2K5TA

Solution nmr structure of putative n-acetyl transferase yhhk from e. coli bound to coenzyme a: northeast structural genomics consortium target et106
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
128
structure length
128
Chain Sequence
b'MKLTIIRLEKFSDQDRIDLQKIWPEYSPSSLQVDDNHRIYAARFNERLLAAVRVTLSGTEGALDSLRVREVTRRRGVGQYLLEEVLRNNPGVSCWWMADAGVEDRGVMTAFMQALGFTTQQGGWEKCG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein yhhK
publication title Solution NMR Structure of Putative N-Acetyl Transferase YhhK from E. coli Bound to Coenzyme A
rcsb
source organism Escherichia coli k12
molecule tags Transferase
total genus 33
structure length 128
sequence length 128
ec nomenclature
pdb deposition date 2008-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12568 PanZ Acetyltransferase (GNAT) domain, PanZ
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 2k5tA00
2K5TA 2ZW4A 1B87A 1J4JA 3GY9A 2WPWA 1MJAA 4KOYA 5KTCA 4KOSA 2DXQA 2BSWA 1SQHA 4F6AA 5H86A 4CAWA 2B4DA 1Q2DA 3SHPA 2X7BA 4OADA 4UA3A 1GHEA 2OZGA 3W91A 5DWNA 2VZYA 1TIQA 1KUYA 4OAEA 5F46A 2FT0A 3TCVA 4QC6A 4RI1A 1IYKA 1YVOA 4YFJA 3WR7A 4AG7A 2P6FA 4KLVA 3FRMA 2KCWA 4B5PB 2FCKA 1YK3A 3FBUA 4PV6A 1I1DA 3SXOA 1XEBA 4U9YA 4XNHB 3PZJA 3G3SA 1M4IA 2G3TA 2EUIA 2Q4YA 1S7KA 1NSLA 2HQYA 3R9GA 4YRHA 3GYAA 2Z0ZA 4R57A 2B4BA 4R9MA 1BOBA 3NE7A 2G0BA 3B8GA 1NMTA 1NE9A 4UWJA 2B5GB 1QSOA 3FIXA 2D4PA 5EC4A 1LRZA 3E0KA 2PR8A 4NXYA 1MJBA 2FS5A 1S60A 2AE6A 2F5IA 1QSMA 4ORFA 2PSWA 1V0CA 1ON0A 2JEVA 2R98A 4E0AA 2QECA 4FD4A 4B5PA 3QAHA 4I49A 3F5BA 2AJ6A 2R8VA 2HUZA 4OLLA 4CRYB 3IWGA 1Y9WA 5HMNA 4JLYA 3D2PA 3VWEA 1Q2YA 3I3GA 4FD7A 4XNHC 3R95A 2OU2A 4JD6A 4BMHA 3VWDA 3MGDA 1IYLA 2PQ8A 1Z4RA 2BUEA 2PC1A 4FD5A 2GIVA 2QIRA 4L8AA 5JPHA 2B5GA 1S3ZA 1MK4A 4XPDB 4AVAA 3DSBA 3V8IA 2IL4A 2NMTA 3LD2A 2Q0YA 5J8FA 4F0YA 1Y7RA 1QSRA 3TO9A 1KUXA 3DNSA 4AB7A 1CM0A 3JVNA 5H84A 4QBJA 1WK4A 2RC4A 2OH1A 2ZW7A 2HV2A 4NCZA 3EC4A 4NSQA 1M44A 2C27A 3H4QA 3ZZIA 2B3UA 4U5YA 2JLMA 2CNSA 2VXKA 4GS4A 4MY3A 2ZW6A 4HNWB 1PU9A 3FXTA 1YGHA 4R87A 3EFAA 1N71A 3BJ7A 2Q7BA 2BEIA 4JJXA 1RXTA 2REFA 2ZXVA 4MY0A 4HKFA 4CS0B 2GE3A 3T90A 1RO5A 1XE4A 3IGRA 4EVYA 2FE7A 4KUAA 4H6UA 3G8WA 3TO7A 2FIWA 3R9FA 4ONUA 1Z4EA 1MJ9A 2G3AA 4K30A 5JQ4A 5KTAA 1KUVA 1IB1E 2EVNA 5I0CA 4R3KA 2PRBA 2ZW5A 4FD6A 2D4OA 4IUSA 5ISVA 2FXFA 4XPKA 2VEZA 3JUWA 3S6HA 1YX0A 2Z10A 5FVJA 3W6SA 2FL4A 4JWPA 4LUAA 1KZFA 2A4NA 3EY5A 2J8MA 4KVME 3S6FA 4E8OA 4IF5A 2H5MA 4KOWA 3N7ZA 1L0CA 3DR6A 2B58A 4KOVA 1WWZA 3RYOA 3FYNA 3T9YA 2VI7A 3DDDA 2B3VA 2OB0A 2J8NA 2R7HA 3I9SA 1I21A 2PR1A 2QMLA 2Q4VA 5HH1A 2OZUA 4E2AA 1Y9KA 4R3LA 1YREA 2ARHA 5IB0A 1XF8A 4LX9A 1YR0A 2REEA 5EBVA 3CXPA 3F0AA 3C26A 1VHSA 2FSRA 4HNYB 3K9UA 4RS2A 1S7NA 4KVOE 1M4DA 3EO4A 2P0WA 5E96A 5C82A 3F8KA 4MBUA 2I79A 4DNCA 3P2HA 4KUBA 2I00A 4KVXA 3PP9A 3TFYA 1UFHA 4MHDA 5DWMA 2ATRA 5KTDA 4HNXB 5IV0A 4QB9A 3D8PA 5F49A 2JDCA 3TOBA 4KZTA 1M4GA 1FY7A 2OZHA 3QB8A 4XPLA 2Q04A 1R57A 4AG9A 3P2FA 5GCNA 4QVTA 1I12A 1IIDA 4M3SA 2VQYA 2WPXA 2JDDA 1BO4A 2FIAA 4CRZB 3R9EA 4H89A 4PSXA 4AVBA 2Z11A 4JXQA 4NF1A 2CNMA 5J8CA 2O28A 4KORA 3GKRA 1VKCA 1IICA 1S5KA 2CY2A 1YLEA 4XPDC 1Z9UA 4AVCA 5F47A 3PGPA 4L89A 4Y49B 4MI4A 2GANA 4PK3A 4CAXA 2P6GA 4X5KA 4KOTA 1PUAA 2Y0MA 3SXNA 4U9ZA 3BJ8A 1XIXA 4KOXA 1S7LA 5C88A 4ZBGA 4CAVA 2BL1A 1K4JA 2CNTA 1QSTA 4QUSA 2VBQA 3KKWA 3R96A 3CXQA 3D3SA 1CJWA 3TO6A 4JXRA 3TE4A 3OWCA 2PDOA 1YVKA 3DR8A 3FB3A 4II9A 2B4DB 2Q44A 4YGOA 4KOUA 4PK2A 1OZPA 3R1KA 4UBRA 4B5OA 1XMTA 5IX3A 3TTHA 3S6GA 4MJ8A 4NEXA 3LODA 4PSWA 4KLWA 1U6MA 2ZPAA 4UWIA 1B6BA 1Q2CA 2P6EA 4J3GA 5F48A 3BLNA 3W6XA 3S6KA 5CNPA 3EXNA 3UY5A 4H6ZA 2VZZA 4Y49C 1P4NA 3FNCA 3TOAA 3D2MA 1QSNA 3TT2A 1S7FA 2R1IA 4M85A 1P0HA 3ZJ0A 3CXSA 1M1DA 2J8RA
chains in the Genus database with same CATH superfamily
2K5TA 4UEEA 2ZW4A 4P4JA 4NGMA 5A28A 1B87A 4CYQA 1J4JA 3GY9A 3TC8A 4OC0A 2WPWA 1MJAA 2ZOFA 4KOYA 5KTCA 5F09A 4MRIA 2AFXA 4KOSA 2XEJA 2DXQA 2NYQA 2BSWA 2AFUA 2GU2A 1YSJA 1SQHA 5LRKA 1AMPA 5J1QA 2JEWA 4NJQA 4BBHA 4MFKA 4F6AA 5AGEA 4CAFA 2PJAA 4PXEA 1YW6A 3IWWA 5H86A 1XMBA 3NH5A 2PJ9A 4IHMA 4P45A 3SJXA 2B4DA 3SI0A 4CAWA 1Q2DA 2PJ3A 3SHPA 4YWYA 2X7BA 4OADA 4UA3A 3IIBA 3D7DA 3KASA 2Z3LA 4JZ0A 1GHEA 2OZGA 4IK2A 3MRUA 3W91A 1CG2A 5DWNA 2XEFA 4FUUA 4P4EA 3KR4A 2YNCC 2VZYA 1TIQA 1KUYA 3FEEA 2RB7A 3PB6X 4OAEA 2FT0A 4H2KA 5F46A 4Z65A 2GREA 4OC1A 5G21A 3TCVA 4QC6A 4RI1A 2CF4A 4UFXA 1IYKA 1YVOA 2ODFA 2OR4A 4YFJA 3WR7A 1KWMA 4AG7A 3D68A 2P6FA 5JH9A 2ZEFA 3IC1A 4OC5A 4NGPA 4KLVA 3FRMA 2KCWA 2G9DA 4B5PB 4F9UA 1VHOA 2F8HA 2FCKA 3WC5A 5LYLA 2HB6A 1YK3A 3FBUA 1IOIA 2GLJA 1I1DA 4HPSA 4PV6A 3SXOA 5HXDA 1XEBA 3GB0A 4OIWA 4U9YA 2F7VA 4XNHB 4FBEA 1FNOA 3PZJA 3G3SA 2Q51A 4MFLA 2AFMA 1M4IA 4OC2A 4ZX8A 3FH4A 2FVGA 3H8EA 2WZNA 1F2OA 4ZY1A 2G3TA 4LQ6A 3D66A 4P4DA 2EUIA 4A33A 2AFZA 2Q4YA 1S7KA 1NSLA 1ZG9A 2HQYA 3R9GA 2JBJA 4YRHA 3GYAA 3WT4A 2Z0ZA 2GLFA 3QNVA 4R57A 3D67A 2B4BA 3GUXA 4PQAA 1EE3P 2EBJA 4R9MA 1BOBA 3NE7A 2G0BA 3B8GA 3NA6A 1NMTA 3FJUA 1NE9A 4UWJA 2B5GB 2EK9A 2ZEMA 3T8WA 1QSOA 1LCPA 3FIXA 5D8NA 2D4PA 3PB7X 3B2YA 1LRZA 2V8DA 3E0KA 3N5FA 5EC4A 4A31A 3FMCA 4MHNA 2PCUA 3KHXA 4NGNA 3V7ZA 2PR8A 4OKOA 1VIXA 4NXYA 4MHYA 2Z3PA 1MJBA 4UEZA 5LYFA 2FS5A 1S60A 5I4MA 2PJBA 2AE6A 2F5IA 3B3WA 3CPAA 1Y0YA 4P6YA 1QSMA 4ORFA 2PSWA 4O23A 1V0CA 2V8HA 5CBMA 1ON0A 4Q36A 2JEVA 2R98A 4X8IA 4E0AA 2QECA 5LYDA 4FD4A 3RAMA 4B5PA 4C68A 1YW4A 3QAHA 2AFOA 4I49A 3F5BA 4TNUA 3DGVA 2AJ6A 2R8VA 1ZLHA 2C1CA 2HUZA 4OLLA 4CRYB 2PJ5A 3IWGA 3L2NA 1Y9WA 5HMNA 4JLYA 3D2PA 3WC6A 3VWEA 4ZGYB 1Q2YA 3I3GA 2AFWA 2GFQA 4FD7A 4KSIA 4XNHC 3R95A 5CPAA 2V8GA 4C2XA 1DE4C 2I3CA 1BPNA 2OU2A 4P4FA 4JD6A 3KI9A 4BMHA 4NFRA 4A39A 3VWDA 3MGDA 4Q7AA 1IYLA 1JQGA 2PQ8A 4MHPA 5EMIA 1Z4RA 2BUEA 2PC1A 4FD5A 2GIVA 3FECA 4MXUA 2XEIA 3CZXA 3NH8A 4CYOA 2QIRA 1R3NA 4L8AA 5JPHA 4NGSA 3B35A 4A38A 3RNZA 5A27A 2B5GA 1S3ZA 1MK4A 2PJ2A 4XPDB 4AVAA 4M6HA 3DSBA 4KSAA 3V8IA 4CYPA 2Z3OA 4ZX9A 5IB9A 4A95A 2IL4A 3IFEA 2NMTA 3LD2A 4PXBA 4B14A 2IJZA 2QYVA 2ZENA 2Q0YA 5J8FA 4CPAA 4FWUA 4F0YA 4MFZA 1Y7RA 5K8MA 1QSRA 3TO9A 3RZAA 1KUXA 3DNSA 4MCQA 5LRJA 1CM0A 3JVNA 4AB7A 5H84A 4QBJA 2VL1A 1WK4A 3KZWA 4UCNA 2EK8A 5ELYA 2RC4A 2OH1A 1QQ9A 3BI0A 2ZW7A 2HV2A 4F9VA 4NCZA 2HC9A 4K3NA 1Z5RA 3EC4A 3NFZA 4NSQA 1TKJA 1M44A 2ABZA 2C27A 3H4QA 4BD9A 4MCPA 1OBRA 3ZZIA 2B3UA 4U5YA 2JLMA 3VH9A 3BI1A 2CNSA 2VXKA 5G22A 4GS4A 1VGYA 1UWYA 2V77A 4MY3A 4A37A 2ZW6A 4HNWB 1PU9A 3FXTA 3IO1A 4P44A 1YGHA 4MCRA 4R87A 1ELLP 5AG5A 4B10A 1PCAA 2ZEGA 3EFAA 1N71A 1Z8TA 3BJ7A 1BAVA 3DLJA 4MHZA 2Q7BA 2BEIA 3S9NA 4JJXA 1RXTA 2REFA 2ZXVA 3A9LA 2OOTA 4MY0A 1LAMA 4HKFA 1TF9A 4CS0B 2PIZA 1AUGA 3KQZA 2GE3A 2PJCA 3T90A 1GYTA 1XFOA 1LAPA 1YLOA 3BXMA 1RO5A 1XE4A 3IGRA 4EVYA 2FE7A 3S9MA 1BLLE 1VHEA 4YU9A 4KUAA 4H6UA 2YNDA 5D29A 1ZG7A 3G8WA 2V8VA 1IGBA 3SJEA 2J9AA 3TO7A 1X12A 2IQ6A 4RN7A 2FIWA 3KGQA 3R9FA 4ONUA 1Z4EA 3PRTA 4MCSA 5JM6A 1MJ9A 2G3AA 4K30A 4MFQA 5JQ4A 1F57A 2CXAA 4P4BA 1IU8A 4A2ZA 5KTAA 1KUVA 1ZG8A 1IB1E 4BINA 1H8LA 3FVLA 3IWEA 2EVNA 3IU2A 2WSAA 4IAVA 2PRBA 4NGQA 2DF5A 4R3KA 4R7MA 4CAEA 3GLJA 2ZW5A 4FD6A 2D4OA 3IEHA 4IUSA 5ISVA 2DPSA 1JWQA 2FXFA 4XPKA 2VEZA 3JUWA 1XJOA 3D7FA 4M6IA 1YX0A 4KSFA 3S6HA 3JTKA 1XBUA 4ZI6A 2Z10A 5FVJA 1IY7A 3B3SA 3W6SA 4C2YA 2FL4A 3QAYA 4JWPA 7CPAA 2XEGA 4LUAA 5BWAB 2O53A 1AYEA 1KZFA 2PJ8A 2A4NA 3EY5A 2YGWA 2ZELA 3SJGA 4B6ZA 1ELMP 4MFJA 2J8MA 2PIYA 4CGPA 4KVME 3PB9X 3S6FA 3K9TA 4E8OA 4F8ZA 1TXRA 4IF5A 2H5MA 4KOWA 1Z8LA 1L0CA 1CP7A 3N7ZA 4CGLA 4F0XA 3DR6A 2B58A 1RTQA 4KOVA 1WWZA 4OP4A 1IOFA 3FYNA 3RYOA 4CGMA 3T9YA 3I1UA 3SI1A 4X3RA 2VI7A 3DDDA 2ZEPA 2BCOA 4R76A 1CP6A 2B3VA 1XRYA 2J8NA 2OB0A 2R7HA 2RFHA 3I9SA 1I21A 2PR1A 2QMLA 4C7IA 3LMSA 1Z2LA 2Q4VA 5HH1A 2OZUA 4E2AA 1Y9KA 4R3LA 1YREA 2ARHA 1R43A 5IB0A 3NH4A 1XF8A 4LX9A 4CGOA 1YR0A 5AG4A 2REEA 3B3CA 5EBVA 3CXPA 3LACA 3F0AA 1LANA 5K8PA 3C26A 1F2PA 1VHSA 2FSRA 4HNYB 5K8OA 3K9UA 4RS2A 4A30A 1CPXA 1S7NA 4X2TA 1M4LA 2PJ4A 3JRUA 4KVOE 4LQGA 2ANPA 1M4DA 3EO4A 2P0WA 5E96A 5C82A 3CPXA 3F8KA 4MBUA 4UFWA 2Q43A 2I79A 4DNCA 3P2HA 3VATA 4KUBA 4MMOA 3KQXA 2QJ8A 4DUKA 4P4IA 4WWVA 4R6TA 2I00A 4KVXA 3PP9A 3TFYA 3RBUA 3V38A 4CGNA 3KHZA 2DPTA 5JGFA 4PPZA 3CDXA 1UFHA 4MHDA 3GIUA 4EMEA 5DWMA 5K8NA 2ATRA 5KTDA 2JBKA 4HNXB 1ZO0A 3PFOA 5LYIA 4C7HA 5IV0A 4NGTA 3LWUA 2AFSA 4QB9A 2PJ6A 3D8PA 5F49A 2JDCA 3TOBA 5AG7A 3HLPA 4KZTA 1M4GA 1FY7A 2OZHA 3ISZA 3WABA 3QB8A 3PBEA 1CX8A 4XPLA 3CT9A 2POKA 2Q04A 1R57A 2Z3MA 4AG9A 3D4UA 3P2FA 2BOAA 5GCNA 4QVTA 2YNCA 1I12A 1IIDA 4M3SA 1XOVA 2CTBA 2VQYA 3B3VA 2WPXA 2WYRA 3BHXA 2JDDA 1BO4A 4DJLA 2FIAA 4NGRA 4WJBA 4CRZB 3R9EA 4UEFA 4RUHA 4H89A 2Z3NA 5I0CA 5HVHA 4KS9A 4PSXA 4UIAA 2PVWA 1NSAA 3H8FA 2Z11A 4UCPA 5AG6A 3RO0A 4AVBA 1TF8A 1YQEA 4JXQA 2CNMA 2YNEA 1Z8XA 2EO8A 4M6GA 4NF1A 5J8CA 2O28A 3PEIA 4P10A 4TWEA 2ZOGA 4KORA 3GKRA 1VKCA 3IJ3A 4PXDA 4UF4A 1IICA 1S5KA 2CY2A 4JYWA 1YLEA 2WUUA 4A32A 4ONWA 4DYOA 2NSMA 4XPDC 1Z9UA 3ISXA 3WC7A 6CPAA 4AVCA 4NJRA 5F47A 3PGPA 4L89A 3H5ZA 4Y49B 2IMOA 4GXHA 4MI4A 4EWTA 3FEDA 2GANA 4PK3A 1QMUA 1TKFA 4CAXA 2P6GA 4X5KA 4A94A 4KOTA 4W9YA 1PUAA 2Y0MA 2C6PA 3SXNA 2PJ0A 3PBBA 3NE8A 4U9ZA 3BJ8A 4FAIA 3SJFA 3VARA 1XIXA 2Z3KA 1S7LA 4KOXA 4CYNA 4OC4A 3FX6A 4C2ZA 4AXVA 5C88A 4MFPA 4UIBA 4ZBGA 4CAVA 3PFEA 2PVVA 1Y7EA 2BL1A 1LOKA 4UFVA 1K4JA 2CNTA 1QSTA 4QUSA 2VBQA 3KKWA 1HDUA 3HUVA 1HDQA 3B7IA 3R96A 3CXQA 3D3SA 1ZLIA 1CJWA 3TO6A 1CPSA 5HVFA 4JXRA 4OMEA 1ARMA 3TE4A 2C6CA 2PDOA 1YVKA 3DR8A 3OWCA 4OC3A 1Z8WA 3FB3A 2DEAA 5DS0A 3TX8A 5G20A 1CBXA 1X10A 3H8GA 4II9A 2Q7SA 1A2ZA 1DTDA 3D7HA 3MN8A 2B4DB 2Q44A 3S9LA 1LFWA 4KOUA 2ZEEA 4YGOA 1Q7LA 2ZEHA 1BPMA 2O4HA 2CTCA 4PK2A 1OZPA 3PB8X 4ZY2A 1PYTB 3R1KA 5LRGA 4UBRA 4B5OA 1XMTA 2QVPA 5IX3A 3B3TA 3TTHA 1Y0RA 4Q38A 3S6GA 4G1PA 4MJ8A 4UCMA 4NEXA 2ZEOA 3LODA 4PSWA 3D7GA 4KLWA 1FT7A 4B13A 3PB4X 1YMEA 1HEEA 2BO9A 1U6MA 2ZPAA 4UWIA 4OIDA 1B6BA 1Q2CA 2PRQA 2P6EA 4GM5A 2C6GA 4B11A 2PE3A 2EWBA 4J3GA 5F48A 8CPAA 3FF3A 3BLNA 3K2KA 3SI2A 3W6XA 1TKHA 3S6KA 2PJ1A 5CNPA 3EXNA 3KL9A 5HVGA 3UY5A 5THWA 3KR5A 2ZEDA 4H6ZA 2VZZA 5G1ZA 4Y49C 1P4NA 3FNCA 3TOAA 3D2MA 1QSNA 2Q4ZA 3TT2A 1S7FA 4EFDA 4ZY0A 2R1IA 4R8FA 4ZYQA 4B12A 4M85A 1P0HA 3ZJ0A 3IU1A 1ARLA 2CIJA 2PJ7A 3CXSA 1M1DA 4PXCA 2J8RA
chains in the Genus database with same CATH topology
2K5TA 2ZW4A 5A28A 1B87A 4CYQA 1J4JA 3GY9A 2WPWA 1MJAA 4KOYA 5KTCA 4KOSA 2DXQA 2BSWA 1SQHA 4BBHA 4MFKA 4F6AA 5AGEA 4CAFA 5H86A 4CAWA 2B4DA 1Q2DA 3SHPA 2X7BA 4OADA 4UA3A 2Z3LA 1GHEA 2OZGA 3W91A 5DWNA 2YNCC 2VZYA 1TIQA 1KUYA 4OAEA 5F46A 2FT0A 5G21A 3TCVA 4QC6A 4RI1A 4UFXA 1IYKA 1YVOA 4YFJA 3WR7A 4AG7A 2P6FA 4KLVA 3FRMA 2KCWA 4B5PB 2FCKA 1YK3A 3FBUA 4PV6A 1I1DA 3SXOA 1XEBA 4U9YA 4XNHB 4MFLA 3PZJA 3G3SA 1M4IA 2G3TA 2EUIA 4A33A 2Q4YA 1S7KA 1NSLA 2HQYA 3R9GA 4YRHA 3GYAA 2Z0ZA 4R57A 2B4BA 4R9MA 1BOBA 3NE7A 2G0BA 3B8GA 1NMTA 1NE9A 4UWJA 2B5GB 1QSOA 3FIXA 2D4PA 5EC4A 1LRZA 3E0KA 4A31A 2PR8A 4NXYA 2Z3PA 1MJBA 2FS5A 1S60A 2AE6A 2F5IA 1QSMA 4ORFA 2PSWA 1V0CA 1ON0A 4Q36A 2JEVA 2R98A 4E0AA 2QECA 4FD4A 4B5PA 4C68A 3QAHA 4I49A 3F5BA 2AJ6A 2R8VA 2HUZA 4OLLA 4CRYB 3IWGA 1Y9WA 5HMNA 4JLYA 3D2PA 4ZGYB 3VWEA 1Q2YA 3I3GA 4FD7A 4XNHC 3R95A 4C2XA 2OU2A 4JD6A 4BMHA 3VWDA 3MGDA 1IYLA 2PQ8A 1Z4RA 2BUEA 2PC1A 4FD5A 2GIVA 4CYOA 2QIRA 4L8AA 5JPHA 5A27A 2B5GA 1S3ZA 1MK4A 4XPDB 4AVAA 3DSBA 4KSAA 3V8IA 4CYPA 2Z3OA 4A95A 2IL4A 4B14A 2NMTA 3LD2A 2Q0YA 5J8FA 4F0YA 4MFZA 1Y7RA 1QSRA 3TO9A 1KUXA 3DNSA 4AB7A 1CM0A 3JVNA 5H84A 4QBJA 1WK4A 4UCNA 2RC4A 2OH1A 2ZW7A 2HV2A 4NCZA 3EC4A 4NSQA 1M44A 2C27A 3H4QA 3ZZIA 2B3UA 4U5YA 2JLMA 2CNSA 2VXKA 5G22A 4GS4A 4MY3A 2ZW6A 4HNWB 1PU9A 3FXTA 1YGHA 4R87A 5AG5A 4B10A 3EFAA 1N71A 3BJ7A 2Q7BA 2BEIA 4JJXA 1RXTA 2REFA 2ZXVA 3A9LA 4MY0A 4HKFA 4CS0B 2GE3A 3T90A 1RO5A 1XE4A 3IGRA 4EVYA 2FE7A 4KUAA 4H6UA 2YNDA 3G8WA 3TO7A 2FIWA 3R9FA 4ONUA 1Z4EA 1MJ9A 2G3AA 4K30A 4MFQA 5JQ4A 2CXAA 4A2ZA 5KTAA 1KUVA 1IB1E 3IWEA 2EVNA 3IU2A 2WSAA 4R3KA 2PRBA 5I0CA 4CAEA 2ZW5A 4FD6A 2D4OA 4IUSA 5ISVA 2DPSA 2FXFA 4XPKA 2VEZA 3JUWA 3S6HA 1YX0A 4KSFA 3JTKA 2Z10A 5FVJA 3W6SA 4C2YA 2FL4A 4JWPA 4LUAA 5BWAB 1KZFA 2A4NA 3EY5A 2YGWA 4MFJA 2J8MA 4CGPA 4KVME 3S6FA 4E8OA 4IF5A 2H5MA 4KOWA 3N7ZA 1L0CA 4CGLA 4F0XA 3DR6A 2B58A 4KOVA 1WWZA 3RYOA 3FYNA 4CGMA 3T9YA 2VI7A 3DDDA 2B3VA 2OB0A 2J8NA 2R7HA 3I9SA 1I21A 2PR1A 2QMLA 4C7IA 2Q4VA 5HH1A 2OZUA 4E2AA 1Y9KA 4R3LA 1YREA 2ARHA 5IB0A 1XF8A 4LX9A 4CGOA 1YR0A 5AG4A 2REEA 5EBVA 3CXPA 3F0AA 3C26A 1VHSA 2FSRA 4HNYB 3K9UA 4RS2A 4A30A 1S7NA 4KVOE 1M4DA 3EO4A 2P0WA 5E96A 5C82A 3F8KA 4MBUA 4UFWA 2I79A 4DNCA 3P2HA 4KUBA 2I00A 4KVXA 3PP9A 3TFYA 4CGNA 2DPTA 1UFHA 4MHDA 5DWMA 2ATRA 5KTDA 4HNXB 1ZO0A 4C7HA 5IV0A 4QB9A 3D8PA 5F49A 2JDCA 3TOBA 5AG7A 4KZTA 1M4GA 1FY7A 2OZHA 3QB8A 4XPLA 2Q04A 1R57A 2Z3MA 4AG9A 3P2FA 5GCNA 4QVTA 2YNCA 1I12A 1IIDA 4M3SA 2VQYA 2WPXA 2JDDA 1BO4A 2FIAA 4CRZB 3R9EA 4H89A 2Z3NA 4KS9A 4PSXA 4AVBA 5AG6A 2Z11A 4UCPA 4JXQA 4NF1A 2CNMA 2YNEA 5J8CA 2O28A 4KORA 3GKRA 1VKCA 1IICA 1S5KA 2CY2A 1YLEA 2WUUA 4A32A 4XPDC 1Z9UA 4AVCA 5F47A 3PGPA 4L89A 3H5ZA 4Y49B 4MI4A 2GANA 4PK3A 4CAXA 2P6GA 4X5KA 4KOTA 1PUAA 2Y0MA 3SXNA 4U9ZA 3BJ8A 1XIXA 2Z3KA 1S7LA 4KOXA 4CYNA 4C2ZA 5C88A 4MFPA 4ZBGA 4CAVA 2BL1A 4UFVA 1K4JA 2CNTA 1QSTA 4QUSA 2VBQA 3KKWA 3R96A 3CXQA 3D3SA 1CJWA 3TO6A 4JXRA 3TE4A 3OWCA 2PDOA 1YVKA 3DR8A 3FB3A 5G20A 4II9A 2B4DB 2Q44A 4YGOA 4KOUA 4PK2A 1OZPA 3R1KA 4UBRA 4B5OA 1XMTA 5IX3A 3TTHA 4Q38A 3S6GA 4MJ8A 4UCMA 4NEXA 3LODA 4PSWA 4KLWA 4B13A 1U6MA 2ZPAA 4UWIA 1B6BA 1Q2CA 4B11A 2P6EA 4J3GA 5F48A 3BLNA 3W6XA 3S6KA 5CNPA 3EXNA 3UY5A 4H6ZA 2VZZA 5G1ZA 4Y49C 1P4NA 3FNCA 3TOAA 3D2MA 1QSNA 3TT2A 1S7FA 2R1IA 4B12A 4M85A 1P0HA 3ZJ0A 3IU1A 3CXSA 1M1DA 2J8RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K5T A;  2ZW4 A;  1B87 A;  1J4J A;  3GY9 A;  2WPW A;  1MJA A;  4KOY A;  5KTC A;  4KOS A;  2DXQ A;  2BSW A;  1SQH A;  4F6A A;  5H86 A;  4CAW A;  2B4D A;  1Q2D A;  3SHP A;  2X7B A;  4OAD A;  4UA3 A;  1GHE A;  2OZG A;  3W91 A;  5DWN A;  2VZY A;  1TIQ A;  1KUY A;  4OAE A;  5F46 A;  2FT0 A;  3TCV A;  4QC6 A;  4RI1 A;  1IYK A;  1YVO A;  4YFJ A;  3WR7 A;  4AG7 A;  2P6F A;  4KLV A;  3FRM A;  2KCW A;  4B5P B;  2FCK A;  1YK3 A;  3FBU A;  4PV6 A;  1I1D A;  3SXO A;  1XEB A;  4U9Y A;  4XNH B;  3PZJ A;  3G3S A;  1M4I A;  2G3T A;  2EUI A;  2Q4Y A;  1S7K A;  1NSL A;  2HQY A;  3R9G A;  4YRH A;  3GYA A;  2Z0Z A;  4R57 A;  2B4B A;  4R9M A;  1BOB A;  3NE7 A;  2G0B A;  3B8G A;  1NMT A;  1NE9 A;  4UWJ A;  2B5G B;  1QSO A;  3FIX A;  2D4P A;  5EC4 A;  1LRZ A;  3E0K A;  2PR8 A;  4NXY A;  1MJB A;  2FS5 A;  1S60 A;  2AE6 A;  2F5I A;  1QSM A;  4ORF A;  2PSW A;  1V0C A;  1ON0 A;  2JEV A;  2R98 A;  4E0A A;  2QEC A;  4FD4 A;  4B5P A;  3QAH A;  4I49 A;  3F5B A;  2AJ6 A;  2R8V A;  2HUZ A;  4OLL A;  4CRY B;  3IWG A;  1Y9W A;  5HMN A;  4JLY A;  3D2P A;  3VWE A;  1Q2Y A;  3I3G A;  4FD7 A;  4XNH C;  3R95 A;  2OU2 A;  4JD6 A;  4BMH A;  3VWD A;  3MGD A;  1IYL A;  2PQ8 A;  1Z4R A;  2BUE A;  2PC1 A;  4FD5 A;  2GIV A;  2QIR A;  4L8A A;  5JPH A;  2B5G A;  1S3Z A;  1MK4 A;  4XPD B;  4AVA A;  3DSB A;  3V8I A;  2IL4 A;  2NMT A;  3LD2 A;  2Q0Y A;  5J8F A;  4F0Y A;  1Y7R A;  1QSR A;  3TO9 A;  1KUX A;  3DNS A;  4AB7 A;  1CM0 A;  3JVN A;  5H84 A;  4QBJ A;  1WK4 A;  2RC4 A;  2OH1 A;  2ZW7 A;  2HV2 A;  4NCZ A;  3EC4 A;  4NSQ A;  1M44 A;  2C27 A;  3H4Q A;  3ZZI A;  2B3U A;  4U5Y A;  2JLM A;  2CNS A;  2VXK A;  4GS4 A;  4MY3 A;  2ZW6 A;  4HNW B;  1PU9 A;  3FXT A;  1YGH A;  4R87 A;  3EFA A;  1N71 A;  3BJ7 A;  2Q7B A;  2BEI A;  4JJX A;  1RXT A;  2REF A;  2ZXV A;  4MY0 A;  4HKF A;  4CS0 B;  2GE3 A;  3T90 A;  1RO5 A;  1XE4 A;  3IGR A;  4EVY A;  2FE7 A;  4KUA A;  4H6U A;  3G8W A;  3TO7 A;  2FIW A;  3R9F A;  4ONU A;  1Z4E A;  1MJ9 A;  2G3A A;  4K30 A;  5JQ4 A;  5KTA A;  1KUV A;  1IB1 E;  2EVN A;  5I0C A;  4R3K A;  2PRB A;  2ZW5 A;  4FD6 A;  2D4O A;  4IUS A;  5ISV A;  2FXF A;  4XPK A;  2VEZ A;  3JUW A;  3S6H A;  1YX0 A;  2Z10 A;  5FVJ A;  3W6S A;  2FL4 A;  4JWP A;  4LUA A;  1KZF A;  2A4N A;  3EY5 A;  2J8M A;  4KVM E;  3S6F A;  4E8O A;  4IF5 A;  2H5M A;  4KOW A;  3N7Z A;  1L0C A;  3DR6 A;  2B58 A;  4KOV A;  1WWZ A;  3RYO A;  3FYN A;  3T9Y A;  2VI7 A;  3DDD A;  2B3V A;  2OB0 A;  2J8N A;  2R7H A;  3I9S A;  1I21 A;  2PR1 A;  2QML A;  2Q4V A;  5HH1 A;  2OZU A;  4E2A A;  1Y9K A;  4R3L A;  1YRE A;  2ARH A;  5IB0 A;  1XF8 A;  4LX9 A;  1YR0 A;  2REE A;  5EBV A;  3CXP A;  3F0A A;  3C26 A;  1VHS A;  2FSR A;  4HNY B;  3K9U A;  4RS2 A;  1S7N A;  4KVO E;  1M4D A;  3EO4 A;  2P0W A;  5E96 A;  5C82 A;  3F8K A;  4MBU A;  2I79 A;  4DNC A;  3P2H A;  4KUB A;  2I00 A;  4KVX A;  3PP9 A;  3TFY A;  1UFH A;  4MHD A;  5DWM A;  2ATR A;  5KTD A;  4HNX B;  5IV0 A;  4QB9 A;  3D8P A;  5F49 A;  2JDC A;  3TOB A;  4KZT A;  1M4G A;  1FY7 A;  2OZH A;  3QB8 A;  4XPL A;  2Q04 A;  1R57 A;  4AG9 A;  3P2F A;  5GCN A;  4QVT A;  1I12 A;  1IID A;  4M3S A;  2VQY A;  2WPX A;  2JDD A;  1BO4 A;  2FIA A;  4CRZ B;  3R9E A;  4H89 A;  4PSX A;  4AVB A;  2Z11 A;  4JXQ A;  4NF1 A;  2CNM A;  5J8C A;  2O28 A;  4KOR A;  3GKR A;  1VKC A;  1IIC A;  1S5K A;  2CY2 A;  1YLE A;  4XPD C;  1Z9U A;  4AVC A;  5F47 A;  3PGP A;  4L89 A;  4Y49 B;  4MI4 A;  2GAN A;  4PK3 A;  4CAX A;  2P6G A;  4X5K A;  4KOT A;  1PUA A;  2Y0M A;  3SXN A;  4U9Z A;  3BJ8 A;  1XIX A;  4KOX A;  1S7L A;  5C88 A;  4ZBG A;  4CAV A;  2BL1 A;  1K4J A;  2CNT A;  1QST A;  4QUS A;  2VBQ A;  3KKW A;  3R96 A;  3CXQ A;  3D3S A;  1CJW A;  3TO6 A;  4JXR A;  3TE4 A;  3OWC A;  2PDO A;  1YVK A;  3DR8 A;  3FB3 A;  4II9 A;  2B4D B;  2Q44 A;  4YGO A;  4KOU A;  4PK2 A;  1OZP A;  3R1K A;  4UBR A;  4B5O A;  1XMT A;  5IX3 A;  3TTH A;  3S6G A;  4MJ8 A;  4NEX A;  3LOD A;  4PSW A;  4KLW A;  1U6M A;  2ZPA A;  4UWI A;  1B6B A;  1Q2C A;  2P6E A;  4J3G A;  5F48 A;  3BLN A;  3W6X A;  3S6K A;  5CNP A;  3EXN A;  3UY5 A;  4H6Z A;  2VZZ A;  4Y49 C;  1P4N A;  3FNC A;  3TOA A;  3D2M A;  1QSN A;  3TT2 A;  1S7F A;  2R1I A;  4M85 A;  1P0H A;  3ZJ0 A;  3CXS A;  1M1D A;  2J8R A; 
#chains in the Genus database with same CATH topology
 2K5T A;  4UEE A;  2ZW4 A;  4P4J A;  4NGM A;  5A28 A;  1B87 A;  4CYQ A;  1J4J A;  3GY9 A;  3TC8 A;  4OC0 A;  2WPW A;  1MJA A;  2ZOF A;  4KOY A;  5KTC A;  5F09 A;  4MRI A;  2AFX A;  4KOS A;  2XEJ A;  2DXQ A;  2NYQ A;  2BSW A;  2AFU A;  2GU2 A;  1YSJ A;  1SQH A;  5LRK A;  1AMP A;  5J1Q A;  2JEW A;  4NJQ A;  4BBH A;  4MFK A;  4F6A A;  5AGE A;  4CAF A;  2PJA A;  4PXE A;  1YW6 A;  3IWW A;  5H86 A;  1XMB A;  3NH5 A;  2PJ9 A;  4IHM A;  4P45 A;  3SJX A;  2B4D A;  3SI0 A;  4CAW A;  1Q2D A;  2PJ3 A;  3SHP A;  4YWY A;  2X7B A;  4OAD A;  4UA3 A;  3IIB A;  3D7D A;  3KAS A;  2Z3L A;  4JZ0 A;  1GHE A;  2OZG A;  4IK2 A;  3MRU A;  3W91 A;  1CG2 A;  5DWN A;  2XEF A;  4FUU A;  4P4E A;  3KR4 A;  2YNC C;  2VZY A;  1TIQ A;  1KUY A;  3FEE A;  2RB7 A;  3PB6 X;  4OAE A;  2FT0 A;  4H2K A;  5F46 A;  4Z65 A;  2GRE A;  4OC1 A;  5G21 A;  3TCV A;  4QC6 A;  4RI1 A;  2CF4 A;  4UFX A;  1IYK A;  1YVO A;  2ODF A;  2OR4 A;  4YFJ A;  3WR7 A;  1KWM A;  4AG7 A;  3D68 A;  2P6F A;  5JH9 A;  2ZEF A;  3IC1 A;  4OC5 A;  4NGP A;  4KLV A;  3FRM A;  2KCW A;  2G9D A;  4B5P B;  4F9U A;  1VHO A;  2F8H A;  2FCK A;  3WC5 A;  5LYL A;  2HB6 A;  1YK3 A;  3FBU A;  1IOI A;  2GLJ A;  1I1D A;  4HPS A;  4PV6 A;  3SXO A;  5HXD A;  1XEB A;  3GB0 A;  4OIW A;  4U9Y A;  2F7V A;  4XNH B;  4FBE A;  1FNO A;  3PZJ A;  3G3S A;  2Q51 A;  4MFL A;  2AFM A;  1M4I A;  4OC2 A;  4ZX8 A;  3FH4 A;  2FVG A;  3H8E A;  2WZN A;  1F2O A;  4ZY1 A;  2G3T A;  4LQ6 A;  3D66 A;  4P4D A;  2EUI A;  4A33 A;  2AFZ A;  2Q4Y A;  1S7K A;  1NSL A;  1ZG9 A;  2HQY A;  3R9G A;  2JBJ A;  4YRH A;  3GYA A;  3WT4 A;  2Z0Z A;  2GLF A;  3QNV A;  4R57 A;  3D67 A;  2B4B A;  3GUX A;  4PQA A;  1EE3 P;  2EBJ A;  4R9M A;  1BOB A;  3NE7 A;  2G0B A;  3B8G A;  3NA6 A;  1NMT A;  3FJU A;  1NE9 A;  4UWJ A;  2B5G B;  2EK9 A;  2ZEM A;  3T8W A;  1QSO A;  1LCP A;  3FIX A;  5D8N A;  2D4P A;  3PB7 X;  3B2Y A;  1LRZ A;  2V8D A;  3E0K A;  3N5F A;  5EC4 A;  4A31 A;  3FMC A;  4MHN A;  2PCU A;  3KHX A;  4NGN A;  3V7Z A;  2PR8 A;  4OKO A;  1VIX A;  4NXY A;  4MHY A;  2Z3P A;  1MJB A;  4UEZ A;  5LYF A;  2FS5 A;  1S60 A;  5I4M A;  2PJB A;  2AE6 A;  2F5I A;  3B3W A;  3CPA A;  1Y0Y A;  4P6Y A;  1QSM A;  4ORF A;  2PSW A;  4O23 A;  1V0C A;  2V8H A;  5CBM A;  1ON0 A;  4Q36 A;  2JEV A;  2R98 A;  4X8I A;  4E0A A;  2QEC A;  5LYD A;  4FD4 A;  3RAM A;  4B5P A;  4C68 A;  1YW4 A;  3QAH A;  2AFO A;  4I49 A;  3F5B A;  4TNU A;  3DGV A;  2AJ6 A;  2R8V A;  1ZLH A;  2C1C A;  2HUZ A;  4OLL A;  4CRY B;  2PJ5 A;  3IWG A;  3L2N A;  1Y9W A;  5HMN A;  4JLY A;  3D2P A;  3WC6 A;  3VWE A;  4ZGY B;  1Q2Y A;  3I3G A;  2AFW A;  2GFQ A;  4FD7 A;  4KSI A;  4XNH C;  3R95 A;  5CPA A;  2V8G A;  4C2X A;  1DE4 C;  2I3C A;  1BPN A;  2OU2 A;  4P4F A;  4JD6 A;  3KI9 A;  4BMH A;  4NFR A;  4A39 A;  3VWD A;  3MGD A;  4Q7A A;  1IYL A;  1JQG A;  2PQ8 A;  4MHP A;  5EMI A;  1Z4R A;  2BUE A;  2PC1 A;  4FD5 A;  2GIV A;  3FEC A;  4MXU A;  2XEI A;  3CZX A;  3NH8 A;  4CYO A;  2QIR A;  1R3N A;  4L8A A;  5JPH A;  4NGS A;  3B35 A;  4A38 A;  3RNZ A;  5A27 A;  2B5G A;  1S3Z A;  1MK4 A;  2PJ2 A;  4XPD B;  4AVA A;  4M6H A;  3DSB A;  4KSA A;  3V8I A;  4CYP A;  2Z3O A;  4ZX9 A;  5IB9 A;  4A95 A;  2IL4 A;  3IFE A;  2NMT A;  3LD2 A;  4PXB A;  4B14 A;  2IJZ A;  2QYV A;  2ZEN A;  2Q0Y A;  5J8F A;  4CPA A;  4FWU A;  4F0Y A;  4MFZ A;  1Y7R A;  5K8M A;  1QSR A;  3TO9 A;  3RZA A;  1KUX A;  3DNS A;  4MCQ A;  5LRJ A;  1CM0 A;  3JVN A;  4AB7 A;  5H84 A;  4QBJ A;  2VL1 A;  1WK4 A;  3KZW A;  4UCN A;  2EK8 A;  5ELY A;  2RC4 A;  2OH1 A;  1QQ9 A;  3BI0 A;  2ZW7 A;  2HV2 A;  4F9V A;  4NCZ A;  2HC9 A;  4K3N A;  1Z5R A;  3EC4 A;  3NFZ A;  4NSQ A;  1TKJ A;  1M44 A;  2ABZ A;  2C27 A;  3H4Q A;  4BD9 A;  4MCP A;  1OBR A;  3ZZI A;  2B3U A;  4U5Y A;  2JLM A;  3VH9 A;  3BI1 A;  2CNS A;  2VXK A;  5G22 A;  4GS4 A;  1VGY A;  1UWY A;  2V77 A;  4MY3 A;  4A37 A;  2ZW6 A;  4HNW B;  1PU9 A;  3FXT A;  3IO1 A;  4P44 A;  1YGH A;  4MCR A;  4R87 A;  1ELL P;  5AG5 A;  4B10 A;  1PCA A;  2ZEG A;  3EFA A;  1N71 A;  1Z8T A;  3BJ7 A;  1BAV A;  3DLJ A;  4MHZ A;  2Q7B A;  2BEI A;  3S9N A;  4JJX A;  1RXT A;  2REF A;  2ZXV A;  3A9L A;  2OOT A;  4MY0 A;  1LAM A;  4HKF A;  1TF9 A;  4CS0 B;  2PIZ A;  1AUG A;  3KQZ A;  2GE3 A;  2PJC A;  3T90 A;  1GYT A;  1XFO A;  1LAP A;  1YLO A;  3BXM A;  1RO5 A;  1XE4 A;  3IGR A;  4EVY A;  2FE7 A;  3S9M A;  1BLL E;  1VHE A;  4YU9 A;  4KUA A;  4H6U A;  2YND A;  5D29 A;  1ZG7 A;  3G8W A;  2V8V A;  1IGB A;  3SJE A;  2J9A A;  3TO7 A;  1X12 A;  2IQ6 A;  4RN7 A;  2FIW A;  3KGQ A;  3R9F A;  4ONU A;  1Z4E A;  3PRT A;  4MCS A;  5JM6 A;  1MJ9 A;  2G3A A;  4K30 A;  4MFQ A;  5JQ4 A;  1F57 A;  2CXA A;  4P4B A;  1IU8 A;  4A2Z A;  5KTA A;  1KUV A;  1ZG8 A;  1IB1 E;  4BIN A;  1H8L A;  3FVL A;  3IWE A;  2EVN A;  3IU2 A;  2WSA A;  4IAV A;  2PRB A;  4NGQ A;  2DF5 A;  4R3K A;  4R7M A;  4CAE A;  3GLJ A;  2ZW5 A;  4FD6 A;  2D4O A;  3IEH A;  4IUS A;  5ISV A;  2DPS A;  1JWQ A;  2FXF A;  4XPK A;  2VEZ A;  3JUW A;  1XJO A;  3D7F A;  4M6I A;  1YX0 A;  4KSF A;  3S6H A;  3JTK A;  1XBU A;  4ZI6 A;  2Z10 A;  5FVJ A;  1IY7 A;  3B3S A;  3W6S A;  4C2Y A;  2FL4 A;  3QAY A;  4JWP A;  7CPA A;  2XEG A;  4LUA A;  5BWA B;  2O53 A;  1AYE A;  1KZF A;  2PJ8 A;  2A4N A;  3EY5 A;  2YGW A;  2ZEL A;  3SJG A;  4B6Z A;  1ELM P;  4MFJ A;  2J8M A;  2PIY A;  4CGP A;  4KVM E;  3PB9 X;  3S6F A;  3K9T A;  4E8O A;  4F8Z A;  1TXR A;  4IF5 A;  2H5M A;  4KOW A;  1Z8L A;  1L0C A;  1CP7 A;  3N7Z A;  4CGL A;  4F0X A;  3DR6 A;  2B58 A;  1RTQ A;  4KOV A;  1WWZ A;  4OP4 A;  1IOF A;  3FYN A;  3RYO A;  4CGM A;  3T9Y A;  3I1U A;  3SI1 A;  4X3R A;  2VI7 A;  3DDD A;  2ZEP A;  2BCO A;  4R76 A;  1CP6 A;  2B3V A;  1XRY A;  2J8N A;  2OB0 A;  2R7H A;  2RFH A;  3I9S A;  1I21 A;  2PR1 A;  2QML A;  4C7I A;  3LMS A;  1Z2L A;  2Q4V A;  5HH1 A;  2OZU A;  4E2A A;  1Y9K A;  4R3L A;  1YRE A;  2ARH A;  1R43 A;  5IB0 A;  3NH4 A;  1XF8 A;  4LX9 A;  4CGO A;  1YR0 A;  5AG4 A;  2REE A;  3B3C A;  5EBV A;  3CXP A;  3LAC A;  3F0A A;  1LAN A;  5K8P A;  3C26 A;  1F2P A;  1VHS A;  2FSR A;  4HNY B;  5K8O A;  3K9U A;  4RS2 A;  4A30 A;  1CPX A;  1S7N A;  4X2T A;  1M4L A;  2PJ4 A;  3JRU A;  4KVO E;  4LQG A;  2ANP A;  1M4D A;  3EO4 A;  2P0W A;  5E96 A;  5C82 A;  3CPX A;  3F8K A;  4MBU A;  4UFW A;  2Q43 A;  2I79 A;  4DNC A;  3P2H A;  3VAT A;  4KUB A;  4MMO A;  3KQX A;  2QJ8 A;  4DUK A;  4P4I A;  4WWV A;  4R6T A;  2I00 A;  4KVX A;  3PP9 A;  3TFY A;  3RBU A;  3V38 A;  4CGN A;  3KHZ A;  2DPT A;  5JGF A;  4PPZ A;  3CDX A;  1UFH A;  4MHD A;  3GIU A;  4EME A;  5DWM A;  5K8N A;  2ATR A;  5KTD A;  2JBK A;  4HNX B;  1ZO0 A;  3PFO A;  5LYI A;  4C7H A;  5IV0 A;  4NGT A;  3LWU A;  2AFS A;  4QB9 A;  2PJ6 A;  3D8P A;  5F49 A;  2JDC A;  3TOB A;  5AG7 A;  3HLP A;  4KZT A;  1M4G A;  1FY7 A;  2OZH A;  3ISZ A;  3WAB A;  3QB8 A;  3PBE A;  1CX8 A;  4XPL A;  3CT9 A;  2POK A;  2Q04 A;  1R57 A;  2Z3M A;  4AG9 A;  3D4U A;  3P2F A;  2BOA A;  5GCN A;  4QVT A;  2YNC A;  1I12 A;  1IID A;  4M3S A;  1XOV A;  2CTB A;  2VQY A;  3B3V A;  2WPX A;  2WYR A;  3BHX A;  2JDD A;  1BO4 A;  4DJL A;  2FIA A;  4NGR A;  4WJB A;  4CRZ B;  3R9E A;  4UEF A;  4RUH A;  4H89 A;  2Z3N A;  5I0C A;  5HVH A;  4KS9 A;  4PSX A;  4UIA A;  2PVW A;  1NSA A;  3H8F A;  2Z11 A;  4UCP A;  5AG6 A;  3RO0 A;  4AVB A;  1TF8 A;  1YQE A;  4JXQ A;  2CNM A;  2YNE A;  1Z8X A;  2EO8 A;  4M6G A;  4NF1 A;  5J8C A;  2O28 A;  3PEI A;  4P10 A;  4TWE A;  2ZOG A;  4KOR A;  3GKR A;  1VKC A;  3IJ3 A;  4PXD A;  4UF4 A;  1IIC A;  1S5K A;  2CY2 A;  4JYW A;  1YLE A;  2WUU A;  4A32 A;  4ONW A;  4DYO A;  2NSM A;  4XPD C;  1Z9U A;  3ISX A;  3WC7 A;  6CPA A;  4AVC A;  4NJR A;  5F47 A;  3PGP A;  4L89 A;  3H5Z A;  4Y49 B;  2IMO A;  4GXH A;  4MI4 A;  4EWT A;  3FED A;  2GAN A;  4PK3 A;  1QMU A;  1TKF A;  4CAX A;  2P6G A;  4X5K A;  4A94 A;  4KOT A;  4W9Y A;  1PUA A;  2Y0M A;  2C6P A;  3SXN A;  2PJ0 A;  3PBB A;  3NE8 A;  4U9Z A;  3BJ8 A;  4FAI A;  3SJF A;  3VAR A;  1XIX A;  2Z3K A;  1S7L A;  4KOX A;  4CYN A;  4OC4 A;  3FX6 A;  4C2Z A;  4AXV A;  5C88 A;  4MFP A;  4UIB A;  4ZBG A;  4CAV A;  3PFE A;  2PVV A;  1Y7E A;  2BL1 A;  1LOK A;  4UFV A;  1K4J A;  2CNT A;  1QST A;  4QUS A;  2VBQ A;  3KKW A;  1HDU A;  3HUV A;  1HDQ A;  3B7I A;  3R96 A;  3CXQ A;  3D3S A;  1ZLI A;  1CJW A;  3TO6 A;  1CPS A;  5HVF A;  4JXR A;  4OME A;  1ARM A;  3TE4 A;  2C6C A;  2PDO A;  1YVK A;  3DR8 A;  3OWC A;  4OC3 A;  1Z8W A;  3FB3 A;  2DEA A;  5DS0 A;  3TX8 A;  5G20 A;  1CBX A;  1X10 A;  3H8G A;  4II9 A;  2Q7S A;  1A2Z A;  1DTD A;  3D7H A;  3MN8 A;  2B4D B;  2Q44 A;  3S9L A;  1LFW A;  4KOU A;  2ZEE A;  4YGO A;  1Q7L A;  2ZEH A;  1BPM A;  2O4H A;  2CTC A;  4PK2 A;  1OZP A;  3PB8 X;  4ZY2 A;  1PYT B;  3R1K A;  5LRG A;  4UBR A;  4B5O A;  1XMT A;  2QVP A;  5IX3 A;  3B3T A;  3TTH A;  1Y0R A;  4Q38 A;  3S6G A;  4G1P A;  4MJ8 A;  4UCM A;  4NEX A;  2ZEO A;  3LOD A;  4PSW A;  3D7G A;  4KLW A;  1FT7 A;  4B13 A;  3PB4 X;  1YME A;  1HEE A;  2BO9 A;  1U6M A;  2ZPA A;  4UWI A;  4OID A;  1B6B A;  1Q2C A;  2PRQ A;  2P6E A;  4GM5 A;  2C6G A;  4B11 A;  2PE3 A;  2EWB A;  4J3G A;  5F48 A;  8CPA A;  3FF3 A;  3BLN A;  3K2K A;  3SI2 A;  3W6X A;  1TKH A;  3S6K A;  2PJ1 A;  5CNP A;  3EXN A;  3KL9 A;  5HVG A;  3UY5 A;  5THW A;  3KR5 A;  2ZED A;  4H6Z A;  2VZZ A;  5G1Z A;  4Y49 C;  1P4N A;  3FNC A;  3TOA A;  3D2M A;  1QSN A;  2Q4Z A;  3TT2 A;  1S7F A;  4EFD A;  4ZY0 A;  2R1I A;  4R8F A;  4ZYQ A;  4B12 A;  4M85 A;  1P0H A;  3ZJ0 A;  3IU1 A;  1ARL A;  2CIJ A;  2PJ7 A;  3CXS A;  1M1D A;  4PXC A;  2J8R A; 
#chains in the Genus database with same CATH homology
 2K5T A;  2ZW4 A;  5A28 A;  1B87 A;  4CYQ A;  1J4J A;  3GY9 A;  2WPW A;  1MJA A;  4KOY A;  5KTC A;  4KOS A;  2DXQ A;  2BSW A;  1SQH A;  4BBH A;  4MFK A;  4F6A A;  5AGE A;  4CAF A;  5H86 A;  4CAW A;  2B4D A;  1Q2D A;  3SHP A;  2X7B A;  4OAD A;  4UA3 A;  2Z3L A;  1GHE A;  2OZG A;  3W91 A;  5DWN A;  2YNC C;  2VZY A;  1TIQ A;  1KUY A;  4OAE A;  5F46 A;  2FT0 A;  5G21 A;  3TCV A;  4QC6 A;  4RI1 A;  4UFX A;  1IYK A;  1YVO A;  4YFJ A;  3WR7 A;  4AG7 A;  2P6F A;  4KLV A;  3FRM A;  2KCW A;  4B5P B;  2FCK A;  1YK3 A;  3FBU A;  4PV6 A;  1I1D A;  3SXO A;  1XEB A;  4U9Y A;  4XNH B;  4MFL A;  3PZJ A;  3G3S A;  1M4I A;  2G3T A;  2EUI A;  4A33 A;  2Q4Y A;  1S7K A;  1NSL A;  2HQY A;  3R9G A;  4YRH A;  3GYA A;  2Z0Z A;  4R57 A;  2B4B A;  4R9M A;  1BOB A;  3NE7 A;  2G0B A;  3B8G A;  1NMT A;  1NE9 A;  4UWJ A;  2B5G B;  1QSO A;  3FIX A;  2D4P A;  5EC4 A;  1LRZ A;  3E0K A;  4A31 A;  2PR8 A;  4NXY A;  2Z3P A;  1MJB A;  2FS5 A;  1S60 A;  2AE6 A;  2F5I A;  1QSM A;  4ORF A;  2PSW A;  1V0C A;  1ON0 A;  4Q36 A;  2JEV A;  2R98 A;  4E0A A;  2QEC A;  4FD4 A;  4B5P A;  4C68 A;  3QAH A;  4I49 A;  3F5B A;  2AJ6 A;  2R8V A;  2HUZ A;  4OLL A;  4CRY B;  3IWG A;  1Y9W A;  5HMN A;  4JLY A;  3D2P A;  4ZGY B;  3VWE A;  1Q2Y A;  3I3G A;  4FD7 A;  4XNH C;  3R95 A;  4C2X A;  2OU2 A;  4JD6 A;  4BMH A;  3VWD A;  3MGD A;  1IYL A;  2PQ8 A;  1Z4R A;  2BUE A;  2PC1 A;  4FD5 A;  2GIV A;  4CYO A;  2QIR A;  4L8A A;  5JPH A;  5A27 A;  2B5G A;  1S3Z A;  1MK4 A;  4XPD B;  4AVA A;  3DSB A;  4KSA A;  3V8I A;  4CYP A;  2Z3O A;  4A95 A;  2IL4 A;  4B14 A;  2NMT A;  3LD2 A;  2Q0Y A;  5J8F A;  4F0Y A;  4MFZ A;  1Y7R A;  1QSR A;  3TO9 A;  1KUX A;  3DNS A;  4AB7 A;  1CM0 A;  3JVN A;  5H84 A;  4QBJ A;  1WK4 A;  4UCN A;  2RC4 A;  2OH1 A;  2ZW7 A;  2HV2 A;  4NCZ A;  3EC4 A;  4NSQ A;  1M44 A;  2C27 A;  3H4Q A;  3ZZI A;  2B3U A;  4U5Y A;  2JLM A;  2CNS A;  2VXK A;  5G22 A;  4GS4 A;  4MY3 A;  2ZW6 A;  4HNW B;  1PU9 A;  3FXT A;  1YGH A;  4R87 A;  5AG5 A;  4B10 A;  3EFA A;  1N71 A;  3BJ7 A;  2Q7B A;  2BEI A;  4JJX A;  1RXT A;  2REF A;  2ZXV A;  3A9L A;  4MY0 A;  4HKF A;  4CS0 B;  2GE3 A;  3T90 A;  1RO5 A;  1XE4 A;  3IGR A;  4EVY A;  2FE7 A;  4KUA A;  4H6U A;  2YND A;  3G8W A;  3TO7 A;  2FIW A;  3R9F A;  4ONU A;  1Z4E A;  1MJ9 A;  2G3A A;  4K30 A;  4MFQ A;  5JQ4 A;  2CXA A;  4A2Z A;  5KTA A;  1KUV A;  1IB1 E;  3IWE A;  2EVN A;  3IU2 A;  2WSA A;  4R3K A;  2PRB A;  5I0C A;  4CAE A;  2ZW5 A;  4FD6 A;  2D4O A;  4IUS A;  5ISV A;  2DPS A;  2FXF A;  4XPK A;  2VEZ A;  3JUW A;  3S6H A;  1YX0 A;  4KSF A;  3JTK A;  2Z10 A;  5FVJ A;  3W6S A;  4C2Y A;  2FL4 A;  4JWP A;  4LUA A;  5BWA B;  1KZF A;  2A4N A;  3EY5 A;  2YGW A;  4MFJ A;  2J8M A;  4CGP A;  4KVM E;  3S6F A;  4E8O A;  4IF5 A;  2H5M A;  4KOW A;  3N7Z A;  1L0C A;  4CGL A;  4F0X A;  3DR6 A;  2B58 A;  4KOV A;  1WWZ A;  3RYO A;  3FYN A;  4CGM A;  3T9Y A;  2VI7 A;  3DDD A;  2B3V A;  2OB0 A;  2J8N A;  2R7H A;  3I9S A;  1I21 A;  2PR1 A;  2QML A;  4C7I A;  2Q4V A;  5HH1 A;  2OZU A;  4E2A A;  1Y9K A;  4R3L A;  1YRE A;  2ARH A;  5IB0 A;  1XF8 A;  4LX9 A;  4CGO A;  1YR0 A;  5AG4 A;  2REE A;  5EBV A;  3CXP A;  3F0A A;  3C26 A;  1VHS A;  2FSR A;  4HNY B;  3K9U A;  4RS2 A;  4A30 A;  1S7N A;  4KVO E;  1M4D A;  3EO4 A;  2P0W A;  5E96 A;  5C82 A;  3F8K A;  4MBU A;  4UFW A;  2I79 A;  4DNC A;  3P2H A;  4KUB A;  2I00 A;  4KVX A;  3PP9 A;  3TFY A;  4CGN A;  2DPT A;  1UFH A;  4MHD A;  5DWM A;  2ATR A;  5KTD A;  4HNX B;  1ZO0 A;  4C7H A;  5IV0 A;  4QB9 A;  3D8P A;  5F49 A;  2JDC A;  3TOB A;  5AG7 A;  4KZT A;  1M4G A;  1FY7 A;  2OZH A;  3QB8 A;  4XPL A;  2Q04 A;  1R57 A;  2Z3M A;  4AG9 A;  3P2F A;  5GCN A;  4QVT A;  2YNC A;  1I12 A;  1IID A;  4M3S A;  2VQY A;  2WPX A;  2JDD A;  1BO4 A;  2FIA A;  4CRZ B;  3R9E A;  4H89 A;  2Z3N A;  4KS9 A;  4PSX A;  4AVB A;  5AG6 A;  2Z11 A;  4UCP A;  4JXQ A;  4NF1 A;  2CNM A;  2YNE A;  5J8C A;  2O28 A;  4KOR A;  3GKR A;  1VKC A;  1IIC A;  1S5K A;  2CY2 A;  1YLE A;  2WUU A;  4A32 A;  4XPD C;  1Z9U A;  4AVC A;  5F47 A;  3PGP A;  4L89 A;  3H5Z A;  4Y49 B;  4MI4 A;  2GAN A;  4PK3 A;  4CAX A;  2P6G A;  4X5K A;  4KOT A;  1PUA A;  2Y0M A;  3SXN A;  4U9Z A;  3BJ8 A;  1XIX A;  2Z3K A;  1S7L A;  4KOX A;  4CYN A;  4C2Z A;  5C88 A;  4MFP A;  4ZBG A;  4CAV A;  2BL1 A;  4UFV A;  1K4J A;  2CNT A;  1QST A;  4QUS A;  2VBQ A;  3KKW A;  3R96 A;  3CXQ A;  3D3S A;  1CJW A;  3TO6 A;  4JXR A;  3TE4 A;  3OWC A;  2PDO A;  1YVK A;  3DR8 A;  3FB3 A;  5G20 A;  4II9 A;  2B4D B;  2Q44 A;  4YGO A;  4KOU A;  4PK2 A;  1OZP A;  3R1K A;  4UBR A;  4B5O A;  1XMT A;  5IX3 A;  3TTH A;  4Q38 A;  3S6G A;  4MJ8 A;  4UCM A;  4NEX A;  3LOD A;  4PSW A;  4KLW A;  4B13 A;  1U6M A;  2ZPA A;  4UWI A;  1B6B A;  1Q2C A;  4B11 A;  2P6E A;  4J3G A;  5F48 A;  3BLN A;  3W6X A;  3S6K A;  5CNP A;  3EXN A;  3UY5 A;  4H6Z A;  2VZZ A;  5G1Z A;  4Y49 C;  1P4N A;  3FNC A;  3TOA A;  3D2M A;  1QSN A;  3TT2 A;  1S7F A;  2R1I A;  4B12 A;  4M85 A;  1P0H A;  3ZJ0 A;  3IU1 A;  3CXS A;  1M1D A;  2J8R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...