2K5TA

Solution nmr structure of putative n-acetyl transferase yhhk from e. coli bound to coenzyme a: northeast structural genomics consortium target et106
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
128
structure length
128
Chain Sequence
MKLTIIRLEKFSDQDRIDLQKIWPEYSPSSLQVDDNHRIYAARFNERLLAAVRVTLSGTEGALDSLRVREVTRRRGVGQYLLEEVLRNNPGVSCWWMADAGVEDRGVMTAFMQALGFTTQQGGWEKCG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein yhhK
publication title Solution NMR Structure of Putative N-Acetyl Transferase YhhK from E. coli Bound to Coenzyme A
rcsb
source organism Escherichia coli k12
molecule tags Transferase
total genus 33
structure length 128
sequence length 128
ec nomenclature
pdb deposition date 2008-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12568 PanZ Acetyltransferase (GNAT) domain, PanZ
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 2k5tA00
1S7KA 3UY5A 4EVYA 1QSRA 4H6ZA 2P0WA 2ARHA 4AG7A 1S7FA 5JQ4A 3FYNA 4KOWA 2OZUA 4KLVA 4F0YA 2Q4VA 3TFYA 3C26A 4FD4A 4RI1A 4QBJA 2PR8A 4MHDA 4B5OA 2OH1A 1QSOA 4FD7A 3MGDA 1XIXA 4MJ8A 4RS2A 4UWJA 4MY0A 4MY3A 4ONUA 4CAXA 4KVOE 5C88A 1Q2DA 3ZJ0A 3R9GA 2I79A 1BOBA 4R87A 1YREA 5DWMA 2HUZA 4KOSA 5HMNA 2PR1A 5F46A 1KUXA 4KOYA 2OZGA 2PRBA 3G3SA 4PV6A 4PSXA 3V8IA 2Z0ZA 5EC4A 3S6FA 1S7LA 4JLYA 5E96A 3GKRA 2ZW5A 3TO7A 3P2HA 3G8WA 4DNCA 4JD6A 2BL1A 1Z9UA 2QIRA 2J8RA 4E2AA 4JXRA 4HKFA 2CNMA 4NXYA 1K4JA 2EVNA 1YR0A 4QVTA 4K30A 3D2PA 2Q44A 5GCNA 3D2MA 2BEIA 4OLLA 3TCVA 1KUVA 2WPWA 1CM0A 4J3GA 2Y0MA 1KUYA 3IWGA 4JWPA 4M3SA 1Z4EA 2PQ8A 3K9UA 5J8FA 2CNTA 3P2FA 1MJ9A 3LODA 1FY7A 1M1DA 3OWCA 3IGRA 4XPDB 2D4PA 2ZXVA 3TO6A 1IYLA 4MBUA 4XNHC 1NSLA 4L8AA 1M4GA 2CY2A 1PUAA 1NE9A 3SXNA 3FBUA 1YVKA 2FIWA 2FIAA 3I3GA 4XPKA 4YFJA 2BUEA 1Y9KA 1XF8A 5ISVA 5IX3A 3TOAA 1YLEA 4YRHA 2H5MA 2J8MA 3VWDA 4NF1A 3EXNA 4H89A 4KZTA 1BO4A 1Y7RA 4Y49B 4KVXA 4CRYB 2RC4A 3PGPA 2J8NA 2FL4A 4LX9A 4XNHB 4R9MA 1M4DA 2R7HA 2PDOA 4LUAA 4NCZA 4HNYB 2AJ6A 4QB9A 2WPXA 4KOTA 1TIQA 2R98A 2GIVA 4XPLA 1XMTA 2B4DB 3JUWA 4AVAA 3EY5A 5KTDA 3R9FA 1U6MA 1QSTA 2GE3A 3EFAA 4GS4A 2FSRA 1IB1E 4KOVA 4R57A 2FE7A 4PSWA 2B5GA 3SXOA 2PSWA 1QSNA 4X5KA 3PP9A 5F47A 3S6KA 3JVNA 3CXPA 2EUIA 4XPDC 4I49A 1XE4A 4AB7A 1L0CA 4OAEA 1YVOA 5H84A 1MJAA 3T9YA 4IF5A 4KOXA 3FXTA 2P6GA 2VZYA 4CAWA 3LD2A 3PZJA 5F48A 2C27A 1B6BA 1S7NA 4FD6A 3D8PA 1M44A 1YX0A 3TOBA 3DR8A 4L89A 2Q4YA 4BMHA 2Z11A 4U9YA 4Y49C 4AVBA 4E8OA 1YK3A 3B8GA 4OADA 1P0HA 4U5YA 2ZPAA 2HV2A 3TTHA 4UBRA 1V0CA 2DXQA 3DDDA 4H6UA 2B4DA 2BSWA 2HQYA 3I9SA 1R57A 4KUAA 1M4IA 3E0KA 2JEVA 3F5BA 3SHPA 4HNWB 2FS5A 3FNCA 1IIDA 5HH1A 3RYOA 3TE4A 2R1IA 3R9EA 1S3ZA 4MI4A 5EBVA 4KOUA 1S5KA 1IICA 2REEA 1VHSA 4E0AA 2B4BA 2FCKA 1QSMA 4NEXA 2VI7A 2Q7BA 4F6AA 1Q2YA 1ON0A 2QMLA 3R1KA 4B5PB 4KUBA 2G0BA 1WK4A 3DNSA 2ZW6A 2PC1A 2G3TA 4KLWA 3KKWA 5FVJA 1RXTA 4ZBGA 1I12A 5H86A 3VWEA 4CS0B 2Q0YA 1I1DA 5CNPA 1S60A 3F0AA 4ORFA 5I0CA 3BJ7A 5DWNA 2NMTA 4KVME 2P6EA 3R96A 3TT2A 1MJBA 2ZW7A 1YGHA 3F8KA 4R3KA 4YGOA 1XEBA 3TO9A 1B87A 5F49A 2D4OA 2GANA 3EO4A 3D3SA 3FB3A 3DSBA 3W91A 1UFHA 3NE7A 3WR7A 1Z4RA 3FRMA 2OB0A 2VEZA 4QC6A 2B58A 3T90A 5IV0A 1SQHA 1CJWA 2VQYA 3DR6A 4QUSA 4CRZB 4FD5A 2B3UA 1J4JA 4M85A 2JDCA 2REFA 1P4NA 2X7BA 2A4NA 4PK3A 5JPHA 4AVCA 4AG9A 2B3VA 3R95A 2ZW4A 2AE6A 2VBQA 1RO5A 2VZZA 1OZPA 1GHEA 2JLMA 2Z10A 1KZFA 4JXQA 4KORA 1MK4A 4B5PA 3BJ8A 3BLNA 1WWZA 2R8VA 3S6GA 1N71A 2ATRA 3QB8A 1Y9WA 5J8CA 4HNXB 2JDDA 4IUSA 4UA3A 3S6HA 3GYAA 2B5GB 2OU2A 2VXKA 3EC4A 2OZHA 1I21A 3GY9A 4II9A 2I00A 4JJXA 1NMTA 2G3AA 4PK2A 3CXQA 5IB0A 2CNSA 4CAVA 1Q2CA 2K5TA 5C82A 4NSQA 2FT0A 4UWIA 5KTAA 5KTCA 2P6FA 2F5IA 3N7ZA 2O28A 1LRZA 3FIXA 3QAHA 4U9ZA 3W6XA 2FXFA 4R3LA 3W6SA 3ZZIA 1VKCA 3H4QA 2QECA 2IL4A 1PU9A 2KCWA 1IYKA 2Q04A 3CXSA
chains in the Genus database with same CATH superfamily
1S7KA 2PVWA 2O53A 1YW6A 3UY5A 4EVYA 4ZI6A 1QSRA 2PJ5A 2PJ1A 4H6ZA 1Z5RA 2P0WA 4Q7AA 4WWVA 1LCPA 2ARHA 4AG7A 3GB0A 2EK9A 1S7FA 4OIWA 5AG7A 5JQ4A 3FYNA 4KOWA 3CDXA 2OZUA 2V8HA 4MCQA 4KLVA 4UCMA 5LRGA 4F8ZA 4BBHA 2AFZA 2Q4VA 4F0YA 1VHEA 3TFYA 4DJLA 2JBJA 3C26A 3B35A 4FD4A 4RI1A 3MRUA 4QBJA 5K8NA 3RBUA 2PR8A 4MHDA 4OIDA 2BO9A 3TC8A 2ZEGA 1R3NA 4B5OA 2F8HA 2HB6A 2OH1A 1QSOA 4FD7A 2PJ7A 2XEIA 4W9YA 4R7MA 3MGDA 1XIXA 1DTDA 4ZY2A 1PYTB 2Q4ZA 3ISXA 4A31A 3B3SA 3D7FA 3ISZA 2C6GA 4MJ8A 4CAFA 5JGFA 4RS2A 1QMUA 4UWJA 2WUUA 5D29A 2VL1A 4MY0A 2ZEDA 2V8VA 3B3WA 4MY3A 4ONUA 4JYWA 4OC0A 4JZ0A 4YWYA 4CAEA 4P6YA 4CAXA 4KVOE 5ELYA 1BLLE 5C88A 1Q2DA 4B13A 3ZJ0A 2IQ6A 3R9GA 2I79A 4NGQA 4R87A 1YREA 5DWMA 2PRQA 2HUZA 4KOSA 4P4JA 5HMNA 2PR1A 3SI1A 5AG5A 4A2ZA 5F46A 4H2KA 1KUXA 3PB9X 4OMEA 4KOYA 2OZGA 1IGBA 2PRBA 3G3SA 4PV6A 2EWBA 2ZELA 3A9LA 3FF3A 4OC5A 1RTQA 4PSXA 2Z0ZA 3V8IA 2EO8A 5EC4A 3S6FA 1S7LA 4F0XA 4JLYA 3BI0A 5E96A 3PB8X 3GKRA 2ZW5A 3TO7A 3P2HA 3KI9A 4PXCA 3WT4A 5A27A 5F09A 3G8WA 4DNCA 3LMSA 4F9UA 4MRIA 4JD6A 3T8WA 4UEZA 4A32A 2BL1A 5LYFA 1DE4C 5JM6A 5K8OA 2WZNA 4ZYQA 1Z9UA 2QIRA 1CX8A 3I1UA 2J8RA 4MCRA 4JXRA 4E2AA 4HKFA 2CNMA 4NXYA 4C2ZA 4MMOA 1K4JA 2EVNA 1YR0A 4QVTA 2I3CA 1X12A 4UCNA 2PJ4A 1Y0RA 2WYRA 4K30A 3D2PA 2Q44A 4UEFA 5GCNA 3D2MA 2BEIA 4OLLA 3IC1A 3TCVA 1KUVA 2WPWA 4MHYA 1CM0A 4J3GA 1IOFA 2Y0MA 3D67A 1KUYA 1VHOA 3IWGA 1F2OA 4OC2A 4JWPA 4A95A 4M3SA 1LOKA 1YSJA 1NSAA 3H8FA 4P10A 1Z4EA 4ZX8A 2PQ8A 3K9UA 5J8FA 4R76A 5LYDA 1A2ZA 2CNTA 3P2FA 4P4EA 4LQGA 3GIUA 1MJ9A 3LODA 1FY7A 1ZG9A 5CBMA 2AFWA 2C6PA 3KR4A 4F9VA 1M1DA 3OWCA 3IIBA 1IY7A 1ZG8A 3IGRA 3NFZA 4A94A 5K8PA 4XPDB 4CYQA 2WSAA 2D4PA 1IOIA 3FECA 2ZXVA 5AG6A 3TO6A 4OKOA 3NH8A 4Q38A 1JWQA 1IYLA 4EMEA 4MBUA 4NJRA 4XNHC 3NE8A 1NSLA 4L8AA 1M4GA 2CY2A 3PBBA 1PUAA 2AFUA 2NYQA 3HLPA 1CG2A 3FEEA 2GLFA 2JEWA 3KASA 4CGPA 5LRKA 2Q04A 1NE9A 1XBUA 3SXNA 3FBUA 1YVKA 1XFOA 5LYLA 4Q36A 2FIWA 2GREA 4CGMA 5HVGA 4UIBA 2FIAA 4DUKA 4ZGYB 3I3GA 4OP4A 3VH9A 4XPKA 2FVGA 3SJFA 4YFJA 2ZEOA 4UIAA 1XJOA 1Y9KA 2BOAA 1XF8A 2J9AA 3IWWA 3H8EA 4FWUA 4TNUA 5IX3A 5ISVA 3TOAA 3FVLA 4NJQA 1YLEA 4YRHA 2H5MA 2J8MA 2Z3MA 3VWDA 1BPNA 3LWUA 4NF1A 4CGNA 3EXNA 4H89A 4KZTA 3BI1A 4B12A 1BO4A 1Y7RA 4Y49B 4IAVA 4KVXA 4CRYB 2RC4A 4M6GA 3PGPA 2J8NA 2FL4A 3CXSA 4LX9A 2IMOA 2YNEA 4XNHB 4GM5A 4R9MA 1ARLA 4B11A 1M4DA 2R7HA 4CYOA 2YNCC 2PDOA 1BAVA 4A39A 2CTBA 4A38A 4LUAA 4NCZA 4HNYB 3SJXA 2ZEHA 2AJ6A 4QB9A 1LFWA 2WPXA 2CXAA 4KOTA 5THWA 1TIQA 2R98A 2GIVA 4XPLA 2JBKA 1XMTA 2B4DB 3JUWA 4AVAA 1FT7A 3EY5A 5KTDA 1ZLHA 3KQXA 3R9FA 1U6MA 1QSTA 2GE3A 3EFAA 4GS4A 2FSRA 2EK8A 1IB1E 2AFSA 4IK2A 1ZLIA 2PJBA 3GUXA 1LAPA 2CTCA 4KOVA 4R57A 2FE7A 4CPAA 4PSWA 2B5GA 3SXOA 2V77A 2PSWA 4FUUA 6CPAA 5G1ZA 1QSNA 4X5KA 3SI2A 4CYNA 3PP9A 3CPXA 4P4BA 4ZY1A 5F47A 3S6KA 3JVNA 2BCOA 2ZOGA 4A30A 3B3TA 3CXPA 3S9MA 2EUIA 4M6HA 4XPDC 4I49A 4X8IA 1XE4A 3H5ZA 4AB7A 1L0CA 4OAEA 1YVOA 3BXMA 4P4IA 5H84A 3S9LA 3MN8A 1MJAA 1FNOA 3T9YA 5A28A 4IF5A 4KOXA 3FXTA 2P6GA 2VZYA 4PQAA 5HVFA 3WC5A 5CPAA 3LD2A 3PB4X 4CAWA 4MFZA 4C7IA 2ODFA 3PZJA 2PIYA 4FAIA 3IWEA 5F48A 3IEHA 1IU8A 2C27A 3PEIA 3KHXA 3SI0A 2PIZA 1YQEA 2GFQA 1Y0YA 2AFOA 2Z3PA 1B6BA 1PCAA 1S7NA 2YNDA 4FD6A 2PJAA 5BWAB 3KZWA 3D7DA 2XEFA 3D8PA 2AFMA 1F57A 1M44A 1YX0A 3TOBA 4P44A 3FH4A 3HUVA 3DR8A 4L89A 2Q4YA 5G21A 3NH4A 4BMHA 4EFDA 2Z11A 4U9YA 4Y49C 4AVBA 4E8OA 1YK3A 5K8MA 1AMPA 3B8GA 2YGWA 4UFVA 2ZEFA 4OADA 3CPAA 2DF5A 1P0HA 3DGVA 4P4FA 4U5YA 2ZPAA 1Z8WA 2HV2A 3TTHA 4UBRA 1V0CA 5D8NA 2DXQA 1LANA 4CGOA 3DDDA 4H6UA 4ZY0A 1Z8TA 1Z2LA 4K3NA 3IFEA 4BINA 4BD9A 2C1CA 4NGTA 3WABA 2B4DA 2BSWA 2HQYA 3I9SA 4C2YA 1M4LA 1R57A 4C2XA 2PJ9A 2Z3OA 4OC3A 4KUAA 1M4IA 3E0KA 2JEVA 4NGMA 3D7HA 3F5BA 3FEDA 3N5FA 4HNWB 4MXUA 3SHPA 4NGSA 3VARA 5J1QA 2FS5A 3FNCA 1X10A 1IIDA 1XRYA 3BHXA 5HH1A 5JH9A 3RYOA 3TE4A 4RN7A 2R1IA 1KWMA 3R9EA 4B14A 2Q51A 2CIJA 1S3ZA 4MI4A 1Z8XA 2POKA 1HDUA 1R43A 5EBVA 4KOUA 1S5KA 1Z8LA 1IICA 2OR4A 2XEGA 1UWYA 2GLJA 2REEA 2XEJA 3FJUA 4CGLA 1YMEA 2RFHA 1VHSA 4E0AA 5DS0A 1CBXA 8CPAA 2QVPA 2B4BA 2YNCA 4NFRA 2FCKA 1QSMA 3KR5A 4NEXA 2VI7A 3K2KA 3IO1A 2Q7BA 4F6AA 1Q2YA 1ON0A 2QMLA 3NH5A 3R1KA 4KUBA 4B5PB 3V38A 4MCPA 4UCPA 2G0BA 1WK4A 3PBEA 3DNSA 3QAYA 1GYTA 2ZW6A 4TWEA 2PC1A 3RNZA 3VATA 4AXVA 1LAMA 2ZEEA 2G3TA 3KHZA 5EMIA 4B10A 5LRJA 2PJ6A 4KLWA 3KKWA 5FVJA 1RXTA 2PJ2A 2Z3NA 4ZBGA 1JQGA 1I12A 3PB6X 2G9DA 4MFLA 5H86A 3VWEA 3V7ZA 4CS0B 2Q0YA 3KQZA 1I1DA 2ANPA 1S60A 3F0AA 5CNPA 4KSFA 3TX8A 2RB7A 4ORFA 1XOVA 5I0CA 3BJ7A 5DWNA 4PPZA 2NMTA 4M6IA 4Z65A 5HVHA 3SJEA 3D66A 4KVME 5LYIA 4PXDA 2P6EA 3R96A 3RO0A 3TT2A 4PXBA 3D7GA 3IU2A 3WC6A 4ZX9A 4MFKA 2ZOFA 3KGQA 1MJBA 4NGNA 2ZW7A 1YGHA 1CPSA 3CZXA 3F8KA 4R3KA 4MHNA 4YGOA 1XEBA 3B7IA 3TO9A 3WC7A 2ABZA 1B87A 4MFPA 5F49A 4IHMA 2D4OA 3SJGA 2PJCA 2GANA 3IU1A 3EO4A 4EWTA 2ZEPA 3D3SA 3FB3A 1VGYA 3DSBA 2V8DA 2DPTA 2V8GA 4NGPA 4GXHA 2DEAA 2NSMA 3W91A 1UFHA 2OOTA 5IB9A 3NE7A 3DLJA 3PFOA 2Z3LA 1Z4RA 3FRMA 4NGRA 3WR7A 1QQ9A 2OB0A 2VEZA 4QC6A 2B58A 1YW4A 2PE3A 4OC1A 4UFXA 3T90A 4FBEA 5IV0A 1SQHA 4P4DA 5I4MA 1F2PA 1CJWA 3JTKA 1Y7EA 4X2TA 2VQYA 3H8GA 2C6CA 2PJ0A 1YLOA 3B3CA 3DR6A 4A33A 4MCSA 4QUSA 4CRZB 4FD5A 2B3UA 1J4JA 4M85A 2JDCA 2REFA 2PVVA 1P4NA 2X7BA 5G22A 1TF8A 2A4NA 4KSAA 3PRTA 4MFQA 4PK3A 4C68A 3B3VA 2DPSA 1H8LA 1Q7LA 1ZG7A 4AVCA 4CYPA 2GU2A 4DYOA 5JPHA 4AG9A 2B3VA 3R95A 2ZW4A 4KS9A 2F7VA 1ARMA 2AE6A 1CP7A 4B6ZA 2VBQA 1RO5A 2VZZA 1ELLP 1VIXA 1OZPA 2EBJA 4OC4A 1GHEA 1TF9A 3IJ3A 1BPMA 5AGEA 3GLJA 2JLMA 2Z10A 3FMCA 1KZFA 3RAMA 4R8FA 5AG4A 4JXQA 2ZENA 4KORA 1TXRA 2Q43A 1MK4A 2QYVA 2HC9A 4O23A 1OBRA 4B5PA 3BJ8A 3PFEA 4LQ6A 3FX6A 4UF4A 3BLNA 4YU9A 4HPSA 3B2YA 1WWZA 2IJZA 2R8VA 1TKJA 1CP6A 3S6GA 1N71A 1CPXA 2ATRA 3QB8A 1Y9WA 3KL9A 4RUHA 4G1PA 4HNXB 1ZO0A 5J8CA 3S9NA 4UEEA 2CF4A 2JDDA 2PJ8A 3D4UA 4IUSA 4ONWA 4UA3A 1TKFA 3S6HA 3NA6A 4UFWA 4PXEA 3GYAA 4C7HA 2B5GB 2OU2A 1AYEA 4A37A 2VXKA 1AUGA 4MHPA 3EC4A 1XMBA 1I21A 2OZHA 3GY9A 3K9TA 7CPAA 4II9A 5HXDA 2I00A 4JJXA 1NMTA 2Q7SA 2G3AA 5G20A 1EE3P 4PK2A 3CXQA 5IB0A 2CNSA 2AFXA 1Q2CA 4CAVA 2K5TA 5C82A 4NSQA 2FT0A 1HDQA 4UWIA 1ELMP 5KTAA 5KTCA 3JRUA 2Z3KA 2P6FA 3RZAA 2F5IA 3N7ZA 2QJ8A 2O28A 1LRZA 3QNVA 4KSIA 1TKHA 1HEEA 3FIXA 3QAHA 4R6TA 2PCUA 3LACA 2ZEMA 3CT9A 4U9ZA 2FXFA 3W6XA 4R3LA 3W6SA 2PJ3A 3PB7X 4MFJA 4WJBA 3ZZIA 1VKCA 4X3RA 3H4QA 2QECA 2IL4A 2O4HA 4MHZA 1PU9A 2KCWA 3D68A 1IYKA 3L2NA 4P45A 2BUEA 1BOBA
chains in the Genus database with same CATH topology
1S7KA 3UY5A 4EVYA 1QSRA 4H6ZA 2P0WA 2ARHA 4AG7A 1S7FA 5AG7A 5JQ4A 3FYNA 4KOWA 2OZUA 4KLVA 4UCMA 4BBHA 4F0YA 2Q4VA 3TFYA 3C26A 4FD4A 4RI1A 4QBJA 2PR8A 4MHDA 4B5OA 2OH1A 1QSOA 4FD7A 3MGDA 1XIXA 4A31A 4MJ8A 4CAFA 4RS2A 4UWJA 2WUUA 4MY0A 4CAEA 4MY3A 4ONUA 4CAXA 4KVOE 5C88A 1Q2DA 4B13A 3ZJ0A 3R9GA 2I79A 1BOBA 4R87A 1YREA 5DWMA 2HUZA 4KOSA 5HMNA 2PR1A 5AG5A 4A2ZA 5F46A 1KUXA 4KOYA 2OZGA 2PRBA 3G3SA 4PV6A 3A9LA 4PSXA 3V8IA 2Z0ZA 4F0XA 5EC4A 3S6FA 1S7LA 4JLYA 5E96A 3GKRA 2ZW5A 3TO7A 3P2HA 5A27A 3G8WA 4DNCA 4JD6A 4A32A 2BL1A 1Z9UA 2QIRA 2J8RA 4E2AA 4JXRA 4HKFA 2CNMA 4NXYA 4C2ZA 1K4JA 2EVNA 1YR0A 4QVTA 4UCNA 4K30A 3D2PA 2Q44A 5GCNA 3D2MA 2BEIA 4OLLA 3TCVA 1KUVA 2WPWA 1CM0A 4J3GA 2Y0MA 1KUYA 3IWGA 4JWPA 4A95A 4M3SA 1Z4EA 2PQ8A 3K9UA 5J8FA 2CNTA 3P2FA 1MJ9A 3LODA 1FY7A 1M1DA 3OWCA 3IGRA 4XPDB 4CYQA 2WSAA 2D4PA 2ZXVA 5AG6A 3TO6A 4Q38A 1IYLA 4MBUA 4XNHC 1NSLA 4L8AA 1M4GA 2CY2A 1PUAA 4CGPA 1NE9A 3SXNA 3FBUA 1YVKA 4Q36A 2FIWA 4CGMA 2FIAA 4ZGYB 3I3GA 4XPKA 4YFJA 2BUEA 1Y9KA 1XF8A 5ISVA 5IX3A 3TOAA 1YLEA 4YRHA 2H5MA 2J8MA 2Z3MA 3VWDA 4NF1A 4CGNA 3EXNA 4H89A 4KZTA 4B12A 1BO4A 1Y7RA 4Y49B 4KVXA 4CRYB 2RC4A 3PGPA 2J8NA 2FL4A 4LX9A 2YNEA 4XNHB 4R9MA 4B11A 1M4DA 2R7HA 4CYOA 2YNCC 2PDOA 4LUAA 4NCZA 4HNYB 2AJ6A 4QB9A 2WPXA 2CXAA 4KOTA 1TIQA 2R98A 2GIVA 4XPLA 1XMTA 2B4DB 3JUWA 4AVAA 3EY5A 5KTDA 3R9FA 1U6MA 1QSTA 2GE3A 3EFAA 4GS4A 2FSRA 1IB1E 4KOVA 4R57A 2FE7A 4PSWA 2B5GA 3SXOA 2PSWA 5G1ZA 1QSNA 4X5KA 4CYNA 3PP9A 5F47A 3S6KA 3JVNA 4A30A 3CXPA 2EUIA 4XPDC 4I49A 1XE4A 3H5ZA 4AB7A 1L0CA 4OAEA 1YVOA 5H84A 5A28A 1MJAA 3T9YA 4IF5A 4KOXA 3FXTA 2P6GA 2VZYA 4CAWA 3LD2A 4MFZA 4C7IA 3PZJA 3IWEA 5F48A 2C27A 2Z3PA 1B6BA 1S7NA 2YNDA 4FD6A 5BWAB 3D8PA 1M44A 1YX0A 3TOBA 3DR8A 4L89A 2Q4YA 5G21A 4BMHA 2Z11A 4U9YA 4Y49C 4AVBA 4E8OA 1YK3A 3B8GA 2YGWA 4UFVA 4OADA 1P0HA 4U5YA 2ZPAA 2HV2A 3TTHA 4UBRA 1V0CA 2DXQA 4CGOA 3DDDA 4H6UA 2B4DA 2BSWA 2HQYA 3I9SA 4C2YA 4C2XA 1R57A 2Z3OA 4KUAA 1M4IA 3E0KA 2JEVA 3F5BA 3SHPA 4HNWB 2FS5A 3FNCA 1IIDA 5HH1A 3RYOA 3TE4A 2R1IA 4B14A 3R9EA 1S3ZA 4MI4A 5EBVA 4KOUA 1S5KA 1IICA 4CGLA 2REEA 1VHSA 4E0AA 2B4BA 2YNCA 2FCKA 1QSMA 4NEXA 2VI7A 2Q7BA 4F6AA 1Q2YA 1ON0A 2QMLA 3R1KA 4B5PB 4KUBA 4UCPA 2G0BA 1WK4A 3DNSA 2ZW6A 2PC1A 2G3TA 4B10A 4KLWA 3KKWA 5FVJA 1RXTA 2Z3NA 4ZBGA 1I12A 4MFLA 5H86A 3VWEA 4CS0B 2Q0YA 1I1DA 5CNPA 1S60A 3F0AA 4KSFA 4ORFA 5I0CA 3BJ7A 5DWNA 2NMTA 4KVME 2P6EA 3R96A 3TT2A 3IU2A 4MFKA 1MJBA 2ZW7A 1YGHA 3F8KA 4R3KA 4YGOA 1XEBA 3TO9A 1B87A 4MFPA 5F49A 2D4OA 2GANA 3IU1A 3EO4A 3D3SA 3FB3A 3DSBA 2DPTA 3W91A 1UFHA 3NE7A 3WR7A 2Z3LA 1Z4RA 3FRMA 2OB0A 2VEZA 4QC6A 2B58A 4UFXA 3T90A 5IV0A 1SQHA 1CJWA 3JTKA 2VQYA 3DR6A 4A33A 4QUSA 4CRZB 4FD5A 2B3UA 1J4JA 4M85A 2JDCA 2REFA 5G22A 1P4NA 2X7BA 2A4NA 4KSAA 4MFQA 4PK3A 4C68A 2DPSA 5JPHA 4AVCA 4CYPA 4AG9A 2B3VA 3R95A 2ZW4A 4KS9A 2AE6A 2VBQA 1RO5A 2VZZA 1OZPA 1GHEA 5AGEA 5AG4A 2JLMA 2Z10A 1KZFA 4JXQA 4KORA 1MK4A 4B5PA 3BJ8A 3BLNA 1WWZA 2R8VA 3S6GA 1N71A 2ATRA 3QB8A 1Y9WA 5J8CA 4HNXB 1ZO0A 2JDDA 4IUSA 4UA3A 3S6HA 4UFWA 3GYAA 4C7HA 2B5GB 2OU2A 2VXKA 3EC4A 2OZHA 1I21A 3GY9A 4II9A 2I00A 4JJXA 1NMTA 2G3AA 5G20A 4PK2A 3CXQA 5IB0A 2CNSA 4CAVA 1Q2CA 2K5TA 5C82A 4NSQA 2FT0A 4UWIA 5KTAA 5KTCA 2Z3KA 2P6FA 2F5IA 3N7ZA 2O28A 1LRZA 3FIXA 3QAHA 4U9ZA 3W6XA 2FXFA 4R3LA 3W6SA 4MFJA 3ZZIA 1VKCA 3H4QA 2QECA 2IL4A 1PU9A 2KCWA 1IYKA 2Q04A 3CXSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1S7K A;  3UY5 A;  4EVY A;  1QSR A;  4H6Z A;  2P0W A;  2ARH A;  4AG7 A;  1S7F A;  5JQ4 A;  3FYN A;  4KOW A;  2OZU A;  4KLV A;  4F0Y A;  2Q4V A;  3TFY A;  3C26 A;  4FD4 A;  4RI1 A;  4QBJ A;  2PR8 A;  4MHD A;  4B5O A;  2OH1 A;  1QSO A;  4FD7 A;  3MGD A;  1XIX A;  4MJ8 A;  4RS2 A;  4UWJ A;  4MY0 A;  4MY3 A;  4ONU A;  4CAX A;  4KVO E;  5C88 A;  1Q2D A;  3ZJ0 A;  3R9G A;  2I79 A;  1BOB A;  4R87 A;  1YRE A;  5DWM A;  2HUZ A;  4KOS A;  5HMN A;  2PR1 A;  5F46 A;  1KUX A;  4KOY A;  2OZG A;  2PRB A;  3G3S A;  4PV6 A;  4PSX A;  3V8I A;  2Z0Z A;  5EC4 A;  3S6F A;  1S7L A;  4JLY A;  5E96 A;  3GKR A;  2ZW5 A;  3TO7 A;  3P2H A;  3G8W A;  4DNC A;  4JD6 A;  2BL1 A;  1Z9U A;  2QIR A;  2J8R A;  4E2A A;  4JXR A;  4HKF A;  2CNM A;  4NXY A;  1K4J A;  2EVN A;  1YR0 A;  4QVT A;  4K30 A;  3D2P A;  2Q44 A;  5GCN A;  3D2M A;  2BEI A;  4OLL A;  3TCV A;  1KUV A;  2WPW A;  1CM0 A;  4J3G A;  2Y0M A;  1KUY A;  3IWG A;  4JWP A;  4M3S A;  1Z4E A;  2PQ8 A;  3K9U A;  5J8F A;  2CNT A;  3P2F A;  1MJ9 A;  3LOD A;  1FY7 A;  1M1D A;  3OWC A;  3IGR A;  4XPD B;  2D4P A;  2ZXV A;  3TO6 A;  1IYL A;  4MBU A;  4XNH C;  1NSL A;  4L8A A;  1M4G A;  2CY2 A;  1PUA A;  1NE9 A;  3SXN A;  3FBU A;  1YVK A;  2FIW A;  2FIA A;  3I3G A;  4XPK A;  4YFJ A;  2BUE A;  1Y9K A;  1XF8 A;  5ISV A;  5IX3 A;  3TOA A;  1YLE A;  4YRH A;  2H5M A;  2J8M A;  3VWD A;  4NF1 A;  3EXN A;  4H89 A;  4KZT A;  1BO4 A;  1Y7R A;  4Y49 B;  4KVX A;  4CRY B;  2RC4 A;  3PGP A;  2J8N A;  2FL4 A;  4LX9 A;  4XNH B;  4R9M A;  1M4D A;  2R7H A;  2PDO A;  4LUA A;  4NCZ A;  4HNY B;  2AJ6 A;  4QB9 A;  2WPX A;  4KOT A;  1TIQ A;  2R98 A;  2GIV A;  4XPL A;  1XMT A;  2B4D B;  3JUW A;  4AVA A;  3EY5 A;  5KTD A;  3R9F A;  1U6M A;  1QST A;  2GE3 A;  3EFA A;  4GS4 A;  2FSR A;  1IB1 E;  4KOV A;  4R57 A;  2FE7 A;  4PSW A;  2B5G A;  3SXO A;  2PSW A;  1QSN A;  4X5K A;  3PP9 A;  5F47 A;  3S6K A;  3JVN A;  3CXP A;  2EUI A;  4XPD C;  4I49 A;  1XE4 A;  4AB7 A;  1L0C A;  4OAE A;  1YVO A;  5H84 A;  1MJA A;  3T9Y A;  4IF5 A;  4KOX A;  3FXT A;  2P6G A;  2VZY A;  4CAW A;  3LD2 A;  3PZJ A;  5F48 A;  2C27 A;  1B6B A;  1S7N A;  4FD6 A;  3D8P A;  1M44 A;  1YX0 A;  3TOB A;  3DR8 A;  4L89 A;  2Q4Y A;  4BMH A;  2Z11 A;  4U9Y A;  4Y49 C;  4AVB A;  4E8O A;  1YK3 A;  3B8G A;  4OAD A;  1P0H A;  4U5Y A;  2ZPA A;  2HV2 A;  3TTH A;  4UBR A;  1V0C A;  2DXQ A;  3DDD A;  4H6U A;  2B4D A;  2BSW A;  2HQY A;  3I9S A;  1R57 A;  4KUA A;  1M4I A;  3E0K A;  2JEV A;  3F5B A;  3SHP A;  4HNW B;  2FS5 A;  3FNC A;  1IID A;  5HH1 A;  3RYO A;  3TE4 A;  2R1I A;  3R9E A;  1S3Z A;  4MI4 A;  5EBV A;  4KOU A;  1S5K A;  1IIC A;  2REE A;  1VHS A;  4E0A A;  2B4B A;  2FCK A;  1QSM A;  4NEX A;  2VI7 A;  2Q7B A;  4F6A A;  1Q2Y A;  1ON0 A;  2QML A;  3R1K A;  4B5P B;  4KUB A;  2G0B A;  1WK4 A;  3DNS A;  2ZW6 A;  2PC1 A;  2G3T A;  4KLW A;  3KKW A;  5FVJ A;  1RXT A;  4ZBG A;  1I12 A;  5H86 A;  3VWE A;  4CS0 B;  2Q0Y A;  1I1D A;  5CNP A;  1S60 A;  3F0A A;  4ORF A;  5I0C A;  3BJ7 A;  5DWN A;  2NMT A;  4KVM E;  2P6E A;  3R96 A;  3TT2 A;  1MJB A;  2ZW7 A;  1YGH A;  3F8K A;  4R3K A;  4YGO A;  1XEB A;  3TO9 A;  1B87 A;  5F49 A;  2D4O A;  2GAN A;  3EO4 A;  3D3S A;  3FB3 A;  3DSB A;  3W91 A;  1UFH A;  3NE7 A;  3WR7 A;  1Z4R A;  3FRM A;  2OB0 A;  2VEZ A;  4QC6 A;  2B58 A;  3T90 A;  5IV0 A;  1SQH A;  1CJW A;  2VQY A;  3DR6 A;  4QUS A;  4CRZ B;  4FD5 A;  2B3U A;  1J4J A;  4M85 A;  2JDC A;  2REF A;  1P4N A;  2X7B A;  2A4N A;  4PK3 A;  5JPH A;  4AVC A;  4AG9 A;  2B3V A;  3R95 A;  2ZW4 A;  2AE6 A;  2VBQ A;  1RO5 A;  2VZZ A;  1OZP A;  1GHE A;  2JLM A;  2Z10 A;  1KZF A;  4JXQ A;  4KOR A;  1MK4 A;  4B5P A;  3BJ8 A;  3BLN A;  1WWZ A;  2R8V A;  3S6G A;  1N71 A;  2ATR A;  3QB8 A;  1Y9W A;  5J8C A;  4HNX B;  2JDD A;  4IUS A;  4UA3 A;  3S6H A;  3GYA A;  2B5G B;  2OU2 A;  2VXK A;  3EC4 A;  2OZH A;  1I21 A;  3GY9 A;  4II9 A;  2I00 A;  4JJX A;  1NMT A;  2G3A A;  4PK2 A;  3CXQ A;  5IB0 A;  2CNS A;  4CAV A;  1Q2C A;  2K5T A;  5C82 A;  4NSQ A;  2FT0 A;  4UWI A;  5KTA A;  5KTC A;  2P6F A;  2F5I A;  3N7Z A;  2O28 A;  1LRZ A;  3FIX A;  3QAH A;  4U9Z A;  3W6X A;  2FXF A;  4R3L A;  3W6S A;  3ZZI A;  1VKC A;  3H4Q A;  2QEC A;  2IL4 A;  1PU9 A;  2KCW A;  1IYK A;  2Q04 A;  3CXS A; 
#chains in the Genus database with same CATH topology
 1S7K A;  2PVW A;  2O53 A;  1YW6 A;  3UY5 A;  4EVY A;  4ZI6 A;  1QSR A;  2PJ5 A;  2PJ1 A;  4H6Z A;  1Z5R A;  2P0W A;  4Q7A A;  4WWV A;  1LCP A;  2ARH A;  4AG7 A;  3GB0 A;  2EK9 A;  1S7F A;  4OIW A;  5AG7 A;  5JQ4 A;  3FYN A;  4KOW A;  3CDX A;  2OZU A;  2V8H A;  4MCQ A;  4KLV A;  4UCM A;  5LRG A;  4F8Z A;  4BBH A;  2AFZ A;  2Q4V A;  4F0Y A;  1VHE A;  3TFY A;  4DJL A;  2JBJ A;  3C26 A;  3B35 A;  4FD4 A;  4RI1 A;  3MRU A;  4QBJ A;  5K8N A;  3RBU A;  2PR8 A;  4MHD A;  4OID A;  2BO9 A;  3TC8 A;  2ZEG A;  1R3N A;  4B5O A;  2F8H A;  2HB6 A;  2OH1 A;  1QSO A;  4FD7 A;  2PJ7 A;  2XEI A;  4W9Y A;  4R7M A;  3MGD A;  1XIX A;  1DTD A;  4ZY2 A;  1PYT B;  2Q4Z A;  3ISX A;  4A31 A;  3B3S A;  3D7F A;  3ISZ A;  2C6G A;  4MJ8 A;  4CAF A;  5JGF A;  4RS2 A;  1QMU A;  4UWJ A;  2WUU A;  5D29 A;  2VL1 A;  4MY0 A;  2ZED A;  2V8V A;  3B3W A;  4MY3 A;  4ONU A;  4JYW A;  4OC0 A;  4JZ0 A;  4YWY A;  4CAE A;  4P6Y A;  4CAX A;  4KVO E;  5ELY A;  1BLL E;  5C88 A;  1Q2D A;  4B13 A;  3ZJ0 A;  2IQ6 A;  3R9G A;  2I79 A;  4NGQ A;  4R87 A;  1YRE A;  5DWM A;  2PRQ A;  2HUZ A;  4KOS A;  4P4J A;  5HMN A;  2PR1 A;  3SI1 A;  5AG5 A;  4A2Z A;  5F46 A;  4H2K A;  1KUX A;  3PB9 X;  4OME A;  4KOY A;  2OZG A;  1IGB A;  2PRB A;  3G3S A;  4PV6 A;  2EWB A;  2ZEL A;  3A9L A;  3FF3 A;  4OC5 A;  1RTQ A;  4PSX A;  2Z0Z A;  3V8I A;  2EO8 A;  5EC4 A;  3S6F A;  1S7L A;  4F0X A;  4JLY A;  3BI0 A;  5E96 A;  3PB8 X;  3GKR A;  2ZW5 A;  3TO7 A;  3P2H A;  3KI9 A;  4PXC A;  3WT4 A;  5A27 A;  5F09 A;  3G8W A;  4DNC A;  3LMS A;  4F9U A;  4MRI A;  4JD6 A;  3T8W A;  4UEZ A;  4A32 A;  2BL1 A;  5LYF A;  1DE4 C;  5JM6 A;  5K8O A;  2WZN A;  4ZYQ A;  1Z9U A;  2QIR A;  1CX8 A;  3I1U A;  2J8R A;  4MCR A;  4JXR A;  4E2A A;  4HKF A;  2CNM A;  4NXY A;  4C2Z A;  4MMO A;  1K4J A;  2EVN A;  1YR0 A;  4QVT A;  2I3C A;  1X12 A;  4UCN A;  2PJ4 A;  1Y0R A;  2WYR A;  4K30 A;  3D2P A;  2Q44 A;  4UEF A;  5GCN A;  3D2M A;  2BEI A;  4OLL A;  3IC1 A;  3TCV A;  1KUV A;  2WPW A;  4MHY A;  1CM0 A;  4J3G A;  1IOF A;  2Y0M A;  3D67 A;  1KUY A;  1VHO A;  3IWG A;  1F2O A;  4OC2 A;  4JWP A;  4A95 A;  4M3S A;  1LOK A;  1YSJ A;  1NSA A;  3H8F A;  4P10 A;  1Z4E A;  4ZX8 A;  2PQ8 A;  3K9U A;  5J8F A;  4R76 A;  5LYD A;  1A2Z A;  2CNT A;  3P2F A;  4P4E A;  4LQG A;  3GIU A;  1MJ9 A;  3LOD A;  1FY7 A;  1ZG9 A;  5CBM A;  2AFW A;  2C6P A;  3KR4 A;  4F9V A;  1M1D A;  3OWC A;  3IIB A;  1IY7 A;  1ZG8 A;  3IGR A;  3NFZ A;  4A94 A;  5K8P A;  4XPD B;  4CYQ A;  2WSA A;  2D4P A;  1IOI A;  3FEC A;  2ZXV A;  5AG6 A;  3TO6 A;  4OKO A;  3NH8 A;  4Q38 A;  1JWQ A;  1IYL A;  4EME A;  4MBU A;  4NJR A;  4XNH C;  3NE8 A;  1NSL A;  4L8A A;  1M4G A;  2CY2 A;  3PBB A;  1PUA A;  2AFU A;  2NYQ A;  3HLP A;  1CG2 A;  3FEE A;  2GLF A;  2JEW A;  3KAS A;  4CGP A;  5LRK A;  2Q04 A;  1NE9 A;  1XBU A;  3SXN A;  3FBU A;  1YVK A;  1XFO A;  5LYL A;  4Q36 A;  2FIW A;  2GRE A;  4CGM A;  5HVG A;  4UIB A;  2FIA A;  4DUK A;  4ZGY B;  3I3G A;  4OP4 A;  3VH9 A;  4XPK A;  2FVG A;  3SJF A;  4YFJ A;  2ZEO A;  4UIA A;  1XJO A;  1Y9K A;  2BOA A;  1XF8 A;  2J9A A;  3IWW A;  3H8E A;  4FWU A;  4TNU A;  5IX3 A;  5ISV A;  3TOA A;  3FVL A;  4NJQ A;  1YLE A;  4YRH A;  2H5M A;  2J8M A;  2Z3M A;  3VWD A;  1BPN A;  3LWU A;  4NF1 A;  4CGN A;  3EXN A;  4H89 A;  4KZT A;  3BI1 A;  4B12 A;  1BO4 A;  1Y7R A;  4Y49 B;  4IAV A;  4KVX A;  4CRY B;  2RC4 A;  4M6G A;  3PGP A;  2J8N A;  2FL4 A;  3CXS A;  4LX9 A;  2IMO A;  2YNE A;  4XNH B;  4GM5 A;  4R9M A;  1ARL A;  4B11 A;  1M4D A;  2R7H A;  4CYO A;  2YNC C;  2PDO A;  1BAV A;  4A39 A;  2CTB A;  4A38 A;  4LUA A;  4NCZ A;  4HNY B;  3SJX A;  2ZEH A;  2AJ6 A;  4QB9 A;  1LFW A;  2WPX A;  2CXA A;  4KOT A;  5THW A;  1TIQ A;  2R98 A;  2GIV A;  4XPL A;  2JBK A;  1XMT A;  2B4D B;  3JUW A;  4AVA A;  1FT7 A;  3EY5 A;  5KTD A;  1ZLH A;  3KQX A;  3R9F A;  1U6M A;  1QST A;  2GE3 A;  3EFA A;  4GS4 A;  2FSR A;  2EK8 A;  1IB1 E;  2AFS A;  4IK2 A;  1ZLI A;  2PJB A;  3GUX A;  1LAP A;  2CTC A;  4KOV A;  4R57 A;  2FE7 A;  4CPA A;  4PSW A;  2B5G A;  3SXO A;  2V77 A;  2PSW A;  4FUU A;  6CPA A;  5G1Z A;  1QSN A;  4X5K A;  3SI2 A;  4CYN A;  3PP9 A;  3CPX A;  4P4B A;  4ZY1 A;  5F47 A;  3S6K A;  3JVN A;  2BCO A;  2ZOG A;  4A30 A;  3B3T A;  3CXP A;  3S9M A;  2EUI A;  4M6H A;  4XPD C;  4I49 A;  4X8I A;  1XE4 A;  3H5Z A;  4AB7 A;  1L0C A;  4OAE A;  1YVO A;  3BXM A;  4P4I A;  5H84 A;  3S9L A;  3MN8 A;  1MJA A;  1FNO A;  3T9Y A;  5A28 A;  4IF5 A;  4KOX A;  3FXT A;  2P6G A;  2VZY A;  4PQA A;  5HVF A;  3WC5 A;  5CPA A;  3LD2 A;  3PB4 X;  4CAW A;  4MFZ A;  4C7I A;  2ODF A;  3PZJ A;  2PIY A;  4FAI A;  3IWE A;  5F48 A;  3IEH A;  1IU8 A;  2C27 A;  3PEI A;  3KHX A;  3SI0 A;  2PIZ A;  1YQE A;  2GFQ A;  1Y0Y A;  2AFO A;  2Z3P A;  1B6B A;  1PCA A;  1S7N A;  2YND A;  4FD6 A;  2PJA A;  5BWA B;  3KZW A;  3D7D A;  2XEF A;  3D8P A;  2AFM A;  1F57 A;  1M44 A;  1YX0 A;  3TOB A;  4P44 A;  3FH4 A;  3HUV A;  3DR8 A;  4L89 A;  2Q4Y A;  5G21 A;  3NH4 A;  4BMH A;  4EFD A;  2Z11 A;  4U9Y A;  4Y49 C;  4AVB A;  4E8O A;  1YK3 A;  5K8M A;  1AMP A;  3B8G A;  2YGW A;  4UFV A;  2ZEF A;  4OAD A;  3CPA A;  2DF5 A;  1P0H A;  3DGV A;  4P4F A;  4U5Y A;  2ZPA A;  1Z8W A;  2HV2 A;  3TTH A;  4UBR A;  1V0C A;  5D8N A;  2DXQ A;  1LAN A;  4CGO A;  3DDD A;  4H6U A;  4ZY0 A;  1Z8T A;  1Z2L A;  4K3N A;  3IFE A;  4BIN A;  4BD9 A;  2C1C A;  4NGT A;  3WAB A;  2B4D A;  2BSW A;  2HQY A;  3I9S A;  4C2Y A;  1M4L A;  1R57 A;  4C2X A;  2PJ9 A;  2Z3O A;  4OC3 A;  4KUA A;  1M4I A;  3E0K A;  2JEV A;  4NGM A;  3D7H A;  3F5B A;  3FED A;  3N5F A;  4HNW B;  4MXU A;  3SHP A;  4NGS A;  3VAR A;  5J1Q A;  2FS5 A;  3FNC A;  1X10 A;  1IID A;  1XRY A;  3BHX A;  5HH1 A;  5JH9 A;  3RYO A;  3TE4 A;  4RN7 A;  2R1I A;  1KWM A;  3R9E A;  4B14 A;  2Q51 A;  2CIJ A;  1S3Z A;  4MI4 A;  1Z8X A;  2POK A;  1HDU A;  1R43 A;  5EBV A;  4KOU A;  1S5K A;  1Z8L A;  1IIC A;  2OR4 A;  2XEG A;  1UWY A;  2GLJ A;  2REE A;  2XEJ A;  3FJU A;  4CGL A;  1YME A;  2RFH A;  1VHS A;  4E0A A;  5DS0 A;  1CBX A;  8CPA A;  2QVP A;  2B4B A;  2YNC A;  4NFR A;  2FCK A;  1QSM A;  3KR5 A;  4NEX A;  2VI7 A;  3K2K A;  3IO1 A;  2Q7B A;  4F6A A;  1Q2Y A;  1ON0 A;  2QML A;  3NH5 A;  3R1K A;  4KUB A;  4B5P B;  3V38 A;  4MCP A;  4UCP A;  2G0B A;  1WK4 A;  3PBE A;  3DNS A;  3QAY A;  1GYT A;  2ZW6 A;  4TWE A;  2PC1 A;  3RNZ A;  3VAT A;  4AXV A;  1LAM A;  2ZEE A;  2G3T A;  3KHZ A;  5EMI A;  4B10 A;  5LRJ A;  2PJ6 A;  4KLW A;  3KKW A;  5FVJ A;  1RXT A;  2PJ2 A;  2Z3N A;  4ZBG A;  1JQG A;  1I12 A;  3PB6 X;  2G9D A;  4MFL A;  5H86 A;  3VWE A;  3V7Z A;  4CS0 B;  2Q0Y A;  3KQZ A;  1I1D A;  2ANP A;  1S60 A;  3F0A A;  5CNP A;  4KSF A;  3TX8 A;  2RB7 A;  4ORF A;  1XOV A;  5I0C A;  3BJ7 A;  5DWN A;  4PPZ A;  2NMT A;  4M6I A;  4Z65 A;  5HVH A;  3SJE A;  3D66 A;  4KVM E;  5LYI A;  4PXD A;  2P6E A;  3R96 A;  3RO0 A;  3TT2 A;  4PXB A;  3D7G A;  3IU2 A;  3WC6 A;  4ZX9 A;  4MFK A;  2ZOF A;  3KGQ A;  1MJB A;  4NGN A;  2ZW7 A;  1YGH A;  1CPS A;  3CZX A;  3F8K A;  4R3K A;  4MHN A;  4YGO A;  1XEB A;  3B7I A;  3TO9 A;  3WC7 A;  2ABZ A;  1B87 A;  4MFP A;  5F49 A;  4IHM A;  2D4O A;  3SJG A;  2PJC A;  2GAN A;  3IU1 A;  3EO4 A;  4EWT A;  2ZEP A;  3D3S A;  3FB3 A;  1VGY A;  3DSB A;  2V8D A;  2DPT A;  2V8G A;  4NGP A;  4GXH A;  2DEA A;  2NSM A;  3W91 A;  1UFH A;  2OOT A;  5IB9 A;  3NE7 A;  3DLJ A;  3PFO A;  2Z3L A;  1Z4R A;  3FRM A;  4NGR A;  3WR7 A;  1QQ9 A;  2OB0 A;  2VEZ A;  4QC6 A;  2B58 A;  1YW4 A;  2PE3 A;  4OC1 A;  4UFX A;  3T90 A;  4FBE A;  5IV0 A;  1SQH A;  4P4D A;  5I4M A;  1F2P A;  1CJW A;  3JTK A;  1Y7E A;  4X2T A;  2VQY A;  3H8G A;  2C6C A;  2PJ0 A;  1YLO A;  3B3C A;  3DR6 A;  4A33 A;  4MCS A;  4QUS A;  4CRZ B;  4FD5 A;  2B3U A;  1J4J A;  4M85 A;  2JDC A;  2REF A;  2PVV A;  1P4N A;  2X7B A;  5G22 A;  1TF8 A;  2A4N A;  4KSA A;  3PRT A;  4MFQ A;  4PK3 A;  4C68 A;  3B3V A;  2DPS A;  1H8L A;  1Q7L A;  1ZG7 A;  4AVC A;  4CYP A;  2GU2 A;  4DYO A;  5JPH A;  4AG9 A;  2B3V A;  3R95 A;  2ZW4 A;  4KS9 A;  2F7V A;  1ARM A;  2AE6 A;  1CP7 A;  4B6Z A;  2VBQ A;  1RO5 A;  2VZZ A;  1ELL P;  1VIX A;  1OZP A;  2EBJ A;  4OC4 A;  1GHE A;  1TF9 A;  3IJ3 A;  1BPM A;  5AGE A;  3GLJ A;  2JLM A;  2Z10 A;  3FMC A;  1KZF A;  3RAM A;  4R8F A;  5AG4 A;  4JXQ A;  2ZEN A;  4KOR A;  1TXR A;  2Q43 A;  1MK4 A;  2QYV A;  2HC9 A;  4O23 A;  1OBR A;  4B5P A;  3BJ8 A;  3PFE A;  4LQ6 A;  3FX6 A;  4UF4 A;  3BLN A;  4YU9 A;  4HPS A;  3B2Y A;  1WWZ A;  2IJZ A;  2R8V A;  1TKJ A;  1CP6 A;  3S6G A;  1N71 A;  1CPX A;  2ATR A;  3QB8 A;  1Y9W A;  3KL9 A;  4RUH A;  4G1P A;  4HNX B;  1ZO0 A;  5J8C A;  3S9N A;  4UEE A;  2CF4 A;  2JDD A;  2PJ8 A;  3D4U A;  4IUS A;  4ONW A;  4UA3 A;  1TKF A;  3S6H A;  3NA6 A;  4UFW A;  4PXE A;  3GYA A;  4C7H A;  2B5G B;  2OU2 A;  1AYE A;  4A37 A;  2VXK A;  1AUG A;  4MHP A;  3EC4 A;  1XMB A;  1I21 A;  2OZH A;  3GY9 A;  3K9T A;  7CPA A;  4II9 A;  5HXD A;  2I00 A;  4JJX A;  1NMT A;  2Q7S A;  2G3A A;  5G20 A;  1EE3 P;  4PK2 A;  3CXQ A;  5IB0 A;  2CNS A;  2AFX A;  1Q2C A;  4CAV A;  2K5T A;  5C82 A;  4NSQ A;  2FT0 A;  1HDQ A;  4UWI A;  1ELM P;  5KTA A;  5KTC A;  3JRU A;  2Z3K A;  2P6F A;  3RZA A;  2F5I A;  3N7Z A;  2QJ8 A;  2O28 A;  1LRZ A;  3QNV A;  4KSI A;  1TKH A;  1HEE A;  3FIX A;  3QAH A;  4R6T A;  2PCU A;  3LAC A;  2ZEM A;  3CT9 A;  4U9Z A;  2FXF A;  3W6X A;  4R3L A;  3W6S A;  2PJ3 A;  3PB7 X;  4MFJ A;  4WJB A;  3ZZI A;  1VKC A;  4X3R A;  3H4Q A;  2QEC A;  2IL4 A;  2O4H A;  4MHZ A;  1PU9 A;  2KCW A;  3D68 A;  1IYK A;  3L2N A;  4P45 A;  2BUE A;  1BOB A; 
#chains in the Genus database with same CATH homology
 1S7K A;  3UY5 A;  4EVY A;  1QSR A;  4H6Z A;  2P0W A;  2ARH A;  4AG7 A;  1S7F A;  5AG7 A;  5JQ4 A;  3FYN A;  4KOW A;  2OZU A;  4KLV A;  4UCM A;  4BBH A;  4F0Y A;  2Q4V A;  3TFY A;  3C26 A;  4FD4 A;  4RI1 A;  4QBJ A;  2PR8 A;  4MHD A;  4B5O A;  2OH1 A;  1QSO A;  4FD7 A;  3MGD A;  1XIX A;  4A31 A;  4MJ8 A;  4CAF A;  4RS2 A;  4UWJ A;  2WUU A;  4MY0 A;  4CAE A;  4MY3 A;  4ONU A;  4CAX A;  4KVO E;  5C88 A;  1Q2D A;  4B13 A;  3ZJ0 A;  3R9G A;  2I79 A;  1BOB A;  4R87 A;  1YRE A;  5DWM A;  2HUZ A;  4KOS A;  5HMN A;  2PR1 A;  5AG5 A;  4A2Z A;  5F46 A;  1KUX A;  4KOY A;  2OZG A;  2PRB A;  3G3S A;  4PV6 A;  3A9L A;  4PSX A;  3V8I A;  2Z0Z A;  4F0X A;  5EC4 A;  3S6F A;  1S7L A;  4JLY A;  5E96 A;  3GKR A;  2ZW5 A;  3TO7 A;  3P2H A;  5A27 A;  3G8W A;  4DNC A;  4JD6 A;  4A32 A;  2BL1 A;  1Z9U A;  2QIR A;  2J8R A;  4E2A A;  4JXR A;  4HKF A;  2CNM A;  4NXY A;  4C2Z A;  1K4J A;  2EVN A;  1YR0 A;  4QVT A;  4UCN A;  4K30 A;  3D2P A;  2Q44 A;  5GCN A;  3D2M A;  2BEI A;  4OLL A;  3TCV A;  1KUV A;  2WPW A;  1CM0 A;  4J3G A;  2Y0M A;  1KUY A;  3IWG A;  4JWP A;  4A95 A;  4M3S A;  1Z4E A;  2PQ8 A;  3K9U A;  5J8F A;  2CNT A;  3P2F A;  1MJ9 A;  3LOD A;  1FY7 A;  1M1D A;  3OWC A;  3IGR A;  4XPD B;  4CYQ A;  2WSA A;  2D4P A;  2ZXV A;  5AG6 A;  3TO6 A;  4Q38 A;  1IYL A;  4MBU A;  4XNH C;  1NSL A;  4L8A A;  1M4G A;  2CY2 A;  1PUA A;  4CGP A;  1NE9 A;  3SXN A;  3FBU A;  1YVK A;  4Q36 A;  2FIW A;  4CGM A;  2FIA A;  4ZGY B;  3I3G A;  4XPK A;  4YFJ A;  2BUE A;  1Y9K A;  1XF8 A;  5ISV A;  5IX3 A;  3TOA A;  1YLE A;  4YRH A;  2H5M A;  2J8M A;  2Z3M A;  3VWD A;  4NF1 A;  4CGN A;  3EXN A;  4H89 A;  4KZT A;  4B12 A;  1BO4 A;  1Y7R A;  4Y49 B;  4KVX A;  4CRY B;  2RC4 A;  3PGP A;  2J8N A;  2FL4 A;  4LX9 A;  2YNE A;  4XNH B;  4R9M A;  4B11 A;  1M4D A;  2R7H A;  4CYO A;  2YNC C;  2PDO A;  4LUA A;  4NCZ A;  4HNY B;  2AJ6 A;  4QB9 A;  2WPX A;  2CXA A;  4KOT A;  1TIQ A;  2R98 A;  2GIV A;  4XPL A;  1XMT A;  2B4D B;  3JUW A;  4AVA A;  3EY5 A;  5KTD A;  3R9F A;  1U6M A;  1QST A;  2GE3 A;  3EFA A;  4GS4 A;  2FSR A;  1IB1 E;  4KOV A;  4R57 A;  2FE7 A;  4PSW A;  2B5G A;  3SXO A;  2PSW A;  5G1Z A;  1QSN A;  4X5K A;  4CYN A;  3PP9 A;  5F47 A;  3S6K A;  3JVN A;  4A30 A;  3CXP A;  2EUI A;  4XPD C;  4I49 A;  1XE4 A;  3H5Z A;  4AB7 A;  1L0C A;  4OAE A;  1YVO A;  5H84 A;  5A28 A;  1MJA A;  3T9Y A;  4IF5 A;  4KOX A;  3FXT A;  2P6G A;  2VZY A;  4CAW A;  3LD2 A;  4MFZ A;  4C7I A;  3PZJ A;  3IWE A;  5F48 A;  2C27 A;  2Z3P A;  1B6B A;  1S7N A;  2YND A;  4FD6 A;  5BWA B;  3D8P A;  1M44 A;  1YX0 A;  3TOB A;  3DR8 A;  4L89 A;  2Q4Y A;  5G21 A;  4BMH A;  2Z11 A;  4U9Y A;  4Y49 C;  4AVB A;  4E8O A;  1YK3 A;  3B8G A;  2YGW A;  4UFV A;  4OAD A;  1P0H A;  4U5Y A;  2ZPA A;  2HV2 A;  3TTH A;  4UBR A;  1V0C A;  2DXQ A;  4CGO A;  3DDD A;  4H6U A;  2B4D A;  2BSW A;  2HQY A;  3I9S A;  4C2Y A;  4C2X A;  1R57 A;  2Z3O A;  4KUA A;  1M4I A;  3E0K A;  2JEV A;  3F5B A;  3SHP A;  4HNW B;  2FS5 A;  3FNC A;  1IID A;  5HH1 A;  3RYO A;  3TE4 A;  2R1I A;  4B14 A;  3R9E A;  1S3Z A;  4MI4 A;  5EBV A;  4KOU A;  1S5K A;  1IIC A;  4CGL A;  2REE A;  1VHS A;  4E0A A;  2B4B A;  2YNC A;  2FCK A;  1QSM A;  4NEX A;  2VI7 A;  2Q7B A;  4F6A A;  1Q2Y A;  1ON0 A;  2QML A;  3R1K A;  4B5P B;  4KUB A;  4UCP A;  2G0B A;  1WK4 A;  3DNS A;  2ZW6 A;  2PC1 A;  2G3T A;  4B10 A;  4KLW A;  3KKW A;  5FVJ A;  1RXT A;  2Z3N A;  4ZBG A;  1I12 A;  4MFL A;  5H86 A;  3VWE A;  4CS0 B;  2Q0Y A;  1I1D A;  5CNP A;  1S60 A;  3F0A A;  4KSF A;  4ORF A;  5I0C A;  3BJ7 A;  5DWN A;  2NMT A;  4KVM E;  2P6E A;  3R96 A;  3TT2 A;  3IU2 A;  4MFK A;  1MJB A;  2ZW7 A;  1YGH A;  3F8K A;  4R3K A;  4YGO A;  1XEB A;  3TO9 A;  1B87 A;  4MFP A;  5F49 A;  2D4O A;  2GAN A;  3IU1 A;  3EO4 A;  3D3S A;  3FB3 A;  3DSB A;  2DPT A;  3W91 A;  1UFH A;  3NE7 A;  3WR7 A;  2Z3L A;  1Z4R A;  3FRM A;  2OB0 A;  2VEZ A;  4QC6 A;  2B58 A;  4UFX A;  3T90 A;  5IV0 A;  1SQH A;  1CJW A;  3JTK A;  2VQY A;  3DR6 A;  4A33 A;  4QUS A;  4CRZ B;  4FD5 A;  2B3U A;  1J4J A;  4M85 A;  2JDC A;  2REF A;  5G22 A;  1P4N A;  2X7B A;  2A4N A;  4KSA A;  4MFQ A;  4PK3 A;  4C68 A;  2DPS A;  5JPH A;  4AVC A;  4CYP A;  4AG9 A;  2B3V A;  3R95 A;  2ZW4 A;  4KS9 A;  2AE6 A;  2VBQ A;  1RO5 A;  2VZZ A;  1OZP A;  1GHE A;  5AGE A;  5AG4 A;  2JLM A;  2Z10 A;  1KZF A;  4JXQ A;  4KOR A;  1MK4 A;  4B5P A;  3BJ8 A;  3BLN A;  1WWZ A;  2R8V A;  3S6G A;  1N71 A;  2ATR A;  3QB8 A;  1Y9W A;  5J8C A;  4HNX B;  1ZO0 A;  2JDD A;  4IUS A;  4UA3 A;  3S6H A;  4UFW A;  3GYA A;  4C7H A;  2B5G B;  2OU2 A;  2VXK A;  3EC4 A;  2OZH A;  1I21 A;  3GY9 A;  4II9 A;  2I00 A;  4JJX A;  1NMT A;  2G3A A;  5G20 A;  4PK2 A;  3CXQ A;  5IB0 A;  2CNS A;  4CAV A;  1Q2C A;  2K5T A;  5C82 A;  4NSQ A;  2FT0 A;  4UWI A;  5KTA A;  5KTC A;  2Z3K A;  2P6F A;  2F5I A;  3N7Z A;  2O28 A;  1LRZ A;  3FIX A;  3QAH A;  4U9Z A;  3W6X A;  2FXF A;  4R3L A;  3W6S A;  4MFJ A;  3ZZI A;  1VKC A;  3H4Q A;  2QEC A;  2IL4 A;  1PU9 A;  2KCW A;  1IYK A;  2Q04 A;  3CXS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...