3GIUA

1.25 angstrom crystal structure of pyrrolidone-carboxylate peptidase (pcp) from staphylococcus aureus
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
212
structure length
212
Chain Sequence
MHILVTGFAPFDNQNINPSWEAVTQLEDIIGTHTIDKLKLPTSFKKVDNIINKTLASNHYDVVLAIGQAGGRNAITPERVAINIDDARIPDNDDFQPIDQAIHLDGAPAYFSNLPVKAMTQSIINQGLPGALSNSAGTFVCNHTLYHLGYLQDKHYPHLRFGFIHVPYIPEQVIGKPDTPSMPLEKIVAGLTAAIEAISNDEDLHLALGTTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Pyrrolidone-carboxylate peptidase
publication title 1.25 Angstrom Crystal Structure of Pyrrolidone-Carboxylate Peptidase (pcp) from Staphylococcus aureus
rcsb
source organism Staphylococcus aureus subsp. aureus col
total genus 66
structure length 212
sequence length 212
chains with identical sequence B
ec nomenclature ec 3.4.19.3: Pyroglutamyl-peptidase I.
pdb deposition date 2009-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01470 Peptidase_C15 Pyroglutamyl peptidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.20 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Peptidase C15, pyroglutamyl peptidase I-like 3giuA00
1AUGA 2EBJA 2EO8A 2DF5A 1X10A 1IOFA 1IOIA 4HPSA 3LACA 1Z8TA 1A2ZA 1IU8A 1X12A 1Z8XA 4GXHA 3RNZA 3RO0A 3GIUA 1Z8WA
chains in the Genus database with same CATH superfamily
2QIRA 3HLPA 5D8NA 5AG5A 4ZY1A 4PXBA 1YW4A 3RAMA 2F8HA 2PJBA 2PC1A 3FXTA 4CAFA 4MI4A 3G3SA 4KSIA 2RFHA 4ZY0A 4UCNA 2GE3A 3SJFA 4AXVA 4MCPA 4YGOA 1LFWA 1LANA 4LQ6A 4U9ZA 2J9AA 1VHEA 2HV2A 4OC3A 3LMSA 1XF8A 1QSNA 4R9MA 4RS2A 2ZW4A 2KCWA 1CPSA 2AFMA 4K3NA 4AVCA 1GYTA 4KVXA 1M4LA 5CPAA 4A37A 2FXFA 4CAEA 2BSWA 3JUWA 4A39A 4PK3A 1WK4A 4QB9A 2QECA 4U5YA 2ZEMA 3TOBA 2HB6A 3KQXA 4NXYA 4OLLA 2IJZA 3OWCA 3D4UA 3WC7A 3B3SA 1R43A 3ZZIA 3FECA 4MY3A 2PJ1A 2CTBA 3SI2A 5FVJA 1VGYA 2OU2A 2PIYA 4KOWA 1YQEA 2IL4A 1Q2DA 5EMIA 2ZENA 3SXNA 1IYLA 2PJCA 2O53A 2XEIA 5DWMA 4R87A 3RYOA 4KVME 2F7VA 3CDXA 2X7BA 4R3KA 1RO5A 4NGSA 4LQGA 3WT4A 4RI1A 4B5PA 2D4PA 3D7DA 2PJ2A 5G21A 1VIXA 4CRZB 1Z5RA 1TXRA 4X3RA 4CGPA 4B12A 2B58A 4CGMA 3PEIA 5DWNA 4NJRA 3BI0A 3D3SA 2EUIA 3SI0A 5I0CA 2ZEGA 3MGDA 2VBQA 4CGLA 1B6BA 2OB0A 4QUSA 3ZJ0A 3TE4A 4GS4A 3FEEA 2JDDA 3MRUA 3WR7A 2ODFA 2HUZA 4EFDA 3EXNA 1HDUA 1Z8LA 2WPWA 3H8FA 1RXTA 3TC8A 4F9VA 2D4OA 1R3NA 3L2NA 1NMTA 5AG4A 3FB3A 4FAIA 3RO0A 3B2YA 1V0CA 2ZEHA 4L8AA 2Q0YA 4AG9A 3KHXA 4JJXA 4FBEA 4IUSA 3NH8A 4C2XA 1DTDA 3IJ3A 5LYFA 1TKFA 2NMTA 2Q51A 2OR4A 3DLJA 1I12A 4UBRA 3R9GA 4P4JA 5JQ4A 4AVAA 1AUGA 2XEGA 4YU9A 2PIZA 4UEFA 2EK9A 4E8OA 2VL1A 1ARMA 4PXCA 3JTKA 5HMNA 1RTQA 4KZTA 1XE4A 3FJUA 4ZGYB 2Q4ZA 3GKRA 4OC2A 1QSTA 1YX0A 3IIBA 1BAVA 4TNUA 3FYNA 2BOAA 2FVGA 4CGOA 3H8GA 1Y0RA 4MMOA 3FVLA 2ZELA 3CPXA 3KR4A 3PB6X 3TX8A 4P4DA 1CP7A 1FY7A 1S7KA 1ELMP 2PSWA 1CX8A 5LYDA 4CYPA 4FUUA 1Z2LA 3B35A 1YMEA 4GM5A 4P45A 4JZ0A 2C6CA 2WYRA 2G0BA 3KHZA 4B6ZA 1F57A 3QB8A 4PXDA 5ELYA 1PCAA 4M3SA 3KR5A 4XPDB 1P0HA 4PPZA 3FEDA 3TFYA 4IAVA 1I21A 3PGPA 4MHPA 4P44A 2DEAA 4A38A 3B8GA 4NSQA 2OZHA 4B5OA 2JEVA 3B3WA 5IB0A 3QAHA 4B11A 1IIDA 1PUAA 4A30A 2PJ9A 1LAPA 5G22A 2B5GB 1XJOA 2FIWA 1X12A 4MFQA 1HDQA 3R9FA 5F49A 3EC4A 3S9MA 5K8OA 4GXHA 1M4GA 2YNEA 2PVWA 4KOVA 2FS5A 4RN7A 4C7HA 3FRMA 2QMLA 3IC1A 2Z3OA 3PBBA 4CYOA 3LD2A 1XRYA 3GB0A 1J4JA 3H5ZA 3NA6A 3CXPA 2WPXA 4JXRA 2JBJA 3FNCA 5JPHA 4L89A 3H4QA 4KVOE 2GFQA 3DGVA 3QAYA 1LOKA 2C6GA 3GLJA 4JXQA 1QSRA 3SJXA 4ZX9A 4HPSA 4QVTA 4PQAA 3RBUA 4B10A 5HH1A 2GLJA 2PVVA 2B4BA 2CNMA 2ZW6A 3CXQA 2Z10A 1YREA 2PDOA 1Z4RA 3RNZA 5BWAB 4ONWA 4O23A 4PV6A 5LRGA 3FX6A 3VH9A 4XNHB 1NSLA 4KOSA 3PBEA 2ABZA 2J8RA 1M1DA 2V8VA 3PB7X 4ZY2A 4CYNA 3JVNA 2AJ6A 4KLVA 4MBUA 4R76A 4TWEA 4B14A 4P4FA 5H84A 1IB1E 1MJAA 1OZPA 1M44A 2FIAA 3DDDA 3KZWA 4KLWA 3B3TA 3SI1A 4C2ZA 4MFKA 2ZEOA 1OBRA 1IOFA 2I3CA 3A9LA 1LRZA 1Q7LA 2H5MA 3R1KA 4II9A 4B5PB 4UEZA 3PB8X 2FT0A 5GCNA 4MFZA 2VXKA 4A95A 2HQYA 4UEEA 1XOVA 1CM0A 3DR6A 1QSMA 3F5BA 3K9TA 3PFOA 3PZJA 4J3GA 2YGWA 2IQ6A 5LRJA 3SJGA 2ZOGA 3SXOA 4UFVA 2G3TA 3TT2A 1KWMA 1Y0YA 2BL1A 1IY7A 5CBMA 1ZG8A 4DNCA 2VEZA 3IFEA 3N5FA 4PK2A 3BLNA 2P6GA 4MFLA 3F0AA 3KASA 2V8GA 4H6ZA 1XFOA 2RC4A 4OC1A 3NH5A 5A28A 1U6MA 2EVNA 4MHNA 2Q7SA 3DNSA 2Z3LA 2Q43A 2YNDA 1LAMA 1NSAA 2CXAA 3BHXA 3CXSA 4Y49B 3W91A 4MHDA 1XMTA 1EE3P 1Y9KA 3VWEA 2ZEPA 3TO7A 1ZO0A 3W6SA 4MFPA 4JWPA 5KTDA 2P6EA 4MCQA 3D7GA 4LUAA 1CG2A 1IICA 3WC5A 3ISXA 4R7MA 4EVYA 2OZGA 1IU8A 4MJ8A 5IX3A 2VZZA 3R95A 1UWYA 4BD9A 4BINA 4DJLA 2R1IA 1B87A 2Z3NA 3D2MA 1Z9UA 1K4JA 2RB7A 2ZEFA 3KL9A 1TIQA 4U9YA 1CBXA 2HC9A 5KTCA 4MFJA 4DYOA 5F09A 1BO4A 4ZYQA 2PJ0A 2Z3KA 3IU1A 2AE6A 4WWVA 5K8NA 1BPNA 2BO9A 5C88A 2GLFA 3KI9A 5LYIA 1FT7A 1Y7RA 2PR8A 2J8NA 1M4DA 2EO8A 2B4DB 2DF5A 1YVOA 2O28A 1S3ZA 4PSWA 4IF5A 3S6GA 2JLMA 3VATA 4OIWA 2PJ5A 2PCUA 3BJ8A 3N7ZA 4MCRA 4Q7AA 1TF9A 3D8PA 1MJ9A 2B4DA 4OADA 4UA3A 2XEFA 5F47A 3TO9A 2ZW5A 4NJQA 3H8EA 4KORA 1ZLHA 3D68A 2Y0MA 3IWGA 4Z65A 1H8LA 4KOUA 2NSMA 2A4NA 4IK2A 2OOTA 1ZLIA 3EO4A 4NGTA 4F8ZA 2AFOA 4R6TA 4ZBGA 4NEXA 3D67A 3G8WA 3TTHA 4YFJA 2Z3MA 2ATRA 4F0YA 3IGRA 4R57A 5HVFA 1Z4EA 4QC6A 2DXQA 3GYAA 4UIAA 3GY9A 3R96A 6CPAA 4A94A 3PRTA 2B3VA 2FCKA 4OP4A 3PP9A 3FF3A 4KOXA 5JGFA 3WABA 4X8IA 1ARLA 4MCSA 4R3LA 3RZAA 2Q4YA 2CIJA 4FD5A 4C7IA 1IYKA 4B13A 4MXUA 4JYWA 1UFHA 4HNXB 1CJWA 1ELLP 2V77A 4I49A 4CPAA 2JBKA 3DR8A 4KSAA 5E96A 4XPDC 4P10A 3D2PA 4WJBA 2P0WA 2YNCA 3PB4X 3I1UA 2GU2A 3BJ7A 3P2HA 5DS0A 3S6KA 1YSJA 4X5KA 2JEWA 1PU9A 2I79A 1Q2YA 3CZXA 3EY5A 4OC4A 4AB7A 2EWBA 1L0CA 4DUKA 4XPKA 3KGQA 4XPLA 5D29A 3I9SA 4F9UA 1YGHA 2PJ8A 2VQYA 3LACA 1XBUA 3FMCA 3MN8A 2WUUA 5JM6A 5HXDA 4YRHA 2QJ8A 2ZXVA 5EC4A 2R7HA 2WZNA 1VKCA 2GIVA 4AG7A 3I3GA 4EWTA 2BUEA 5CNPA 2ZOFA 4NCZA 1GHEA 2EK8A 3B3VA 3D66A 4NGRA 2K5TA 3CPAA 2BCOA 3K2KA 5IV0A 1MJBA 5LRKA 4W9YA 2Z11A 2Q4VA 2G9DA 2ZW7A 1ON0A 5IB9A 1YLEA 2P6FA 1X10A 3C26A 4OC5A 4KSFA 1IGBA 2XEJA 4JLYA 1IOIA 2BEIA 2CF4A 4F0XA 4XNHC 3UY5A 2ZEDA 1VHSA 4IHMA 1YK3A 2C6PA 5HVHA 5JH9A 1S7FA 4FD4A 4MY0A 3TCVA 2GREA 1KUYA 3LWUA 3SJEA 1S7NA 3GUXA 3B3CA 2ZEEA 1ZG7A 4PSXA 4UFXA 5G20A 4CRYB 1P4NA 2I00A 1LCPA 4OMEA 4KOTA 1Y7EA 4ORFA 1S60A 3SHPA 5F46A 1DE4C 1R57A 5EBVA 1Z8WA 4UWIA 5H86A 3FH4A 2C27A 4ONUA 2WSAA 1BLLE 4CS0B 2R98A 5G1ZA 2Q44A 1FNOA 7CPAA 2PJ7A 3T90A 2AFUA 4E2AA 1BPMA 2IMOA 3V38A 1F2OA 1XEBA 3DSBA 3W6XA 2CY2A 1Y9WA 2V8HA 3K9UA 4ZX8A 1Z8TA 1A2ZA 2Z0ZA 5J1QA 2ANPA 3D7FA 1S7LA 2PE3A 2REEA 3IEHA 1M4IA 1S5KA 1Z8XA 3KQZA 4NGMA 4Y49C 4KOYA 5THWA 3R9EA 4RUHA 5LYLA 3GIUA 2B3UA 2O4HA 2QVPA 2DPSA 2V8DA 3JRUA 2QYVA 3FIXA 3NH4A 3S9NA 3LODA 3S6HA 3NE7A 5F48A 3VWDA 2PRQA 3E0KA 3EFAA 2FE7A 5AGEA 3D7HA 4BMHA 3S9LA 1VHOA 2NYQA 2J8MA 4MRIA 5C82A 5KTAA 1I1DA 1QMUA 3IO1A 3TO6A 4A31A 4CAWA 5J8FA 2PJ6A 2R8VA 3IU2A 1N71A 4NGPA 4KUBA 5AG6A 1JQGA 4R8FA 1KUXA 3PB9X 4M6GA 5ISVA 1YLOA 4HKFA 4EMEA 4CGNA 4NF1A 1CP6A 2FSRA 2CNSA 4H2KA 4C2YA 3F8KA 4CYQA 1QSOA 5HVGA 5K8MA 4MHZA 4OC0A 4UCPA 3BI1A 1F2PA 2DPTA 3HUVA 4ZI6A 3ISZA 2VZYA 8CPAA 4P4EA 3KKWA 4F6AA 1YR0A 2PJ3A 3BXMA 1PYTB 2PQ8A 1TKJA 1JWQA 4P4IA 1TF8A 4YWYA 4FD7A 4QBJA 4KUAA 1XIXA 2PR1A 1NE9A 4H89A 1KZFA 2C1CA 2EBJA 4UCMA 2ZPAA 4FWUA 3V8IA 2VI7A 4A2ZA 1MK4A 2CNTA 2FL4A 4NFRA 3WC6A 5AG7A 1YW6A 4NGNA 4OAEA 4AVBA 5A27A 4UFWA 1QQ9A 3V7ZA 4HNYB 3B7IA 4C68A 2Q7BA 1HEEA 3IWWA 4G1PA 4Q36A 4UIBA 4LX9A 2Z3PA 2ARHA 2OZUA 4HNWB 4NGQA 4OKOA 4A33A 4E0AA 3T8WA 2AFXA 1WWZA 3P2FA 4P6YA 4X2TA 3TOAA 4BBHA 4CAXA 3VARA 2OH1A 4MHYA 1AMPA 4H6UA 2PJ4A 2PRBA 2F5IA 3NFZA 2Q04A 4P4BA 4Q38A 1XMBA 1BOBA 5K8PA 1AYEA 1YVKA 2AFWA 4PXEA 4M6IA 2YNCC 1Q2CA 4CAVA 5J8CA 2AFSA 3CT9A 3IWEA 1TKHA 3PFEA 4UWJA 4A32A 3QNVA 1ZG9A 4KS9A 2PJAA 2G3AA 2REFA 4K30A 5I4MA 1KUVA 4M6HA 1SQHA 2AFZA 1CPXA 4OIDA 3NE8A 2GANA 4FD6A 3T9YA 3FBUA 2JDCA 3S6FA 2B5GA 2CTCA 2POKA 4JD6A 4M85A 4UF4A
chains in the Genus database with same CATH topology
1AUGA 2EBJA 2EO8A 2DF5A 1X10A 1IOFA 1IOIA 4HPSA 3LACA 1Z8TA 1A2ZA 1IU8A 1X12A 1Z8XA 4GXHA 3RNZA 3RO0A 3GIUA 1Z8WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1AUG A;  2EBJ A;  2EO8 A;  2DF5 A;  1X10 A;  1IOF A;  1IOI A;  4HPS A;  3LAC A;  1Z8T A;  1A2Z A;  1IU8 A;  1X12 A;  1Z8X A;  4GXH A;  3RNZ A;  3RO0 A;  3GIU A;  1Z8W A; 
#chains in the Genus database with same CATH topology
 2QIR A;  3HLP A;  5D8N A;  5AG5 A;  4ZY1 A;  4PXB A;  1YW4 A;  3RAM A;  2F8H A;  2PJB A;  2PC1 A;  3FXT A;  4CAF A;  4MI4 A;  3G3S A;  4KSI A;  2RFH A;  4ZY0 A;  4UCN A;  2GE3 A;  3SJF A;  4AXV A;  4MCP A;  4YGO A;  1LFW A;  1LAN A;  4LQ6 A;  4U9Z A;  2J9A A;  1VHE A;  2HV2 A;  4OC3 A;  3LMS A;  1XF8 A;  1QSN A;  4R9M A;  4RS2 A;  2ZW4 A;  2KCW A;  1CPS A;  2AFM A;  4K3N A;  4AVC A;  1GYT A;  4KVX A;  1M4L A;  5CPA A;  4A37 A;  2FXF A;  4CAE A;  2BSW A;  3JUW A;  4A39 A;  4PK3 A;  1WK4 A;  4QB9 A;  2QEC A;  4U5Y A;  2ZEM A;  3TOB A;  2HB6 A;  3KQX A;  4NXY A;  4OLL A;  2IJZ A;  3OWC A;  3D4U A;  3WC7 A;  3B3S A;  1R43 A;  3ZZI A;  3FEC A;  4MY3 A;  2PJ1 A;  2CTB A;  3SI2 A;  5FVJ A;  1VGY A;  2OU2 A;  2PIY A;  4KOW A;  1YQE A;  2IL4 A;  1Q2D A;  5EMI A;  2ZEN A;  3SXN A;  1IYL A;  2PJC A;  2O53 A;  2XEI A;  5DWM A;  4R87 A;  3RYO A;  4KVM E;  2F7V A;  3CDX A;  2X7B A;  4R3K A;  1RO5 A;  4NGS A;  4LQG A;  3WT4 A;  4RI1 A;  4B5P A;  2D4P A;  3D7D A;  2PJ2 A;  5G21 A;  1VIX A;  4CRZ B;  1Z5R A;  1TXR A;  4X3R A;  4CGP A;  4B12 A;  2B58 A;  4CGM A;  3PEI A;  5DWN A;  4NJR A;  3BI0 A;  3D3S A;  2EUI A;  3SI0 A;  5I0C A;  2ZEG A;  3MGD A;  2VBQ A;  4CGL A;  1B6B A;  2OB0 A;  4QUS A;  3ZJ0 A;  3TE4 A;  4GS4 A;  3FEE A;  2JDD A;  3MRU A;  3WR7 A;  2ODF A;  2HUZ A;  4EFD A;  3EXN A;  1HDU A;  1Z8L A;  2WPW A;  3H8F A;  1RXT A;  3TC8 A;  4F9V A;  2D4O A;  1R3N A;  3L2N A;  1NMT A;  5AG4 A;  3FB3 A;  4FAI A;  3RO0 A;  3B2Y A;  1V0C A;  2ZEH A;  4L8A A;  2Q0Y A;  4AG9 A;  3KHX A;  4JJX A;  4FBE A;  4IUS A;  3NH8 A;  4C2X A;  1DTD A;  3IJ3 A;  5LYF A;  1TKF A;  2NMT A;  2Q51 A;  2OR4 A;  3DLJ A;  1I12 A;  4UBR A;  3R9G A;  4P4J A;  5JQ4 A;  4AVA A;  1AUG A;  2XEG A;  4YU9 A;  2PIZ A;  4UEF A;  2EK9 A;  4E8O A;  2VL1 A;  1ARM A;  4PXC A;  3JTK A;  5HMN A;  1RTQ A;  4KZT A;  1XE4 A;  3FJU A;  4ZGY B;  2Q4Z A;  3GKR A;  4OC2 A;  1QST A;  1YX0 A;  3IIB A;  1BAV A;  4TNU A;  3FYN A;  2BOA A;  2FVG A;  4CGO A;  3H8G A;  1Y0R A;  4MMO A;  3FVL A;  2ZEL A;  3CPX A;  3KR4 A;  3PB6 X;  3TX8 A;  4P4D A;  1CP7 A;  1FY7 A;  1S7K A;  1ELM P;  2PSW A;  1CX8 A;  5LYD A;  4CYP A;  4FUU A;  1Z2L A;  3B35 A;  1YME A;  4GM5 A;  4P45 A;  4JZ0 A;  2C6C A;  2WYR A;  2G0B A;  3KHZ A;  4B6Z A;  1F57 A;  3QB8 A;  4PXD A;  5ELY A;  1PCA A;  4M3S A;  3KR5 A;  4XPD B;  1P0H A;  4PPZ A;  3FED A;  3TFY A;  4IAV A;  1I21 A;  3PGP A;  4MHP A;  4P44 A;  2DEA A;  4A38 A;  3B8G A;  4NSQ A;  2OZH A;  4B5O A;  2JEV A;  3B3W A;  5IB0 A;  3QAH A;  4B11 A;  1IID A;  1PUA A;  4A30 A;  2PJ9 A;  1LAP A;  5G22 A;  2B5G B;  1XJO A;  2FIW A;  1X12 A;  4MFQ A;  1HDQ A;  3R9F A;  5F49 A;  3EC4 A;  3S9M A;  5K8O A;  4GXH A;  1M4G A;  2YNE A;  2PVW A;  4KOV A;  2FS5 A;  4RN7 A;  4C7H A;  3FRM A;  2QML A;  3IC1 A;  2Z3O A;  3PBB A;  4CYO A;  3LD2 A;  1XRY A;  3GB0 A;  1J4J A;  3H5Z A;  3NA6 A;  3CXP A;  2WPX A;  4JXR A;  2JBJ A;  3FNC A;  5JPH A;  4L89 A;  3H4Q A;  4KVO E;  2GFQ A;  3DGV A;  3QAY A;  1LOK A;  2C6G A;  3GLJ A;  4JXQ A;  1QSR A;  3SJX A;  4ZX9 A;  4HPS A;  4QVT A;  4PQA A;  3RBU A;  4B10 A;  5HH1 A;  2GLJ A;  2PVV A;  2B4B A;  2CNM A;  2ZW6 A;  3CXQ A;  2Z10 A;  1YRE A;  2PDO A;  1Z4R A;  3RNZ A;  5BWA B;  4ONW A;  4O23 A;  4PV6 A;  5LRG A;  3FX6 A;  3VH9 A;  4XNH B;  1NSL A;  4KOS A;  3PBE A;  2ABZ A;  2J8R A;  1M1D A;  2V8V A;  3PB7 X;  4ZY2 A;  4CYN A;  3JVN A;  2AJ6 A;  4KLV A;  4MBU A;  4R76 A;  4TWE A;  4B14 A;  4P4F A;  5H84 A;  1IB1 E;  1MJA A;  1OZP A;  1M44 A;  2FIA A;  3DDD A;  3KZW A;  4KLW A;  3B3T A;  3SI1 A;  4C2Z A;  4MFK A;  2ZEO A;  1OBR A;  1IOF A;  2I3C A;  3A9L A;  1LRZ A;  1Q7L A;  2H5M A;  3R1K A;  4II9 A;  4B5P B;  4UEZ A;  3PB8 X;  2FT0 A;  5GCN A;  4MFZ A;  2VXK A;  4A95 A;  2HQY A;  4UEE A;  1XOV A;  1CM0 A;  3DR6 A;  1QSM A;  3F5B A;  3K9T A;  3PFO A;  3PZJ A;  4J3G A;  2YGW A;  2IQ6 A;  5LRJ A;  3SJG A;  2ZOG A;  3SXO A;  4UFV A;  2G3T A;  3TT2 A;  1KWM A;  1Y0Y A;  2BL1 A;  1IY7 A;  5CBM A;  1ZG8 A;  4DNC A;  2VEZ A;  3IFE A;  3N5F A;  4PK2 A;  3BLN A;  2P6G A;  4MFL A;  3F0A A;  3KAS A;  2V8G A;  4H6Z A;  1XFO A;  2RC4 A;  4OC1 A;  3NH5 A;  5A28 A;  1U6M A;  2EVN A;  4MHN A;  2Q7S A;  3DNS A;  2Z3L A;  2Q43 A;  2YND A;  1LAM A;  1NSA A;  2CXA A;  3BHX A;  3CXS A;  4Y49 B;  3W91 A;  4MHD A;  1XMT A;  1EE3 P;  1Y9K A;  3VWE A;  2ZEP A;  3TO7 A;  1ZO0 A;  3W6S A;  4MFP A;  4JWP A;  5KTD A;  2P6E A;  4MCQ A;  3D7G A;  4LUA A;  1CG2 A;  1IIC A;  3WC5 A;  3ISX A;  4R7M A;  4EVY A;  2OZG A;  1IU8 A;  4MJ8 A;  5IX3 A;  2VZZ A;  3R95 A;  1UWY A;  4BD9 A;  4BIN A;  4DJL A;  2R1I A;  1B87 A;  2Z3N A;  3D2M A;  1Z9U A;  1K4J A;  2RB7 A;  2ZEF A;  3KL9 A;  1TIQ A;  4U9Y A;  1CBX A;  2HC9 A;  5KTC A;  4MFJ A;  4DYO A;  5F09 A;  1BO4 A;  4ZYQ A;  2PJ0 A;  2Z3K A;  3IU1 A;  2AE6 A;  4WWV A;  5K8N A;  1BPN A;  2BO9 A;  5C88 A;  2GLF A;  3KI9 A;  5LYI A;  1FT7 A;  1Y7R A;  2PR8 A;  2J8N A;  1M4D A;  2EO8 A;  2B4D B;  2DF5 A;  1YVO A;  2O28 A;  1S3Z A;  4PSW A;  4IF5 A;  3S6G A;  2JLM A;  3VAT A;  4OIW A;  2PJ5 A;  2PCU A;  3BJ8 A;  3N7Z A;  4MCR A;  4Q7A A;  1TF9 A;  3D8P A;  1MJ9 A;  2B4D A;  4OAD A;  4UA3 A;  2XEF A;  5F47 A;  3TO9 A;  2ZW5 A;  4NJQ A;  3H8E A;  4KOR A;  1ZLH A;  3D68 A;  2Y0M A;  3IWG A;  4Z65 A;  1H8L A;  4KOU A;  2NSM A;  2A4N A;  4IK2 A;  2OOT A;  1ZLI A;  3EO4 A;  4NGT A;  4F8Z A;  2AFO A;  4R6T A;  4ZBG A;  4NEX A;  3D67 A;  3G8W A;  3TTH A;  4YFJ A;  2Z3M A;  2ATR A;  4F0Y A;  3IGR A;  4R57 A;  5HVF A;  1Z4E A;  4QC6 A;  2DXQ A;  3GYA A;  4UIA A;  3GY9 A;  3R96 A;  6CPA A;  4A94 A;  3PRT A;  2B3V A;  2FCK A;  4OP4 A;  3PP9 A;  3FF3 A;  4KOX A;  5JGF A;  3WAB A;  4X8I A;  1ARL A;  4MCS A;  4R3L A;  3RZA A;  2Q4Y A;  2CIJ A;  4FD5 A;  4C7I A;  1IYK A;  4B13 A;  4MXU A;  4JYW A;  1UFH A;  4HNX B;  1CJW A;  1ELL P;  2V77 A;  4I49 A;  4CPA A;  2JBK A;  3DR8 A;  4KSA A;  5E96 A;  4XPD C;  4P10 A;  3D2P A;  4WJB A;  2P0W A;  2YNC A;  3PB4 X;  3I1U A;  2GU2 A;  3BJ7 A;  3P2H A;  5DS0 A;  3S6K A;  1YSJ A;  4X5K A;  2JEW A;  1PU9 A;  2I79 A;  1Q2Y A;  3CZX A;  3EY5 A;  4OC4 A;  4AB7 A;  2EWB A;  1L0C A;  4DUK A;  4XPK A;  3KGQ A;  4XPL A;  5D29 A;  3I9S A;  4F9U A;  1YGH A;  2PJ8 A;  2VQY A;  3LAC A;  1XBU A;  3FMC A;  3MN8 A;  2WUU A;  5JM6 A;  5HXD A;  4YRH A;  2QJ8 A;  2ZXV A;  5EC4 A;  2R7H A;  2WZN A;  1VKC A;  2GIV A;  4AG7 A;  3I3G A;  4EWT A;  2BUE A;  5CNP A;  2ZOF A;  4NCZ A;  1GHE A;  2EK8 A;  3B3V A;  3D66 A;  4NGR A;  2K5T A;  3CPA A;  2BCO A;  3K2K A;  5IV0 A;  1MJB A;  5LRK A;  4W9Y A;  2Z11 A;  2Q4V A;  2G9D A;  2ZW7 A;  1ON0 A;  5IB9 A;  1YLE A;  2P6F A;  1X10 A;  3C26 A;  4OC5 A;  4KSF A;  1IGB A;  2XEJ A;  4JLY A;  1IOI A;  2BEI A;  2CF4 A;  4F0X A;  4XNH C;  3UY5 A;  2ZED A;  1VHS A;  4IHM A;  1YK3 A;  2C6P A;  5HVH A;  5JH9 A;  1S7F A;  4FD4 A;  4MY0 A;  3TCV A;  2GRE A;  1KUY A;  3LWU A;  3SJE A;  1S7N A;  3GUX A;  3B3C A;  2ZEE A;  1ZG7 A;  4PSX A;  4UFX A;  5G20 A;  4CRY B;  1P4N A;  2I00 A;  1LCP A;  4OME A;  4KOT A;  1Y7E A;  4ORF A;  1S60 A;  3SHP A;  5F46 A;  1DE4 C;  1R57 A;  5EBV A;  1Z8W A;  4UWI A;  5H86 A;  3FH4 A;  2C27 A;  4ONU A;  2WSA A;  1BLL E;  4CS0 B;  2R98 A;  5G1Z A;  2Q44 A;  1FNO A;  7CPA A;  2PJ7 A;  3T90 A;  2AFU A;  4E2A A;  1BPM A;  2IMO A;  3V38 A;  1F2O A;  1XEB A;  3DSB A;  3W6X A;  2CY2 A;  1Y9W A;  2V8H A;  3K9U A;  4ZX8 A;  1Z8T A;  1A2Z A;  2Z0Z A;  5J1Q A;  2ANP A;  3D7F A;  1S7L A;  2PE3 A;  2REE A;  3IEH A;  1M4I A;  1S5K A;  1Z8X A;  3KQZ A;  4NGM A;  4Y49 C;  4KOY A;  5THW A;  3R9E A;  4RUH A;  5LYL A;  3GIU A;  2B3U A;  2O4H A;  2QVP A;  2DPS A;  2V8D A;  3JRU A;  2QYV A;  3FIX A;  3NH4 A;  3S9N A;  3LOD A;  3S6H A;  3NE7 A;  5F48 A;  3VWD A;  2PRQ A;  3E0K A;  3EFA A;  2FE7 A;  5AGE A;  3D7H A;  4BMH A;  3S9L A;  1VHO A;  2NYQ A;  2J8M A;  4MRI A;  5C82 A;  5KTA A;  1I1D A;  1QMU A;  3IO1 A;  3TO6 A;  4A31 A;  4CAW A;  5J8F A;  2PJ6 A;  2R8V A;  3IU2 A;  1N71 A;  4NGP A;  4KUB A;  5AG6 A;  1JQG A;  4R8F A;  1KUX A;  3PB9 X;  4M6G A;  5ISV A;  1YLO A;  4HKF A;  4EME A;  4CGN A;  4NF1 A;  1CP6 A;  2FSR A;  2CNS A;  4H2K A;  4C2Y A;  3F8K A;  4CYQ A;  1QSO A;  5HVG A;  5K8M A;  4MHZ A;  4OC0 A;  4UCP A;  3BI1 A;  1F2P A;  2DPT A;  3HUV A;  4ZI6 A;  3ISZ A;  2VZY A;  8CPA A;  4P4E A;  3KKW A;  4F6A A;  1YR0 A;  2PJ3 A;  3BXM A;  1PYT B;  2PQ8 A;  1TKJ A;  1JWQ A;  4P4I A;  1TF8 A;  4YWY A;  4FD7 A;  4QBJ A;  4KUA A;  1XIX A;  2PR1 A;  1NE9 A;  4H89 A;  1KZF A;  2C1C A;  2EBJ A;  4UCM A;  2ZPA A;  4FWU A;  3V8I A;  2VI7 A;  4A2Z A;  1MK4 A;  2CNT A;  2FL4 A;  4NFR A;  3WC6 A;  5AG7 A;  1YW6 A;  4NGN A;  4OAE A;  4AVB A;  5A27 A;  4UFW A;  1QQ9 A;  3V7Z A;  4HNY B;  3B7I A;  4C68 A;  2Q7B A;  1HEE A;  3IWW A;  4G1P A;  4Q36 A;  4UIB A;  4LX9 A;  2Z3P A;  2ARH A;  2OZU A;  4HNW B;  4NGQ A;  4OKO A;  4A33 A;  4E0A A;  3T8W A;  2AFX A;  1WWZ A;  3P2F A;  4P6Y A;  4X2T A;  3TOA A;  4BBH A;  4CAX A;  3VAR A;  2OH1 A;  4MHY A;  1AMP A;  4H6U A;  2PJ4 A;  2PRB A;  2F5I A;  3NFZ A;  2Q04 A;  4P4B A;  4Q38 A;  1XMB A;  1BOB A;  5K8P A;  1AYE A;  1YVK A;  2AFW A;  4PXE A;  4M6I A;  2YNC C;  1Q2C A;  4CAV A;  5J8C A;  2AFS A;  3CT9 A;  3IWE A;  1TKH A;  3PFE A;  4UWJ A;  4A32 A;  3QNV A;  1ZG9 A;  4KS9 A;  2PJA A;  2G3A A;  2REF A;  4K30 A;  5I4M A;  1KUV A;  4M6H A;  1SQH A;  2AFZ A;  1CPX A;  4OID A;  3NE8 A;  2GAN A;  4FD6 A;  3T9Y A;  3FBU A;  2JDC A;  3S6F A;  2B5G A;  2CTC A;  2POK A;  4JD6 A;  4M85 A;  4UF4 A; 
#chains in the Genus database with same CATH homology
 1AUG A;  2EBJ A;  2EO8 A;  2DF5 A;  1X10 A;  1IOF A;  1IOI A;  4HPS A;  3LAC A;  1Z8T A;  1A2Z A;  1IU8 A;  1X12 A;  1Z8X A;  4GXH A;  3RNZ A;  3RO0 A;  3GIU A;  1Z8W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...