2JDCA

Glyphosate n-acetyltransferase bound to oxidized coa and sulfate
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
145
structure length
145
Chain Sequence
IEVKPINAEDTYELRHRILRPNQPIEACMFESDLLRGAFHLGGYYGGKLISIASFHQAEHSELQGQKQYQLRGMATLEGYREQKAGSSLIKHAEEILRKRGADLLWCNARTSASGYYKKLGFSEQGEVFDTPPVGPHILMYKRIT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords GLYPHOSATE N-ACETYLTRANSFERASE
publication title The Molecular Basis of Glyphosate Resistance by an Optimized Microbial Acetyltransferase.
pubmed doi rcsb
source organism Bacillus licheniformis
total genus 38
structure length 145
sequence length 145
ec nomenclature
pdb deposition date 2007-01-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 2jdcA00
2IL4A 3D3SA 3TFYA 1YX0A 4R57A 4ONUA 4XNHC 1M44A 2FIAA 3GKRA 1S3ZA 1S7NA 4AVCA 1XF8A 2FIWA 4HNYB 4M85A 3H4QA 4XPDB 3GY9A 2Z0ZA 1XMTA 4E2AA 2JLMA 1M4IA 5IV0A 3FNCA 3FB3A 4R3LA 3W91A 1I1DA 1J4JA 3S6GA 3BJ7A 2JEVA 1BO4A 2G3TA 2Q4YA 3PGPA 5ISVA 4UBRA 1YREA 2Z10A 3IGRA 1QSTA 3JVNA 1S5KA 2R98A 1L0CA 4IF5A 2OH1A 1KUYA 2NMTA 3V8IA 3EFAA 2DXQA 2OZGA 4UWIA 1XIXA 1Y9KA 4QC6A 1YGHA 2I00A 3LD2A 2VEZA 2OB0A 3R9FA 2Z11A 3CXPA 4CAWA 4Y49B 3TCVA 4FD7A 2B58A 3R9EA 2ARHA 5I0CA 1NSLA 5C88A 3F0AA 4CS0B 4F0YA 3NE7A 4J3GA 1Y7RA 2P6GA 3D2PA 4L8AA 3S6FA 4MHDA 5EBVA 4KZTA 5F47A 4B5PB 4JLYA 1IYKA 1KUXA 5J8FA 1YVOA 2CY2A 4XPLA 2VXKA 1YVKA 2X7BA 2P6FA 3C26A 5HH1A 2QECA 3P2HA 2WPXA 1WWZA 4PK2A 5KTDA 4U9ZA 2H5MA 4KVXA 3R95A 4B5PA 5CNPA 3D2MA 3UY5A 3TO7A 4II9A 1PUAA 4JXRA 3I9SA 1MK4A 3EO4A 2FL4A 4JXQA 2B3UA 2REEA 4JD6A 5J8CA 1YR0A 3SXOA 2JDDA 2WPWA 2ZW6A 4CRYB 3R1KA 2Y0MA 4R9MA 4KLVA 3P2FA 1S7LA 1S60A 3QAHA 4H6ZA 3VWEA 1QSMA 2EVNA 4E8OA 3FYNA 5KTCA 3N7ZA 5DWNA 2HUZA 3EY5A 3K9UA 2BL1A 3I3GA 3TOBA 4KVOE 1IICA 2R8VA 4GS4A 3TO9A 3FXTA 4B5OA 4MY0A 2OZHA 1VKCA 4NCZA 4CAVA 2PC1A 4MBUA 1I21A 3TT2A 3BJ8A 2OU2A 4KOUA 2PDOA 4OADA 5H86A 4M3SA 1RXTA 1VHSA 2C27A 4AG7A 4KOXA 3QB8A 4PK3A 2AE6A 2VQYA 4QBJA 1B87A 4U9YA 4KORA 3LODA 1MJBA 4KOTA 4PV6A 4ORFA 4OAEA 4KOYA 3TE4A 2Q7BA 5FVJA 3TTHA 1OZPA 4R3KA 4AB7A 2GE3A 4LX9A 2B4BA 4KOVA 1KUVA 1UFHA 1YLEA 2OZUA 2ZXVA 5E96A 3DDDA 1M4GA 2ATRA 4HKFA 2QIRA 4I49A 3DR8A 2R7HA 3TO6A 2VI7A 4KUAA 1ON0A 3IWGA 1QSRA 2HV2A 4XNHB 4XPDC 1B6BA 3EC4A 2G3AA 3ZJ0A 3S6HA 1NE9A 3OWCA 4KVME 1Y9WA 1M1DA 4YFJA 1PU9A 1S7KA 4PSWA 2G0BA 4F6AA 3W6SA 1FY7A 5KTAA 2BSWA 2FCKA 3EXNA 4KLWA 1N71A 3T9YA 4AVBA 2PR8A 5JQ4A 3FBUA 1KZFA 4UWJA 4IUSA 3SHPA 2FE7A 2VBQA 4QB9A 3GYAA 4LUAA 3KKWA 2A4NA 2B5GB 2CNSA 2ZW5A 2CNTA 4MJ8A 5HMNA 1IB1E 4H89A 4NXYA 2O28A 4NEXA 1GHEA 3TOAA 3S6KA 4K30A 4Y49C 2EUIA 2B5GA 5EC4A 3FIXA 1QSOA 2PQ8A 2FT0A 3F5BA 1LRZA 2BEIA 1Q2DA 3SXNA 1U6MA 4HNWB 1WK4A 1CJWA 2FSRA 1P0HA 2REFA 2PSWA 2B3VA 4AVAA 2QMLA 4ZBGA 3DNSA 3JUWA 4FD6A 2GANA 4E0AA 1Q2YA 2Q04A 5JPHA 2F5IA 4L89A 4FD5A 3D8PA 4OLLA 1R57A 4NSQA 5F49A 5IX3A 1P4NA 2PR1A 2HQYA 4QVTA 1Z9UA 2R1IA 1MJAA 2P0WA 3W6XA 3E0KA 5F46A 4X5KA 4YGOA 4BMHA 2FS5A 5C82A 1S7FA 2I79A 1SQHA 4H6UA 3DSBA 2P6EA 1YK3A 1Q2CA 3G3SA 2D4OA 1RO5A 3CXQA 1IYLA 2D4PA 5F48A 4XPKA 2GIVA 4MY3A 3CXSA 2PRBA 4KOSA 2Q0YA 4U5YA 3MGDA 2VZZA 4CRZB 2ZPAA 2AJ6A 3R96A 3B8GA 4RI1A 1MJ9A 1CM0A 2JDCA 4JWPA 4KUBA 2Q4VA 4EVYA 2VZYA 3PZJA 1BOBA 1Z4EA 3F8KA 3ZZIA 3BLNA 3VWDA 2J8MA 3RYOA 4HNXB 2RC4A 5GCNA 2J8NA 2ZW7A 5DWMA 4QUSA 4MI4A 2KCWA 4YRHA 3PP9A 1K4JA 1M4DA 3T90A 1NMTA 4NF1A 4R87A 4JJXA 3DR6A 4FD4A 2FXFA 2B4DB 1IIDA 5H84A 1QSNA 1Z4RA 4DNCA 1TIQA 4KOWA 4AG9A 3G8WA 2ZW4A 5IB0A 3FRMA 2CNMA 1XEBA 2K5TA 3R9GA 2B4DA 1I12A 1V0CA 2BUEA 2J8RA 3WR7A 4PSXA 4CAXA 4UA3A 2Q44A 1XE4A 4RS2A
chains in the Genus database with same CATH superfamily
2IQ6A 2XEIA 3IWEA 2HC9A 2V8VA 4NGMA 2BCOA 3SJEA 4CGPA 2PJ4A 2IL4A 3D3SA 4GM5A 1IU8A 2OR4A 2QYVA 3TFYA 2PRQA 1YX0A 4TNUA 4UEEA 3B2YA 4IK2A 4R57A 4ONUA 4XNHC 1ZG9A 4ONWA 1M44A 5AG4A 2FIAA 3GKRA 1S3ZA 1AYEA 3KQZA 1S7NA 3QAYA 4P4BA 4LQ6A 4A38A 3K9TA 4AVCA 2CTCA 1XF8A 1TXRA 3IC1A 1ZLIA 1ARMA 4OC2A 4B10A 4ZY2A 2FIWA 4HNYB 2GLFA 4M85A 2XEFA 4X3RA 1X10A 3S9NA 3H4QA 4XPDB 3VATA 3GY9A 3VARA 5LRKA 3S9LA 2Z0ZA 4UCMA 1XMTA 4E2AA 4MHZA 4C7IA 5CBMA 2JLMA 1M4IA 1ELMP 5IV0A 4X2TA 3FNCA 3FB3A 4R3LA 5THWA 2WUUA 3KR5A 2AFZA 4DJLA 3PFOA 3W91A 3WC6A 1I1DA 4CGLA 3PBEA 1J4JA 3S6GA 3BJ7A 1XOVA 2JEVA 4MFQA 1BO4A 4UEZA 3PBBA 2G3TA 1Z5RA 3KQXA 4ZX8A 4UFXA 2DF5A 2Q4YA 3PGPA 5ISVA 4OIDA 4UBRA 1YREA 2BO9A 2Z10A 2ZEGA 3IGRA 4KS9A 4M6HA 1R3NA 1QSTA 3JVNA 1S5KA 2R98A 1L0CA 4YWYA 5JM6A 1ZG8A 3KHZA 4IF5A 1YW6A 2OH1A 2PCUA 1CX8A 3D66A 1KUYA 2NMTA 3SJXA 1QQ9A 4TWEA 4F9VA 2JBKA 3V8IA 2BOAA 3EFAA 4MXUA 5DS0A 1VHEA 3WABA 3S9MA 2EWBA 2GFQA 2DXQA 2OZGA 4UWIA 1XIXA 1Y9KA 4QC6A 1Q7LA 1YGHA 4P4FA 2I00A 3CPXA 3LD2A 4NGRA 2NYQA 4JZ0A 2VEZA 2OB0A 3R9FA 2Z11A 3CXPA 4P4JA 4FAIA 4CAWA 3GB0A 4Y49B 1PCAA 2ZEDA 3TCVA 2V8GA 5LYDA 4FD7A 4P4EA 3KZWA 4B11A 4WJBA 4Q36A 4C68A 4PQAA 2B58A 3TC8A 1XFOA 3R9EA 2ARHA 4MFKA 3NA6A 4NGNA 3RO0A 5I0CA 4CGOA 1ZG7A 3D7DA 4P45A 1NSLA 4A30A 4F0XA 1EE3P 2PJ6A 3F0AA 4CS0B 5C88A 4KSFA 4F0YA 3NE7A 3IO1A 2DPTA 5A28A 3CDXA 3PB8X 1JQGA 3HUVA 4J3GA 1Y7RA 3DGVA 2P6GA 2YNEA 3D2PA 3N5FA 4L8AA 4CAEA 3WC7A 3S6FA 1IGBA 4MHDA 4MCRA 5EBVA 2YNDA 3LWUA 4KZTA 5F47A 4B5PB 4JLYA 1IYKA 1KUXA 2EBJA 5LYIA 5J8FA 1YVOA 4MHNA 2PVVA 2CY2A 4A33A 2FVGA 4XPLA 2VXKA 1YVKA 2X7BA 2ZEEA 3WT4A 4CYNA 2P6FA 3C26A 5HH1A 4PXDA 2QECA 1HDUA 2EK8A 3P2HA 2WSAA 1YW4A 2WPXA 1WWZA 4PK2A 5D8NA 4BBHA 5KTDA 4NJRA 4U9ZA 2H5MA 4KVXA 3R95A 4F8ZA 5AG5A 4B5PA 5CNPA 7CPAA 4P44A 2ZENA 3L2NA 2PJ8A 3D2MA 3UY5A 3TO7A 4II9A 1PUAA 4JXRA 3I9SA 1MK4A 3EO4A 5G20A 3BI0A 2FL4A 2ANPA 4JXQA 2ZEPA 2PJ9A 2B3UA 2PJ3A 2REEA 4JD6A 5K8PA 5J8CA 1YR0A 3SXOA 2JDDA 3B3TA 2WPWA 4CPAA 5HXDA 2C1CA 2ZW6A 4CRYB 4K3NA 3R1KA 2Y0MA 4F9UA 4R9MA 4KLVA 3IEHA 3FEDA 1UWYA 3RNZA 2GREA 3P2FA 1S7LA 1S60A 3QAHA 4H6ZA 3VWEA 1QSMA 2EVNA 4E8OA 5K8NA 4MCQA 5LRJA 3GLJA 3FYNA 5KTCA 2ZEOA 3N7ZA 2PE3A 1ARLA 3H8EA 1Z2LA 4UCPA 2YNCC 5DWNA 2ZEMA 2HUZA 3EY5A 3D68A 3K9UA 1CPXA 4MFPA 2BL1A 3I3GA 4UIBA 5AG7A 4KVOE 4OKOA 3TOBA 4DUKA 1IICA 1XRYA 2VL1A 3IJ3A 3B3SA 2R8VA 4C2XA 2PIYA 2Q4ZA 4GS4A 3TO9A 5A27A 3RZAA 1QMUA 2JBJA 3FXTA 4B5OA 4MY0A 2Q43A 2OZHA 1VKCA 4NCZA 1A2ZA 4CAVA 1Y0YA 4PXEA 5D29A 3SI0A 2PJCA 4PXCA 2PJ7A 2PC1A 3VH9A 4UCNA 4MBUA 1I21A 3NH5A 3TT2A 3BJ8A 3NH4A 1XJOA 3KR4A 3NH8A 2RFHA 4W9YA 1PYTB 2OU2A 4KOUA 2PDOA 4OADA 4JYWA 3TX8A 5JH9A 5H86A 4CGMA 4M3SA 4ZGYB 1RXTA 1VHSA 2C27A 4OMEA 8CPAA 2Z3KA 4AG7A 4A32A 4O23A 4KOXA 1VIXA 4NGTA 2EK9A 3QB8A 4PK3A 3SI1A 2Q7SA 4DYOA 3D7GA 2AE6A 2VQYA 5EMIA 2V77A 4QBJA 1B87A 4U9YA 2RB7A 4MMOA 4MCPA 4HPSA 3DLJA 4KORA 4ZX9A 1CPSA 4OIWA 2V8HA 3FH4A 1Y7EA 3LODA 3MRUA 2OOTA 1MJBA 4KOTA 4PV6A 4ORFA 3KGQA 4OAEA 3IU2A 4KSAA 3SI2A 4KOYA 3H8FA 5AGEA 3TE4A 1F57A 2IMOA 2Q7BA 4UEFA 5FVJA 3TTHA 1OZPA 4R3KA 3GUXA 5CPAA 3B3CA 4AB7A 2GE3A 1JWQA 4LX9A 2B4BA 1LANA 4KOVA 5HVHA 1KUVA 1UFHA 4C2YA 1YLEA 2OZUA 3WC5A 4A37A 2ZXVA 5JGFA 4RN7A 5E96A 3DDDA 1M4GA 4FBEA 2ATRA 3IFEA 4HKFA 4P10A 2QIRA 3NFZA 4I49A 4UFWA 4C7HA 2ZOFA 3DR8A 2R7HA 3D67A 3TO6A 4NGSA 4EMEA 2Z3NA 2VI7A 3BXMA 3CZXA 1ON0A 3IWWA 4KUAA 4R6TA 2PJ1A 2ZOGA 3IWGA 1QSRA 3QNVA 4P6YA 5K8OA 4Z65A 2HV2A 4XNHB 4XPDC 1B6BA 3EC4A 2G3AA 3ZJ0A 3JTKA 1IOIA 3S6HA 2F7VA 4OC5A 1HEEA 2GLJA 3PEIA 1NE9A 3OWCA 4KVME 1Y9WA 1M1DA 4A95A 4YFJA 1PU9A 1S7KA 4PSWA 2G0BA 4MCSA 4Q38A 3W6SA 1LAPA 4F6AA 4OC0A 1FY7A 5KTAA 4CAFA 2BSWA 3HLPA 1VHOA 2FCKA 3EXNA 4KLWA 1VGYA 1N71A 2AFXA 3KASA 3T9YA 4AVBA 2PR8A 3SJGA 1TKJA 4CYPA 5JQ4A 3FBUA 1KZFA 2Z3MA 4UWJA 6CPAA 4IUSA 3SHPA 1IY7A 4FUUA 1BPNA 2FE7A 4CGNA 1AMPA 1YQEA 2VBQA 4QB9A 3GYAA 4LUAA 3KKWA 4G1PA 4MFLA 4UIAA 2ABZA 2A4NA 2B5GB 2CNSA 2ZW5A 5K8MA 1TF9A 2CNTA 4MJ8A 4B14A 5HMNA 1BAVA 1IB1E 4H89A 2AFOA 4NXYA 2QJ8A 3V7ZA 1YLOA 1BLLE 4LQGA 4B6ZA 2C6GA 3FF3A 4YU9A 3ISXA 4MFZA 3PB6X 2O28A 3BHXA 2PIZA 2DPSA 5ELYA 4NEXA 4R8FA 3I1UA 1GHEA 3FX6A 3TOAA 3S6KA 3LACA 4K30A 5G22A 1LCPA 2EUIA 4Y49C 5LRGA 2B5GA 5EC4A 4RUHA 1HDQA 3FIXA 3JRUA 4P4DA 1QSOA 2PQ8A 2FT0A 2DEAA 2YGWA 1F2OA 4NFRA 4WWVA 3D7HA 1R43A 3CT9A 3F5BA 1LRZA 2BEIA 4OP4A 1Q2DA 5HVFA 3RAMA 3SXNA 4EFDA 1Z8LA 3IIBA 3MN8A 1LAMA 1AUGA 3FEEA 4IAVA 1U6MA 2O4HA 3PB7X 1F2PA 4HNWB 5J1QA 1WK4A 5IB9A 1CJWA 2NSMA 2AFWA 2PVWA 1TKHA 4P4IA 2FSRA 1P0HA 2REFA 2PSWA 2B3VA 2ZEHA 4AVAA 1FT7A 2J9AA 2QMLA 1FNOA 4GXHA 4ZBGA 2I3CA 2JEWA 4OC3A 4ZI6A 3BI1A 2QVPA 3K2KA 4KSIA 3DNSA 3JUWA 2Z3LA 4FD6A 2GANA 4E0AA 1Q2YA 2Q04A 1ZLHA 3IU1A 5JPHA 2CF4A 2F5IA 2WYRA 4L89A 5BWAB 1CG2A 2V8DA 4FD5A 5AG6A 5HVGA 4CYOA 2Q51A 3D8PA 4CYQA 4MFJA 4EWTA 4OLLA 4ZY1A 4X8IA 1R57A 1H8LA 3D7FA 4NSQA 4B12A 3RBUA 5F49A 4A2ZA 2C6CA 1DTDA 5IX3A 1P4NA 1M4LA 2PR1A 2HQYA 2XEJA 4QVTA 1Z9UA 4C2ZA 5I4MA 2GU2A 1OBRA 2R1IA 3PRTA 1MJAA 2P0WA 5G21A 1LOKA 4NJQA 3PB4X 3W6XA 3E0KA 1X12A 5F46A 4UFVA 4X5KA 1ELLP 4YGOA 4BMHA 2FS5A 1NSAA 2HB6A 5C82A 1S7FA 3PFEA 1IOFA 2I79A 3SJFA 1SQHA 4H6UA 4B13A 3DSBA 4BD9A 2Z3OA 1TKFA 2P6EA 1YK3A 1Q2CA 3G3SA 2D4OA 4FWUA 4OC1A 1RO5A 2POKA 3GIUA 1Z8XA 2PJ2A 1TF8A 1IYLA 3CXQA 2D4PA 3LMSA 4UF4A 5F48A 4AXVA 4A94A 1YMEA 4R76A 5LYFA 4XPKA 2EO8A 4IHMA 2GIVA 2CTBA 3KHXA 3B3WA 4MY3A 2PJBA 4ZYQA 4PXBA 3CXSA 2PRBA 1Z8TA 4KOSA 2F8HA 2Q0YA 4U5YA 3MGDA 2VZZA 4CRZB 3T8WA 4NGQA 2ZPAA 3NE8A 2AJ6A 3H5ZA 3R96A 3B8GA 4PPZA 4RI1A 1MJ9A 3H8GA 2ODFA 1CM0A 2IJZA 1GYTA 1YSJA 2JDCA 2ZELA 3KI9A 4OC4A 4JWPA 4KUBA 2O53A 2Q4VA 4H2KA 4EVYA 2VZYA 3PZJA 5F09A 2PJ0A 1BOBA 1Z4EA 3F8KA 3ZZIA 1XMBA 2PJAA 1DE4C 2CIJA 1CP7A 2ZEFA 3BLNA 3VWDA 2C6PA 2J8MA 5G1ZA 3RYOA 3FVLA 4HNXB 2RC4A 4M6IA 5GCNA 4MHPA 2J8NA 2ZW7A 5DWMA 4QUSA 4MI4A 3CPAA 2KCWA 1RTQA 4YRHA 4R7MA 2YNCA 1K4JA 3PB9X 3PP9A 3FMCA 1M4DA 3T90A 1NMTA 4NF1A 4A39A 4R87A 2AFUA 2CXAA 4JJXA 3DR6A 2G9DA 1LFWA 3V38A 1Z8WA 4FD4A 2FXFA 3D4UA 2B4DB 4M6GA 4A31A 2XEGA 1IIDA 1BPMA 3FECA 3B7IA 3A9LA 2PJ5A 5H84A 2WZNA 3B3VA 4MHYA 1QSNA 1Z4RA 4DNCA 1TIQA 3KL9A 4ZY0A 1CP6A 2Z3PA 4KOWA 4AG9A 4NGPA 3G8WA 2ZW4A 3ISZA 1KWMA 3B35A 5IB0A 3FRMA 2CNMA 3FJUA 1XEBA 4BINA 2K5TA 3R9GA 4Q7AA 2B4DA 1I12A 4MRIA 1V0CA 1Y0RA 2AFSA 2BUEA 1XBUA 2J8RA 3WR7A 1ZO0A 4PSXA 4CAXA 5LYLA 4UA3A 2Q44A 1XE4A 1CBXA 2AFMA 4RS2A
chains in the Genus database with same CATH topology
3IWEA 4CGPA 2IL4A 3D3SA 3TFYA 1YX0A 4R57A 4ONUA 4XNHC 1M44A 5AG4A 2FIAA 3GKRA 1S3ZA 1S7NA 4AVCA 1XF8A 4B10A 2FIWA 4HNYB 4M85A 3H4QA 4XPDB 3GY9A 2Z0ZA 4UCMA 1XMTA 4E2AA 4C7IA 2JLMA 1M4IA 5IV0A 3FNCA 3FB3A 4R3LA 2WUUA 3W91A 1I1DA 4CGLA 1J4JA 3S6GA 3BJ7A 2JEVA 4MFQA 1BO4A 2G3TA 4UFXA 2Q4YA 3PGPA 5ISVA 4UBRA 1YREA 2Z10A 3IGRA 4KS9A 1QSTA 3JVNA 1S5KA 2R98A 1L0CA 4IF5A 2OH1A 1KUYA 2NMTA 3V8IA 3EFAA 2DXQA 2OZGA 4UWIA 1XIXA 1Y9KA 4QC6A 1YGHA 2I00A 3LD2A 2VEZA 2OB0A 3R9FA 2Z11A 3CXPA 4CAWA 4Y49B 3TCVA 4FD7A 4B11A 4Q36A 4C68A 2B58A 3R9EA 2ARHA 4MFKA 5I0CA 4CGOA 1NSLA 4A30A 4F0XA 5C88A 3F0AA 4CS0B 4KSFA 4F0YA 3NE7A 2DPTA 5A28A 4J3GA 1Y7RA 2P6GA 2YNEA 3D2PA 4L8AA 4CAEA 3S6FA 4MHDA 5EBVA 2YNDA 4KZTA 5F47A 4B5PB 4JLYA 1IYKA 1KUXA 5J8FA 1YVOA 2CY2A 4A33A 4XPLA 2VXKA 1YVKA 2X7BA 4CYNA 2P6FA 3C26A 5HH1A 2QECA 3P2HA 2WSAA 2WPXA 1WWZA 4PK2A 4BBHA 5KTDA 4U9ZA 2H5MA 4KVXA 3R95A 5AG5A 4B5PA 5CNPA 3D2MA 3UY5A 3TO7A 4II9A 1PUAA 4JXRA 3I9SA 1MK4A 3EO4A 5G20A 2FL4A 4JXQA 2B3UA 2REEA 4JD6A 5J8CA 1YR0A 3SXOA 2JDDA 2WPWA 2ZW6A 4CRYB 3R1KA 2Y0MA 4R9MA 4KLVA 3P2FA 1S7LA 1S60A 3QAHA 4H6ZA 3VWEA 1QSMA 2EVNA 4E8OA 3FYNA 5KTCA 3N7ZA 4UCPA 2YNCC 5DWNA 2HUZA 3EY5A 3K9UA 4MFPA 2BL1A 3I3GA 3TOBA 5AG7A 4KVOE 1IICA 2R8VA 4C2XA 4GS4A 3TO9A 5A27A 3FXTA 4B5OA 4MY0A 2OZHA 1VKCA 4NCZA 4CAVA 2PC1A 4UCNA 4MBUA 1I21A 3TT2A 3BJ8A 2OU2A 4KOUA 2PDOA 4OADA 5H86A 4CGMA 4M3SA 4ZGYB 1RXTA 1VHSA 2C27A 2Z3KA 4AG7A 4A32A 4KOXA 3QB8A 4PK3A 2AE6A 2VQYA 4QBJA 1B87A 4U9YA 4KORA 3LODA 1MJBA 4KOTA 4PV6A 4ORFA 4OAEA 3IU2A 4KSAA 4KOYA 5AGEA 3TE4A 2Q7BA 5FVJA 3TTHA 1OZPA 4R3KA 4AB7A 2GE3A 4LX9A 2B4BA 4KOVA 1KUVA 1UFHA 4C2YA 1YLEA 2OZUA 2ZXVA 5E96A 3DDDA 1M4GA 2ATRA 4HKFA 2QIRA 4I49A 4UFWA 4C7HA 3DR8A 2R7HA 3TO6A 2Z3NA 2VI7A 4KUAA 1ON0A 3IWGA 1QSRA 2HV2A 4XNHB 4XPDC 1B6BA 3EC4A 2G3AA 3ZJ0A 3JTKA 3S6HA 1NE9A 3OWCA 4KVME 1Y9WA 1M1DA 4A95A 4YFJA 1PU9A 1S7KA 4PSWA 2G0BA 4Q38A 4F6AA 3W6SA 1FY7A 5KTAA 4CAFA 2BSWA 2FCKA 3EXNA 4KLWA 1N71A 3T9YA 4AVBA 2PR8A 4CYPA 5JQ4A 3FBUA 1KZFA 2Z3MA 4UWJA 4IUSA 3SHPA 2FE7A 4CGNA 2VBQA 4QB9A 3GYAA 4LUAA 3KKWA 4MFLA 2A4NA 2B5GB 2CNSA 2ZW5A 2CNTA 4MJ8A 4B14A 5HMNA 1IB1E 4H89A 4NXYA 4MFZA 2O28A 2DPSA 4NEXA 1GHEA 3TOAA 3S6KA 4K30A 5G22A 4Y49C 2EUIA 2B5GA 5EC4A 3FIXA 1QSOA 2PQ8A 2FT0A 2YGWA 3F5BA 1LRZA 2BEIA 1Q2DA 3SXNA 1U6MA 4HNWB 1WK4A 1CJWA 2FSRA 1P0HA 2REFA 2PSWA 2B3VA 4AVAA 2QMLA 4ZBGA 3DNSA 3JUWA 2Z3LA 4FD6A 2GANA 4E0AA 1Q2YA 2Q04A 3IU1A 5JPHA 2F5IA 4L89A 5BWAB 4FD5A 5AG6A 4CYOA 3D8PA 4CYQA 4MFJA 4OLLA 1R57A 4NSQA 4B12A 5F49A 4A2ZA 5IX3A 1P4NA 2PR1A 2HQYA 4QVTA 1Z9UA 4C2ZA 2R1IA 1MJAA 2P0WA 5G21A 3W6XA 3E0KA 5F46A 4UFVA 4X5KA 4YGOA 4BMHA 2FS5A 5C82A 1S7FA 2I79A 1SQHA 4H6UA 4B13A 3DSBA 2Z3OA 2P6EA 1YK3A 1Q2CA 3G3SA 2D4OA 1RO5A 3CXQA 1IYLA 2D4PA 5F48A 4XPKA 2GIVA 4MY3A 3CXSA 2PRBA 4KOSA 2Q0YA 4U5YA 3MGDA 2VZZA 4CRZB 2ZPAA 2AJ6A 3H5ZA 3R96A 3B8GA 4RI1A 1MJ9A 1CM0A 2JDCA 4JWPA 4KUBA 2Q4VA 4EVYA 2VZYA 3PZJA 1BOBA 1Z4EA 3F8KA 3ZZIA 3BLNA 3VWDA 2J8MA 5G1ZA 3RYOA 4HNXB 2RC4A 5GCNA 2J8NA 2ZW7A 5DWMA 4QUSA 4MI4A 2KCWA 4YRHA 2YNCA 1K4JA 3PP9A 1M4DA 3T90A 1NMTA 4NF1A 4R87A 2CXAA 4JJXA 3DR6A 4FD4A 2FXFA 2B4DB 4A31A 1IIDA 3A9LA 5H84A 1QSNA 1Z4RA 4DNCA 1TIQA 2Z3PA 4KOWA 4AG9A 3G8WA 2ZW4A 5IB0A 3FRMA 2CNMA 1XEBA 2K5TA 3R9GA 2B4DA 1I12A 1V0CA 2BUEA 2J8RA 3WR7A 1ZO0A 4PSXA 4CAXA 4UA3A 2Q44A 1XE4A 4RS2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IL4 A;  3D3S A;  3TFY A;  1YX0 A;  4R57 A;  4ONU A;  4XNH C;  1M44 A;  2FIA A;  3GKR A;  1S3Z A;  1S7N A;  4AVC A;  1XF8 A;  2FIW A;  4HNY B;  4M85 A;  3H4Q A;  4XPD B;  3GY9 A;  2Z0Z A;  1XMT A;  4E2A A;  2JLM A;  1M4I A;  5IV0 A;  3FNC A;  3FB3 A;  4R3L A;  3W91 A;  1I1D A;  1J4J A;  3S6G A;  3BJ7 A;  2JEV A;  1BO4 A;  2G3T A;  2Q4Y A;  3PGP A;  5ISV A;  4UBR A;  1YRE A;  2Z10 A;  3IGR A;  1QST A;  3JVN A;  1S5K A;  2R98 A;  1L0C A;  4IF5 A;  2OH1 A;  1KUY A;  2NMT A;  3V8I A;  3EFA A;  2DXQ A;  2OZG A;  4UWI A;  1XIX A;  1Y9K A;  4QC6 A;  1YGH A;  2I00 A;  3LD2 A;  2VEZ A;  2OB0 A;  3R9F A;  2Z11 A;  3CXP A;  4CAW A;  4Y49 B;  3TCV A;  4FD7 A;  2B58 A;  3R9E A;  2ARH A;  5I0C A;  1NSL A;  5C88 A;  3F0A A;  4CS0 B;  4F0Y A;  3NE7 A;  4J3G A;  1Y7R A;  2P6G A;  3D2P A;  4L8A A;  3S6F A;  4MHD A;  5EBV A;  4KZT A;  5F47 A;  4B5P B;  4JLY A;  1IYK A;  1KUX A;  5J8F A;  1YVO A;  2CY2 A;  4XPL A;  2VXK A;  1YVK A;  2X7B A;  2P6F A;  3C26 A;  5HH1 A;  2QEC A;  3P2H A;  2WPX A;  1WWZ A;  4PK2 A;  5KTD A;  4U9Z A;  2H5M A;  4KVX A;  3R95 A;  4B5P A;  5CNP A;  3D2M A;  3UY5 A;  3TO7 A;  4II9 A;  1PUA A;  4JXR A;  3I9S A;  1MK4 A;  3EO4 A;  2FL4 A;  4JXQ A;  2B3U A;  2REE A;  4JD6 A;  5J8C A;  1YR0 A;  3SXO A;  2JDD A;  2WPW A;  2ZW6 A;  4CRY B;  3R1K A;  2Y0M A;  4R9M A;  4KLV A;  3P2F A;  1S7L A;  1S60 A;  3QAH A;  4H6Z A;  3VWE A;  1QSM A;  2EVN A;  4E8O A;  3FYN A;  5KTC A;  3N7Z A;  5DWN A;  2HUZ A;  3EY5 A;  3K9U A;  2BL1 A;  3I3G A;  3TOB A;  4KVO E;  1IIC A;  2R8V A;  4GS4 A;  3TO9 A;  3FXT A;  4B5O A;  4MY0 A;  2OZH A;  1VKC A;  4NCZ A;  4CAV A;  2PC1 A;  4MBU A;  1I21 A;  3TT2 A;  3BJ8 A;  2OU2 A;  4KOU A;  2PDO A;  4OAD A;  5H86 A;  4M3S A;  1RXT A;  1VHS A;  2C27 A;  4AG7 A;  4KOX A;  3QB8 A;  4PK3 A;  2AE6 A;  2VQY A;  4QBJ A;  1B87 A;  4U9Y A;  4KOR A;  3LOD A;  1MJB A;  4KOT A;  4PV6 A;  4ORF A;  4OAE A;  4KOY A;  3TE4 A;  2Q7B A;  5FVJ A;  3TTH A;  1OZP A;  4R3K A;  4AB7 A;  2GE3 A;  4LX9 A;  2B4B A;  4KOV A;  1KUV A;  1UFH A;  1YLE A;  2OZU A;  2ZXV A;  5E96 A;  3DDD A;  1M4G A;  2ATR A;  4HKF A;  2QIR A;  4I49 A;  3DR8 A;  2R7H A;  3TO6 A;  2VI7 A;  4KUA A;  1ON0 A;  3IWG A;  1QSR A;  2HV2 A;  4XNH B;  4XPD C;  1B6B A;  3EC4 A;  2G3A A;  3ZJ0 A;  3S6H A;  1NE9 A;  3OWC A;  4KVM E;  1Y9W A;  1M1D A;  4YFJ A;  1PU9 A;  1S7K A;  4PSW A;  2G0B A;  4F6A A;  3W6S A;  1FY7 A;  5KTA A;  2BSW A;  2FCK A;  3EXN A;  4KLW A;  1N71 A;  3T9Y A;  4AVB A;  2PR8 A;  5JQ4 A;  3FBU A;  1KZF A;  4UWJ A;  4IUS A;  3SHP A;  2FE7 A;  2VBQ A;  4QB9 A;  3GYA A;  4LUA A;  3KKW A;  2A4N A;  2B5G B;  2CNS A;  2ZW5 A;  2CNT A;  4MJ8 A;  5HMN A;  1IB1 E;  4H89 A;  4NXY A;  2O28 A;  4NEX A;  1GHE A;  3TOA A;  3S6K A;  4K30 A;  4Y49 C;  2EUI A;  2B5G A;  5EC4 A;  3FIX A;  1QSO A;  2PQ8 A;  2FT0 A;  3F5B A;  1LRZ A;  2BEI A;  1Q2D A;  3SXN A;  1U6M A;  4HNW B;  1WK4 A;  1CJW A;  2FSR A;  1P0H A;  2REF A;  2PSW A;  2B3V A;  4AVA A;  2QML A;  4ZBG A;  3DNS A;  3JUW A;  4FD6 A;  2GAN A;  4E0A A;  1Q2Y A;  2Q04 A;  5JPH A;  2F5I A;  4L89 A;  4FD5 A;  3D8P A;  4OLL A;  1R57 A;  4NSQ A;  5F49 A;  5IX3 A;  1P4N A;  2PR1 A;  2HQY A;  4QVT A;  1Z9U A;  2R1I A;  1MJA A;  2P0W A;  3W6X A;  3E0K A;  5F46 A;  4X5K A;  4YGO A;  4BMH A;  2FS5 A;  5C82 A;  1S7F A;  2I79 A;  1SQH A;  4H6U A;  3DSB A;  2P6E A;  1YK3 A;  1Q2C A;  3G3S A;  2D4O A;  1RO5 A;  3CXQ A;  1IYL A;  2D4P A;  5F48 A;  4XPK A;  2GIV A;  4MY3 A;  3CXS A;  2PRB A;  4KOS A;  2Q0Y A;  4U5Y A;  3MGD A;  2VZZ A;  4CRZ B;  2ZPA A;  2AJ6 A;  3R96 A;  3B8G A;  4RI1 A;  1MJ9 A;  1CM0 A;  2JDC A;  4JWP A;  4KUB A;  2Q4V A;  4EVY A;  2VZY A;  3PZJ A;  1BOB A;  1Z4E A;  3F8K A;  3ZZI A;  3BLN A;  3VWD A;  2J8M A;  3RYO A;  4HNX B;  2RC4 A;  5GCN A;  2J8N A;  2ZW7 A;  5DWM A;  4QUS A;  4MI4 A;  2KCW A;  4YRH A;  3PP9 A;  1K4J A;  1M4D A;  3T90 A;  1NMT A;  4NF1 A;  4R87 A;  4JJX A;  3DR6 A;  4FD4 A;  2FXF A;  2B4D B;  1IID A;  5H84 A;  1QSN A;  1Z4R A;  4DNC A;  1TIQ A;  4KOW A;  4AG9 A;  3G8W A;  2ZW4 A;  5IB0 A;  3FRM A;  2CNM A;  1XEB A;  2K5T A;  3R9G A;  2B4D A;  1I12 A;  1V0C A;  2BUE A;  2J8R A;  3WR7 A;  4PSX A;  4CAX A;  4UA3 A;  2Q44 A;  1XE4 A;  4RS2 A; 
#chains in the Genus database with same CATH topology
 2IQ6 A;  2XEI A;  3IWE A;  2HC9 A;  2V8V A;  4NGM A;  2BCO A;  3SJE A;  4CGP A;  2PJ4 A;  2IL4 A;  3D3S A;  4GM5 A;  1IU8 A;  2OR4 A;  2QYV A;  3TFY A;  2PRQ A;  1YX0 A;  4TNU A;  4UEE A;  3B2Y A;  4IK2 A;  4R57 A;  4ONU A;  4XNH C;  1ZG9 A;  4ONW A;  1M44 A;  5AG4 A;  2FIA A;  3GKR A;  1S3Z A;  1AYE A;  3KQZ A;  1S7N A;  3QAY A;  4P4B A;  4LQ6 A;  4A38 A;  3K9T A;  4AVC A;  2CTC A;  1XF8 A;  1TXR A;  3IC1 A;  1ZLI A;  1ARM A;  4OC2 A;  4B10 A;  4ZY2 A;  2FIW A;  4HNY B;  2GLF A;  4M85 A;  2XEF A;  4X3R A;  1X10 A;  3S9N A;  3H4Q A;  4XPD B;  3VAT A;  3GY9 A;  3VAR A;  5LRK A;  3S9L A;  2Z0Z A;  4UCM A;  1XMT A;  4E2A A;  4MHZ A;  4C7I A;  5CBM A;  2JLM A;  1M4I A;  1ELM P;  5IV0 A;  4X2T A;  3FNC A;  3FB3 A;  4R3L A;  5THW A;  2WUU A;  3KR5 A;  2AFZ A;  4DJL A;  3PFO A;  3W91 A;  3WC6 A;  1I1D A;  4CGL A;  3PBE A;  1J4J A;  3S6G A;  3BJ7 A;  1XOV A;  2JEV A;  4MFQ A;  1BO4 A;  4UEZ A;  3PBB A;  2G3T A;  1Z5R A;  3KQX A;  4ZX8 A;  4UFX A;  2DF5 A;  2Q4Y A;  3PGP A;  5ISV A;  4OID A;  4UBR A;  1YRE A;  2BO9 A;  2Z10 A;  2ZEG A;  3IGR A;  4KS9 A;  4M6H A;  1R3N A;  1QST A;  3JVN A;  1S5K A;  2R98 A;  1L0C A;  4YWY A;  5JM6 A;  1ZG8 A;  3KHZ A;  4IF5 A;  1YW6 A;  2OH1 A;  2PCU A;  1CX8 A;  3D66 A;  1KUY A;  2NMT A;  3SJX A;  1QQ9 A;  4TWE A;  4F9V A;  2JBK A;  3V8I A;  2BOA A;  3EFA A;  4MXU A;  5DS0 A;  1VHE A;  3WAB A;  3S9M A;  2EWB A;  2GFQ A;  2DXQ A;  2OZG A;  4UWI A;  1XIX A;  1Y9K A;  4QC6 A;  1Q7L A;  1YGH A;  4P4F A;  2I00 A;  3CPX A;  3LD2 A;  4NGR A;  2NYQ A;  4JZ0 A;  2VEZ A;  2OB0 A;  3R9F A;  2Z11 A;  3CXP A;  4P4J A;  4FAI A;  4CAW A;  3GB0 A;  4Y49 B;  1PCA A;  2ZED A;  3TCV A;  2V8G A;  5LYD A;  4FD7 A;  4P4E A;  3KZW A;  4B11 A;  4WJB A;  4Q36 A;  4C68 A;  4PQA A;  2B58 A;  3TC8 A;  1XFO A;  3R9E A;  2ARH A;  4MFK A;  3NA6 A;  4NGN A;  3RO0 A;  5I0C A;  4CGO A;  1ZG7 A;  3D7D A;  4P45 A;  1NSL A;  4A30 A;  4F0X A;  1EE3 P;  2PJ6 A;  3F0A A;  4CS0 B;  5C88 A;  4KSF A;  4F0Y A;  3NE7 A;  3IO1 A;  2DPT A;  5A28 A;  3CDX A;  3PB8 X;  1JQG A;  3HUV A;  4J3G A;  1Y7R A;  3DGV A;  2P6G A;  2YNE A;  3D2P A;  3N5F A;  4L8A A;  4CAE A;  3WC7 A;  3S6F A;  1IGB A;  4MHD A;  4MCR A;  5EBV A;  2YND A;  3LWU A;  4KZT A;  5F47 A;  4B5P B;  4JLY A;  1IYK A;  1KUX A;  2EBJ A;  5LYI A;  5J8F A;  1YVO A;  4MHN A;  2PVV A;  2CY2 A;  4A33 A;  2FVG A;  4XPL A;  2VXK A;  1YVK A;  2X7B A;  2ZEE A;  3WT4 A;  4CYN A;  2P6F A;  3C26 A;  5HH1 A;  4PXD A;  2QEC A;  1HDU A;  2EK8 A;  3P2H A;  2WSA A;  1YW4 A;  2WPX A;  1WWZ A;  4PK2 A;  5D8N A;  4BBH A;  5KTD A;  4NJR A;  4U9Z A;  2H5M A;  4KVX A;  3R95 A;  4F8Z A;  5AG5 A;  4B5P A;  5CNP A;  7CPA A;  4P44 A;  2ZEN A;  3L2N A;  2PJ8 A;  3D2M A;  3UY5 A;  3TO7 A;  4II9 A;  1PUA A;  4JXR A;  3I9S A;  1MK4 A;  3EO4 A;  5G20 A;  3BI0 A;  2FL4 A;  2ANP A;  4JXQ A;  2ZEP A;  2PJ9 A;  2B3U A;  2PJ3 A;  2REE A;  4JD6 A;  5K8P A;  5J8C A;  1YR0 A;  3SXO A;  2JDD A;  3B3T A;  2WPW A;  4CPA A;  5HXD A;  2C1C A;  2ZW6 A;  4CRY B;  4K3N A;  3R1K A;  2Y0M A;  4F9U A;  4R9M A;  4KLV A;  3IEH A;  3FED A;  1UWY A;  3RNZ A;  2GRE A;  3P2F A;  1S7L A;  1S60 A;  3QAH A;  4H6Z A;  3VWE A;  1QSM A;  2EVN A;  4E8O A;  5K8N A;  4MCQ A;  5LRJ A;  3GLJ A;  3FYN A;  5KTC A;  2ZEO A;  3N7Z A;  2PE3 A;  1ARL A;  3H8E A;  1Z2L A;  4UCP A;  2YNC C;  5DWN A;  2ZEM A;  2HUZ A;  3EY5 A;  3D68 A;  3K9U A;  1CPX A;  4MFP A;  2BL1 A;  3I3G A;  4UIB A;  5AG7 A;  4KVO E;  4OKO A;  3TOB A;  4DUK A;  1IIC A;  1XRY A;  2VL1 A;  3IJ3 A;  3B3S A;  2R8V A;  4C2X A;  2PIY A;  2Q4Z A;  4GS4 A;  3TO9 A;  5A27 A;  3RZA A;  1QMU A;  2JBJ A;  3FXT A;  4B5O A;  4MY0 A;  2Q43 A;  2OZH A;  1VKC A;  4NCZ A;  1A2Z A;  4CAV A;  1Y0Y A;  4PXE A;  5D29 A;  3SI0 A;  2PJC A;  4PXC A;  2PJ7 A;  2PC1 A;  3VH9 A;  4UCN A;  4MBU A;  1I21 A;  3NH5 A;  3TT2 A;  3BJ8 A;  3NH4 A;  1XJO A;  3KR4 A;  3NH8 A;  2RFH A;  4W9Y A;  1PYT B;  2OU2 A;  4KOU A;  2PDO A;  4OAD A;  4JYW A;  3TX8 A;  5JH9 A;  5H86 A;  4CGM A;  4M3S A;  4ZGY B;  1RXT A;  1VHS A;  2C27 A;  4OME A;  8CPA A;  2Z3K A;  4AG7 A;  4A32 A;  4O23 A;  4KOX A;  1VIX A;  4NGT A;  2EK9 A;  3QB8 A;  4PK3 A;  3SI1 A;  2Q7S A;  4DYO A;  3D7G A;  2AE6 A;  2VQY A;  5EMI A;  2V77 A;  4QBJ A;  1B87 A;  4U9Y A;  2RB7 A;  4MMO A;  4MCP A;  4HPS A;  3DLJ A;  4KOR A;  4ZX9 A;  1CPS A;  4OIW A;  2V8H A;  3FH4 A;  1Y7E A;  3LOD A;  3MRU A;  2OOT A;  1MJB A;  4KOT A;  4PV6 A;  4ORF A;  3KGQ A;  4OAE A;  3IU2 A;  4KSA A;  3SI2 A;  4KOY A;  3H8F A;  5AGE A;  3TE4 A;  1F57 A;  2IMO A;  2Q7B A;  4UEF A;  5FVJ A;  3TTH A;  1OZP A;  4R3K A;  3GUX A;  5CPA A;  3B3C A;  4AB7 A;  2GE3 A;  1JWQ A;  4LX9 A;  2B4B A;  1LAN A;  4KOV A;  5HVH A;  1KUV A;  1UFH A;  4C2Y A;  1YLE A;  2OZU A;  3WC5 A;  4A37 A;  2ZXV A;  5JGF A;  4RN7 A;  5E96 A;  3DDD A;  1M4G A;  4FBE A;  2ATR A;  3IFE A;  4HKF A;  4P10 A;  2QIR A;  3NFZ A;  4I49 A;  4UFW A;  4C7H A;  2ZOF A;  3DR8 A;  2R7H A;  3D67 A;  3TO6 A;  4NGS A;  4EME A;  2Z3N A;  2VI7 A;  3BXM A;  3CZX A;  1ON0 A;  3IWW A;  4KUA A;  4R6T A;  2PJ1 A;  2ZOG A;  3IWG A;  1QSR A;  3QNV A;  4P6Y A;  5K8O A;  4Z65 A;  2HV2 A;  4XNH B;  4XPD C;  1B6B A;  3EC4 A;  2G3A A;  3ZJ0 A;  3JTK A;  1IOI A;  3S6H A;  2F7V A;  4OC5 A;  1HEE A;  2GLJ A;  3PEI A;  1NE9 A;  3OWC A;  4KVM E;  1Y9W A;  1M1D A;  4A95 A;  4YFJ A;  1PU9 A;  1S7K A;  4PSW A;  2G0B A;  4MCS A;  4Q38 A;  3W6S A;  1LAP A;  4F6A A;  4OC0 A;  1FY7 A;  5KTA A;  4CAF A;  2BSW A;  3HLP A;  1VHO A;  2FCK A;  3EXN A;  4KLW A;  1VGY A;  1N71 A;  2AFX A;  3KAS A;  3T9Y A;  4AVB A;  2PR8 A;  3SJG A;  1TKJ A;  4CYP A;  5JQ4 A;  3FBU A;  1KZF A;  2Z3M A;  4UWJ A;  6CPA A;  4IUS A;  3SHP A;  1IY7 A;  4FUU A;  1BPN A;  2FE7 A;  4CGN A;  1AMP A;  1YQE A;  2VBQ A;  4QB9 A;  3GYA A;  4LUA A;  3KKW A;  4G1P A;  4MFL A;  4UIA A;  2ABZ A;  2A4N A;  2B5G B;  2CNS A;  2ZW5 A;  5K8M A;  1TF9 A;  2CNT A;  4MJ8 A;  4B14 A;  5HMN A;  1BAV A;  1IB1 E;  4H89 A;  2AFO A;  4NXY A;  2QJ8 A;  3V7Z A;  1YLO A;  1BLL E;  4LQG A;  4B6Z A;  2C6G A;  3FF3 A;  4YU9 A;  3ISX A;  4MFZ A;  3PB6 X;  2O28 A;  3BHX A;  2PIZ A;  2DPS A;  5ELY A;  4NEX A;  4R8F A;  3I1U A;  1GHE A;  3FX6 A;  3TOA A;  3S6K A;  3LAC A;  4K30 A;  5G22 A;  1LCP A;  2EUI A;  4Y49 C;  5LRG A;  2B5G A;  5EC4 A;  4RUH A;  1HDQ A;  3FIX A;  3JRU A;  4P4D A;  1QSO A;  2PQ8 A;  2FT0 A;  2DEA A;  2YGW A;  1F2O A;  4NFR A;  4WWV A;  3D7H A;  1R43 A;  3CT9 A;  3F5B A;  1LRZ A;  2BEI A;  4OP4 A;  1Q2D A;  5HVF A;  3RAM A;  3SXN A;  4EFD A;  1Z8L A;  3IIB A;  3MN8 A;  1LAM A;  1AUG A;  3FEE A;  4IAV A;  1U6M A;  2O4H A;  3PB7 X;  1F2P A;  4HNW B;  5J1Q A;  1WK4 A;  5IB9 A;  1CJW A;  2NSM A;  2AFW A;  2PVW A;  1TKH A;  4P4I A;  2FSR A;  1P0H A;  2REF A;  2PSW A;  2B3V A;  2ZEH A;  4AVA A;  1FT7 A;  2J9A A;  2QML A;  1FNO A;  4GXH A;  4ZBG A;  2I3C A;  2JEW A;  4OC3 A;  4ZI6 A;  3BI1 A;  2QVP A;  3K2K A;  4KSI A;  3DNS A;  3JUW A;  2Z3L A;  4FD6 A;  2GAN A;  4E0A A;  1Q2Y A;  2Q04 A;  1ZLH A;  3IU1 A;  5JPH A;  2CF4 A;  2F5I A;  2WYR A;  4L89 A;  5BWA B;  1CG2 A;  2V8D A;  4FD5 A;  5AG6 A;  5HVG A;  4CYO A;  2Q51 A;  3D8P A;  4CYQ A;  4MFJ A;  4EWT A;  4OLL A;  4ZY1 A;  4X8I A;  1R57 A;  1H8L A;  3D7F A;  4NSQ A;  4B12 A;  3RBU A;  5F49 A;  4A2Z A;  2C6C A;  1DTD A;  5IX3 A;  1P4N A;  1M4L A;  2PR1 A;  2HQY A;  2XEJ A;  4QVT A;  1Z9U A;  4C2Z A;  5I4M A;  2GU2 A;  1OBR A;  2R1I A;  3PRT A;  1MJA A;  2P0W A;  5G21 A;  1LOK A;  4NJQ A;  3PB4 X;  3W6X A;  3E0K A;  1X12 A;  5F46 A;  4UFV A;  4X5K A;  1ELL P;  4YGO A;  4BMH A;  2FS5 A;  1NSA A;  2HB6 A;  5C82 A;  1S7F A;  3PFE A;  1IOF A;  2I79 A;  3SJF A;  1SQH A;  4H6U A;  4B13 A;  3DSB A;  4BD9 A;  2Z3O A;  1TKF A;  2P6E A;  1YK3 A;  1Q2C A;  3G3S A;  2D4O A;  4FWU A;  4OC1 A;  1RO5 A;  2POK A;  3GIU A;  1Z8X A;  2PJ2 A;  1TF8 A;  1IYL A;  3CXQ A;  2D4P A;  3LMS A;  4UF4 A;  5F48 A;  4AXV A;  4A94 A;  1YME A;  4R76 A;  5LYF A;  4XPK A;  2EO8 A;  4IHM A;  2GIV A;  2CTB A;  3KHX A;  3B3W A;  4MY3 A;  2PJB A;  4ZYQ A;  4PXB A;  3CXS A;  2PRB A;  1Z8T A;  4KOS A;  2F8H A;  2Q0Y A;  4U5Y A;  3MGD A;  2VZZ A;  4CRZ B;  3T8W A;  4NGQ A;  2ZPA A;  3NE8 A;  2AJ6 A;  3H5Z A;  3R96 A;  3B8G A;  4PPZ A;  4RI1 A;  1MJ9 A;  3H8G A;  2ODF A;  1CM0 A;  2IJZ A;  1GYT A;  1YSJ A;  2JDC A;  2ZEL A;  3KI9 A;  4OC4 A;  4JWP A;  4KUB A;  2O53 A;  2Q4V A;  4H2K A;  4EVY A;  2VZY A;  3PZJ A;  5F09 A;  2PJ0 A;  1BOB A;  1Z4E A;  3F8K A;  3ZZI A;  1XMB A;  2PJA A;  1DE4 C;  2CIJ A;  1CP7 A;  2ZEF A;  3BLN A;  3VWD A;  2C6P A;  2J8M A;  5G1Z A;  3RYO A;  3FVL A;  4HNX B;  2RC4 A;  4M6I A;  5GCN A;  4MHP A;  2J8N A;  2ZW7 A;  5DWM A;  4QUS A;  4MI4 A;  3CPA A;  2KCW A;  1RTQ A;  4YRH A;  4R7M A;  2YNC A;  1K4J A;  3PB9 X;  3PP9 A;  3FMC A;  1M4D A;  3T90 A;  1NMT A;  4NF1 A;  4A39 A;  4R87 A;  2AFU A;  2CXA A;  4JJX A;  3DR6 A;  2G9D A;  1LFW A;  3V38 A;  1Z8W A;  4FD4 A;  2FXF A;  3D4U A;  2B4D B;  4M6G A;  4A31 A;  2XEG A;  1IID A;  1BPM A;  3FEC A;  3B7I A;  3A9L A;  2PJ5 A;  5H84 A;  2WZN A;  3B3V A;  4MHY A;  1QSN A;  1Z4R A;  4DNC A;  1TIQ A;  3KL9 A;  4ZY0 A;  1CP6 A;  2Z3P A;  4KOW A;  4AG9 A;  4NGP A;  3G8W A;  2ZW4 A;  3ISZ A;  1KWM A;  3B35 A;  5IB0 A;  3FRM A;  2CNM A;  3FJU A;  1XEB A;  4BIN A;  2K5T A;  3R9G A;  4Q7A A;  2B4D A;  1I12 A;  4MRI A;  1V0C A;  1Y0R A;  2AFS A;  2BUE A;  1XBU A;  2J8R A;  3WR7 A;  1ZO0 A;  4PSX A;  4CAX A;  5LYL A;  4UA3 A;  2Q44 A;  1XE4 A;  1CBX A;  2AFM A;  4RS2 A; 
#chains in the Genus database with same CATH homology
 3IWE A;  4CGP A;  2IL4 A;  3D3S A;  3TFY A;  1YX0 A;  4R57 A;  4ONU A;  4XNH C;  1M44 A;  5AG4 A;  2FIA A;  3GKR A;  1S3Z A;  1S7N A;  4AVC A;  1XF8 A;  4B10 A;  2FIW A;  4HNY B;  4M85 A;  3H4Q A;  4XPD B;  3GY9 A;  2Z0Z A;  4UCM A;  1XMT A;  4E2A A;  4C7I A;  2JLM A;  1M4I A;  5IV0 A;  3FNC A;  3FB3 A;  4R3L A;  2WUU A;  3W91 A;  1I1D A;  4CGL A;  1J4J A;  3S6G A;  3BJ7 A;  2JEV A;  4MFQ A;  1BO4 A;  2G3T A;  4UFX A;  2Q4Y A;  3PGP A;  5ISV A;  4UBR A;  1YRE A;  2Z10 A;  3IGR A;  4KS9 A;  1QST A;  3JVN A;  1S5K A;  2R98 A;  1L0C A;  4IF5 A;  2OH1 A;  1KUY A;  2NMT A;  3V8I A;  3EFA A;  2DXQ A;  2OZG A;  4UWI A;  1XIX A;  1Y9K A;  4QC6 A;  1YGH A;  2I00 A;  3LD2 A;  2VEZ A;  2OB0 A;  3R9F A;  2Z11 A;  3CXP A;  4CAW A;  4Y49 B;  3TCV A;  4FD7 A;  4B11 A;  4Q36 A;  4C68 A;  2B58 A;  3R9E A;  2ARH A;  4MFK A;  5I0C A;  4CGO A;  1NSL A;  4A30 A;  4F0X A;  5C88 A;  3F0A A;  4CS0 B;  4KSF A;  4F0Y A;  3NE7 A;  2DPT A;  5A28 A;  4J3G A;  1Y7R A;  2P6G A;  2YNE A;  3D2P A;  4L8A A;  4CAE A;  3S6F A;  4MHD A;  5EBV A;  2YND A;  4KZT A;  5F47 A;  4B5P B;  4JLY A;  1IYK A;  1KUX A;  5J8F A;  1YVO A;  2CY2 A;  4A33 A;  4XPL A;  2VXK A;  1YVK A;  2X7B A;  4CYN A;  2P6F A;  3C26 A;  5HH1 A;  2QEC A;  3P2H A;  2WSA A;  2WPX A;  1WWZ A;  4PK2 A;  4BBH A;  5KTD A;  4U9Z A;  2H5M A;  4KVX A;  3R95 A;  5AG5 A;  4B5P A;  5CNP A;  3D2M A;  3UY5 A;  3TO7 A;  4II9 A;  1PUA A;  4JXR A;  3I9S A;  1MK4 A;  3EO4 A;  5G20 A;  2FL4 A;  4JXQ A;  2B3U A;  2REE A;  4JD6 A;  5J8C A;  1YR0 A;  3SXO A;  2JDD A;  2WPW A;  2ZW6 A;  4CRY B;  3R1K A;  2Y0M A;  4R9M A;  4KLV A;  3P2F A;  1S7L A;  1S60 A;  3QAH A;  4H6Z A;  3VWE A;  1QSM A;  2EVN A;  4E8O A;  3FYN A;  5KTC A;  3N7Z A;  4UCP A;  2YNC C;  5DWN A;  2HUZ A;  3EY5 A;  3K9U A;  4MFP A;  2BL1 A;  3I3G A;  3TOB A;  5AG7 A;  4KVO E;  1IIC A;  2R8V A;  4C2X A;  4GS4 A;  3TO9 A;  5A27 A;  3FXT A;  4B5O A;  4MY0 A;  2OZH A;  1VKC A;  4NCZ A;  4CAV A;  2PC1 A;  4UCN A;  4MBU A;  1I21 A;  3TT2 A;  3BJ8 A;  2OU2 A;  4KOU A;  2PDO A;  4OAD A;  5H86 A;  4CGM A;  4M3S A;  4ZGY B;  1RXT A;  1VHS A;  2C27 A;  2Z3K A;  4AG7 A;  4A32 A;  4KOX A;  3QB8 A;  4PK3 A;  2AE6 A;  2VQY A;  4QBJ A;  1B87 A;  4U9Y A;  4KOR A;  3LOD A;  1MJB A;  4KOT A;  4PV6 A;  4ORF A;  4OAE A;  3IU2 A;  4KSA A;  4KOY A;  5AGE A;  3TE4 A;  2Q7B A;  5FVJ A;  3TTH A;  1OZP A;  4R3K A;  4AB7 A;  2GE3 A;  4LX9 A;  2B4B A;  4KOV A;  1KUV A;  1UFH A;  4C2Y A;  1YLE A;  2OZU A;  2ZXV A;  5E96 A;  3DDD A;  1M4G A;  2ATR A;  4HKF A;  2QIR A;  4I49 A;  4UFW A;  4C7H A;  3DR8 A;  2R7H A;  3TO6 A;  2Z3N A;  2VI7 A;  4KUA A;  1ON0 A;  3IWG A;  1QSR A;  2HV2 A;  4XNH B;  4XPD C;  1B6B A;  3EC4 A;  2G3A A;  3ZJ0 A;  3JTK A;  3S6H A;  1NE9 A;  3OWC A;  4KVM E;  1Y9W A;  1M1D A;  4A95 A;  4YFJ A;  1PU9 A;  1S7K A;  4PSW A;  2G0B A;  4Q38 A;  4F6A A;  3W6S A;  1FY7 A;  5KTA A;  4CAF A;  2BSW A;  2FCK A;  3EXN A;  4KLW A;  1N71 A;  3T9Y A;  4AVB A;  2PR8 A;  4CYP A;  5JQ4 A;  3FBU A;  1KZF A;  2Z3M A;  4UWJ A;  4IUS A;  3SHP A;  2FE7 A;  4CGN A;  2VBQ A;  4QB9 A;  3GYA A;  4LUA A;  3KKW A;  4MFL A;  2A4N A;  2B5G B;  2CNS A;  2ZW5 A;  2CNT A;  4MJ8 A;  4B14 A;  5HMN A;  1IB1 E;  4H89 A;  4NXY A;  4MFZ A;  2O28 A;  2DPS A;  4NEX A;  1GHE A;  3TOA A;  3S6K A;  4K30 A;  5G22 A;  4Y49 C;  2EUI A;  2B5G A;  5EC4 A;  3FIX A;  1QSO A;  2PQ8 A;  2FT0 A;  2YGW A;  3F5B A;  1LRZ A;  2BEI A;  1Q2D A;  3SXN A;  1U6M A;  4HNW B;  1WK4 A;  1CJW A;  2FSR A;  1P0H A;  2REF A;  2PSW A;  2B3V A;  4AVA A;  2QML A;  4ZBG A;  3DNS A;  3JUW A;  2Z3L A;  4FD6 A;  2GAN A;  4E0A A;  1Q2Y A;  2Q04 A;  3IU1 A;  5JPH A;  2F5I A;  4L89 A;  5BWA B;  4FD5 A;  5AG6 A;  4CYO A;  3D8P A;  4CYQ A;  4MFJ A;  4OLL A;  1R57 A;  4NSQ A;  4B12 A;  5F49 A;  4A2Z A;  5IX3 A;  1P4N A;  2PR1 A;  2HQY A;  4QVT A;  1Z9U A;  4C2Z A;  2R1I A;  1MJA A;  2P0W A;  5G21 A;  3W6X A;  3E0K A;  5F46 A;  4UFV A;  4X5K A;  4YGO A;  4BMH A;  2FS5 A;  5C82 A;  1S7F A;  2I79 A;  1SQH A;  4H6U A;  4B13 A;  3DSB A;  2Z3O A;  2P6E A;  1YK3 A;  1Q2C A;  3G3S A;  2D4O A;  1RO5 A;  3CXQ A;  1IYL A;  2D4P A;  5F48 A;  4XPK A;  2GIV A;  4MY3 A;  3CXS A;  2PRB A;  4KOS A;  2Q0Y A;  4U5Y A;  3MGD A;  2VZZ A;  4CRZ B;  2ZPA A;  2AJ6 A;  3H5Z A;  3R96 A;  3B8G A;  4RI1 A;  1MJ9 A;  1CM0 A;  2JDC A;  4JWP A;  4KUB A;  2Q4V A;  4EVY A;  2VZY A;  3PZJ A;  1BOB A;  1Z4E A;  3F8K A;  3ZZI A;  3BLN A;  3VWD A;  2J8M A;  5G1Z A;  3RYO A;  4HNX B;  2RC4 A;  5GCN A;  2J8N A;  2ZW7 A;  5DWM A;  4QUS A;  4MI4 A;  2KCW A;  4YRH A;  2YNC A;  1K4J A;  3PP9 A;  1M4D A;  3T90 A;  1NMT A;  4NF1 A;  4R87 A;  2CXA A;  4JJX A;  3DR6 A;  4FD4 A;  2FXF A;  2B4D B;  4A31 A;  1IID A;  3A9L A;  5H84 A;  1QSN A;  1Z4R A;  4DNC A;  1TIQ A;  2Z3P A;  4KOW A;  4AG9 A;  3G8W A;  2ZW4 A;  5IB0 A;  3FRM A;  2CNM A;  1XEB A;  2K5T A;  3R9G A;  2B4D A;  1I12 A;  1V0C A;  2BUE A;  2J8R A;  3WR7 A;  1ZO0 A;  4PSX A;  4CAX A;  4UA3 A;  2Q44 A;  1XE4 A;  4RS2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...