4KUBA

Crystal structure of a gnat superfamily acetyltransferase pa4794 in complex with coa
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
160
structure length
160
Chain Sequence
HMQLSHRPAETGDLETVAGFPQDRDELFYCYPKAIWPFSVAQLAAAIAERRGSTVAVHDGQVLGFANFYQWQHGDFCALGNMMVAPAARGLGVARYLIGVMENLAREQYKARLMKISCFNANAAGLLLYTQLGYQPRAIAERHDPDGRRVALIQMDKPLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GNAT superfamily acetyltransferase PA4794
publication title Structural, functional, and inhibition studies of a Gcn5-related N-acetyltransferase (GNAT) superfamily protein PA4794: a new C-terminal lysine protein acetyltransferase from pseudomonas aeruginosa.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Transferase
total genus 46
structure length 160
sequence length 160
ec nomenclature
pdb deposition date 2013-05-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4kubA00
2G0BA 4Y49C 1PUAA 4NEXA 1KUVA 3ZJ0A 1I21A 5F48A 1ON0A 1GHEA 2REEA 3P2HA 3W6XA 4JLYA 3H4QA 1M1DA 4PV6A 5J8FA 2J8NA 4F6AA 3UY5A 1K4JA 2O28A 5E96A 3E0KA 2BEIA 3QAHA 3TOAA 3GYAA 4R3KA 2B4BA 4AVAA 1XIXA 4H6UA 1MJBA 4JJXA 1NMTA 2VZYA 4EVYA 1S5KA 1YVKA 1RO5A 4UWJA 5DWNA 1YVOA 3TFYA 1Y9KA 3D2MA 4ONUA 4E0AA 2C27A 1KZFA 5H86A 3SXOA 1VKCA 3EFAA 1I12A 2Q44A 2D4OA 4QUSA 3T9YA 2I79A 1SQHA 2BUEA 3JUWA 2B5GA 1YX0A 2P6EA 5F47A 3NE7A 3N7ZA 2ARHA 1YREA 3WR7A 2RC4A 2Q4VA 3GKRA 1V0CA 2REFA 2Q04A 3S6KA 1OZPA 1XF8A 3FBUA 1QSRA 2HQYA 1LRZA 1MK4A 3T90A 3BJ7A 3ZZIA 3R9EA 5KTCA 2K5TA 3D8PA 4CS0B 1Y9WA 1IB1E 4U9ZA 3F8KA 1YGHA 3FNCA 4ZBGA 5JQ4A 1QSMA 4J3GA 4KOXA 3TOBA 4AB7A 2QECA 4AG9A 2ZW6A 2PSWA 4PSWA 4FD5A 2FSRA 4KORA 3PP9A 4XPKA 4FD6A 3S6FA 3K9UA 4E2AA 1Z9UA 4KOWA 5I0CA 2FIWA 3EO4A 4KVXA 2Z11A 3C26A 4PK2A 4KVME 2CNMA 3EXNA 2Q7BA 1XEBA 3TO6A 4ORFA 1M4IA 4AVBA 4E8OA 4CAXA 2BL1A 4QVTA 2PQ8A 3W91A 2KCWA 3QB8A 2J8RA 3FIXA 3TE4A 2J8MA 1FY7A 3D2PA 4UBRA 4GS4A 4R3LA 1CJWA 4UWIA 3S6HA 1P4NA 1XMTA 4KOTA 2GE3A 5FVJA 1S3ZA 2WPXA 3DNSA 1NSLA 3IWGA 4PSXA 4R9MA 5F49A 2OZHA 3DR6A 3FRMA 4XPDB 2R98A 2Q0YA 4B5PB 3FXTA 3R95A 2FL4A 2G3AA 5EBVA 4L89A 1Q2CA 1MJAA 4NCZA 5HMNA 3DSBA 2PR8A 3TTHA 3FYNA 1RXTA 1J4JA 2DXQA 3G8WA 4FD4A 4XPLA 5DWMA 4OAEA 2VXKA 2HUZA 3VWEA 2B4DA 1KUXA 1BO4A 1I1DA 4KOUA 1M44A 2PDOA 4KUBA 2AE6A 4AVCA 3I9SA 2B3UA 1B6BA 4KZTA 2X7BA 3FB3A 2OZGA 4YRHA 3S6GA 2JDDA 5H84A 4I49A 4XNHC 2OB0A 4B5OA 4KVOE 4K30A 4PK3A 4RS2A 5C88A 2G3TA 5ISVA 2F5IA 4HNXB 1MJ9A 1IYLA 2CY2A 2A4NA 2JEVA 3SHPA 5KTDA 3TO7A 2B58A 2FIAA 2Y0MA 3EC4A 4IUSA 4M85A 1S7NA 1L0CA 2GANA 2PR1A 4HNYB 4IF5A 1QSOA 4HKFA 2P0WA 4NXYA 3PGPA 3CXQA 4CRZB 4CRYB 3V8IA 4X5KA 3TO9A 3IGRA 4L8AA 2P6GA 4CAVA 2PRBA 2ZXVA 2ZW7A 3LD2A 2CNSA 4MY3A 4MI4A 1QSTA 5HH1A 3VWDA 1IIDA 2QMLA 3R1KA 1Z4EA 1N71A 1IICA 1CM0A 3F0AA 5CNPA 3EY5A 2ZPAA 2ATRA 1B87A 4Y49B 4F0YA 3B8GA 3DDDA 3BLNA 3OWCA 4II9A 2FXFA 4JXQA 5EC4A 1YLEA 2R1IA 4KOYA 1R57A 2OU2A 4FD7A 2PC1A 2VI7A 4U9YA 4M3SA 2Q4YA 4OADA 3MGDA 2EVNA 4MY0A 5C82A 3DR8A 4CAWA 2D4PA 4RI1A 4XPDC 4UA3A 1IYKA 1S7LA 4B5PA 2B3VA 3P2FA 1YR0A 2R8VA 2Z0ZA 4JWPA 2JDCA 2FT0A 2FE7A 3GY9A 5IX3A 3TT2A 3LODA 1NE9A 1Q2DA 4NF1A 2FS5A 2HV2A 4LX9A 4MHDA 1VHSA 1TIQA 3BJ8A 4KOSA 1WK4A 3CXSA 4MBUA 4QBJA 2ZW4A 1S60A 1KUYA 5F46A 3R9GA 3G3SA 2Z10A 1M4DA 4LUAA 4KUAA 2B5GB 1U6MA 1M4GA 4DNCA 4HNWB 3PZJA 5GCNA 4AG7A 4YGOA 4KLWA 3F5BA 5IV0A 4BMHA 2GIVA 4QB9A 2OZUA 3JVNA 3R9FA 4R57A 5IB0A 4R87A 5JPHA 2B4DB 4OLLA 2H5MA 4U5YA 1S7KA 3I3GA 4KLVA 2VEZA 1Z4RA 4H6ZA 4H89A 2VQYA 4JXRA 2NMTA 3D3SA 2QIRA 3CXPA 2JLMA 4NSQA 1QSNA 5KTAA 2R7HA 1XE4A 3TCVA 4XNHB 1WWZA 1BOBA 2EUIA 2FCKA 2VBQA 1PU9A 2P6FA 2WPWA 2OH1A 5J8CA 2ZW5A 4KOVA 4YFJA 3R96A 4MJ8A 1Q2YA 2IL4A 2CNTA 3KKWA 4JD6A 2AJ6A 1S7FA 1Y7RA 1UFHA 2VZZA 2BSWA 4QC6A 2I00A 3W6SA 1YK3A 3SXNA 1P0HA 3RYOA
chains in the Genus database with same CATH superfamily
1FT7A 2G0BA 4UF4A 1ARMA 3VH9A 4A95A 4Y49C 1PUAA 2C6PA 4NEXA 4R8FA 1KUVA 3ZJ0A 1XOVA 1ZG7A 1I21A 5K8MA 2GLJA 3RBUA 2PJ7A 3WC6A 4C2XA 4PXEA 1ON0A 5F48A 1GHEA 2REEA 3P2HA 3W6XA 4JLYA 3H4QA 1M1DA 3LMSA 1CPXA 2GLFA 2Z3OA 2F8HA 4MXUA 2QYVA 4PV6A 4F9VA 5J8FA 3D4UA 5LYLA 1HDQA 1CP6A 2J8NA 3HUVA 4F6AA 4HPSA 4R7MA 2ANPA 2PJ5A 4AXVA 3V7ZA 4F8ZA 5I4MA 3UY5A 1K4JA 2O28A 5E96A 2PJ4A 4OC1A 3E0KA 3B3CA 4P6YA 2BEIA 4UIAA 3QAHA 1ZG9A 3TOAA 1HDUA 3GYAA 4R3KA 2YNEA 2B4BA 2AFWA 3NH4A 4AVAA 1Y0YA 1XIXA 2Z3NA 4H6UA 3WC5A 3IU2A 4R76A 4X8IA 1F2PA 1MJBA 5LRJA 4JJXA 1NMTA 2VZYA 4EVYA 1S5KA 4MMOA 1YVKA 1RO5A 4EFDA 3FF3A 3GIUA 4UWJA 2WYRA 4MCPA 5DWNA 3IEHA 1YVOA 2EBJA 3PB7X 4NFRA 3ISZA 4DYOA 1BPNA 2C6CA 3TFYA 3IU1A 1Y9KA 3D2MA 2ZEFA 2GFQA 3CZXA 4ONUA 4E0AA 2C27A 1KZFA 2O53A 5H86A 3CDXA 4O23A 4C68A 3SXOA 1VKCA 3EFAA 1I12A 2Q44A 4M6HA 2PVVA 4EMEA 2EO8A 5ELYA 2D4OA 4QUSA 4A2ZA 3T9YA 2I79A 1SQHA 2BUEA 2HB6A 4OC0A 5K8PA 3JUWA 2B5GA 2C1CA 1YX0A 1NSAA 4GXHA 4P4EA 2P6EA 5F47A 4CGOA 4ZY1A 3NE7A 3H8FA 4CYQA 3N7ZA 2ARHA 3SJXA 1YREA 3WR7A 3FVLA 5BWAB 2RC4A 2ZEMA 2Q4VA 5AGEA 3CPAA 3GKRA 4IAVA 1V0CA 2REFA 2Q04A 1AUGA 2NYQA 4CGNA 3B35A 3K9TA 4MCRA 2OR4A 5LYDA 3S6KA 2PIYA 1OZPA 2NSMA 2JBKA 2AFZA 1GYTA 1XF8A 2CTCA 1XRYA 3FBUA 1QSRA 3D67A 5DS0A 2ZEPA 3NH8A 5CBMA 3IO1A 2HQYA 2IMOA 1LRZA 1MK4A 2BCOA 4A31A 1XJOA 3T90A 5LRKA 4UCMA 3BJ7A 3BI0A 3ZZIA 1LAPA 2V77A 4UEZA 3R9EA 1TKJA 2ZOGA 4OKOA 3JTKA 5KTCA 3FX6A 2K5TA 3D8PA 3NA6A 3SJGA 2ZEHA 3I1UA 3RNZA 4CS0B 4PXCA 2VL1A 1Y9WA 1IB1E 2Q7SA 4U9ZA 3F8KA 3WC7A 1YGHA 2PVWA 4CGPA 3FNCA 4MHPA 2XEIA 4ZBGA 3SI1A 5JQ4A 2RFHA 1QSMA 4J3GA 4A32A 3FJUA 4KOXA 3TOBA 4IHMA 4AB7A 1ARLA 3FH4A 3FMCA 2QECA 4ZX8A 4AG9A 2ZW6A 4MHZA 1M4LA 2PSWA 4TNUA 4PSWA 2DPSA 3TC8A 4NGTA 4FD5A 2FSRA 3D66A 4KORA 3PP9A 4XPKA 4FD6A 5G22A 3S6FA 3K9UA 4OIWA 3NE8A 1XFOA 3GUXA 2O4HA 4E2AA 1Z9UA 4KOWA 2GREA 5I0CA 2FIWA 3EO4A 6CPAA 4CGLA 1UWYA 4YU9A 5LYFA 4C2YA 4KVXA 5K8OA 2Q43A 4ZX9A 2Z11A 4CYPA 3C26A 4RUHA 4ZI6A 4NJRA 4PK2A 4KVME 2CNMA 3EXNA 3PB6X 1Y0RA 4OC3A 2Q7BA 1XEBA 2XEJA 3TO6A 2YNCA 4ORFA 5J1QA 2ZELA 4TWEA 5LRGA 1M4IA 4AVBA 1IGBA 4E8OA 4CAXA 2BL1A 4QVTA 2HC9A 4ZY0A 2CXAA 2PQ8A 1LAMA 3H5ZA 4NGMA 3S9MA 3W91A 4CPAA 2KCWA 4P44A 2ZOFA 3PEIA 4ZGYB 4OIDA 4C7IA 3QB8A 1Z2LA 2J8RA 3FIXA 3TE4A 2J8MA 4OC2A 4UFWA 1FY7A 3D2PA 4PPZA 4UBRA 4GS4A 1Z8TA 4R3LA 2ABZA 1CJWA 1Z5RA 4MRIA 4UIBA 5THWA 4A33A 4DUKA 4UWIA 3DGVA 4MHNA 1H8LA 2CF4A 3S6HA 1P4NA 1XMTA 2ZENA 4KOTA 2GE3A 2AFOA 4G1PA 2RB7A 4M6IA 4Q36A 5FVJA 4JZ0A 5G20A 4P4IA 1S3ZA 2WPXA 3DNSA 4CYNA 3S9LA 4KSFA 3V38A 1NSLA 4EWTA 3IWGA 1TKHA 4PSXA 4R9MA 5F49A 1X10A 2OZHA 4OC4A 1R3NA 2JBJA 3DR6A 3FRMA 4XPDB 4FAIA 2AFMA 2EWBA 2R98A 3PB8X 2PJ1A 2Q0YA 2PJBA 4B5PB 3FXTA 5G1ZA 3R95A 2FL4A 1ELMP 2F7VA 2G3AA 5EBVA 3NFZA 4L89A 5HXDA 1Q2CA 1Z8XA 1MJAA 2PE3A 1DE4C 2YGWA 4NCZA 3PBEA 4LQGA 3SI2A 5HMNA 4P4FA 1YW6A 3DSBA 1IOFA 2PR8A 4PXDA 3PB4X 3TTHA 3MRUA 4ZY2A 2PJ3A 3FYNA 3WABA 2CTBA 1RXTA 1J4JA 1VHEA 2V8VA 2XEGA 5K8NA 2DXQA 3G8WA 4FD4A 5F09A 4MCQA 5HVGA 1Q7LA 4ONWA 2Q4ZA 4UFVA 4XPLA 5LYIA 3FEEA 5DWMA 4B11A 4OAEA 3D68A 4UCPA 3B3WA 2VXKA 2HUZA 3VWEA 2B4DA 1KUXA 2PJAA 1QMUA 1YW4A 1BO4A 2C6GA 1I1DA 1YQEA 2GU2A 4KOUA 1M44A 1LANA 2PDOA 3ISXA 4KUBA 2AE6A 3IC1A 4H2KA 1HEEA 3B3VA 2QVPA 4AVCA 4C7HA 2PRQA 3I9SA 5CPAA 2B3UA 4FWUA 1B6BA 4KZTA 5AG4A 2X7BA 5EMIA 2AFSA 3FB3A 2OZGA 4YRHA 3PRTA 1DTDA 3CPXA 4CGMA 3S6GA 2JDDA 5H84A 2PJ2A 4I49A 4MFKA 4XNHC 2OB0A 2ZEOA 3RZAA 3A9LA 2Z3PA 4KVOE 4WWVA 4B5OA 2DPTA 2ZEEA 3PFEA 4K30A 4PK3A 4RS2A 4MFJA 5G21A 5C88A 4P4BA 3SJEA 2G3TA 3IJ3A 5ISVA 2F5IA 4HNXB 3N5FA 4NGQA 1MJ9A 4P10A 4X2TA 1IYLA 2CY2A 3VATA 1A2ZA 2A4NA 2JEVA 2AFUA 2IJZA 3SHPA 5KTDA 1BPMA 2B58A 2FIAA 1R43A 4NJQA 3TO7A 2Y0MA 3EC4A 2PCUA 4IUSA 4OMEA 3KGQA 4M85A 1S7NA 4KS9A 1ZLHA 1L0CA 4P4JA 5HVHA 2GANA 2PR1A 4HNYB 4IF5A 4CAFA 1QSOA 3KR4A 2Z3LA 1AMPA 4HKFA 2P0WA 4JYWA 3KZWA 4NXYA 3PGPA 3CXQA 4CRZB 4X3RA 4CRYB 3IWEA 3V8IA 4X5KA 3TO9A 3IGRA 4L8AA 2P6GA 3L2NA 3QNVA 1LCPA 2Q51A 4CAVA 2PRBA 4FBEA 3FEDA 2PJ6A 2ZXVA 3IWWA 4NGPA 3T8WA 5JH9A 3FECA 1BAVA 4M6GA 2YNCC 2ZW7A 3LD2A 1IU8A 2CNSA 4K3NA 4MHYA 4MY3A 4MI4A 2FVGA 1TKFA 2WUUA 1QSTA 5HH1A 5JM6A 3VWDA 1IIDA 2QMLA 3R1KA 1Z4EA 1N71A 4BD9A 5JGFA 1IICA 1CM0A 1VIXA 3F0AA 5CNPA 1YMEA 2CIJA 1EE3P 3EY5A 2ZPAA 1LFWA 2ATRA 2PJ0A 2QJ8A 1B87A 4Y49B 4B10A 3KHZA 3B8GA 3DDDA 2PJ8A 3BLNA 3PB9X 5D29A 3KI9A 4F0YA 4UCNA 3SI0A 4CAEA 1TXRA 3OWCA 4PXBA 1VHOA 1X12A 1BLLE 2V8DA 1PYTB 2PJ9A 3CT9A 3D7HA 4II9A 2FXFA 2ZEDA 2POKA 4JXQA 4NGSA 5EC4A 1YLEA 1F2OA 3KL9A 3LWUA 2R1IA 4KOYA 4WJBA 3IFEA 1R57A 2OU2A 4R6TA 2J9AA 4FD7A 2PC1A 1XMBA 2VI7A 4B12A 4U9YA 3IIBA 4M3SA 2Q4YA 3GLJA 4OADA 5AG5A 2PIZA 1RTQA 3MGDA 2EVNA 4UEFA 4MY0A 3KHXA 1TF9A 4LQ6A 5C82A 1ZLIA 4MFLA 3DR8A 3PFOA 4A94A 1AYEA 4CAWA 2D4PA 2EK9A 4RI1A 2PJCA 4UA3A 1IYKA 4XPDC 3TX8A 4A38A 3B2YA 4W9YA 1S7LA 4B5PA 2B3VA 1XBUA 5A28A 3P2FA 4DJLA 1YR0A 2R8VA 2Z0ZA 1ZO0A 3D7GA 4MFPA 4JWPA 4B6ZA 2JDCA 4A30A 2FT0A 2FE7A 3GY9A 4UEEA 5IX3A 2ZEGA 3TT2A 5IB9A 3LODA 1OBRA 4YWYA 5AG6A 1NE9A 1Q2DA 4NF1A 2FS5A 2HV2A 4BBHA 4LX9A 4MHDA 1Z8WA 1LOKA 1VHSA 1TIQA 2XEFA 3BJ8A 4KOSA 4PQAA 2YNDA 1WK4A 3PBBA 3CXSA 3B3TA 3D7FA 4MBUA 1Z8LA 4QBJA 4ZYQA 1JWQA 2ZW4A 1S60A 4Q7AA 1KUYA 5F46A 3R9GA 3G3SA 2Z10A 1M4DA 2BOAA 4OP4A 4LUAA 4KUAA 2OOTA 3RAMA 1CBXA 3HLPA 3JRUA 1CP7A 3GB0A 4Q38A 2B5GB 2JEWA 2DF5A 5HVFA 4CYOA 3VARA 1U6MA 4NGRA 1M4GA 3LACA 4DNCA 4HNWB 3PZJA 3BHXA 5GCNA 4AG7A 4YGOA 4C2ZA 3QAYA 4KLWA 4F9UA 4A37A 2I3CA 3F5BA 3NH5A 4P4DA 5IV0A 1QQ9A 4BMHA 1YLOA 1KWMA 2GIVA 2IQ6A 4QB9A 2OZUA 4MFZA 4KSIA 4UFXA 3JVNA 3KASA 3R9FA 3K2KA 4R57A 2EK8A 5IB0A 4R87A 5JPHA 3D7DA 2B4DB 4OLLA 2DEAA 2H5MA 4U5YA 1S7KA 4Z65A 3I3GA 4KLVA 4MCSA 2VEZA 1Z4RA 2VQYA 4H6ZA 2V8HA 4H89A 4JXRA 5AG7A 3DLJA 3BI1A 4B13A 2NMTA 3RO0A 4P45A 1FNOA 3BXMA 1PCAA 1ZG8A 3D3SA 2Z3MA 2WZNA 1IOIA 1CX8A 2QIRA 3CXPA 2JLMA 4NSQA 4OC5A 1QSNA 2G9DA 3MN8A 5KTAA 1CPSA 2R7HA 1XE4A 3TCVA 4RN7A 4XNHB 1WWZA 2AFXA 1BOBA 2EUIA 2FCKA 4KSAA 1ELLP 2VBQA 5D8NA 1PU9A 2P6FA 2WPWA 2OH1A 3SJFA 5J8CA 2ZW5A 3KR5A 4KOVA 4YFJA 3R96A 1IY7A 1TF8A 4MFQA 4MJ8A 1Q2YA 2IL4A 2ODFA 1YSJA 1JQGA 2CNTA 1F57A 2Z3KA 3KKWA 3B7IA 2AJ6A 4JD6A 1VGYA 3WT4A 5A27A 7CPAA 2WSAA 1S7FA 3H8EA 4IK2A 3B3SA 1CG2A 1Y7RA 2BO9A 1UFHA 3KQXA 2VZZA 2BSWA 4FUUA 1Y7EA 8CPAA 3KQZA 4QC6A 2I00A 4B14A 3W6SA 1YK3A 4GM5A 3SXNA 4BINA 1P0HA 4F0XA 3S9NA 3H8GA 4NGNA 3RYOA 2V8GA 4A39A
chains in the Genus database with same CATH topology
2G0BA 4A95A 4Y49C 1PUAA 4NEXA 1KUVA 3ZJ0A 1I21A 4C2XA 5F48A 1ON0A 1GHEA 2REEA 3P2HA 3W6XA 4JLYA 3H4QA 1M1DA 2Z3OA 4PV6A 5J8FA 2J8NA 4F6AA 3UY5A 1K4JA 2O28A 5E96A 3E0KA 2BEIA 3QAHA 3TOAA 3GYAA 4R3KA 2YNEA 2B4BA 4AVAA 1XIXA 2Z3NA 4H6UA 3IU2A 1MJBA 4JJXA 1NMTA 2VZYA 4EVYA 1S5KA 1YVKA 1RO5A 4UWJA 5DWNA 1YVOA 3TFYA 3IU1A 1Y9KA 3D2MA 4ONUA 4E0AA 2C27A 1KZFA 5H86A 4C68A 3SXOA 1VKCA 3EFAA 1I12A 2Q44A 2D4OA 4QUSA 4A2ZA 3T9YA 2I79A 1SQHA 2BUEA 3JUWA 2B5GA 1YX0A 2P6EA 5F47A 4CGOA 3NE7A 4CYQA 3N7ZA 2ARHA 1YREA 3WR7A 5BWAB 2RC4A 2Q4VA 5AGEA 3GKRA 1V0CA 2REFA 2Q04A 4CGNA 3S6KA 1OZPA 1XF8A 3FBUA 1QSRA 2HQYA 1LRZA 1MK4A 4A31A 3T90A 4UCMA 3BJ7A 3ZZIA 3R9EA 5KTCA 3JTKA 2K5TA 3D8PA 4CS0B 1Y9WA 1IB1E 4U9ZA 3F8KA 1YGHA 4CGPA 3FNCA 4ZBGA 5JQ4A 1QSMA 4J3GA 4A32A 4KOXA 3TOBA 4AB7A 2QECA 4AG9A 2ZW6A 2PSWA 4PSWA 2DPSA 4FD5A 2FSRA 4KORA 3PP9A 4XPKA 4FD6A 5G22A 3S6FA 3K9UA 4E2AA 1Z9UA 4KOWA 5I0CA 2FIWA 3EO4A 4CGLA 4C2YA 4KVXA 2Z11A 4CYPA 3C26A 4PK2A 4KVME 2CNMA 3EXNA 2Q7BA 1XEBA 3TO6A 2YNCA 4ORFA 1M4IA 4AVBA 4E8OA 4CAXA 2BL1A 4QVTA 2CXAA 2PQ8A 3H5ZA 3W91A 2KCWA 4ZGYB 4C7IA 3QB8A 2J8RA 3FIXA 3TE4A 2J8MA 4UFWA 1FY7A 3D2PA 4UBRA 4GS4A 4R3LA 1CJWA 4A33A 4UWIA 3S6HA 1P4NA 1XMTA 4KOTA 2GE3A 4Q36A 5FVJA 5G20A 1S3ZA 2WPXA 3DNSA 4CYNA 4KSFA 1NSLA 3IWGA 4PSXA 4R9MA 5F49A 2OZHA 3DR6A 3FRMA 4XPDB 2R98A 2Q0YA 4B5PB 3FXTA 5G1ZA 3R95A 2FL4A 2G3AA 5EBVA 4L89A 1Q2CA 1MJAA 4NCZA 2YGWA 5HMNA 3DSBA 2PR8A 3TTHA 3FYNA 1RXTA 1J4JA 2DXQA 3G8WA 4FD4A 4UFVA 4XPLA 5DWMA 4B11A 4OAEA 4UCPA 2VXKA 2HUZA 3VWEA 2B4DA 1KUXA 1BO4A 1I1DA 4KOUA 1M44A 2PDOA 4KUBA 2AE6A 4AVCA 4C7HA 3I9SA 2B3UA 1B6BA 4KZTA 5AG4A 2X7BA 3FB3A 2OZGA 4YRHA 4CGMA 3S6GA 2JDDA 5H84A 4I49A 4MFKA 4XNHC 2OB0A 3A9LA 2Z3PA 4KVOE 4B5OA 2DPTA 4K30A 4PK3A 4RS2A 4MFJA 5G21A 5C88A 2G3TA 5ISVA 2F5IA 4HNXB 1MJ9A 1IYLA 2CY2A 2A4NA 2JEVA 3SHPA 5KTDA 3TO7A 2B58A 2FIAA 2Y0MA 3EC4A 4IUSA 4M85A 1S7NA 4KS9A 1L0CA 2GANA 2PR1A 4HNYB 4IF5A 4CAFA 1QSOA 2Z3LA 4HKFA 2P0WA 4NXYA 3PGPA 3CXQA 4CRZB 4CRYB 3IWEA 3V8IA 4X5KA 3TO9A 3IGRA 4L8AA 2P6GA 4CAVA 2PRBA 2ZXVA 2YNCC 2ZW7A 3LD2A 2CNSA 4MY3A 4MI4A 2WUUA 1QSTA 5HH1A 3VWDA 1IIDA 2QMLA 3R1KA 1Z4EA 1N71A 1IICA 1CM0A 3F0AA 5CNPA 3EY5A 2ZPAA 2ATRA 1B87A 4Y49B 4B10A 4F0YA 3B8GA 3DDDA 3BLNA 4UCNA 4CAEA 3OWCA 4II9A 2FXFA 4JXQA 5EC4A 1YLEA 2R1IA 4KOYA 1R57A 2OU2A 4FD7A 2PC1A 2VI7A 4B12A 4U9YA 4M3SA 2Q4YA 5AG5A 4OADA 3MGDA 2EVNA 4MY0A 5C82A 4MFLA 3DR8A 4CAWA 2D4PA 4RI1A 4XPDC 4UA3A 1IYKA 1S7LA 4B5PA 2B3VA 5A28A 3P2FA 1YR0A 2R8VA 2Z0ZA 1ZO0A 4MFPA 4JWPA 2JDCA 4A30A 2FT0A 2FE7A 3GY9A 5IX3A 3TT2A 3LODA 4BBHA 5AG6A 1NE9A 1Q2DA 4NF1A 2FS5A 2HV2A 4LX9A 4MHDA 1VHSA 1TIQA 3BJ8A 4KOSA 2YNDA 1WK4A 3CXSA 4MBUA 4QBJA 2ZW4A 1S60A 1KUYA 5F46A 3R9GA 3G3SA 2Z10A 1M4DA 4LUAA 4KUAA 4Q38A 2B5GB 4CYOA 1U6MA 1M4GA 4DNCA 4HNWB 3PZJA 4C2ZA 5GCNA 4AG7A 4YGOA 4KLWA 3F5BA 5IV0A 4BMHA 2GIVA 4QB9A 2OZUA 4MFZA 4UFXA 3JVNA 3R9FA 4R57A 5IB0A 4R87A 5JPHA 2B4DB 4OLLA 2H5MA 4U5YA 1S7KA 3I3GA 4KLVA 2VEZA 1Z4RA 4H6ZA 4H89A 2VQYA 4JXRA 5AG7A 4B13A 2NMTA 3D3SA 2Z3MA 2QIRA 3CXPA 2JLMA 4NSQA 1QSNA 5KTAA 2R7HA 1XE4A 3TCVA 4XNHB 1WWZA 1BOBA 2EUIA 2FCKA 4KSAA 2VBQA 1PU9A 2P6FA 2WPWA 2OH1A 5J8CA 2ZW5A 4KOVA 4YFJA 3R96A 4MFQA 4MJ8A 1Q2YA 2IL4A 2CNTA 3KKWA 2Z3KA 4JD6A 2AJ6A 5A27A 2WSAA 1S7FA 1Y7RA 1UFHA 2VZZA 2BSWA 4QC6A 2I00A 4B14A 3W6SA 1YK3A 3SXNA 1P0HA 4F0XA 3RYOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2G0B A;  4Y49 C;  1PUA A;  4NEX A;  1KUV A;  3ZJ0 A;  1I21 A;  5F48 A;  1ON0 A;  1GHE A;  2REE A;  3P2H A;  3W6X A;  4JLY A;  3H4Q A;  1M1D A;  4PV6 A;  5J8F A;  2J8N A;  4F6A A;  3UY5 A;  1K4J A;  2O28 A;  5E96 A;  3E0K A;  2BEI A;  3QAH A;  3TOA A;  3GYA A;  4R3K A;  2B4B A;  4AVA A;  1XIX A;  4H6U A;  1MJB A;  4JJX A;  1NMT A;  2VZY A;  4EVY A;  1S5K A;  1YVK A;  1RO5 A;  4UWJ A;  5DWN A;  1YVO A;  3TFY A;  1Y9K A;  3D2M A;  4ONU A;  4E0A A;  2C27 A;  1KZF A;  5H86 A;  3SXO A;  1VKC A;  3EFA A;  1I12 A;  2Q44 A;  2D4O A;  4QUS A;  3T9Y A;  2I79 A;  1SQH A;  2BUE A;  3JUW A;  2B5G A;  1YX0 A;  2P6E A;  5F47 A;  3NE7 A;  3N7Z A;  2ARH A;  1YRE A;  3WR7 A;  2RC4 A;  2Q4V A;  3GKR A;  1V0C A;  2REF A;  2Q04 A;  3S6K A;  1OZP A;  1XF8 A;  3FBU A;  1QSR A;  2HQY A;  1LRZ A;  1MK4 A;  3T90 A;  3BJ7 A;  3ZZI A;  3R9E A;  5KTC A;  2K5T A;  3D8P A;  4CS0 B;  1Y9W A;  1IB1 E;  4U9Z A;  3F8K A;  1YGH A;  3FNC A;  4ZBG A;  5JQ4 A;  1QSM A;  4J3G A;  4KOX A;  3TOB A;  4AB7 A;  2QEC A;  4AG9 A;  2ZW6 A;  2PSW A;  4PSW A;  4FD5 A;  2FSR A;  4KOR A;  3PP9 A;  4XPK A;  4FD6 A;  3S6F A;  3K9U A;  4E2A A;  1Z9U A;  4KOW A;  5I0C A;  2FIW A;  3EO4 A;  4KVX A;  2Z11 A;  3C26 A;  4PK2 A;  4KVM E;  2CNM A;  3EXN A;  2Q7B A;  1XEB A;  3TO6 A;  4ORF A;  1M4I A;  4AVB A;  4E8O A;  4CAX A;  2BL1 A;  4QVT A;  2PQ8 A;  3W91 A;  2KCW A;  3QB8 A;  2J8R A;  3FIX A;  3TE4 A;  2J8M A;  1FY7 A;  3D2P A;  4UBR A;  4GS4 A;  4R3L A;  1CJW A;  4UWI A;  3S6H A;  1P4N A;  1XMT A;  4KOT A;  2GE3 A;  5FVJ A;  1S3Z A;  2WPX A;  3DNS A;  1NSL A;  3IWG A;  4PSX A;  4R9M A;  5F49 A;  2OZH A;  3DR6 A;  3FRM A;  4XPD B;  2R98 A;  2Q0Y A;  4B5P B;  3FXT A;  3R95 A;  2FL4 A;  2G3A A;  5EBV A;  4L89 A;  1Q2C A;  1MJA A;  4NCZ A;  5HMN A;  3DSB A;  2PR8 A;  3TTH A;  3FYN A;  1RXT A;  1J4J A;  2DXQ A;  3G8W A;  4FD4 A;  4XPL A;  5DWM A;  4OAE A;  2VXK A;  2HUZ A;  3VWE A;  2B4D A;  1KUX A;  1BO4 A;  1I1D A;  4KOU A;  1M44 A;  2PDO A;  4KUB A;  2AE6 A;  4AVC A;  3I9S A;  2B3U A;  1B6B A;  4KZT A;  2X7B A;  3FB3 A;  2OZG A;  4YRH A;  3S6G A;  2JDD A;  5H84 A;  4I49 A;  4XNH C;  2OB0 A;  4B5O A;  4KVO E;  4K30 A;  4PK3 A;  4RS2 A;  5C88 A;  2G3T A;  5ISV A;  2F5I A;  4HNX B;  1MJ9 A;  1IYL A;  2CY2 A;  2A4N A;  2JEV A;  3SHP A;  5KTD A;  3TO7 A;  2B58 A;  2FIA A;  2Y0M A;  3EC4 A;  4IUS A;  4M85 A;  1S7N A;  1L0C A;  2GAN A;  2PR1 A;  4HNY B;  4IF5 A;  1QSO A;  4HKF A;  2P0W A;  4NXY A;  3PGP A;  3CXQ A;  4CRZ B;  4CRY B;  3V8I A;  4X5K A;  3TO9 A;  3IGR A;  4L8A A;  2P6G A;  4CAV A;  2PRB A;  2ZXV A;  2ZW7 A;  3LD2 A;  2CNS A;  4MY3 A;  4MI4 A;  1QST A;  5HH1 A;  3VWD A;  1IID A;  2QML A;  3R1K A;  1Z4E A;  1N71 A;  1IIC A;  1CM0 A;  3F0A A;  5CNP A;  3EY5 A;  2ZPA A;  2ATR A;  1B87 A;  4Y49 B;  4F0Y A;  3B8G A;  3DDD A;  3BLN A;  3OWC A;  4II9 A;  2FXF A;  4JXQ A;  5EC4 A;  1YLE A;  2R1I A;  4KOY A;  1R57 A;  2OU2 A;  4FD7 A;  2PC1 A;  2VI7 A;  4U9Y A;  4M3S A;  2Q4Y A;  4OAD A;  3MGD A;  2EVN A;  4MY0 A;  5C82 A;  3DR8 A;  4CAW A;  2D4P A;  4RI1 A;  4XPD C;  4UA3 A;  1IYK A;  1S7L A;  4B5P A;  2B3V A;  3P2F A;  1YR0 A;  2R8V A;  2Z0Z A;  4JWP A;  2JDC A;  2FT0 A;  2FE7 A;  3GY9 A;  5IX3 A;  3TT2 A;  3LOD A;  1NE9 A;  1Q2D A;  4NF1 A;  2FS5 A;  2HV2 A;  4LX9 A;  4MHD A;  1VHS A;  1TIQ A;  3BJ8 A;  4KOS A;  1WK4 A;  3CXS A;  4MBU A;  4QBJ A;  2ZW4 A;  1S60 A;  1KUY A;  5F46 A;  3R9G A;  3G3S A;  2Z10 A;  1M4D A;  4LUA A;  4KUA A;  2B5G B;  1U6M A;  1M4G A;  4DNC A;  4HNW B;  3PZJ A;  5GCN A;  4AG7 A;  4YGO A;  4KLW A;  3F5B A;  5IV0 A;  4BMH A;  2GIV A;  4QB9 A;  2OZU A;  3JVN A;  3R9F A;  4R57 A;  5IB0 A;  4R87 A;  5JPH A;  2B4D B;  4OLL A;  2H5M A;  4U5Y A;  1S7K A;  3I3G A;  4KLV A;  2VEZ A;  1Z4R A;  4H6Z A;  4H89 A;  2VQY A;  4JXR A;  2NMT A;  3D3S A;  2QIR A;  3CXP A;  2JLM A;  4NSQ A;  1QSN A;  5KTA A;  2R7H A;  1XE4 A;  3TCV A;  4XNH B;  1WWZ A;  1BOB A;  2EUI A;  2FCK A;  2VBQ A;  1PU9 A;  2P6F A;  2WPW A;  2OH1 A;  5J8C A;  2ZW5 A;  4KOV A;  4YFJ A;  3R96 A;  4MJ8 A;  1Q2Y A;  2IL4 A;  2CNT A;  3KKW A;  4JD6 A;  2AJ6 A;  1S7F A;  1Y7R A;  1UFH A;  2VZZ A;  2BSW A;  4QC6 A;  2I00 A;  3W6S A;  1YK3 A;  3SXN A;  1P0H A;  3RYO A; 
#chains in the Genus database with same CATH topology
 1FT7 A;  2G0B A;  4UF4 A;  1ARM A;  3VH9 A;  4A95 A;  4Y49 C;  1PUA A;  2C6P A;  4NEX A;  4R8F A;  1KUV A;  3ZJ0 A;  1XOV A;  1ZG7 A;  1I21 A;  5K8M A;  2GLJ A;  3RBU A;  2PJ7 A;  3WC6 A;  4C2X A;  4PXE A;  1ON0 A;  5F48 A;  1GHE A;  2REE A;  3P2H A;  3W6X A;  4JLY A;  3H4Q A;  1M1D A;  3LMS A;  1CPX A;  2GLF A;  2Z3O A;  2F8H A;  4MXU A;  2QYV A;  4PV6 A;  4F9V A;  5J8F A;  3D4U A;  5LYL A;  1HDQ A;  1CP6 A;  2J8N A;  3HUV A;  4F6A A;  4HPS A;  4R7M A;  2ANP A;  2PJ5 A;  4AXV A;  3V7Z A;  4F8Z A;  5I4M A;  3UY5 A;  1K4J A;  2O28 A;  5E96 A;  2PJ4 A;  4OC1 A;  3E0K A;  3B3C A;  4P6Y A;  2BEI A;  4UIA A;  3QAH A;  1ZG9 A;  3TOA A;  1HDU A;  3GYA A;  4R3K A;  2YNE A;  2B4B A;  2AFW A;  3NH4 A;  4AVA A;  1Y0Y A;  1XIX A;  2Z3N A;  4H6U A;  3WC5 A;  3IU2 A;  4R76 A;  4X8I A;  1F2P A;  1MJB A;  5LRJ A;  4JJX A;  1NMT A;  2VZY A;  4EVY A;  1S5K A;  4MMO A;  1YVK A;  1RO5 A;  4EFD A;  3FF3 A;  3GIU A;  4UWJ A;  2WYR A;  4MCP A;  5DWN A;  3IEH A;  1YVO A;  2EBJ A;  3PB7 X;  4NFR A;  3ISZ A;  4DYO A;  1BPN A;  2C6C A;  3TFY A;  3IU1 A;  1Y9K A;  3D2M A;  2ZEF A;  2GFQ A;  3CZX A;  4ONU A;  4E0A A;  2C27 A;  1KZF A;  2O53 A;  5H86 A;  3CDX A;  4O23 A;  4C68 A;  3SXO A;  1VKC A;  3EFA A;  1I12 A;  2Q44 A;  4M6H A;  2PVV A;  4EME A;  2EO8 A;  5ELY A;  2D4O A;  4QUS A;  4A2Z A;  3T9Y A;  2I79 A;  1SQH A;  2BUE A;  2HB6 A;  4OC0 A;  5K8P A;  3JUW A;  2B5G A;  2C1C A;  1YX0 A;  1NSA A;  4GXH A;  4P4E A;  2P6E A;  5F47 A;  4CGO A;  4ZY1 A;  3NE7 A;  3H8F A;  4CYQ A;  3N7Z A;  2ARH A;  3SJX A;  1YRE A;  3WR7 A;  3FVL A;  5BWA B;  2RC4 A;  2ZEM A;  2Q4V A;  5AGE A;  3CPA A;  3GKR A;  4IAV A;  1V0C A;  2REF A;  2Q04 A;  1AUG A;  2NYQ A;  4CGN A;  3B35 A;  3K9T A;  4MCR A;  2OR4 A;  5LYD A;  3S6K A;  2PIY A;  1OZP A;  2NSM A;  2JBK A;  2AFZ A;  1GYT A;  1XF8 A;  2CTC A;  1XRY A;  3FBU A;  1QSR A;  3D67 A;  5DS0 A;  2ZEP A;  3NH8 A;  5CBM A;  3IO1 A;  2HQY A;  2IMO A;  1LRZ A;  1MK4 A;  2BCO A;  4A31 A;  1XJO A;  3T90 A;  5LRK A;  4UCM A;  3BJ7 A;  3BI0 A;  3ZZI A;  1LAP A;  2V77 A;  4UEZ A;  3R9E A;  1TKJ A;  2ZOG A;  4OKO A;  3JTK A;  5KTC A;  3FX6 A;  2K5T A;  3D8P A;  3NA6 A;  3SJG A;  2ZEH A;  3I1U A;  3RNZ A;  4CS0 B;  4PXC A;  2VL1 A;  1Y9W A;  1IB1 E;  2Q7S A;  4U9Z A;  3F8K A;  3WC7 A;  1YGH A;  2PVW A;  4CGP A;  3FNC A;  4MHP A;  2XEI A;  4ZBG A;  3SI1 A;  5JQ4 A;  2RFH A;  1QSM A;  4J3G A;  4A32 A;  3FJU A;  4KOX A;  3TOB A;  4IHM A;  4AB7 A;  1ARL A;  3FH4 A;  3FMC A;  2QEC A;  4ZX8 A;  4AG9 A;  2ZW6 A;  4MHZ A;  1M4L A;  2PSW A;  4TNU A;  4PSW A;  2DPS A;  3TC8 A;  4NGT A;  4FD5 A;  2FSR A;  3D66 A;  4KOR A;  3PP9 A;  4XPK A;  4FD6 A;  5G22 A;  3S6F A;  3K9U A;  4OIW A;  3NE8 A;  1XFO A;  3GUX A;  2O4H A;  4E2A A;  1Z9U A;  4KOW A;  2GRE A;  5I0C A;  2FIW A;  3EO4 A;  6CPA A;  4CGL A;  1UWY A;  4YU9 A;  5LYF A;  4C2Y A;  4KVX A;  5K8O A;  2Q43 A;  4ZX9 A;  2Z11 A;  4CYP A;  3C26 A;  4RUH A;  4ZI6 A;  4NJR A;  4PK2 A;  4KVM E;  2CNM A;  3EXN A;  3PB6 X;  1Y0R A;  4OC3 A;  2Q7B A;  1XEB A;  2XEJ A;  3TO6 A;  2YNC A;  4ORF A;  5J1Q A;  2ZEL A;  4TWE A;  5LRG A;  1M4I A;  4AVB A;  1IGB A;  4E8O A;  4CAX A;  2BL1 A;  4QVT A;  2HC9 A;  4ZY0 A;  2CXA A;  2PQ8 A;  1LAM A;  3H5Z A;  4NGM A;  3S9M A;  3W91 A;  4CPA A;  2KCW A;  4P44 A;  2ZOF A;  3PEI A;  4ZGY B;  4OID A;  4C7I A;  3QB8 A;  1Z2L A;  2J8R A;  3FIX A;  3TE4 A;  2J8M A;  4OC2 A;  4UFW A;  1FY7 A;  3D2P A;  4PPZ A;  4UBR A;  4GS4 A;  1Z8T A;  4R3L A;  2ABZ A;  1CJW A;  1Z5R A;  4MRI A;  4UIB A;  5THW A;  4A33 A;  4DUK A;  4UWI A;  3DGV A;  4MHN A;  1H8L A;  2CF4 A;  3S6H A;  1P4N A;  1XMT A;  2ZEN A;  4KOT A;  2GE3 A;  2AFO A;  4G1P A;  2RB7 A;  4M6I A;  4Q36 A;  5FVJ A;  4JZ0 A;  5G20 A;  4P4I A;  1S3Z A;  2WPX A;  3DNS A;  4CYN A;  3S9L A;  4KSF A;  3V38 A;  1NSL A;  4EWT A;  3IWG A;  1TKH A;  4PSX A;  4R9M A;  5F49 A;  1X10 A;  2OZH A;  4OC4 A;  1R3N A;  2JBJ A;  3DR6 A;  3FRM A;  4XPD B;  4FAI A;  2AFM A;  2EWB A;  2R98 A;  3PB8 X;  2PJ1 A;  2Q0Y A;  2PJB A;  4B5P B;  3FXT A;  5G1Z A;  3R95 A;  2FL4 A;  1ELM P;  2F7V A;  2G3A A;  5EBV A;  3NFZ A;  4L89 A;  5HXD A;  1Q2C A;  1Z8X A;  1MJA A;  2PE3 A;  1DE4 C;  2YGW A;  4NCZ A;  3PBE A;  4LQG A;  3SI2 A;  5HMN A;  4P4F A;  1YW6 A;  3DSB A;  1IOF A;  2PR8 A;  4PXD A;  3PB4 X;  3TTH A;  3MRU A;  4ZY2 A;  2PJ3 A;  3FYN A;  3WAB A;  2CTB A;  1RXT A;  1J4J A;  1VHE A;  2V8V A;  2XEG A;  5K8N A;  2DXQ A;  3G8W A;  4FD4 A;  5F09 A;  4MCQ A;  5HVG A;  1Q7L A;  4ONW A;  2Q4Z A;  4UFV A;  4XPL A;  5LYI A;  3FEE A;  5DWM A;  4B11 A;  4OAE A;  3D68 A;  4UCP A;  3B3W A;  2VXK A;  2HUZ A;  3VWE A;  2B4D A;  1KUX A;  2PJA A;  1QMU A;  1YW4 A;  1BO4 A;  2C6G A;  1I1D A;  1YQE A;  2GU2 A;  4KOU A;  1M44 A;  1LAN A;  2PDO A;  3ISX A;  4KUB A;  2AE6 A;  3IC1 A;  4H2K A;  1HEE A;  3B3V A;  2QVP A;  4AVC A;  4C7H A;  2PRQ A;  3I9S A;  5CPA A;  2B3U A;  4FWU A;  1B6B A;  4KZT A;  5AG4 A;  2X7B A;  5EMI A;  2AFS A;  3FB3 A;  2OZG A;  4YRH A;  3PRT A;  1DTD A;  3CPX A;  4CGM A;  3S6G A;  2JDD A;  5H84 A;  2PJ2 A;  4I49 A;  4MFK A;  4XNH C;  2OB0 A;  2ZEO A;  3RZA A;  3A9L A;  2Z3P A;  4KVO E;  4WWV A;  4B5O A;  2DPT A;  2ZEE A;  3PFE A;  4K30 A;  4PK3 A;  4RS2 A;  4MFJ A;  5G21 A;  5C88 A;  4P4B A;  3SJE A;  2G3T A;  3IJ3 A;  5ISV A;  2F5I A;  4HNX B;  3N5F A;  4NGQ A;  1MJ9 A;  4P10 A;  4X2T A;  1IYL A;  2CY2 A;  3VAT A;  1A2Z A;  2A4N A;  2JEV A;  2AFU A;  2IJZ A;  3SHP A;  5KTD A;  1BPM A;  2B58 A;  2FIA A;  1R43 A;  4NJQ A;  3TO7 A;  2Y0M A;  3EC4 A;  2PCU A;  4IUS A;  4OME A;  3KGQ A;  4M85 A;  1S7N A;  4KS9 A;  1ZLH A;  1L0C A;  4P4J A;  5HVH A;  2GAN A;  2PR1 A;  4HNY B;  4IF5 A;  4CAF A;  1QSO A;  3KR4 A;  2Z3L A;  1AMP A;  4HKF A;  2P0W A;  4JYW A;  3KZW A;  4NXY A;  3PGP A;  3CXQ A;  4CRZ B;  4X3R A;  4CRY B;  3IWE A;  3V8I A;  4X5K A;  3TO9 A;  3IGR A;  4L8A A;  2P6G A;  3L2N A;  3QNV A;  1LCP A;  2Q51 A;  4CAV A;  2PRB A;  4FBE A;  3FED A;  2PJ6 A;  2ZXV A;  3IWW A;  4NGP A;  3T8W A;  5JH9 A;  3FEC A;  1BAV A;  4M6G A;  2YNC C;  2ZW7 A;  3LD2 A;  1IU8 A;  2CNS A;  4K3N A;  4MHY A;  4MY3 A;  4MI4 A;  2FVG A;  1TKF A;  2WUU A;  1QST A;  5HH1 A;  5JM6 A;  3VWD A;  1IID A;  2QML A;  3R1K A;  1Z4E A;  1N71 A;  4BD9 A;  5JGF A;  1IIC A;  1CM0 A;  1VIX A;  3F0A A;  5CNP A;  1YME A;  2CIJ A;  1EE3 P;  3EY5 A;  2ZPA A;  1LFW A;  2ATR A;  2PJ0 A;  2QJ8 A;  1B87 A;  4Y49 B;  4B10 A;  3KHZ A;  3B8G A;  3DDD A;  2PJ8 A;  3BLN A;  3PB9 X;  5D29 A;  3KI9 A;  4F0Y A;  4UCN A;  3SI0 A;  4CAE A;  1TXR A;  3OWC A;  4PXB A;  1VHO A;  1X12 A;  1BLL E;  2V8D A;  1PYT B;  2PJ9 A;  3CT9 A;  3D7H A;  4II9 A;  2FXF A;  2ZED A;  2POK A;  4JXQ A;  4NGS A;  5EC4 A;  1YLE A;  1F2O A;  3KL9 A;  3LWU A;  2R1I A;  4KOY A;  4WJB A;  3IFE A;  1R57 A;  2OU2 A;  4R6T A;  2J9A A;  4FD7 A;  2PC1 A;  1XMB A;  2VI7 A;  4B12 A;  4U9Y A;  3IIB A;  4M3S A;  2Q4Y A;  3GLJ A;  4OAD A;  5AG5 A;  2PIZ A;  1RTQ A;  3MGD A;  2EVN A;  4UEF A;  4MY0 A;  3KHX A;  1TF9 A;  4LQ6 A;  5C82 A;  1ZLI A;  4MFL A;  3DR8 A;  3PFO A;  4A94 A;  1AYE A;  4CAW A;  2D4P A;  2EK9 A;  4RI1 A;  2PJC A;  4UA3 A;  1IYK A;  4XPD C;  3TX8 A;  4A38 A;  3B2Y A;  4W9Y A;  1S7L A;  4B5P A;  2B3V A;  1XBU A;  5A28 A;  3P2F A;  4DJL A;  1YR0 A;  2R8V A;  2Z0Z A;  1ZO0 A;  3D7G A;  4MFP A;  4JWP A;  4B6Z A;  2JDC A;  4A30 A;  2FT0 A;  2FE7 A;  3GY9 A;  4UEE A;  5IX3 A;  2ZEG A;  3TT2 A;  5IB9 A;  3LOD A;  1OBR A;  4YWY A;  5AG6 A;  1NE9 A;  1Q2D A;  4NF1 A;  2FS5 A;  2HV2 A;  4BBH A;  4LX9 A;  4MHD A;  1Z8W A;  1LOK A;  1VHS A;  1TIQ A;  2XEF A;  3BJ8 A;  4KOS A;  4PQA A;  2YND A;  1WK4 A;  3PBB A;  3CXS A;  3B3T A;  3D7F A;  4MBU A;  1Z8L A;  4QBJ A;  4ZYQ A;  1JWQ A;  2ZW4 A;  1S60 A;  4Q7A A;  1KUY A;  5F46 A;  3R9G A;  3G3S A;  2Z10 A;  1M4D A;  2BOA A;  4OP4 A;  4LUA A;  4KUA A;  2OOT A;  3RAM A;  1CBX A;  3HLP A;  3JRU A;  1CP7 A;  3GB0 A;  4Q38 A;  2B5G B;  2JEW A;  2DF5 A;  5HVF A;  4CYO A;  3VAR A;  1U6M A;  4NGR A;  1M4G A;  3LAC A;  4DNC A;  4HNW B;  3PZJ A;  3BHX A;  5GCN A;  4AG7 A;  4YGO A;  4C2Z A;  3QAY A;  4KLW A;  4F9U A;  4A37 A;  2I3C A;  3F5B A;  3NH5 A;  4P4D A;  5IV0 A;  1QQ9 A;  4BMH A;  1YLO A;  1KWM A;  2GIV A;  2IQ6 A;  4QB9 A;  2OZU A;  4MFZ A;  4KSI A;  4UFX A;  3JVN A;  3KAS A;  3R9F A;  3K2K A;  4R57 A;  2EK8 A;  5IB0 A;  4R87 A;  5JPH A;  3D7D A;  2B4D B;  4OLL A;  2DEA A;  2H5M A;  4U5Y A;  1S7K A;  4Z65 A;  3I3G A;  4KLV A;  4MCS A;  2VEZ A;  1Z4R A;  2VQY A;  4H6Z A;  2V8H A;  4H89 A;  4JXR A;  5AG7 A;  3DLJ A;  3BI1 A;  4B13 A;  2NMT A;  3RO0 A;  4P45 A;  1FNO A;  3BXM A;  1PCA A;  1ZG8 A;  3D3S A;  2Z3M A;  2WZN A;  1IOI A;  1CX8 A;  2QIR A;  3CXP A;  2JLM A;  4NSQ A;  4OC5 A;  1QSN A;  2G9D A;  3MN8 A;  5KTA A;  1CPS A;  2R7H A;  1XE4 A;  3TCV A;  4RN7 A;  4XNH B;  1WWZ A;  2AFX A;  1BOB A;  2EUI A;  2FCK A;  4KSA A;  1ELL P;  2VBQ A;  5D8N A;  1PU9 A;  2P6F A;  2WPW A;  2OH1 A;  3SJF A;  5J8C A;  2ZW5 A;  3KR5 A;  4KOV A;  4YFJ A;  3R96 A;  1IY7 A;  1TF8 A;  4MFQ A;  4MJ8 A;  1Q2Y A;  2IL4 A;  2ODF A;  1YSJ A;  1JQG A;  2CNT A;  1F57 A;  2Z3K A;  3KKW A;  3B7I A;  2AJ6 A;  4JD6 A;  1VGY A;  3WT4 A;  5A27 A;  7CPA A;  2WSA A;  1S7F A;  3H8E A;  4IK2 A;  3B3S A;  1CG2 A;  1Y7R A;  2BO9 A;  1UFH A;  3KQX A;  2VZZ A;  2BSW A;  4FUU A;  1Y7E A;  8CPA A;  3KQZ A;  4QC6 A;  2I00 A;  4B14 A;  3W6S A;  1YK3 A;  4GM5 A;  3SXN A;  4BIN A;  1P0H A;  4F0X A;  3S9N A;  3H8G A;  4NGN A;  3RYO A;  2V8G A;  4A39 A; 
#chains in the Genus database with same CATH homology
 2G0B A;  4A95 A;  4Y49 C;  1PUA A;  4NEX A;  1KUV A;  3ZJ0 A;  1I21 A;  4C2X A;  5F48 A;  1ON0 A;  1GHE A;  2REE A;  3P2H A;  3W6X A;  4JLY A;  3H4Q A;  1M1D A;  2Z3O A;  4PV6 A;  5J8F A;  2J8N A;  4F6A A;  3UY5 A;  1K4J A;  2O28 A;  5E96 A;  3E0K A;  2BEI A;  3QAH A;  3TOA A;  3GYA A;  4R3K A;  2YNE A;  2B4B A;  4AVA A;  1XIX A;  2Z3N A;  4H6U A;  3IU2 A;  1MJB A;  4JJX A;  1NMT A;  2VZY A;  4EVY A;  1S5K A;  1YVK A;  1RO5 A;  4UWJ A;  5DWN A;  1YVO A;  3TFY A;  3IU1 A;  1Y9K A;  3D2M A;  4ONU A;  4E0A A;  2C27 A;  1KZF A;  5H86 A;  4C68 A;  3SXO A;  1VKC A;  3EFA A;  1I12 A;  2Q44 A;  2D4O A;  4QUS A;  4A2Z A;  3T9Y A;  2I79 A;  1SQH A;  2BUE A;  3JUW A;  2B5G A;  1YX0 A;  2P6E A;  5F47 A;  4CGO A;  3NE7 A;  4CYQ A;  3N7Z A;  2ARH A;  1YRE A;  3WR7 A;  5BWA B;  2RC4 A;  2Q4V A;  5AGE A;  3GKR A;  1V0C A;  2REF A;  2Q04 A;  4CGN A;  3S6K A;  1OZP A;  1XF8 A;  3FBU A;  1QSR A;  2HQY A;  1LRZ A;  1MK4 A;  4A31 A;  3T90 A;  4UCM A;  3BJ7 A;  3ZZI A;  3R9E A;  5KTC A;  3JTK A;  2K5T A;  3D8P A;  4CS0 B;  1Y9W A;  1IB1 E;  4U9Z A;  3F8K A;  1YGH A;  4CGP A;  3FNC A;  4ZBG A;  5JQ4 A;  1QSM A;  4J3G A;  4A32 A;  4KOX A;  3TOB A;  4AB7 A;  2QEC A;  4AG9 A;  2ZW6 A;  2PSW A;  4PSW A;  2DPS A;  4FD5 A;  2FSR A;  4KOR A;  3PP9 A;  4XPK A;  4FD6 A;  5G22 A;  3S6F A;  3K9U A;  4E2A A;  1Z9U A;  4KOW A;  5I0C A;  2FIW A;  3EO4 A;  4CGL A;  4C2Y A;  4KVX A;  2Z11 A;  4CYP A;  3C26 A;  4PK2 A;  4KVM E;  2CNM A;  3EXN A;  2Q7B A;  1XEB A;  3TO6 A;  2YNC A;  4ORF A;  1M4I A;  4AVB A;  4E8O A;  4CAX A;  2BL1 A;  4QVT A;  2CXA A;  2PQ8 A;  3H5Z A;  3W91 A;  2KCW A;  4ZGY B;  4C7I A;  3QB8 A;  2J8R A;  3FIX A;  3TE4 A;  2J8M A;  4UFW A;  1FY7 A;  3D2P A;  4UBR A;  4GS4 A;  4R3L A;  1CJW A;  4A33 A;  4UWI A;  3S6H A;  1P4N A;  1XMT A;  4KOT A;  2GE3 A;  4Q36 A;  5FVJ A;  5G20 A;  1S3Z A;  2WPX A;  3DNS A;  4CYN A;  4KSF A;  1NSL A;  3IWG A;  4PSX A;  4R9M A;  5F49 A;  2OZH A;  3DR6 A;  3FRM A;  4XPD B;  2R98 A;  2Q0Y A;  4B5P B;  3FXT A;  5G1Z A;  3R95 A;  2FL4 A;  2G3A A;  5EBV A;  4L89 A;  1Q2C A;  1MJA A;  4NCZ A;  2YGW A;  5HMN A;  3DSB A;  2PR8 A;  3TTH A;  3FYN A;  1RXT A;  1J4J A;  2DXQ A;  3G8W A;  4FD4 A;  4UFV A;  4XPL A;  5DWM A;  4B11 A;  4OAE A;  4UCP A;  2VXK A;  2HUZ A;  3VWE A;  2B4D A;  1KUX A;  1BO4 A;  1I1D A;  4KOU A;  1M44 A;  2PDO A;  4KUB A;  2AE6 A;  4AVC A;  4C7H A;  3I9S A;  2B3U A;  1B6B A;  4KZT A;  5AG4 A;  2X7B A;  3FB3 A;  2OZG A;  4YRH A;  4CGM A;  3S6G A;  2JDD A;  5H84 A;  4I49 A;  4MFK A;  4XNH C;  2OB0 A;  3A9L A;  2Z3P A;  4KVO E;  4B5O A;  2DPT A;  4K30 A;  4PK3 A;  4RS2 A;  4MFJ A;  5G21 A;  5C88 A;  2G3T A;  5ISV A;  2F5I A;  4HNX B;  1MJ9 A;  1IYL A;  2CY2 A;  2A4N A;  2JEV A;  3SHP A;  5KTD A;  3TO7 A;  2B58 A;  2FIA A;  2Y0M A;  3EC4 A;  4IUS A;  4M85 A;  1S7N A;  4KS9 A;  1L0C A;  2GAN A;  2PR1 A;  4HNY B;  4IF5 A;  4CAF A;  1QSO A;  2Z3L A;  4HKF A;  2P0W A;  4NXY A;  3PGP A;  3CXQ A;  4CRZ B;  4CRY B;  3IWE A;  3V8I A;  4X5K A;  3TO9 A;  3IGR A;  4L8A A;  2P6G A;  4CAV A;  2PRB A;  2ZXV A;  2YNC C;  2ZW7 A;  3LD2 A;  2CNS A;  4MY3 A;  4MI4 A;  2WUU A;  1QST A;  5HH1 A;  3VWD A;  1IID A;  2QML A;  3R1K A;  1Z4E A;  1N71 A;  1IIC A;  1CM0 A;  3F0A A;  5CNP A;  3EY5 A;  2ZPA A;  2ATR A;  1B87 A;  4Y49 B;  4B10 A;  4F0Y A;  3B8G A;  3DDD A;  3BLN A;  4UCN A;  4CAE A;  3OWC A;  4II9 A;  2FXF A;  4JXQ A;  5EC4 A;  1YLE A;  2R1I A;  4KOY A;  1R57 A;  2OU2 A;  4FD7 A;  2PC1 A;  2VI7 A;  4B12 A;  4U9Y A;  4M3S A;  2Q4Y A;  5AG5 A;  4OAD A;  3MGD A;  2EVN A;  4MY0 A;  5C82 A;  4MFL A;  3DR8 A;  4CAW A;  2D4P A;  4RI1 A;  4XPD C;  4UA3 A;  1IYK A;  1S7L A;  4B5P A;  2B3V A;  5A28 A;  3P2F A;  1YR0 A;  2R8V A;  2Z0Z A;  1ZO0 A;  4MFP A;  4JWP A;  2JDC A;  4A30 A;  2FT0 A;  2FE7 A;  3GY9 A;  5IX3 A;  3TT2 A;  3LOD A;  4BBH A;  5AG6 A;  1NE9 A;  1Q2D A;  4NF1 A;  2FS5 A;  2HV2 A;  4LX9 A;  4MHD A;  1VHS A;  1TIQ A;  3BJ8 A;  4KOS A;  2YND A;  1WK4 A;  3CXS A;  4MBU A;  4QBJ A;  2ZW4 A;  1S60 A;  1KUY A;  5F46 A;  3R9G A;  3G3S A;  2Z10 A;  1M4D A;  4LUA A;  4KUA A;  4Q38 A;  2B5G B;  4CYO A;  1U6M A;  1M4G A;  4DNC A;  4HNW B;  3PZJ A;  4C2Z A;  5GCN A;  4AG7 A;  4YGO A;  4KLW A;  3F5B A;  5IV0 A;  4BMH A;  2GIV A;  4QB9 A;  2OZU A;  4MFZ A;  4UFX A;  3JVN A;  3R9F A;  4R57 A;  5IB0 A;  4R87 A;  5JPH A;  2B4D B;  4OLL A;  2H5M A;  4U5Y A;  1S7K A;  3I3G A;  4KLV A;  2VEZ A;  1Z4R A;  4H6Z A;  4H89 A;  2VQY A;  4JXR A;  5AG7 A;  4B13 A;  2NMT A;  3D3S A;  2Z3M A;  2QIR A;  3CXP A;  2JLM A;  4NSQ A;  1QSN A;  5KTA A;  2R7H A;  1XE4 A;  3TCV A;  4XNH B;  1WWZ A;  1BOB A;  2EUI A;  2FCK A;  4KSA A;  2VBQ A;  1PU9 A;  2P6F A;  2WPW A;  2OH1 A;  5J8C A;  2ZW5 A;  4KOV A;  4YFJ A;  3R96 A;  4MFQ A;  4MJ8 A;  1Q2Y A;  2IL4 A;  2CNT A;  3KKW A;  2Z3K A;  4JD6 A;  2AJ6 A;  5A27 A;  2WSA A;  1S7F A;  1Y7R A;  1UFH A;  2VZZ A;  2BSW A;  4QC6 A;  2I00 A;  4B14 A;  3W6S A;  1YK3 A;  3SXN A;  1P0H A;  4F0X A;  3RYO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...