2JDCA

Glyphosate n-acetyltransferase bound to oxidized coa and sulfate
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
145
structure length
145
Chain Sequence
b'IEVKPINAEDTYELRHRILRPNQPIEACMFESDLLRGAFHLGGYYGGKLISIASFHQAEHSELQGQKQYQLRGMATLEGYREQKAGSSLIKHAEEILRKRGADLLWCNARTSASGYYKKLGFSEQGEVFDTPPVGPHILMYKRIT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLYPHOSATE N-ACETYLTRANSFERASE
publication title The Molecular Basis of Glyphosate Resistance by an Optimized Microbial Acetyltransferase.
pubmed doi rcsb
source organism Bacillus licheniformis
molecule tags Transferase
total genus 38
structure length 145
sequence length 145
ec nomenclature
pdb deposition date 2007-01-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 2jdcA00
1S5KA 4KOTA 3FYNA 5FVJA 2Q4YA 3R96A 1YLEA 1TIQA 4H6UA 4KLVA 3S6KA 2Q04A 2K5TA 4CAVA 2EVNA 2Q0YA 1Z4RA 2A4NA 4AG9A 4GS4A 2Z0ZA 2VBQA 3TT2A 3F0AA 3EC4A 5DWMA 3FB3A 4HNWB 1MJAA 4UWJA 1UFHA 2B3VA 3BJ8A 1XMTA 3CXSA 2BL1A 2FSRA 3EXNA 4JLYA 2CNSA 1CJWA 4KORA 4R57A 1Q2YA 2PDOA 4F0YA 2VZZA 4JJXA 1ON0A 5KTDA 3PGPA 1Q2CA 1S3ZA 2RC4A 2OZGA 5H86A 5KTCA 4M85A 1M1DA 3RYOA 3V8IA 4UBRA 2BUEA 2PRBA 2B4BA 2AE6A 3JUWA 4Y49B 1V0CA 3R9FA 2ZXVA 3FXTA 1L0CA 1S7NA 3FRMA 3S6FA 1YVOA 4NXYA 3GKRA 4AB7A 2B3UA 4R3KA 1KUVA 3SXNA 5E96A 4HNYB 2HV2A 1WK4A 4FD7A 4XNHC 4KOVA 4CAXA 5IX3A 2QECA 5EC4A 3H4QA 3D2PA 3G3SA 1YR0A 4ONUA 4AVCA 2B4DB 3G8WA 2B4DA 4H6ZA 2CNMA 2Z10A 5CNPA 3TO9A 3F8KA 5F48A 2FS5A 3D8PA 3VWDA 3FNCA 3PP9A 4JXRA 1M4DA 2OH1A 4CRYB 4M3SA 3JVNA 4QB9A 1KUYA 3NE7A 4KVXA 5J8CA 3R9EA 4NSQA 2HUZA 2QMLA 3SHPA 2GIVA 2JDDA 3UY5A 4E8OA 3GY9A 1Y9KA 4X5KA 4JXQA 2G3TA 2JDCA 3PZJA 4KVME 1OZPA 3WR7A 2OZHA 3OWCA 2PQ8A 4U5YA 3D3SA 2Z11A 1R57A 1BOBA 1IB1E 1IICA 4BMHA 1Z4EA 2QIRA 1CM0A 1QSMA 4EVYA 5HH1A 3IWGA 4K30A 4E0AA 4XPKA 1QSOA 3TFYA 2ZW7A 1PUAA 3TE4A 3N7ZA 3P2HA 4KZTA 2VXKA 2GE3A 4MHDA 2G0BA 4H89A 1XF8A 1P0HA 2DXQA 4J3GA 4HKFA 1PU9A 2REEA 4AVBA 4NEXA 1VHSA 4YRHA 4ZBGA 3TO6A 1S60A 2OZUA 3I9SA 4QC6A 3TOAA 3E0KA 1M44A 3F5BA 4KOWA 2CNTA 3KKWA 2GANA 4PK2A 4MI4A 2VEZA 1XE4A 2P6FA 4XNHB 2VQYA 2ZW4A 3DR8A 4IUSA 2H5MA 2R7HA 1J4JA 4F6AA 2CY2A 2PSWA 3TTHA 3S6HA 2C27A 5JQ4A 5F49A 2X7BA 4IF5A 2ZW6A 2FE7A 1M4GA 2O28A 3BJ7A 5JPHA 4DNCA 3ZJ0A 1YVKA 3SXOA 4LX9A 4RI1A 4R87A 1I1DA 2P0WA 4MJ8A 3P2FA 1I12A 4RS2A 3W6SA 4XPLA 4R9MA 5DWNA 1IYKA 3QAHA 4PK3A 2REFA 1LRZA 2KCWA 1MJ9A 2B58A 4JWPA 2VZYA 2WPXA 3R95A 4XPDC 2HQYA 1YREA 1SQHA 2PR8A 1S7KA 1Z9UA 1YK3A 3T9YA 4B5OA 1MK4A 2ARHA 4KOSA 4QBJA 2FT0A 3VWEA 5EBVA 2P6EA 1I21A 1IYLA 4UWIA 4CS0B 2J8MA 3S6GA 2G3AA 3TO7A 2ZW5A 4U9YA 1P4NA 1GHEA 3DR6A 2ZPAA 2FL4A 2D4PA 1B6BA 1U6MA 2J8NA 4QUSA 5J8FA 5HMNA 4YGOA 3R1KA 1S7LA 2I00A 4CAWA 4YFJA 2F5IA 2JLMA 4L89A 1RXTA 2IL4A 2Q4VA 2JEVA 2R1IA 3QB8A 4CRZB 4KUAA 2NMTA 3EO4A 3DSBA 4JD6A 3W6XA 3CXQA 3MGDA 1KUXA 1MJBA 2BEIA 4B5PB 4B5PA 5IV0A 5KTAA 1QSRA 4KVOE 4NF1A 1S7FA 3C26A 1YGHA 3LD2A 5IB0A 1VKCA 3TCVA 4ORFA 2Q44A 4KOUA 5F46A 4OAEA 1FY7A 3FIXA 2R8VA 1M4IA 4FD4A 3EY5A 4L8AA 3DNSA 1XIXA 1NMTA 1WWZA 2OU2A 4MY0A 4HNXB 4OLLA 5C88A 3ZZIA 4E2AA 2BSWA 4KOXA 1XEBA 1NSLA 2ATRA 4Y49C 4I49A 3BLNA 1NE9A 4OADA 4II9A 4QVTA 3FBUA 3B8GA 1QSNA 3LODA 1RO5A 4FD5A 3IGRA 2AJ6A 5I0CA 2Q7BA 5C82A 4KOYA 1K4JA 3D2MA 4MBUA 4NCZA 3T90A 1Y9WA 1QSTA 4PV6A 4XPDB 2B5GB 4UA3A 1YX0A 2B5GA 4AVAA 1IIDA 4MY3A 2I79A 2D4OA 2FCKA 5F47A 3CXPA 4KUBA 2PC1A 1Y7RA 5GCNA 2J8RA 2FIWA 3K9UA 3I3GA 3EFAA 1KZFA 4R3LA 3R9GA 1B87A 5H84A 1Q2DA 2FXFA 2EUIA 4LUAA 4FD6A 4PSWA 4PSXA 3DDDA 2PR1A 1BO4A 2WPWA 2Y0MA 2R98A 2P6GA 4KLWA 4AG7A 3TOBA 3GYAA 3W91A 2OB0A 4U9ZA 5ISVA 2FIAA 2VI7A 1N71A
chains in the Genus database with same CATH superfamily
2PJ5A 1AUGA 5I4MA 1S5KA 4KOTA 5LYIA 1CX8A 3FYNA 1VHOA 4C2YA 5FVJA 4Q7AA 4NFRA 1A2ZA 2Z3PA 2Q4YA 1ZG7A 3R96A 1XMBA 5AG7A 1YLEA 3FJUA 4CAEA 3CT9A 1TIQA 4H6UA 4KLVA 3S6KA 3LACA 4CPAA 2Q04A 2WUUA 5G20A 2K5TA 4CAVA 2EVNA 1XOVA 4H2KA 4IK2A 2Q0YA 1Z4RA 5BWAB 2A4NA 2Z3LA 4A33A 4GS4A 4AG9A 2Z0ZA 2VBQA 3TT2A 1ZLIA 2G9DA 4P4IA 3F0AA 2YNDA 3EC4A 3RO0A 1IU8A 1EE3P 4RUHA 4A30A 3PBBA 5DWMA 3FB3A 1Z8XA 4HNWB 1MJAA 1F2OA 4ZY1A 2DF5A 4UWJA 1UFHA 2B3VA 4PXBA 3BJ8A 1XMTA 1ELLP 1X12A 2BOAA 3CXSA 4UFXA 2BL1A 2FSRA 3EXNA 4JLYA 2CNSA 2C6CA 3IFEA 3HLPA 1CJWA 4KORA 4R57A 1Q2YA 5HVGA 2GU2A 3D7DA 4CYOA 2PDOA 4F0YA 1F57A 2VZZA 2EBJA 4YWYA 4CGLA 4OMEA 4JJXA 1ON0A 2FVGA 3A9LA 3PGPA 5F09A 5KTDA 1Q2CA 1S3ZA 1BPMA 2RC4A 2OZGA 5H86A 5KTCA 4M85A 3SI2A 1YW4A 1KWMA 1M1DA 3B35A 4MFKA 3KHZA 5ELYA 3RYOA 3BI0A 3V8IA 4UBRA 2BUEA 2PRBA 4RN7A 2F7VA 2B4BA 2AE6A 3JUWA 4IHMA 4Y49B 1V0CA 3R9FA 4CGOA 3S9MA 4NGSA 2CTBA 3PB8X 2PJ3A 2ZXVA 4C68A 1QMUA 3FXTA 2I3CA 3PFOA 1L0CA 1S7NA 4Q36A 3FRMA 4OC1A 3S6FA 1Q7LA 1YVOA 3PB4X 3GKRA 4NXYA 4X2TA 2PJ2A 4AB7A 4CYQA 4UIBA 2B3UA 4R3KA 4Z65A 4ONWA 3CPXA 3VH9A 1ARLA 5K8MA 2HB6A 2V8VA 1KUVA 3K9TA 3RBUA 1IOIA 3SXNA 4M6GA 5E96A 2PJ0A 4HNYB 2ANPA 2HV2A 2PE3A 2OOTA 4K3NA 5JM6A 1WK4A 4FD7A 4XNHC 2IJZA 3IU1A 4KOVA 1TKJA 2AFSA 5EMIA 3FVLA 3QAYA 4PXDA 4CAXA 2QYVA 4TWEA 4ZX9A 4FBEA 3MN8A 5IX3A 2QECA 1IY7A 5EC4A 3SJXA 3H4QA 3I1UA 3B3CA 3QNVA 4UEZA 3D2PA 4HPSA 3G3SA 4R6TA 3KI9A 1YR0A 4P4FA 3GB0A 4ONUA 4AVCA 4A95A 5AGEA 2B4DB 3G8WA 2B4DA 3PB9X 3V38A 4H6ZA 1YSJA 2CNMA 4OC2A 3CDXA 4CYNA 3FH4A 3H8FA 2CF4A 2Z10A 5K8NA 5CNPA 1XRYA 2CIJA 2XEIA 4MHNA 3PB6X 3TO9A 3F8KA 5F48A 2FS5A 3D8PA 4M6HA 3VWDA 4MFQA 4WWVA 2V8GA 2YNEA 3FNCA 3PP9A 4JXRA 3NH8A 1M4DA 1HDQA 4F8ZA 2OH1A 1R43A 3LMSA 4CRYB 2PJ8A 4JZ0A 3JVNA 4M3SA 4A2ZA 4QB9A 4NGTA 2PJ1A 1KUYA 2ZEHA 3NE7A 5K8PA 4KVXA 4PXEA 5J8CA 3WT4A 3R9EA 4NSQA 1Y0RA 1JQGA 2JEWA 1YW6A 4BINA 3FEDA 1FNOA 3D7HA 2HUZA 2QMLA 3SHPA 2DPSA 2GIVA 2JDDA 3NH4A 3UY5A 4E8OA 2OR4A 3GY9A 1Y9KA 3B3WA 4X5KA 1BPNA 4A39A 5HVFA 4CGPA 4UCNA 4FAIA 1Y7EA 2ZEEA 4OKOA 2ZELA 4NGMA 5HVHA 3FX6A 4MFPA 4JXQA 2G3TA 1TKHA 2JDCA 3PZJA 4KVME 1TF8A 1UWYA 3B2YA 4OC3A 1OZPA 2ZEGA 4P10A 3WR7A 2OZHA 3OWCA 1CP6A 4UFWA 2IMOA 2PQ8A 3NFZA 4G1PA 4NGPA 4OC5A 4U5YA 3D66A 3D3SA 3RAMA 5CPAA 1VHEA 1R3NA 1CPSA 4FWUA 2Z11A 1R57A 1ZLHA 1BOBA 1IB1E 4MCQA 1IICA 2YNCC 4BD9A 5LYFA 4BMHA 1Z4EA 2QIRA 1CM0A 1M4LA 3IO1A 4OC4A 4TNUA 1QSMA 4EVYA 5J1QA 1X10A 3IWGA 5HH1A 2YGWA 4MRIA 4K30A 4B13A 4XPKA 4E0AA 1QSOA 5DS0A 3TFYA 2Q43A 2ZW7A 4MXUA 1PUAA 3TE4A 3N7ZA 4F9UA 3P2HA 4R76A 4C7HA 2PVWA 2PIZA 4KZTA 4AVBA 1TKFA 2VXKA 4MFJA 3KQZA 2GE3A 3JRUA 4MHDA 2G0BA 4H89A 2ZEMA 4X8IA 2ODFA 2GREA 1CPXA 1LFWA 1XF8A 3SJEA 5A27A 1VIXA 1P0HA 2XEJA 3KQXA 4UEEA 3TX8A 3RNZA 3WC7A 2AFOA 3CPAA 2DXQA 4J3GA 3NE8A 4HKFA 3WC5A 1GYTA 1PU9A 2REEA 4A31A 2PJCA 3PEIA 4LQGA 4NEXA 4Q38A 1VHSA 4JYWA 4YRHA 5D29A 1S60A 4ZBGA 3TC8A 3TO6A 2OZUA 7CPAA 5HXDA 3I9SA 4DYOA 4QC6A 3TOAA 3E0KA 4KSAA 2V8HA 2IQ6A 2PJ9A 3KL9A 4CGNA 1M44A 1QQ9A 2C6PA 3D68A 3F5BA 4A38A 4KOWA 4P4EA 2CNTA 5LRKA 3GUXA 3KHXA 4P6YA 3KKWA 1JWQA 2GANA 4MHZA 4PK2A 1XBUA 3N5FA 4MI4A 1DE4C 2VEZA 1XE4A 3NA6A 2P6FA 3SJFA 4XNHB 2VQYA 3SI1A 2ZW4A 3DR8A 5D8NA 5AG6A 4IUSA 1VGYA 2H5MA 2R7HA 4ZY0A 1J4JA 1Z5RA 1XFOA 4F6AA 2BCOA 4P4BA 2CY2A 2PSWA 3TTHA 3S6HA 2C27A 5JQ4A 5F49A 2X7BA 4IF5A 3DGVA 1LAPA 2ZW6A 2FE7A 2WYRA 1M4GA 4MMOA 4UFVA 4NGNA 5K8OA 2O28A 2NSMA 3B7IA 3BJ7A 5JGFA 5JPHA 4DNCA 3ZJ0A 1YVKA 1IOFA 2DPTA 2GFQA 2ZENA 4LX9A 3FEEA 4R87A 4RI1A 3SXOA 4EMEA 1I1DA 2P0WA 2F8HA 4MJ8A 3P2FA 1NSAA 1I12A 1H8LA 4RS2A 3W6SA 4XPLA 4R9MA 5DWNA 3T8WA 3B3SA 1Z8WA 5JH9A 1IYKA 3QAHA 4KSIA 4PK3A 4WJBA 2REFA 1LRZA 2KCWA 5G1ZA 4CAFA 4UIAA 4F9VA 1MJ9A 3GLJA 2B58A 1RTQA 4ZI6A 4JWPA 3IIBA 3BI1A 3D67A 2VZYA 3KR4A 2WPXA 3RZAA 3IJ3A 3VATA 3R95A 4XPDC 2HQYA 1YREA 1SQHA 4IAVA 4MHYA 2PR8A 4NGQA 1PCAA 1S7KA 1Z9UA 4ZGYB 1YK3A 3T9YA 4MFZA 1MK4A 2ARHA 4B5OA 4KOSA 1YLOA 2FT0A 2PJ4A 4QBJA 3VWEA 5EBVA 2XEFA 2P6EA 1IGBA 1I21A 1ELMP 4P44A 1PYTB 3ISZA 3L2NA 1IYLA 4B10A 2DEAA 4UWIA 1XJOA 4C2ZA 4CS0B 2J8MA 3S6GA 5LYLA 3LWUA 1Y0YA 4CYPA 4UCPA 2G3AA 3TO7A 2ZW5A 3FMCA 2ZEFA 2QJ8A 4U9YA 1P4NA 1GHEA 3DR6A 2ZPAA 4P4DA 1ZG9A 2FL4A 2HC9A 2EK8A 1LCPA 2ZOFA 2D4PA 3D7FA 1B6BA 1U6MA 2Q51A 4UCMA 2J8NA 2PJAA 4QUSA 1YMEA 3BHXA 5J8FA 5HMNA 4LQ6A 2JBJA 1LOKA 2AFMA 5IB9A 2PJ6A 1TXRA 4CGMA 2YNCA 3SJGA 4EFDA 2PIYA 2QVPA 4YGOA 2Z3OA 3H5ZA 3R1KA 3KR5A 4OIDA 3VARA 1S7LA 3HUVA 4P45A 5CBMA 4OIWA 2I00A 2AFZA 5A28A 4CAWA 4DUKA 4YFJA 2F5IA 2V8DA 2JLMA 2ZEDA 4L89A 1RXTA 4M6IA 2EWBA 2IL4A 2Q4VA 3B3TA 5AG5A 3CZXA 2JEVA 2R1IA 3QB8A 4CRZB 2NYQA 2Q4ZA 2NMTA 4KUAA 3EO4A 4F0XA 4PPZA 3DSBA 3BXMA 2CXAA 3B3VA 3WABA 3PRTA 4JD6A 3W6XA 1LAMA 1YQEA 1OBRA 3CXQA 3MGDA 1KUXA 1MJBA 1HDUA 2BEIA 4B5PB 4MCSA 3GIUA 4MHPA 4B5PA 5IV0A 5KTAA 4R8FA 1QSRA 5AG4A 4KVOE 1Z8LA 4NF1A 1S7FA 3C26A 4P4JA 1YGHA 2WSAA 2J9AA 4UEFA 2JBKA 3LD2A 5IB0A 1VKCA 3TCVA 4ORFA 4KS9A 2Q44A 1DTDA 4KOUA 5F46A 3H8EA 4OAEA 1FY7A 3FIXA 2R8VA 1M4IA 2PVVA 2RFHA 1F2PA 2PRQA 3S9NA 4FD4A 3EY5A 2POKA 4B14A 3PFEA 3IU2A 4L8AA 2AFWA 2RB7A 4B12A 3DNSA 1XIXA 4NJRA 1NMTA 5LYDA 1WWZA 2OU2A 2GLJA 4MY0A 3MRUA 1AMPA 2ZOGA 3IWEA 4HNXB 4A37A 4OLLA 5C88A 8CPAA 3ZZIA 1FT7A 4UF4A 4E2AA 2BSWA 4KOXA 5G21A 2Z3KA 1XEBA 2PJ7A 2PJBA 1NSLA 1LANA 2ATRA 4Y49C 4I49A 3BLNA 1NE9A 3D7GA 2Q7SA 2VL1A 4OADA 2V77A 4II9A 4OP4A 4FUUA 4C7IA 4QVTA 1TF9A 3FBUA 5LRJA 3B8GA 1QSNA 5LRGA 3IWWA 1RO5A 3LODA 4FD5A 2O4HA 2ZEPA 5G22A 3SI0A 1Z2LA 2WZNA 4O23A 4AXVA 3IGRA 2C6GA 2AJ6A 5I0CA 3PB7X 1HEEA 2Q7BA 5C82A 3D4UA 4KOYA 1K4JA 3D2MA 2XEGA 4MBUA 4NCZA 3T90A 1Y9WA 1QSTA 4PV6A 1AYEA 4XPDB 2B5GB 3S9LA 4UA3A 1YX0A 2B5GA 1ARMA 2ZEOA 1IIDA 4AVAA 3KASA 4MY3A 2I79A 3ISXA 4X3RA 2D4OA 4DJLA 2FCKA 4KSFA 5F47A 3CXPA 2BO9A 4KUBA 4PQAA 3WC6A 2PC1A 4R7MA 3K2KA 1Y7RA 1CG2A 3JTKA 1CP7A 4MFLA 2J8RA 2PCUA 5GCNA 4BBHA 1BLLE 2FIWA 2ABZA 3K9UA 3I3GA 4MCRA 3EFAA 3H8GA 6CPAA 4OC0A 1KZFA 4R3LA 4ZY2A 1B87A 1ZO0A 4GM5A 3R9GA 4W9YA 5H84A 1Q2DA 3KGQA 5THWA 4MCPA 3PBEA 2FXFA 2EUIA 1ZG8A 4LUAA 4EWTA 2O53A 3NH5A 2C1CA 4FD6A 1BAVA 4PSWA 4YU9A 4A32A 2EO8A 2Z3MA 3DLJA 4PSXA 4PXCA 3DDDA 2PR1A 2EK9A 1BO4A 2WPWA 4NJQA 2Y0MA 2R98A 2Z3NA 3KZWA 4B6ZA 2P6GA 3IC1A 4KLWA 4ZX8A 3IEHA 1Z8TA 2AFUA 3FECA 4C2XA 4NGRA 3FF3A 1CBXA 2GLFA 4ZYQA 4AG7A 3TOBA 4A94A 3GYAA 2AFXA 3W91A 2OB0A 4B11A 4U9ZA 5ISVA 2FIAA 4GXHA 2VI7A 3V7ZA 1N71A 2CTCA
chains in the Genus database with same CATH topology
1S5KA 4KOTA 3FYNA 4C2YA 5FVJA 2Z3PA 2Q4YA 3R96A 5AG7A 1YLEA 4CAEA 1TIQA 4H6UA 4KLVA 3S6KA 2Q04A 2WUUA 5G20A 2K5TA 4CAVA 2EVNA 2Q0YA 1Z4RA 5BWAB 2A4NA 2Z3LA 4A33A 4GS4A 4AG9A 2Z0ZA 2VBQA 3TT2A 3F0AA 2YNDA 3EC4A 4A30A 5DWMA 3FB3A 4HNWB 1MJAA 4UWJA 1UFHA 2B3VA 3BJ8A 1XMTA 3CXSA 4UFXA 2BL1A 2FSRA 3EXNA 4JLYA 2CNSA 1CJWA 4KORA 4R57A 1Q2YA 4CYOA 2PDOA 4F0YA 2VZZA 4CGLA 4JJXA 1ON0A 3A9LA 5KTDA 3PGPA 1Q2CA 1S3ZA 2RC4A 2OZGA 5H86A 5KTCA 4M85A 1M1DA 4MFKA 3RYOA 3V8IA 4UBRA 2BUEA 2PRBA 2B4BA 2AE6A 3JUWA 4Y49B 1V0CA 3R9FA 4CGOA 2ZXVA 4C68A 3FXTA 1L0CA 1S7NA 4Q36A 3FRMA 3S6FA 1YVOA 4NXYA 3GKRA 4AB7A 4CYQA 2B3UA 4R3KA 1KUVA 3SXNA 5E96A 4HNYB 2HV2A 1WK4A 4FD7A 4XNHC 3IU1A 4KOVA 4CAXA 5IX3A 2QECA 5EC4A 3H4QA 3D2PA 3G3SA 1YR0A 4ONUA 4AVCA 4A95A 5AGEA 2B4DB 3G8WA 2B4DA 4H6ZA 2CNMA 4CYNA 2Z10A 5CNPA 3TO9A 3F8KA 5F48A 2FS5A 3D8PA 3VWDA 4MFQA 3FNCA 2YNEA 3PP9A 4JXRA 1M4DA 2OH1A 4CRYB 4M3SA 3JVNA 4A2ZA 4QB9A 1KUYA 3NE7A 4KVXA 5J8CA 3R9EA 4NSQA 2HUZA 2QMLA 3SHPA 2DPSA 2GIVA 2JDDA 3UY5A 4E8OA 3GY9A 1Y9KA 4X5KA 4CGPA 4UCNA 4MFPA 4JXQA 2G3TA 2JDCA 3PZJA 4KVME 1OZPA 3WR7A 2OZHA 3OWCA 4UFWA 2PQ8A 4U5YA 3D3SA 2Z11A 1R57A 1BOBA 1IB1E 1IICA 2YNCC 4BMHA 1Z4EA 2QIRA 1CM0A 1QSMA 4EVYA 5HH1A 3IWGA 2YGWA 4K30A 4B13A 4XPKA 4E0AA 1QSOA 3TFYA 2ZW7A 1PUAA 3TE4A 3N7ZA 3P2HA 4C7HA 4KZTA 4MFJA 2VXKA 2GE3A 4MHDA 2G0BA 4H89A 1XF8A 5A27A 1P0HA 2DXQA 4J3GA 4HKFA 1PU9A 2REEA 4A31A 4Q38A 4AVBA 4NEXA 1VHSA 4YRHA 4ZBGA 3TO6A 1S60A 2OZUA 3I9SA 4QC6A 3TOAA 3E0KA 4KSAA 4CGNA 1M44A 3F5BA 4KOWA 2CNTA 3KKWA 2GANA 4PK2A 4MI4A 2VEZA 1XE4A 2P6FA 4XNHB 2VQYA 2ZW4A 3DR8A 5AG6A 4IUSA 2H5MA 2R7HA 1J4JA 4F6AA 2CY2A 2PSWA 3TTHA 3S6HA 2C27A 5JQ4A 5F49A 2X7BA 4IF5A 2ZW6A 2FE7A 4UFVA 1M4GA 2O28A 3BJ7A 5JPHA 4DNCA 3ZJ0A 1YVKA 2DPTA 3SXOA 4LX9A 4RI1A 4R87A 1I1DA 2P0WA 4MJ8A 3P2FA 1I12A 4RS2A 3W6SA 4XPLA 4R9MA 5DWNA 1IYKA 3QAHA 4PK3A 5G1ZA 2REFA 1LRZA 2KCWA 4CAFA 1MJ9A 2B58A 4JWPA 2VZYA 2WPXA 3R95A 4XPDC 2HQYA 1YREA 1SQHA 2PR8A 1S7KA 1Z9UA 4ZGYB 1YK3A 3T9YA 4MFZA 1MK4A 2ARHA 4B5OA 4KOSA 4QBJA 2FT0A 3VWEA 5EBVA 2P6EA 1I21A 1IYLA 4B10A 4UWIA 4C2ZA 4CS0B 2J8MA 3S6GA 4CYPA 4UCPA 2G3AA 3TO7A 2ZW5A 4U9YA 1P4NA 1GHEA 3DR6A 2ZPAA 2FL4A 2D4PA 1B6BA 1U6MA 4UCMA 2J8NA 4QUSA 5J8FA 5HMNA 4CGMA 2YNCA 4YGOA 2Z3OA 3H5ZA 3R1KA 1S7LA 2I00A 5A28A 4CAWA 4YFJA 2F5IA 2JLMA 4L89A 1RXTA 2IL4A 2Q4VA 5AG5A 2JEVA 2R1IA 3QB8A 4CRZB 4KUAA 4F0XA 2NMTA 3EO4A 3DSBA 2CXAA 4JD6A 3W6XA 3CXQA 3MGDA 1KUXA 1MJBA 2BEIA 4B5PB 4B5PA 5IV0A 5KTAA 1QSRA 5AG4A 4KVOE 4NF1A 1S7FA 3C26A 1YGHA 2WSAA 3LD2A 5IB0A 1VKCA 3TCVA 4ORFA 4KS9A 2Q44A 4KOUA 5F46A 4OAEA 1FY7A 3FIXA 2R8VA 1M4IA 4FD4A 3EY5A 4B14A 3IU2A 4L8AA 4B12A 3DNSA 1XIXA 1NMTA 1WWZA 2OU2A 4MY0A 3IWEA 4HNXB 4OLLA 5C88A 3ZZIA 4E2AA 2BSWA 4KOXA 5G21A 2Z3KA 1XEBA 1NSLA 2ATRA 4Y49C 4I49A 3BLNA 1NE9A 4OADA 4II9A 4C7IA 4QVTA 3FBUA 3B8GA 1QSNA 3LODA 1RO5A 4FD5A 5G22A 3IGRA 2AJ6A 5I0CA 2Q7BA 5C82A 4KOYA 1K4JA 3D2MA 4MBUA 4NCZA 3T90A 1Y9WA 1QSTA 4PV6A 4XPDB 2B5GB 4UA3A 1YX0A 2B5GA 4AVAA 1IIDA 4MY3A 2I79A 2D4OA 2FCKA 4KSFA 5F47A 3CXPA 4KUBA 2PC1A 1Y7RA 4MFLA 3JTKA 5GCNA 4BBHA 2J8RA 2FIWA 3K9UA 3I3GA 3EFAA 1KZFA 4R3LA 3R9GA 1B87A 1ZO0A 5H84A 1Q2DA 2FXFA 2EUIA 4LUAA 4FD6A 4PSWA 4A32A 2Z3MA 4PSXA 3DDDA 2PR1A 1BO4A 2WPWA 2Y0MA 2R98A 2Z3NA 2P6GA 4KLWA 4C2XA 4AG7A 3TOBA 3GYAA 3W91A 2OB0A 4B11A 4U9ZA 5ISVA 2FIAA 2VI7A 1N71A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1S5K A;  4KOT A;  3FYN A;  5FVJ A;  2Q4Y A;  3R96 A;  1YLE A;  1TIQ A;  4H6U A;  4KLV A;  3S6K A;  2Q04 A;  2K5T A;  4CAV A;  2EVN A;  2Q0Y A;  1Z4R A;  2A4N A;  4AG9 A;  4GS4 A;  2Z0Z A;  2VBQ A;  3TT2 A;  3F0A A;  3EC4 A;  5DWM A;  3FB3 A;  4HNW B;  1MJA A;  4UWJ A;  1UFH A;  2B3V A;  3BJ8 A;  1XMT A;  3CXS A;  2BL1 A;  2FSR A;  3EXN A;  4JLY A;  2CNS A;  1CJW A;  4KOR A;  4R57 A;  1Q2Y A;  2PDO A;  4F0Y A;  2VZZ A;  4JJX A;  1ON0 A;  5KTD A;  3PGP A;  1Q2C A;  1S3Z A;  2RC4 A;  2OZG A;  5H86 A;  5KTC A;  4M85 A;  1M1D A;  3RYO A;  3V8I A;  4UBR A;  2BUE A;  2PRB A;  2B4B A;  2AE6 A;  3JUW A;  4Y49 B;  1V0C A;  3R9F A;  2ZXV A;  3FXT A;  1L0C A;  1S7N A;  3FRM A;  3S6F A;  1YVO A;  4NXY A;  3GKR A;  4AB7 A;  2B3U A;  4R3K A;  1KUV A;  3SXN A;  5E96 A;  4HNY B;  2HV2 A;  1WK4 A;  4FD7 A;  4XNH C;  4KOV A;  4CAX A;  5IX3 A;  2QEC A;  5EC4 A;  3H4Q A;  3D2P A;  3G3S A;  1YR0 A;  4ONU A;  4AVC A;  2B4D B;  3G8W A;  2B4D A;  4H6Z A;  2CNM A;  2Z10 A;  5CNP A;  3TO9 A;  3F8K A;  5F48 A;  2FS5 A;  3D8P A;  3VWD A;  3FNC A;  3PP9 A;  4JXR A;  1M4D A;  2OH1 A;  4CRY B;  4M3S A;  3JVN A;  4QB9 A;  1KUY A;  3NE7 A;  4KVX A;  5J8C A;  3R9E A;  4NSQ A;  2HUZ A;  2QML A;  3SHP A;  2GIV A;  2JDD A;  3UY5 A;  4E8O A;  3GY9 A;  1Y9K A;  4X5K A;  4JXQ A;  2G3T A;  2JDC A;  3PZJ A;  4KVM E;  1OZP A;  3WR7 A;  2OZH A;  3OWC A;  2PQ8 A;  4U5Y A;  3D3S A;  2Z11 A;  1R57 A;  1BOB A;  1IB1 E;  1IIC A;  4BMH A;  1Z4E A;  2QIR A;  1CM0 A;  1QSM A;  4EVY A;  5HH1 A;  3IWG A;  4K30 A;  4E0A A;  4XPK A;  1QSO A;  3TFY A;  2ZW7 A;  1PUA A;  3TE4 A;  3N7Z A;  3P2H A;  4KZT A;  2VXK A;  2GE3 A;  4MHD A;  2G0B A;  4H89 A;  1XF8 A;  1P0H A;  2DXQ A;  4J3G A;  4HKF A;  1PU9 A;  2REE A;  4AVB A;  4NEX A;  1VHS A;  4YRH A;  4ZBG A;  3TO6 A;  1S60 A;  2OZU A;  3I9S A;  4QC6 A;  3TOA A;  3E0K A;  1M44 A;  3F5B A;  4KOW A;  2CNT A;  3KKW A;  2GAN A;  4PK2 A;  4MI4 A;  2VEZ A;  1XE4 A;  2P6F A;  4XNH B;  2VQY A;  2ZW4 A;  3DR8 A;  4IUS A;  2H5M A;  2R7H A;  1J4J A;  4F6A A;  2CY2 A;  2PSW A;  3TTH A;  3S6H A;  2C27 A;  5JQ4 A;  5F49 A;  2X7B A;  4IF5 A;  2ZW6 A;  2FE7 A;  1M4G A;  2O28 A;  3BJ7 A;  5JPH A;  4DNC A;  3ZJ0 A;  1YVK A;  3SXO A;  4LX9 A;  4RI1 A;  4R87 A;  1I1D A;  2P0W A;  4MJ8 A;  3P2F A;  1I12 A;  4RS2 A;  3W6S A;  4XPL A;  4R9M A;  5DWN A;  1IYK A;  3QAH A;  4PK3 A;  2REF A;  1LRZ A;  2KCW A;  1MJ9 A;  2B58 A;  4JWP A;  2VZY A;  2WPX A;  3R95 A;  4XPD C;  2HQY A;  1YRE A;  1SQH A;  2PR8 A;  1S7K A;  1Z9U A;  1YK3 A;  3T9Y A;  4B5O A;  1MK4 A;  2ARH A;  4KOS A;  4QBJ A;  2FT0 A;  3VWE A;  5EBV A;  2P6E A;  1I21 A;  1IYL A;  4UWI A;  4CS0 B;  2J8M A;  3S6G A;  2G3A A;  3TO7 A;  2ZW5 A;  4U9Y A;  1P4N A;  1GHE A;  3DR6 A;  2ZPA A;  2FL4 A;  2D4P A;  1B6B A;  1U6M A;  2J8N A;  4QUS A;  5J8F A;  5HMN A;  4YGO A;  3R1K A;  1S7L A;  2I00 A;  4CAW A;  4YFJ A;  2F5I A;  2JLM A;  4L89 A;  1RXT A;  2IL4 A;  2Q4V A;  2JEV A;  2R1I A;  3QB8 A;  4CRZ B;  4KUA A;  2NMT A;  3EO4 A;  3DSB A;  4JD6 A;  3W6X A;  3CXQ A;  3MGD A;  1KUX A;  1MJB A;  2BEI A;  4B5P B;  4B5P A;  5IV0 A;  5KTA A;  1QSR A;  4KVO E;  4NF1 A;  1S7F A;  3C26 A;  1YGH A;  3LD2 A;  5IB0 A;  1VKC A;  3TCV A;  4ORF A;  2Q44 A;  4KOU A;  5F46 A;  4OAE A;  1FY7 A;  3FIX A;  2R8V A;  1M4I A;  4FD4 A;  3EY5 A;  4L8A A;  3DNS A;  1XIX A;  1NMT A;  1WWZ A;  2OU2 A;  4MY0 A;  4HNX B;  4OLL A;  5C88 A;  3ZZI A;  4E2A A;  2BSW A;  4KOX A;  1XEB A;  1NSL A;  2ATR A;  4Y49 C;  4I49 A;  3BLN A;  1NE9 A;  4OAD A;  4II9 A;  4QVT A;  3FBU A;  3B8G A;  1QSN A;  3LOD A;  1RO5 A;  4FD5 A;  3IGR A;  2AJ6 A;  5I0C A;  2Q7B A;  5C82 A;  4KOY A;  1K4J A;  3D2M A;  4MBU A;  4NCZ A;  3T90 A;  1Y9W A;  1QST A;  4PV6 A;  4XPD B;  2B5G B;  4UA3 A;  1YX0 A;  2B5G A;  4AVA A;  1IID A;  4MY3 A;  2I79 A;  2D4O A;  2FCK A;  5F47 A;  3CXP A;  4KUB A;  2PC1 A;  1Y7R A;  5GCN A;  2J8R A;  2FIW A;  3K9U A;  3I3G A;  3EFA A;  1KZF A;  4R3L A;  3R9G A;  1B87 A;  5H84 A;  1Q2D A;  2FXF A;  2EUI A;  4LUA A;  4FD6 A;  4PSW A;  4PSX A;  3DDD A;  2PR1 A;  1BO4 A;  2WPW A;  2Y0M A;  2R98 A;  2P6G A;  4KLW A;  4AG7 A;  3TOB A;  3GYA A;  3W91 A;  2OB0 A;  4U9Z A;  5ISV A;  2FIA A;  2VI7 A;  1N71 A; 
#chains in the Genus database with same CATH topology
 2PJ5 A;  1AUG A;  5I4M A;  1S5K A;  4KOT A;  5LYI A;  1CX8 A;  3FYN A;  1VHO A;  4C2Y A;  5FVJ A;  4Q7A A;  4NFR A;  1A2Z A;  2Z3P A;  2Q4Y A;  1ZG7 A;  3R96 A;  1XMB A;  5AG7 A;  1YLE A;  3FJU A;  4CAE A;  3CT9 A;  1TIQ A;  4H6U A;  4KLV A;  3S6K A;  3LAC A;  4CPA A;  2Q04 A;  2WUU A;  5G20 A;  2K5T A;  4CAV A;  2EVN A;  1XOV A;  4H2K A;  4IK2 A;  2Q0Y A;  1Z4R A;  5BWA B;  2A4N A;  2Z3L A;  4A33 A;  4GS4 A;  4AG9 A;  2Z0Z A;  2VBQ A;  3TT2 A;  1ZLI A;  2G9D A;  4P4I A;  3F0A A;  2YND A;  3EC4 A;  3RO0 A;  1IU8 A;  1EE3 P;  4RUH A;  4A30 A;  3PBB A;  5DWM A;  3FB3 A;  1Z8X A;  4HNW B;  1MJA A;  1F2O A;  4ZY1 A;  2DF5 A;  4UWJ A;  1UFH A;  2B3V A;  4PXB A;  3BJ8 A;  1XMT A;  1ELL P;  1X12 A;  2BOA A;  3CXS A;  4UFX A;  2BL1 A;  2FSR A;  3EXN A;  4JLY A;  2CNS A;  2C6C A;  3IFE A;  3HLP A;  1CJW A;  4KOR A;  4R57 A;  1Q2Y A;  5HVG A;  2GU2 A;  3D7D A;  4CYO A;  2PDO A;  4F0Y A;  1F57 A;  2VZZ A;  2EBJ A;  4YWY A;  4CGL A;  4OME A;  4JJX A;  1ON0 A;  2FVG A;  3A9L A;  3PGP A;  5F09 A;  5KTD A;  1Q2C A;  1S3Z A;  1BPM A;  2RC4 A;  2OZG A;  5H86 A;  5KTC A;  4M85 A;  3SI2 A;  1YW4 A;  1KWM A;  1M1D A;  3B35 A;  4MFK A;  3KHZ A;  5ELY A;  3RYO A;  3BI0 A;  3V8I A;  4UBR A;  2BUE A;  2PRB A;  4RN7 A;  2F7V A;  2B4B A;  2AE6 A;  3JUW A;  4IHM A;  4Y49 B;  1V0C A;  3R9F A;  4CGO A;  3S9M A;  4NGS A;  2CTB A;  3PB8 X;  2PJ3 A;  2ZXV A;  4C68 A;  1QMU A;  3FXT A;  2I3C A;  3PFO A;  1L0C A;  1S7N A;  4Q36 A;  3FRM A;  4OC1 A;  3S6F A;  1Q7L A;  1YVO A;  3PB4 X;  3GKR A;  4NXY A;  4X2T A;  2PJ2 A;  4AB7 A;  4CYQ A;  4UIB A;  2B3U A;  4R3K A;  4Z65 A;  4ONW A;  3CPX A;  3VH9 A;  1ARL A;  5K8M A;  2HB6 A;  2V8V A;  1KUV A;  3K9T A;  3RBU A;  1IOI A;  3SXN A;  4M6G A;  5E96 A;  2PJ0 A;  4HNY B;  2ANP A;  2HV2 A;  2PE3 A;  2OOT A;  4K3N A;  5JM6 A;  1WK4 A;  4FD7 A;  4XNH C;  2IJZ A;  3IU1 A;  4KOV A;  1TKJ A;  2AFS A;  5EMI A;  3FVL A;  3QAY A;  4PXD A;  4CAX A;  2QYV A;  4TWE A;  4ZX9 A;  4FBE A;  3MN8 A;  5IX3 A;  2QEC A;  1IY7 A;  5EC4 A;  3SJX A;  3H4Q A;  3I1U A;  3B3C A;  3QNV A;  4UEZ A;  3D2P A;  4HPS A;  3G3S A;  4R6T A;  3KI9 A;  1YR0 A;  4P4F A;  3GB0 A;  4ONU A;  4AVC A;  4A95 A;  5AGE A;  2B4D B;  3G8W A;  2B4D A;  3PB9 X;  3V38 A;  4H6Z A;  1YSJ A;  2CNM A;  4OC2 A;  3CDX A;  4CYN A;  3FH4 A;  3H8F A;  2CF4 A;  2Z10 A;  5K8N A;  5CNP A;  1XRY A;  2CIJ A;  2XEI A;  4MHN A;  3PB6 X;  3TO9 A;  3F8K A;  5F48 A;  2FS5 A;  3D8P A;  4M6H A;  3VWD A;  4MFQ A;  4WWV A;  2V8G A;  2YNE A;  3FNC A;  3PP9 A;  4JXR A;  3NH8 A;  1M4D A;  1HDQ A;  4F8Z A;  2OH1 A;  1R43 A;  3LMS A;  4CRY B;  2PJ8 A;  4JZ0 A;  3JVN A;  4M3S A;  4A2Z A;  4QB9 A;  4NGT A;  2PJ1 A;  1KUY A;  2ZEH A;  3NE7 A;  5K8P A;  4KVX A;  4PXE A;  5J8C A;  3WT4 A;  3R9E A;  4NSQ A;  1Y0R A;  1JQG A;  2JEW A;  1YW6 A;  4BIN A;  3FED A;  1FNO A;  3D7H A;  2HUZ A;  2QML A;  3SHP A;  2DPS A;  2GIV A;  2JDD A;  3NH4 A;  3UY5 A;  4E8O A;  2OR4 A;  3GY9 A;  1Y9K A;  3B3W A;  4X5K A;  1BPN A;  4A39 A;  5HVF A;  4CGP A;  4UCN A;  4FAI A;  1Y7E A;  2ZEE A;  4OKO A;  2ZEL A;  4NGM A;  5HVH A;  3FX6 A;  4MFP A;  4JXQ A;  2G3T A;  1TKH A;  2JDC A;  3PZJ A;  4KVM E;  1TF8 A;  1UWY A;  3B2Y A;  4OC3 A;  1OZP A;  2ZEG A;  4P10 A;  3WR7 A;  2OZH A;  3OWC A;  1CP6 A;  4UFW A;  2IMO A;  2PQ8 A;  3NFZ A;  4G1P A;  4NGP A;  4OC5 A;  4U5Y A;  3D66 A;  3D3S A;  3RAM A;  5CPA A;  1VHE A;  1R3N A;  1CPS A;  4FWU A;  2Z11 A;  1R57 A;  1ZLH A;  1BOB A;  1IB1 E;  4MCQ A;  1IIC A;  2YNC C;  4BD9 A;  5LYF A;  4BMH A;  1Z4E A;  2QIR A;  1CM0 A;  1M4L A;  3IO1 A;  4OC4 A;  4TNU A;  1QSM A;  4EVY A;  5J1Q A;  1X10 A;  3IWG A;  5HH1 A;  2YGW A;  4MRI A;  4K30 A;  4B13 A;  4XPK A;  4E0A A;  1QSO A;  5DS0 A;  3TFY A;  2Q43 A;  2ZW7 A;  4MXU A;  1PUA A;  3TE4 A;  3N7Z A;  4F9U A;  3P2H A;  4R76 A;  4C7H A;  2PVW A;  2PIZ A;  4KZT A;  4AVB A;  1TKF A;  2VXK A;  4MFJ A;  3KQZ A;  2GE3 A;  3JRU A;  4MHD A;  2G0B A;  4H89 A;  2ZEM A;  4X8I A;  2ODF A;  2GRE A;  1CPX A;  1LFW A;  1XF8 A;  3SJE A;  5A27 A;  1VIX A;  1P0H A;  2XEJ A;  3KQX A;  4UEE A;  3TX8 A;  3RNZ A;  3WC7 A;  2AFO A;  3CPA A;  2DXQ A;  4J3G A;  3NE8 A;  4HKF A;  3WC5 A;  1GYT A;  1PU9 A;  2REE A;  4A31 A;  2PJC A;  3PEI A;  4LQG A;  4NEX A;  4Q38 A;  1VHS A;  4JYW A;  4YRH A;  5D29 A;  1S60 A;  4ZBG A;  3TC8 A;  3TO6 A;  2OZU A;  7CPA A;  5HXD A;  3I9S A;  4DYO A;  4QC6 A;  3TOA A;  3E0K A;  4KSA A;  2V8H A;  2IQ6 A;  2PJ9 A;  3KL9 A;  4CGN A;  1M44 A;  1QQ9 A;  2C6P A;  3D68 A;  3F5B A;  4A38 A;  4KOW A;  4P4E A;  2CNT A;  5LRK A;  3GUX A;  3KHX A;  4P6Y A;  3KKW A;  1JWQ A;  2GAN A;  4MHZ A;  4PK2 A;  1XBU A;  3N5F A;  4MI4 A;  1DE4 C;  2VEZ A;  1XE4 A;  3NA6 A;  2P6F A;  3SJF A;  4XNH B;  2VQY A;  3SI1 A;  2ZW4 A;  3DR8 A;  5D8N A;  5AG6 A;  4IUS A;  1VGY A;  2H5M A;  2R7H A;  4ZY0 A;  1J4J A;  1Z5R A;  1XFO A;  4F6A A;  2BCO A;  4P4B A;  2CY2 A;  2PSW A;  3TTH A;  3S6H A;  2C27 A;  5JQ4 A;  5F49 A;  2X7B A;  4IF5 A;  3DGV A;  1LAP A;  2ZW6 A;  2FE7 A;  2WYR A;  1M4G A;  4MMO A;  4UFV A;  4NGN A;  5K8O A;  2O28 A;  2NSM A;  3B7I A;  3BJ7 A;  5JGF A;  5JPH A;  4DNC A;  3ZJ0 A;  1YVK A;  1IOF A;  2DPT A;  2GFQ A;  2ZEN A;  4LX9 A;  3FEE A;  4R87 A;  4RI1 A;  3SXO A;  4EME A;  1I1D A;  2P0W A;  2F8H A;  4MJ8 A;  3P2F A;  1NSA A;  1I12 A;  1H8L A;  4RS2 A;  3W6S A;  4XPL A;  4R9M A;  5DWN A;  3T8W A;  3B3S A;  1Z8W A;  5JH9 A;  1IYK A;  3QAH A;  4KSI A;  4PK3 A;  4WJB A;  2REF A;  1LRZ A;  2KCW A;  5G1Z A;  4CAF A;  4UIA A;  4F9V A;  1MJ9 A;  3GLJ A;  2B58 A;  1RTQ A;  4ZI6 A;  4JWP A;  3IIB A;  3BI1 A;  3D67 A;  2VZY A;  3KR4 A;  2WPX A;  3RZA A;  3IJ3 A;  3VAT A;  3R95 A;  4XPD C;  2HQY A;  1YRE A;  1SQH A;  4IAV A;  4MHY A;  2PR8 A;  4NGQ A;  1PCA A;  1S7K A;  1Z9U A;  4ZGY B;  1YK3 A;  3T9Y A;  4MFZ A;  1MK4 A;  2ARH A;  4B5O A;  4KOS A;  1YLO A;  2FT0 A;  2PJ4 A;  4QBJ A;  3VWE A;  5EBV A;  2XEF A;  2P6E A;  1IGB A;  1I21 A;  1ELM P;  4P44 A;  1PYT B;  3ISZ A;  3L2N A;  1IYL A;  4B10 A;  2DEA A;  4UWI A;  1XJO A;  4C2Z A;  4CS0 B;  2J8M A;  3S6G A;  5LYL A;  3LWU A;  1Y0Y A;  4CYP A;  4UCP A;  2G3A A;  3TO7 A;  2ZW5 A;  3FMC A;  2ZEF A;  2QJ8 A;  4U9Y A;  1P4N A;  1GHE A;  3DR6 A;  2ZPA A;  4P4D A;  1ZG9 A;  2FL4 A;  2HC9 A;  2EK8 A;  1LCP A;  2ZOF A;  2D4P A;  3D7F A;  1B6B A;  1U6M A;  2Q51 A;  4UCM A;  2J8N A;  2PJA A;  4QUS A;  1YME A;  3BHX A;  5J8F A;  5HMN A;  4LQ6 A;  2JBJ A;  1LOK A;  2AFM A;  5IB9 A;  2PJ6 A;  1TXR A;  4CGM A;  2YNC A;  3SJG A;  4EFD A;  2PIY A;  2QVP A;  4YGO A;  2Z3O A;  3H5Z A;  3R1K A;  3KR5 A;  4OID A;  3VAR A;  1S7L A;  3HUV A;  4P45 A;  5CBM A;  4OIW A;  2I00 A;  2AFZ A;  5A28 A;  4CAW A;  4DUK A;  4YFJ A;  2F5I A;  2V8D A;  2JLM A;  2ZED A;  4L89 A;  1RXT A;  4M6I A;  2EWB A;  2IL4 A;  2Q4V A;  3B3T A;  5AG5 A;  3CZX A;  2JEV A;  2R1I A;  3QB8 A;  4CRZ B;  2NYQ A;  2Q4Z A;  2NMT A;  4KUA A;  3EO4 A;  4F0X A;  4PPZ A;  3DSB A;  3BXM A;  2CXA A;  3B3V A;  3WAB A;  3PRT A;  4JD6 A;  3W6X A;  1LAM A;  1YQE A;  1OBR A;  3CXQ A;  3MGD A;  1KUX A;  1MJB A;  1HDU A;  2BEI A;  4B5P B;  4MCS A;  3GIU A;  4MHP A;  4B5P A;  5IV0 A;  5KTA A;  4R8F A;  1QSR A;  5AG4 A;  4KVO E;  1Z8L A;  4NF1 A;  1S7F A;  3C26 A;  4P4J A;  1YGH A;  2WSA A;  2J9A A;  4UEF A;  2JBK A;  3LD2 A;  5IB0 A;  1VKC A;  3TCV A;  4ORF A;  4KS9 A;  2Q44 A;  1DTD A;  4KOU A;  5F46 A;  3H8E A;  4OAE A;  1FY7 A;  3FIX A;  2R8V A;  1M4I A;  2PVV A;  2RFH A;  1F2P A;  2PRQ A;  3S9N A;  4FD4 A;  3EY5 A;  2POK A;  4B14 A;  3PFE A;  3IU2 A;  4L8A A;  2AFW A;  2RB7 A;  4B12 A;  3DNS A;  1XIX A;  4NJR A;  1NMT A;  5LYD A;  1WWZ A;  2OU2 A;  2GLJ A;  4MY0 A;  3MRU A;  1AMP A;  2ZOG A;  3IWE A;  4HNX B;  4A37 A;  4OLL A;  5C88 A;  8CPA A;  3ZZI A;  1FT7 A;  4UF4 A;  4E2A A;  2BSW A;  4KOX A;  5G21 A;  2Z3K A;  1XEB A;  2PJ7 A;  2PJB A;  1NSL A;  1LAN A;  2ATR A;  4Y49 C;  4I49 A;  3BLN A;  1NE9 A;  3D7G A;  2Q7S A;  2VL1 A;  4OAD A;  2V77 A;  4II9 A;  4OP4 A;  4FUU A;  4C7I A;  4QVT A;  1TF9 A;  3FBU A;  5LRJ A;  3B8G A;  1QSN A;  5LRG A;  3IWW A;  1RO5 A;  3LOD A;  4FD5 A;  2O4H A;  2ZEP A;  5G22 A;  3SI0 A;  1Z2L A;  2WZN A;  4O23 A;  4AXV A;  3IGR A;  2C6G A;  2AJ6 A;  5I0C A;  3PB7 X;  1HEE A;  2Q7B A;  5C82 A;  3D4U A;  4KOY A;  1K4J A;  3D2M A;  2XEG A;  4MBU A;  4NCZ A;  3T90 A;  1Y9W A;  1QST A;  4PV6 A;  1AYE A;  4XPD B;  2B5G B;  3S9L A;  4UA3 A;  1YX0 A;  2B5G A;  1ARM A;  2ZEO A;  1IID A;  4AVA A;  3KAS A;  4MY3 A;  2I79 A;  3ISX A;  4X3R A;  2D4O A;  4DJL A;  2FCK A;  4KSF A;  5F47 A;  3CXP A;  2BO9 A;  4KUB A;  4PQA A;  3WC6 A;  2PC1 A;  4R7M A;  3K2K A;  1Y7R A;  1CG2 A;  3JTK A;  1CP7 A;  4MFL A;  2J8R A;  2PCU A;  5GCN A;  4BBH A;  1BLL E;  2FIW A;  2ABZ A;  3K9U A;  3I3G A;  4MCR A;  3EFA A;  3H8G A;  6CPA A;  4OC0 A;  1KZF A;  4R3L A;  4ZY2 A;  1B87 A;  1ZO0 A;  4GM5 A;  3R9G A;  4W9Y A;  5H84 A;  1Q2D A;  3KGQ A;  5THW A;  4MCP A;  3PBE A;  2FXF A;  2EUI A;  1ZG8 A;  4LUA A;  4EWT A;  2O53 A;  3NH5 A;  2C1C A;  4FD6 A;  1BAV A;  4PSW A;  4YU9 A;  4A32 A;  2EO8 A;  2Z3M A;  3DLJ A;  4PSX A;  4PXC A;  3DDD A;  2PR1 A;  2EK9 A;  1BO4 A;  2WPW A;  4NJQ A;  2Y0M A;  2R98 A;  2Z3N A;  3KZW A;  4B6Z A;  2P6G A;  3IC1 A;  4KLW A;  4ZX8 A;  3IEH A;  1Z8T A;  2AFU A;  3FEC A;  4C2X A;  4NGR A;  3FF3 A;  1CBX A;  2GLF A;  4ZYQ A;  4AG7 A;  3TOB A;  4A94 A;  3GYA A;  2AFX A;  3W91 A;  2OB0 A;  4B11 A;  4U9Z A;  5ISV A;  2FIA A;  4GXH A;  2VI7 A;  3V7Z A;  1N71 A;  2CTC A; 
#chains in the Genus database with same CATH homology
 1S5K A;  4KOT A;  3FYN A;  4C2Y A;  5FVJ A;  2Z3P A;  2Q4Y A;  3R96 A;  5AG7 A;  1YLE A;  4CAE A;  1TIQ A;  4H6U A;  4KLV A;  3S6K A;  2Q04 A;  2WUU A;  5G20 A;  2K5T A;  4CAV A;  2EVN A;  2Q0Y A;  1Z4R A;  5BWA B;  2A4N A;  2Z3L A;  4A33 A;  4GS4 A;  4AG9 A;  2Z0Z A;  2VBQ A;  3TT2 A;  3F0A A;  2YND A;  3EC4 A;  4A30 A;  5DWM A;  3FB3 A;  4HNW B;  1MJA A;  4UWJ A;  1UFH A;  2B3V A;  3BJ8 A;  1XMT A;  3CXS A;  4UFX A;  2BL1 A;  2FSR A;  3EXN A;  4JLY A;  2CNS A;  1CJW A;  4KOR A;  4R57 A;  1Q2Y A;  4CYO A;  2PDO A;  4F0Y A;  2VZZ A;  4CGL A;  4JJX A;  1ON0 A;  3A9L A;  5KTD A;  3PGP A;  1Q2C A;  1S3Z A;  2RC4 A;  2OZG A;  5H86 A;  5KTC A;  4M85 A;  1M1D A;  4MFK A;  3RYO A;  3V8I A;  4UBR A;  2BUE A;  2PRB A;  2B4B A;  2AE6 A;  3JUW A;  4Y49 B;  1V0C A;  3R9F A;  4CGO A;  2ZXV A;  4C68 A;  3FXT A;  1L0C A;  1S7N A;  4Q36 A;  3FRM A;  3S6F A;  1YVO A;  4NXY A;  3GKR A;  4AB7 A;  4CYQ A;  2B3U A;  4R3K A;  1KUV A;  3SXN A;  5E96 A;  4HNY B;  2HV2 A;  1WK4 A;  4FD7 A;  4XNH C;  3IU1 A;  4KOV A;  4CAX A;  5IX3 A;  2QEC A;  5EC4 A;  3H4Q A;  3D2P A;  3G3S A;  1YR0 A;  4ONU A;  4AVC A;  4A95 A;  5AGE A;  2B4D B;  3G8W A;  2B4D A;  4H6Z A;  2CNM A;  4CYN A;  2Z10 A;  5CNP A;  3TO9 A;  3F8K A;  5F48 A;  2FS5 A;  3D8P A;  3VWD A;  4MFQ A;  3FNC A;  2YNE A;  3PP9 A;  4JXR A;  1M4D A;  2OH1 A;  4CRY B;  4M3S A;  3JVN A;  4A2Z A;  4QB9 A;  1KUY A;  3NE7 A;  4KVX A;  5J8C A;  3R9E A;  4NSQ A;  2HUZ A;  2QML A;  3SHP A;  2DPS A;  2GIV A;  2JDD A;  3UY5 A;  4E8O A;  3GY9 A;  1Y9K A;  4X5K A;  4CGP A;  4UCN A;  4MFP A;  4JXQ A;  2G3T A;  2JDC A;  3PZJ A;  4KVM E;  1OZP A;  3WR7 A;  2OZH A;  3OWC A;  4UFW A;  2PQ8 A;  4U5Y A;  3D3S A;  2Z11 A;  1R57 A;  1BOB A;  1IB1 E;  1IIC A;  2YNC C;  4BMH A;  1Z4E A;  2QIR A;  1CM0 A;  1QSM A;  4EVY A;  5HH1 A;  3IWG A;  2YGW A;  4K30 A;  4B13 A;  4XPK A;  4E0A A;  1QSO A;  3TFY A;  2ZW7 A;  1PUA A;  3TE4 A;  3N7Z A;  3P2H A;  4C7H A;  4KZT A;  4MFJ A;  2VXK A;  2GE3 A;  4MHD A;  2G0B A;  4H89 A;  1XF8 A;  5A27 A;  1P0H A;  2DXQ A;  4J3G A;  4HKF A;  1PU9 A;  2REE A;  4A31 A;  4Q38 A;  4AVB A;  4NEX A;  1VHS A;  4YRH A;  4ZBG A;  3TO6 A;  1S60 A;  2OZU A;  3I9S A;  4QC6 A;  3TOA A;  3E0K A;  4KSA A;  4CGN A;  1M44 A;  3F5B A;  4KOW A;  2CNT A;  3KKW A;  2GAN A;  4PK2 A;  4MI4 A;  2VEZ A;  1XE4 A;  2P6F A;  4XNH B;  2VQY A;  2ZW4 A;  3DR8 A;  5AG6 A;  4IUS A;  2H5M A;  2R7H A;  1J4J A;  4F6A A;  2CY2 A;  2PSW A;  3TTH A;  3S6H A;  2C27 A;  5JQ4 A;  5F49 A;  2X7B A;  4IF5 A;  2ZW6 A;  2FE7 A;  4UFV A;  1M4G A;  2O28 A;  3BJ7 A;  5JPH A;  4DNC A;  3ZJ0 A;  1YVK A;  2DPT A;  3SXO A;  4LX9 A;  4RI1 A;  4R87 A;  1I1D A;  2P0W A;  4MJ8 A;  3P2F A;  1I12 A;  4RS2 A;  3W6S A;  4XPL A;  4R9M A;  5DWN A;  1IYK A;  3QAH A;  4PK3 A;  5G1Z A;  2REF A;  1LRZ A;  2KCW A;  4CAF A;  1MJ9 A;  2B58 A;  4JWP A;  2VZY A;  2WPX A;  3R95 A;  4XPD C;  2HQY A;  1YRE A;  1SQH A;  2PR8 A;  1S7K A;  1Z9U A;  4ZGY B;  1YK3 A;  3T9Y A;  4MFZ A;  1MK4 A;  2ARH A;  4B5O A;  4KOS A;  4QBJ A;  2FT0 A;  3VWE A;  5EBV A;  2P6E A;  1I21 A;  1IYL A;  4B10 A;  4UWI A;  4C2Z A;  4CS0 B;  2J8M A;  3S6G A;  4CYP A;  4UCP A;  2G3A A;  3TO7 A;  2ZW5 A;  4U9Y A;  1P4N A;  1GHE A;  3DR6 A;  2ZPA A;  2FL4 A;  2D4P A;  1B6B A;  1U6M A;  4UCM A;  2J8N A;  4QUS A;  5J8F A;  5HMN A;  4CGM A;  2YNC A;  4YGO A;  2Z3O A;  3H5Z A;  3R1K A;  1S7L A;  2I00 A;  5A28 A;  4CAW A;  4YFJ A;  2F5I A;  2JLM A;  4L89 A;  1RXT A;  2IL4 A;  2Q4V A;  5AG5 A;  2JEV A;  2R1I A;  3QB8 A;  4CRZ B;  4KUA A;  4F0X A;  2NMT A;  3EO4 A;  3DSB A;  2CXA A;  4JD6 A;  3W6X A;  3CXQ A;  3MGD A;  1KUX A;  1MJB A;  2BEI A;  4B5P B;  4B5P A;  5IV0 A;  5KTA A;  1QSR A;  5AG4 A;  4KVO E;  4NF1 A;  1S7F A;  3C26 A;  1YGH A;  2WSA A;  3LD2 A;  5IB0 A;  1VKC A;  3TCV A;  4ORF A;  4KS9 A;  2Q44 A;  4KOU A;  5F46 A;  4OAE A;  1FY7 A;  3FIX A;  2R8V A;  1M4I A;  4FD4 A;  3EY5 A;  4B14 A;  3IU2 A;  4L8A A;  4B12 A;  3DNS A;  1XIX A;  1NMT A;  1WWZ A;  2OU2 A;  4MY0 A;  3IWE A;  4HNX B;  4OLL A;  5C88 A;  3ZZI A;  4E2A A;  2BSW A;  4KOX A;  5G21 A;  2Z3K A;  1XEB A;  1NSL A;  2ATR A;  4Y49 C;  4I49 A;  3BLN A;  1NE9 A;  4OAD A;  4II9 A;  4C7I A;  4QVT A;  3FBU A;  3B8G A;  1QSN A;  3LOD A;  1RO5 A;  4FD5 A;  5G22 A;  3IGR A;  2AJ6 A;  5I0C A;  2Q7B A;  5C82 A;  4KOY A;  1K4J A;  3D2M A;  4MBU A;  4NCZ A;  3T90 A;  1Y9W A;  1QST A;  4PV6 A;  4XPD B;  2B5G B;  4UA3 A;  1YX0 A;  2B5G A;  4AVA A;  1IID A;  4MY3 A;  2I79 A;  2D4O A;  2FCK A;  4KSF A;  5F47 A;  3CXP A;  4KUB A;  2PC1 A;  1Y7R A;  4MFL A;  3JTK A;  5GCN A;  4BBH A;  2J8R A;  2FIW A;  3K9U A;  3I3G A;  3EFA A;  1KZF A;  4R3L A;  3R9G A;  1B87 A;  1ZO0 A;  5H84 A;  1Q2D A;  2FXF A;  2EUI A;  4LUA A;  4FD6 A;  4PSW A;  4A32 A;  2Z3M A;  4PSX A;  3DDD A;  2PR1 A;  1BO4 A;  2WPW A;  2Y0M A;  2R98 A;  2Z3N A;  2P6G A;  4KLW A;  4C2X A;  4AG7 A;  3TOB A;  3GYA A;  3W91 A;  2OB0 A;  4B11 A;  4U9Z A;  5ISV A;  2FIA A;  2VI7 A;  1N71 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...