1XBUA

Streptomyces griseus aminopeptidase complexed with p-iodo-d-phenylalanine
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
277
structure length
275
Chain Sequence
APDIPLANVKAHLTQLSTIAANNGGNRAHGRPGYKASVDYVKAKLDAAGYTTTLQQFTSGGATGYNLIANWPGGDPNKVLMAGAHLDSVSSGAGINDNGSGSAAVLETALAVSRAGYQPDKHLRFAWWGAEELGLIGSKFYVNNLPSADRSKLAGYLNFDMIGSPNPGYFVYDDDPVIEKTFKNYFAGLNVPTEIETEGRSDHAPFKNVGVPVGGLFTGAGYTKSAAQAQKWGGTAGQAFDRCYHSSCDSLSNINDTALDRNSDAAAHAIWTLSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aminopeptidase
publication title Streptomyces griseus aminopeptidase complexed with p-iodo-D-phenylalanine
rcsb
molecule tags Hydrolase
total genus 111
structure length 275
sequence length 277
ec nomenclature ec 3.4.11.24: Aminopeptidase S.
pdb deposition date 2004-08-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 1xbuA00
2C6CA 4JYWA 3KHXA 4B6ZA 1ZG9A 2PVWA 1LCPA 2BO9A 2PJ0A 4NGPA 1XFOA 4NGTA 4X3RA 4MXUA 2DEAA 2F7VA 4EMEA 2XEFA 3PB8X 3B3WA 8CPAA 4UEFA 1YSJA 1DTDA 3T8WA 2RB7A 4ZI6A 3B2YA 4Q7AA 1CP7A 4MHPA 1BLLE 3IIBA 1QQ9A 5I4MA 4OC0A 2AFZA 4W9YA 7CPAA 3V7ZA 2WZNA 3D68A 3D7HA 4UIAA 3D66A 2CF4A 4R76A 2RFHA 2GLJA 2G9DA 1Y0YA 3FX6A 1F57A 4NFRA 2IMOA 3H8FA 3KHZA 3K9TA 1QMUA 4IK2A 2JEWA 2ZEMA 2GLFA 4DYOA 2AFSA 1AMPA 1F2PA 4OP4A 1ZG7A 1YW4A 2AFMA 4WWVA 3KR4A 4H2KA 1CBXA 4TNUA 4A94A 3FF3A 5D8NA 2EK9A 3GLJA 2CIJA 3HUVA 3KASA 3H8GA 2ZEGA 1CPXA 1CP6A 4F8ZA 3SJGA 1HDUA 4A38A 1XBUA 1H8LA 4JZ0A 1YW6A 2NYQA 3BI0A 4NGQA 2V8VA 3FEEA 3KL9A 2ZENA 2AFUA 3PB4X 3PB7X 4R8FA 3H8EA 1UWYA 4O23A 2C1CA 3LMSA 2PJ2A 4P6YA 3I1UA 4MCPA 4P44A 2HB6A 4WJBA 1YMEA 3SJEA 3SI0A 3D67A 2XEGA 1Z2LA 2IJZA 4OC3A 1LFWA 2C6GA 3GB0A 4MHNA 1IGBA 3CT9A 2EK8A 2QJ8A 3TX8A 1ZLHA 1Z5RA 3IC1A 4FAIA 4A39A 5LRKA 4FWUA 5LRGA 4FUUA 2GREA 1XRYA 3PFEA 3N5FA 2PIYA 2JBKA 3IJ3A 4P4JA 4AXVA 2VL1A 4RUHA 1R43A 3D7DA 4IHMA 1BPNA 4ZY1A 5J1QA 4ZY0A 5K8NA 4FBEA 3NH4A 3ISXA 4UEZA 6CPAA 3FH4A 2ABZA 3TC8A 2Q51A 1XMBA 3KQXA 5LYLA 3LWUA 2ZEFA 1LAPA 5HVFA 4NGNA 1AYEA 3WT4A 2ANPA 2XEJA 2POKA 1R3NA 2PJ1A 1M4LA 2EWBA 3FVLA 5LRJA 3B7IA 3WABA 5ELYA 5THWA 2Q43A 4UIBA 4KSIA 1ELMP 2O53A 1BPMA 3PB9X 4P4IA 3WC7A 3NH8A 3RAMA 4MMOA 2QVPA 3KI9A 4GM5A 5LYFA 2BOAA 5HVHA 3NFZA 2JBJA 3HLPA 2AFXA 4P45A 4Z65A 2OR4A 3D7GA 2PRQA 3PB6X 3S9MA 2ZEEA 1NSAA 3FMCA 3GUXA 2AFWA 2ZEPA 1LOKA 1OBRA 4IAVA 1DE4C 3B3TA 2PIZA 2ZEDA 2AFOA 1VHOA 2PJAA 2PJBA 1JQGA 2V77A 1TXRA 1CX8A 4OC4A 2C6PA 4MHZA 1VIXA 3IWWA 5JH9A 1ARMA 1ZG8A 4NGRA 3SJFA 5K8OA 2BCOA 1Z8LA 3S9NA 2V8HA 5CBMA 2Q4ZA 1EE3P 2O4HA 4UEEA 4MRIA 2PJ5A 1IY7A 3VATA 2PE3A 4X2TA 3PBEA 2I3CA 4PXDA 1TKHA 2V8GA 5D29A 3FEDA 1CPSA 4G1PA 5LYDA 4OKOA 4PQAA 3ISZA 3V38A 3KR5A 1TF9A 3MRUA 1YLOA 2XEIA 3MN8A 5DS0A 3JRUA 2V8DA 4MCSA 2PJ3A 4TWEA 3CPAA 1Y0RA 2J9AA 5K8MA 2PJ7A 4R7MA 4PXBA 3BHXA 2FVGA 2QYVA 5CPAA 3SI1A 2WYRA 4P10A 1HDQA 5HXDA 1CG2A 4NGSA 1RTQA 1ZLIA 3QNVA 4ZX9A 2PJ4A 3VH9A 2ZOFA 3PEIA 2ZOGA 4F9VA 3IFEA 3L2NA 1VHEA 4DJLA 5IB9A 2ZEOA 3IO1A 2IQ6A 5JGFA 1PCAA 1BAVA 2PJCA 2ZELA 1TKFA 4BD9A 5F09A 4YU9A 4EFDA 4LQGA 3PFOA 4PPZA 3CPXA 3D7FA 3S9LA 4MHYA 3NH5A 4P4BA 4DUKA 1F2OA 1Q7LA 3PBBA 5JM6A 4NJRA 1PYTB 2PVVA 3RZAA 2ZEHA 3IEHA 4UF4A 4YWYA 3BXMA 3PRTA 1LANA 4MCRA 3RBUA 4NGMA 1TKJA 3DLJA 3BI1A 4P4DA 1VGYA 3CDXA 1FT7A 1TF8A 4PXCA 3NA6A 4NJQA 3SI2A 3K2KA 1FNOA 4ZX8A 3DGVA 3D4UA 1LAMA 2HC9A 3SJXA 2CTBA 3FECA 5LYIA 4ONWA 1Y7EA 2CTCA 2NSMA 4OC5A 4P4FA 3KGQA 4OMEA 3WC5A 3B35A 4OIWA 2OOTA 4X8IA 3WC6A 2PJ8A 1KWMA 4ZY2A 5HVGA 1XJOA 2PJ6A 4A37A 1ARLA 4OC2A 4F9UA 3FJUA 4EWTA 4CPAA 2GU2A 2F8HA 5K8PA 3B3VA 3KQZA 1GYTA 3B3SA 4R6TA 1ELLP 4OIDA 4PXEA 4OC1A 1HEEA 2PJ9A 3KZWA 2PCUA 4P4EA 3VARA 4K3NA 4MCQA 3B3CA 4ZYQA
chains in the Genus database with same CATH superfamily
4KOTA 2C6CA 4MFPA 4JYWA 3LODA 3KHXA 4ZGYB 4B6ZA 1ZG9A 2Z10A 1I1DA 2PVWA 4UWJA 1IU8A 1LCPA 2BO9A 2PJ0A 4NGPA 3D8PA 4AVAA 1XFOA 3KKWA 2I00A 4NGTA 4X3RA 5G22A 1FY7A 4MXUA 2DEAA 2F7VA 4A95A 3BJ8A 4EMEA 2XEFA 1XEBA 2J8MA 3PB8X 5H84A 4CYNA 1XMTA 4QBJA 3H4QA 2WPWA 3B3WA 1R57A 3P2FA 4NEXA 5C82A 1QSOA 2ZPAA 1P4NA 2F5IA 8CPAA 4X5KA 1IYKA 4MY3A 3S6KA 2FXFA 4UEFA 1YSJA 4YGOA 1DTDA 3FXTA 2RB7A 3T8WA 2Z3NA 4ZI6A 3B2YA 4H6ZA 4Q7AA 2P0WA 1YLEA 1CP7A 1CJWA 2Q0YA 2GE3A 3RO0A 4CAFA 4MHPA 1L0CA 2IL4A 2OZUA 4CYOA 3V8IA 2B5GA 4B5PA 1BLLE 3IIBA 3FBUA 4MHDA 1B87A 1QQ9A 2ZW6A 2Q4VA 2VI7A 2Z3OA 4OC0A 5F48A 5I4MA 3F8KA 2AFZA 4XPDB 4W9YA 7CPAA 4H6UA 1M4GA 3FNCA 3V7ZA 2ZW7A 5EMIA 4PK3A 2WZNA 4KOUA 3D68A 3D7HA 4ONUA 4UIAA 2Q4YA 3D66A 5AG7A 3R95A 2CF4A 2FIWA 4R76A 4A30A 4XNHB 2RFHA 2GLJA 4U5YA 2G9DA 1Y0YA 3FX6A 2J8NA 1F57A 1IIDA 3F5BA 4NFRA 3IU1A 4MFLA 4OLLA 2IMOA 3H8FA 4JXQA 1YK3A 3KHZA 3K9TA 1QMUA 4IK2A 5EC4A 1CM0A 3W6XA 1NSLA 2JEWA 4EVYA 2ZEMA 2GLFA 3R1KA 1MK4A 1U6MA 4DYOA 2AFSA 1LRZA 1AMPA 1F2PA 1BO4A 4OP4A 1ZG7A 3TO9A 1YW4A 2BUEA 5KTDA 2AFMA 2Q7SA 4R3KA 1J4JA 4JD6A 4WWVA 3KR4A 4CGNA 1Q2DA 4H2KA 1YVOA 1CBXA 4M6GA 3EO4A 4TNUA 4KOWA 2CNSA 3NE7A 4A94A 1IYLA 2R8VA 3FF3A 5D8NA 2EK9A 2D4PA 3GLJA 2CIJA 3HUVA 3QAYA 2QECA 3KASA 1VHSA 3H8GA 1Z8TA 2ZEGA 1CPXA 1CP6A 1S7NA 2PSWA 2EVNA 3SJGA 4CAEA 4F8ZA 1HDUA 4A38A 4KLVA 4L89A 1XBUA 4MFQA 3ZZIA 3W6SA 1H8LA 4JZ0A 4C2XA 4MI4A 1YW6A 2O28A 2RC4A 2B5GB 4B5PB 4Y49C 2A4NA 5I0CA 3VWEA 2Z3PA 2ARHA 2NYQA 3BI0A 1OZPA 4J3GA 2CNMA 2EO8A 4LUAA 4NGQA 3ZJ0A 2V8VA 3JVNA 2VXKA 3P2HA 2WUUA 3JUWA 3FEEA 3KL9A 1Z8WA 2ZENA 4JLYA 2FS5A 3D3SA 2AFUA 3PB4X 4H89A 2B4DA 2R1IA 1YREA 5HMNA 3PB7X 4R8FA 3H8EA 2BL1A 3SHPA 3F0AA 1UWYA 2Z11A 4O23A 2C1CA 3LMSA 2PJ2A 4P6YA 2Z3MA 1KUVA 3S6GA 3BLNA 3I1UA 4MCPA 4P44A 2B4BA 2BSWA 3FIXA 3EY5A 2HB6A 4WJBA 1YMEA 3SJEA 3K9UA 5AG6A 4UFWA 4K30A 3SI0A 3D67A 2XEGA 1Z2LA 4NSQA 4FD6A 4II9A 4IF5A 2IJZA 4OC3A 3OWCA 2FCKA 1LFWA 5CNPA 2C6GA 3DNSA 4FD4A 3GB0A 4MHNA 4XPKA 4B14A 4PSXA 1IGBA 3CT9A 2HQYA 2EK8A 2JDCA 2PC1A 2QJ8A 3TX8A 4KOXA 4MFZA 3LD2A 1ZLHA 2D4OA 1Z5RA 4KSFA 3IC1A 3RNZA 4FAIA 4A39A 3TTHA 4F0YA 4KSAA 5IV0A 1SQHA 5LRKA 4FWUA 4QUSA 5LRGA 3D2PA 4FUUA 3T9YA 3TOBA 1PUAA 2GREA 3N7ZA 2YNDA 4AVCA 4AG7A 2AE6A 4CGPA 5KTCA 2I79A 1QSTA 1XRYA 3N5FA 3PFEA 2PIYA 2JBKA 3TT2A 4AB7A 3IJ3A 2BEIA 2Q44A 3DR8A 4P4JA 3G3SA 4A33A 3GIUA 3QB8A 2VL1A 4AXVA 2PQ8A 3TOAA 4RUHA 1R43A 3DR6A 2GFQA 4KVXA 3D7DA 4IHMA 1BPNA 4ZY1A 5J1QA 4ZY0A 4IUSA 4FBEA 3NH4A 5K8NA 1RO5A 3ISXA 4UEZA 2FT0A 2K5TA 3WR7A 1XOVA 6CPAA 3FH4A 2ABZA 4CRZB 4F6AA 3TC8A 2Q51A 1XMBA 1IOFA 3KQXA 3BJ7A 4KUAA 5LYLA 3LWUA 4U9ZA 1XF8A 5G21A 2ZEFA 1LAPA 1XE4A 2B4DB 5HVFA 4NGNA 1AYEA 3A9LA 5JPHA 4B5OA 3WT4A 2ANPA 5J8FA 2XEJA 2POKA 2Z0ZA 3EXNA 1R3NA 4AG9A 2PJ1A 5IX3A 4B11A 3PZJA 1M4LA 4DNCA 5GCNA 2EWBA 3FVLA 5LRJA 3B7IA 4B12A 2P6EA 3WABA 4CAWA 5ELYA 5THWA 2Q43A 2YNCA 4UIBA 2PRBA 4A31A 3GY9A 1S3ZA 4KSIA 5AGEA 5KTAA 4RI1A 1ELMP 2O53A 1BPMA 4HKFA 3PB9X 4LQ6A 1YR0A 2CXAA 4P4IA 3WC7A 1S7LA 2H5MA 3NH8A 1TIQA 3RAMA 4MMOA 2QVPA 3KI9A 4NXYA 4GM5A 5LYFA 2B3UA 2DF5A 2BOAA 2B3VA 1M4IA 3EC4A 5HVHA 2CY2A 3I3GA 2PDOA 1YVKA 3CXQA 3NFZA 1M1DA 3FRMA 4XNHC 2ATRA 2JBJA 1B6BA 4XPLA 3HLPA 4RS2A 2AFXA 4P45A 3TO7A 4Z65A 2OR4A 4UA3A 3D7GA 2PRQA 3PB6X 3S9MA 2ZEEA 1NSAA 2Q7BA 3FMCA 4CRYB 3VWDA 3GUXA 1WK4A 2AFWA 4MFJA 4A32A 3W91A 1I21A 2ZEPA 1IB1E 1LOKA 1OBRA 4IAVA 2VEZA 5ISVA 1DE4C 4UCMA 3B3TA 3S6FA 2PIZA 4MY0A 2GANA 1S5KA 3SXOA 2ZEDA 5F47A 2QMLA 2AFOA 1VHOA 2PJAA 1P0HA 4I49A 2PJBA 1JQGA 2V77A 4AVBA 1TXRA 1CX8A 3LACA 4B13A 2QIRA 2X7BA 2G3AA 1S7FA 1AUGA 4CGOA 4OC4A 4KVOE 3C26A 2C6PA 4MHZA 4BBHA 2OZHA 1VIXA 3IWWA 5G20A 4QVTA 1ARMA 5JH9A 1ZG8A 2FSRA 4GS4A 4NGRA 2JLMA 3S6HA 3SJFA 1XIXA 5K8OA 3FB3A 2BCOA 1Z8LA 3S9NA 2V8HA 5CBMA 4KVME 2Q4ZA 1ON0A 4BMHA 1EE3P 2O4HA 4UEEA 4OAEA 3TE4A 5J8CA 1KUXA 1M4DA 4MRIA 2JEVA 2PJ5A 1IY7A 4FD7A 3VATA 2PE3A 5EBVA 4X2TA 3PBEA 2I3CA 4L8AA 4PXDA 1TKHA 2V8GA 4LX9A 2OU2A 5D29A 3QAHA 3FEDA 1CPSA 3RYOA 4G1PA 4KLWA 5LYDA 3R96A 1Q2YA 2HV2A 4OKOA 2G3TA 4PQAA 3ISZA 3V38A 4CYQA 4QC6A 2YNEA 3KR5A 4UFVA 4BINA 1TF9A 3CXSA 4HNXB 2G0BA 3T90A 3MRUA 5HH1A 2KCWA 5E96A 1YLOA 2XEIA 2FL4A 4R3LA 3MN8A 1QSMA 5DS0A 4E8OA 1X12A 2FE7A 1PU9A 3JRUA 3PP9A 2DPTA 2V8DA 4MCSA 2PJ3A 4CS0B 1S60A 3PGPA 4TWEA 3CPAA 1Y9KA 1Y0RA 2J9AA 2ODFA 1GHEA 2J8RA 3D2MA 4UWIA 5AG4A 1K4JA 3R9EA 5K8MA 4UCNA 2PJ7A 4R7MA 4PXBA 3BHXA 2FVGA 4F0XA 4ZBGA 4JXRA 5DWMA 2QYVA 3R9GA 2YGWA 5CPAA 3SI1A 1Z4EA 4CAVA 2WYRA 3NE8A 4MBUA 2VQYA 1KZFA 4P10A 1HDQA 4HPSA 1CG2A 1YQEA 4NGSA 1RTQA 5HXDA 1ZLIA 3QNVA 2REEA 4ZX9A 2PJ4A 4JWPA 3VH9A 2WPXA 4C68A 4R87A 2ZOFA 2FIAA 3PEIA 1BOBA 5JQ4A 2ZOGA 3MGDA 3IFEA 2R98A 2OH1A 3L2NA 1VHEA 4KS9A 4C2ZA 4CAXA 4DJLA 5IB9A 4C7IA 4UBRA 2ZEOA 4PSWA 1N71A 4E2AA 3UY5A 3IO1A 4KOSA 2IQ6A 3IWEA 5JGFA 1NMTA 3IWGA 4JJXA 1YX0A 1V0CA 5A28A 1PCAA 3CXPA 2C27A 2ZW4A 4M3SA 1BAVA 1MJBA 2PJCA 1TKFA 2ZELA 3CZXA 4BD9A 2CNTA 1Z9UA 4C7HA 5F09A 4YU9A 4RN7A 5FVJA 4KUBA 4EFDA 2NMTA 4HNWB 5IB0A 2VZZA 4CYPA 4LQGA 3PFOA 1QSNA 4PPZA 2P6GA 3CPXA 4E0AA 3D7FA 1WWZA 3H5ZA 3S9LA 4NF1A 4MJ8A 1Z4RA 4MHYA 3NH5A 4P4BA 4XPDC 5H86A 4M85A 1RXTA 4DUKA 5G1ZA 1YGHA 2PR1A 4YRHA 2HUZA 1Y7RA 4KOVA 3TO6A 4M6HA 1F2OA 1Q7LA 4PK2A 3I9SA 3IGRA 3JTKA 3PBBA 1QSRA 5JM6A 5A27A 4NJRA 1PYTB 2PVVA 3RZAA 3GYAA 2ZXVA 3FYNA 4MCQA 2Z3LA 1A2ZA 3B8GA 2ZEHA 1UFHA 1S7KA 4PV6A 3IEHA 2VBQA 4UF4A 1MJ9A 4GXHA 4UCPA 5F49A 4KORA 4YWYA 3BXMA 3PRTA 2OZGA 1LANA 2DPSA 4Y49B 2B58A 3GKRA 4MCRA 2Z3KA 3RBUA 4NGMA 5AG5A 1TKJA 3DLJA 1Z8XA 3BI1A 4P4DA 1VGYA 2EUIA 3CDXA 1FT7A 2EBJA 1TF8A 1M44A 5F46A 2R7HA 3TFYA 4YFJA 3EFAA 2Q04A 4ORFA 3NA6A 4PXCA 4NJQA 3SI2A 3K2KA 4HNYB 1FNOA 1NE9A 3DGVA 4OADA 4UFXA 4ZX8A 4MFKA 3D4UA 1LAMA 2HC9A 3SJXA 4QB9A 1X10A 2CTBA 3DSBA 1I12A 1ZO0A 3FECA 5LYIA 3SXNA 4KOYA 1Y7EA 2CTCA 2NSMA 4ONWA 4OC5A 4P4FA 2DXQA 3KGQA 4Q36A 5C88A 2PR8A 2Y0MA 4OMEA 4CGMA 3E0KA 1IICA 4F9VA 3WC5A 4C2YA 1Y9WA 4R9MA 4R57A 4M6IA 3B35A 4OIWA 1JWQA 4FD5A 2OOTA 4X8IA 3R9FA 3WC6A 4NCZA 3IU2A 2PJ8A 1KWMA 3TCVA 4ZY2A 5HVGA 1XJOA 2PJ6A 4Q38A 1MJAA 4A37A 5BWAB 1ARLA 2VZYA 1KUYA 2JDDA 4OC2A 2OB0A 3FJUA 4KZTA 4A2ZA 4B10A 4EWTA 4CPAA 4F9UA 2GU2A 2F8HA 2GIVA 3G8WA 5K8PA 1Q2CA 5DWNA 2AJ6A 2REFA 3B3VA 1GYTA 3KQZA 1VKCA 3B3SA 3DDDA 4R6TA 1ELLP 2WSAA 4OIDA 2ZW5A 4PXEA 4OC1A 1HEEA 2PJ9A 4CGLA 2YNCC 3KZWA 2PCUA 4P4EA 3VARA 4K3NA 2P6FA 3B3CA 4ZYQA 4U9YA 1IOIA
chains in the Genus database with same CATH topology
2C6CA 4JYWA 3KHXA 4B6ZA 1ZG9A 2PVWA 1LCPA 2BO9A 2PJ0A 4NGPA 1XFOA 4NGTA 4X3RA 4MXUA 2DEAA 2F7VA 4EMEA 2XEFA 3PB8X 3B3WA 8CPAA 4UEFA 1YSJA 1DTDA 3T8WA 2RB7A 4ZI6A 3B2YA 4Q7AA 1CP7A 4MHPA 1BLLE 3IIBA 1QQ9A 5I4MA 4OC0A 2AFZA 4W9YA 7CPAA 3V7ZA 2WZNA 3D68A 3D7HA 4UIAA 3D66A 2CF4A 4R76A 2RFHA 2GLJA 2G9DA 1Y0YA 3FX6A 1F57A 4NFRA 2IMOA 3H8FA 3KHZA 3K9TA 1QMUA 4IK2A 2JEWA 2ZEMA 2GLFA 4DYOA 2AFSA 1AMPA 1F2PA 4OP4A 1ZG7A 1YW4A 2AFMA 4WWVA 3KR4A 4H2KA 1CBXA 4TNUA 4A94A 3FF3A 5D8NA 2EK9A 3GLJA 2CIJA 3HUVA 3KASA 3H8GA 2ZEGA 1CPXA 1CP6A 4F8ZA 3SJGA 1HDUA 4A38A 1XBUA 1H8LA 4JZ0A 1YW6A 2NYQA 3BI0A 4NGQA 2V8VA 3FEEA 3KL9A 2ZENA 2AFUA 3PB4X 3PB7X 4R8FA 3H8EA 1UWYA 4O23A 2C1CA 3LMSA 2PJ2A 4P6YA 3I1UA 4MCPA 4P44A 2HB6A 4WJBA 1YMEA 3SJEA 3SI0A 3D67A 2XEGA 1Z2LA 2IJZA 4OC3A 1LFWA 2C6GA 3GB0A 4MHNA 1IGBA 3CT9A 2EK8A 2QJ8A 3TX8A 1ZLHA 1Z5RA 3IC1A 4FAIA 4A39A 5LRKA 4FWUA 5LRGA 4FUUA 2GREA 1XRYA 3PFEA 3N5FA 2PIYA 2JBKA 3IJ3A 4P4JA 4AXVA 2VL1A 4RUHA 1R43A 3D7DA 4IHMA 1BPNA 4ZY1A 5J1QA 4ZY0A 5K8NA 4FBEA 3NH4A 3ISXA 4UEZA 6CPAA 3FH4A 2ABZA 3TC8A 2Q51A 1XMBA 3KQXA 5LYLA 3LWUA 2ZEFA 1LAPA 5HVFA 4NGNA 1AYEA 3WT4A 2ANPA 2XEJA 2POKA 1R3NA 2PJ1A 1M4LA 2EWBA 3FVLA 5LRJA 3B7IA 3WABA 5ELYA 5THWA 2Q43A 4UIBA 4KSIA 1ELMP 2O53A 1BPMA 3PB9X 4P4IA 3WC7A 3NH8A 3RAMA 4MMOA 2QVPA 3KI9A 4GM5A 5LYFA 2BOAA 5HVHA 3NFZA 2JBJA 3HLPA 2AFXA 4P45A 4Z65A 2OR4A 3D7GA 2PRQA 3PB6X 3S9MA 2ZEEA 1NSAA 3FMCA 3GUXA 2AFWA 2ZEPA 1LOKA 1OBRA 4IAVA 1DE4C 3B3TA 2PIZA 2ZEDA 2AFOA 1VHOA 2PJAA 2PJBA 1JQGA 2V77A 1TXRA 1CX8A 4OC4A 2C6PA 4MHZA 1VIXA 3IWWA 5JH9A 1ARMA 1ZG8A 4NGRA 3SJFA 5K8OA 2BCOA 1Z8LA 3S9NA 2V8HA 5CBMA 2Q4ZA 1EE3P 2O4HA 4UEEA 4MRIA 2PJ5A 1IY7A 3VATA 2PE3A 4X2TA 3PBEA 2I3CA 4PXDA 1TKHA 2V8GA 5D29A 3FEDA 1CPSA 4G1PA 5LYDA 4OKOA 4PQAA 3ISZA 3V38A 3KR5A 1TF9A 3MRUA 1YLOA 2XEIA 3MN8A 5DS0A 3JRUA 2V8DA 4MCSA 2PJ3A 4TWEA 3CPAA 1Y0RA 2J9AA 5K8MA 2PJ7A 4R7MA 4PXBA 3BHXA 2FVGA 2QYVA 5CPAA 3SI1A 2WYRA 4P10A 1HDQA 5HXDA 1CG2A 4NGSA 1RTQA 1ZLIA 3QNVA 4ZX9A 2PJ4A 3VH9A 2ZOFA 3PEIA 2ZOGA 4F9VA 3IFEA 3L2NA 1VHEA 4DJLA 5IB9A 2ZEOA 3IO1A 2IQ6A 5JGFA 1PCAA 1BAVA 2PJCA 2ZELA 1TKFA 4BD9A 5F09A 4YU9A 4EFDA 4LQGA 3PFOA 4PPZA 3CPXA 3D7FA 3S9LA 4MHYA 3NH5A 4P4BA 4DUKA 1F2OA 1Q7LA 3PBBA 5JM6A 4NJRA 1PYTB 2PVVA 3RZAA 2ZEHA 3IEHA 4UF4A 4YWYA 3BXMA 3PRTA 1LANA 4MCRA 3RBUA 4NGMA 1TKJA 3DLJA 3BI1A 4P4DA 1VGYA 3CDXA 1FT7A 1TF8A 4PXCA 3NA6A 4NJQA 3SI2A 3K2KA 1FNOA 4ZX8A 3DGVA 3D4UA 1LAMA 2HC9A 3SJXA 2CTBA 3FECA 5LYIA 4ONWA 1Y7EA 2CTCA 2NSMA 4OC5A 4P4FA 3KGQA 4OMEA 3WC5A 3B35A 4OIWA 2OOTA 4X8IA 3WC6A 2PJ8A 1KWMA 4ZY2A 5HVGA 1XJOA 2PJ6A 4A37A 1ARLA 4OC2A 4F9UA 3FJUA 4EWTA 4CPAA 2GU2A 2F8HA 5K8PA 3B3VA 3KQZA 1GYTA 3B3SA 4R6TA 1ELLP 4OIDA 4PXEA 4OC1A 1HEEA 2PJ9A 3KZWA 2PCUA 4P4EA 3VARA 4K3NA 4MCQA 3B3CA 4ZYQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2C6C A;  4JYW A;  3KHX A;  4B6Z A;  1ZG9 A;  2PVW A;  1LCP A;  2BO9 A;  2PJ0 A;  4NGP A;  1XFO A;  4NGT A;  4X3R A;  4MXU A;  2DEA A;  2F7V A;  4EME A;  2XEF A;  3PB8 X;  3B3W A;  8CPA A;  4UEF A;  1YSJ A;  1DTD A;  3T8W A;  2RB7 A;  4ZI6 A;  3B2Y A;  4Q7A A;  1CP7 A;  4MHP A;  1BLL E;  3IIB A;  1QQ9 A;  5I4M A;  4OC0 A;  2AFZ A;  4W9Y A;  7CPA A;  3V7Z A;  2WZN A;  3D68 A;  3D7H A;  4UIA A;  3D66 A;  2CF4 A;  4R76 A;  2RFH A;  2GLJ A;  2G9D A;  1Y0Y A;  3FX6 A;  1F57 A;  4NFR A;  2IMO A;  3H8F A;  3KHZ A;  3K9T A;  1QMU A;  4IK2 A;  2JEW A;  2ZEM A;  2GLF A;  4DYO A;  2AFS A;  1AMP A;  1F2P A;  4OP4 A;  1ZG7 A;  1YW4 A;  2AFM A;  4WWV A;  3KR4 A;  4H2K A;  1CBX A;  4TNU A;  4A94 A;  3FF3 A;  5D8N A;  2EK9 A;  3GLJ A;  2CIJ A;  3HUV A;  3KAS A;  3H8G A;  2ZEG A;  1CPX A;  1CP6 A;  4F8Z A;  3SJG A;  1HDU A;  4A38 A;  1XBU A;  1H8L A;  4JZ0 A;  1YW6 A;  2NYQ A;  3BI0 A;  4NGQ A;  2V8V A;  3FEE A;  3KL9 A;  2ZEN A;  2AFU A;  3PB4 X;  3PB7 X;  4R8F A;  3H8E A;  1UWY A;  4O23 A;  2C1C A;  3LMS A;  2PJ2 A;  4P6Y A;  3I1U A;  4MCP A;  4P44 A;  2HB6 A;  4WJB A;  1YME A;  3SJE A;  3SI0 A;  3D67 A;  2XEG A;  1Z2L A;  2IJZ A;  4OC3 A;  1LFW A;  2C6G A;  3GB0 A;  4MHN A;  1IGB A;  3CT9 A;  2EK8 A;  2QJ8 A;  3TX8 A;  1ZLH A;  1Z5R A;  3IC1 A;  4FAI A;  4A39 A;  5LRK A;  4FWU A;  5LRG A;  4FUU A;  2GRE A;  1XRY A;  3PFE A;  3N5F A;  2PIY A;  2JBK A;  3IJ3 A;  4P4J A;  4AXV A;  2VL1 A;  4RUH A;  1R43 A;  3D7D A;  4IHM A;  1BPN A;  4ZY1 A;  5J1Q A;  4ZY0 A;  5K8N A;  4FBE A;  3NH4 A;  3ISX A;  4UEZ A;  6CPA A;  3FH4 A;  2ABZ A;  3TC8 A;  2Q51 A;  1XMB A;  3KQX A;  5LYL A;  3LWU A;  2ZEF A;  1LAP A;  5HVF A;  4NGN A;  1AYE A;  3WT4 A;  2ANP A;  2XEJ A;  2POK A;  1R3N A;  2PJ1 A;  1M4L A;  2EWB A;  3FVL A;  5LRJ A;  3B7I A;  3WAB A;  5ELY A;  5THW A;  2Q43 A;  4UIB A;  4KSI A;  1ELM P;  2O53 A;  1BPM A;  3PB9 X;  4P4I A;  3WC7 A;  3NH8 A;  3RAM A;  4MMO A;  2QVP A;  3KI9 A;  4GM5 A;  5LYF A;  2BOA A;  5HVH A;  3NFZ A;  2JBJ A;  3HLP A;  2AFX A;  4P45 A;  4Z65 A;  2OR4 A;  3D7G A;  2PRQ A;  3PB6 X;  3S9M A;  2ZEE A;  1NSA A;  3FMC A;  3GUX A;  2AFW A;  2ZEP A;  1LOK A;  1OBR A;  4IAV A;  1DE4 C;  3B3T A;  2PIZ A;  2ZED A;  2AFO A;  1VHO A;  2PJA A;  2PJB A;  1JQG A;  2V77 A;  1TXR A;  1CX8 A;  4OC4 A;  2C6P A;  4MHZ A;  1VIX A;  3IWW A;  5JH9 A;  1ARM A;  1ZG8 A;  4NGR A;  3SJF A;  5K8O A;  2BCO A;  1Z8L A;  3S9N A;  2V8H A;  5CBM A;  2Q4Z A;  1EE3 P;  2O4H A;  4UEE A;  4MRI A;  2PJ5 A;  1IY7 A;  3VAT A;  2PE3 A;  4X2T A;  3PBE A;  2I3C A;  4PXD A;  1TKH A;  2V8G A;  5D29 A;  3FED A;  1CPS A;  4G1P A;  5LYD A;  4OKO A;  4PQA A;  3ISZ A;  3V38 A;  3KR5 A;  1TF9 A;  3MRU A;  1YLO A;  2XEI A;  3MN8 A;  5DS0 A;  3JRU A;  2V8D A;  4MCS A;  2PJ3 A;  4TWE A;  3CPA A;  1Y0R A;  2J9A A;  5K8M A;  2PJ7 A;  4R7M A;  4PXB A;  3BHX A;  2FVG A;  2QYV A;  5CPA A;  3SI1 A;  2WYR A;  4P10 A;  1HDQ A;  5HXD A;  1CG2 A;  4NGS A;  1RTQ A;  1ZLI A;  3QNV A;  4ZX9 A;  2PJ4 A;  3VH9 A;  2ZOF A;  3PEI A;  2ZOG A;  4F9V A;  3IFE A;  3L2N A;  1VHE A;  4DJL A;  5IB9 A;  2ZEO A;  3IO1 A;  2IQ6 A;  5JGF A;  1PCA A;  1BAV A;  2PJC A;  2ZEL A;  1TKF A;  4BD9 A;  5F09 A;  4YU9 A;  4EFD A;  4LQG A;  3PFO A;  4PPZ A;  3CPX A;  3D7F A;  3S9L A;  4MHY A;  3NH5 A;  4P4B A;  4DUK A;  1F2O A;  1Q7L A;  3PBB A;  5JM6 A;  4NJR A;  1PYT B;  2PVV A;  3RZA A;  2ZEH A;  3IEH A;  4UF4 A;  4YWY A;  3BXM A;  3PRT A;  1LAN A;  4MCR A;  3RBU A;  4NGM A;  1TKJ A;  3DLJ A;  3BI1 A;  4P4D A;  1VGY A;  3CDX A;  1FT7 A;  1TF8 A;  4PXC A;  3NA6 A;  4NJQ A;  3SI2 A;  3K2K A;  1FNO A;  4ZX8 A;  3DGV A;  3D4U A;  1LAM A;  2HC9 A;  3SJX A;  2CTB A;  3FEC A;  5LYI A;  4ONW A;  1Y7E A;  2CTC A;  2NSM A;  4OC5 A;  4P4F A;  3KGQ A;  4OME A;  3WC5 A;  3B35 A;  4OIW A;  2OOT A;  4X8I A;  3WC6 A;  2PJ8 A;  1KWM A;  4ZY2 A;  5HVG A;  1XJO A;  2PJ6 A;  4A37 A;  1ARL A;  4OC2 A;  4F9U A;  3FJU A;  4EWT A;  4CPA A;  2GU2 A;  2F8H A;  5K8P A;  3B3V A;  3KQZ A;  1GYT A;  3B3S A;  4R6T A;  1ELL P;  4OID A;  4PXE A;  4OC1 A;  1HEE A;  2PJ9 A;  3KZW A;  2PCU A;  4P4E A;  3VAR A;  4K3N A;  4MCQ A;  3B3C A;  4ZYQ A; 
#chains in the Genus database with same CATH topology
 4KOT A;  2C6C A;  4MFP A;  4JYW A;  3LOD A;  3KHX A;  4ZGY B;  4B6Z A;  1ZG9 A;  2Z10 A;  1I1D A;  2PVW A;  4UWJ A;  1IU8 A;  1LCP A;  2BO9 A;  2PJ0 A;  4NGP A;  3D8P A;  4AVA A;  1XFO A;  3KKW A;  2I00 A;  4NGT A;  4X3R A;  5G22 A;  1FY7 A;  4MXU A;  2DEA A;  2F7V A;  4A95 A;  3BJ8 A;  4EME A;  2XEF A;  1XEB A;  2J8M A;  3PB8 X;  5H84 A;  4CYN A;  1XMT A;  4QBJ A;  3H4Q A;  2WPW A;  3B3W A;  1R57 A;  3P2F A;  4NEX A;  5C82 A;  1QSO A;  2ZPA A;  1P4N A;  2F5I A;  8CPA A;  4X5K A;  1IYK A;  4MY3 A;  3S6K A;  2FXF A;  4UEF A;  1YSJ A;  4YGO A;  1DTD A;  3FXT A;  2RB7 A;  3T8W A;  2Z3N A;  4ZI6 A;  3B2Y A;  4H6Z A;  4Q7A A;  2P0W A;  1YLE A;  1CP7 A;  1CJW A;  2Q0Y A;  2GE3 A;  3RO0 A;  4CAF A;  4MHP A;  1L0C A;  2IL4 A;  2OZU A;  4CYO A;  3V8I A;  2B5G A;  4B5P A;  1BLL E;  3IIB A;  3FBU A;  4MHD A;  1B87 A;  1QQ9 A;  2ZW6 A;  2Q4V A;  2VI7 A;  2Z3O A;  4OC0 A;  5F48 A;  5I4M A;  3F8K A;  2AFZ A;  4XPD B;  4W9Y A;  7CPA A;  4H6U A;  1M4G A;  3FNC A;  3V7Z A;  2ZW7 A;  5EMI A;  4PK3 A;  2WZN A;  4KOU A;  3D68 A;  3D7H A;  4ONU A;  4UIA A;  2Q4Y A;  3D66 A;  5AG7 A;  3R95 A;  2CF4 A;  2FIW A;  4R76 A;  4A30 A;  4XNH B;  2RFH A;  2GLJ A;  4U5Y A;  2G9D A;  1Y0Y A;  3FX6 A;  2J8N A;  1F57 A;  1IID A;  3F5B A;  4NFR A;  3IU1 A;  4MFL A;  4OLL A;  2IMO A;  3H8F A;  4JXQ A;  1YK3 A;  3KHZ A;  3K9T A;  1QMU A;  4IK2 A;  5EC4 A;  1CM0 A;  3W6X A;  1NSL A;  2JEW A;  4EVY A;  2ZEM A;  2GLF A;  3R1K A;  1MK4 A;  1U6M A;  4DYO A;  2AFS A;  1LRZ A;  1AMP A;  1F2P A;  1BO4 A;  4OP4 A;  1ZG7 A;  3TO9 A;  1YW4 A;  2BUE A;  5KTD A;  2AFM A;  2Q7S A;  4R3K A;  1J4J A;  4JD6 A;  4WWV A;  3KR4 A;  4CGN A;  1Q2D A;  4H2K A;  1YVO A;  1CBX A;  4M6G A;  3EO4 A;  4TNU A;  4KOW A;  2CNS A;  3NE7 A;  4A94 A;  1IYL A;  2R8V A;  3FF3 A;  5D8N A;  2EK9 A;  2D4P A;  3GLJ A;  2CIJ A;  3HUV A;  3QAY A;  2QEC A;  3KAS A;  1VHS A;  3H8G A;  1Z8T A;  2ZEG A;  1CPX A;  1CP6 A;  1S7N A;  2PSW A;  2EVN A;  3SJG A;  4CAE A;  4F8Z A;  1HDU A;  4A38 A;  4KLV A;  4L89 A;  1XBU A;  4MFQ A;  3ZZI A;  3W6S A;  1H8L A;  4JZ0 A;  4C2X A;  4MI4 A;  1YW6 A;  2O28 A;  2RC4 A;  2B5G B;  4B5P B;  4Y49 C;  2A4N A;  5I0C A;  3VWE A;  2Z3P A;  2ARH A;  2NYQ A;  3BI0 A;  1OZP A;  4J3G A;  2CNM A;  2EO8 A;  4LUA A;  4NGQ A;  3ZJ0 A;  2V8V A;  3JVN A;  2VXK A;  3P2H A;  2WUU A;  3JUW A;  3FEE A;  3KL9 A;  1Z8W A;  2ZEN A;  4JLY A;  2FS5 A;  3D3S A;  2AFU A;  3PB4 X;  4H89 A;  2B4D A;  2R1I A;  1YRE A;  5HMN A;  3PB7 X;  4R8F A;  3H8E A;  2BL1 A;  3SHP A;  3F0A A;  1UWY A;  2Z11 A;  4O23 A;  2C1C A;  3LMS A;  2PJ2 A;  4P6Y A;  2Z3M A;  1KUV A;  3S6G A;  3BLN A;  3I1U A;  4MCP A;  4P44 A;  2B4B A;  2BSW A;  3FIX A;  3EY5 A;  2HB6 A;  4WJB A;  1YME A;  3SJE A;  3K9U A;  5AG6 A;  4UFW A;  4K30 A;  3SI0 A;  3D67 A;  2XEG A;  1Z2L A;  4NSQ A;  4FD6 A;  4II9 A;  4IF5 A;  2IJZ A;  4OC3 A;  3OWC A;  2FCK A;  1LFW A;  5CNP A;  2C6G A;  3DNS A;  4FD4 A;  3GB0 A;  4MHN A;  4XPK A;  4B14 A;  4PSX A;  1IGB A;  3CT9 A;  2HQY A;  2EK8 A;  2JDC A;  2PC1 A;  2QJ8 A;  3TX8 A;  4KOX A;  4MFZ A;  3LD2 A;  1ZLH A;  2D4O A;  1Z5R A;  4KSF A;  3IC1 A;  3RNZ A;  4FAI A;  4A39 A;  3TTH A;  4F0Y A;  4KSA A;  5IV0 A;  1SQH A;  5LRK A;  4FWU A;  4QUS A;  5LRG A;  3D2P A;  4FUU A;  3T9Y A;  3TOB A;  1PUA A;  2GRE A;  3N7Z A;  2YND A;  4AVC A;  4AG7 A;  2AE6 A;  4CGP A;  5KTC A;  2I79 A;  1QST A;  1XRY A;  3N5F A;  3PFE A;  2PIY A;  2JBK A;  3TT2 A;  4AB7 A;  3IJ3 A;  2BEI A;  2Q44 A;  3DR8 A;  4P4J A;  3G3S A;  4A33 A;  3GIU A;  3QB8 A;  2VL1 A;  4AXV A;  2PQ8 A;  3TOA A;  4RUH A;  1R43 A;  3DR6 A;  2GFQ A;  4KVX A;  3D7D A;  4IHM A;  1BPN A;  4ZY1 A;  5J1Q A;  4ZY0 A;  4IUS A;  4FBE A;  3NH4 A;  5K8N A;  1RO5 A;  3ISX A;  4UEZ A;  2FT0 A;  2K5T A;  3WR7 A;  1XOV A;  6CPA A;  3FH4 A;  2ABZ A;  4CRZ B;  4F6A A;  3TC8 A;  2Q51 A;  1XMB A;  1IOF A;  3KQX A;  3BJ7 A;  4KUA A;  5LYL A;  3LWU A;  4U9Z A;  1XF8 A;  5G21 A;  2ZEF A;  1LAP A;  1XE4 A;  2B4D B;  5HVF A;  4NGN A;  1AYE A;  3A9L A;  5JPH A;  4B5O A;  3WT4 A;  2ANP A;  5J8F A;  2XEJ A;  2POK A;  2Z0Z A;  3EXN A;  1R3N A;  4AG9 A;  2PJ1 A;  5IX3 A;  4B11 A;  3PZJ A;  1M4L A;  4DNC A;  5GCN A;  2EWB A;  3FVL A;  5LRJ A;  3B7I A;  4B12 A;  2P6E A;  3WAB A;  4CAW A;  5ELY A;  5THW A;  2Q43 A;  2YNC A;  4UIB A;  2PRB A;  4A31 A;  3GY9 A;  1S3Z A;  4KSI A;  5AGE A;  5KTA A;  4RI1 A;  1ELM P;  2O53 A;  1BPM A;  4HKF A;  3PB9 X;  4LQ6 A;  1YR0 A;  2CXA A;  4P4I A;  3WC7 A;  1S7L A;  2H5M A;  3NH8 A;  1TIQ A;  3RAM A;  4MMO A;  2QVP A;  3KI9 A;  4NXY A;  4GM5 A;  5LYF A;  2B3U A;  2DF5 A;  2BOA A;  2B3V A;  1M4I A;  3EC4 A;  5HVH A;  2CY2 A;  3I3G A;  2PDO A;  1YVK A;  3CXQ A;  3NFZ A;  1M1D A;  3FRM A;  4XNH C;  2ATR A;  2JBJ A;  1B6B A;  4XPL A;  3HLP A;  4RS2 A;  2AFX A;  4P45 A;  3TO7 A;  4Z65 A;  2OR4 A;  4UA3 A;  3D7G A;  2PRQ A;  3PB6 X;  3S9M A;  2ZEE A;  1NSA A;  2Q7B A;  3FMC A;  4CRY B;  3VWD A;  3GUX A;  1WK4 A;  2AFW A;  4MFJ A;  4A32 A;  3W91 A;  1I21 A;  2ZEP A;  1IB1 E;  1LOK A;  1OBR A;  4IAV A;  2VEZ A;  5ISV A;  1DE4 C;  4UCM A;  3B3T A;  3S6F A;  2PIZ A;  4MY0 A;  2GAN A;  1S5K A;  3SXO A;  2ZED A;  5F47 A;  2QML A;  2AFO A;  1VHO A;  2PJA A;  1P0H A;  4I49 A;  2PJB A;  1JQG A;  2V77 A;  4AVB A;  1TXR A;  1CX8 A;  3LAC A;  4B13 A;  2QIR A;  2X7B A;  2G3A A;  1S7F A;  1AUG A;  4CGO A;  4OC4 A;  4KVO E;  3C26 A;  2C6P A;  4MHZ A;  4BBH A;  2OZH A;  1VIX A;  3IWW A;  5G20 A;  4QVT A;  1ARM A;  5JH9 A;  1ZG8 A;  2FSR A;  4GS4 A;  4NGR A;  2JLM A;  3S6H A;  3SJF A;  1XIX A;  5K8O A;  3FB3 A;  2BCO A;  1Z8L A;  3S9N A;  2V8H A;  5CBM A;  4KVM E;  2Q4Z A;  1ON0 A;  4BMH A;  1EE3 P;  2O4H A;  4UEE A;  4OAE A;  3TE4 A;  5J8C A;  1KUX A;  1M4D A;  4MRI A;  2JEV A;  2PJ5 A;  1IY7 A;  4FD7 A;  3VAT A;  2PE3 A;  5EBV A;  4X2T A;  3PBE A;  2I3C A;  4L8A A;  4PXD A;  1TKH A;  2V8G A;  4LX9 A;  2OU2 A;  5D29 A;  3QAH A;  3FED A;  1CPS A;  3RYO A;  4G1P A;  4KLW A;  5LYD A;  3R96 A;  1Q2Y A;  2HV2 A;  4OKO A;  2G3T A;  4PQA A;  3ISZ A;  3V38 A;  4CYQ A;  4QC6 A;  2YNE A;  3KR5 A;  4UFV A;  4BIN A;  1TF9 A;  3CXS A;  4HNX B;  2G0B A;  3T90 A;  3MRU A;  5HH1 A;  2KCW A;  5E96 A;  1YLO A;  2XEI A;  2FL4 A;  4R3L A;  3MN8 A;  1QSM A;  5DS0 A;  4E8O A;  1X12 A;  2FE7 A;  1PU9 A;  3JRU A;  3PP9 A;  2DPT A;  2V8D A;  4MCS A;  2PJ3 A;  4CS0 B;  1S60 A;  3PGP A;  4TWE A;  3CPA A;  1Y9K A;  1Y0R A;  2J9A A;  2ODF A;  1GHE A;  2J8R A;  3D2M A;  4UWI A;  5AG4 A;  1K4J A;  3R9E A;  5K8M A;  4UCN A;  2PJ7 A;  4R7M A;  4PXB A;  3BHX A;  2FVG A;  4F0X A;  4ZBG A;  4JXR A;  5DWM A;  2QYV A;  3R9G A;  2YGW A;  5CPA A;  3SI1 A;  1Z4E A;  4CAV A;  2WYR A;  3NE8 A;  4MBU A;  2VQY A;  1KZF A;  4P10 A;  1HDQ A;  4HPS A;  1CG2 A;  1YQE A;  4NGS A;  1RTQ A;  5HXD A;  1ZLI A;  3QNV A;  2REE A;  4ZX9 A;  2PJ4 A;  4JWP A;  3VH9 A;  2WPX A;  4C68 A;  4R87 A;  2ZOF A;  2FIA A;  3PEI A;  1BOB A;  5JQ4 A;  2ZOG A;  3MGD A;  3IFE A;  2R98 A;  2OH1 A;  3L2N A;  1VHE A;  4KS9 A;  4C2Z A;  4CAX A;  4DJL A;  5IB9 A;  4C7I A;  4UBR A;  2ZEO A;  4PSW A;  1N71 A;  4E2A A;  3UY5 A;  3IO1 A;  4KOS A;  2IQ6 A;  3IWE A;  5JGF A;  1NMT A;  3IWG A;  4JJX A;  1YX0 A;  1V0C A;  5A28 A;  1PCA A;  3CXP A;  2C27 A;  2ZW4 A;  4M3S A;  1BAV A;  1MJB A;  2PJC A;  1TKF A;  2ZEL A;  3CZX A;  4BD9 A;  2CNT A;  1Z9U A;  4C7H A;  5F09 A;  4YU9 A;  4RN7 A;  5FVJ A;  4KUB A;  4EFD A;  2NMT A;  4HNW B;  5IB0 A;  2VZZ A;  4CYP A;  4LQG A;  3PFO A;  1QSN A;  4PPZ A;  2P6G A;  3CPX A;  4E0A A;  3D7F A;  1WWZ A;  3H5Z A;  3S9L A;  4NF1 A;  4MJ8 A;  1Z4R A;  4MHY A;  3NH5 A;  4P4B A;  4XPD C;  5H86 A;  4M85 A;  1RXT A;  4DUK A;  5G1Z A;  1YGH A;  2PR1 A;  4YRH A;  2HUZ A;  1Y7R A;  4KOV A;  3TO6 A;  4M6H A;  1F2O A;  1Q7L A;  4PK2 A;  3I9S A;  3IGR A;  3JTK A;  3PBB A;  1QSR A;  5JM6 A;  5A27 A;  4NJR A;  1PYT B;  2PVV A;  3RZA A;  3GYA A;  2ZXV A;  3FYN A;  4MCQ A;  2Z3L A;  1A2Z A;  3B8G A;  2ZEH A;  1UFH A;  1S7K A;  4PV6 A;  3IEH A;  2VBQ A;  4UF4 A;  1MJ9 A;  4GXH A;  4UCP A;  5F49 A;  4KOR A;  4YWY A;  3BXM A;  3PRT A;  2OZG A;  1LAN A;  2DPS A;  4Y49 B;  2B58 A;  3GKR A;  4MCR A;  2Z3K A;  3RBU A;  4NGM A;  5AG5 A;  1TKJ A;  3DLJ A;  1Z8X A;  3BI1 A;  4P4D A;  1VGY A;  2EUI A;  3CDX A;  1FT7 A;  2EBJ A;  1TF8 A;  1M44 A;  5F46 A;  2R7H A;  3TFY A;  4YFJ A;  3EFA A;  2Q04 A;  4ORF A;  3NA6 A;  4PXC A;  4NJQ A;  3SI2 A;  3K2K A;  4HNY B;  1FNO A;  1NE9 A;  3DGV A;  4OAD A;  4UFX A;  4ZX8 A;  4MFK A;  3D4U A;  1LAM A;  2HC9 A;  3SJX A;  4QB9 A;  1X10 A;  2CTB A;  3DSB A;  1I12 A;  1ZO0 A;  3FEC A;  5LYI A;  3SXN A;  4KOY A;  1Y7E A;  2CTC A;  2NSM A;  4ONW A;  4OC5 A;  4P4F A;  2DXQ A;  3KGQ A;  4Q36 A;  5C88 A;  2PR8 A;  2Y0M A;  4OME A;  4CGM A;  3E0K A;  1IIC A;  4F9V A;  3WC5 A;  4C2Y A;  1Y9W A;  4R9M A;  4R57 A;  4M6I A;  3B35 A;  4OIW A;  1JWQ A;  4FD5 A;  2OOT A;  4X8I A;  3R9F A;  3WC6 A;  4NCZ A;  3IU2 A;  2PJ8 A;  1KWM A;  3TCV A;  4ZY2 A;  5HVG A;  1XJO A;  2PJ6 A;  4Q38 A;  1MJA A;  4A37 A;  5BWA B;  1ARL A;  2VZY A;  1KUY A;  2JDD A;  4OC2 A;  2OB0 A;  3FJU A;  4KZT A;  4A2Z A;  4B10 A;  4EWT A;  4CPA A;  4F9U A;  2GU2 A;  2F8H A;  2GIV A;  3G8W A;  5K8P A;  1Q2C A;  5DWN A;  2AJ6 A;  2REF A;  3B3V A;  1GYT A;  3KQZ A;  1VKC A;  3B3S A;  3DDD A;  4R6T A;  1ELL P;  2WSA A;  4OID A;  2ZW5 A;  4PXE A;  4OC1 A;  1HEE A;  2PJ9 A;  4CGL A;  2YNC C;  3KZW A;  2PCU A;  4P4E A;  3VAR A;  4K3N A;  2P6F A;  3B3C A;  4ZYQ A;  4U9Y A;  1IOI A; 
#chains in the Genus database with same CATH homology
 2C6C A;  4JYW A;  3KHX A;  4B6Z A;  1ZG9 A;  2PVW A;  1LCP A;  2BO9 A;  2PJ0 A;  4NGP A;  1XFO A;  4NGT A;  4X3R A;  4MXU A;  2DEA A;  2F7V A;  4EME A;  2XEF A;  3PB8 X;  3B3W A;  8CPA A;  4UEF A;  1YSJ A;  1DTD A;  3T8W A;  2RB7 A;  4ZI6 A;  3B2Y A;  4Q7A A;  1CP7 A;  4MHP A;  1BLL E;  3IIB A;  1QQ9 A;  5I4M A;  4OC0 A;  2AFZ A;  4W9Y A;  7CPA A;  3V7Z A;  2WZN A;  3D68 A;  3D7H A;  4UIA A;  3D66 A;  2CF4 A;  4R76 A;  2RFH A;  2GLJ A;  2G9D A;  1Y0Y A;  3FX6 A;  1F57 A;  4NFR A;  2IMO A;  3H8F A;  3KHZ A;  3K9T A;  1QMU A;  4IK2 A;  2JEW A;  2ZEM A;  2GLF A;  4DYO A;  2AFS A;  1AMP A;  1F2P A;  4OP4 A;  1ZG7 A;  1YW4 A;  2AFM A;  4WWV A;  3KR4 A;  4H2K A;  1CBX A;  4TNU A;  4A94 A;  3FF3 A;  5D8N A;  2EK9 A;  3GLJ A;  2CIJ A;  3HUV A;  3KAS A;  3H8G A;  2ZEG A;  1CPX A;  1CP6 A;  4F8Z A;  3SJG A;  1HDU A;  4A38 A;  1XBU A;  1H8L A;  4JZ0 A;  1YW6 A;  2NYQ A;  3BI0 A;  4NGQ A;  2V8V A;  3FEE A;  3KL9 A;  2ZEN A;  2AFU A;  3PB4 X;  3PB7 X;  4R8F A;  3H8E A;  1UWY A;  4O23 A;  2C1C A;  3LMS A;  2PJ2 A;  4P6Y A;  3I1U A;  4MCP A;  4P44 A;  2HB6 A;  4WJB A;  1YME A;  3SJE A;  3SI0 A;  3D67 A;  2XEG A;  1Z2L A;  2IJZ A;  4OC3 A;  1LFW A;  2C6G A;  3GB0 A;  4MHN A;  1IGB A;  3CT9 A;  2EK8 A;  2QJ8 A;  3TX8 A;  1ZLH A;  1Z5R A;  3IC1 A;  4FAI A;  4A39 A;  5LRK A;  4FWU A;  5LRG A;  4FUU A;  2GRE A;  1XRY A;  3PFE A;  3N5F A;  2PIY A;  2JBK A;  3IJ3 A;  4P4J A;  4AXV A;  2VL1 A;  4RUH A;  1R43 A;  3D7D A;  4IHM A;  1BPN A;  4ZY1 A;  5J1Q A;  4ZY0 A;  5K8N A;  4FBE A;  3NH4 A;  3ISX A;  4UEZ A;  6CPA A;  3FH4 A;  2ABZ A;  3TC8 A;  2Q51 A;  1XMB A;  3KQX A;  5LYL A;  3LWU A;  2ZEF A;  1LAP A;  5HVF A;  4NGN A;  1AYE A;  3WT4 A;  2ANP A;  2XEJ A;  2POK A;  1R3N A;  2PJ1 A;  1M4L A;  2EWB A;  3FVL A;  5LRJ A;  3B7I A;  3WAB A;  5ELY A;  5THW A;  2Q43 A;  4UIB A;  4KSI A;  1ELM P;  2O53 A;  1BPM A;  3PB9 X;  4P4I A;  3WC7 A;  3NH8 A;  3RAM A;  4MMO A;  2QVP A;  3KI9 A;  4GM5 A;  5LYF A;  2BOA A;  5HVH A;  3NFZ A;  2JBJ A;  3HLP A;  2AFX A;  4P45 A;  4Z65 A;  2OR4 A;  3D7G A;  2PRQ A;  3PB6 X;  3S9M A;  2ZEE A;  1NSA A;  3FMC A;  3GUX A;  2AFW A;  2ZEP A;  1LOK A;  1OBR A;  4IAV A;  1DE4 C;  3B3T A;  2PIZ A;  2ZED A;  2AFO A;  1VHO A;  2PJA A;  2PJB A;  1JQG A;  2V77 A;  1TXR A;  1CX8 A;  4OC4 A;  2C6P A;  4MHZ A;  1VIX A;  3IWW A;  5JH9 A;  1ARM A;  1ZG8 A;  4NGR A;  3SJF A;  5K8O A;  2BCO A;  1Z8L A;  3S9N A;  2V8H A;  5CBM A;  2Q4Z A;  1EE3 P;  2O4H A;  4UEE A;  4MRI A;  2PJ5 A;  1IY7 A;  3VAT A;  2PE3 A;  4X2T A;  3PBE A;  2I3C A;  4PXD A;  1TKH A;  2V8G A;  5D29 A;  3FED A;  1CPS A;  4G1P A;  5LYD A;  4OKO A;  4PQA A;  3ISZ A;  3V38 A;  3KR5 A;  1TF9 A;  3MRU A;  1YLO A;  2XEI A;  3MN8 A;  5DS0 A;  3JRU A;  2V8D A;  4MCS A;  2PJ3 A;  4TWE A;  3CPA A;  1Y0R A;  2J9A A;  5K8M A;  2PJ7 A;  4R7M A;  4PXB A;  3BHX A;  2FVG A;  2QYV A;  5CPA A;  3SI1 A;  2WYR A;  4P10 A;  1HDQ A;  5HXD A;  1CG2 A;  4NGS A;  1RTQ A;  1ZLI A;  3QNV A;  4ZX9 A;  2PJ4 A;  3VH9 A;  2ZOF A;  3PEI A;  2ZOG A;  4F9V A;  3IFE A;  3L2N A;  1VHE A;  4DJL A;  5IB9 A;  2ZEO A;  3IO1 A;  2IQ6 A;  5JGF A;  1PCA A;  1BAV A;  2PJC A;  2ZEL A;  1TKF A;  4BD9 A;  5F09 A;  4YU9 A;  4EFD A;  4LQG A;  3PFO A;  4PPZ A;  3CPX A;  3D7F A;  3S9L A;  4MHY A;  3NH5 A;  4P4B A;  4DUK A;  1F2O A;  1Q7L A;  3PBB A;  5JM6 A;  4NJR A;  1PYT B;  2PVV A;  3RZA A;  2ZEH A;  3IEH A;  4UF4 A;  4YWY A;  3BXM A;  3PRT A;  1LAN A;  4MCR A;  3RBU A;  4NGM A;  1TKJ A;  3DLJ A;  3BI1 A;  4P4D A;  1VGY A;  3CDX A;  1FT7 A;  1TF8 A;  4PXC A;  3NA6 A;  4NJQ A;  3SI2 A;  3K2K A;  1FNO A;  4ZX8 A;  3DGV A;  3D4U A;  1LAM A;  2HC9 A;  3SJX A;  2CTB A;  3FEC A;  5LYI A;  4ONW A;  1Y7E A;  2CTC A;  2NSM A;  4OC5 A;  4P4F A;  3KGQ A;  4OME A;  3WC5 A;  3B35 A;  4OIW A;  2OOT A;  4X8I A;  3WC6 A;  2PJ8 A;  1KWM A;  4ZY2 A;  5HVG A;  1XJO A;  2PJ6 A;  4A37 A;  1ARL A;  4OC2 A;  4F9U A;  3FJU A;  4EWT A;  4CPA A;  2GU2 A;  2F8H A;  5K8P A;  3B3V A;  3KQZ A;  1GYT A;  3B3S A;  4R6T A;  1ELL P;  4OID A;  4PXE A;  4OC1 A;  1HEE A;  2PJ9 A;  3KZW A;  2PCU A;  4P4E A;  3VAR A;  4K3N A;  4MCQ A;  3B3C A;  4ZYQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...