3GIUA

1.25 angstrom crystal structure of pyrrolidone-carboxylate peptidase (pcp) from staphylococcus aureus
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
212
structure length
212
Chain Sequence
MHILVTGFAPFDNQNINPSWEAVTQLEDIIGTHTIDKLKLPTSFKKVDNIINKTLASNHYDVVLAIGQAGGRNAITPERVAINIDDARIPDNDDFQPIDQAIHLDGAPAYFSNLPVKAMTQSIINQGLPGALSNSAGTFVCNHTLYHLGYLQDKHYPHLRFGFIHVPYIPEQVIGKPDTPSMPLEKIVAGLTAAIEAISNDEDLHLALGTTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title 1.25 Angstrom Crystal Structure of Pyrrolidone-Carboxylate Peptidase (pcp) from Staphylococcus aureus
rcsb
source organism Staphylococcus aureus subsp. aureus col
molecule tags Hydrolase
molecule keywords Pyrrolidone-carboxylate peptidase
total genus 66
structure length 212
sequence length 212
chains with identical sequence B
ec nomenclature ec 3.4.19.3: Pyroglutamyl-peptidase I.
pdb deposition date 2009-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01470 Peptidase_C15 Pyroglutamyl peptidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.20 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Peptidase C15, pyroglutamyl peptidase I-like 3giuA00
1AUGA 3GIUA 1IOIA 1Z8TA 1Z8XA 1IU8A 1A2ZA 1IOFA 3RO0A 1Z8WA 4GXHA 4HPSA 3RNZA 2EO8A 1X10A 3LACA 1X12A 2EBJA 2DF5A
chains in the Genus database with same CATH superfamily
4FD4A 1S3ZA 1I21A 1P0HA 2CNSA 3FNCA 2FIWA 5K8OA 3B3CA 1QQ9A 1IGBA 1Q7LA 4MCSA 4ONWA 1QSNA 4UIAA 4X8IA 2HUZA 5G20A 3JTKA 4B13A 4FD7A 3JUWA 2ZEOA 1Z9UA 3W91A 1M4IA 3IIBA 2Q43A 4MY0A 4X3RA 4M85A 3KQZA 5J8CA 3S6HA 4CYPA 4HPSA 1F2PA 1YW6A 2JEVA 2ZW4A 2ZEPA 5AG7A 3GLJA 5A28A 1GYTA 2FIAA 3NA6A 1BPMA 2J8NA 4NGPA 4AG7A 4PQAA 2AFUA 2DEAA 3KR4A 4ZY1A 1YQEA 4JXRA 1CPSA 3DSBA 1PU9A 4NF1A 3P2FA 4DUKA 1SQHA 2WPXA 4NGNA 1BOBA 4F6AA 3BI1A 2VEZA 1XMBA 4EMEA 4KZTA 7CPAA 3K9TA 4CGOA 2RFHA 5EMIA 2AFZA 1TKFA 3LWUA 4WWVA 3TC8A 3TOBA 3KZWA 1NSAA 4XPKA 2P6GA 2F8HA 4P10A 3D2PA 1Z2LA 3VATA 1VGYA 2X7BA 3NH4A 2GREA 3T8WA 2ZOGA 3PFEA 4NGSA 4HKFA 3KL9A 5CBMA 4CYQA 3S9NA 1LAPA 1XFOA 4NFRA 1R43A 3W6SA 3IU1A 3PZJA 5CNPA 2GE3A 4A31A 3D3SA 4B11A 4B14A 4CAEA 2J9AA 2RC4A 2Q7BA 4F0XA 4TWEA 1Y9KA 4H89A 4B10A 1S5KA 1Z8WA 3VWEA 2OZUA 4QUSA 5K8MA 2GFQA 1P4NA 4Y49B 3WR7A 4KS9A 3EY5A 2CNTA 4B5OA 5IB9A 4XPDC 2GU2A 2ZPAA 3VWDA 2NSMA 1R57A 3SI2A 4F9VA 1Z8LA 3GIUA 4NGRA 1IOIA 2Y0MA 1MJBA 4NCZA 5F49A 1FNOA 4KUAA 2CTCA 3G3SA 2QECA 4KOWA 3EC4A 3D68A 1S7FA 3ISXA 3BHXA 3E0KA 2A4NA 4MFKA 2ARHA 3KI9A 4OC0A 4QBJA 4U5YA 5IX3A 4AVBA 4KSFA 5AGEA 2PSWA 2Q04A 1MK4A 2O4HA 4ZY2A 1Q2YA 3IJ3A 5EC4A 1M4DA 4JXQA 2O28A 5LRGA 2I00A 2R1IA 2C27A 4Y49C 2GIVA 2PCUA 1M4LA 3R1KA 2ZELA 3R9EA 4A95A 2AFOA 4H6UA 3SJFA 2ZW6A 4OAEA 1QSRA 2JDCA 3B2YA 3IEHA 5F48A 4CPAA 4HNWB 4KUBA 3H8EA 3I1UA 1IB1E 4CS0B 4ZYQA 6CPAA 3TOAA 2HC9A 3KR5A 4UA3A 2POKA 3FX6A 1TKJA 1ARMA 3SHPA 4KOSA 4YWYA 4R8FA 5D8NA 4MHDA 5CPAA 1DE4C 1DTDA 5HXDA 2GLFA 1Y7EA 2D4OA 4CGLA 2KCWA 2I3CA 4II9A 4NGMA 2YGWA 3RO0A 2OOTA 1IICA 2QJ8A 1XMTA 2NYQA 1VHEA 4ORFA 4CGMA 4JLYA 3S6KA 3IU2A 4X5KA 2ZEFA 2R98A 3FIXA 4R9MA 3SXNA 1S60A 5J8FA 2PJ1A 2FT0A 2WPWA 4LQGA 3JVNA 4LQ6A 4P4FA 3B8GA 4KOUA 3KASA 4KVME 3CT9A 4FWUA 2PR1A 4Q38A 5ELYA 4OADA 3V8IA 3S9LA 2VBQA 3PB8X 4UWIA 2PJ8A 4PXCA 3D2MA 2EWBA 4R76A 1YLEA 4NSQA 4A38A 3MRUA 2QYVA 2AE6A 2K5TA 1RXTA 3RBUA 2XEFA 2ATRA 3WT4A 3ZJ0A 2Z3OA 2IJZA 4MFQA 4P4EA 1CP7A 5HVHA 1XIXA 1YVKA 4O23A 3K2KA 3LACA 4OC2A 4MRIA 5E96A 2VZZA 3SI0A 3LMSA 4FBEA 4MMOA 4MY3A 1ARLA 2Q44A 2OU2A 3KHZA 3TO9A 2Q0YA 4IF5A 3CXSA 1YGHA 2PC1A 5A27A 4UCNA 2ANPA 3DLJA 1M1DA 2ZEEA 4MHNA 4ZY0A 1QSTA 1LAMA 3KKWA 3PFOA 4GS4A 2O53A 3WC5A 1UFHA 2WUUA 3FXTA 5I0CA 1VKCA 2CY2A 2QVPA 4KOTA 2AFWA 4NGQA 1MJAA 2WSAA 3PP9A 4AG9A 5EBVA 2PDOA 1XF8A 4B5PA 3PBBA 4BMHA 3RNZA 1JQGA 1NE9A 2PRBA 3FEEA 2ZEGA 2NMTA 2FVGA 2PJ5A 4PPZA 1LCPA 5KTDA 1KUYA 4C7IA 2B4DA 1XJOA 5I4MA 4PSXA 2B3UA 3R96A 3GY9A 3FVLA 3F8KA 4IAVA 4CRYB 1JWQA 1Z5RA 3BJ8A 3V7ZA 2ZXVA 1PCAA 4QC6A 2PJBA 3WABA 4L89A 4W9YA 1ZG9A 3IWEA 4A33A 4A94A 2Z0ZA 2FE7A 2WZNA 2PIYA 2Z3PA 3DNSA 2AJ6A 4R7MA 4UEZA 1FT7A 3TFYA 2CXAA 1QMUA 4BD9A 1HDUA 4RS2A 4ZBGA 1B6BA 5JQ4A 3I9SA 4FAIA 1M4GA 3NFZA 3T90A 4DNCA 4YFJA 3PB9X 8CPAA 5G22A 1LANA 3R95A 1I1DA 2R7HA 4H6ZA 4MHYA 4ONUA 4UBRA 2OB0A 1PUAA 1X12A 2ZW5A 4RUHA 4A2ZA 3FRMA 1CX8A 3NE8A 2PVWA 3B3SA 4KLVA 2Z3NA 2PJ6A 4IK2A 3QAHA 5JGFA 1X10A 2DPTA 3FBUA 3QB8A 1Q2CA 1VHSA 4JWPA 4U9YA 1GHEA 4IUSA 4H2KA 2YNCA 2PQ8A 4G1PA 5F09A 2FL4A 1KUVA 2HB6A 3GB0A 2J8MA 2V8DA 3PGPA 2PJ2A 4AB7A 3NE7A 5GCNA 3L2NA 4JJXA 1CP6A 2VL1A 3D67A 1FY7A 4L8AA 3BJ7A 4KVXA 2QIRA 2ZOFA 2J8RA 4JD6A 2V77A 2BCOA 1YLOA 2EVNA 3IO1A 2ABZA 3D66A 3LD2A 4OIDA 4P4JA 5IB0A 1YREA 4AXVA 1ELMP 2IMOA 3JRUA 2V8GA 3PB7X 1XEBA 1HDQA 3HUVA 2GLJA 2ZENA 2JBJA 1AMPA 3GUXA 1N71A 4M6GA 2REEA 1F2OA 2XEGA 4KLWA 1NSLA 2XEIA 1EE3P 3F5BA 5J1QA 2YNEA 3W6XA 1S7KA 3KQXA 3GYAA 1KUXA 2G3AA 5LYLA 1LFWA 2IL4A 4M6HA 3WC6A 4X2TA 3D4UA 4R3KA 1Z8XA 2PJCA 4OC1A 4B5PB 2PVVA 1WK4A 2YNDA 2Z3MA 4OMEA 4ZX8A 5KTCA 3NH5A 3CDXA 1VIXA 3CZXA 4UFWA 5AG5A 4LUAA 2FSRA 4NJQA 3CXPA 1LOKA 1XRYA 1ZG8A 1U6MA 2G9DA 2PR8A 2VI7A 4DYOA 4I49A 2ODFA 1Z8TA 4A39A 5KTAA 2ZEHA 5LYFA 2JLMA 2AFXA 1S7LA 4XPDB 1IYLA 2AFSA 1RO5A 1XOVA 1V0CA 4OC5A 4R6TA 4GM5A 4CAFA 3PRTA 4FUUA 5LRKA 1ELLP 1I12A 2OR4A 1CPXA 4MXUA 4JYWA 4UCMA 3RYOA 4YU9A 4C7HA 1M44A 1QSOA 2F5IA 3BI0A 3B35A 2JBKA 3KHXA 3ZZIA 5IV0A 1CG2A 3FF3A 2YNCC 4WJBA 1ZLHA 2PJ9A 3PBEA 4UIBA 1QSMA 2EK8A 4M6IA 4NXYA 3WC7A 5K8PA 1XE4A 2PJ4A 2BO9A 4MBUA 1YX0A 1PYTB 2DPSA 3S9MA 2PJ3A 3IWGA 3IGRA 4B6ZA 5HVGA 2XEJA 3H5ZA 2B5GB 2CF4A 4EVYA 4UEEA 4KOVA 2F7VA 3SXOA 1YVOA 5HVFA 1BLLE 5THWA 2B4BA 4QVTA 4FD5A 4PV6A 3G8WA 1CM0A 3PEIA 1K4JA 2BOAA 3SJGA 1YW4A 2EBJA 4F9UA 5LRJA 2HQYA 4K30A 3EXNA 4YGOA 4CYOA 4FD6A 4M3SA 3CXQA 4A30A 3H8FA 1BO4A 4OLLA 4P4BA 4E8OA 4HNYB 3C26A 1Y0RA 3B3VA 4OP4A 4RN7A 4ZX9A 4BINA 1RTQA 3R9FA 4ZGYB 1Y9WA 2BEIA 4K3NA 4Q7AA 4KOXA 1AYEA 2BSWA 4P6YA 5G21A 4EWTA 3ISZA 2B3VA 1B87A 3FMCA 2PJAA 2FS5A 4YRHA 4A32A 3FYNA 3H8GA 1A2ZA 1IU8A 1HEEA 1TF9A 3B7IA 3FEDA 4A37A 3I3GA 2ZEMA 3D7DA 1VHOA 1CBXA 2WYRA 4P45A 4CYNA 1NMTA 4XNHB 4R87A 5DWNA 4CGPA 5D29A 3R9GA 4C2XA 4P4IA 5DS0A 4AVCA 3P2HA 1Y0YA 4TNUA 5C82A 1J4JA 3UY5A 1TXRA 3S6FA 4C2YA 4F8ZA 1MJ9A 2AFMA 4R3LA 1R3NA 4MFZA 4MHZA 2CIJA 2DF5A 1ZLIA 2Q51A 1F57A 2ZEDA 2PIZA 4B12A 5K8NA 1OBRA 3S6GA 3SJXA 5G1ZA 2JDDA 5LYDA 3IFEA 1YR0A 3TTHA 4C68A 1BAVA 2PE3A 2PJ7A 2C6CA 4MFPA 3VH9A 1TF8A 5JH9A 4KSAA 2P0WA 3SJEA 5C88A 1Q2DA 4Z65A 4MCPA 3CPAA 4UEFA 3FJUA 4XNHC 4NEXA 4PXDA 2HV2A 4MHPA 3D7FA 4CAXA 4CAWA 1TKHA 1LRZA 2OZGA 2B58A 2PJ0A 3DR6A 4KORA 4OC3A 5AG6A 4UFVA 2Z11A 2BL1A 5JM6A 4XPLA 1IIDA 2P6FA 1CJWA 2G3TA 2V8VA 3H4QA 3NH8A 4CAVA 4E2AA 3RAMA 3VARA 4CRZB 4MJ8A 2VZYA 4PXBA 2CNMA 3B3TA 4UWJA 3D8PA 3KGQA 1IY7A 3PB4X 3TX8A 4ZI6A 3TO7A 3GKRA 4MCRA 4MFJA 1OZPA 3LODA 3SI1A 2CTBA 2OH1A 3QNVA 5ISVA 4KVOE 3QAYA 2EUIA 4PK2A 1TIQA 2IQ6A 2Q4YA 2ZW7A 4F0YA 2OZHA 2D4PA 3MGDA 4KOYA 1BPNA 1Y7RA 2DXQA 2R8VA 4OKOA 5H86A 2EK9A 5F46A 3V38A 4KSIA 4MCQA 4MI4A 2FXFA 4HNXB 3BXMA 3N5FA 5F47A 3T9YA 1ON0A 3OWCA 2Z10A 2Z3LA 5JPHA 2REFA 3DGVA 3FB3A 2H5MA 3D7HA 2P6EA 4PSWA 3HLPA 2Q7SA 5AG4A 3B3WA 4OC4A 5BWAB 4P44A 1IYKA 4IHMA 4QB9A 2Z3KA 4PXEA 3BLNA 1XBUA 4LX9A 2PRQA 4JZ0A 4U9ZA 2QMLA 2C6GA 4NGTA 2Q4VA 5H84A 3TE4A 2BUEA 2C1CA 4MFLA 5DWMA 4CGNA 4E0AA 4GXHA 3F0AA 4OIWA 2GANA 4Q36A 4J3GA 1H8LA 3PB6X 4UFXA 3DR8A 5FVJA 2RB7A 1ZG7A 1AUGA 4EFDA 3EFAA 3A9LA 1UWYA 1YSJA 4R57A 2VQYA 2JEWA 2VXKA 4UCPA 1S7NA 2B5GA 5HH1A 3FECA 5LYIA 2G0BA 2B4DB 3EO4A 1Z4RA 2FCKA 2EO8A 4DJLA 3TO6A 2V8HA 4P4DA 4RI1A 1ZO0A 1KZFA 4BBHA 3FH4A 3CPXA 1YMEA 1IOFA 3N7ZA 3TCVA 3TT2A 3D7GA 4C2ZA 1Z4EA 5HMNA 2Q4ZA 2I79A 3K9UA 4PK3A 1WWZA 3DDDA 1YK3A 3IWWA 1KWMA 3MN8A 4UF4A 4AVAA 2C6PA 4NJRA 3IC1A 1L0CA 3RZAA
chains in the Genus database with same CATH topology
1AUGA 3GIUA 1IOIA 1Z8TA 1Z8XA 1IU8A 1A2ZA 1IOFA 3RO0A 1Z8WA 4GXHA 4HPSA 3RNZA 2EO8A 1X10A 3LACA 1X12A 2EBJA 2DF5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1AUG A;  3GIU A;  1IOI A;  1Z8T A;  1Z8X A;  1IU8 A;  1A2Z A;  1IOF A;  3RO0 A;  1Z8W A;  4GXH A;  4HPS A;  3RNZ A;  2EO8 A;  1X10 A;  3LAC A;  1X12 A;  2EBJ A;  2DF5 A; 
#chains in the Genus database with same CATH topology
 4FD4 A;  1S3Z A;  1I21 A;  1P0H A;  2CNS A;  3FNC A;  2FIW A;  5K8O A;  3B3C A;  1QQ9 A;  1IGB A;  1Q7L A;  4MCS A;  4ONW A;  1QSN A;  4UIA A;  4X8I A;  2HUZ A;  5G20 A;  3JTK A;  4B13 A;  4FD7 A;  3JUW A;  2ZEO A;  1Z9U A;  3W91 A;  1M4I A;  3IIB A;  2Q43 A;  4MY0 A;  4X3R A;  4M85 A;  3KQZ A;  5J8C A;  3S6H A;  4CYP A;  4HPS A;  1F2P A;  1YW6 A;  2JEV A;  2ZW4 A;  2ZEP A;  5AG7 A;  3GLJ A;  5A28 A;  1GYT A;  2FIA A;  3NA6 A;  1BPM A;  2J8N A;  4NGP A;  4AG7 A;  4PQA A;  2AFU A;  2DEA A;  3KR4 A;  4ZY1 A;  1YQE A;  4JXR A;  1CPS A;  3DSB A;  1PU9 A;  4NF1 A;  3P2F A;  4DUK A;  1SQH A;  2WPX A;  4NGN A;  1BOB A;  4F6A A;  3BI1 A;  2VEZ A;  1XMB A;  4EME A;  4KZT A;  7CPA A;  3K9T A;  4CGO A;  2RFH A;  5EMI A;  2AFZ A;  1TKF A;  3LWU A;  4WWV A;  3TC8 A;  3TOB A;  3KZW A;  1NSA A;  4XPK A;  2P6G A;  2F8H A;  4P10 A;  3D2P A;  1Z2L A;  3VAT A;  1VGY A;  2X7B A;  3NH4 A;  2GRE A;  3T8W A;  2ZOG A;  3PFE A;  4NGS A;  4HKF A;  3KL9 A;  5CBM A;  4CYQ A;  3S9N A;  1LAP A;  1XFO A;  4NFR A;  1R43 A;  3W6S A;  3IU1 A;  3PZJ A;  5CNP A;  2GE3 A;  4A31 A;  3D3S A;  4B11 A;  4B14 A;  4CAE A;  2J9A A;  2RC4 A;  2Q7B A;  4F0X A;  4TWE A;  1Y9K A;  4H89 A;  4B10 A;  1S5K A;  1Z8W A;  3VWE A;  2OZU A;  4QUS A;  5K8M A;  2GFQ A;  1P4N A;  4Y49 B;  3WR7 A;  4KS9 A;  3EY5 A;  2CNT A;  4B5O A;  5IB9 A;  4XPD C;  2GU2 A;  2ZPA A;  3VWD A;  2NSM A;  1R57 A;  3SI2 A;  4F9V A;  1Z8L A;  3GIU A;  4NGR A;  1IOI A;  2Y0M A;  1MJB A;  4NCZ A;  5F49 A;  1FNO A;  4KUA A;  2CTC A;  3G3S A;  2QEC A;  4KOW A;  3EC4 A;  3D68 A;  1S7F A;  3ISX A;  3BHX A;  3E0K A;  2A4N A;  4MFK A;  2ARH A;  3KI9 A;  4OC0 A;  4QBJ A;  4U5Y A;  5IX3 A;  4AVB A;  4KSF A;  5AGE A;  2PSW A;  2Q04 A;  1MK4 A;  2O4H A;  4ZY2 A;  1Q2Y A;  3IJ3 A;  5EC4 A;  1M4D A;  4JXQ A;  2O28 A;  5LRG A;  2I00 A;  2R1I A;  2C27 A;  4Y49 C;  2GIV A;  2PCU A;  1M4L A;  3R1K A;  2ZEL A;  3R9E A;  4A95 A;  2AFO A;  4H6U A;  3SJF A;  2ZW6 A;  4OAE A;  1QSR A;  2JDC A;  3B2Y A;  3IEH A;  5F48 A;  4CPA A;  4HNW B;  4KUB A;  3H8E A;  3I1U A;  1IB1 E;  4CS0 B;  4ZYQ A;  6CPA A;  3TOA A;  2HC9 A;  3KR5 A;  4UA3 A;  2POK A;  3FX6 A;  1TKJ A;  1ARM A;  3SHP A;  4KOS A;  4YWY A;  4R8F A;  5D8N A;  4MHD A;  5CPA A;  1DE4 C;  1DTD A;  5HXD A;  2GLF A;  1Y7E A;  2D4O A;  4CGL A;  2KCW A;  2I3C A;  4II9 A;  4NGM A;  2YGW A;  3RO0 A;  2OOT A;  1IIC A;  2QJ8 A;  1XMT A;  2NYQ A;  1VHE A;  4ORF A;  4CGM A;  4JLY A;  3S6K A;  3IU2 A;  4X5K A;  2ZEF A;  2R98 A;  3FIX A;  4R9M A;  3SXN A;  1S60 A;  5J8F A;  2PJ1 A;  2FT0 A;  2WPW A;  4LQG A;  3JVN A;  4LQ6 A;  4P4F A;  3B8G A;  4KOU A;  3KAS A;  4KVM E;  3CT9 A;  4FWU A;  2PR1 A;  4Q38 A;  5ELY A;  4OAD A;  3V8I A;  3S9L A;  2VBQ A;  3PB8 X;  4UWI A;  2PJ8 A;  4PXC A;  3D2M A;  2EWB A;  4R76 A;  1YLE A;  4NSQ A;  4A38 A;  3MRU A;  2QYV A;  2AE6 A;  2K5T A;  1RXT A;  3RBU A;  2XEF A;  2ATR A;  3WT4 A;  3ZJ0 A;  2Z3O A;  2IJZ A;  4MFQ A;  4P4E A;  1CP7 A;  5HVH A;  1XIX A;  1YVK A;  4O23 A;  3K2K A;  3LAC A;  4OC2 A;  4MRI A;  5E96 A;  2VZZ A;  3SI0 A;  3LMS A;  4FBE A;  4MMO A;  4MY3 A;  1ARL A;  2Q44 A;  2OU2 A;  3KHZ A;  3TO9 A;  2Q0Y A;  4IF5 A;  3CXS A;  1YGH A;  2PC1 A;  5A27 A;  4UCN A;  2ANP A;  3DLJ A;  1M1D A;  2ZEE A;  4MHN A;  4ZY0 A;  1QST A;  1LAM A;  3KKW A;  3PFO A;  4GS4 A;  2O53 A;  3WC5 A;  1UFH A;  2WUU A;  3FXT A;  5I0C A;  1VKC A;  2CY2 A;  2QVP A;  4KOT A;  2AFW A;  4NGQ A;  1MJA A;  2WSA A;  3PP9 A;  4AG9 A;  5EBV A;  2PDO A;  1XF8 A;  4B5P A;  3PBB A;  4BMH A;  3RNZ A;  1JQG A;  1NE9 A;  2PRB A;  3FEE A;  2ZEG A;  2NMT A;  2FVG A;  2PJ5 A;  4PPZ A;  1LCP A;  5KTD A;  1KUY A;  4C7I A;  2B4D A;  1XJO A;  5I4M A;  4PSX A;  2B3U A;  3R96 A;  3GY9 A;  3FVL A;  3F8K A;  4IAV A;  4CRY B;  1JWQ A;  1Z5R A;  3BJ8 A;  3V7Z A;  2ZXV A;  1PCA A;  4QC6 A;  2PJB A;  3WAB A;  4L89 A;  4W9Y A;  1ZG9 A;  3IWE A;  4A33 A;  4A94 A;  2Z0Z A;  2FE7 A;  2WZN A;  2PIY A;  2Z3P A;  3DNS A;  2AJ6 A;  4R7M A;  4UEZ A;  1FT7 A;  3TFY A;  2CXA A;  1QMU A;  4BD9 A;  1HDU A;  4RS2 A;  4ZBG A;  1B6B A;  5JQ4 A;  3I9S A;  4FAI A;  1M4G A;  3NFZ A;  3T90 A;  4DNC A;  4YFJ A;  3PB9 X;  8CPA A;  5G22 A;  1LAN A;  3R95 A;  1I1D A;  2R7H A;  4H6Z A;  4MHY A;  4ONU A;  4UBR A;  2OB0 A;  1PUA A;  1X12 A;  2ZW5 A;  4RUH A;  4A2Z A;  3FRM A;  1CX8 A;  3NE8 A;  2PVW A;  3B3S A;  4KLV A;  2Z3N A;  2PJ6 A;  4IK2 A;  3QAH A;  5JGF A;  1X10 A;  2DPT A;  3FBU A;  3QB8 A;  1Q2C A;  1VHS A;  4JWP A;  4U9Y A;  1GHE A;  4IUS A;  4H2K A;  2YNC A;  2PQ8 A;  4G1P A;  5F09 A;  2FL4 A;  1KUV A;  2HB6 A;  3GB0 A;  2J8M A;  2V8D A;  3PGP A;  2PJ2 A;  4AB7 A;  3NE7 A;  5GCN A;  3L2N A;  4JJX A;  1CP6 A;  2VL1 A;  3D67 A;  1FY7 A;  4L8A A;  3BJ7 A;  4KVX A;  2QIR A;  2ZOF A;  2J8R A;  4JD6 A;  2V77 A;  2BCO A;  1YLO A;  2EVN A;  3IO1 A;  2ABZ A;  3D66 A;  3LD2 A;  4OID A;  4P4J A;  5IB0 A;  1YRE A;  4AXV A;  1ELM P;  2IMO A;  3JRU A;  2V8G A;  3PB7 X;  1XEB A;  1HDQ A;  3HUV A;  2GLJ A;  2ZEN A;  2JBJ A;  1AMP A;  3GUX A;  1N71 A;  4M6G A;  2REE A;  1F2O A;  2XEG A;  4KLW A;  1NSL A;  2XEI A;  1EE3 P;  3F5B A;  5J1Q A;  2YNE A;  3W6X A;  1S7K A;  3KQX A;  3GYA A;  1KUX A;  2G3A A;  5LYL A;  1LFW A;  2IL4 A;  4M6H A;  3WC6 A;  4X2T A;  3D4U A;  4R3K A;  1Z8X A;  2PJC A;  4OC1 A;  4B5P B;  2PVV A;  1WK4 A;  2YND A;  2Z3M A;  4OME A;  4ZX8 A;  5KTC A;  3NH5 A;  3CDX A;  1VIX A;  3CZX A;  4UFW A;  5AG5 A;  4LUA A;  2FSR A;  4NJQ A;  3CXP A;  1LOK A;  1XRY A;  1ZG8 A;  1U6M A;  2G9D A;  2PR8 A;  2VI7 A;  4DYO A;  4I49 A;  2ODF A;  1Z8T A;  4A39 A;  5KTA A;  2ZEH A;  5LYF A;  2JLM A;  2AFX A;  1S7L A;  4XPD B;  1IYL A;  2AFS A;  1RO5 A;  1XOV A;  1V0C A;  4OC5 A;  4R6T A;  4GM5 A;  4CAF A;  3PRT A;  4FUU A;  5LRK A;  1ELL P;  1I12 A;  2OR4 A;  1CPX A;  4MXU A;  4JYW A;  4UCM A;  3RYO A;  4YU9 A;  4C7H A;  1M44 A;  1QSO A;  2F5I A;  3BI0 A;  3B35 A;  2JBK A;  3KHX A;  3ZZI A;  5IV0 A;  1CG2 A;  3FF3 A;  2YNC C;  4WJB A;  1ZLH A;  2PJ9 A;  3PBE A;  4UIB A;  1QSM A;  2EK8 A;  4M6I A;  4NXY A;  3WC7 A;  5K8P A;  1XE4 A;  2PJ4 A;  2BO9 A;  4MBU A;  1YX0 A;  1PYT B;  2DPS A;  3S9M A;  2PJ3 A;  3IWG A;  3IGR A;  4B6Z A;  5HVG A;  2XEJ A;  3H5Z A;  2B5G B;  2CF4 A;  4EVY A;  4UEE A;  4KOV A;  2F7V A;  3SXO A;  1YVO A;  5HVF A;  1BLL E;  5THW A;  2B4B A;  4QVT A;  4FD5 A;  4PV6 A;  3G8W A;  1CM0 A;  3PEI A;  1K4J A;  2BOA A;  3SJG A;  1YW4 A;  2EBJ A;  4F9U A;  5LRJ A;  2HQY A;  4K30 A;  3EXN A;  4YGO A;  4CYO A;  4FD6 A;  4M3S A;  3CXQ A;  4A30 A;  3H8F A;  1BO4 A;  4OLL A;  4P4B A;  4E8O A;  4HNY B;  3C26 A;  1Y0R A;  3B3V A;  4OP4 A;  4RN7 A;  4ZX9 A;  4BIN A;  1RTQ A;  3R9F A;  4ZGY B;  1Y9W A;  2BEI A;  4K3N A;  4Q7A A;  4KOX A;  1AYE A;  2BSW A;  4P6Y A;  5G21 A;  4EWT A;  3ISZ A;  2B3V A;  1B87 A;  3FMC A;  2PJA A;  2FS5 A;  4YRH A;  4A32 A;  3FYN A;  3H8G A;  1A2Z A;  1IU8 A;  1HEE A;  1TF9 A;  3B7I A;  3FED A;  4A37 A;  3I3G A;  2ZEM A;  3D7D A;  1VHO A;  1CBX A;  2WYR A;  4P45 A;  4CYN A;  1NMT A;  4XNH B;  4R87 A;  5DWN A;  4CGP A;  5D29 A;  3R9G A;  4C2X A;  4P4I A;  5DS0 A;  4AVC A;  3P2H A;  1Y0Y A;  4TNU A;  5C82 A;  1J4J A;  3UY5 A;  1TXR A;  3S6F A;  4C2Y A;  4F8Z A;  1MJ9 A;  2AFM A;  4R3L A;  1R3N A;  4MFZ A;  4MHZ A;  2CIJ A;  2DF5 A;  1ZLI A;  2Q51 A;  1F57 A;  2ZED A;  2PIZ A;  4B12 A;  5K8N A;  1OBR A;  3S6G A;  3SJX A;  5G1Z A;  2JDD A;  5LYD A;  3IFE A;  1YR0 A;  3TTH A;  4C68 A;  1BAV A;  2PE3 A;  2PJ7 A;  2C6C A;  4MFP A;  3VH9 A;  1TF8 A;  5JH9 A;  4KSA A;  2P0W A;  3SJE A;  5C88 A;  1Q2D A;  4Z65 A;  4MCP A;  3CPA A;  4UEF A;  3FJU A;  4XNH C;  4NEX A;  4PXD A;  2HV2 A;  4MHP A;  3D7F A;  4CAX A;  4CAW A;  1TKH A;  1LRZ A;  2OZG A;  2B58 A;  2PJ0 A;  3DR6 A;  4KOR A;  4OC3 A;  5AG6 A;  4UFV A;  2Z11 A;  2BL1 A;  5JM6 A;  4XPL A;  1IID A;  2P6F A;  1CJW A;  2G3T A;  2V8V A;  3H4Q A;  3NH8 A;  4CAV A;  4E2A A;  3RAM A;  3VAR A;  4CRZ B;  4MJ8 A;  2VZY A;  4PXB A;  2CNM A;  3B3T A;  4UWJ A;  3D8P A;  3KGQ A;  1IY7 A;  3PB4 X;  3TX8 A;  4ZI6 A;  3TO7 A;  3GKR A;  4MCR A;  4MFJ A;  1OZP A;  3LOD A;  3SI1 A;  2CTB A;  2OH1 A;  3QNV A;  5ISV A;  4KVO E;  3QAY A;  2EUI A;  4PK2 A;  1TIQ A;  2IQ6 A;  2Q4Y A;  2ZW7 A;  4F0Y A;  2OZH A;  2D4P A;  3MGD A;  4KOY A;  1BPN A;  1Y7R A;  2DXQ A;  2R8V A;  4OKO A;  5H86 A;  2EK9 A;  5F46 A;  3V38 A;  4KSI A;  4MCQ A;  4MI4 A;  2FXF A;  4HNX B;  3BXM A;  3N5F A;  5F47 A;  3T9Y A;  1ON0 A;  3OWC A;  2Z10 A;  2Z3L A;  5JPH A;  2REF A;  3DGV A;  3FB3 A;  2H5M A;  3D7H A;  2P6E A;  4PSW A;  3HLP A;  2Q7S A;  5AG4 A;  3B3W A;  4OC4 A;  5BWA B;  4P44 A;  1IYK A;  4IHM A;  4QB9 A;  2Z3K A;  4PXE A;  3BLN A;  1XBU A;  4LX9 A;  2PRQ A;  4JZ0 A;  4U9Z A;  2QML A;  2C6G A;  4NGT A;  2Q4V A;  5H84 A;  3TE4 A;  2BUE A;  2C1C A;  4MFL A;  5DWM A;  4CGN A;  4E0A A;  4GXH A;  3F0A A;  4OIW A;  2GAN A;  4Q36 A;  4J3G A;  1H8L A;  3PB6 X;  4UFX A;  3DR8 A;  5FVJ A;  2RB7 A;  1ZG7 A;  1AUG A;  4EFD A;  3EFA A;  3A9L A;  1UWY A;  1YSJ A;  4R57 A;  2VQY A;  2JEW A;  2VXK A;  4UCP A;  1S7N A;  2B5G A;  5HH1 A;  3FEC A;  5LYI A;  2G0B A;  2B4D B;  3EO4 A;  1Z4R A;  2FCK A;  2EO8 A;  4DJL A;  3TO6 A;  2V8H A;  4P4D A;  4RI1 A;  1ZO0 A;  1KZF A;  4BBH A;  3FH4 A;  3CPX A;  1YME A;  1IOF A;  3N7Z A;  3TCV A;  3TT2 A;  3D7G A;  4C2Z A;  1Z4E A;  5HMN A;  2Q4Z A;  2I79 A;  3K9U A;  4PK3 A;  1WWZ A;  3DDD A;  1YK3 A;  3IWW A;  1KWM A;  3MN8 A;  4UF4 A;  4AVA A;  2C6P A;  4NJR A;  3IC1 A;  1L0C A;  3RZA A; 
#chains in the Genus database with same CATH homology
 1AUG A;  3GIU A;  1IOI A;  1Z8T A;  1Z8X A;  1IU8 A;  1A2Z A;  1IOF A;  3RO0 A;  1Z8W A;  4GXH A;  4HPS A;  3RNZ A;  2EO8 A;  1X10 A;  3LAC A;  1X12 A;  2EBJ A;  2DF5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...