1XBUA

Streptomyces griseus aminopeptidase complexed with p-iodo-d-phenylalanine
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
277
structure length
275
Chain Sequence
APDIPLANVKAHLTQLSTIAANNGGNRAHGRPGYKASVDYVKAKLDAAGYTTTLQQFTSGGATGYNLIANWPGGDPNKVLMAGAHLDSVSSGAGINDNGSGSAAVLETALAVSRAGYQPDKHLRFAWWGAEELGLIGSKFYVNNLPSADRSKLAGYLNFDMIGSPNPGYFVYDDDPVIEKTFKNYFAGLNVPTEIETEGRSDHAPFKNVGVPVGGLFTGAGYTKSAAQAQKWGGTAGQAFDRCYHSSCDSLSNINDTALDRNSDAAAHAIWTLSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Aminopeptidase
publication title Streptomyces griseus aminopeptidase complexed with p-iodo-D-phenylalanine
rcsb
total genus 111
structure length 275
sequence length 277
ec nomenclature ec 3.4.11.24: Aminopeptidase S.
pdb deposition date 2004-08-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 1xbuA00
1VGYA 1BPNA 1Q7LA 4DUKA 4TWEA 2CTBA 3SI2A 2F8HA 4TNUA 2GLFA 3KHXA 1ELLP 1ZLIA 4NGMA 1Z8LA 4PXEA 3NH8A 3MN8A 1IY7A 2CTCA 3B3TA 2PIYA 2C6GA 2HB6A 2XEJA 3FMCA 2PJ1A 2PJ2A 3H8FA 3TX8A 1TF8A 3V38A 4P4EA 4MCQA 3D7GA 1R43A 2RB7A 2NSMA 1GYTA 4EFDA 2XEIA 3VH9A 4NGNA 1M4LA 1PCAA 5CBMA 4OP4A 2ZENA 2BO9A 1TXRA 5LRKA 1Z2LA 2PJ0A 2C6PA 1FNOA 4MCSA 2ZEHA 4NGSA 2PJCA 2AFZA 4F9VA 3IC1A 3RZAA 1CPSA 1TKJA 3CDXA 3SJXA 1ZLHA 3PB9X 4PXBA 2ZEGA 2ZEOA 2ZELA 3KI9A 2NYQA 5LYFA 1PYTB 4KSIA 3B3VA 1YSJA 3PFOA 1XBUA 4DYOA 1HDQA 3PBBA 2IQ6A 3FF3A 4F9UA 5I4MA 4UEEA 1EE3P 1NSAA 4Z65A 3PFEA 2JBKA 3I1UA 3BXMA 1LAPA 4MHNA 3JRUA 4GM5A 1Y0RA 3IWWA 2ZOGA 4YU9A 2EK8A 4ZX9A 2C6CA 5LYLA 4A38A 2WZNA 4O23A 3KZWA 3N5FA 4X2TA 1CP6A 3WT4A 3V7ZA 2ABZA 4MMOA 5DS0A 3TC8A 3D7HA 4PXCA 4P4BA 1ZG8A 1F57A 2VL1A 2CF4A 3S9LA 3BHXA 3WC6A 1R3NA 2JEWA 1RTQA 3L2NA 3DGVA 2PVWA 3PRTA 5D29A 2PVVA 2O53A 2Q51A 4G1PA 5LRGA 3D4UA 1BAVA 2GREA 2Q43A 4R76A 3NH5A 6CPAA 2PJBA 5D8NA 3IEHA 4UIAA 2HC9A 1F2PA 1TF9A 1IGBA 5K8OA 2J9AA 4P45A 2QYVA 3H8GA 4AXVA 4OC1A 3CPAA 5HXDA 3B3SA 3IFEA 3K2KA 3SI1A 3KR5A 1UWYA 3ISXA 4FUUA 5LYDA 3FX6A 4OIWA 3FJUA 3RBUA 4P4DA 5JGFA 4MRIA 3VATA 2AFMA 4OC5A 1Y7EA 3WC5A 3IJ3A 2V8GA 3VARA 2EWBA 5LYIA 1LANA 1CPXA 1LOKA 2I3CA 4K3NA 2PRQA 4R7MA 1Z5RA 4UF4A 4JYWA 3QNVA 5LRJA 2V8HA 3FVLA 1HDUA 3CT9A 1KWMA 1YLOA 2IJZA 4UIBA 4IHMA 2QJ8A 4IAVA 2RFHA 4DJLA 2ZOFA 5JH9A 3NA6A 4PQAA 4R8FA 1YMEA 2Q4ZA 3KGQA 1ZG7A 3RAMA 2BCOA 4IK2A 4YWYA 1ARLA 5JM6A 4NJRA 4P10A 4A37A 2C1CA 2POKA 3PB4X 4MCPA 5HVFA 4P4JA 2ZEFA 1TKHA 2PJ6A 5K8PA 2ANPA 4W9YA 3KQXA 2AFSA 4MHZA 2PJ8A 3FECA 4F8ZA 4WJBA 1QQ9A 2V8VA 3HUVA 7CPAA 3K9TA 4EWTA 2CIJA 1F2OA 1LCPA 3IO1A 3FH4A 3B35A 3KR4A 2PJ7A 2ZEDA 4OC0A 5HVHA 3D67A 3SI0A 4FAIA 1BPMA 4OC3A 4PPZA 2ZEMA 2F7VA 1DE4C 1QMUA 4NGTA 4OMEA 3HLPA 4NGPA 4ZYQA 3ISZA 4MCRA 2G9DA 1TKFA 4ZY2A 5J1QA 4NGRA 4ONWA 4P4IA 3B3CA 4ZI6A 2FVGA 4P4FA 4P44A 4ZY0A 1XRYA 4R6TA 3LWUA 1DTDA 5ELYA 3GB0A 2AFUA 3GUXA 1AYEA 1HEEA 3D66A 4LQGA 3NFZA 2ZEPA 2XEFA 3MRUA 1H8LA 2PJ9A 1CBXA 2AFWA 2PJ3A 2ZEEA 4ZY1A 1ZG9A 5THWA 3D7DA 1AMPA 1CG2A 1LFWA 2OOTA 3PBEA 2PJ4A 3KASA 4WWVA 3BI0A 3SJFA 5IB9A 3KL9A 3SJGA 2PE3A 2PCUA 1CP7A 2WYRA 1YW4A 4JZ0A 1VIXA 3D7FA 1XFOA 1VHEA 2OR4A 3PB6X 3B3WA 4BD9A 2GLJA 3CPXA 3B2YA 3KQZA 3S9MA 4ZX8A 3FEDA 4EMEA 3B7IA 2DEAA 3KHZA 4MHPA 1OBRA 4PXDA 3S9NA 3SJEA 5CPAA 2PJAA 4X3RA 2PIZA 4MHYA 4UEFA 3WC7A 4OC4A 8CPAA 3PB7X 4MXUA 3LMSA 2V77A 4Q7AA 5HVGA 4NFRA 3H8EA 3T8WA 1ELMP 2O4HA 4FBEA 2EK9A 1JQGA 4NJQA 2IMOA 3IIBA 3PB8X 2BOAA 2GU2A 1FT7A 4NGQA 4B6ZA 1LAMA 4RUHA 2AFXA 4X8IA 4CPAA 1Y0YA 3FEEA 2AFOA 2V8DA 3PEIA 3DLJA 2XEGA 2QVPA 5K8MA 4UEZA 2PJ5A 4FWUA 4OIDA 1XMBA 1BLLE 1XJOA 5F09A 3NH4A 4P6YA 1VHOA 5K8NA 2JBJA 1YW6A 3WABA 4OKOA 4A39A 4H2KA 4OC2A 1CX8A 3GLJA 4A94A 1ARMA 3BI1A 3D68A
chains in the Genus database with same CATH superfamily
1VGYA 4CAWA 3JUWA 1BPNA 1Q7LA 4DUKA 5A28A 2R1IA 2Y0MA 4TWEA 3TTHA 4CGMA 2BL1A 1QSMA 2F8HA 1MJ9A 2CTBA 3D3SA 1B6BA 1S7LA 4M6IA 3SI2A 2FS5A 4TNUA 2J8RA 4MBUA 2GLFA 3KHXA 1ELLP 2J8MA 2DF5A 1ZLIA 4NGMA 4CYNA 1Z8LA 1YLEA 3NE8A 1S60A 4PXEA 3TO9A 3NH8A 3MN8A 1IY7A 1KUVA 1Z8WA 2CTCA 3B3TA 4XPDC 5FVJA 2B4DA 2PIYA 2QIRA 5KTDA 2C6GA 2HB6A 2XEJA 3FMCA 2BSWA 2PDOA 2PJ1A 2PJ2A 3H8FA 5J8FA 3TX8A 1TF8A 3V38A 2Z3OA 3CXPA 4P4EA 1YX0A 4MCQA 4B12A 4UFWA 3PZJA 4B5PB 2B5GA 1R43A 3D7GA 2G3TA 2RB7A 3G8WA 3ZJ0A 2NSMA 2B4BA 1GYTA 3TT2A 4XPKA 4CAVA 5DWMA 2HQYA 4EFDA 2KCWA 3P2HA 2XEIA 3VH9A 4NGNA 2REEA 2G0BA 1M4LA 1PCAA 2NMTA 5CBMA 4OP4A 2I00A 1XIXA 4E8OA 2ZENA 4X5KA 2BO9A 3D2PA 2K5TA 2VBQA 4J3GA 3WR7A 1TXRA 5LRKA 4M6GA 3V8IA 1Z2LA 2PJ0A 2C6PA 3CXSA 4F6AA 1FNOA 3N7ZA 1NMTA 4I49A 4MCSA 2ZEHA 4NGSA 2PJCA 2AFZA 4MY0A 3P2FA 4C7HA 4F9VA 3UY5A 1XMTA 4CRZB 2B58A 2WSAA 3IC1A 3RZAA 1CPSA 1TKJA 1IYLA 2DXQA 4FD7A 4YGOA 4E2AA 3CDXA 1B87A 3I3GA 1YK3A 1ZLHA 3SJXA 3PB9X 2OZGA 3DSBA 1QSTA 2ZEGA 4PXBA 1P0HA 2FT0A 2ZEOA 1RXTA 2ZELA 3KI9A 2NYQA 5LYFA 1YGHA 4B5OA 4MFLA 5EBVA 4E0AA 1PYTB 4KSIA 3DDDA 1VHSA 3B3VA 2F5IA 1YSJA 3PFOA 5AG7A 1XBUA 4NCZA 4DYOA 1HDQA 4FD4A 3R9EA 4PSXA 4B11A 5AG5A 1YR0A 3PBBA 5J8CA 2IQ6A 4U9YA 3FF3A 1S7NA 4F9UA 5I4MA 1IIDA 4UEEA 1EE3P 1NSAA 1K4JA 4LQ6A 2B4DB 4BBHA 4Z65A 1S7FA 3NE7A 3PFEA 4KOYA 2JBKA 1MJAA 1U6MA 3C26A 4JJXA 5JQ4A 3A9LA 3I1UA 2Q0YA 3TOBA 3BXMA 1LAPA 4MHNA 3JRUA 1YQEA 4GM5A 4BMHA 1Y0RA 3IWWA 3FIXA 2ZOGA 4B5PA 4UBRA 2HUZA 2EK8A 4MFQA 2B5GB 4YU9A 4KZTA 4ZX9A 2C6CA 4JXQA 5LYLA 4A38A 4B13A 5AGEA 2WZNA 3TOAA 4JWPA 4O23A 5KTCA 3KZWA 4JLYA 4F0XA 3N5FA 4NEXA 2PR1A 4X2TA 1CP6A 2J8NA 1KUYA 3WT4A 3V7ZA 5EC4A 3T9YA 2ABZA 4MMOA 5CNPA 1Y9WA 5DS0A 1PU9A 5G1ZA 3TC8A 3D7HA 4PXCA 2Q4VA 4P4BA 1ZG8A 5G21A 4UWIA 1SQHA 3T90A 3OWCA 3B8GA 2FE7A 4AVAA 2ZXVA 1F57A 2VL1A 3CZXA 3IWGA 4UWJA 2CF4A 4LX9A 3S9LA 1Z9UA 3BHXA 5F47A 3WC6A 1R3NA 2JEWA 5GCNA 3FNCA 1RTQA 3L2NA 4PK3A 3R95A 3DGVA 2PVWA 3PRTA 5D29A 3GKRA 2PVVA 2O53A 3IU1A 5AG4A 4HKFA 2VQYA 2Q51A 4RN7A 4M6HA 1TIQA 4G1PA 3EY5A 5LRGA 3D4UA 1IYKA 1XEBA 2GREA 1BAVA 2PR8A 2Q43A 2BEIA 3F0AA 4R76A 4CS0B 3NH5A 6CPAA 2PJBA 2PRBA 5D8NA 3BJ7A 3IEHA 3LD2A 2AE6A 2HC9A 4UIAA 4YFJA 1F2PA 3R1KA 4C2YA 1TF9A 2EBJA 1IGBA 4MY3A 2P6FA 5K8OA 2HV2A 2J9AA 4HPSA 4OLLA 4P45A 2QYVA 3H8GA 4AXVA 4UCMA 4OC1A 3CPAA 5HXDA 4QBJA 3B3SA 3FXTA 2YNCC 3H4QA 3IFEA 4NSQA 2X7BA 3K2KA 3IWEA 4U9ZA 3SI1A 3W6XA 3W6SA 2BUEA 3KR5A 1UWYA 4ZGYB 3ISXA 1NE9A 1N71A 4FUUA 3R9FA 2R8VA 5LYDA 3FX6A 2Z11A 3GY9A 4BINA 4OIWA 3ZZIA 4MFPA 1CM0A 2ZPAA 1IU8A 3FJUA 1Q2CA 2Q04A 3RBUA 4P4DA 5JGFA 4MRIA 2H5MA 2I79A 4KORA 3VATA 4UFXA 3QAYA 2AFMA 1IOFA 4OC5A 2ZW6A 1Y7EA 3WC5A 3IJ3A 4AG9A 1BOBA 1QSNA 2V8GA 5F48A 4UCNA 3VARA 2EWBA 4XPDB 1L0CA 3IU2A 5LYIA 4MHDA 1LANA 1CPXA 3DR8A 1LOKA 4KOWA 4PSWA 4CAXA 5IV0A 2I3CA 2FXFA 2FL4A 2IL4A 2PRQA 4K3NA 4R7MA 1Z5RA 4UF4A 3SXOA 4AG7A 1CJWA 2WPXA 4HNXB 4UFVA 4CYPA 4JYWA 5C82A 5IB0A 2CY2A 4CGPA 2EVNA 3QNVA 5LRJA 1I21A 2OH1A 2V8HA 2D4OA 3FVLA 1HDUA 2CNMA 3FYNA 1JWQA 3CT9A 1M4IA 1KWMA 1X10A 1YLOA 2GIVA 2OZUA 2IJZA 4QVTA 4AVCA 3JTKA 4UIBA 3DNSA 4CAFA 3D2MA 4IHMA 3G3SA 2REFA 2ARHA 4GS4A 1QSOA 4CGNA 2QJ8A 4KOVA 5C88A 4K30A 2ZW4A 4IAVA 1M4GA 2RFHA 3S6KA 4DJLA 1BO4A 2Z10A 2ZOFA 4CAEA 1YVOA 3RO0A 3H5ZA 4QUSA 5H86A 5H84A 5JH9A 1IICA 4MFKA 3NA6A 1S5KA 4HNYB 4PQAA 4KLWA 1YMEA 2Q4ZA 3KGQA 1ZG7A 2DPTA 4FD6A 3F8KA 4QC6A 4R8FA 3RAMA 2EUIA 2BCOA 4IK2A 2VZZA 1ARLA 4YWYA 5EMIA 2P6GA 4LUAA 5G22A 5JM6A 4NJRA 4P10A 4AVBA 4A37A 2Q4YA 2C1CA 2POKA 3PB4X 4MCPA 1IOIA 5HVFA 2OU2A 4P4JA 2ZEFA 3CXQA 2JLMA 1TKHA 2PJ6A 5K8PA 1S7KA 2GFQA 2ANPA 1A2ZA 4A95A 4W9YA 3KQXA 2AFSA 2Z3KA 4MHZA 2PJ8A 3FECA 3VWDA 4B14A 4C68A 3FBUA 4R9MA 4WJBA 4F8ZA 1QQ9A 2V8VA 3HUVA 7CPAA 2Z0ZA 4PV6A 3K9TA 5A27A 4EWTA 2CIJA 1F2OA 4KOUA 3SHPA 1MK4A 2B3VA 3TE4A 1LCPA 3GIUA 3IO1A 1QSRA 3FH4A 1XF8A 2OB0A 3B35A 3TFYA 3KR4A 2PJ7A 4B10A 4EVYA 3S6FA 4CRYB 2ZEDA 4OC0A 5HVHA 4XNHC 3D67A 1FY7A 1UFHA 4PK2A 3SI0A 2FIWA 4R3LA 2B3UA 3E0KA 4KOSA 1BPMA 4OC3A 4PPZA 5E96A 4FAIA 2ZEMA 4Y49C 2F7VA 1Q2DA 3VWEA 4KOTA 4L89A 4MFJA 1DE4C 1QMUA 3TO6A 4NGTA 4OMEA 5AG6A 2QECA 4H6ZA 3EC4A 1Z8TA 2O28A 4KUBA 3HLPA 3QB8A 4NGPA 4ZYQA 3ISZA 4MCRA 2G9DA 5BWAB 1TKFA 4RS2A 4ZY2A 4NGRA 3MGDA 1VKCA 4ONWA 2VXKA 5J1QA 1GHEA 4RI1A 2EO8A 2WPWA 4P4IA 3B3CA 4C2XA 4ZI6A 2FVGA 3D8PA 4P4FA 5DWNA 4KUAA 3F5BA 4P44A 1MJBA 2Z3NA 4ZY0A 1XRYA 2Z3MA 1I1DA 4YRHA 4R6TA 2YGWA 3LWUA 4KVOE 2VZYA 1DTDA 5ELYA 2ZW7A 1P4NA 2YNDA 3GB0A 3S6HA 2AFUA 3GUXA 3BLNA 1AYEA 1HEEA 3FRMA 3FB3A 3D66A 3DR6A 2ZW5A 4MJ8A 2C27A 4LQGA 1I12A 4A30A 3NFZA 2ZEPA 2XEFA 2GANA 3MRUA 1H8LA 4II9A 2PJ9A 1CBXA 2AFWA 3EFAA 1WWZA 2PJ3A 4KVME 2RC4A 2ZEEA 3JVNA 4A2ZA 4ZY1A 1ZG9A 3W91A 5THWA 1R57A 2A4NA 2OZHA 3RNZA 3K9UA 1PUAA 4Q36A 3D7DA 1AMPA 1CG2A 1LFWA 3PP9A 2OOTA 4A32A 3PBEA 2QMLA 4CGLA 4R57A 2R7HA 2PJ4A 3KASA 4WWVA 3BI0A 3SJFA 5IB9A 2CNSA 2G3AA 3KL9A 3EXNA 3SJGA 2PE3A 2PCUA 2Q44A 1CP7A 3GYAA 2WYRA 2PQ8A 2Z3PA 1YW4A 2Q7BA 4A33A 1S3ZA 4JZ0A 1VIXA 4CYQA 4M85A 4UA3A 3D7FA 4NXYA 4DNCA 1KZFA 3KKWA 1X12A 1XFOA 1Z8XA 2PC1A 4KSFA 1VHEA 1Y7RA 2OR4A 3PB6X 3B3WA 3I9SA 4BD9A 1AUGA 2GLJA 3LODA 4CYOA 4R3KA 3IGRA 2JEVA 3CPXA 3B2YA 3KQZA 5F46A 3S9MA 4ZX8A 3FEDA 3QAHA 4EMEA 3B7IA 2JDCA 4CGOA 4JD6A 4ZBGA 5KTAA 3BJ8A 2DEAA 3KHZA 2FIAA 1NSLA 3SXNA 4MHPA 2FSRA 2Q7SA 1OBRA 1YREA 4PXDA 3S9NA 2ATRA 3SJEA 4H89A 2JDDA 5CPAA 2PJAA 4L8AA 1ZO0A 1M1DA 1YVKA 2PSWA 4X3RA 2PIZA 4IF5A 4MHYA 1OZPA 4UEFA 3WC7A 4JXRA 1Q2YA 2WUUA 3TO7A 4OC4A 1LRZA 8CPAA 4ONUA 3PB7X 4MXUA 3LMSA 2V77A 4Q7AA 3R9GA 4A31A 4C2ZA 4NFRA 3TCVA 3H8EA 3T8WA 5HVGA 2CNTA 1IB1E 1KUXA 5IX3A 2CXAA 4FD5A 4UCPA 1ELMP 2O4HA 4FBEA 1XE4A 4KSAA 2EK9A 1JQGA 4IUSA 2IMOA 3IIBA 3PB8X 4NJQA 1M4DA 1WK4A 2BOAA 3EO4A 4KS9A 4KVXA 4Q38A 1V0CA 2GU2A 1FT7A 4NGQA 2DPSA 2P0WA 3R96A 5JPHA 4MFZA 2D4PA 5HH1A 5ISVA 4B6ZA 1LAMA 3LACA 4XPLA 2AFXA 4KLVA 4X8IA 1M44A 4GXHA 4RUHA 4CPAA 2Z3LA 4M3SA 1Y0YA 1Z4RA 2YNCA 3FEEA 3RYOA 2AFOA 4OAEA 2V8DA 3PEIA 2YNEA 4C7IA 3DLJA 2XEGA 2FCKA 4NF1A 5HMNA 2VI7A 4OADA 4HNWB 4QB9A 2QVPA 3S6GA 4MI4A 1ON0A 5K8MA 4UEZA 1XOVA 2PJ5A 4FWUA 2P6EA 4KOXA 4OIDA 4H6UA 1XMBA 1J4JA 4U5YA 1BLLE 1XJOA 1Z4EA 2AJ6A 5F09A 3NH4A 4P6YA 2VEZA 1VHOA 1Y9KA 5K8NA 4F0YA 2JBJA 3PGPA 1YW6A 5I0CA 3WABA 4R87A 4OKOA 4A39A 5F49A 4H2KA 1RO5A 4OC2A 5G20A 2ODFA 4XNHB 1CX8A 2R98A 2GE3A 3GLJA 4A94A 4AB7A 1ARMA 4Y49B 4ORFA 3BI1A 3D68A
chains in the Genus database with same CATH topology
1VGYA 1BPNA 1Q7LA 4DUKA 4TWEA 2CTBA 3SI2A 2F8HA 4TNUA 2GLFA 3KHXA 1ELLP 1ZLIA 4NGMA 1Z8LA 4PXEA 3NH8A 3MN8A 1IY7A 2CTCA 3B3TA 2PIYA 2C6GA 2HB6A 2XEJA 3FMCA 2PJ1A 2PJ2A 3H8FA 3TX8A 1TF8A 3V38A 4P4EA 4MCQA 3D7GA 1R43A 2RB7A 2NSMA 1GYTA 4EFDA 2XEIA 3VH9A 4NGNA 1M4LA 1PCAA 5CBMA 4OP4A 2ZENA 2BO9A 1TXRA 5LRKA 1Z2LA 2PJ0A 2C6PA 1FNOA 4MCSA 2ZEHA 4NGSA 2PJCA 2AFZA 4F9VA 3IC1A 3RZAA 1CPSA 1TKJA 3CDXA 3SJXA 1ZLHA 3PB9X 4PXBA 2ZEGA 2ZEOA 2ZELA 3KI9A 2NYQA 5LYFA 1PYTB 4KSIA 3B3VA 1YSJA 3PFOA 1XBUA 4DYOA 1HDQA 3PBBA 2IQ6A 3FF3A 4F9UA 5I4MA 4UEEA 1EE3P 1NSAA 4Z65A 3PFEA 2JBKA 3I1UA 3BXMA 1LAPA 4MHNA 3JRUA 4GM5A 1Y0RA 3IWWA 2ZOGA 4YU9A 2EK8A 4ZX9A 2C6CA 5LYLA 4A38A 2WZNA 4O23A 3KZWA 3N5FA 4X2TA 1CP6A 3WT4A 3V7ZA 2ABZA 4MMOA 5DS0A 3TC8A 3D7HA 4PXCA 4P4BA 1ZG8A 1F57A 2VL1A 2CF4A 3S9LA 3BHXA 3WC6A 1R3NA 2JEWA 1RTQA 3L2NA 3DGVA 2PVWA 3PRTA 5D29A 2PVVA 2O53A 2Q51A 4G1PA 5LRGA 3D4UA 1BAVA 2GREA 2Q43A 4R76A 3NH5A 6CPAA 2PJBA 5D8NA 3IEHA 4UIAA 2HC9A 1F2PA 1TF9A 1IGBA 5K8OA 2J9AA 4P45A 2QYVA 3H8GA 4AXVA 4OC1A 3CPAA 5HXDA 3B3SA 3IFEA 3K2KA 3SI1A 3KR5A 1UWYA 3ISXA 4FUUA 5LYDA 3FX6A 4OIWA 3FJUA 3RBUA 4P4DA 5JGFA 4MRIA 3VATA 2AFMA 4OC5A 1Y7EA 3WC5A 3IJ3A 2V8GA 3VARA 2EWBA 5LYIA 1LANA 1CPXA 1LOKA 2I3CA 4K3NA 2PRQA 4R7MA 1Z5RA 4UF4A 4JYWA 3QNVA 5LRJA 2V8HA 3FVLA 1HDUA 3CT9A 1KWMA 1YLOA 2IJZA 4UIBA 4IHMA 2QJ8A 4IAVA 2RFHA 4DJLA 2ZOFA 5JH9A 3NA6A 4PQAA 4R8FA 1YMEA 2Q4ZA 3KGQA 1ZG7A 3RAMA 2BCOA 4IK2A 4YWYA 1ARLA 5JM6A 4NJRA 4P10A 4A37A 2C1CA 2POKA 3PB4X 4MCPA 5HVFA 4P4JA 2ZEFA 1TKHA 2PJ6A 5K8PA 2ANPA 4W9YA 3KQXA 2AFSA 4MHZA 2PJ8A 3FECA 4F8ZA 4WJBA 1QQ9A 2V8VA 3HUVA 7CPAA 3K9TA 4EWTA 2CIJA 1F2OA 1LCPA 3IO1A 3FH4A 3B35A 3KR4A 2PJ7A 2ZEDA 4OC0A 5HVHA 3D67A 3SI0A 4FAIA 1BPMA 4OC3A 4PPZA 2ZEMA 2F7VA 1DE4C 1QMUA 4NGTA 4OMEA 3HLPA 4NGPA 4ZYQA 3ISZA 4MCRA 2G9DA 1TKFA 4ZY2A 5J1QA 4NGRA 4ONWA 4P4IA 3B3CA 4ZI6A 2FVGA 4P4FA 4P44A 4ZY0A 1XRYA 4R6TA 3LWUA 1DTDA 5ELYA 3GB0A 2AFUA 3GUXA 1AYEA 1HEEA 3D66A 4LQGA 3NFZA 2ZEPA 2XEFA 3MRUA 1H8LA 2PJ9A 1CBXA 2AFWA 2PJ3A 2ZEEA 4ZY1A 1ZG9A 5THWA 3D7DA 1AMPA 1CG2A 1LFWA 2OOTA 3PBEA 2PJ4A 3KASA 4WWVA 3BI0A 3SJFA 5IB9A 3KL9A 3SJGA 2PE3A 2PCUA 1CP7A 2WYRA 1YW4A 4JZ0A 1VIXA 3D7FA 1XFOA 1VHEA 2OR4A 3PB6X 3B3WA 4BD9A 2GLJA 3CPXA 3B2YA 3KQZA 3S9MA 4ZX8A 3FEDA 4EMEA 3B7IA 2DEAA 3KHZA 4MHPA 1OBRA 4PXDA 3S9NA 3SJEA 5CPAA 2PJAA 4X3RA 2PIZA 4MHYA 4UEFA 3WC7A 4OC4A 8CPAA 3PB7X 4MXUA 3LMSA 2V77A 4Q7AA 5HVGA 4NFRA 3H8EA 3T8WA 1ELMP 2O4HA 4FBEA 2EK9A 1JQGA 4NJQA 2IMOA 3IIBA 3PB8X 2BOAA 2GU2A 1FT7A 4NGQA 4B6ZA 1LAMA 4RUHA 2AFXA 4X8IA 4CPAA 1Y0YA 3FEEA 2AFOA 2V8DA 3PEIA 3DLJA 2XEGA 2QVPA 5K8MA 4UEZA 2PJ5A 4FWUA 4OIDA 1XMBA 1BLLE 1XJOA 5F09A 3NH4A 4P6YA 1VHOA 5K8NA 2JBJA 1YW6A 3WABA 4OKOA 4A39A 4H2KA 4OC2A 1CX8A 3GLJA 4A94A 1ARMA 3BI1A 3D68A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VGY A;  1BPN A;  1Q7L A;  4DUK A;  4TWE A;  2CTB A;  3SI2 A;  2F8H A;  4TNU A;  2GLF A;  3KHX A;  1ELL P;  1ZLI A;  4NGM A;  1Z8L A;  4PXE A;  3NH8 A;  3MN8 A;  1IY7 A;  2CTC A;  3B3T A;  2PIY A;  2C6G A;  2HB6 A;  2XEJ A;  3FMC A;  2PJ1 A;  2PJ2 A;  3H8F A;  3TX8 A;  1TF8 A;  3V38 A;  4P4E A;  4MCQ A;  3D7G A;  1R43 A;  2RB7 A;  2NSM A;  1GYT A;  4EFD A;  2XEI A;  3VH9 A;  4NGN A;  1M4L A;  1PCA A;  5CBM A;  4OP4 A;  2ZEN A;  2BO9 A;  1TXR A;  5LRK A;  1Z2L A;  2PJ0 A;  2C6P A;  1FNO A;  4MCS A;  2ZEH A;  4NGS A;  2PJC A;  2AFZ A;  4F9V A;  3IC1 A;  3RZA A;  1CPS A;  1TKJ A;  3CDX A;  3SJX A;  1ZLH A;  3PB9 X;  4PXB A;  2ZEG A;  2ZEO A;  2ZEL A;  3KI9 A;  2NYQ A;  5LYF A;  1PYT B;  4KSI A;  3B3V A;  1YSJ A;  3PFO A;  1XBU A;  4DYO A;  1HDQ A;  3PBB A;  2IQ6 A;  3FF3 A;  4F9U A;  5I4M A;  4UEE A;  1EE3 P;  1NSA A;  4Z65 A;  3PFE A;  2JBK A;  3I1U A;  3BXM A;  1LAP A;  4MHN A;  3JRU A;  4GM5 A;  1Y0R A;  3IWW A;  2ZOG A;  4YU9 A;  2EK8 A;  4ZX9 A;  2C6C A;  5LYL A;  4A38 A;  2WZN A;  4O23 A;  3KZW A;  3N5F A;  4X2T A;  1CP6 A;  3WT4 A;  3V7Z A;  2ABZ A;  4MMO A;  5DS0 A;  3TC8 A;  3D7H A;  4PXC A;  4P4B A;  1ZG8 A;  1F57 A;  2VL1 A;  2CF4 A;  3S9L A;  3BHX A;  3WC6 A;  1R3N A;  2JEW A;  1RTQ A;  3L2N A;  3DGV A;  2PVW A;  3PRT A;  5D29 A;  2PVV A;  2O53 A;  2Q51 A;  4G1P A;  5LRG A;  3D4U A;  1BAV A;  2GRE A;  2Q43 A;  4R76 A;  3NH5 A;  6CPA A;  2PJB A;  5D8N A;  3IEH A;  4UIA A;  2HC9 A;  1F2P A;  1TF9 A;  1IGB A;  5K8O A;  2J9A A;  4P45 A;  2QYV A;  3H8G A;  4AXV A;  4OC1 A;  3CPA A;  5HXD A;  3B3S A;  3IFE A;  3K2K A;  3SI1 A;  3KR5 A;  1UWY A;  3ISX A;  4FUU A;  5LYD A;  3FX6 A;  4OIW A;  3FJU A;  3RBU A;  4P4D A;  5JGF A;  4MRI A;  3VAT A;  2AFM A;  4OC5 A;  1Y7E A;  3WC5 A;  3IJ3 A;  2V8G A;  3VAR A;  2EWB A;  5LYI A;  1LAN A;  1CPX A;  1LOK A;  2I3C A;  4K3N A;  2PRQ A;  4R7M A;  1Z5R A;  4UF4 A;  4JYW A;  3QNV A;  5LRJ A;  2V8H A;  3FVL A;  1HDU A;  3CT9 A;  1KWM A;  1YLO A;  2IJZ A;  4UIB A;  4IHM A;  2QJ8 A;  4IAV A;  2RFH A;  4DJL A;  2ZOF A;  5JH9 A;  3NA6 A;  4PQA A;  4R8F A;  1YME A;  2Q4Z A;  3KGQ A;  1ZG7 A;  3RAM A;  2BCO A;  4IK2 A;  4YWY A;  1ARL A;  5JM6 A;  4NJR A;  4P10 A;  4A37 A;  2C1C A;  2POK A;  3PB4 X;  4MCP A;  5HVF A;  4P4J A;  2ZEF A;  1TKH A;  2PJ6 A;  5K8P A;  2ANP A;  4W9Y A;  3KQX A;  2AFS A;  4MHZ A;  2PJ8 A;  3FEC A;  4F8Z A;  4WJB A;  1QQ9 A;  2V8V A;  3HUV A;  7CPA A;  3K9T A;  4EWT A;  2CIJ A;  1F2O A;  1LCP A;  3IO1 A;  3FH4 A;  3B35 A;  3KR4 A;  2PJ7 A;  2ZED A;  4OC0 A;  5HVH A;  3D67 A;  3SI0 A;  4FAI A;  1BPM A;  4OC3 A;  4PPZ A;  2ZEM A;  2F7V A;  1DE4 C;  1QMU A;  4NGT A;  4OME A;  3HLP A;  4NGP A;  4ZYQ A;  3ISZ A;  4MCR A;  2G9D A;  1TKF A;  4ZY2 A;  5J1Q A;  4NGR A;  4ONW A;  4P4I A;  3B3C A;  4ZI6 A;  2FVG A;  4P4F A;  4P44 A;  4ZY0 A;  1XRY A;  4R6T A;  3LWU A;  1DTD A;  5ELY A;  3GB0 A;  2AFU A;  3GUX A;  1AYE A;  1HEE A;  3D66 A;  4LQG A;  3NFZ A;  2ZEP A;  2XEF A;  3MRU A;  1H8L A;  2PJ9 A;  1CBX A;  2AFW A;  2PJ3 A;  2ZEE A;  4ZY1 A;  1ZG9 A;  5THW A;  3D7D A;  1AMP A;  1CG2 A;  1LFW A;  2OOT A;  3PBE A;  2PJ4 A;  3KAS A;  4WWV A;  3BI0 A;  3SJF A;  5IB9 A;  3KL9 A;  3SJG A;  2PE3 A;  2PCU A;  1CP7 A;  2WYR A;  1YW4 A;  4JZ0 A;  1VIX A;  3D7F A;  1XFO A;  1VHE A;  2OR4 A;  3PB6 X;  3B3W A;  4BD9 A;  2GLJ A;  3CPX A;  3B2Y A;  3KQZ A;  3S9M A;  4ZX8 A;  3FED A;  4EME A;  3B7I A;  2DEA A;  3KHZ A;  4MHP A;  1OBR A;  4PXD A;  3S9N A;  3SJE A;  5CPA A;  2PJA A;  4X3R A;  2PIZ A;  4MHY A;  4UEF A;  3WC7 A;  4OC4 A;  8CPA A;  3PB7 X;  4MXU A;  3LMS A;  2V77 A;  4Q7A A;  5HVG A;  4NFR A;  3H8E A;  3T8W A;  1ELM P;  2O4H A;  4FBE A;  2EK9 A;  1JQG A;  4NJQ A;  2IMO A;  3IIB A;  3PB8 X;  2BOA A;  2GU2 A;  1FT7 A;  4NGQ A;  4B6Z A;  1LAM A;  4RUH A;  2AFX A;  4X8I A;  4CPA A;  1Y0Y A;  3FEE A;  2AFO A;  2V8D A;  3PEI A;  3DLJ A;  2XEG A;  2QVP A;  5K8M A;  4UEZ A;  2PJ5 A;  4FWU A;  4OID A;  1XMB A;  1BLL E;  1XJO A;  5F09 A;  3NH4 A;  4P6Y A;  1VHO A;  5K8N A;  2JBJ A;  1YW6 A;  3WAB A;  4OKO A;  4A39 A;  4H2K A;  4OC2 A;  1CX8 A;  3GLJ A;  4A94 A;  1ARM A;  3BI1 A;  3D68 A; 
#chains in the Genus database with same CATH topology
 1VGY A;  4CAW A;  3JUW A;  1BPN A;  1Q7L A;  4DUK A;  5A28 A;  2R1I A;  2Y0M A;  4TWE A;  3TTH A;  4CGM A;  2BL1 A;  1QSM A;  2F8H A;  1MJ9 A;  2CTB A;  3D3S A;  1B6B A;  1S7L A;  4M6I A;  3SI2 A;  2FS5 A;  4TNU A;  2J8R A;  4MBU A;  2GLF A;  3KHX A;  1ELL P;  2J8M A;  2DF5 A;  1ZLI A;  4NGM A;  4CYN A;  1Z8L A;  1YLE A;  3NE8 A;  1S60 A;  4PXE A;  3TO9 A;  3NH8 A;  3MN8 A;  1IY7 A;  1KUV A;  1Z8W A;  2CTC A;  3B3T A;  4XPD C;  5FVJ A;  2B4D A;  2PIY A;  2QIR A;  5KTD A;  2C6G A;  2HB6 A;  2XEJ A;  3FMC A;  2BSW A;  2PDO A;  2PJ1 A;  2PJ2 A;  3H8F A;  5J8F A;  3TX8 A;  1TF8 A;  3V38 A;  2Z3O A;  3CXP A;  4P4E A;  1YX0 A;  4MCQ A;  4B12 A;  4UFW A;  3PZJ A;  4B5P B;  2B5G A;  1R43 A;  3D7G A;  2G3T A;  2RB7 A;  3G8W A;  3ZJ0 A;  2NSM A;  2B4B A;  1GYT A;  3TT2 A;  4XPK A;  4CAV A;  5DWM A;  2HQY A;  4EFD A;  2KCW A;  3P2H A;  2XEI A;  3VH9 A;  4NGN A;  2REE A;  2G0B A;  1M4L A;  1PCA A;  2NMT A;  5CBM A;  4OP4 A;  2I00 A;  1XIX A;  4E8O A;  2ZEN A;  4X5K A;  2BO9 A;  3D2P A;  2K5T A;  2VBQ A;  4J3G A;  3WR7 A;  1TXR A;  5LRK A;  4M6G A;  3V8I A;  1Z2L A;  2PJ0 A;  2C6P A;  3CXS A;  4F6A A;  1FNO A;  3N7Z A;  1NMT A;  4I49 A;  4MCS A;  2ZEH A;  4NGS A;  2PJC A;  2AFZ A;  4MY0 A;  3P2F A;  4C7H A;  4F9V A;  3UY5 A;  1XMT A;  4CRZ B;  2B58 A;  2WSA A;  3IC1 A;  3RZA A;  1CPS A;  1TKJ A;  1IYL A;  2DXQ A;  4FD7 A;  4YGO A;  4E2A A;  3CDX A;  1B87 A;  3I3G A;  1YK3 A;  1ZLH A;  3SJX A;  3PB9 X;  2OZG A;  3DSB A;  1QST A;  2ZEG A;  4PXB A;  1P0H A;  2FT0 A;  2ZEO A;  1RXT A;  2ZEL A;  3KI9 A;  2NYQ A;  5LYF A;  1YGH A;  4B5O A;  4MFL A;  5EBV A;  4E0A A;  1PYT B;  4KSI A;  3DDD A;  1VHS A;  3B3V A;  2F5I A;  1YSJ A;  3PFO A;  5AG7 A;  1XBU A;  4NCZ A;  4DYO A;  1HDQ A;  4FD4 A;  3R9E A;  4PSX A;  4B11 A;  5AG5 A;  1YR0 A;  3PBB A;  5J8C A;  2IQ6 A;  4U9Y A;  3FF3 A;  1S7N A;  4F9U A;  5I4M A;  1IID A;  4UEE A;  1EE3 P;  1NSA A;  1K4J A;  4LQ6 A;  2B4D B;  4BBH A;  4Z65 A;  1S7F A;  3NE7 A;  3PFE A;  4KOY A;  2JBK A;  1MJA A;  1U6M A;  3C26 A;  4JJX A;  5JQ4 A;  3A9L A;  3I1U A;  2Q0Y A;  3TOB A;  3BXM A;  1LAP A;  4MHN A;  3JRU A;  1YQE A;  4GM5 A;  4BMH A;  1Y0R A;  3IWW A;  3FIX A;  2ZOG A;  4B5P A;  4UBR A;  2HUZ A;  2EK8 A;  4MFQ A;  2B5G B;  4YU9 A;  4KZT A;  4ZX9 A;  2C6C A;  4JXQ A;  5LYL A;  4A38 A;  4B13 A;  5AGE A;  2WZN A;  3TOA A;  4JWP A;  4O23 A;  5KTC A;  3KZW A;  4JLY A;  4F0X A;  3N5F A;  4NEX A;  2PR1 A;  4X2T A;  1CP6 A;  2J8N A;  1KUY A;  3WT4 A;  3V7Z A;  5EC4 A;  3T9Y A;  2ABZ A;  4MMO A;  5CNP A;  1Y9W A;  5DS0 A;  1PU9 A;  5G1Z A;  3TC8 A;  3D7H A;  4PXC A;  2Q4V A;  4P4B A;  1ZG8 A;  5G21 A;  4UWI A;  1SQH A;  3T90 A;  3OWC A;  3B8G A;  2FE7 A;  4AVA A;  2ZXV A;  1F57 A;  2VL1 A;  3CZX A;  3IWG A;  4UWJ A;  2CF4 A;  4LX9 A;  3S9L A;  1Z9U A;  3BHX A;  5F47 A;  3WC6 A;  1R3N A;  2JEW A;  5GCN A;  3FNC A;  1RTQ A;  3L2N A;  4PK3 A;  3R95 A;  3DGV A;  2PVW A;  3PRT A;  5D29 A;  3GKR A;  2PVV A;  2O53 A;  3IU1 A;  5AG4 A;  4HKF A;  2VQY A;  2Q51 A;  4RN7 A;  4M6H A;  1TIQ A;  4G1P A;  3EY5 A;  5LRG A;  3D4U A;  1IYK A;  1XEB A;  2GRE A;  1BAV A;  2PR8 A;  2Q43 A;  2BEI A;  3F0A A;  4R76 A;  4CS0 B;  3NH5 A;  6CPA A;  2PJB A;  2PRB A;  5D8N A;  3BJ7 A;  3IEH A;  3LD2 A;  2AE6 A;  2HC9 A;  4UIA A;  4YFJ A;  1F2P A;  3R1K A;  4C2Y A;  1TF9 A;  2EBJ A;  1IGB A;  4MY3 A;  2P6F A;  5K8O A;  2HV2 A;  2J9A A;  4HPS A;  4OLL A;  4P45 A;  2QYV A;  3H8G A;  4AXV A;  4UCM A;  4OC1 A;  3CPA A;  5HXD A;  4QBJ A;  3B3S A;  3FXT A;  2YNC C;  3H4Q A;  3IFE A;  4NSQ A;  2X7B A;  3K2K A;  3IWE A;  4U9Z A;  3SI1 A;  3W6X A;  3W6S A;  2BUE A;  3KR5 A;  1UWY A;  4ZGY B;  3ISX A;  1NE9 A;  1N71 A;  4FUU A;  3R9F A;  2R8V A;  5LYD A;  3FX6 A;  2Z11 A;  3GY9 A;  4BIN A;  4OIW A;  3ZZI A;  4MFP A;  1CM0 A;  2ZPA A;  1IU8 A;  3FJU A;  1Q2C A;  2Q04 A;  3RBU A;  4P4D A;  5JGF A;  4MRI A;  2H5M A;  2I79 A;  4KOR A;  3VAT A;  4UFX A;  3QAY A;  2AFM A;  1IOF A;  4OC5 A;  2ZW6 A;  1Y7E A;  3WC5 A;  3IJ3 A;  4AG9 A;  1BOB A;  1QSN A;  2V8G A;  5F48 A;  4UCN A;  3VAR A;  2EWB A;  4XPD B;  1L0C A;  3IU2 A;  5LYI A;  4MHD A;  1LAN A;  1CPX A;  3DR8 A;  1LOK A;  4KOW A;  4PSW A;  4CAX A;  5IV0 A;  2I3C A;  2FXF A;  2FL4 A;  2IL4 A;  2PRQ A;  4K3N A;  4R7M A;  1Z5R A;  4UF4 A;  3SXO A;  4AG7 A;  1CJW A;  2WPX A;  4HNX B;  4UFV A;  4CYP A;  4JYW A;  5C82 A;  5IB0 A;  2CY2 A;  4CGP A;  2EVN A;  3QNV A;  5LRJ A;  1I21 A;  2OH1 A;  2V8H A;  2D4O A;  3FVL A;  1HDU A;  2CNM A;  3FYN A;  1JWQ A;  3CT9 A;  1M4I A;  1KWM A;  1X10 A;  1YLO A;  2GIV A;  2OZU A;  2IJZ A;  4QVT A;  4AVC A;  3JTK A;  4UIB A;  3DNS A;  4CAF A;  3D2M A;  4IHM A;  3G3S A;  2REF A;  2ARH A;  4GS4 A;  1QSO A;  4CGN A;  2QJ8 A;  4KOV A;  5C88 A;  4K30 A;  2ZW4 A;  4IAV A;  1M4G A;  2RFH A;  3S6K A;  4DJL A;  1BO4 A;  2Z10 A;  2ZOF A;  4CAE A;  1YVO A;  3RO0 A;  3H5Z A;  4QUS A;  5H86 A;  5H84 A;  5JH9 A;  1IIC A;  4MFK A;  3NA6 A;  1S5K A;  4HNY B;  4PQA A;  4KLW A;  1YME A;  2Q4Z A;  3KGQ A;  1ZG7 A;  2DPT A;  4FD6 A;  3F8K A;  4QC6 A;  4R8F A;  3RAM A;  2EUI A;  2BCO A;  4IK2 A;  2VZZ A;  1ARL A;  4YWY A;  5EMI A;  2P6G A;  4LUA A;  5G22 A;  5JM6 A;  4NJR A;  4P10 A;  4AVB A;  4A37 A;  2Q4Y A;  2C1C A;  2POK A;  3PB4 X;  4MCP A;  1IOI A;  5HVF A;  2OU2 A;  4P4J A;  2ZEF A;  3CXQ A;  2JLM A;  1TKH A;  2PJ6 A;  5K8P A;  1S7K A;  2GFQ A;  2ANP A;  1A2Z A;  4A95 A;  4W9Y A;  3KQX A;  2AFS A;  2Z3K A;  4MHZ A;  2PJ8 A;  3FEC A;  3VWD A;  4B14 A;  4C68 A;  3FBU A;  4R9M A;  4WJB A;  4F8Z A;  1QQ9 A;  2V8V A;  3HUV A;  7CPA A;  2Z0Z A;  4PV6 A;  3K9T A;  5A27 A;  4EWT A;  2CIJ A;  1F2O A;  4KOU A;  3SHP A;  1MK4 A;  2B3V A;  3TE4 A;  1LCP A;  3GIU A;  3IO1 A;  1QSR A;  3FH4 A;  1XF8 A;  2OB0 A;  3B35 A;  3TFY A;  3KR4 A;  2PJ7 A;  4B10 A;  4EVY A;  3S6F A;  4CRY B;  2ZED A;  4OC0 A;  5HVH A;  4XNH C;  3D67 A;  1FY7 A;  1UFH A;  4PK2 A;  3SI0 A;  2FIW A;  4R3L A;  2B3U A;  3E0K A;  4KOS A;  1BPM A;  4OC3 A;  4PPZ A;  5E96 A;  4FAI A;  2ZEM A;  4Y49 C;  2F7V A;  1Q2D A;  3VWE A;  4KOT A;  4L89 A;  4MFJ A;  1DE4 C;  1QMU A;  3TO6 A;  4NGT A;  4OME A;  5AG6 A;  2QEC A;  4H6Z A;  3EC4 A;  1Z8T A;  2O28 A;  4KUB A;  3HLP A;  3QB8 A;  4NGP A;  4ZYQ A;  3ISZ A;  4MCR A;  2G9D A;  5BWA B;  1TKF A;  4RS2 A;  4ZY2 A;  4NGR A;  3MGD A;  1VKC A;  4ONW A;  2VXK A;  5J1Q A;  1GHE A;  4RI1 A;  2EO8 A;  2WPW A;  4P4I A;  3B3C A;  4C2X A;  4ZI6 A;  2FVG A;  3D8P A;  4P4F A;  5DWN A;  4KUA A;  3F5B A;  4P44 A;  1MJB A;  2Z3N A;  4ZY0 A;  1XRY A;  2Z3M A;  1I1D A;  4YRH A;  4R6T A;  2YGW A;  3LWU A;  4KVO E;  2VZY A;  1DTD A;  5ELY A;  2ZW7 A;  1P4N A;  2YND A;  3GB0 A;  3S6H A;  2AFU A;  3GUX A;  3BLN A;  1AYE A;  1HEE A;  3FRM A;  3FB3 A;  3D66 A;  3DR6 A;  2ZW5 A;  4MJ8 A;  2C27 A;  4LQG A;  1I12 A;  4A30 A;  3NFZ A;  2ZEP A;  2XEF A;  2GAN A;  3MRU A;  1H8L A;  4II9 A;  2PJ9 A;  1CBX A;  2AFW A;  3EFA A;  1WWZ A;  2PJ3 A;  4KVM E;  2RC4 A;  2ZEE A;  3JVN A;  4A2Z A;  4ZY1 A;  1ZG9 A;  3W91 A;  5THW A;  1R57 A;  2A4N A;  2OZH A;  3RNZ A;  3K9U A;  1PUA A;  4Q36 A;  3D7D A;  1AMP A;  1CG2 A;  1LFW A;  3PP9 A;  2OOT A;  4A32 A;  3PBE A;  2QML A;  4CGL A;  4R57 A;  2R7H A;  2PJ4 A;  3KAS A;  4WWV A;  3BI0 A;  3SJF A;  5IB9 A;  2CNS A;  2G3A A;  3KL9 A;  3EXN A;  3SJG A;  2PE3 A;  2PCU A;  2Q44 A;  1CP7 A;  3GYA A;  2WYR A;  2PQ8 A;  2Z3P A;  1YW4 A;  2Q7B A;  4A33 A;  1S3Z A;  4JZ0 A;  1VIX A;  4CYQ A;  4M85 A;  4UA3 A;  3D7F A;  4NXY A;  4DNC A;  1KZF A;  3KKW A;  1X12 A;  1XFO A;  1Z8X A;  2PC1 A;  4KSF A;  1VHE A;  1Y7R A;  2OR4 A;  3PB6 X;  3B3W A;  3I9S A;  4BD9 A;  1AUG A;  2GLJ A;  3LOD A;  4CYO A;  4R3K A;  3IGR A;  2JEV A;  3CPX A;  3B2Y A;  3KQZ A;  5F46 A;  3S9M A;  4ZX8 A;  3FED A;  3QAH A;  4EME A;  3B7I A;  2JDC A;  4CGO A;  4JD6 A;  4ZBG A;  5KTA A;  3BJ8 A;  2DEA A;  3KHZ A;  2FIA A;  1NSL A;  3SXN A;  4MHP A;  2FSR A;  2Q7S A;  1OBR A;  1YRE A;  4PXD A;  3S9N A;  2ATR A;  3SJE A;  4H89 A;  2JDD A;  5CPA A;  2PJA A;  4L8A A;  1ZO0 A;  1M1D A;  1YVK A;  2PSW A;  4X3R A;  2PIZ A;  4IF5 A;  4MHY A;  1OZP A;  4UEF A;  3WC7 A;  4JXR A;  1Q2Y A;  2WUU A;  3TO7 A;  4OC4 A;  1LRZ A;  8CPA A;  4ONU A;  3PB7 X;  4MXU A;  3LMS A;  2V77 A;  4Q7A A;  3R9G A;  4A31 A;  4C2Z A;  4NFR A;  3TCV A;  3H8E A;  3T8W A;  5HVG A;  2CNT A;  1IB1 E;  1KUX A;  5IX3 A;  2CXA A;  4FD5 A;  4UCP A;  1ELM P;  2O4H A;  4FBE A;  1XE4 A;  4KSA A;  2EK9 A;  1JQG A;  4IUS A;  2IMO A;  3IIB A;  3PB8 X;  4NJQ A;  1M4D A;  1WK4 A;  2BOA A;  3EO4 A;  4KS9 A;  4KVX A;  4Q38 A;  1V0C A;  2GU2 A;  1FT7 A;  4NGQ A;  2DPS A;  2P0W A;  3R96 A;  5JPH A;  4MFZ A;  2D4P A;  5HH1 A;  5ISV A;  4B6Z A;  1LAM A;  3LAC A;  4XPL A;  2AFX A;  4KLV A;  4X8I A;  1M44 A;  4GXH A;  4RUH A;  4CPA A;  2Z3L A;  4M3S A;  1Y0Y A;  1Z4R A;  2YNC A;  3FEE A;  3RYO A;  2AFO A;  4OAE A;  2V8D A;  3PEI A;  2YNE A;  4C7I A;  3DLJ A;  2XEG A;  2FCK A;  4NF1 A;  5HMN A;  2VI7 A;  4OAD A;  4HNW B;  4QB9 A;  2QVP A;  3S6G A;  4MI4 A;  1ON0 A;  5K8M A;  4UEZ A;  1XOV A;  2PJ5 A;  4FWU A;  2P6E A;  4KOX A;  4OID A;  4H6U A;  1XMB A;  1J4J A;  4U5Y A;  1BLL E;  1XJO A;  1Z4E A;  2AJ6 A;  5F09 A;  3NH4 A;  4P6Y A;  2VEZ A;  1VHO A;  1Y9K A;  5K8N A;  4F0Y A;  2JBJ A;  3PGP A;  1YW6 A;  5I0C A;  3WAB A;  4R87 A;  4OKO A;  4A39 A;  5F49 A;  4H2K A;  1RO5 A;  4OC2 A;  5G20 A;  2ODF A;  4XNH B;  1CX8 A;  2R98 A;  2GE3 A;  3GLJ A;  4A94 A;  4AB7 A;  1ARM A;  4Y49 B;  4ORF A;  3BI1 A;  3D68 A; 
#chains in the Genus database with same CATH homology
 1VGY A;  1BPN A;  1Q7L A;  4DUK A;  4TWE A;  2CTB A;  3SI2 A;  2F8H A;  4TNU A;  2GLF A;  3KHX A;  1ELL P;  1ZLI A;  4NGM A;  1Z8L A;  4PXE A;  3NH8 A;  3MN8 A;  1IY7 A;  2CTC A;  3B3T A;  2PIY A;  2C6G A;  2HB6 A;  2XEJ A;  3FMC A;  2PJ1 A;  2PJ2 A;  3H8F A;  3TX8 A;  1TF8 A;  3V38 A;  4P4E A;  4MCQ A;  3D7G A;  1R43 A;  2RB7 A;  2NSM A;  1GYT A;  4EFD A;  2XEI A;  3VH9 A;  4NGN A;  1M4L A;  1PCA A;  5CBM A;  4OP4 A;  2ZEN A;  2BO9 A;  1TXR A;  5LRK A;  1Z2L A;  2PJ0 A;  2C6P A;  1FNO A;  4MCS A;  2ZEH A;  4NGS A;  2PJC A;  2AFZ A;  4F9V A;  3IC1 A;  3RZA A;  1CPS A;  1TKJ A;  3CDX A;  3SJX A;  1ZLH A;  3PB9 X;  4PXB A;  2ZEG A;  2ZEO A;  2ZEL A;  3KI9 A;  2NYQ A;  5LYF A;  1PYT B;  4KSI A;  3B3V A;  1YSJ A;  3PFO A;  1XBU A;  4DYO A;  1HDQ A;  3PBB A;  2IQ6 A;  3FF3 A;  4F9U A;  5I4M A;  4UEE A;  1EE3 P;  1NSA A;  4Z65 A;  3PFE A;  2JBK A;  3I1U A;  3BXM A;  1LAP A;  4MHN A;  3JRU A;  4GM5 A;  1Y0R A;  3IWW A;  2ZOG A;  4YU9 A;  2EK8 A;  4ZX9 A;  2C6C A;  5LYL A;  4A38 A;  2WZN A;  4O23 A;  3KZW A;  3N5F A;  4X2T A;  1CP6 A;  3WT4 A;  3V7Z A;  2ABZ A;  4MMO A;  5DS0 A;  3TC8 A;  3D7H A;  4PXC A;  4P4B A;  1ZG8 A;  1F57 A;  2VL1 A;  2CF4 A;  3S9L A;  3BHX A;  3WC6 A;  1R3N A;  2JEW A;  1RTQ A;  3L2N A;  3DGV A;  2PVW A;  3PRT A;  5D29 A;  2PVV A;  2O53 A;  2Q51 A;  4G1P A;  5LRG A;  3D4U A;  1BAV A;  2GRE A;  2Q43 A;  4R76 A;  3NH5 A;  6CPA A;  2PJB A;  5D8N A;  3IEH A;  4UIA A;  2HC9 A;  1F2P A;  1TF9 A;  1IGB A;  5K8O A;  2J9A A;  4P45 A;  2QYV A;  3H8G A;  4AXV A;  4OC1 A;  3CPA A;  5HXD A;  3B3S A;  3IFE A;  3K2K A;  3SI1 A;  3KR5 A;  1UWY A;  3ISX A;  4FUU A;  5LYD A;  3FX6 A;  4OIW A;  3FJU A;  3RBU A;  4P4D A;  5JGF A;  4MRI A;  3VAT A;  2AFM A;  4OC5 A;  1Y7E A;  3WC5 A;  3IJ3 A;  2V8G A;  3VAR A;  2EWB A;  5LYI A;  1LAN A;  1CPX A;  1LOK A;  2I3C A;  4K3N A;  2PRQ A;  4R7M A;  1Z5R A;  4UF4 A;  4JYW A;  3QNV A;  5LRJ A;  2V8H A;  3FVL A;  1HDU A;  3CT9 A;  1KWM A;  1YLO A;  2IJZ A;  4UIB A;  4IHM A;  2QJ8 A;  4IAV A;  2RFH A;  4DJL A;  2ZOF A;  5JH9 A;  3NA6 A;  4PQA A;  4R8F A;  1YME A;  2Q4Z A;  3KGQ A;  1ZG7 A;  3RAM A;  2BCO A;  4IK2 A;  4YWY A;  1ARL A;  5JM6 A;  4NJR A;  4P10 A;  4A37 A;  2C1C A;  2POK A;  3PB4 X;  4MCP A;  5HVF A;  4P4J A;  2ZEF A;  1TKH A;  2PJ6 A;  5K8P A;  2ANP A;  4W9Y A;  3KQX A;  2AFS A;  4MHZ A;  2PJ8 A;  3FEC A;  4F8Z A;  4WJB A;  1QQ9 A;  2V8V A;  3HUV A;  7CPA A;  3K9T A;  4EWT A;  2CIJ A;  1F2O A;  1LCP A;  3IO1 A;  3FH4 A;  3B35 A;  3KR4 A;  2PJ7 A;  2ZED A;  4OC0 A;  5HVH A;  3D67 A;  3SI0 A;  4FAI A;  1BPM A;  4OC3 A;  4PPZ A;  2ZEM A;  2F7V A;  1DE4 C;  1QMU A;  4NGT A;  4OME A;  3HLP A;  4NGP A;  4ZYQ A;  3ISZ A;  4MCR A;  2G9D A;  1TKF A;  4ZY2 A;  5J1Q A;  4NGR A;  4ONW A;  4P4I A;  3B3C A;  4ZI6 A;  2FVG A;  4P4F A;  4P44 A;  4ZY0 A;  1XRY A;  4R6T A;  3LWU A;  1DTD A;  5ELY A;  3GB0 A;  2AFU A;  3GUX A;  1AYE A;  1HEE A;  3D66 A;  4LQG A;  3NFZ A;  2ZEP A;  2XEF A;  3MRU A;  1H8L A;  2PJ9 A;  1CBX A;  2AFW A;  2PJ3 A;  2ZEE A;  4ZY1 A;  1ZG9 A;  5THW A;  3D7D A;  1AMP A;  1CG2 A;  1LFW A;  2OOT A;  3PBE A;  2PJ4 A;  3KAS A;  4WWV A;  3BI0 A;  3SJF A;  5IB9 A;  3KL9 A;  3SJG A;  2PE3 A;  2PCU A;  1CP7 A;  2WYR A;  1YW4 A;  4JZ0 A;  1VIX A;  3D7F A;  1XFO A;  1VHE A;  2OR4 A;  3PB6 X;  3B3W A;  4BD9 A;  2GLJ A;  3CPX A;  3B2Y A;  3KQZ A;  3S9M A;  4ZX8 A;  3FED A;  4EME A;  3B7I A;  2DEA A;  3KHZ A;  4MHP A;  1OBR A;  4PXD A;  3S9N A;  3SJE A;  5CPA A;  2PJA A;  4X3R A;  2PIZ A;  4MHY A;  4UEF A;  3WC7 A;  4OC4 A;  8CPA A;  3PB7 X;  4MXU A;  3LMS A;  2V77 A;  4Q7A A;  5HVG A;  4NFR A;  3H8E A;  3T8W A;  1ELM P;  2O4H A;  4FBE A;  2EK9 A;  1JQG A;  4NJQ A;  2IMO A;  3IIB A;  3PB8 X;  2BOA A;  2GU2 A;  1FT7 A;  4NGQ A;  4B6Z A;  1LAM A;  4RUH A;  2AFX A;  4X8I A;  4CPA A;  1Y0Y A;  3FEE A;  2AFO A;  2V8D A;  3PEI A;  3DLJ A;  2XEG A;  2QVP A;  5K8M A;  4UEZ A;  2PJ5 A;  4FWU A;  4OID A;  1XMB A;  1BLL E;  1XJO A;  5F09 A;  3NH4 A;  4P6Y A;  1VHO A;  5K8N A;  2JBJ A;  1YW6 A;  3WAB A;  4OKO A;  4A39 A;  4H2K A;  4OC2 A;  1CX8 A;  3GLJ A;  4A94 A;  1ARM A;  3BI1 A;  3D68 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...