1XBUA

Streptomyces griseus aminopeptidase complexed with p-iodo-d-phenylalanine
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
277
structure length
275
Chain Sequence
b'APDIPLANVKAHLTQLSTIAANNGGNRAHGRPGYKASVDYVKAKLDAAGYTTTLQQFTSGGATGYNLIANWPGGDPNKVLMAGAHLDSVSSGAGINDNGSGSAAVLETALAVSRAGYQPDKHLRFAWWGAEELGLIGSKFYVNNLPSADRSKLAGYLNFDMIGSPNPGYFVYDDDPVIEKTFKNYFAGLNVPTEIETEGRSDHAPFKNVGVPVGGLFTGAGYTKSAAQAQKWGGTAGQAFDRCYHSSCDSLSNINDTALDRNSDAAAHAIWTLSS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aminopeptidase
publication title Streptomyces griseus aminopeptidase complexed with p-iodo-D-phenylalanine
rcsb
molecule tags Hydrolase
total genus 111
structure length 275
sequence length 277
ec nomenclature ec 3.4.11.24: Aminopeptidase S.
pdb deposition date 2004-08-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 1xbuA00
2C6GA 2ZEEA 3WC6A 3SI1A 3TC8A 4P4DA 1F2PA 1YSJA 2XEGA 1FNOA 1BAVA 4Z65A 3TX8A 1VIXA 2CIJA 2ZENA 1XFOA 2GLFA 2BOAA 4FAIA 4MHPA 4UIBA 2VL1A 3MN8A 1QQ9A 1KWMA 2CTBA 2CTCA 1ARLA 1LCPA 4UF4A 3L2NA 3FJUA 2GREA 5LYLA 1YW6A 5HXDA 4B6ZA 3LWUA 2EK9A 1XMBA 4YU9A 5DS0A 1Z2LA 3GB0A 2BCOA 3DLJA 3PBEA 1OBRA 4JZ0A 3S9MA 4X8IA 4MRIA 4NGMA 1UWYA 1YMEA 3HUVA 5HVFA 3N5FA 2ZEGA 2ZEHA 4X2TA 3K2KA 1XRYA 4NJRA 1F2OA 5D8NA 3KI9A 4NJQA 1YLOA 2G9DA 3GUXA 3KQXA 3FX6A 1TXRA 1CX8A 5F09A 1PCAA 2F8HA 1LAMA 2ZEFA 4R8FA 1ZLIA 2PJ9A 4P45A 2HB6A 4MHNA 4OC2A 4P4EA 4A39A 4PXBA 3VARA 3D67A 2EWBA 3FF3A 1ZG8A 2BO9A 2PJ7A 2C6PA 3B35A 1CBXA 3IEHA 2Q51A 3B3TA 2ANPA 2O53A 2PE3A 3PRTA 4DJLA 1AMPA 4OC1A 2PIYA 4OIDA 4DYOA 2IMOA 3NH8A 2PRQA 3FEEA 4NGNA 3KL9A 3ISZA 4IK2A 4OC0A 1Y7EA 3KGQA 5K8OA 1BPMA 1XJOA 3WT4A 2IJZA 2IQ6A 3PEIA 3NFZA 4ZI6A 4WWVA 4JYWA 4R7MA 1Y0YA 3D4UA 3H8EA 3PFEA 2ZOGA 5ELYA 5LYFA 3IO1A 3KR5A 2O4HA 3PB8X 5LRGA 2ZOFA 5D29A 3V38A 2XEJA 3IIBA 2AFOA 4H2KA 2WYRA 1Q7LA 4CPAA 3SI2A 1TF9A 4MHYA 4LQGA 1EE3P 3IWWA 5K8MA 4R6TA 2JBKA 4P6YA 1LOKA 5HVGA 3GLJA 1TKJA 4EFDA 3NH4A 3IJ3A 3D7FA 3ISXA 3PB6X 4A37A 2PIZA 5K8NA 2GU2A 4RUHA 2V8VA 1GYTA 3IFEA 4FWUA 1NSAA 5JM6A 3SI0A 4GM5A 4AXVA 1R43A 4ZYQA 3MRUA 3SJFA 1H8LA 3KZWA 2PJ4A 4BD9A 3VH9A 1LFWA 5IB9A 4OC4A 3S9LA 3FECA 1M4LA 4R76A 4PXCA 3CT9A 4A38A 3JRUA 3PB7X 2RB7A 2XEIA 5J1QA 3D7HA 3SJGA 2AFZA 3IC1A 4F9VA 1PYTB 2WZNA 3HLPA 1XBUA 3V7ZA 2PJBA 3D7DA 4NFRA 2C1CA 3T8WA 4MCPA 1ELLP 3QNVA 1BPNA 4PQAA 3H8GA 4PXEA 2DEAA 2J9AA 2V77A 1ZG7A 3BHXA 1Z8LA 3BI1A 4NGSA 5HVHA 4O23A 4W9YA 4ZX9A 3WC7A 4FBEA 2PVWA 5LYIA 4IAVA 3CDXA 1ZG9A 4MCQA 2PJCA 1VHOA 2QYVA 4NGTA 2PCUA 5JGFA 2OR4A 4ZY1A 1CPSA 3FH4A 4A94A 2AFSA 4TWEA 3B3SA 5I4MA 1DE4C 2PJ3A 3CPXA 1ELMP 1TKFA 1BLLE 3RAMA 4Q7AA 2F7VA 3K9TA 2AFXA 4UEFA 1CP7A 3NH5A 2ZEMA 2PJ1A 2C6CA 4KSIA 3PB4X 4P4JA 5LRKA 3I1UA 4X3RA 3WABA 3VATA 2AFWA 2ZEDA 4P44A 3D66A 4P4FA 1IGBA 2Q43A 2JBJA 1Z5RA 2PVVA 4OMEA 2NYQA 1LANA 2NSMA 1QMUA 4MXUA 3H8FA 3BI0A 3RZAA 1AYEA 1CPXA 4F9UA 1CG2A 2PJ0A 4PXDA 3B3VA 4EWTA 4OC3A 2ZEPA 1DTDA 4MHZA 1HEEA 4MCRA 2V8HA 2RFHA 2V8GA 1VHEA 3B2YA 4K3NA 4OIWA 4OKOA 4OC5A 2EK8A 2PJ2A 5THWA 2XEFA 5K8PA 1HDUA 1CP6A 1IY7A 3RBUA 2QJ8A 3SJXA 1RTQA 3WC5A 2AFUA 5LYDA 3NA6A 4ZX8A 4IHMA 4NGQA 2FVGA 3D7GA 1JQGA 4FUUA 4DUKA 3PB9X 4NGPA 2GLJA 8CPAA 4MCSA 4UIAA 5CBMA 2PJ8A 2PJAA 4WJBA 3B3CA 7CPAA 4TNUA 4EMEA 1ARMA 3LMSA 4F8ZA 4MMOA 3KHZA 2AFMA 3KR4A 4P4IA 3FEDA 3PBBA 2PJ6A 3D68A 3SJEA 2ZEOA 2V8DA 2OOTA 1HDQA 2JEWA 4ZY0A 3PFOA 4P10A 4ZY2A 4G1PA 4UEZA 4OP4A 1LAPA 6CPAA 4ONWA 2QVPA 5JH9A 1VGYA 3B7IA 1F57A 3KASA 2HC9A 1TF8A 2POKA 5CPAA 3FVLA 2I3CA 3DGVA 4NGRA 3S9NA 4UEEA 1R3NA 1ZLHA 2CF4A 1TKHA 3B3WA 1YW4A 3KHXA 1Y0RA 3KQZA 3FMCA 1FT7A 3CPAA 5LRJA 4PPZA 4P4BA 3BXMA 2Q4ZA 2ZELA 2PJ5A 4YWYA 2ABZA
chains in the Genus database with same CATH superfamily
2VZYA 2C6GA 4KSAA 2ZEEA 4UFWA 2KCWA 4KSFA 4JD6A 4QUSA 3WC6A 2DPSA 3TO9A 2GFQA 3SI1A 1I1DA 3TC8A 3DNSA 4P4DA 1F2PA 1YSJA 2XEGA 2Z0ZA 1I21A 1FNOA 5HMNA 4CGLA 1BAVA 4Z65A 3TX8A 1SQHA 1VIXA 2CIJA 1YVKA 1IU8A 2ZENA 2EO8A 1XFOA 2K5TA 1KUVA 2BOAA 2GLFA 3C26A 4ORFA 4MHPA 4CGMA 2Z10A 4QC6A 4UIBA 2VL1A 4HPSA 3MN8A 3IU1A 3P2HA 1QQ9A 2R1IA 1KWMA 2CTBA 2PDOA 4LUAA 2CTCA 1MJ9A 1UFHA 1ARLA 2PRBA 2VI7A 2I00A 2JDDA 1LCPA 4UF4A 3L2NA 4CS0B 3FJUA 2GREA 5LYLA 1YW6A 3DR6A 5HXDA 3KKWA 4AVAA 2A4NA 4B6ZA 3LWUA 4IUSA 4MFJA 5AG4A 3TE4A 5J8CA 2EK9A 1XMBA 4YU9A 5DS0A 4AG7A 3VWEA 4UCNA 1Z2LA 3GB0A 2BCOA 2ZW4A 4C2XA 4M3SA 3BJ8A 2Z3LA 3DLJA 1OBRA 1S7LA 1Z8WA 3JTKA 3PBEA 4HNXB 4JZ0A 3S9MA 2B4DB 4KOTA 4X8IA 2FSRA 5G1ZA 4MRIA 4NGMA 1YR0A 1UWYA 1YMEA 2YNEA 3HUVA 4CYPA 3GKRA 5HVFA 1ON0A 3N5FA 2ZEGA 2ZEHA 4X2TA 4B5PB 3G3SA 3K2KA 3W6SA 5EMIA 1Z8TA 2JLMA 1XRYA 2J8RA 4KVME 4NJRA 1MK4A 1F2OA 5D8NA 4XPKA 4UBRA 3KI9A 3S6KA 4NJQA 2Z3NA 4ONUA 3N7ZA 3K9UA 1YLOA 3BLNA 1X10A 1V0CA 2G9DA 3GUXA 4A2ZA 4C2ZA 2OH1A 3KQXA 3FX6A 4FD6A 1TXRA 5AG7A 1CX8A 1Y7RA 3I3GA 4MFZA 4PK3A 2DXQA 2REEA 2PC1A 3IGRA 4I49A 1PCAA 4XPDC 5AG5A 5F09A 2F8HA 3SXOA 1LAMA 2ZEFA 4R8FA 1ZLIA 2PJ9A 3RO0A 4P45A 2HB6A 4MHNA 4KUAA 4B14A 4OC2A 3IWEA 4FD7A 4UCPA 4P4EA 1S3ZA 5AG6A 4A39A 4B10A 3UY5A 3R9EA 4PXBA 3VARA 2GANA 3D67A 3IWGA 3QAYA 2EWBA 1QSNA 2Q4ZA 3FF3A 4F0XA 4RS2A 1ZG8A 2BO9A 2QIRA 2PJ7A 2C6PA 3B35A 1CBXA 3IEHA 4FD5A 4YGOA 2Q51A 4KVOE 1QSTA 3B3TA 1U6MA 3PZJA 1S5KA 3H5ZA 2ANPA 2O53A 2PE3A 3PRTA 4DJLA 3B8GA 3H4QA 4JXRA 1AMPA 2FL4A 4KLWA 3S6FA 2B3VA 4MFLA 4OC1A 2YGWA 2PIYA 4E0AA 4OIDA 2Q04A 1WK4A 3EC4A 4DYOA 3F0AA 2IMOA 3NH8A 4ZGYB 2PRQA 3FEEA 2FE7A 3FXTA 2WPXA 4NGNA 1LRZA 2R7HA 4C2YA 2YNCC 3KL9A 2YNDA 3D2MA 3ISZA 4IK2A 4OC0A 2JDCA 1Y7EA 4YRHA 1KUXA 3ZJ0A 2R8VA 3KGQA 3TOAA 4E8OA 3SHPA 5K8OA 4B5PA 1BPMA 3S6GA 3EXNA 1XJOA 4NCZA 5JPHA 1MJAA 3WT4A 4AVBA 2FIWA 3R1KA 2IJZA 2IQ6A 1S7KA 3PEIA 3NFZA 4ZI6A 4WWVA 4JYWA 4R7MA 4HKFA 2EUIA 1Y0YA 3D4UA 3H8EA 3PFEA 2ZOGA 2NMTA 3I9SA 5ELYA 3W91A 1XEBA 3IO1A 5IX3A 5LYFA 3CXPA 3KR5A 3R95A 2D4OA 2O4HA 3PB8X 2PSWA 3F8KA 5LRGA 2Y0MA 2ZOFA 5D29A 3V38A 2YNCA 1IOIA 2XEJA 3FBUA 3FB3A 3D3SA 3IIBA 3P2FA 1S7FA 2WUUA 2AFOA 4H2KA 2WYRA 2O28A 4HNYB 2P6FA 4X5KA 5G20A 1Q7LA 2P6EA 1NSLA 3DR8A 5G21A 4CPAA 3SI2A 1TF9A 2Q44A 4MHYA 3JVNA 3DDDA 1PU9A 1PUAA 2G0BA 3PGPA 4LQGA 1M4IA 1EE3P 2Q0YA 2Q7SA 3IWWA 4OAEA 5K8MA 4LX9A 1QSRA 4F0YA 4CGPA 4MJ8A 2JBKA 4R6TA 3BJ7A 4P6YA 4B11A 1LOKA 2J8MA 4AB7A 3TO6A 4XNHC 5DWNA 5HVGA 3GLJA 2FIAA 2G3TA 2B58A 1TKJA 4EFDA 3NH4A 4XPDB 1M4DA 3IJ3A 3D7FA 4H6ZA 1Q2CA 3ISXA 3FYNA 4UFVA 3TTHA 3PB6X 5IV0A 2Q7BA 4A37A 4KUBA 4U9ZA 4BINA 4H6UA 4FAIA 2PIZA 4Q38A 1NE9A 3MGDA 4A33A 5K8NA 2GU2A 1YREA 4MY3A 2VZZA 1ZO0A 4RUHA 2ZPAA 2V8VA 3EO4A 4JJXA 1YGHA 5EC4A 1GYTA 3IFEA 4MBUA 5BWAB 4FWUA 1NSAA 5JM6A 1YX0A 5EBVA 3SI0A 4XPLA 2Z3PA 4GM5A 4AXVA 1R43A 4ZYQA 3MRUA 3SJFA 1WWZA 1H8LA 4IF5A 4M85A 4E2AA 1YVOA 3KZWA 2PJ4A 4KLVA 4BD9A 2I79A 1LFWA 3VH9A 5IB9A 4OC4A 3S9LA 3FECA 1M4LA 3R96A 1IB1E 4R76A 1K4JA 3E0KA 4KOYA 4PK2A 4PXCA 3CT9A 1X12A 1FY7A 4L89A 4UCMA 4EVYA 1AUGA 1YLEA 2FCKA 4A38A 3JRUA 2VEZA 2RB7A 1GHEA 2XEIA 3PB7X 5J1QA 3D7HA 3OWCA 3SJGA 3D2PA 2AFZA 4KOVA 1RXTA 3LODA 2ZW5A 2QMLA 1BO4A 3IC1A 4F9VA 1PYTB 4CYQA 1A2ZA 2WZNA 4A30A 2ARHA 1BOBA 3HLPA 2REFA 1XBUA 3V7ZA 1J4JA 2JEVA 2PJBA 3D7DA 4HNWB 3A9LA 4NFRA 4UA3A 2C1CA 2Z3MA 2VBQA 3T8WA 4MCPA 1ELLP 3QNVA 1BPNA 4PQAA 1Q2DA 3H8GA 3R9FA 4PXEA 4UWIA 2DEAA 4OLLA 1Y9KA 4QB9A 2FXFA 2J9AA 2V77A 4MHDA 4CYOA 3T9YA 1ZG7A 3BHXA 1Z8LA 3FRMA 1IYKA 3BI1A 4NGSA 4C7HA 1VKCA 4CAFA 4O23A 1IYLA 2AJ6A 5HVHA 4QVTA 4W9YA 5DWMA 4ZX9A 3WC7A 4FBEA 4J3GA 5CNPA 1XE4A 4CAXA 2PVWA 1Z4EA 2X7BA 2G3AA 4M6IA 2CNSA 4GXHA 4IAVA 5LYIA 3CDXA 3TO7A 4Y49C 4AVCA 4CAEA 4B12A 5KTCA 1KZFA 5C88A 4Q36A 2CXAA 1ZG9A 1M1DA 4CRZB 4MCQA 5C82A 2IL4A 2PJCA 5F46A 1VHSA 2Q4YA 2HV2A 1Z8XA 1XMTA 1VHOA 2QYVA 4NF1A 1Z4RA 4NGTA 4CRYB 2PCUA 5JGFA 2OR4A 3R9GA 4ZY1A 1CPSA 3FH4A 4XNHB 4C68A 4A94A 2AFSA 2Q4VA 4TWEA 4KS9A 2AE6A 3B3SA 2B3UA 5A28A 4KOUA 4U5YA 5A27A 4M6GA 4C7IA 5I4MA 4CAVA 4CGOA 1DE4C 4LQ6A 2PJ3A 2FT0A 2ATRA 1RO5A 3CPXA 1ELMP 4KORA 1TKFA 3QAHA 1BLLE 3RAMA 1XIXA 4KOXA 5I0CA 4Q7AA 5KTAA 2F7VA 2R98A 3K9TA 2AFXA 4UEFA 1CP7A 3NH5A 1I12A 1R57A 2J8NA 4H89A 4BMHA 4CGNA 2ZEMA 2PJ1A 2C6CA 4M6HA 3S6HA 5F48A 1OZPA 1YQEA 4FD4A 2DPTA 3NE7A 4KSIA 3PB4X 4UFXA 3RNZA 4P4JA 3D8PA 5LRKA 3I1UA 4X3RA 4PV6A 3JUWA 4KZTA 5JQ4A 3WABA 2EBJA 2D4PA 2PR8A 4UWJA 4B5OA 5IB0A 1N71A 3CXQA 2AFWA 2P6GA 3VATA 3WR7A 2Z3OA 4PSWA 3EY5A 3F5BA 2WSAA 2F5IA 5F47A 2ZEDA 4KOWA 4OADA 4R57A 4JXQA 1JWQA 3NE8A 4P44A 3D66A 4P4FA 2ZXVA 1IGBA 3LACA 2Q43A 1XOVA 4KVXA 2JBJA 4JWPA 3G8WA 5ISVA 1Z5RA 2PVVA 4OMEA 1KUYA 5E96A 2C27A 2NYQA 3SXNA 2GIVA 1CM0A 2B5GA 3PP9A 1LANA 2NSMA 1QMUA 4MXUA 4F6AA 3H8FA 3BI0A 2BSWA 3LD2A 5FVJA 3RZAA 1AYEA 3RYOA 1P0HA 1IIDA 2FS5A 5H86A 1YK3A 4F9UA 1CG2A 4KOSA 2OU2A 2PJ0A 4PXDA 5HH1A 3B3VA 4EWTA 3GYAA 4OC3A 2Z11A 2ZEPA 5GCNA 5KTDA 1DTDA 4MHZA 1HEEA 2CNTA 1B6BA 3FIXA 2H5MA 4MCRA 4RI1A 2V8HA 2RFHA 2OZGA 1VHEA 2V8GA 1Y9WA 3B2YA 3CXSA 4K3NA 5F49A 4OIWA 1S7NA 4OKOA 4OC5A 2EK8A 4NEXA 2PJ2A 4Y49B 1L0CA 4B13A 5THWA 1QSOA 2XEFA 5K8PA 1HDUA 1CP6A 1IY7A 1B87A 3RBUA 4R87A 2QJ8A 3SJXA 2BEIA 1RTQA 2HQYA 3IU2A 3W6XA 3WC5A 1M4GA 2AFUA 2CNMA 4U9YA 3NA6A 4JLYA 4ZX8A 4IHMA 4NGQA 5LYDA 2FVGA 2RC4A 3D7GA 1QSMA 4A32A 1JQGA 3TOBA 1IOFA 4BBHA 4FUUA 2B4BA 4DUKA 2BL1A 3PB9X 4NXYA 4NGPA 2GLJA 8CPAA 4MCSA 4UIAA 5CBMA 2OB0A 2PJ8A 2PJAA 4WJBA 2DF5A 2ZW6A 3B3CA 3GY9A 7CPAA 4TNUA 4EMEA 1ARMA 3LMSA 4R3LA 4AG9A 4F8ZA 4II9A 4MMOA 1CJWA 1S60A 5AGEA 3KHZA 1Q2YA 2OZUA 2AFMA 1NMTA 4MFKA 4R3KA 3KR4A 4P4IA 2OZHA 2PR1A 4MY0A 2HUZA 2WPWA 3FEDA 3PBBA 4R9MA 2PJ6A 3D68A 4RN7A 3SJEA 3T90A 2ZEOA 3EFAA 4DNCA 4CAWA 4QBJA 3ZZIA 2V8DA 4L8AA 2OOTA 1HDQA 3TCVA 4A31A 1MJBA 2B5GB 2JEWA 5H84A 3PFOA 4P10A 4ZY2A 1M44A 4G1PA 4CYNA 4UEZA 4ZY0A 5G22A 4OP4A 2BUEA 1LAPA 2PQ8A 6CPAA 4ONWA 2CY2A 2QVPA 1Z9UA 3CZXA 5JH9A 1VGYA 3B7IA 5J8FA 3GIUA 2ODFA 1F57A 2VXKA 4NSQA 3KASA 2HC9A 1TF8A 2POKA 1XF8A 5CPAA 4PSXA 2B4DA 2I3CA 3FVLA 3DGVA 4NGRA 4YFJA 1P4NA 4MI4A 2ZW7A 3QB8A 3V8IA 3S9NA 1TIQA 1R3NA 4UEEA 3VWDA 3DSBA 2QECA 1ZLHA 2CF4A 1TKHA 2Z3KA 1YW4A 3B3WA 3KHXA 1Y0RA 2EVNA 2P0WA 1IICA 4K30A 4MFPA 4A95A 3KQZA 3FMCA 1FT7A 3TFYA 2VQYA 3CPAA 4MFQA 5LRJA 2GE3A 4PPZA 3TT2A 4P4BA 3FNCA 4GS4A 4ZBGA 3BXMA 1CPXA 2ZELA 2PJ5A 4YWYA 2ABZA
chains in the Genus database with same CATH topology
2C6GA 2ZEEA 3WC6A 3SI1A 3TC8A 4P4DA 1F2PA 1YSJA 2XEGA 1FNOA 1BAVA 4Z65A 3TX8A 1VIXA 2CIJA 2ZENA 1XFOA 2GLFA 2BOAA 4FAIA 4MHPA 4UIBA 2VL1A 3MN8A 1QQ9A 1KWMA 2CTBA 2CTCA 1ARLA 1LCPA 4UF4A 3L2NA 3FJUA 2GREA 5LYLA 1YW6A 5HXDA 4B6ZA 3LWUA 2EK9A 1XMBA 4YU9A 5DS0A 1Z2LA 3GB0A 2BCOA 3DLJA 3PBEA 1OBRA 4JZ0A 3S9MA 4X8IA 4MRIA 4NGMA 1UWYA 1YMEA 3HUVA 5HVFA 3N5FA 2ZEGA 2ZEHA 4X2TA 3K2KA 1XRYA 4NJRA 1F2OA 5D8NA 3KI9A 4NJQA 1YLOA 2G9DA 3GUXA 3KQXA 3FX6A 1TXRA 1CX8A 5F09A 1PCAA 2F8HA 1LAMA 2ZEFA 4R8FA 1ZLIA 2PJ9A 4P45A 2HB6A 4MHNA 4OC2A 4P4EA 4A39A 4PXBA 3VARA 3D67A 2EWBA 3FF3A 1ZG8A 2BO9A 2PJ7A 2C6PA 3B35A 1CBXA 3IEHA 2Q51A 3B3TA 2ANPA 2O53A 2PE3A 3PRTA 4DJLA 1AMPA 4OC1A 2PIYA 4OIDA 4DYOA 2IMOA 3NH8A 2PRQA 3FEEA 4NGNA 3KL9A 3ISZA 4IK2A 4OC0A 1Y7EA 3KGQA 5K8OA 1BPMA 1XJOA 3WT4A 2IJZA 2IQ6A 3PEIA 3NFZA 4ZI6A 4WWVA 4JYWA 4R7MA 1Y0YA 3D4UA 3H8EA 3PFEA 2ZOGA 5ELYA 5LYFA 3IO1A 3KR5A 2O4HA 3PB8X 5LRGA 2ZOFA 5D29A 3V38A 2XEJA 3IIBA 2AFOA 4H2KA 2WYRA 1Q7LA 4CPAA 3SI2A 1TF9A 4MHYA 4LQGA 1EE3P 3IWWA 5K8MA 4R6TA 2JBKA 4P6YA 1LOKA 5HVGA 3GLJA 1TKJA 4EFDA 3NH4A 3IJ3A 3D7FA 3ISXA 3PB6X 4A37A 2PIZA 5K8NA 2GU2A 4RUHA 2V8VA 1GYTA 3IFEA 4FWUA 1NSAA 5JM6A 3SI0A 4GM5A 4AXVA 1R43A 4ZYQA 3MRUA 3SJFA 1H8LA 3KZWA 2PJ4A 4BD9A 3VH9A 1LFWA 5IB9A 4OC4A 3S9LA 3FECA 1M4LA 4R76A 4PXCA 3CT9A 4A38A 3JRUA 3PB7X 2RB7A 2XEIA 5J1QA 3D7HA 3SJGA 2AFZA 3IC1A 4F9VA 1PYTB 2WZNA 3HLPA 1XBUA 3V7ZA 2PJBA 3D7DA 4NFRA 2C1CA 3T8WA 4MCPA 1ELLP 3QNVA 1BPNA 4PQAA 3H8GA 4PXEA 2DEAA 2J9AA 2V77A 1ZG7A 3BHXA 1Z8LA 3BI1A 4NGSA 5HVHA 4O23A 4W9YA 4ZX9A 3WC7A 4FBEA 2PVWA 5LYIA 4IAVA 3CDXA 1ZG9A 4MCQA 2PJCA 1VHOA 2QYVA 4NGTA 2PCUA 5JGFA 2OR4A 4ZY1A 1CPSA 3FH4A 4A94A 2AFSA 4TWEA 3B3SA 5I4MA 1DE4C 2PJ3A 3CPXA 1ELMP 1TKFA 1BLLE 3RAMA 4Q7AA 2F7VA 3K9TA 2AFXA 4UEFA 1CP7A 3NH5A 2ZEMA 2PJ1A 2C6CA 4KSIA 3PB4X 4P4JA 5LRKA 3I1UA 4X3RA 3WABA 3VATA 2AFWA 2ZEDA 4P44A 3D66A 4P4FA 1IGBA 2Q43A 2JBJA 1Z5RA 2PVVA 4OMEA 2NYQA 1LANA 2NSMA 1QMUA 4MXUA 3H8FA 3BI0A 3RZAA 1AYEA 1CPXA 4F9UA 1CG2A 2PJ0A 4PXDA 3B3VA 4EWTA 4OC3A 2ZEPA 1DTDA 4MHZA 1HEEA 4MCRA 2V8HA 2RFHA 2V8GA 1VHEA 3B2YA 4K3NA 4OIWA 4OKOA 4OC5A 2EK8A 2PJ2A 5THWA 2XEFA 5K8PA 1HDUA 1CP6A 1IY7A 3RBUA 2QJ8A 3SJXA 1RTQA 3WC5A 2AFUA 5LYDA 3NA6A 4ZX8A 4IHMA 4NGQA 2FVGA 3D7GA 1JQGA 4FUUA 4DUKA 3PB9X 4NGPA 2GLJA 8CPAA 4MCSA 4UIAA 5CBMA 2PJ8A 2PJAA 4WJBA 3B3CA 7CPAA 4TNUA 4EMEA 1ARMA 3LMSA 4F8ZA 4MMOA 3KHZA 2AFMA 3KR4A 4P4IA 3FEDA 3PBBA 2PJ6A 3D68A 3SJEA 2ZEOA 2V8DA 2OOTA 1HDQA 2JEWA 4ZY0A 3PFOA 4P10A 4ZY2A 4G1PA 4UEZA 4OP4A 1LAPA 6CPAA 4ONWA 2QVPA 5JH9A 1VGYA 3B7IA 1F57A 3KASA 2HC9A 1TF8A 2POKA 5CPAA 3FVLA 2I3CA 3DGVA 4NGRA 3S9NA 4UEEA 1R3NA 1ZLHA 2CF4A 1TKHA 3B3WA 1YW4A 3KHXA 1Y0RA 3KQZA 3FMCA 1FT7A 3CPAA 5LRJA 4PPZA 4P4BA 3BXMA 2Q4ZA 2ZELA 2PJ5A 4YWYA 2ABZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2C6G A;  2ZEE A;  3WC6 A;  3SI1 A;  3TC8 A;  4P4D A;  1F2P A;  1YSJ A;  2XEG A;  1FNO A;  1BAV A;  4Z65 A;  3TX8 A;  1VIX A;  2CIJ A;  2ZEN A;  1XFO A;  2GLF A;  2BOA A;  4FAI A;  4MHP A;  4UIB A;  2VL1 A;  3MN8 A;  1QQ9 A;  1KWM A;  2CTB A;  2CTC A;  1ARL A;  1LCP A;  4UF4 A;  3L2N A;  3FJU A;  2GRE A;  5LYL A;  1YW6 A;  5HXD A;  4B6Z A;  3LWU A;  2EK9 A;  1XMB A;  4YU9 A;  5DS0 A;  1Z2L A;  3GB0 A;  2BCO A;  3DLJ A;  3PBE A;  1OBR A;  4JZ0 A;  3S9M A;  4X8I A;  4MRI A;  4NGM A;  1UWY A;  1YME A;  3HUV A;  5HVF A;  3N5F A;  2ZEG A;  2ZEH A;  4X2T A;  3K2K A;  1XRY A;  4NJR A;  1F2O A;  5D8N A;  3KI9 A;  4NJQ A;  1YLO A;  2G9D A;  3GUX A;  3KQX A;  3FX6 A;  1TXR A;  1CX8 A;  5F09 A;  1PCA A;  2F8H A;  1LAM A;  2ZEF A;  4R8F A;  1ZLI A;  2PJ9 A;  4P45 A;  2HB6 A;  4MHN A;  4OC2 A;  4P4E A;  4A39 A;  4PXB A;  3VAR A;  3D67 A;  2EWB A;  3FF3 A;  1ZG8 A;  2BO9 A;  2PJ7 A;  2C6P A;  3B35 A;  1CBX A;  3IEH A;  2Q51 A;  3B3T A;  2ANP A;  2O53 A;  2PE3 A;  3PRT A;  4DJL A;  1AMP A;  4OC1 A;  2PIY A;  4OID A;  4DYO A;  2IMO A;  3NH8 A;  2PRQ A;  3FEE A;  4NGN A;  3KL9 A;  3ISZ A;  4IK2 A;  4OC0 A;  1Y7E A;  3KGQ A;  5K8O A;  1BPM A;  1XJO A;  3WT4 A;  2IJZ A;  2IQ6 A;  3PEI A;  3NFZ A;  4ZI6 A;  4WWV A;  4JYW A;  4R7M A;  1Y0Y A;  3D4U A;  3H8E A;  3PFE A;  2ZOG A;  5ELY A;  5LYF A;  3IO1 A;  3KR5 A;  2O4H A;  3PB8 X;  5LRG A;  2ZOF A;  5D29 A;  3V38 A;  2XEJ A;  3IIB A;  2AFO A;  4H2K A;  2WYR A;  1Q7L A;  4CPA A;  3SI2 A;  1TF9 A;  4MHY A;  4LQG A;  1EE3 P;  3IWW A;  5K8M A;  4R6T A;  2JBK A;  4P6Y A;  1LOK A;  5HVG A;  3GLJ A;  1TKJ A;  4EFD A;  3NH4 A;  3IJ3 A;  3D7F A;  3ISX A;  3PB6 X;  4A37 A;  2PIZ A;  5K8N A;  2GU2 A;  4RUH A;  2V8V A;  1GYT A;  3IFE A;  4FWU A;  1NSA A;  5JM6 A;  3SI0 A;  4GM5 A;  4AXV A;  1R43 A;  4ZYQ A;  3MRU A;  3SJF A;  1H8L A;  3KZW A;  2PJ4 A;  4BD9 A;  3VH9 A;  1LFW A;  5IB9 A;  4OC4 A;  3S9L A;  3FEC A;  1M4L A;  4R76 A;  4PXC A;  3CT9 A;  4A38 A;  3JRU A;  3PB7 X;  2RB7 A;  2XEI A;  5J1Q A;  3D7H A;  3SJG A;  2AFZ A;  3IC1 A;  4F9V A;  1PYT B;  2WZN A;  3HLP A;  1XBU A;  3V7Z A;  2PJB A;  3D7D A;  4NFR A;  2C1C A;  3T8W A;  4MCP A;  1ELL P;  3QNV A;  1BPN A;  4PQA A;  3H8G A;  4PXE A;  2DEA A;  2J9A A;  2V77 A;  1ZG7 A;  3BHX A;  1Z8L A;  3BI1 A;  4NGS A;  5HVH A;  4O23 A;  4W9Y A;  4ZX9 A;  3WC7 A;  4FBE A;  2PVW A;  5LYI A;  4IAV A;  3CDX A;  1ZG9 A;  4MCQ A;  2PJC A;  1VHO A;  2QYV A;  4NGT A;  2PCU A;  5JGF A;  2OR4 A;  4ZY1 A;  1CPS A;  3FH4 A;  4A94 A;  2AFS A;  4TWE A;  3B3S A;  5I4M A;  1DE4 C;  2PJ3 A;  3CPX A;  1ELM P;  1TKF A;  1BLL E;  3RAM A;  4Q7A A;  2F7V A;  3K9T A;  2AFX A;  4UEF A;  1CP7 A;  3NH5 A;  2ZEM A;  2PJ1 A;  2C6C A;  4KSI A;  3PB4 X;  4P4J A;  5LRK A;  3I1U A;  4X3R A;  3WAB A;  3VAT A;  2AFW A;  2ZED A;  4P44 A;  3D66 A;  4P4F A;  1IGB A;  2Q43 A;  2JBJ A;  1Z5R A;  2PVV A;  4OME A;  2NYQ A;  1LAN A;  2NSM A;  1QMU A;  4MXU A;  3H8F A;  3BI0 A;  3RZA A;  1AYE A;  1CPX A;  4F9U A;  1CG2 A;  2PJ0 A;  4PXD A;  3B3V A;  4EWT A;  4OC3 A;  2ZEP A;  1DTD A;  4MHZ A;  1HEE A;  4MCR A;  2V8H A;  2RFH A;  2V8G A;  1VHE A;  3B2Y A;  4K3N A;  4OIW A;  4OKO A;  4OC5 A;  2EK8 A;  2PJ2 A;  5THW A;  2XEF A;  5K8P A;  1HDU A;  1CP6 A;  1IY7 A;  3RBU A;  2QJ8 A;  3SJX A;  1RTQ A;  3WC5 A;  2AFU A;  5LYD A;  3NA6 A;  4ZX8 A;  4IHM A;  4NGQ A;  2FVG A;  3D7G A;  1JQG A;  4FUU A;  4DUK A;  3PB9 X;  4NGP A;  2GLJ A;  8CPA A;  4MCS A;  4UIA A;  5CBM A;  2PJ8 A;  2PJA A;  4WJB A;  3B3C A;  7CPA A;  4TNU A;  4EME A;  1ARM A;  3LMS A;  4F8Z A;  4MMO A;  3KHZ A;  2AFM A;  3KR4 A;  4P4I A;  3FED A;  3PBB A;  2PJ6 A;  3D68 A;  3SJE A;  2ZEO A;  2V8D A;  2OOT A;  1HDQ A;  2JEW A;  4ZY0 A;  3PFO A;  4P10 A;  4ZY2 A;  4G1P A;  4UEZ A;  4OP4 A;  1LAP A;  6CPA A;  4ONW A;  2QVP A;  5JH9 A;  1VGY A;  3B7I A;  1F57 A;  3KAS A;  2HC9 A;  1TF8 A;  2POK A;  5CPA A;  3FVL A;  2I3C A;  3DGV A;  4NGR A;  3S9N A;  4UEE A;  1R3N A;  1ZLH A;  2CF4 A;  1TKH A;  3B3W A;  1YW4 A;  3KHX A;  1Y0R A;  3KQZ A;  3FMC A;  1FT7 A;  3CPA A;  5LRJ A;  4PPZ A;  4P4B A;  3BXM A;  2Q4Z A;  2ZEL A;  2PJ5 A;  4YWY A;  2ABZ A; 
#chains in the Genus database with same CATH topology
 2VZY A;  2C6G A;  4KSA A;  2ZEE A;  4UFW A;  2KCW A;  4KSF A;  4JD6 A;  4QUS A;  3WC6 A;  2DPS A;  3TO9 A;  2GFQ A;  3SI1 A;  1I1D A;  3TC8 A;  3DNS A;  4P4D A;  1F2P A;  1YSJ A;  2XEG A;  2Z0Z A;  1I21 A;  1FNO A;  5HMN A;  4CGL A;  1BAV A;  4Z65 A;  3TX8 A;  1SQH A;  1VIX A;  2CIJ A;  1YVK A;  1IU8 A;  2ZEN A;  2EO8 A;  1XFO A;  2K5T A;  1KUV A;  2BOA A;  2GLF A;  3C26 A;  4ORF A;  4MHP A;  4CGM A;  2Z10 A;  4QC6 A;  4UIB A;  2VL1 A;  4HPS A;  3MN8 A;  3IU1 A;  3P2H A;  1QQ9 A;  2R1I A;  1KWM A;  2CTB A;  2PDO A;  4LUA A;  2CTC A;  1MJ9 A;  1UFH A;  1ARL A;  2PRB A;  2VI7 A;  2I00 A;  2JDD A;  1LCP A;  4UF4 A;  3L2N A;  4CS0 B;  3FJU A;  2GRE A;  5LYL A;  1YW6 A;  3DR6 A;  5HXD A;  3KKW A;  4AVA A;  2A4N A;  4B6Z A;  3LWU A;  4IUS A;  4MFJ A;  5AG4 A;  3TE4 A;  5J8C A;  2EK9 A;  1XMB A;  4YU9 A;  5DS0 A;  4AG7 A;  3VWE A;  4UCN A;  1Z2L A;  3GB0 A;  2BCO A;  2ZW4 A;  4C2X A;  4M3S A;  3BJ8 A;  2Z3L A;  3DLJ A;  1OBR A;  1S7L A;  1Z8W A;  3JTK A;  3PBE A;  4HNX B;  4JZ0 A;  3S9M A;  2B4D B;  4KOT A;  4X8I A;  2FSR A;  5G1Z A;  4MRI A;  4NGM A;  1YR0 A;  1UWY A;  1YME A;  2YNE A;  3HUV A;  4CYP A;  3GKR A;  5HVF A;  1ON0 A;  3N5F A;  2ZEG A;  2ZEH A;  4X2T A;  4B5P B;  3G3S A;  3K2K A;  3W6S A;  5EMI A;  1Z8T A;  2JLM A;  1XRY A;  2J8R A;  4KVM E;  4NJR A;  1MK4 A;  1F2O A;  5D8N A;  4XPK A;  4UBR A;  3KI9 A;  3S6K A;  4NJQ A;  2Z3N A;  4ONU A;  3N7Z A;  3K9U A;  1YLO A;  3BLN A;  1X10 A;  1V0C A;  2G9D A;  3GUX A;  4A2Z A;  4C2Z A;  2OH1 A;  3KQX A;  3FX6 A;  4FD6 A;  1TXR A;  5AG7 A;  1CX8 A;  1Y7R A;  3I3G A;  4MFZ A;  4PK3 A;  2DXQ A;  2REE A;  2PC1 A;  3IGR A;  4I49 A;  1PCA A;  4XPD C;  5AG5 A;  5F09 A;  2F8H A;  3SXO A;  1LAM A;  2ZEF A;  4R8F A;  1ZLI A;  2PJ9 A;  3RO0 A;  4P45 A;  2HB6 A;  4MHN A;  4KUA A;  4B14 A;  4OC2 A;  3IWE A;  4FD7 A;  4UCP A;  4P4E A;  1S3Z A;  5AG6 A;  4A39 A;  4B10 A;  3UY5 A;  3R9E A;  4PXB A;  3VAR A;  2GAN A;  3D67 A;  3IWG A;  3QAY A;  2EWB A;  1QSN A;  2Q4Z A;  3FF3 A;  4F0X A;  4RS2 A;  1ZG8 A;  2BO9 A;  2QIR A;  2PJ7 A;  2C6P A;  3B35 A;  1CBX A;  3IEH A;  4FD5 A;  4YGO A;  2Q51 A;  4KVO E;  1QST A;  3B3T A;  1U6M A;  3PZJ A;  1S5K A;  3H5Z A;  2ANP A;  2O53 A;  2PE3 A;  3PRT A;  4DJL A;  3B8G A;  3H4Q A;  4JXR A;  1AMP A;  2FL4 A;  4KLW A;  3S6F A;  2B3V A;  4MFL A;  4OC1 A;  2YGW A;  2PIY A;  4E0A A;  4OID A;  2Q04 A;  1WK4 A;  3EC4 A;  4DYO A;  3F0A A;  2IMO A;  3NH8 A;  4ZGY B;  2PRQ A;  3FEE A;  2FE7 A;  3FXT A;  2WPX A;  4NGN A;  1LRZ A;  2R7H A;  4C2Y A;  2YNC C;  3KL9 A;  2YND A;  3D2M A;  3ISZ A;  4IK2 A;  4OC0 A;  2JDC A;  1Y7E A;  4YRH A;  1KUX A;  3ZJ0 A;  2R8V A;  3KGQ A;  3TOA A;  4E8O A;  3SHP A;  5K8O A;  4B5P A;  1BPM A;  3S6G A;  3EXN A;  1XJO A;  4NCZ A;  5JPH A;  1MJA A;  3WT4 A;  4AVB A;  2FIW A;  3R1K A;  2IJZ A;  2IQ6 A;  1S7K A;  3PEI A;  3NFZ A;  4ZI6 A;  4WWV A;  4JYW A;  4R7M A;  4HKF A;  2EUI A;  1Y0Y A;  3D4U A;  3H8E A;  3PFE A;  2ZOG A;  2NMT A;  3I9S A;  5ELY A;  3W91 A;  1XEB A;  3IO1 A;  5IX3 A;  5LYF A;  3CXP A;  3KR5 A;  3R95 A;  2D4O A;  2O4H A;  3PB8 X;  2PSW A;  3F8K A;  5LRG A;  2Y0M A;  2ZOF A;  5D29 A;  3V38 A;  2YNC A;  1IOI A;  2XEJ A;  3FBU A;  3FB3 A;  3D3S A;  3IIB A;  3P2F A;  1S7F A;  2WUU A;  2AFO A;  4H2K A;  2WYR A;  2O28 A;  4HNY B;  2P6F A;  4X5K A;  5G20 A;  1Q7L A;  2P6E A;  1NSL A;  3DR8 A;  5G21 A;  4CPA A;  3SI2 A;  1TF9 A;  2Q44 A;  4MHY A;  3JVN A;  3DDD A;  1PU9 A;  1PUA A;  2G0B A;  3PGP A;  4LQG A;  1M4I A;  1EE3 P;  2Q0Y A;  2Q7S A;  3IWW A;  4OAE A;  5K8M A;  4LX9 A;  1QSR A;  4F0Y A;  4CGP A;  4MJ8 A;  2JBK A;  4R6T A;  3BJ7 A;  4P6Y A;  4B11 A;  1LOK A;  2J8M A;  4AB7 A;  3TO6 A;  4XNH C;  5DWN A;  5HVG A;  3GLJ A;  2FIA A;  2G3T A;  2B58 A;  1TKJ A;  4EFD A;  3NH4 A;  4XPD B;  1M4D A;  3IJ3 A;  3D7F A;  4H6Z A;  1Q2C A;  3ISX A;  3FYN A;  4UFV A;  3TTH A;  3PB6 X;  5IV0 A;  2Q7B A;  4A37 A;  4KUB A;  4U9Z A;  4BIN A;  4H6U A;  4FAI A;  2PIZ A;  4Q38 A;  1NE9 A;  3MGD A;  4A33 A;  5K8N A;  2GU2 A;  1YRE A;  4MY3 A;  2VZZ A;  1ZO0 A;  4RUH A;  2ZPA A;  2V8V A;  3EO4 A;  4JJX A;  1YGH A;  5EC4 A;  1GYT A;  3IFE A;  4MBU A;  5BWA B;  4FWU A;  1NSA A;  5JM6 A;  1YX0 A;  5EBV A;  3SI0 A;  4XPL A;  2Z3P A;  4GM5 A;  4AXV A;  1R43 A;  4ZYQ A;  3MRU A;  3SJF A;  1WWZ A;  1H8L A;  4IF5 A;  4M85 A;  4E2A A;  1YVO A;  3KZW A;  2PJ4 A;  4KLV A;  4BD9 A;  2I79 A;  1LFW A;  3VH9 A;  5IB9 A;  4OC4 A;  3S9L A;  3FEC A;  1M4L A;  3R96 A;  1IB1 E;  4R76 A;  1K4J A;  3E0K A;  4KOY A;  4PK2 A;  4PXC A;  3CT9 A;  1X12 A;  1FY7 A;  4L89 A;  4UCM A;  4EVY A;  1AUG A;  1YLE A;  2FCK A;  4A38 A;  3JRU A;  2VEZ A;  2RB7 A;  1GHE A;  2XEI A;  3PB7 X;  5J1Q A;  3D7H A;  3OWC A;  3SJG A;  3D2P A;  2AFZ A;  4KOV A;  1RXT A;  3LOD A;  2ZW5 A;  2QML A;  1BO4 A;  3IC1 A;  4F9V A;  1PYT B;  4CYQ A;  1A2Z A;  2WZN A;  4A30 A;  2ARH A;  1BOB A;  3HLP A;  2REF A;  1XBU A;  3V7Z A;  1J4J A;  2JEV A;  2PJB A;  3D7D A;  4HNW B;  3A9L A;  4NFR A;  4UA3 A;  2C1C A;  2Z3M A;  2VBQ A;  3T8W A;  4MCP A;  1ELL P;  3QNV A;  1BPN A;  4PQA A;  1Q2D A;  3H8G A;  3R9F A;  4PXE A;  4UWI A;  2DEA A;  4OLL A;  1Y9K A;  4QB9 A;  2FXF A;  2J9A A;  2V77 A;  4MHD A;  4CYO A;  3T9Y A;  1ZG7 A;  3BHX A;  1Z8L A;  3FRM A;  1IYK A;  3BI1 A;  4NGS A;  4C7H A;  1VKC A;  4CAF A;  4O23 A;  1IYL A;  2AJ6 A;  5HVH A;  4QVT A;  4W9Y A;  5DWM A;  4ZX9 A;  3WC7 A;  4FBE A;  4J3G A;  5CNP A;  1XE4 A;  4CAX A;  2PVW A;  1Z4E A;  2X7B A;  2G3A A;  4M6I A;  2CNS A;  4GXH A;  4IAV A;  5LYI A;  3CDX A;  3TO7 A;  4Y49 C;  4AVC A;  4CAE A;  4B12 A;  5KTC A;  1KZF A;  5C88 A;  4Q36 A;  2CXA A;  1ZG9 A;  1M1D A;  4CRZ B;  4MCQ A;  5C82 A;  2IL4 A;  2PJC A;  5F46 A;  1VHS A;  2Q4Y A;  2HV2 A;  1Z8X A;  1XMT A;  1VHO A;  2QYV A;  4NF1 A;  1Z4R A;  4NGT A;  4CRY B;  2PCU A;  5JGF A;  2OR4 A;  3R9G A;  4ZY1 A;  1CPS A;  3FH4 A;  4XNH B;  4C68 A;  4A94 A;  2AFS A;  2Q4V A;  4TWE A;  4KS9 A;  2AE6 A;  3B3S A;  2B3U A;  5A28 A;  4KOU A;  4U5Y A;  5A27 A;  4M6G A;  4C7I A;  5I4M A;  4CAV A;  4CGO A;  1DE4 C;  4LQ6 A;  2PJ3 A;  2FT0 A;  2ATR A;  1RO5 A;  3CPX A;  1ELM P;  4KOR A;  1TKF A;  3QAH A;  1BLL E;  3RAM A;  1XIX A;  4KOX A;  5I0C A;  4Q7A A;  5KTA A;  2F7V A;  2R98 A;  3K9T A;  2AFX A;  4UEF A;  1CP7 A;  3NH5 A;  1I12 A;  1R57 A;  2J8N A;  4H89 A;  4BMH A;  4CGN A;  2ZEM A;  2PJ1 A;  2C6C A;  4M6H A;  3S6H A;  5F48 A;  1OZP A;  1YQE A;  4FD4 A;  2DPT A;  3NE7 A;  4KSI A;  3PB4 X;  4UFX A;  3RNZ A;  4P4J A;  3D8P A;  5LRK A;  3I1U A;  4X3R A;  4PV6 A;  3JUW A;  4KZT A;  5JQ4 A;  3WAB A;  2EBJ A;  2D4P A;  2PR8 A;  4UWJ A;  4B5O A;  5IB0 A;  1N71 A;  3CXQ A;  2AFW A;  2P6G A;  3VAT A;  3WR7 A;  2Z3O A;  4PSW A;  3EY5 A;  3F5B A;  2WSA A;  2F5I A;  5F47 A;  2ZED A;  4KOW A;  4OAD A;  4R57 A;  4JXQ A;  1JWQ A;  3NE8 A;  4P44 A;  3D66 A;  4P4F A;  2ZXV A;  1IGB A;  3LAC A;  2Q43 A;  1XOV A;  4KVX A;  2JBJ A;  4JWP A;  3G8W A;  5ISV A;  1Z5R A;  2PVV A;  4OME A;  1KUY A;  5E96 A;  2C27 A;  2NYQ A;  3SXN A;  2GIV A;  1CM0 A;  2B5G A;  3PP9 A;  1LAN A;  2NSM A;  1QMU A;  4MXU A;  4F6A A;  3H8F A;  3BI0 A;  2BSW A;  3LD2 A;  5FVJ A;  3RZA A;  1AYE A;  3RYO A;  1P0H A;  1IID A;  2FS5 A;  5H86 A;  1YK3 A;  4F9U A;  1CG2 A;  4KOS A;  2OU2 A;  2PJ0 A;  4PXD A;  5HH1 A;  3B3V A;  4EWT A;  3GYA A;  4OC3 A;  2Z11 A;  2ZEP A;  5GCN A;  5KTD A;  1DTD A;  4MHZ A;  1HEE A;  2CNT A;  1B6B A;  3FIX A;  2H5M A;  4MCR A;  4RI1 A;  2V8H A;  2RFH A;  2OZG A;  1VHE A;  2V8G A;  1Y9W A;  3B2Y A;  3CXS A;  4K3N A;  5F49 A;  4OIW A;  1S7N A;  4OKO A;  4OC5 A;  2EK8 A;  4NEX A;  2PJ2 A;  4Y49 B;  1L0C A;  4B13 A;  5THW A;  1QSO A;  2XEF A;  5K8P A;  1HDU A;  1CP6 A;  1IY7 A;  1B87 A;  3RBU A;  4R87 A;  2QJ8 A;  3SJX A;  2BEI A;  1RTQ A;  2HQY A;  3IU2 A;  3W6X A;  3WC5 A;  1M4G A;  2AFU A;  2CNM A;  4U9Y A;  3NA6 A;  4JLY A;  4ZX8 A;  4IHM A;  4NGQ A;  5LYD A;  2FVG A;  2RC4 A;  3D7G A;  1QSM A;  4A32 A;  1JQG A;  3TOB A;  1IOF A;  4BBH A;  4FUU A;  2B4B A;  4DUK A;  2BL1 A;  3PB9 X;  4NXY A;  4NGP A;  2GLJ A;  8CPA A;  4MCS A;  4UIA A;  5CBM A;  2OB0 A;  2PJ8 A;  2PJA A;  4WJB A;  2DF5 A;  2ZW6 A;  3B3C A;  3GY9 A;  7CPA A;  4TNU A;  4EME A;  1ARM A;  3LMS A;  4R3L A;  4AG9 A;  4F8Z A;  4II9 A;  4MMO A;  1CJW A;  1S60 A;  5AGE A;  3KHZ A;  1Q2Y A;  2OZU A;  2AFM A;  1NMT A;  4MFK A;  4R3K A;  3KR4 A;  4P4I A;  2OZH A;  2PR1 A;  4MY0 A;  2HUZ A;  2WPW A;  3FED A;  3PBB A;  4R9M A;  2PJ6 A;  3D68 A;  4RN7 A;  3SJE A;  3T90 A;  2ZEO A;  3EFA A;  4DNC A;  4CAW A;  4QBJ A;  3ZZI A;  2V8D A;  4L8A A;  2OOT A;  1HDQ A;  3TCV A;  4A31 A;  1MJB A;  2B5G B;  2JEW A;  5H84 A;  3PFO A;  4P10 A;  4ZY2 A;  1M44 A;  4G1P A;  4CYN A;  4UEZ A;  4ZY0 A;  5G22 A;  4OP4 A;  2BUE A;  1LAP A;  2PQ8 A;  6CPA A;  4ONW A;  2CY2 A;  2QVP A;  1Z9U A;  3CZX A;  5JH9 A;  1VGY A;  3B7I A;  5J8F A;  3GIU A;  2ODF A;  1F57 A;  2VXK A;  4NSQ A;  3KAS A;  2HC9 A;  1TF8 A;  2POK A;  1XF8 A;  5CPA A;  4PSX A;  2B4D A;  2I3C A;  3FVL A;  3DGV A;  4NGR A;  4YFJ A;  1P4N A;  4MI4 A;  2ZW7 A;  3QB8 A;  3V8I A;  3S9N A;  1TIQ A;  1R3N A;  4UEE A;  3VWD A;  3DSB A;  2QEC A;  1ZLH A;  2CF4 A;  1TKH A;  2Z3K A;  1YW4 A;  3B3W A;  3KHX A;  1Y0R A;  2EVN A;  2P0W A;  1IIC A;  4K30 A;  4MFP A;  4A95 A;  3KQZ A;  3FMC A;  1FT7 A;  3TFY A;  2VQY A;  3CPA A;  4MFQ A;  5LRJ A;  2GE3 A;  4PPZ A;  3TT2 A;  4P4B A;  3FNC A;  4GS4 A;  4ZBG A;  3BXM A;  1CPX A;  2ZEL A;  2PJ5 A;  4YWY A;  2ABZ A; 
#chains in the Genus database with same CATH homology
 2C6G A;  2ZEE A;  3WC6 A;  3SI1 A;  3TC8 A;  4P4D A;  1F2P A;  1YSJ A;  2XEG A;  1FNO A;  1BAV A;  4Z65 A;  3TX8 A;  1VIX A;  2CIJ A;  2ZEN A;  1XFO A;  2GLF A;  2BOA A;  4FAI A;  4MHP A;  4UIB A;  2VL1 A;  3MN8 A;  1QQ9 A;  1KWM A;  2CTB A;  2CTC A;  1ARL A;  1LCP A;  4UF4 A;  3L2N A;  3FJU A;  2GRE A;  5LYL A;  1YW6 A;  5HXD A;  4B6Z A;  3LWU A;  2EK9 A;  1XMB A;  4YU9 A;  5DS0 A;  1Z2L A;  3GB0 A;  2BCO A;  3DLJ A;  3PBE A;  1OBR A;  4JZ0 A;  3S9M A;  4X8I A;  4MRI A;  4NGM A;  1UWY A;  1YME A;  3HUV A;  5HVF A;  3N5F A;  2ZEG A;  2ZEH A;  4X2T A;  3K2K A;  1XRY A;  4NJR A;  1F2O A;  5D8N A;  3KI9 A;  4NJQ A;  1YLO A;  2G9D A;  3GUX A;  3KQX A;  3FX6 A;  1TXR A;  1CX8 A;  5F09 A;  1PCA A;  2F8H A;  1LAM A;  2ZEF A;  4R8F A;  1ZLI A;  2PJ9 A;  4P45 A;  2HB6 A;  4MHN A;  4OC2 A;  4P4E A;  4A39 A;  4PXB A;  3VAR A;  3D67 A;  2EWB A;  3FF3 A;  1ZG8 A;  2BO9 A;  2PJ7 A;  2C6P A;  3B35 A;  1CBX A;  3IEH A;  2Q51 A;  3B3T A;  2ANP A;  2O53 A;  2PE3 A;  3PRT A;  4DJL A;  1AMP A;  4OC1 A;  2PIY A;  4OID A;  4DYO A;  2IMO A;  3NH8 A;  2PRQ A;  3FEE A;  4NGN A;  3KL9 A;  3ISZ A;  4IK2 A;  4OC0 A;  1Y7E A;  3KGQ A;  5K8O A;  1BPM A;  1XJO A;  3WT4 A;  2IJZ A;  2IQ6 A;  3PEI A;  3NFZ A;  4ZI6 A;  4WWV A;  4JYW A;  4R7M A;  1Y0Y A;  3D4U A;  3H8E A;  3PFE A;  2ZOG A;  5ELY A;  5LYF A;  3IO1 A;  3KR5 A;  2O4H A;  3PB8 X;  5LRG A;  2ZOF A;  5D29 A;  3V38 A;  2XEJ A;  3IIB A;  2AFO A;  4H2K A;  2WYR A;  1Q7L A;  4CPA A;  3SI2 A;  1TF9 A;  4MHY A;  4LQG A;  1EE3 P;  3IWW A;  5K8M A;  4R6T A;  2JBK A;  4P6Y A;  1LOK A;  5HVG A;  3GLJ A;  1TKJ A;  4EFD A;  3NH4 A;  3IJ3 A;  3D7F A;  3ISX A;  3PB6 X;  4A37 A;  2PIZ A;  5K8N A;  2GU2 A;  4RUH A;  2V8V A;  1GYT A;  3IFE A;  4FWU A;  1NSA A;  5JM6 A;  3SI0 A;  4GM5 A;  4AXV A;  1R43 A;  4ZYQ A;  3MRU A;  3SJF A;  1H8L A;  3KZW A;  2PJ4 A;  4BD9 A;  3VH9 A;  1LFW A;  5IB9 A;  4OC4 A;  3S9L A;  3FEC A;  1M4L A;  4R76 A;  4PXC A;  3CT9 A;  4A38 A;  3JRU A;  3PB7 X;  2RB7 A;  2XEI A;  5J1Q A;  3D7H A;  3SJG A;  2AFZ A;  3IC1 A;  4F9V A;  1PYT B;  2WZN A;  3HLP A;  1XBU A;  3V7Z A;  2PJB A;  3D7D A;  4NFR A;  2C1C A;  3T8W A;  4MCP A;  1ELL P;  3QNV A;  1BPN A;  4PQA A;  3H8G A;  4PXE A;  2DEA A;  2J9A A;  2V77 A;  1ZG7 A;  3BHX A;  1Z8L A;  3BI1 A;  4NGS A;  5HVH A;  4O23 A;  4W9Y A;  4ZX9 A;  3WC7 A;  4FBE A;  2PVW A;  5LYI A;  4IAV A;  3CDX A;  1ZG9 A;  4MCQ A;  2PJC A;  1VHO A;  2QYV A;  4NGT A;  2PCU A;  5JGF A;  2OR4 A;  4ZY1 A;  1CPS A;  3FH4 A;  4A94 A;  2AFS A;  4TWE A;  3B3S A;  5I4M A;  1DE4 C;  2PJ3 A;  3CPX A;  1ELM P;  1TKF A;  1BLL E;  3RAM A;  4Q7A A;  2F7V A;  3K9T A;  2AFX A;  4UEF A;  1CP7 A;  3NH5 A;  2ZEM A;  2PJ1 A;  2C6C A;  4KSI A;  3PB4 X;  4P4J A;  5LRK A;  3I1U A;  4X3R A;  3WAB A;  3VAT A;  2AFW A;  2ZED A;  4P44 A;  3D66 A;  4P4F A;  1IGB A;  2Q43 A;  2JBJ A;  1Z5R A;  2PVV A;  4OME A;  2NYQ A;  1LAN A;  2NSM A;  1QMU A;  4MXU A;  3H8F A;  3BI0 A;  3RZA A;  1AYE A;  1CPX A;  4F9U A;  1CG2 A;  2PJ0 A;  4PXD A;  3B3V A;  4EWT A;  4OC3 A;  2ZEP A;  1DTD A;  4MHZ A;  1HEE A;  4MCR A;  2V8H A;  2RFH A;  2V8G A;  1VHE A;  3B2Y A;  4K3N A;  4OIW A;  4OKO A;  4OC5 A;  2EK8 A;  2PJ2 A;  5THW A;  2XEF A;  5K8P A;  1HDU A;  1CP6 A;  1IY7 A;  3RBU A;  2QJ8 A;  3SJX A;  1RTQ A;  3WC5 A;  2AFU A;  5LYD A;  3NA6 A;  4ZX8 A;  4IHM A;  4NGQ A;  2FVG A;  3D7G A;  1JQG A;  4FUU A;  4DUK A;  3PB9 X;  4NGP A;  2GLJ A;  8CPA A;  4MCS A;  4UIA A;  5CBM A;  2PJ8 A;  2PJA A;  4WJB A;  3B3C A;  7CPA A;  4TNU A;  4EME A;  1ARM A;  3LMS A;  4F8Z A;  4MMO A;  3KHZ A;  2AFM A;  3KR4 A;  4P4I A;  3FED A;  3PBB A;  2PJ6 A;  3D68 A;  3SJE A;  2ZEO A;  2V8D A;  2OOT A;  1HDQ A;  2JEW A;  4ZY0 A;  3PFO A;  4P10 A;  4ZY2 A;  4G1P A;  4UEZ A;  4OP4 A;  1LAP A;  6CPA A;  4ONW A;  2QVP A;  5JH9 A;  1VGY A;  3B7I A;  1F57 A;  3KAS A;  2HC9 A;  1TF8 A;  2POK A;  5CPA A;  3FVL A;  2I3C A;  3DGV A;  4NGR A;  3S9N A;  4UEE A;  1R3N A;  1ZLH A;  2CF4 A;  1TKH A;  3B3W A;  1YW4 A;  3KHX A;  1Y0R A;  3KQZ A;  3FMC A;  1FT7 A;  3CPA A;  5LRJ A;  4PPZ A;  4P4B A;  3BXM A;  2Q4Z A;  2ZEL A;  2PJ5 A;  4YWY A;  2ABZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...