4KUBA

Crystal structure of a gnat superfamily acetyltransferase pa4794 in complex with coa
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
160
structure length
160
Chain Sequence
b'HMQLSHRPAETGDLETVAGFPQDRDELFYCYPKAIWPFSVAQLAAAIAERRGSTVAVHDGQVLGFANFYQWQHGDFCALGNMMVAPAARGLGVARYLIGVMENLAREQYKARLMKISCFNANAAGLLLYTQLGYQPRAIAERHDPDGRRVALIQMDKPLE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GNAT superfamily acetyltransferase PA4794
publication title Structural, functional, and inhibition studies of a Gcn5-related N-acetyltransferase (GNAT) superfamily protein PA4794: a new C-terminal lysine protein acetyltransferase from pseudomonas aeruginosa.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Transferase
total genus 46
structure length 160
sequence length 160
ec nomenclature
pdb deposition date 2013-05-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4kubA00
4XPKA 2P0WA 4IUSA 4JXQA 2FCKA 3PGPA 3SXNA 1S60A 4HKFA 4NXYA 2Q7BA 3SXOA 4B5PA 1PU9A 1CJWA 4K30A 3LD2A 1BO4A 3TO6A 3NE7A 3TFYA 2FIAA 3GY9A 3DSBA 3TOBA 1MK4A 4E0AA 4LX9A 1LRZA 4YRHA 1XE4A 5IV0A 1Y9KA 4UWIA 2ARHA 3D2MA 2OZGA 1YX0A 1WK4A 4PV6A 2PR8A 4HNWB 1U6MA 2C27A 3D3SA 2Y0MA 2PQ8A 3TE4A 3FNCA 4JLYA 1QSOA 4E2AA 2Z11A 4AVCA 2G3AA 3D2PA 1XEBA 4KOUA 3E0KA 3R9GA 1Q2YA 4QVTA 5DWMA 4KVXA 3FXTA 2OZUA 4KLWA 2ZW5A 3T9YA 3F0AA 1QSNA 2PDOA 3S6HA 3W91A 4BMHA 1MJ9A 2REFA 2B4DA 5J8CA 4FD4A 1R57A 4MY0A 5KTDA 1S7KA 5E96A 5GCNA 1M44A 4H6ZA 4YGOA 3CXQA 4U9ZA 5HH1A 1IYLA 3OWCA 5C82A 2P6FA 3SHPA 3JVNA 4QB9A 4XPDB 3H4QA 2ZW7A 4JXRA 4KZTA 1M4DA 2NMTA 5F47A 3EXNA 2Z0ZA 4R3KA 3TTHA 1S7LA 2R7HA 1UFHA 2BL1A 3F8KA 1NSLA 2P6GA 1I1DA 2PC1A 4B5OA 4I49A 3QB8A 3R96A 2QIRA 2GIVA 5J8FA 3T90A 3P2FA 2ZXVA 3W6XA 5H84A 4R87A 1Z4EA 4PK3A 3TO7A 1YK3A 4M85A 3S6KA 3W6SA 2J8MA 4L8AA 2FS5A 3G8WA 1TIQA 3DDDA 3IWGA 3F5BA 1CM0A 1IYKA 1ON0A 2DXQA 1S3ZA 1KUYA 1GHEA 1YR0A 5FVJA 2HV2A 5C88A 2VQYA 2EUIA 4PSXA 4KORA 3N7ZA 3B8GA 2JLMA 4U5YA 2WPWA 1XF8A 3VWDA 5EC4A 4KVOE 1YREA 5KTAA 1S7FA 4NEXA 5EBVA 3V8IA 2R1IA 4NF1A 4XPDC 1YVOA 5IX3A 3CXSA 5KTCA 1NE9A 4MI4A 2BEIA 3I3GA 1IB1E 4KOTA 2Q4YA 3DNSA 3S6GA 4B5PB 1Z9UA 1KUVA 2B58A 2Q4VA 1Y7RA 1YGHA 3I9SA 3JUWA 4UA3A 3WR7A 4AG7A 2D4OA 1PUAA 3EO4A 4OAEA 4DNCA 2PRBA 4MBUA 4F0YA 2AE6A 4FD5A 1M4GA 4Y49B 5F46A 3C26A 4R3LA 4GS4A 3S6FA 4II9A 3TCVA 4H89A 4FD6A 3EY5A 4AG9A 2B4BA 1BOBA 3P2HA 2OU2A 1RXTA 2F5IA 4YFJA 4KUAA 4CRYB 1B87A 2VI7A 1QSMA 4L89A 1I21A 2BSWA 3FBUA 2PSWA 1P4NA 3IGRA 5F48A 1IICA 2FSRA 4KVME 2K5TA 5ISVA 1VKCA 1K4JA 4R9MA 1XMTA 3DR8A 1KZFA 4UBRA 2H5MA 3ZZIA 3G3SA 5F49A 2O28A 1Q2CA 4PSWA 4ZBGA 2JDCA 4JD6A 4HNXB 4AVAA 2ZW6A 2Q0YA 2CNTA 2HUZA 4CRZB 5CNPA 2B3VA 3LODA 2R98A 2B5GA 2FT0A 4JWPA 3DR6A 1S7NA 1P0HA 2REEA 4Y49C 1YLEA 4KOVA 2Q04A 2Z10A 2IL4A 2ATRA 4LUAA 2AJ6A 4UWJA 5JQ4A 1XIXA 5H86A 2I00A 4KOYA 2D4PA 3TO9A 3QAHA 4IF5A 3MGDA 4EVYA 3ZJ0A 3FRMA 4XPLA 2R8VA 1I12A 2G0BA 4CAWA 3BLNA 3RYOA 4NSQA 3UY5A 2Q44A 3BJ7A 4R57A 2FIWA 1VHSA 2ZW4A 1IIDA 3GKRA 4RI1A 3KKWA 2P6EA 2JDDA 5DWNA 4QBJA 2PR1A 3GYAA 2OZHA 2KCWA 4KLVA 3R1KA 2OH1A 4M3SA 2X7BA 2VZZA 2FXFA 3EC4A 1Y9WA 3TT2A 3BJ8A 3FB3A 2G3TA 2RC4A 2VXKA 4HNYB 1SQHA 4KOXA 1Z4RA 3K9UA 1OZPA 4MY3A 4NCZA 4U9YA 4XNHB 4MHDA 1YVKA 2OB0A 4OLLA 1NMTA 4JJXA 4QC6A 3TOAA 1KUXA 4KOSA 2GE3A 2QECA 1QSTA 2ZPAA 5I0CA 4F6AA 1WWZA 2CNSA 1M1DA 1M4IA 1N71A 1QSRA 1Q2DA 4MJ8A 2FE7A 4E8OA 2JEVA 2B4DB 4AVBA 2B3UA 3FIXA 4CAVA 4RS2A 3FYNA 4ORFA 2CY2A 3EFAA 4CAXA 2HQYA 3PP9A 4H6UA 1MJAA 4KUBA 1MJBA 2VZYA 4AB7A 4J3GA 2VEZA 2FL4A 5IB0A 5HMNA 2J8NA 1RO5A 3VWEA 1S5KA 4PK2A 2WPXA 3PZJA 1FY7A 3R9EA 4FD7A 2QMLA 1J4JA 4CS0B 4X5KA 2J8RA 3R95A 4OADA 2VBQA 3D8PA 2GANA 2EVNA 2I79A 3CXPA 4XNHC 2CNMA 4KOWA 3R9FA 1B6BA 2BUEA 1V0CA 4ONUA 2A4NA 1L0CA 5JPHA 2B5GB 4QUSA
chains in the Genus database with same CATH superfamily
4XPKA 2P0WA 2BCOA 1XFOA 1XRYA 4IUSA 3WC5A 2JBKA 4JXQA 4Q36A 2FCKA 1ZG8A 3PGPA 1S60A 4HKFA 4NXYA 3SXNA 2Q7BA 3RNZA 3SXOA 4B5PA 1PU9A 1CJWA 4K30A 4FBEA 2ZEPA 3LD2A 2PJAA 1BO4A 4A32A 3TO6A 3NE7A 1Y7EA 2FIAA 5AG4A 3TFYA 3GY9A 3DSBA 1F57A 1MK4A 3TOBA 2ZOGA 3GIUA 4E0AA 4LX9A 1LRZA 2POKA 3SJXA 4YRHA 3PB9X 1XE4A 2XEGA 3D7FA 3IU1A 1Y9KA 4O23A 5IV0A 4KSFA 2NYQA 3PB6X 3H5ZA 3FEEA 3VARA 4UWIA 4B11A 2ARHA 3D2MA 2OZGA 4ZYQA 1YX0A 1WK4A 4PV6A 4P4IA 3RBUA 4Q38A 4DNCA 2PR8A 4HNWB 1U6MA 4UIBA 4ZY2A 2C27A 3D3SA 2Y0MA 4CYOA 2PQ8A 2PJ0A 3IWWA 3TE4A 1IY7A 2BOAA 2EBJA 2IJZA 3FNCA 4JLYA 1QSOA 4A33A 4E2AA 2Z11A 3PB4X 4KSAA 1CPSA 2F8HA 2G3AA 4AVCA 3D2PA 1XJOA 3GB0A 1XEBA 1AUGA 1CP7A 4KOUA 3E0KA 4C68A 4P4EA 2PJ9A 1OBRA 2PJ5A 2V8DA 4MHZA 5A27A 2AFZA 3R9GA 1Q2YA 4MFQA 4QVTA 5DWMA 4KVXA 3KQXA 3FXTA 4CYPA 2IQ6A 2OZUA 3NFZA 4KLWA 2ZW5A 3T9YA 4EWTA 3F0AA 1YW6A 1QSNA 2PDOA 4DYOA 4NGQA 3S6HA 3W91A 3S9LA 2XEFA 4BMHA 2Q7SA 1MJ9A 1Y0RA 4IHMA 2REFA 2B4DA 2V8GA 5J8CA 4FD4A 7CPAA 1R57A 2WZNA 1LAMA 4M6HA 1S7KA 4MY0A 4PPZA 2IMOA 3SI2A 3SJFA 5KTDA 5E96A 5GCNA 1M44A 3LACA 4ZGYB 4H6ZA 2AFOA 4YGOA 3FMCA 3CXQA 4A95A 1TKFA 2PVWA 1IOIA 3FX6A 4OIDA 2EWBA 2ZENA 1ELLP 1PYTB 4U9ZA 5HH1A 1IYLA 3OWCA 2GLJA 4K3NA 4CPAA 4C7IA 1AYEA 3RAMA 5LYIA 5LYFA 5C82A 2P6FA 2NSMA 3SHPA 2DF5A 2WUUA 3JVNA 4QB9A 4XPDB 3H4QA 4P44A 3VH9A 4CGPA 1TKJA 2ZW7A 2CTBA 4JXRA 5G22A 2Z3PA 4KZTA 1M4DA 2CTCA 2Z3OA 2ZEEA 4UEEA 4C2ZA 2NMTA 5F47A 3EXNA 4TWEA 3FJUA 4MMOA 4MHNA 2Z0ZA 3SI1A 4OC1A 4UEZA 4R3KA 3TTHA 3PB7X 1H8LA 2O53A 1YW4A 2CF4A 3FECA 5HVHA 1S7LA 2R7HA 2ZOFA 8CPAA 2VL1A 3D66A 1UFHA 2BL1A 4YWYA 3F8KA 1NSLA 2P6GA 1I1DA 2PC1A 3B3TA 4NGMA 4B5OA 4B14A 4OMEA 4C2YA 4EMEA 4I49A 3QB8A 1BAVA 3R96A 2QIRA 2G9DA 2GIVA 2PJ1A 3KR5A 5J8FA 3T90A 3P2FA 2ZXVA 4MHYA 3W6XA 5H84A 4R87A 5HVFA 2QVPA 4PXEA 1Z4EA 4PK3A 3TO7A 1Z8LA 2WSAA 3H8EA 1YK3A 4M85A 1LFWA 3S6KA 2V77A 3CPXA 1FT7A 4NGNA 3W6SA 2J8MA 1AMPA 2Z3MA 2ZELA 4C2XA 2PIYA 4L8AA 2FS5A 3G8WA 1TIQA 2PJ7A 3KQZA 3DDDA 5HVGA 3B35A 2YNEA 2PCUA 3B2YA 3IWGA 3SI0A 3F5BA 1CM0A 4OC5A 1IYKA 1ON0A 4YU9A 2DXQA 1KUYA 1S3ZA 3KI9A 1GHEA 4MFPA 4RUHA 1YR0A 5FVJA 5LRGA 2HV2A 2F7VA 1ZLHA 2PJ6A 5C88A 4WJBA 2VQYA 2EUIA 4PSXA 4PQAA 3FEDA 1IU8A 2C6CA 4KORA 4Q7AA 3N7ZA 3WR7A 3B8GA 1VGYA 1Z2LA 2JLMA 2XEJA 4MFLA 4U5YA 2WPWA 3ISXA 1XF8A 5AG6A 3VWDA 4UFWA 1UWYA 1DE4C 1VHOA 1Z8WA 3B3WA 3QAYA 5EC4A 4KVOE 1LCPA 4ZX9A 1YREA 4UA3A 4NGRA 1S7FA 4NEXA 5KTAA 5EBVA 3V8IA 2R1IA 4NF1A 2CXAA 1HDQA 5EMIA 4GXHA 4A39A 1YMEA 3MN8A 4XPDC 5LRJA 1YVOA 4A37A 5IX3A 3CXSA 4P45A 1LOKA 1JQGA 3PBEA 5KTCA 1NE9A 4ZI6A 4NGPA 3HUVA 4MI4A 3PB8X 5G1ZA 2BEIA 3I3GA 1IB1E 3KZWA 4A30A 4KOTA 4B12A 2Q4YA 4OC3A 1EE3P 3DNSA 3S6GA 2C6GA 3KHZA 4B5PB 1Z9UA 2AFSA 5K8NA 3H8FA 1KUVA 2B58A 2Q4VA 1Y7RA 1BPNA 1XMBA 1YGHA 2PJ4A 3I9SA 3JUWA 2D4OA 1PUAA 3EO4A 4NGTA 4OAEA 4UCNA 4AG7A 2PRBA 3PBBA 4BINA 4MBUA 4F0YA 2AE6A 4FD5A 1M4GA 4Y49B 4TNUA 5F46A 3C26A 2AFUA 1Z5RA 2C6PA 3D68A 4R3LA 4GS4A 4PXCA 5D8NA 3S6FA 2ZEHA 4R76A 1PCAA 4R7MA 4II9A 4G1PA 3WC7A 4M6GA 4PXDA 3IC1A 2Q51A 3TCVA 4H89A 4FD6A 5F09A 4MFKA 3RZAA 3EY5A 4OC4A 4AG9A 2B4BA 1BOBA 2Q4ZA 3JRUA 2EK8A 3P2HA 4ZY0A 1QMUA 3NH5A 3B7IA 2OU2A 1RXTA 2F5IA 3BHXA 1F2PA 2OOTA 3HLPA 4YFJA 2J9AA 4KUAA 2GLFA 4A2ZA 1R43A 3PEIA 5D29A 1ARMA 4F8ZA 4OP4A 1XOVA 4B6ZA 4CRYB 5AGEA 2I3CA 1B87A 2VI7A 1QSMA 2JBJA 2ODFA 5K8MA 4L89A 1I21A 2PVVA 2BSWA 3QNVA 1CBXA 4BBHA 3FBUA 4CAFA 4F0XA 2PSWA 3SJEA 1P4NA 2ZEOA 3IGRA 5F48A 2PJ2A 2GU2A 1IICA 2FSRA 4KVME 2K5TA 3CDXA 4M6IA 1VKCA 1K4JA 4P6YA 1XMTA 2WYRA 3DR8A 4R9MA 5ISVA 4ZX8A 2HC9A 1RTQA 3IEHA 1KZFA 4MFJA 2H5MA 4OKOA 4UBRA 3ZZIA 3VATA 3G3SA 4WWVA 2O28A 1Q2CA 1IOFA 5F49A 4PSWA 4A94A 4ZBGA 3D7HA 2JDCA 4JD6A 3K9TA 4HNXB 2XEIA 1Z8TA 3D67A 1Q7LA 4AVAA 2ZW6A 2AFMA 2RB7A 3IO1A 2Q0YA 2CNTA 2YNCC 3LMSA 4F9VA 2HUZA 4CRZB 5CNPA 2DEAA 4A38A 2B3VA 3LODA 4KS9A 3K2KA 3KGQA 4C7HA 2R98A 2B5GA 3H8GA 2FT0A 3TX8A 4B10A 5JGFA 4OC2A 4JWPA 1F2OA 3DR6A 1S7NA 4UFVA 1P0HA 2REEA 4Y49C 1YLEA 4KOVA 3L2NA 3D7DA 5AG5A 2Q04A 1TF8A 2Z10A 3LWUA 4P4FA 2IL4A 2ATRA 5J1QA 4LUAA 2BO9A 2AJ6A 4UWJA 4AXVA 4CAEA 5JQ4A 4JYWA 5AG7A 1KWMA 2FVGA 2EO8A 5BWAB 1XIXA 5H86A 2I00A 4IAVA 2D4PA 4KOYA 3TO9A 1LAPA 4UEFA 3QAHA 4IF5A 3MGDA 3NH4A 4EVYA 3ZJ0A 3FRMA 5CBMA 4XPLA 2R8VA 1GYTA 2ZEGA 1I12A 3PRTA 1FNOA 4A31A 2G0BA 2QJ8A 2YGWA 3BLNA 5G21A 3RYOA 4CAWA 4CGNA 2OR4A 4NSQA 3UY5A 1HEEA 5G20A 2DPTA 2PRQA 3V7ZA 3TC8A 3GUXA 4MCRA 2AFWA 3IIBA 4NGSA 2PJ3A 3A9LA 1YQEA 2PJ8A 5JH9A 2Q44A 3BJ7A 4R57A 2FIWA 1VHSA 2ZW4A 1IIDA 3GKRA 4RI1A 1LANA 4F9UA 3KKWA 2ABZA 4CYNA 2PJCA 2P6EA 3PFOA 5ELYA 1R3NA 2JDDA 1A2ZA 4MHPA 5DWNA 4FAIA 4QBJA 2PR1A 4P4JA 2JEWA 4Z65A 3GYAA 2OZHA 2ZEDA 5THWA 1X10A 2HB6A 4CGOA 2ZEMA 4H2KA 2KCWA 1BLLE 4KLVA 3R1KA 2OH1A 4M3SA 4UCPA 2X7BA 2VZZA 1YSJA 3GLJA 2FXFA 4BD9A 5LYLA 3EC4A 4NJQA 1Y9WA 1TF9A 4R8FA 2AFXA 3CPAA 4B13A 3SJGA 3TT2A 3BJ8A 3RO0A 2RFHA 3PFEA 3I1UA 4DUKA 3WC6A 3FB3A 4R6TA 2CIJA 2G3TA 2RC4A 2VXKA 4UFXA 3B3CA 3KR4A 4HNYB 1XBUA 4GM5A 4DJLA 2EK9A 3IWEA 1CG2A 1SQHA 5DS0A 4KOXA 1Z4RA 3K9UA 4OIWA 1CX8A 1OZPA 4MY3A 4NCZA 4IK2A 4P4BA 4U9YA 4PXBA 2ZEFA 3CT9A 4MHDA 4XNHB 1CPXA 1YVKA 1M4LA 2OB0A 4OLLA 1NMTA 4JJXA 4QC6A 3N5FA 1ZLIA 3MRUA 4NFRA 4P10A 1DTDA 3S9MA 4JZ0A 3CZXA 3TOAA 1KUXA 4KOSA 1CP6A 2GE3A 2QECA 1QSTA 3BI0A 2ZPAA 3FF3A 3WABA 3JTKA 4F6AA 5I0CA 1WWZA 4MCQA 5IB9A 2PIZA 1ELMP 4RN7A 2CNSA 4MRIA 6CPAA 4X2TA 1M1DA 1M4IA 1N71A 1QSRA 1IGBA 2V8HA 3KASA 3KL9A 1Q2DA 4MJ8A 1BPMA 3FVLA 5JM6A 2Z3LA 2FE7A 3NH8A 4E8OA 2JEVA 4MFZA 4UF4A 1HDUA 1Z8XA 2B4DB 4AVBA 3WT4A 2B3UA 4EFDA 3FIXA 5I4MA 4CAVA 4RS2A 1ZG7A 3NA6A 2O4HA 4UCMA 3FYNA 4ORFA 2V8VA 2CY2A 4LQGA 3EFAA 3BI1A 5LRKA 1Y0YA 1X12A 2GFQA 4CGLA 2ANPA 3DLJA 4CAXA 3S9NA 4FWUA 3T8WA 3ISZA 2HQYA 3PP9A 4P4DA 4H6UA 1MJAA 4MXUA 1VIXA 4KUBA 1MJBA 3FH4A 1ZO0A 2VZYA 1TKHA 4AB7A 4MCSA 2YNDA 2QYVA 2VEZA 4J3GA 4W9YA 2PJBA 5CPAA 4MCPA 2FL4A 4OC0A 5A28A 5IB0A 5HMNA 2DPSA 2J8NA 4LQ6A 4NJRA 1ARLA 1VHEA 3BXMA 1RO5A 3VWEA 4ONWA 1S5KA 4PK2A 2WPXA 3PZJA 3IJ3A 1TXRA 1FY7A 5HXDA 3R9EA 4FD7A 2QMLA 3D7GA 3NE8A 4UIAA 4X8IA 1ZG9A 4FUUA 1J4JA 4CS0B 5K8OA 2PE3A 4X5KA 2J8RA 1NSAA 3B3SA 3R95A 5K8PA 4HPSA 4OADA 2VBQA 3DGVA 3D8PA 2GANA 2YNCA 5LYDA 4X3RA 4CGMA 2GREA 2Z3KA 3IU2A 2EVNA 2C1CA 2I79A 1JWQA 1YLOA 3IFEA 3CXPA 4CYQA 3V38A 4XNHC 2CNMA 3D4UA 1QQ9A 3B3VA 4KOWA 3R9FA 3KHXA 1B6BA 2BUEA 4ZY1A 1V0CA 4ONUA 2A4NA 1L0CA 2Z3NA 4KSIA 2B5GB 5JPHA 2Q43A 4QUSA
chains in the Genus database with same CATH topology
4XPKA 2P0WA 4IUSA 4JXQA 4Q36A 2FCKA 3PGPA 3SXNA 1S60A 4HKFA 4NXYA 2Q7BA 3SXOA 4B5PA 1PU9A 1CJWA 4K30A 3LD2A 1BO4A 4A32A 3TO6A 3NE7A 3TFYA 2FIAA 5AG4A 3GY9A 3DSBA 3TOBA 1MK4A 4E0AA 4LX9A 1LRZA 4YRHA 1XE4A 5IV0A 3IU1A 1Y9KA 4KSFA 3H5ZA 4UWIA 4B11A 2ARHA 3D2MA 2OZGA 1YX0A 1WK4A 4PV6A 4Q38A 4DNCA 2PR8A 4HNWB 1U6MA 2C27A 3D3SA 2Y0MA 4CYOA 2PQ8A 3TE4A 3FNCA 4JLYA 1QSOA 4A33A 4E2AA 2Z11A 4KSAA 4AVCA 2G3AA 3D2PA 1XEBA 4KOUA 3E0KA 4C68A 5A27A 3R9GA 1Q2YA 4MFQA 4QVTA 5DWMA 4KVXA 4CYPA 3FXTA 2OZUA 4KLWA 2ZW5A 3T9YA 3F0AA 1QSNA 2PDOA 3S6HA 3W91A 4BMHA 1MJ9A 2REFA 2B4DA 5J8CA 4FD4A 1R57A 4MY0A 5KTDA 1S7KA 5E96A 5GCNA 1M44A 4ZGYB 4H6ZA 4YGOA 4A95A 3CXQA 4U9ZA 5HH1A 1IYLA 3OWCA 4C7IA 5C82A 2P6FA 3SHPA 2WUUA 3JVNA 4QB9A 4XPDB 3H4QA 4CGPA 2ZW7A 5G22A 4JXRA 2Z3PA 4KZTA 1M4DA 2Z3OA 4C2ZA 2NMTA 5F47A 3EXNA 2Z0ZA 4R3KA 3TTHA 1S7LA 2R7HA 1UFHA 2BL1A 3F8KA 1NSLA 2P6GA 1I1DA 2PC1A 4B5OA 4B14A 4C2YA 4I49A 3QB8A 3R96A 2QIRA 2GIVA 5J8FA 3T90A 3P2FA 2ZXVA 3W6XA 5H84A 4R87A 1Z4EA 4PK3A 3TO7A 2WSAA 1YK3A 4M85A 3S6KA 3W6SA 2J8MA 2Z3MA 4C2XA 4L8AA 2FS5A 3G8WA 1TIQA 3DDDA 3IWGA 2YNEA 3F5BA 1CM0A 1IYKA 1ON0A 2DXQA 1S3ZA 1KUYA 1GHEA 4MFPA 1YR0A 5FVJA 2HV2A 5C88A 2VQYA 2EUIA 4PSXA 4KORA 3N7ZA 3B8GA 2JLMA 4MFLA 4U5YA 2WPWA 1XF8A 5AG6A 3VWDA 4UFWA 5EC4A 4KVOE 1YREA 5KTAA 1S7FA 4NEXA 5EBVA 3V8IA 2R1IA 4NF1A 2CXAA 4XPDC 1YVOA 5IX3A 3CXSA 5KTCA 1NE9A 4MI4A 5G1ZA 2BEIA 3I3GA 1IB1E 4A30A 4KOTA 4B12A 2Q4YA 3DNSA 3S6GA 4B5PB 1Z9UA 1KUVA 2B58A 2Q4VA 1Y7RA 1YGHA 3I9SA 3JUWA 4UA3A 4UCNA 3WR7A 2D4OA 1PUAA 3EO4A 4OAEA 4AG7A 2PRBA 4MBUA 4F0YA 2AE6A 4FD5A 1M4GA 4Y49B 5F46A 3C26A 4R3LA 4GS4A 3S6FA 4II9A 3TCVA 4H89A 4FD6A 4MFKA 3EY5A 4AG9A 2B4BA 1BOBA 3P2HA 2OU2A 1RXTA 2F5IA 4YFJA 4KUAA 4A2ZA 4CRYB 5AGEA 1B87A 2VI7A 1QSMA 4L89A 1I21A 2BSWA 4BBHA 3FBUA 4CAFA 4F0XA 2PSWA 1P4NA 3IGRA 5F48A 4CGLA 1IICA 2FSRA 4KVME 2K5TA 5ISVA 1VKCA 1K4JA 4R9MA 1XMTA 3DR8A 4MFJA 1KZFA 4UBRA 2H5MA 3ZZIA 3G3SA 5F49A 2O28A 1Q2CA 4PSWA 4ZBGA 2JDCA 4JD6A 4HNXB 4AVAA 2ZW6A 2Q0YA 2CNTA 2YNCC 2HUZA 4CRZB 5CNPA 2B3VA 3LODA 4KS9A 4C7HA 2R98A 2B5GA 2FT0A 4B10A 4JWPA 3DR6A 1S7NA 4UFVA 1P0HA 2REEA 4Y49C 1YLEA 4KOVA 5AG5A 2Q04A 2Z10A 2IL4A 2ATRA 4LUAA 2AJ6A 4UWJA 4CAEA 5JQ4A 5AG7A 5BWAB 1XIXA 5H86A 2I00A 4KOYA 2D4PA 3TO9A 3QAHA 4IF5A 3MGDA 4EVYA 3ZJ0A 3FRMA 4XPLA 2R8VA 4A31A 1I12A 2G0BA 2YGWA 3BLNA 5G21A 4CAWA 3RYOA 4CGNA 4NSQA 3UY5A 5G20A 2DPTA 3A9LA 2Q44A 3BJ7A 4R57A 2FIWA 1VHSA 2ZW4A 1IIDA 3GKRA 4RI1A 3KKWA 4CYNA 2P6EA 2JDDA 5DWNA 4QBJA 2PR1A 3GYAA 2OZHA 4CGOA 2KCWA 4KLVA 3R1KA 2OH1A 4M3SA 4UCPA 2X7BA 2VZZA 2FXFA 3EC4A 1Y9WA 4B13A 3TT2A 3BJ8A 3FB3A 2G3TA 2RC4A 2VXKA 4UFXA 4HNYB 3IWEA 1SQHA 4KOXA 1Z4RA 3K9UA 1OZPA 4MY3A 4NCZA 4U9YA 4XNHB 4MHDA 1YVKA 2OB0A 4OLLA 1NMTA 4JJXA 4QC6A 3TOAA 1KUXA 4KOSA 2GE3A 2QECA 1QSTA 2ZPAA 5I0CA 3JTKA 4F6AA 1WWZA 2CNSA 1M1DA 1M4IA 1N71A 1QSRA 1Q2DA 4MJ8A 2Z3LA 2FE7A 4E8OA 2JEVA 4MFZA 2B4DB 4AVBA 2B3UA 3FIXA 4CAVA 4RS2A 4UCMA 3FYNA 4ORFA 2CY2A 3EFAA 4CAXA 2HQYA 3PP9A 4H6UA 1MJAA 4KUBA 1MJBA 1ZO0A 2VZYA 4AB7A 2YNDA 4J3GA 2VEZA 2FL4A 5A28A 5IB0A 5HMNA 2DPSA 2J8NA 1RO5A 3VWEA 1S5KA 4PK2A 2WPXA 3PZJA 1FY7A 3R9EA 4FD7A 2QMLA 1J4JA 4CS0B 4X5KA 2J8RA 3R95A 4OADA 2VBQA 3D8PA 2GANA 4CGMA 2Z3KA 3IU2A 2EVNA 2I79A 3CXPA 4CYQA 4XNHC 2CNMA 4KOWA 3R9FA 1B6BA 2BUEA 1V0CA 4ONUA 2A4NA 1L0CA 2Z3NA 5JPHA 2B5GB 2YNCA 4QUSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XPK A;  2P0W A;  4IUS A;  4JXQ A;  2FCK A;  3PGP A;  3SXN A;  1S60 A;  4HKF A;  4NXY A;  2Q7B A;  3SXO A;  4B5P A;  1PU9 A;  1CJW A;  4K30 A;  3LD2 A;  1BO4 A;  3TO6 A;  3NE7 A;  3TFY A;  2FIA A;  3GY9 A;  3DSB A;  3TOB A;  1MK4 A;  4E0A A;  4LX9 A;  1LRZ A;  4YRH A;  1XE4 A;  5IV0 A;  1Y9K A;  4UWI A;  2ARH A;  3D2M A;  2OZG A;  1YX0 A;  1WK4 A;  4PV6 A;  2PR8 A;  4HNW B;  1U6M A;  2C27 A;  3D3S A;  2Y0M A;  2PQ8 A;  3TE4 A;  3FNC A;  4JLY A;  1QSO A;  4E2A A;  2Z11 A;  4AVC A;  2G3A A;  3D2P A;  1XEB A;  4KOU A;  3E0K A;  3R9G A;  1Q2Y A;  4QVT A;  5DWM A;  4KVX A;  3FXT A;  2OZU A;  4KLW A;  2ZW5 A;  3T9Y A;  3F0A A;  1QSN A;  2PDO A;  3S6H A;  3W91 A;  4BMH A;  1MJ9 A;  2REF A;  2B4D A;  5J8C A;  4FD4 A;  1R57 A;  4MY0 A;  5KTD A;  1S7K A;  5E96 A;  5GCN A;  1M44 A;  4H6Z A;  4YGO A;  3CXQ A;  4U9Z A;  5HH1 A;  1IYL A;  3OWC A;  5C82 A;  2P6F A;  3SHP A;  3JVN A;  4QB9 A;  4XPD B;  3H4Q A;  2ZW7 A;  4JXR A;  4KZT A;  1M4D A;  2NMT A;  5F47 A;  3EXN A;  2Z0Z A;  4R3K A;  3TTH A;  1S7L A;  2R7H A;  1UFH A;  2BL1 A;  3F8K A;  1NSL A;  2P6G A;  1I1D A;  2PC1 A;  4B5O A;  4I49 A;  3QB8 A;  3R96 A;  2QIR A;  2GIV A;  5J8F A;  3T90 A;  3P2F A;  2ZXV A;  3W6X A;  5H84 A;  4R87 A;  1Z4E A;  4PK3 A;  3TO7 A;  1YK3 A;  4M85 A;  3S6K A;  3W6S A;  2J8M A;  4L8A A;  2FS5 A;  3G8W A;  1TIQ A;  3DDD A;  3IWG A;  3F5B A;  1CM0 A;  1IYK A;  1ON0 A;  2DXQ A;  1S3Z A;  1KUY A;  1GHE A;  1YR0 A;  5FVJ A;  2HV2 A;  5C88 A;  2VQY A;  2EUI A;  4PSX A;  4KOR A;  3N7Z A;  3B8G A;  2JLM A;  4U5Y A;  2WPW A;  1XF8 A;  3VWD A;  5EC4 A;  4KVO E;  1YRE A;  5KTA A;  1S7F A;  4NEX A;  5EBV A;  3V8I A;  2R1I A;  4NF1 A;  4XPD C;  1YVO A;  5IX3 A;  3CXS A;  5KTC A;  1NE9 A;  4MI4 A;  2BEI A;  3I3G A;  1IB1 E;  4KOT A;  2Q4Y A;  3DNS A;  3S6G A;  4B5P B;  1Z9U A;  1KUV A;  2B58 A;  2Q4V A;  1Y7R A;  1YGH A;  3I9S A;  3JUW A;  4UA3 A;  3WR7 A;  4AG7 A;  2D4O A;  1PUA A;  3EO4 A;  4OAE A;  4DNC A;  2PRB A;  4MBU A;  4F0Y A;  2AE6 A;  4FD5 A;  1M4G A;  4Y49 B;  5F46 A;  3C26 A;  4R3L A;  4GS4 A;  3S6F A;  4II9 A;  3TCV A;  4H89 A;  4FD6 A;  3EY5 A;  4AG9 A;  2B4B A;  1BOB A;  3P2H A;  2OU2 A;  1RXT A;  2F5I A;  4YFJ A;  4KUA A;  4CRY B;  1B87 A;  2VI7 A;  1QSM A;  4L89 A;  1I21 A;  2BSW A;  3FBU A;  2PSW A;  1P4N A;  3IGR A;  5F48 A;  1IIC A;  2FSR A;  4KVM E;  2K5T A;  5ISV A;  1VKC A;  1K4J A;  4R9M A;  1XMT A;  3DR8 A;  1KZF A;  4UBR A;  2H5M A;  3ZZI A;  3G3S A;  5F49 A;  2O28 A;  1Q2C A;  4PSW A;  4ZBG A;  2JDC A;  4JD6 A;  4HNX B;  4AVA A;  2ZW6 A;  2Q0Y A;  2CNT A;  2HUZ A;  4CRZ B;  5CNP A;  2B3V A;  3LOD A;  2R98 A;  2B5G A;  2FT0 A;  4JWP A;  3DR6 A;  1S7N A;  1P0H A;  2REE A;  4Y49 C;  1YLE A;  4KOV A;  2Q04 A;  2Z10 A;  2IL4 A;  2ATR A;  4LUA A;  2AJ6 A;  4UWJ A;  5JQ4 A;  1XIX A;  5H86 A;  2I00 A;  4KOY A;  2D4P A;  3TO9 A;  3QAH A;  4IF5 A;  3MGD A;  4EVY A;  3ZJ0 A;  3FRM A;  4XPL A;  2R8V A;  1I12 A;  2G0B A;  4CAW A;  3BLN A;  3RYO A;  4NSQ A;  3UY5 A;  2Q44 A;  3BJ7 A;  4R57 A;  2FIW A;  1VHS A;  2ZW4 A;  1IID A;  3GKR A;  4RI1 A;  3KKW A;  2P6E A;  2JDD A;  5DWN A;  4QBJ A;  2PR1 A;  3GYA A;  2OZH A;  2KCW A;  4KLV A;  3R1K A;  2OH1 A;  4M3S A;  2X7B A;  2VZZ A;  2FXF A;  3EC4 A;  1Y9W A;  3TT2 A;  3BJ8 A;  3FB3 A;  2G3T A;  2RC4 A;  2VXK A;  4HNY B;  1SQH A;  4KOX A;  1Z4R A;  3K9U A;  1OZP A;  4MY3 A;  4NCZ A;  4U9Y A;  4XNH B;  4MHD A;  1YVK A;  2OB0 A;  4OLL A;  1NMT A;  4JJX A;  4QC6 A;  3TOA A;  1KUX A;  4KOS A;  2GE3 A;  2QEC A;  1QST A;  2ZPA A;  5I0C A;  4F6A A;  1WWZ A;  2CNS A;  1M1D A;  1M4I A;  1N71 A;  1QSR A;  1Q2D A;  4MJ8 A;  2FE7 A;  4E8O A;  2JEV A;  2B4D B;  4AVB A;  2B3U A;  3FIX A;  4CAV A;  4RS2 A;  3FYN A;  4ORF A;  2CY2 A;  3EFA A;  4CAX A;  2HQY A;  3PP9 A;  4H6U A;  1MJA A;  4KUB A;  1MJB A;  2VZY A;  4AB7 A;  4J3G A;  2VEZ A;  2FL4 A;  5IB0 A;  5HMN A;  2J8N A;  1RO5 A;  3VWE A;  1S5K A;  4PK2 A;  2WPX A;  3PZJ A;  1FY7 A;  3R9E A;  4FD7 A;  2QML A;  1J4J A;  4CS0 B;  4X5K A;  2J8R A;  3R95 A;  4OAD A;  2VBQ A;  3D8P A;  2GAN A;  2EVN A;  2I79 A;  3CXP A;  4XNH C;  2CNM A;  4KOW A;  3R9F A;  1B6B A;  2BUE A;  1V0C A;  4ONU A;  2A4N A;  1L0C A;  5JPH A;  2B5G B;  4QUS A; 
#chains in the Genus database with same CATH topology
 4XPK A;  2P0W A;  2BCO A;  1XFO A;  1XRY A;  4IUS A;  3WC5 A;  2JBK A;  4JXQ A;  4Q36 A;  2FCK A;  1ZG8 A;  3PGP A;  1S60 A;  4HKF A;  4NXY A;  3SXN A;  2Q7B A;  3RNZ A;  3SXO A;  4B5P A;  1PU9 A;  1CJW A;  4K30 A;  4FBE A;  2ZEP A;  3LD2 A;  2PJA A;  1BO4 A;  4A32 A;  3TO6 A;  3NE7 A;  1Y7E A;  2FIA A;  5AG4 A;  3TFY A;  3GY9 A;  3DSB A;  1F57 A;  1MK4 A;  3TOB A;  2ZOG A;  3GIU A;  4E0A A;  4LX9 A;  1LRZ A;  2POK A;  3SJX A;  4YRH A;  3PB9 X;  1XE4 A;  2XEG A;  3D7F A;  3IU1 A;  1Y9K A;  4O23 A;  5IV0 A;  4KSF A;  2NYQ A;  3PB6 X;  3H5Z A;  3FEE A;  3VAR A;  4UWI A;  4B11 A;  2ARH A;  3D2M A;  2OZG A;  4ZYQ A;  1YX0 A;  1WK4 A;  4PV6 A;  4P4I A;  3RBU A;  4Q38 A;  4DNC A;  2PR8 A;  4HNW B;  1U6M A;  4UIB A;  4ZY2 A;  2C27 A;  3D3S A;  2Y0M A;  4CYO A;  2PQ8 A;  2PJ0 A;  3IWW A;  3TE4 A;  1IY7 A;  2BOA A;  2EBJ A;  2IJZ A;  3FNC A;  4JLY A;  1QSO A;  4A33 A;  4E2A A;  2Z11 A;  3PB4 X;  4KSA A;  1CPS A;  2F8H A;  2G3A A;  4AVC A;  3D2P A;  1XJO A;  3GB0 A;  1XEB A;  1AUG A;  1CP7 A;  4KOU A;  3E0K A;  4C68 A;  4P4E A;  2PJ9 A;  1OBR A;  2PJ5 A;  2V8D A;  4MHZ A;  5A27 A;  2AFZ A;  3R9G A;  1Q2Y A;  4MFQ A;  4QVT A;  5DWM A;  4KVX A;  3KQX A;  3FXT A;  4CYP A;  2IQ6 A;  2OZU A;  3NFZ A;  4KLW A;  2ZW5 A;  3T9Y A;  4EWT A;  3F0A A;  1YW6 A;  1QSN A;  2PDO A;  4DYO A;  4NGQ A;  3S6H A;  3W91 A;  3S9L A;  2XEF A;  4BMH A;  2Q7S A;  1MJ9 A;  1Y0R A;  4IHM A;  2REF A;  2B4D A;  2V8G A;  5J8C A;  4FD4 A;  7CPA A;  1R57 A;  2WZN A;  1LAM A;  4M6H A;  1S7K A;  4MY0 A;  4PPZ A;  2IMO A;  3SI2 A;  3SJF A;  5KTD A;  5E96 A;  5GCN A;  1M44 A;  3LAC A;  4ZGY B;  4H6Z A;  2AFO A;  4YGO A;  3FMC A;  3CXQ A;  4A95 A;  1TKF A;  2PVW A;  1IOI A;  3FX6 A;  4OID A;  2EWB A;  2ZEN A;  1ELL P;  1PYT B;  4U9Z A;  5HH1 A;  1IYL A;  3OWC A;  2GLJ A;  4K3N A;  4CPA A;  4C7I A;  1AYE A;  3RAM A;  5LYI A;  5LYF A;  5C82 A;  2P6F A;  2NSM A;  3SHP A;  2DF5 A;  2WUU A;  3JVN A;  4QB9 A;  4XPD B;  3H4Q A;  4P44 A;  3VH9 A;  4CGP A;  1TKJ A;  2ZW7 A;  2CTB A;  4JXR A;  5G22 A;  2Z3P A;  4KZT A;  1M4D A;  2CTC A;  2Z3O A;  2ZEE A;  4UEE A;  4C2Z A;  2NMT A;  5F47 A;  3EXN A;  4TWE A;  3FJU A;  4MMO A;  4MHN A;  2Z0Z A;  3SI1 A;  4OC1 A;  4UEZ A;  4R3K A;  3TTH A;  3PB7 X;  1H8L A;  2O53 A;  1YW4 A;  2CF4 A;  3FEC A;  5HVH A;  1S7L A;  2R7H A;  2ZOF A;  8CPA A;  2VL1 A;  3D66 A;  1UFH A;  2BL1 A;  4YWY A;  3F8K A;  1NSL A;  2P6G A;  1I1D A;  2PC1 A;  3B3T A;  4NGM A;  4B5O A;  4B14 A;  4OME A;  4C2Y A;  4EME A;  4I49 A;  3QB8 A;  1BAV A;  3R96 A;  2QIR A;  2G9D A;  2GIV A;  2PJ1 A;  3KR5 A;  5J8F A;  3T90 A;  3P2F A;  2ZXV A;  4MHY A;  3W6X A;  5H84 A;  4R87 A;  5HVF A;  2QVP A;  4PXE A;  1Z4E A;  4PK3 A;  3TO7 A;  1Z8L A;  2WSA A;  3H8E A;  1YK3 A;  4M85 A;  1LFW A;  3S6K A;  2V77 A;  3CPX A;  1FT7 A;  4NGN A;  3W6S A;  2J8M A;  1AMP A;  2Z3M A;  2ZEL A;  4C2X A;  2PIY A;  4L8A A;  2FS5 A;  3G8W A;  1TIQ A;  2PJ7 A;  3KQZ A;  3DDD A;  5HVG A;  3B35 A;  2YNE A;  2PCU A;  3B2Y A;  3IWG A;  3SI0 A;  3F5B A;  1CM0 A;  4OC5 A;  1IYK A;  1ON0 A;  4YU9 A;  2DXQ A;  1KUY A;  1S3Z A;  3KI9 A;  1GHE A;  4MFP A;  4RUH A;  1YR0 A;  5FVJ A;  5LRG A;  2HV2 A;  2F7V A;  1ZLH A;  2PJ6 A;  5C88 A;  4WJB A;  2VQY A;  2EUI A;  4PSX A;  4PQA A;  3FED A;  1IU8 A;  2C6C A;  4KOR A;  4Q7A A;  3N7Z A;  3WR7 A;  3B8G A;  1VGY A;  1Z2L A;  2JLM A;  2XEJ A;  4MFL A;  4U5Y A;  2WPW A;  3ISX A;  1XF8 A;  5AG6 A;  3VWD A;  4UFW A;  1UWY A;  1DE4 C;  1VHO A;  1Z8W A;  3B3W A;  3QAY A;  5EC4 A;  4KVO E;  1LCP A;  4ZX9 A;  1YRE A;  4UA3 A;  4NGR A;  1S7F A;  4NEX A;  5KTA A;  5EBV A;  3V8I A;  2R1I A;  4NF1 A;  2CXA A;  1HDQ A;  5EMI A;  4GXH A;  4A39 A;  1YME A;  3MN8 A;  4XPD C;  5LRJ A;  1YVO A;  4A37 A;  5IX3 A;  3CXS A;  4P45 A;  1LOK A;  1JQG A;  3PBE A;  5KTC A;  1NE9 A;  4ZI6 A;  4NGP A;  3HUV A;  4MI4 A;  3PB8 X;  5G1Z A;  2BEI A;  3I3G A;  1IB1 E;  3KZW A;  4A30 A;  4KOT A;  4B12 A;  2Q4Y A;  4OC3 A;  1EE3 P;  3DNS A;  3S6G A;  2C6G A;  3KHZ A;  4B5P B;  1Z9U A;  2AFS A;  5K8N A;  3H8F A;  1KUV A;  2B58 A;  2Q4V A;  1Y7R A;  1BPN A;  1XMB A;  1YGH A;  2PJ4 A;  3I9S A;  3JUW A;  2D4O A;  1PUA A;  3EO4 A;  4NGT A;  4OAE A;  4UCN A;  4AG7 A;  2PRB A;  3PBB A;  4BIN A;  4MBU A;  4F0Y A;  2AE6 A;  4FD5 A;  1M4G A;  4Y49 B;  4TNU A;  5F46 A;  3C26 A;  2AFU A;  1Z5R A;  2C6P A;  3D68 A;  4R3L A;  4GS4 A;  4PXC A;  5D8N A;  3S6F A;  2ZEH A;  4R76 A;  1PCA A;  4R7M A;  4II9 A;  4G1P A;  3WC7 A;  4M6G A;  4PXD A;  3IC1 A;  2Q51 A;  3TCV A;  4H89 A;  4FD6 A;  5F09 A;  4MFK A;  3RZA A;  3EY5 A;  4OC4 A;  4AG9 A;  2B4B A;  1BOB A;  2Q4Z A;  3JRU A;  2EK8 A;  3P2H A;  4ZY0 A;  1QMU A;  3NH5 A;  3B7I A;  2OU2 A;  1RXT A;  2F5I A;  3BHX A;  1F2P A;  2OOT A;  3HLP A;  4YFJ A;  2J9A A;  4KUA A;  2GLF A;  4A2Z A;  1R43 A;  3PEI A;  5D29 A;  1ARM A;  4F8Z A;  4OP4 A;  1XOV A;  4B6Z A;  4CRY B;  5AGE A;  2I3C A;  1B87 A;  2VI7 A;  1QSM A;  2JBJ A;  2ODF A;  5K8M A;  4L89 A;  1I21 A;  2PVV A;  2BSW A;  3QNV A;  1CBX A;  4BBH A;  3FBU A;  4CAF A;  4F0X A;  2PSW A;  3SJE A;  1P4N A;  2ZEO A;  3IGR A;  5F48 A;  2PJ2 A;  2GU2 A;  1IIC A;  2FSR A;  4KVM E;  2K5T A;  3CDX A;  4M6I A;  1VKC A;  1K4J A;  4P6Y A;  1XMT A;  2WYR A;  3DR8 A;  4R9M A;  5ISV A;  4ZX8 A;  2HC9 A;  1RTQ A;  3IEH A;  1KZF A;  4MFJ A;  2H5M A;  4OKO A;  4UBR A;  3ZZI A;  3VAT A;  3G3S A;  4WWV A;  2O28 A;  1Q2C A;  1IOF A;  5F49 A;  4PSW A;  4A94 A;  4ZBG A;  3D7H A;  2JDC A;  4JD6 A;  3K9T A;  4HNX B;  2XEI A;  1Z8T A;  3D67 A;  1Q7L A;  4AVA A;  2ZW6 A;  2AFM A;  2RB7 A;  3IO1 A;  2Q0Y A;  2CNT A;  2YNC C;  3LMS A;  4F9V A;  2HUZ A;  4CRZ B;  5CNP A;  2DEA A;  4A38 A;  2B3V A;  3LOD A;  4KS9 A;  3K2K A;  3KGQ A;  4C7H A;  2R98 A;  2B5G A;  3H8G A;  2FT0 A;  3TX8 A;  4B10 A;  5JGF A;  4OC2 A;  4JWP A;  1F2O A;  3DR6 A;  1S7N A;  4UFV A;  1P0H A;  2REE A;  4Y49 C;  1YLE A;  4KOV A;  3L2N A;  3D7D A;  5AG5 A;  2Q04 A;  1TF8 A;  2Z10 A;  3LWU A;  4P4F A;  2IL4 A;  2ATR A;  5J1Q A;  4LUA A;  2BO9 A;  2AJ6 A;  4UWJ A;  4AXV A;  4CAE A;  5JQ4 A;  4JYW A;  5AG7 A;  1KWM A;  2FVG A;  2EO8 A;  5BWA B;  1XIX A;  5H86 A;  2I00 A;  4IAV A;  2D4P A;  4KOY A;  3TO9 A;  1LAP A;  4UEF A;  3QAH A;  4IF5 A;  3MGD A;  3NH4 A;  4EVY A;  3ZJ0 A;  3FRM A;  5CBM A;  4XPL A;  2R8V A;  1GYT A;  2ZEG A;  1I12 A;  3PRT A;  1FNO A;  4A31 A;  2G0B A;  2QJ8 A;  2YGW A;  3BLN A;  5G21 A;  3RYO A;  4CAW A;  4CGN A;  2OR4 A;  4NSQ A;  3UY5 A;  1HEE A;  5G20 A;  2DPT A;  2PRQ A;  3V7Z A;  3TC8 A;  3GUX A;  4MCR A;  2AFW A;  3IIB A;  4NGS A;  2PJ3 A;  3A9L A;  1YQE A;  2PJ8 A;  5JH9 A;  2Q44 A;  3BJ7 A;  4R57 A;  2FIW A;  1VHS A;  2ZW4 A;  1IID A;  3GKR A;  4RI1 A;  1LAN A;  4F9U A;  3KKW A;  2ABZ A;  4CYN A;  2PJC A;  2P6E A;  3PFO A;  5ELY A;  1R3N A;  2JDD A;  1A2Z A;  4MHP A;  5DWN A;  4FAI A;  4QBJ A;  2PR1 A;  4P4J A;  2JEW A;  4Z65 A;  3GYA A;  2OZH A;  2ZED A;  5THW A;  1X10 A;  2HB6 A;  4CGO A;  2ZEM A;  4H2K A;  2KCW A;  1BLL E;  4KLV A;  3R1K A;  2OH1 A;  4M3S A;  4UCP A;  2X7B A;  2VZZ A;  1YSJ A;  3GLJ A;  2FXF A;  4BD9 A;  5LYL A;  3EC4 A;  4NJQ A;  1Y9W A;  1TF9 A;  4R8F A;  2AFX A;  3CPA A;  4B13 A;  3SJG A;  3TT2 A;  3BJ8 A;  3RO0 A;  2RFH A;  3PFE A;  3I1U A;  4DUK A;  3WC6 A;  3FB3 A;  4R6T A;  2CIJ A;  2G3T A;  2RC4 A;  2VXK A;  4UFX A;  3B3C A;  3KR4 A;  4HNY B;  1XBU A;  4GM5 A;  4DJL A;  2EK9 A;  3IWE A;  1CG2 A;  1SQH A;  5DS0 A;  4KOX A;  1Z4R A;  3K9U A;  4OIW A;  1CX8 A;  1OZP A;  4MY3 A;  4NCZ A;  4IK2 A;  4P4B A;  4U9Y A;  4PXB A;  2ZEF A;  3CT9 A;  4MHD A;  4XNH B;  1CPX A;  1YVK A;  1M4L A;  2OB0 A;  4OLL A;  1NMT A;  4JJX A;  4QC6 A;  3N5F A;  1ZLI A;  3MRU A;  4NFR A;  4P10 A;  1DTD A;  3S9M A;  4JZ0 A;  3CZX A;  3TOA A;  1KUX A;  4KOS A;  1CP6 A;  2GE3 A;  2QEC A;  1QST A;  3BI0 A;  2ZPA A;  3FF3 A;  3WAB A;  3JTK A;  4F6A A;  5I0C A;  1WWZ A;  4MCQ A;  5IB9 A;  2PIZ A;  1ELM P;  4RN7 A;  2CNS A;  4MRI A;  6CPA A;  4X2T A;  1M1D A;  1M4I A;  1N71 A;  1QSR A;  1IGB A;  2V8H A;  3KAS A;  3KL9 A;  1Q2D A;  4MJ8 A;  1BPM A;  3FVL A;  5JM6 A;  2Z3L A;  2FE7 A;  3NH8 A;  4E8O A;  2JEV A;  4MFZ A;  4UF4 A;  1HDU A;  1Z8X A;  2B4D B;  4AVB A;  3WT4 A;  2B3U A;  4EFD A;  3FIX A;  5I4M A;  4CAV A;  4RS2 A;  1ZG7 A;  3NA6 A;  2O4H A;  4UCM A;  3FYN A;  4ORF A;  2V8V A;  2CY2 A;  4LQG A;  3EFA A;  3BI1 A;  5LRK A;  1Y0Y A;  1X12 A;  2GFQ A;  4CGL A;  2ANP A;  3DLJ A;  4CAX A;  3S9N A;  4FWU A;  3T8W A;  3ISZ A;  2HQY A;  3PP9 A;  4P4D A;  4H6U A;  1MJA A;  4MXU A;  1VIX A;  4KUB A;  1MJB A;  3FH4 A;  1ZO0 A;  2VZY A;  1TKH A;  4AB7 A;  4MCS A;  2YND A;  2QYV A;  2VEZ A;  4J3G A;  4W9Y A;  2PJB A;  5CPA A;  4MCP A;  2FL4 A;  4OC0 A;  5A28 A;  5IB0 A;  5HMN A;  2DPS A;  2J8N A;  4LQ6 A;  4NJR A;  1ARL A;  1VHE A;  3BXM A;  1RO5 A;  3VWE A;  4ONW A;  1S5K A;  4PK2 A;  2WPX A;  3PZJ A;  3IJ3 A;  1TXR A;  1FY7 A;  5HXD A;  3R9E A;  4FD7 A;  2QML A;  3D7G A;  3NE8 A;  4UIA A;  4X8I A;  1ZG9 A;  4FUU A;  1J4J A;  4CS0 B;  5K8O A;  2PE3 A;  4X5K A;  2J8R A;  1NSA A;  3B3S A;  3R95 A;  5K8P A;  4HPS A;  4OAD A;  2VBQ A;  3DGV A;  3D8P A;  2GAN A;  2YNC A;  5LYD A;  4X3R A;  4CGM A;  2GRE A;  2Z3K A;  3IU2 A;  2EVN A;  2C1C A;  2I79 A;  1JWQ A;  1YLO A;  3IFE A;  3CXP A;  4CYQ A;  3V38 A;  4XNH C;  2CNM A;  3D4U A;  1QQ9 A;  3B3V A;  4KOW A;  3R9F A;  3KHX A;  1B6B A;  2BUE A;  4ZY1 A;  1V0C A;  4ONU A;  2A4N A;  1L0C A;  2Z3N A;  4KSI A;  2B5G B;  5JPH A;  2Q43 A;  4QUS A; 
#chains in the Genus database with same CATH homology
 4XPK A;  2P0W A;  4IUS A;  4JXQ A;  4Q36 A;  2FCK A;  3PGP A;  3SXN A;  1S60 A;  4HKF A;  4NXY A;  2Q7B A;  3SXO A;  4B5P A;  1PU9 A;  1CJW A;  4K30 A;  3LD2 A;  1BO4 A;  4A32 A;  3TO6 A;  3NE7 A;  3TFY A;  2FIA A;  5AG4 A;  3GY9 A;  3DSB A;  3TOB A;  1MK4 A;  4E0A A;  4LX9 A;  1LRZ A;  4YRH A;  1XE4 A;  5IV0 A;  3IU1 A;  1Y9K A;  4KSF A;  3H5Z A;  4UWI A;  4B11 A;  2ARH A;  3D2M A;  2OZG A;  1YX0 A;  1WK4 A;  4PV6 A;  4Q38 A;  4DNC A;  2PR8 A;  4HNW B;  1U6M A;  2C27 A;  3D3S A;  2Y0M A;  4CYO A;  2PQ8 A;  3TE4 A;  3FNC A;  4JLY A;  1QSO A;  4A33 A;  4E2A A;  2Z11 A;  4KSA A;  4AVC A;  2G3A A;  3D2P A;  1XEB A;  4KOU A;  3E0K A;  4C68 A;  5A27 A;  3R9G A;  1Q2Y A;  4MFQ A;  4QVT A;  5DWM A;  4KVX A;  4CYP A;  3FXT A;  2OZU A;  4KLW A;  2ZW5 A;  3T9Y A;  3F0A A;  1QSN A;  2PDO A;  3S6H A;  3W91 A;  4BMH A;  1MJ9 A;  2REF A;  2B4D A;  5J8C A;  4FD4 A;  1R57 A;  4MY0 A;  5KTD A;  1S7K A;  5E96 A;  5GCN A;  1M44 A;  4ZGY B;  4H6Z A;  4YGO A;  4A95 A;  3CXQ A;  4U9Z A;  5HH1 A;  1IYL A;  3OWC A;  4C7I A;  5C82 A;  2P6F A;  3SHP A;  2WUU A;  3JVN A;  4QB9 A;  4XPD B;  3H4Q A;  4CGP A;  2ZW7 A;  5G22 A;  4JXR A;  2Z3P A;  4KZT A;  1M4D A;  2Z3O A;  4C2Z A;  2NMT A;  5F47 A;  3EXN A;  2Z0Z A;  4R3K A;  3TTH A;  1S7L A;  2R7H A;  1UFH A;  2BL1 A;  3F8K A;  1NSL A;  2P6G A;  1I1D A;  2PC1 A;  4B5O A;  4B14 A;  4C2Y A;  4I49 A;  3QB8 A;  3R96 A;  2QIR A;  2GIV A;  5J8F A;  3T90 A;  3P2F A;  2ZXV A;  3W6X A;  5H84 A;  4R87 A;  1Z4E A;  4PK3 A;  3TO7 A;  2WSA A;  1YK3 A;  4M85 A;  3S6K A;  3W6S A;  2J8M A;  2Z3M A;  4C2X A;  4L8A A;  2FS5 A;  3G8W A;  1TIQ A;  3DDD A;  3IWG A;  2YNE A;  3F5B A;  1CM0 A;  1IYK A;  1ON0 A;  2DXQ A;  1S3Z A;  1KUY A;  1GHE A;  4MFP A;  1YR0 A;  5FVJ A;  2HV2 A;  5C88 A;  2VQY A;  2EUI A;  4PSX A;  4KOR A;  3N7Z A;  3B8G A;  2JLM A;  4MFL A;  4U5Y A;  2WPW A;  1XF8 A;  5AG6 A;  3VWD A;  4UFW A;  5EC4 A;  4KVO E;  1YRE A;  5KTA A;  1S7F A;  4NEX A;  5EBV A;  3V8I A;  2R1I A;  4NF1 A;  2CXA A;  4XPD C;  1YVO A;  5IX3 A;  3CXS A;  5KTC A;  1NE9 A;  4MI4 A;  5G1Z A;  2BEI A;  3I3G A;  1IB1 E;  4A30 A;  4KOT A;  4B12 A;  2Q4Y A;  3DNS A;  3S6G A;  4B5P B;  1Z9U A;  1KUV A;  2B58 A;  2Q4V A;  1Y7R A;  1YGH A;  3I9S A;  3JUW A;  4UA3 A;  4UCN A;  3WR7 A;  2D4O A;  1PUA A;  3EO4 A;  4OAE A;  4AG7 A;  2PRB A;  4MBU A;  4F0Y A;  2AE6 A;  4FD5 A;  1M4G A;  4Y49 B;  5F46 A;  3C26 A;  4R3L A;  4GS4 A;  3S6F A;  4II9 A;  3TCV A;  4H89 A;  4FD6 A;  4MFK A;  3EY5 A;  4AG9 A;  2B4B A;  1BOB A;  3P2H A;  2OU2 A;  1RXT A;  2F5I A;  4YFJ A;  4KUA A;  4A2Z A;  4CRY B;  5AGE A;  1B87 A;  2VI7 A;  1QSM A;  4L89 A;  1I21 A;  2BSW A;  4BBH A;  3FBU A;  4CAF A;  4F0X A;  2PSW A;  1P4N A;  3IGR A;  5F48 A;  4CGL A;  1IIC A;  2FSR A;  4KVM E;  2K5T A;  5ISV A;  1VKC A;  1K4J A;  4R9M A;  1XMT A;  3DR8 A;  4MFJ A;  1KZF A;  4UBR A;  2H5M A;  3ZZI A;  3G3S A;  5F49 A;  2O28 A;  1Q2C A;  4PSW A;  4ZBG A;  2JDC A;  4JD6 A;  4HNX B;  4AVA A;  2ZW6 A;  2Q0Y A;  2CNT A;  2YNC C;  2HUZ A;  4CRZ B;  5CNP A;  2B3V A;  3LOD A;  4KS9 A;  4C7H A;  2R98 A;  2B5G A;  2FT0 A;  4B10 A;  4JWP A;  3DR6 A;  1S7N A;  4UFV A;  1P0H A;  2REE A;  4Y49 C;  1YLE A;  4KOV A;  5AG5 A;  2Q04 A;  2Z10 A;  2IL4 A;  2ATR A;  4LUA A;  2AJ6 A;  4UWJ A;  4CAE A;  5JQ4 A;  5AG7 A;  5BWA B;  1XIX A;  5H86 A;  2I00 A;  4KOY A;  2D4P A;  3TO9 A;  3QAH A;  4IF5 A;  3MGD A;  4EVY A;  3ZJ0 A;  3FRM A;  4XPL A;  2R8V A;  4A31 A;  1I12 A;  2G0B A;  2YGW A;  3BLN A;  5G21 A;  4CAW A;  3RYO A;  4CGN A;  4NSQ A;  3UY5 A;  5G20 A;  2DPT A;  3A9L A;  2Q44 A;  3BJ7 A;  4R57 A;  2FIW A;  1VHS A;  2ZW4 A;  1IID A;  3GKR A;  4RI1 A;  3KKW A;  4CYN A;  2P6E A;  2JDD A;  5DWN A;  4QBJ A;  2PR1 A;  3GYA A;  2OZH A;  4CGO A;  2KCW A;  4KLV A;  3R1K A;  2OH1 A;  4M3S A;  4UCP A;  2X7B A;  2VZZ A;  2FXF A;  3EC4 A;  1Y9W A;  4B13 A;  3TT2 A;  3BJ8 A;  3FB3 A;  2G3T A;  2RC4 A;  2VXK A;  4UFX A;  4HNY B;  3IWE A;  1SQH A;  4KOX A;  1Z4R A;  3K9U A;  1OZP A;  4MY3 A;  4NCZ A;  4U9Y A;  4XNH B;  4MHD A;  1YVK A;  2OB0 A;  4OLL A;  1NMT A;  4JJX A;  4QC6 A;  3TOA A;  1KUX A;  4KOS A;  2GE3 A;  2QEC A;  1QST A;  2ZPA A;  5I0C A;  3JTK A;  4F6A A;  1WWZ A;  2CNS A;  1M1D A;  1M4I A;  1N71 A;  1QSR A;  1Q2D A;  4MJ8 A;  2Z3L A;  2FE7 A;  4E8O A;  2JEV A;  4MFZ A;  2B4D B;  4AVB A;  2B3U A;  3FIX A;  4CAV A;  4RS2 A;  4UCM A;  3FYN A;  4ORF A;  2CY2 A;  3EFA A;  4CAX A;  2HQY A;  3PP9 A;  4H6U A;  1MJA A;  4KUB A;  1MJB A;  1ZO0 A;  2VZY A;  4AB7 A;  2YND A;  4J3G A;  2VEZ A;  2FL4 A;  5A28 A;  5IB0 A;  5HMN A;  2DPS A;  2J8N A;  1RO5 A;  3VWE A;  1S5K A;  4PK2 A;  2WPX A;  3PZJ A;  1FY7 A;  3R9E A;  4FD7 A;  2QML A;  1J4J A;  4CS0 B;  4X5K A;  2J8R A;  3R95 A;  4OAD A;  2VBQ A;  3D8P A;  2GAN A;  4CGM A;  2Z3K A;  3IU2 A;  2EVN A;  2I79 A;  3CXP A;  4CYQ A;  4XNH C;  2CNM A;  4KOW A;  3R9F A;  1B6B A;  2BUE A;  1V0C A;  4ONU A;  2A4N A;  1L0C A;  2Z3N A;  5JPH A;  2B5G B;  2YNC A;  4QUS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...