;  1QMU A;  4XPK A;  3RO0 A;  2K5T A;  4PSX A;  2ZEG A;  1XBU A;  3PBE A;  1LFW A;  3TC8 A;  3WAB A;  3W6S A;  4P44 A;  5H84 A;  1GHE A;  3BI0 A;  4F0Y A;  1HDQ A;  2IL4 A;  4WJB A;  4KS9 A;  4CAX A;  4F6A A;  3GIU A;  5ISV A;  4B5P A;  4R76 A;  4MCR A;  2CIJ A;  2J8N A;  1YLE A;  3SJE A;  2RB7 A;  2PQ8 A;  1B87 A;  1YW4 A;  3R9F A;  4UF4 A;  4II9 A;  5IB9 A;  1M4I A;  1Y9K A;  2AFW A;  1S3Z A;  1ARM A;  1KUV A;  2AFS A;  3PEI A;  4AVB A;  2CY2 A;  4IK2 A;  4MFQ A;  1WK4 A;  2PRB A;  3CXQ A;  4KOV A;  2AFU A;  2QEC A;  1Y9W A;  4NGR A;  1JWQ A;  1Z5R A;  3S6F A;  4R87 A;  2C6P A;  3QB8 A;  5DS0 A;  4ZGY B;  1FT7 A;  3DR6 A;  2XEF A;  3PB4 X;  1IOF A;  2G0B A;  4PQA A;  4UEF A;  1PYT B;  2GE3 A;  3B3V A;  3D8P A;  3DSB A;  3EO4 A;  4CYQ A;  2JDC A;  5F09 A;  3BLN A;  2R98 A;  3TTH A;  1ZG9 A;  5THW A;  2EBJ A;  2O28 A;  4B5P B;  2HQY A;  1BPM A;  3GLJ A;  4MHP A;  4OC4 A;  4PK2 A;  3I1U A;  5AG5 A;  2B5G A;  3PB7 X;  4B13 A;  1YME A;  4QC6 A;  2ATR A;  3KZW A;  4KZT A;  3SI2 A;  2IQ6 A;  3W6X A;  5LYI A;  3PB6 X;  4A2Z A;  2BUE A;  2F8H A;  2F5I A;  1XJO A;  1IU8 A;  3LWU A;  4FUU A;  3FVL A;  2IMO A;  5F49 A;  1QSN A;  1Q2Y A;  5HMN A;  1CBX A;  4UFX A;  5CNP A;  5LRG A;  2BL1 A;  2GU2 A;  5CPA A;  3MGD A;  1S5K A;  3D7G A;  3B8G A;  2OB0 A;  1Z9U A;  2IJZ A;  2JLM A;  4UWJ A;  1U6M A;  4OP4 A;  4X2T A;  3TO6 A;  1IGB A;  1KUX A;  1M44 A;  4I49 A;  3W91 A;  5G20 A;  2OH1 A;  3PGP A;  2AJ6 A;  4MHY A;  3B3C A;  3B3S A;  4KOS A;  5ELY A;  2B5G B;  4C7H A;  2BSW A;  1L0C A;  2YNC A;  5AGE A;  4YU9 A;  1RTQ A;  2EO8 A;  2PR8 A;  4KOX A;  2ZED A;  4PV6 A;  2PJC A; 
#chains in the Genus database with same CATH homology
 5I0C A;  1IIC A;  4M85 A;  4UFV A;  3TO7 A;  4XNH C;  2WUU A;  2Z10 A;  2BEI A;  2EVN A;  2Z0Z A;  4CRY B;  1IB1 E;  4IF5 A;  1J4J A;  2CXA A;  2QIR A;  4AVA A;  2DPT A;  4MFZ A;  1BOB A;  2DXQ A;  4KOT A;  4FD5 A;  4KSF A;  1KUY A;  1S7K A;  4KOY A;  4AG7 A;  5A28 A;  4J3G A;  3TOA A;  2JDD A;  3LD2 A;  1K4J A;  3PP9 A;  4CYN A;  4H6Z A;  4UFW A;  4NCZ A;  4KVO E;  2B4B A;  2WSA A;  4X5K A;  2NMT A;  4JXQ A;  4UCM A;  4MBU A;  4R9M A;  2FCK A;  4HNW B;  2YNC C;  1XIX A;  3F0A A;  3K9U A;  3H5Z A;  1ZO0 A;  3S6H A;  4NF1 A;  2D4O A;  5E96 A;  3BJ8 A;  3CXP A;  2DPS A;  5IB0 A;  4KOW A;  4A30 A;  4U9Y A;  1S7N A;  2FE7 A;  3EC4 A;  4U9Z A;  4CAW A;  4MHD A;  4R57 A;  4CAV A;  4PK3 A;  1M4G A;  2Q4Y A;  1I1D A;  2FIW A;  2Z3K A;  2FSR A;  2ZW6 A;  4KVM E;  2H5M A;  3G3S A;  4QUS A;  1QSO A;  2ZPA A;  3GYA A;  3FBU A;  4ONU A;  4MFL A;  2Z3O A;  3IWG A;  2VXK A;  3P2F A;  3LOD A;  1Y7R A;  4KVX A;  4AG9 A;  2ZW5 A;  2RC4 A;  2EUI A;  2WPW A;  2Z3N A;  4H6U A;  2P6G A;  3VWE A;  1M4D A;  1MJA A;  3CXS A;  1B6B A;  3TFY A;  2ZW4 A;  2KCW A;  4K30 A;  3WR7 A;  2VI7 A;  1NMT A;  4FD6 A;  4F0X A;  1YRE A;  4E8O A;  4C2X A;  4MFJ A;  2Z3M A;  4OAE A;  3UY5 A;  4B11 A;  4MY3 A;  3GKR A;  1XE4 A;  3TE4 A;  4XNH B;  5H86 A;  5G1Z A;  3VWD A;  3QAH A;  5F47 A;  3PZJ A;  5C88 A;  5KTC A;  4GS4 A;  1KZF A;  2ZXV A;  4M3S A;  2B4D A;  5G21 A;  1XF8 A;  1MK4 A;  4MFK A;  1NSL A;  1YVO A;  2OU2 A;  4JWP A;  3FRM A;  1WWZ A;  5KTA A;  4CGL A;  4Q36 A;  4FD4 A;  1YGH A;  1MJ9 A;  4HNX B;  1P4N A;  5BWA B;  3V8I A;  4UCP A;  3I3G A;  5J8F A;  2VEZ A;  3F5B A;  1Q2C A;  4CGN A;  4B5O A;  5IX3 A;  5JQ4 A;  1Z4R A;  4BBH A;  4QB9 A;  2G3T A;  2JEV A;  3R1K A;  2B4D B;  3H4Q A;  4CAE A;  1P0H A;  3A9L A;  2J8R A;  4E0A A;  1R57 A;  2VQY A;  1Q2D A;  3S6K A;  2PC1 A;  4RI1 A;  2REF A;  4RS2 A;  2OZH A;  3R96 A;  4LX9 A;  2Z3P A;  5FVJ A;  4Y49 C;  3D2M A;  2I79 A;  1IYK A;  2AE6 A;  3EXN A;  4NXY A;  2VZY A;  4UCN A;  5G22 A;  4FD7 A;  3FYN A;  3BJ7 A;  1IYL A;  4PSW A;  3R9E A;  4Q38 A;  5DWN A;  3D3S A;  4HKF A;  4LUA A;  2Q04 A;  5KTD A;  3I9S A;  3EY5 A;  4A31 A;  4C68 A;  2R1I A;  4YFJ A;  2REE A;  2J8M A;  5C82 A;  1NE9 A;  1I12 A;  5DWM A;  2FT0 A;  3DR8 A;  3N7Z A;  2I00 A;  2Z3L A;  1RXT A;  5GCN A;  3JVN A;  1S60 A;  1YR0 A;  4KUB A;  4AVC A;  3NE7 A;  2CNS A;  1OZP A;  4ORF A;  1QSR A;  2CNM A;  2HV2 A;  1PUA A;  4EVY A;  2P0W A;  2C27 A;  4CGP A;  3TOB A;  2FL4 A;  1S7F A;  2YND A;  2YGW A;  4CYP A;  1YK3 A;  3FB3 A;  3KKW A;  3G8W A;  4JJX A;  1MJB A;  4U5Y A;  4E2A A;  4QBJ A;  1UFH A;  4KSA A;  5AG4 A;  3DDD A;  3S6G A;  3SXO A;  2A4N A;  2B3U A;  4CS0 B;  4AB7 A;  4H89 A;  3R95 A;  5EBV A;  2D4P A;  5JPH A;  4CRZ B;  3FNC A;  3IU1 A;  4CGM A;  3IWE A;  4C7I A;  3TCV A;  4B12 A;  2B3V A;  3D2P A;  2Q7B A;  3FIX A;  2WPX A;  1CM0 A;  4NSQ A;  3F8K A;  2P6F A;  4CGO A;  5AG6 A;  1PU9 A;  2G3A A;  1N71 A;  2QML A;  4JLY A;  2CNT A;  4KOU A;  4A95 A;  3T90 A;  4C2Z A;  4DNC A;  4YRH A;  2Z11 A;  2PSW A;  1IID A;  2ARH A;  3TO9 A;  2ZW7 A;  1XMT A;  4KOR A;  3RYO A;  1FY7 A;  5IV0 A;  2VZZ A;  2FXF A;  2R8V A;  5AG7 A;  4C2Y A;  5HH1 A;  4CAF A;  1QSM A;  5F46 A;  1VHS A;  4UWI A;  2GAN A;  4Y49 B;  2OZG A;  4KLV A;  1S7L A;  3SXN A;  4R3L A;  3JUW A;  3FXT A;  2VBQ A;  4UA3 A;  1SQH A;  3SHP A;  4MY0 A;  4L8A A;  4A33 A;  2Q4V A;  4BMH A;  4CYO A;  5A27 A;  3GY9 A;  2GIV A;  2PR1 A;  1YVK A;  4L89 A;  4UBR A;  1Z4E A;  2B58 A;  3DNS A;  3P2H A;  3E0K A;  3JTK A;  3R9G A;  1BO4 A;  2HUZ A;  4MFP A;  1M1D A;  1ON0 A;  5F48 A;  1YX0 A;  4B10 A;  2X7B A;  2YNE A;  2P6E A;  4B14 A;  5J8C A;  1LRZ A;  2Q44 A;  3C26 A;  4XPL A;  2FS5 A;  4XPD B;  4ZBG A;  4JXR A;  4OAD A;  2OZU A;  3T9Y A;  4MJ8 A;  3EFA A;  1RO5 A;  3OWC A;  4NEX A;  4OLL A;  3TT2 A;  2FIA A;  4A32 A;  1CJW A;  1I21 A;  1XEB A;  4HNY B;  1V0C A;  3IU2 A;  2R7H A;  2Q0Y A;  3ZJ0 A;  4R3K A;  1VKC A;  4YGO A;  4XPD C;  2PDO A;  2Y0M A;  5EC4 A;  4IUS A;  4KLW A;  4MI4 A;  1QST A;  4KUA A;  1TIQ A;  3ZZI A;  3IGR A;  4JD6 A;  4QVT A;  4XPK A;  2K5T A;  4PSX A;  3W6S A;  5H84 A;  1GHE A;  4F0Y A;  2IL4 A;  4KS9 A;  4CAX A;  4F6A A;  5ISV A;  4B5P A;  2J8N A;  1YLE A;  2PQ8 A;  1B87 A;  3R9F A;  4II9 A;  1M4I A;  1Y9K A;  1S3Z A;  1KUV A;  4AVB A;  2CY2 A;  4MFQ A;  1WK4 A;  2PRB A;  3CXQ A;  4KOV A;  2QEC A;  1Y9W A;  3S6F A;  4R87 A;  3QB8 A;  4ZGY B;  3DR6 A;  2G0B A;  2GE3 A;  3D8P A;  3DSB A;  3EO4 A;  4CYQ A;  2JDC A;  3BLN A;  2R98 A;  3TTH A;  2O28 A;  4B5P B;  2HQY A;  4PK2 A;  5AG5 A;  2B5G A;  4B13 A;  4QC6 A;  2ATR A;  4KZT A;  3W6X A;  4A2Z A;  2BUE A;  2F5I A;  5F49 A;  1QSN A;  1Q2Y A;  5HMN A;  4UFX A;  5CNP A;  2BL1 A;  3MGD A;  1S5K A;  3B8G A;  2OB0 A;  1Z9U A;  2JLM A;  4UWJ A;  1U6M A;  3TO6 A;  4I49 A;  1KUX A;  1M44 A;  3W91 A;  5G20 A;  2OH1 A;  3PGP A;  2AJ6 A;  4KOS A;  2B5G B;  4C7H A;  2BSW A;  1L0C A;  2YNC A;  5AGE A;  2PR8 A;  4KOX A;  4PV6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...