2JDCA

Glyphosate n-acetyltransferase bound to oxidized coa and sulfate
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
145
structure length
145
Chain Sequence
IEVKPINAEDTYELRHRILRPNQPIEACMFESDLLRGAFHLGGYYGGKLISIASFHQAEHSELQGQKQYQLRGMATLEGYREQKAGSSLIKHAEEILRKRGADLLWCNARTSASGYYKKLGFSEQGEVFDTPPVGPHILMYKRIT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLYPHOSATE N-ACETYLTRANSFERASE
publication title The Molecular Basis of Glyphosate Resistance by an Optimized Microbial Acetyltransferase.
pubmed doi rcsb
source organism Bacillus licheniformis
molecule tags Transferase
total genus 38
structure length 145
sequence length 145
ec nomenclature
pdb deposition date 2007-01-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 2jdcA00
1S7NA 4CS0B 3GY9A 4II9A 4PK2A 4HNXB 1YLEA 5F49A 2EUIA 2ATRA 1Q2CA 2VXKA 4PSXA 3D3SA 4KLWA 2A4NA 1M4GA 2OZGA 3E0KA 1QSNA 4OLLA 2FCKA 2BL1A 1M44A 4KVME 3R95A 2RC4A 2B3UA 2Q4VA 3B8GA 3NE7A 5JQ4A 1KUXA 1IYKA 4KVOE 2D4PA 2FIAA 4NCZA 4ZBGA 4KOUA 2VI7A 3K9UA 4I49A 4UBRA 2X7BA 4R3LA 1U6MA 1QSMA 4H6ZA 4KVXA 3R96A 1Y7RA 3DR6A 1YK3A 4QVTA 1CJWA 2JDDA 1YGHA 3C26A 2Q0YA 1Y9WA 4E0AA 4AVCA 2P6GA 4M85A 4JJXA 1Q2DA 2JEVA 3R9EA 3GKRA 4NXYA 1YVKA 1K4JA 1B87A 1WWZA 4R9MA 1L0CA 1S7FA 2CNTA 5C88A 1MJBA 2VQYA 4UWJA 1S7LA 3DSBA 4R3KA 1RO5A 1V0CA 2B4DB 2PC1A 3DDDA 1I12A 3D2MA 3S6FA 3D8PA 3EFAA 5FVJA 4AVAA 4MY0A 2ZPAA 4YRHA 1IICA 2G3TA 2P0WA 3FBUA 4K30A 2C27A 4IF5A 3PGPA 2CNMA 3S6HA 1Z4RA 2HUZA 4EVYA 2VZYA 3F0AA 4XNHC 2CY2A 4J3GA 4CRZB 4FD5A 1M4DA 2G3AA 1YR0A 3P2FA 2OH1A 3FB3A 3D2PA 4UA3A 2QIRA 4KZTA 4XPDC 3CXQA 3FRMA 2QECA 1BO4A 2ZW4A 5I0CA 4U5YA 2ZW6A 1NMTA 4OAEA 4BMHA 2PQ8A 1TIQA 2I79A 5DWMA 3LD2A 2PSWA 4HKFA 1NSLA 2AE6A 3CXPA 3S6GA 3DR8A 1XEBA 5HMNA 5GCNA 1MJAA 2B5GA 3BJ8A 3PP9A 2AJ6A 4XPKA 4E8OA 2HQYA 4B5OA 3TE4A 2PR8A 4R57A 2JDCA 3DNSA 5IV0A 3QAHA 1IYLA 4OADA 4HNWB 4B5PA 2Q4YA 3EY5A 4KOTA 4NF1A 5J8CA 4KOVA 2P6FA 1QSTA 1MJ9A 2EVNA 1UFHA 1WK4A 2GE3A 1Y9KA 1P0HA 1YX0A 2P6EA 1Q2YA 1Z9UA 4KUAA 5F48A 1XE4A 4HNYB 2O28A 5ISVA 5IB0A 3FXTA 3EO4A 2GIVA 2VBQA 4LUAA 1M1DA 5H84A 3R9FA 5F47A 2Y0MA 2OB0A 5HH1A 3TTHA 2OU2A 5E96A 1MK4A 2DXQA 5CNPA 3CXSA 2PR1A 4JLYA 3FIXA 3JUWA 4IUSA 1KZFA 4R87A 2FIWA 4AG7A 3F5BA 2FS5A 5KTCA 3KKWA 4UWIA 4DNCA 4AVBA 1FY7A 4AB7A 2BEIA 4CAWA 4F6AA 3IWGA 4RS2A 3ZZIA 5EBVA 2REEA 4H6UA 1I21A 2FSRA 2R98A 4Y49B 2ARHA 2R8VA 1CM0A 1XIXA 5DWNA 2B58A 1S3ZA 3FNCA 3N7ZA 2JLMA 2ZW7A 3SXOA 1R57A 3SHPA 5C82A 1GHEA 3EC4A 3R9GA 4QC6A 4PSWA 2FXFA 4JXQA 4XPLA 1PUAA 3VWEA 2Q7BA 1QSOA 1Z4EA 2J8RA 5IX3A 4JWPA 1SQHA 5J8FA 3T90A 2FL4A 1I1DA 2WPWA 2B4DA 2B3VA 2K5TA 3P2HA 3TT2A 2Z11A 3G3SA 4KUBA 3TCVA 4KORA 4L8AA 1LRZA 2I00A 2ZW5A 4X5KA 2IL4A 1S60A 1NE9A 3TO9A 3V8IA 2G0BA 4M3SA 4MHDA 4E2AA 4ORFA 3RYOA 2FT0A 1XF8A 1VHSA 4U9YA 3JVNA 1M4IA 2R1IA 1KUVA 5EC4A 2WPXA 4QUSA 4FD4A 3R1KA 4AG9A 1YVOA 4JXRA 4QB9A 3VWDA 2OZUA 2NMTA 1N71A 3TOAA 3TO7A 4CRYB 1YREA 4YGOA 5KTAA 1XMTA 4JD6A 2R7HA 1J4JA 3OWCA 2HV2A 1BOBA 3BLNA 4GS4A 4QBJA 2VEZA 2QMLA 3EXNA 1PU9A 4LX9A 4PV6A 4CAVA 5H86A 3I9SA 4MJ8A 2PRBA 4FD7A 1VKCA 4CAXA 3S6KA 3W6SA 1KUYA 2J8MA 2Q04A 2REFA 4MBUA 3PZJA 4XNHB 3MGDA 2H5MA 2Q44A 3W6XA 3GYAA 4U9ZA 4PK3A 1S5KA 2BSWA 2BUEA 2D4OA 3G8WA 4KOXA 3W91A 2KCWA 3LODA 2VZZA 3TOBA 2Z10A 3F8KA 4XPDB 4L89A 3UY5A 1B6BA 2CNSA 2B4BA 3H4QA 4RI1A 2ZXVA 3FYNA 1P4NA 3TO6A 1QSRA 2GANA 3ZJ0A 4YFJA 4MI4A 3I3GA 4KOWA 4NEXA 2B5GB 3T9YA 3SXNA 3WR7A 2FE7A 2J8NA 1IB1E 2Z0ZA 5KTDA 4KLVA 1S7KA 2OZHA 1IIDA 3IGRA 4B5PB 4F0YA 4NSQA 1OZPA 2PDOA 3QB8A 4MY3A 5JPHA 4ONUA 4H89A 1ON0A 4KOYA 1RXTA 4Y49C 4KOSA 4FD6A 3TFYA 5F46A 2F5IA 3BJ7A
chains in the Genus database with same CATH superfamily
1S7NA 1XBUA 4OC4A 2ZENA 4CS0B 3GY9A 1AUGA 4II9A 4PK2A 2F7VA 4HNXB 4Q38A 2JBJA 1YLEA 5F49A 2EUIA 2RB7A 4ZI6A 4Q7AA 1TKHA 2ATRA 2GU2A 1Q2CA 2VXKA 4PPZA 4OMEA 3KQZA 2CIJA 2C6GA 4PSXA 1YMEA 2EBJA 3D3SA 4IAVA 2XEFA 4KLWA 3IC1A 2A4NA 2EWBA 2Q43A 3K9TA 1M4GA 1Z5RA 2OZGA 5J1QA 3E0KA 1QSNA 4OLLA 4CAFA 2FCKA 2BL1A 1M44A 2PJ6A 4KVME 3SJFA 1IOIA 4FAIA 3R95A 3NH5A 4MXUA 2RC4A 4P6YA 3H8FA 2B3UA 2Q4VA 4KSIA 4ZYQA 3PB6X 3B8GA 3NE7A 5JQ4A 1KUXA 2Z3LA 1IYKA 3PB8X 2D4PA 2FIAA 2PVVA 4KVOE 2YGWA 2Q4ZA 4NCZA 4KOUA 5DS0A 4ZBGA 2VI7A 4IHMA 3WT4A 3K9UA 4UFXA 4I49A 4UBRA 3RZAA 2X7BA 4R3LA 1TKFA 1U6MA 4X8IA 4A30A 1QSMA 2QYVA 4NGNA 4H6ZA 2OOTA 2V8DA 4KVXA 3JRUA 4CPAA 3D7HA 3R96A 1GYTA 2EK8A 1Y7RA 3BJ7A 3DR6A 2Z3MA 4C2XA 1YK3A 3CT9A 3KI9A 4B11A 3WC5A 3K2KA 4QVTA 3KZWA 4FUUA 3KR5A 2PRQA 5LYIA 1CJWA 2JDDA 5HVFA 1BPMA 1CP7A 1FNOA 1YGHA 3C26A 4P10A 2Q0YA 4C68A 1Y9WA 4MCPA 3CPXA 4E0AA 4AVCA 2P6GA 4R6TA 2AFMA 4EWTA 4M85A 2J9AA 4JJXA 1IGBA 4CGNA 3H5ZA 3QNVA 1TF8A 4A2ZA 3ISXA 1LAPA 1Q2DA 2JEVA 4Q36A 2Z3KA 3R9EA 3TX8A 3GKRA 2ANPA 4NXYA 1YVKA 1K4JA 3T8WA 1B87A 1WWZA 4R9MA 4UFVA 1L0CA 3GIUA 1S7FA 5K8MA 1LCPA 2CNTA 1BPNA 3NA6A 5C88A 5K8NA 1MJBA 2VQYA 4UWJA 1S7LA 3B3TA 1X12A 4CGLA 3DSBA 3IWEA 4NFRA 2ZEFA 4R3KA 1RO5A 5D8NA 4ZX9A 2C1CA 3IEHA 4OC2A 2NSMA 4C7IA 2Q7SA 4P44A 3WC6A 2Z3PA 4B10A 2PJ0A 1M4LA 2WUUA 1V0CA 2B4DB 3D66A 3NFZA 2PC1A 4MHPA 2XEGA 3SJEA 4NGQA 3DDDA 5CPAA 1I12A 1VGYA 1Y0RA 3NH4A 3D2MA 2Z3OA 3D8PA 3EFAA 5FVJA 3S6FA 4AVAA 3BI1A 4MY0A 2ZPAA 4YRHA 4GXHA 3WABA 3B3WA 4UIBA 1IICA 4ZX8A 2G3TA 2P0WA 3FBUA 4K30A 2YNCC 2C27A 4IF5A 5G20A 1VIXA 3PGPA 2CNMA 1ELLP 2BCOA 1Z4RA 4TWEA 2HUZA 1LFWA 3S6HA 4EVYA 1BAVA 3V38A 5LRKA 2VZYA 2ZEDA 3F0AA 4XNHC 4NGTA 2ABZA 2CY2A 4CGPA 3LWUA 4J3GA 2YNEA 4FD5A 4CRZB 2PJ1A 1M4DA 2G3AA 1CX8A 1YR0A 2V8GA 1QQ9A 3B35A 1Q7LA 2BOAA 5ELYA 2WZNA 3PB4X 3P2FA 1HDUA 2OH1A 3FB3A 3D2PA 2V8VA 4UA3A 3FJUA 2DF5A 3RAMA 3FMCA 4UEZA 2QIRA 1VHOA 4KZTA 3KASA 1TF9A 4OP4A 3TC8A 5CBMA 4XPDC 3SI1A 3CXQA 3FRMA 5AG4A 1R3NA 1DE4C 2AFSA 2QECA 1BO4A 1X10A 2BO9A 3GB0A 4F8ZA 3CZXA 4A32A 1CPXA 1H8LA 2ZW4A 1BLLE 4U5YA 4BBHA 2ZW6A 1NMTA 4OAEA 3V7ZA 5I0CA 4BMHA 2ZEOA 2PQ8A 1TIQA 2I79A 5DWMA 3IIBA 3LD2A 5BWAB 2PSWA 3BI0A 4HKFA 1NSLA 2AE6A 4OC3A 3CXPA 3S6GA 3DR8A 1IOFA 1TKJA 1XEBA 1JWQA 3NE8A 5GCNA 1ZLIA 5HMNA 4PXDA 1MJAA 2B5GA 3BJ8A 1Z2LA 2AJ6A 3PP9A 4XPKA 4ZY2A 5HXDA 4M6HA 4RN7A 2HQYA 4E8OA 1A2ZA 3B2YA 1Z8WA 2XEIA 4B5OA 3TE4A 2PR8A 4R57A 4F0XA 4NGMA 2JDCA 3DNSA 1PYTB 3FEEA 5IV0A 3QAHA 4MCRA 4LQ6A 2O53A 2XEJA 1IYLA 2ZEHA 4OADA 4UEFA 4A39A 4HNWB 3DGVA 4B5PA 1AYEA 2Q4YA 3EY5A 2PJ4A 4KOTA 4NF1A 1CP6A 5J8CA 1RTQA 4KOVA 2P6FA 1QSTA 3JTKA 1MJ9A 2EVNA 1UFHA 2PJ9A 1WK4A 2GE3A 1Y9KA 3BHXA 3BXMA 4CYQA 1P0HA 1YX0A 2P6EA 8CPAA 1Q2YA 1Z9UA 4KUAA 3B3CA 5HVHA 3A9LA 5F48A 4M6GA 4WWVA 3S9LA 1XE4A 4HNYB 5JH9A 3FEDA 2O28A 5ISVA 4BD9A 4C2ZA 6CPAA 3FXTA 4CYPA 3EO4A 5IB0A 2GIVA 2VBQA 4OIWA 4LUAA 1M1DA 1UWYA 5LRGA 5H84A 2GLFA 3R9FA 2PJBA 2GREA 4H2KA 5F47A 4KSFA 2I3CA 2AFZA 2Y0MA 2OB0A 5HH1A 3TTHA 3S9NA 4OKOA 2QVPA 2OU2A 3H8EA 5E96A 1MK4A 3CPAA 4MMOA 2ZOFA 2WYRA 3SJGA 2DXQA 5CNPA 1IU8A 3CXSA 5THWA 2PR1A 4EFDA 2PIZA 5AG7A 5LYLA 1ZO0A 1DTDA 4JLYA 3FIXA 3JUWA 5LRJA 4MCSA 4NJQA 4IUSA 1KZFA 5G1ZA 4R76A 4R87A 2FIWA 2PJ3A 4AG7A 4MFPA 2AFXA 2ZEGA 1YW6A 3PBBA 2PJCA 3F5BA 5AG5A 2FS5A 2Z3NA 4YWYA 4DUKA 5LYDA 5KTCA 3KKWA 4MRIA 4UWIA 4DNCA 4AVBA 1FY7A 4WJBA 4AB7A 2BEIA 1Y0YA 1R43A 4DJLA 3N5FA 4CAWA 5I4MA 4CYOA 4O23A 4CYNA 4F6AA 4B13A 1HEEA 3IWGA 1YSJA 4RS2A 3ZZIA 5EBVA 4R8FA 2REEA 4H6UA 1ARLA 3LACA 4P45A 1I21A 1F57A 2FSRA 1LAMA 2R98A 4Y49B 2ARHA 2YNCA 4A37A 4XNHB 2R8VA 2V77A 1HDQA 1KWMA 1CM0A 4MHZA 2FVGA 1XIXA 4KS9A 2C6CA 1ZG9A 4B14A 2NYQA 5DWNA 2B58A 4A38A 1S3ZA 4CGOA 4YU9A 1YW4A 3FNCA 3N7ZA 4A95A 2JLMA 2ZW7A 3SXOA 2AFOA 2G9DA 3B3SA 4P4BA 4PXEA 1EE3P 1LANA 1R57A 3I1UA 3SHPA 1FT7A 3GLJA 5C82A 1PCAA 2DPSA 1IY7A 1GHEA 2IMOA 2YNDA 3EC4A 1ARMA 3NH8A 2ZELA 3R9GA 4QC6A 5LYFA 4PSWA 2FXFA 4UCMA 4JXQA 4XPLA 2CXAA 1PUAA 3VWEA 4A33A 2Q7BA 4LQGA 1QSOA 1Z4EA 4P4DA 2ZOGA 4MFZA 2J8RA 2ZEMA 3QAYA 4JWPA 5IX3A 1XFOA 1SQHA 3KR4A 4ZY1A 4GM5A 5J8FA 3FH4A 2FL4A 3T90A 4IK2A 4C7HA 1CG2A 1I1DA 2WPWA 3MN8A 2B4DA 3FF3A 2B3VA 3PFEA 2K5TA 3P2HA 3TT2A 2Z11A 3G3SA 4KUBA 3TCVA 4KORA 3VARA 4B6ZA 4L8AA 2PJAA 4CAEA 1LRZA 2I00A 2ZW5A 3RO0A 3PB9X 4P4JA 4X5KA 2IL4A 4NJRA 1S60A 1NE9A 3TO9A 3V8IA 1Y7EA 4UCNA 4Z65A 2G0BA 1YQEA 4M3SA 4MHDA 4E2AA 4ORFA 3KGQA 4F9VA 3D7DA 3RYOA 1JQGA 3LMSA 3PBEA 2FT0A 3S9MA 1XF8A 1VHSA 4NGRA 4MHYA 4NGSA 1OBRA 3JVNA 1M4IA 4U9YA 5JM6A 3PEIA 3IU2A 4NGPA 3WC7A 2VL1A 2R1IA 3SJXA 1KUVA 2QJ8A 2PE3A 5EC4A 2WPXA 2OR4A 4QUSA 4FD4A 3R1KA 3KHZA 3IU1A 1Z8XA 4K3NA 2PCUA 3KL9A 3FX6A 4AG9A 5A28A 1YVOA 4X3RA 4JXRA 4QB9A 3VWDA 2OZUA 3CDXA 3PRTA 1F2PA 4M6IA 2ODFA 2NMTA 1N71A 3TOAA 3TO7A 2C6PA 4CRYB 3HLPA 4ONWA 4PXBA 4JZ0A 3PFOA 1Z8TA 1YREA 3B7IA 3HUVA 2F8HA 4YGOA 2PJ2A 4MFLA 2GFQA 3B3VA 3IWWA 4HPSA 5KTAA 1XMTA 2PIYA 4FBEA 1XRYA 3IO1A 4JD6A 4R7MA 2R7HA 5AG6A 3SI0A 2WSAA 1J4JA 3OWCA 4B12A 4PQAA 1CPSA 2HV2A 1BOBA 3IJ3A 3BLNA 1ELMP 4UCPA 4GS4A 4QBJA 2VEZA 5IB9A 4KSAA 3DLJA 3D68A 2QMLA 3EXNA 1PU9A 2GLJA 4OC1A 3D4UA 4BINA 5K8OA 4LX9A 4PV6A 4CAVA 5H86A 3I9SA 4MJ8A 4UIAA 2PRBA 3SI2A 4F9UA 2ZEEA 4FD7A 1VKCA 4OC0A 2Q51A 4CAXA 3S6KA 3W6SA 1KUYA 2J8MA 2Q04A 2REFA 3D7FA 2PJ5A 3KHXA 3PZJA 4MBUA 2CTBA 3MGDA 4OC5A 2H5MA 2Q44A 4UF4A 2HB6A 3GYAA 3W6XA 7CPAA 1VHEA 4U9ZA 2EK9A 2DEAA 3FECA 4PK3A 1S5KA 1XMBA 2D4OA 1NSAA 2BSWA 2BUEA 3FVLA 3G8WA 4KOXA 4MFJA 4X2TA 4A31A 2DPTA 3RBUA 3W91A 2KCWA 3LODA 2VZZA 3TOBA 5K8PA 4ZY0A 3H8GA 3VH9A 2Z10A 3F8KA 4XPDB 5A27A 2AFUA 4L89A 3UY5A 2JEWA 2CTCA 4PXCA 1B6BA 4TNUA 2CNSA 4ZGYB 2B4BA 3H4QA 1CBXA 4UFWA 3VATA 3ISZA 3KQXA 4RI1A 5G21A 2O4HA 2V8HA 1AMPA 2ZXVA 4JYWA 3FYNA 4AXVA 4RUHA 5EMIA 1P4NA 3TO6A 1Z8LA 4UEEA 5HVGA 4P4EA 1QSRA 2GANA 3ZJ0A 2IJZA 5AGEA 4G1PA 4YFJA 4MI4A 4EMEA 1YLOA 3IFEA 3I3GA 4KOWA 3PB7X 4NEXA 1XOVA 2B5GB 3RNZA 3T9YA 3SXNA 3D7GA 4MFKA 4CGMA 2PJ7A 3L2NA 2RFHA 3WR7A 1ZG7A 2CF4A 2FE7A 2J8NA 1IB1E 2PVWA 1ZLHA 2Z0ZA 1ZG8A 3GUXA 4KLVA 1TXRA 5JGFA 1S7KA 5KTDA 3D67A 4FWUA 2OZHA 1IIDA 2POKA 4P4IA 2EO8A 1LOKA 3IGRA 4OIDA 1F2OA 4P4FA 4MFQA 2IQ6A 2JBKA 1QMUA 4B5PB 4DYOA 4F0YA 4NSQA 2ZEPA 5D29A 1OZPA 2PDOA 3QB8A 4MY3A 5JPHA 4ONUA 2PJ8A 1ON0A 4H89A 4KOYA 2HC9A 4C2YA 4MHNA 3MRUA 1RXTA 4Y49C 4KOSA 4FD6A 4W9YA 5G22A 1XJOA 5F09A 4MCQA 3TFYA 4A94A 5F46A 2F5IA 2AFWA
chains in the Genus database with same CATH topology
1S7NA 4CS0B 3GY9A 4II9A 4PK2A 4HNXB 4Q38A 1YLEA 5F49A 2EUIA 2ATRA 1Q2CA 2VXKA 4PSXA 3D3SA 4KLWA 2A4NA 1M4GA 2OZGA 3E0KA 1QSNA 4OLLA 4CAFA 2FCKA 2BL1A 1M44A 4KVME 3R95A 2RC4A 2B3UA 2Q4VA 3B8GA 3NE7A 5JQ4A 1KUXA 2Z3LA 1IYKA 4KVOE 2D4PA 2FIAA 2YGWA 4NCZA 4ZBGA 4KOUA 2VI7A 3K9UA 4UFXA 4I49A 4UBRA 2X7BA 4R3LA 1U6MA 4A30A 1QSMA 4H6ZA 4KVXA 3R96A 1Y7RA 3DR6A 2Z3MA 4C2XA 1YK3A 4B11A 4QVTA 1CJWA 2JDDA 1YGHA 3C26A 2Q0YA 4C68A 1Y9WA 4E0AA 4AVCA 2P6GA 4M85A 4JJXA 3H5ZA 4A2ZA 1Q2DA 2JEVA 4Q36A 2Z3KA 3R9EA 3GKRA 4NXYA 1YVKA 1K4JA 1B87A 1WWZA 4R9MA 4UFVA 1L0CA 1S7FA 2CNTA 5C88A 1MJBA 2VQYA 4UWJA 1S7LA 4CGLA 3DSBA 3IWEA 4R3KA 1RO5A 4C7IA 4B10A 2Z3PA 2WUUA 1V0CA 2B4DB 2PC1A 3DDDA 1I12A 3D2MA 2Z3OA 3D8PA 3EFAA 5FVJA 3S6FA 4AVAA 4MY0A 2ZPAA 4YRHA 1IICA 2G3TA 2P0WA 3FBUA 4K30A 2YNCC 2C27A 4IF5A 5G20A 3PGPA 2CNMA 3S6HA 1Z4RA 2HUZA 4EVYA 2VZYA 3F0AA 4XNHC 2CY2A 4CGPA 4J3GA 2YNEA 4FD5A 4CRZB 1M4DA 2G3AA 1YR0A 3P2FA 2OH1A 3FB3A 3D2PA 4UA3A 2QIRA 4KZTA 4XPDC 5AG4A 3CXQA 3FRMA 2QECA 1BO4A 4A32A 2ZW4A 4BBHA 4U5YA 5I0CA 2ZW6A 1NMTA 4OAEA 4BMHA 2PQ8A 1TIQA 2I79A 5DWMA 3LD2A 5BWAB 2PSWA 4HKFA 1NSLA 2AE6A 3CXPA 3S6GA 3DR8A 1XEBA 5HMNA 5GCNA 1MJAA 2B5GA 3PP9A 3BJ8A 2AJ6A 4XPKA 4E8OA 2HQYA 4B5OA 3TE4A 2PR8A 4R57A 4F0XA 2JDCA 3DNSA 5IV0A 3QAHA 1IYLA 4OADA 4HNWB 4B5PA 2Q4YA 3EY5A 4KOTA 4NF1A 5J8CA 4KOVA 2P6FA 1QSTA 3JTKA 1MJ9A 2EVNA 1UFHA 1WK4A 2GE3A 1Y9KA 4CYQA 1P0HA 1YX0A 2P6EA 1Q2YA 1Z9UA 4KUAA 3A9LA 5F48A 1XE4A 4HNYB 2O28A 5ISVA 4C2ZA 5IB0A 3FXTA 4CYPA 3EO4A 2GIVA 2VBQA 4LUAA 1M1DA 5H84A 3R9FA 5F47A 4KSFA 2Y0MA 2OB0A 5HH1A 3TTHA 2OU2A 5E96A 1MK4A 2DXQA 5CNPA 3CXSA 2PR1A 5AG7A 1ZO0A 4JLYA 3FIXA 3JUWA 4IUSA 1KZFA 5G1ZA 4R87A 2FIWA 4AG7A 4MFPA 5AG5A 3F5BA 2FS5A 2Z3NA 5KTCA 3KKWA 4UWIA 4DNCA 4AVBA 1FY7A 4AB7A 2BEIA 4CAWA 4CYOA 4CYNA 4F6AA 4B13A 3IWGA 4RS2A 3ZZIA 5EBVA 2REEA 4H6UA 1I21A 2FSRA 2R98A 4Y49B 2ARHA 2YNCA 2R8VA 1CM0A 1XIXA 4KS9A 4B14A 5DWNA 2B58A 1S3ZA 4CGOA 3FNCA 3N7ZA 4A95A 2JLMA 2ZW7A 3SXOA 1R57A 3SHPA 5C82A 2DPSA 1GHEA 2YNDA 3EC4A 3R9GA 4QC6A 4PSWA 2FXFA 4UCMA 4JXQA 4XPLA 2CXAA 1PUAA 3VWEA 4A33A 2Q7BA 1QSOA 1Z4EA 4MFZA 2J8RA 5IX3A 4JWPA 1SQHA 5J8FA 3T90A 2FL4A 4C7HA 1I1DA 2WPWA 2B4DA 2B3VA 2K5TA 3P2HA 3TT2A 2Z11A 3G3SA 4KUBA 3TCVA 4KORA 4L8AA 4CAEA 1LRZA 2I00A 2ZW5A 4X5KA 2IL4A 1S60A 1NE9A 3TO9A 3V8IA 4UCNA 2G0BA 4M3SA 4MHDA 4E2AA 4ORFA 3RYOA 2FT0A 1XF8A 1VHSA 4U9YA 3JVNA 1M4IA 3IU2A 2R1IA 1KUVA 5EC4A 2WPXA 4QUSA 4FD4A 3R1KA 3IU1A 4AG9A 5A28A 1YVOA 4JXRA 4QB9A 3VWDA 2OZUA 2NMTA 1N71A 3TOAA 3TO7A 4CRYB 1YREA 4YGOA 4MFLA 5KTAA 1XMTA 4JD6A 2R7HA 5AG6A 2WSAA 1J4JA 3OWCA 4B12A 2HV2A 1BOBA 3BLNA 4UCPA 4GS4A 4QBJA 2VEZA 4KSAA 2QMLA 3EXNA 1PU9A 4LX9A 4PV6A 4CAVA 5H86A 3I9SA 4MJ8A 2PRBA 4FD7A 1VKCA 4CAXA 3S6KA 3W6SA 1KUYA 2J8MA 2Q04A 2REFA 4MBUA 3PZJA 4XNHB 3MGDA 2H5MA 2Q44A 3W6XA 3GYAA 4U9ZA 4PK3A 1S5KA 2BSWA 2BUEA 2D4OA 3G8WA 4KOXA 4MFJA 4A31A 2DPTA 3W91A 2KCWA 3LODA 2VZZA 3TOBA 2Z10A 3F8KA 4XPDB 5A27A 4L89A 3UY5A 1B6BA 2CNSA 4ZGYB 2B4BA 3H4QA 4UFWA 4RI1A 5G21A 2ZXVA 3FYNA 1P4NA 3TO6A 1QSRA 2GANA 3ZJ0A 5AGEA 4YFJA 4MI4A 3I3GA 4KOWA 4NEXA 2B5GB 3T9YA 3SXNA 4MFKA 4CGMA 3WR7A 2FE7A 2J8NA 4MFQA 1IB1E 2Z0ZA 5KTDA 4KLVA 1S7KA 2OZHA 1IIDA 4CGNA 3IGRA 4B5PB 4F0YA 4NSQA 1OZPA 2PDOA 3QB8A 4MY3A 5JPHA 4ONUA 4H89A 1ON0A 4KOYA 4C2YA 1RXTA 4Y49C 4KOSA 4FD6A 5G22A 3TFYA 5F46A 2F5IA 3BJ7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1S7N A;  4CS0 B;  3GY9 A;  4II9 A;  4PK2 A;  4HNX B;  1YLE A;  5F49 A;  2EUI A;  2ATR A;  1Q2C A;  2VXK A;  4PSX A;  3D3S A;  4KLW A;  2A4N A;  1M4G A;  2OZG A;  3E0K A;  1QSN A;  4OLL A;  2FCK A;  2BL1 A;  1M44 A;  4KVM E;  3R95 A;  2RC4 A;  2B3U A;  2Q4V A;  3B8G A;  3NE7 A;  5JQ4 A;  1KUX A;  1IYK A;  4KVO E;  2D4P A;  2FIA A;  4NCZ A;  4ZBG A;  4KOU A;  2VI7 A;  3K9U A;  4I49 A;  4UBR A;  2X7B A;  4R3L A;  1U6M A;  1QSM A;  4H6Z A;  4KVX A;  3R96 A;  1Y7R A;  3DR6 A;  1YK3 A;  4QVT A;  1CJW A;  2JDD A;  1YGH A;  3C26 A;  2Q0Y A;  1Y9W A;  4E0A A;  4AVC A;  2P6G A;  4M85 A;  4JJX A;  1Q2D A;  2JEV A;  3R9E A;  3GKR A;  4NXY A;  1YVK A;  1K4J A;  1B87 A;  1WWZ A;  4R9M A;  1L0C A;  1S7F A;  2CNT A;  5C88 A;  1MJB A;  2VQY A;  4UWJ A;  1S7L A;  3DSB A;  4R3K A;  1RO5 A;  1V0C A;  2B4D B;  2PC1 A;  3DDD A;  1I12 A;  3D2M A;  3S6F A;  3D8P A;  3EFA A;  5FVJ A;  4AVA A;  4MY0 A;  2ZPA A;  4YRH A;  1IIC A;  2G3T A;  2P0W A;  3FBU A;  4K30 A;  2C27 A;  4IF5 A;  3PGP A;  2CNM A;  3S6H A;  1Z4R A;  2HUZ A;  4EVY A;  2VZY A;  3F0A A;  4XNH C;  2CY2 A;  4J3G A;  4CRZ B;  4FD5 A;  1M4D A;  2G3A A;  1YR0 A;  3P2F A;  2OH1 A;  3FB3 A;  3D2P A;  4UA3 A;  2QIR A;  4KZT A;  4XPD C;  3CXQ A;  3FRM A;  2QEC A;  1BO4 A;  2ZW4 A;  5I0C A;  4U5Y A;  2ZW6 A;  1NMT A;  4OAE A;  4BMH A;  2PQ8 A;  1TIQ A;  2I79 A;  5DWM A;  3LD2 A;  2PSW A;  4HKF A;  1NSL A;  2AE6 A;  3CXP A;  3S6G A;  3DR8 A;  1XEB A;  5HMN A;  5GCN A;  1MJA A;  2B5G A;  3BJ8 A;  3PP9 A;  2AJ6 A;  4XPK A;  4E8O A;  2HQY A;  4B5O A;  3TE4 A;  2PR8 A;  4R57 A;  2JDC A;  3DNS A;  5IV0 A;  3QAH A;  1IYL A;  4OAD A;  4HNW B;  4B5P A;  2Q4Y A;  3EY5 A;  4KOT A;  4NF1 A;  5J8C A;  4KOV A;  2P6F A;  1QST A;  1MJ9 A;  2EVN A;  1UFH A;  1WK4 A;  2GE3 A;  1Y9K A;  1P0H A;  1YX0 A;  2P6E A;  1Q2Y A;  1Z9U A;  4KUA A;  5F48 A;  1XE4 A;  4HNY B;  2O28 A;  5ISV A;  5IB0 A;  3FXT A;  3EO4 A;  2GIV A;  2VBQ A;  4LUA A;  1M1D A;  5H84 A;  3R9F A;  5F47 A;  2Y0M A;  2OB0 A;  5HH1 A;  3TTH A;  2OU2 A;  5E96 A;  1MK4 A;  2DXQ A;  5CNP A;  3CXS A;  2PR1 A;  4JLY A;  3FIX A;  3JUW A;  4IUS A;  1KZF A;  4R87 A;  2FIW A;  4AG7 A;  3F5B A;  2FS5 A;  5KTC A;  3KKW A;  4UWI A;  4DNC A;  4AVB A;  1FY7 A;  4AB7 A;  2BEI A;  4CAW A;  4F6A A;  3IWG A;  4RS2 A;  3ZZI A;  5EBV A;  2REE A;  4H6U A;  1I21 A;  2FSR A;  2R98 A;  4Y49 B;  2ARH A;  2R8V A;  1CM0 A;  1XIX A;  5DWN A;  2B58 A;  1S3Z A;  3FNC A;  3N7Z A;  2JLM A;  2ZW7 A;  3SXO A;  1R57 A;  3SHP A;  5C82 A;  1GHE A;  3EC4 A;  3R9G A;  4QC6 A;  4PSW A;  2FXF A;  4JXQ A;  4XPL A;  1PUA A;  3VWE A;  2Q7B A;  1QSO A;  1Z4E A;  2J8R A;  5IX3 A;  4JWP A;  1SQH A;  5J8F A;  3T90 A;  2FL4 A;  1I1D A;  2WPW A;  2B4D A;  2B3V A;  2K5T A;  3P2H A;  3TT2 A;  2Z11 A;  3G3S A;  4KUB A;  3TCV A;  4KOR A;  4L8A A;  1LRZ A;  2I00 A;  2ZW5 A;  4X5K A;  2IL4 A;  1S60 A;  1NE9 A;  3TO9 A;  3V8I A;  2G0B A;  4M3S A;  4MHD A;  4E2A A;  4ORF A;  3RYO A;  2FT0 A;  1XF8 A;  1VHS A;  4U9Y A;  3JVN A;  1M4I A;  2R1I A;  1KUV A;  5EC4 A;  2WPX A;  4QUS A;  4FD4 A;  3R1K A;  4AG9 A;  1YVO A;  4JXR A;  4QB9 A;  3VWD A;  2OZU A;  2NMT A;  1N71 A;  3TOA A;  3TO7 A;  4CRY B;  1YRE A;  4YGO A;  5KTA A;  1XMT A;  4JD6 A;  2R7H A;  1J4J A;  3OWC A;  2HV2 A;  1BOB A;  3BLN A;  4GS4 A;  4QBJ A;  2VEZ A;  2QML A;  3EXN A;  1PU9 A;  4LX9 A;  4PV6 A;  4CAV A;  5H86 A;  3I9S A;  4MJ8 A;  2PRB A;  4FD7 A;  1VKC A;  4CAX A;  3S6K A;  3W6S A;  1KUY A;  2J8M A;  2Q04 A;  2REF A;  4MBU A;  3PZJ A;  4XNH B;  3MGD A;  2H5M A;  2Q44 A;  3W6X A;  3GYA A;  4U9Z A;  4PK3 A;  1S5K A;  2BSW A;  2BUE A;  2D4O A;  3G8W A;  4KOX A;  3W91 A;  2KCW A;  3LOD A;  2VZZ A;  3TOB A;  2Z10 A;  3F8K A;  4XPD B;  4L89 A;  3UY5 A;  1B6B A;  2CNS A;  2B4B A;  3H4Q A;  4RI1 A;  2ZXV A;  3FYN A;  1P4N A;  3TO6 A;  1QSR A;  2GAN A;  3ZJ0 A;  4YFJ A;  4MI4 A;  3I3G A;  4KOW A;  4NEX A;  2B5G B;  3T9Y A;  3SXN A;  3WR7 A;  2FE7 A;  2J8N A;  1IB1 E;  2Z0Z A;  5KTD A;  4KLV A;  1S7K A;  2OZH A;  1IID A;  3IGR A;  4B5P B;  4F0Y A;  4NSQ A;  1OZP A;  2PDO A;  3QB8 A;  4MY3 A;  5JPH A;  4ONU A;  4H89 A;  1ON0 A;  4KOY A;  1RXT A;  4Y49 C;  4KOS A;  4FD6 A;  3TFY A;  5F46 A;  2F5I A;  3BJ7 A; 
#chains in the Genus database with same CATH topology
 1S7N A;  1XBU A;  4OC4 A;  2ZEN A;  4CS0 B;  3GY9 A;  1AUG A;  4II9 A;  4PK2 A;  2F7V A;  4HNX B;  4Q38 A;  2JBJ A;  1YLE A;  5F49 A;  2EUI A;  2RB7 A;  4ZI6 A;  4Q7A A;  1TKH A;  2ATR A;  2GU2 A;  1Q2C A;  2VXK A;  4PPZ A;  4OME A;  3KQZ A;  2CIJ A;  2C6G A;  4PSX A;  1YME A;  2EBJ A;  3D3S A;  4IAV A;  2XEF A;  4KLW A;  3IC1 A;  2A4N A;  2EWB A;  2Q43 A;  3K9T A;  1M4G A;  1Z5R A;  2OZG A;  5J1Q A;  3E0K A;  1QSN A;  4OLL A;  4CAF A;  2FCK A;  2BL1 A;  1M44 A;  2PJ6 A;  4KVM E;  3SJF A;  1IOI A;  4FAI A;  3R95 A;  3NH5 A;  4MXU A;  2RC4 A;  4P6Y A;  3H8F A;  2B3U A;  2Q4V A;  4KSI A;  4ZYQ A;  3PB6 X;  3B8G A;  3NE7 A;  5JQ4 A;  1KUX A;  2Z3L A;  1IYK A;  3PB8 X;  2D4P A;  2FIA A;  2PVV A;  4KVO E;  2YGW A;  2Q4Z A;  4NCZ A;  4KOU A;  5DS0 A;  4ZBG A;  2VI7 A;  4IHM A;  3WT4 A;  3K9U A;  4UFX A;  4I49 A;  4UBR A;  3RZA A;  2X7B A;  4R3L A;  1TKF A;  1U6M A;  4X8I A;  4A30 A;  1QSM A;  2QYV A;  4NGN A;  4H6Z A;  2OOT A;  2V8D A;  4KVX A;  3JRU A;  4CPA A;  3D7H A;  3R96 A;  1GYT A;  2EK8 A;  1Y7R A;  3BJ7 A;  3DR6 A;  2Z3M A;  4C2X A;  1YK3 A;  3CT9 A;  3KI9 A;  4B11 A;  3WC5 A;  3K2K A;  4QVT A;  3KZW A;  4FUU A;  3KR5 A;  2PRQ A;  5LYI A;  1CJW A;  2JDD A;  5HVF A;  1BPM A;  1CP7 A;  1FNO A;  1YGH A;  3C26 A;  4P10 A;  2Q0Y A;  4C68 A;  1Y9W A;  4MCP A;  3CPX A;  4E0A A;  4AVC A;  2P6G A;  4R6T A;  2AFM A;  4EWT A;  4M85 A;  2J9A A;  4JJX A;  1IGB A;  4CGN A;  3H5Z A;  3QNV A;  1TF8 A;  4A2Z A;  3ISX A;  1LAP A;  1Q2D A;  2JEV A;  4Q36 A;  2Z3K A;  3R9E A;  3TX8 A;  3GKR A;  2ANP A;  4NXY A;  1YVK A;  1K4J A;  3T8W A;  1B87 A;  1WWZ A;  4R9M A;  4UFV A;  1L0C A;  3GIU A;  1S7F A;  5K8M A;  1LCP A;  2CNT A;  1BPN A;  3NA6 A;  5C88 A;  5K8N A;  1MJB A;  2VQY A;  4UWJ A;  1S7L A;  3B3T A;  1X12 A;  4CGL A;  3DSB A;  3IWE A;  4NFR A;  2ZEF A;  4R3K A;  1RO5 A;  5D8N A;  4ZX9 A;  2C1C A;  3IEH A;  4OC2 A;  2NSM A;  4C7I A;  2Q7S A;  4P44 A;  3WC6 A;  2Z3P A;  4B10 A;  2PJ0 A;  1M4L A;  2WUU A;  1V0C A;  2B4D B;  3D66 A;  3NFZ A;  2PC1 A;  4MHP A;  2XEG A;  3SJE A;  4NGQ A;  3DDD A;  5CPA A;  1I12 A;  1VGY A;  1Y0R A;  3NH4 A;  3D2M A;  2Z3O A;  3D8P A;  3EFA A;  5FVJ A;  3S6F A;  4AVA A;  3BI1 A;  4MY0 A;  2ZPA A;  4YRH A;  4GXH A;  3WAB A;  3B3W A;  4UIB A;  1IIC A;  4ZX8 A;  2G3T A;  2P0W A;  3FBU A;  4K30 A;  2YNC C;  2C27 A;  4IF5 A;  5G20 A;  1VIX A;  3PGP A;  2CNM A;  1ELL P;  2BCO A;  1Z4R A;  4TWE A;  2HUZ A;  1LFW A;  3S6H A;  4EVY A;  1BAV A;  3V38 A;  5LRK A;  2VZY A;  2ZED A;  3F0A A;  4XNH C;  4NGT A;  2ABZ A;  2CY2 A;  4CGP A;  3LWU A;  4J3G A;  2YNE A;  4FD5 A;  4CRZ B;  2PJ1 A;  1M4D A;  2G3A A;  1CX8 A;  1YR0 A;  2V8G A;  1QQ9 A;  3B35 A;  1Q7L A;  2BOA A;  5ELY A;  2WZN A;  3PB4 X;  3P2F A;  1HDU A;  2OH1 A;  3FB3 A;  3D2P A;  2V8V A;  4UA3 A;  3FJU A;  2DF5 A;  3RAM A;  3FMC A;  4UEZ A;  2QIR A;  1VHO A;  4KZT A;  3KAS A;  1TF9 A;  4OP4 A;  3TC8 A;  5CBM A;  4XPD C;  3SI1 A;  3CXQ A;  3FRM A;  5AG4 A;  1R3N A;  1DE4 C;  2AFS A;  2QEC A;  1BO4 A;  1X10 A;  2BO9 A;  3GB0 A;  4F8Z A;  3CZX A;  4A32 A;  1CPX A;  1H8L A;  2ZW4 A;  1BLL E;  4U5Y A;  4BBH A;  2ZW6 A;  1NMT A;  4OAE A;  3V7Z A;  5I0C A;  4BMH A;  2ZEO A;  2PQ8 A;  1TIQ A;  2I79 A;  5DWM A;  3IIB A;  3LD2 A;  5BWA B;  2PSW A;  3BI0 A;  4HKF A;  1NSL A;  2AE6 A;  4OC3 A;  3CXP A;  3S6G A;  3DR8 A;  1IOF A;  1TKJ A;  1XEB A;  1JWQ A;  3NE8 A;  5GCN A;  1ZLI A;  5HMN A;  4PXD A;  1MJA A;  2B5G A;  3BJ8 A;  1Z2L A;  2AJ6 A;  3PP9 A;  4XPK A;  4ZY2 A;  5HXD A;  4M6H A;  4RN7 A;  2HQY A;  4E8O A;  1A2Z A;  3B2Y A;  1Z8W A;  2XEI A;  4B5O A;  3TE4 A;  2PR8 A;  4R57 A;  4F0X A;  4NGM A;  2JDC A;  3DNS A;  1PYT B;  3FEE A;  5IV0 A;  3QAH A;  4MCR A;  4LQ6 A;  2O53 A;  2XEJ A;  1IYL A;  2ZEH A;  4OAD A;  4UEF A;  4A39 A;  4HNW B;  3DGV A;  4B5P A;  1AYE A;  2Q4Y A;  3EY5 A;  2PJ4 A;  4KOT A;  4NF1 A;  1CP6 A;  5J8C A;  1RTQ A;  4KOV A;  2P6F A;  1QST A;  3JTK A;  1MJ9 A;  2EVN A;  1UFH A;  2PJ9 A;  1WK4 A;  2GE3 A;  1Y9K A;  3BHX A;  3BXM A;  4CYQ A;  1P0H A;  1YX0 A;  2P6E A;  8CPA A;  1Q2Y A;  1Z9U A;  4KUA A;  3B3C A;  5HVH A;  3A9L A;  5F48 A;  4M6G A;  4WWV A;  3S9L A;  1XE4 A;  4HNY B;  5JH9 A;  3FED A;  2O28 A;  5ISV A;  4BD9 A;  4C2Z A;  6CPA A;  3FXT A;  4CYP A;  3EO4 A;  5IB0 A;  2GIV A;  2VBQ A;  4OIW A;  4LUA A;  1M1D A;  1UWY A;  5LRG A;  5H84 A;  2GLF A;  3R9F A;  2PJB A;  2GRE A;  4H2K A;  5F47 A;  4KSF A;  2I3C A;  2AFZ A;  2Y0M A;  2OB0 A;  5HH1 A;  3TTH A;  3S9N A;  4OKO A;  2QVP A;  2OU2 A;  3H8E A;  5E96 A;  1MK4 A;  3CPA A;  4MMO A;  2ZOF A;  2WYR A;  3SJG A;  2DXQ A;  5CNP A;  1IU8 A;  3CXS A;  5THW A;  2PR1 A;  4EFD A;  2PIZ A;  5AG7 A;  5LYL A;  1ZO0 A;  1DTD A;  4JLY A;  3FIX A;  3JUW A;  5LRJ A;  4MCS A;  4NJQ A;  4IUS A;  1KZF A;  5G1Z A;  4R76 A;  4R87 A;  2FIW A;  2PJ3 A;  4AG7 A;  4MFP A;  2AFX A;  2ZEG A;  1YW6 A;  3PBB A;  2PJC A;  3F5B A;  5AG5 A;  2FS5 A;  2Z3N A;  4YWY A;  4DUK A;  5LYD A;  5KTC A;  3KKW A;  4MRI A;  4UWI A;  4DNC A;  4AVB A;  1FY7 A;  4WJB A;  4AB7 A;  2BEI A;  1Y0Y A;  1R43 A;  4DJL A;  3N5F A;  4CAW A;  5I4M A;  4CYO A;  4O23 A;  4CYN A;  4F6A A;  4B13 A;  1HEE A;  3IWG A;  1YSJ A;  4RS2 A;  3ZZI A;  5EBV A;  4R8F A;  2REE A;  4H6U A;  1ARL A;  3LAC A;  4P45 A;  1I21 A;  1F57 A;  2FSR A;  1LAM A;  2R98 A;  4Y49 B;  2ARH A;  2YNC A;  4A37 A;  4XNH B;  2R8V A;  2V77 A;  1HDQ A;  1KWM A;  1CM0 A;  4MHZ A;  2FVG A;  1XIX A;  4KS9 A;  2C6C A;  1ZG9 A;  4B14 A;  2NYQ A;  5DWN A;  2B58 A;  4A38 A;  1S3Z A;  4CGO A;  4YU9 A;  1YW4 A;  3FNC A;  3N7Z A;  4A95 A;  2JLM A;  2ZW7 A;  3SXO A;  2AFO A;  2G9D A;  3B3S A;  4P4B A;  4PXE A;  1EE3 P;  1LAN A;  1R57 A;  3I1U A;  3SHP A;  1FT7 A;  3GLJ A;  5C82 A;  1PCA A;  2DPS A;  1IY7 A;  1GHE A;  2IMO A;  2YND A;  3EC4 A;  1ARM A;  3NH8 A;  2ZEL A;  3R9G A;  4QC6 A;  5LYF A;  4PSW A;  2FXF A;  4UCM A;  4JXQ A;  4XPL A;  2CXA A;  1PUA A;  3VWE A;  4A33 A;  2Q7B A;  4LQG A;  1QSO A;  1Z4E A;  4P4D A;  2ZOG A;  4MFZ A;  2J8R A;  2ZEM A;  3QAY A;  4JWP A;  5IX3 A;  1XFO A;  1SQH A;  3KR4 A;  4ZY1 A;  4GM5 A;  5J8F A;  3FH4 A;  2FL4 A;  3T90 A;  4IK2 A;  4C7H A;  1CG2 A;  1I1D A;  2WPW A;  3MN8 A;  2B4D A;  3FF3 A;  2B3V A;  3PFE A;  2K5T A;  3P2H A;  3TT2 A;  2Z11 A;  3G3S A;  4KUB A;  3TCV A;  4KOR A;  3VAR A;  4B6Z A;  4L8A A;  2PJA A;  4CAE A;  1LRZ A;  2I00 A;  2ZW5 A;  3RO0 A;  3PB9 X;  4P4J A;  4X5K A;  2IL4 A;  4NJR A;  1S60 A;  1NE9 A;  3TO9 A;  3V8I A;  1Y7E A;  4UCN A;  4Z65 A;  2G0B A;  1YQE A;  4M3S A;  4MHD A;  4E2A A;  4ORF A;  3KGQ A;  4F9V A;  3D7D A;  3RYO A;  1JQG A;  3LMS A;  3PBE A;  2FT0 A;  3S9M A;  1XF8 A;  1VHS A;  4NGR A;  4MHY A;  4NGS A;  1OBR A;  3JVN A;  1M4I A;  4U9Y A;  5JM6 A;  3PEI A;  3IU2 A;  4NGP A;  3WC7 A;  2VL1 A;  2R1I A;  3SJX A;  1KUV A;  2QJ8 A;  2PE3 A;  5EC4 A;  2WPX A;  2OR4 A;  4QUS A;  4FD4 A;  3R1K A;  3KHZ A;  3IU1 A;  1Z8X A;  4K3N A;  2PCU A;  3KL9 A;  3FX6 A;  4AG9 A;  5A28 A;  1YVO A;  4X3R A;  4JXR A;  4QB9 A;  3VWD A;  2OZU A;  3CDX A;  3PRT A;  1F2P A;  4M6I A;  2ODF A;  2NMT A;  1N71 A;  3TOA A;  3TO7 A;  2C6P A;  4CRY B;  3HLP A;  4ONW A;  4PXB A;  4JZ0 A;  3PFO A;  1Z8T A;  1YRE A;  3B7I A;  3HUV A;  2F8H A;  4YGO A;  2PJ2 A;  4MFL A;  2GFQ A;  3B3V A;  3IWW A;  4HPS A;  5KTA A;  1XMT A;  2PIY A;  4FBE A;  1XRY A;  3IO1 A;  4JD6 A;  4R7M A;  2R7H A;  5AG6 A;  3SI0 A;  2WSA A;  1J4J A;  3OWC A;  4B12 A;  4PQA A;  1CPS A;  2HV2 A;  1BOB A;  3IJ3 A;  3BLN A;  1ELM P;  4UCP A;  4GS4 A;  4QBJ A;  2VEZ A;  5IB9 A;  4KSA A;  3DLJ A;  3D68 A;  2QML A;  3EXN A;  1PU9 A;  2GLJ A;  4OC1 A;  3D4U A;  4BIN A;  5K8O A;  4LX9 A;  4PV6 A;  4CAV A;  5H86 A;  3I9S A;  4MJ8 A;  4UIA A;  2PRB A;  3SI2 A;  4F9U A;  2ZEE A;  4FD7 A;  1VKC A;  4OC0 A;  2Q51 A;  4CAX A;  3S6K A;  3W6S A;  1KUY A;  2J8M A;  2Q04 A;  2REF A;  3D7F A;  2PJ5 A;  3KHX A;  3PZJ A;  4MBU A;  2CTB A;  3MGD A;  4OC5 A;  2H5M A;  2Q44 A;  4UF4 A;  2HB6 A;  3GYA A;  3W6X A;  7CPA A;  1VHE A;  4U9Z A;  2EK9 A;  2DEA A;  3FEC A;  4PK3 A;  1S5K A;  1XMB A;  2D4O A;  1NSA A;  2BSW A;  2BUE A;  3FVL A;  3G8W A;  4KOX A;  4MFJ A;  4X2T A;  4A31 A;  2DPT A;  3RBU A;  3W91 A;  2KCW A;  3LOD A;  2VZZ A;  3TOB A;  5K8P A;  4ZY0 A;  3H8G A;  3VH9 A;  2Z10 A;  3F8K A;  4XPD B;  5A27 A;  2AFU A;  4L89 A;  3UY5 A;  2JEW A;  2CTC A;  4PXC A;  1B6B A;  4TNU A;  2CNS A;  4ZGY B;  2B4B A;  3H4Q A;  1CBX A;  4UFW A;  3VAT A;  3ISZ A;  3KQX A;  4RI1 A;  5G21 A;  2O4H A;  2V8H A;  1AMP A;  2ZXV A;  4JYW A;  3FYN A;  4AXV A;  4RUH A;  5EMI A;  1P4N A;  3TO6 A;  1Z8L A;  4UEE A;  5HVG A;  4P4E A;  1QSR A;  2GAN A;  3ZJ0 A;  2IJZ A;  5AGE A;  4G1P A;  4YFJ A;  4MI4 A;  4EME A;  1YLO A;  3IFE A;  3I3G A;  4KOW A;  3PB7 X;  4NEX A;  1XOV A;  2B5G B;  3RNZ A;  3T9Y A;  3SXN A;  3D7G A;  4MFK A;  4CGM A;  2PJ7 A;  3L2N A;  2RFH A;  3WR7 A;  1ZG7 A;  2CF4 A;  2FE7 A;  2J8N A;  1IB1 E;  2PVW A;  1ZLH A;  2Z0Z A;  1ZG8 A;  3GUX A;  4KLV A;  1TXR A;  5JGF A;  1S7K A;  5KTD A;  3D67 A;  4FWU A;  2OZH A;  1IID A;  2POK A;  4P4I A;  2EO8 A;  1LOK A;  3IGR A;  4OID A;  1F2O A;  4P4F A;  4MFQ A;  2IQ6 A;  2JBK A;  1QMU A;  4B5P B;  4DYO A;  4F0Y A;  4NSQ A;  2ZEP A;  5D29 A;  1OZP A;  2PDO A;  3QB8 A;  4MY3 A;  5JPH A;  4ONU A;  2PJ8 A;  1ON0 A;  4H89 A;  4KOY A;  2HC9 A;  4C2Y A;  4MHN A;  3MRU A;  1RXT A;  4Y49 C;  4KOS A;  4FD6 A;  4W9Y A;  5G22 A;  1XJO A;  5F09 A;  4MCQ A;  3TFY A;  4A94 A;  5F46 A;  2F5I A;  2AFW A; 
#chains in the Genus database with same CATH homology
 1S7N A;  4CS0 B;  3GY9 A;  4II9 A;  4PK2 A;  4HNX B;  4Q38 A;  1YLE A;  5F49 A;  2EUI A;  2ATR A;  1Q2C A;  2VXK A;  4PSX A;  3D3S A;  4KLW A;  2A4N A;  1M4G A;  2OZG A;  3E0K A;  1QSN A;  4OLL A;  4CAF A;  2FCK A;  2BL1 A;  1M44 A;  4KVM E;  3R95 A;  2RC4 A;  2B3U A;  2Q4V A;  3B8G A;  3NE7 A;  5JQ4 A;  1KUX A;  2Z3L A;  1IYK A;  4KVO E;  2D4P A;  2FIA A;  2YGW A;  4NCZ A;  4ZBG A;  4KOU A;  2VI7 A;  3K9U A;  4UFX A;  4I49 A;  4UBR A;  2X7B A;  4R3L A;  1U6M A;  4A30 A;  1QSM A;  4H6Z A;  4KVX A;  3R96 A;  1Y7R A;  3DR6 A;  2Z3M A;  4C2X A;  1YK3 A;  4B11 A;  4QVT A;  1CJW A;  2JDD A;  1YGH A;  3C26 A;  2Q0Y A;  4C68 A;  1Y9W A;  4E0A A;  4AVC A;  2P6G A;  4M85 A;  4JJX A;  3H5Z A;  4A2Z A;  1Q2D A;  2JEV A;  4Q36 A;  2Z3K A;  3R9E A;  3GKR A;  4NXY A;  1YVK A;  1K4J A;  1B87 A;  1WWZ A;  4R9M A;  4UFV A;  1L0C A;  1S7F A;  2CNT A;  5C88 A;  1MJB A;  2VQY A;  4UWJ A;  1S7L A;  4CGL A;  3DSB A;  3IWE A;  4R3K A;  1RO5 A;  4C7I A;  4B10 A;  2Z3P A;  2WUU A;  1V0C A;  2B4D B;  2PC1 A;  3DDD A;  1I12 A;  3D2M A;  2Z3O A;  3D8P A;  3EFA A;  5FVJ A;  3S6F A;  4AVA A;  4MY0 A;  2ZPA A;  4YRH A;  1IIC A;  2G3T A;  2P0W A;  3FBU A;  4K30 A;  2YNC C;  2C27 A;  4IF5 A;  5G20 A;  3PGP A;  2CNM A;  3S6H A;  1Z4R A;  2HUZ A;  4EVY A;  2VZY A;  3F0A A;  4XNH C;  2CY2 A;  4CGP A;  4J3G A;  2YNE A;  4FD5 A;  4CRZ B;  1M4D A;  2G3A A;  1YR0 A;  3P2F A;  2OH1 A;  3FB3 A;  3D2P A;  4UA3 A;  2QIR A;  4KZT A;  4XPD C;  5AG4 A;  3CXQ A;  3FRM A;  2QEC A;  1BO4 A;  4A32 A;  2ZW4 A;  4BBH A;  4U5Y A;  5I0C A;  2ZW6 A;  1NMT A;  4OAE A;  4BMH A;  2PQ8 A;  1TIQ A;  2I79 A;  5DWM A;  3LD2 A;  5BWA B;  2PSW A;  4HKF A;  1NSL A;  2AE6 A;  3CXP A;  3S6G A;  3DR8 A;  1XEB A;  5HMN A;  5GCN A;  1MJA A;  2B5G A;  3PP9 A;  3BJ8 A;  2AJ6 A;  4XPK A;  4E8O A;  2HQY A;  4B5O A;  3TE4 A;  2PR8 A;  4R57 A;  4F0X A;  2JDC A;  3DNS A;  5IV0 A;  3QAH A;  1IYL A;  4OAD A;  4HNW B;  4B5P A;  2Q4Y A;  3EY5 A;  4KOT A;  4NF1 A;  5J8C A;  4KOV A;  2P6F A;  1QST A;  3JTK A;  1MJ9 A;  2EVN A;  1UFH A;  1WK4 A;  2GE3 A;  1Y9K A;  4CYQ A;  1P0H A;  1YX0 A;  2P6E A;  1Q2Y A;  1Z9U A;  4KUA A;  3A9L A;  5F48 A;  1XE4 A;  4HNY B;  2O28 A;  5ISV A;  4C2Z A;  5IB0 A;  3FXT A;  4CYP A;  3EO4 A;  2GIV A;  2VBQ A;  4LUA A;  1M1D A;  5H84 A;  3R9F A;  5F47 A;  4KSF A;  2Y0M A;  2OB0 A;  5HH1 A;  3TTH A;  2OU2 A;  5E96 A;  1MK4 A;  2DXQ A;  5CNP A;  3CXS A;  2PR1 A;  5AG7 A;  1ZO0 A;  4JLY A;  3FIX A;  3JUW A;  4IUS A;  1KZF A;  5G1Z A;  4R87 A;  2FIW A;  4AG7 A;  4MFP A;  5AG5 A;  3F5B A;  2FS5 A;  2Z3N A;  5KTC A;  3KKW A;  4UWI A;  4DNC A;  4AVB A;  1FY7 A;  4AB7 A;  2BEI A;  4CAW A;  4CYO A;  4CYN A;  4F6A A;  4B13 A;  3IWG A;  4RS2 A;  3ZZI A;  5EBV A;  2REE A;  4H6U A;  1I21 A;  2FSR A;  2R98 A;  4Y49 B;  2ARH A;  2YNC A;  2R8V A;  1CM0 A;  1XIX A;  4KS9 A;  4B14 A;  5DWN A;  2B58 A;  1S3Z A;  4CGO A;  3FNC A;  3N7Z A;  4A95 A;  2JLM A;  2ZW7 A;  3SXO A;  1R57 A;  3SHP A;  5C82 A;  2DPS A;  1GHE A;  2YND A;  3EC4 A;  3R9G A;  4QC6 A;  4PSW A;  2FXF A;  4UCM A;  4JXQ A;  4XPL A;  2CXA A;  1PUA A;  3VWE A;  4A33 A;  2Q7B A;  1QSO A;  1Z4E A;  4MFZ A;  2J8R A;  5IX3 A;  4JWP A;  1SQH A;  5J8F A;  3T90 A;  2FL4 A;  4C7H A;  1I1D A;  2WPW A;  2B4D A;  2B3V A;  2K5T A;  3P2H A;  3TT2 A;  2Z11 A;  3G3S A;  4KUB A;  3TCV A;  4KOR A;  4L8A A;  4CAE A;  1LRZ A;  2I00 A;  2ZW5 A;  4X5K A;  2IL4 A;  1S60 A;  1NE9 A;  3TO9 A;  3V8I A;  4UCN A;  2G0B A;  4M3S A;  4MHD A;  4E2A A;  4ORF A;  3RYO A;  2FT0 A;  1XF8 A;  1VHS A;  4U9Y A;  3JVN A;  1M4I A;  3IU2 A;  2R1I A;  1KUV A;  5EC4 A;  2WPX A;  4QUS A;  4FD4 A;  3R1K A;  3IU1 A;  4AG9 A;  5A28 A;  1YVO A;  4JXR A;  4QB9 A;  3VWD A;  2OZU A;  2NMT A;  1N71 A;  3TOA A;  3TO7 A;  4CRY B;  1YRE A;  4YGO A;  4MFL A;  5KTA A;  1XMT A;  4JD6 A;  2R7H A;  5AG6 A;  2WSA A;  1J4J A;  3OWC A;  4B12 A;  2HV2 A;  1BOB A;  3BLN A;  4UCP A;  4GS4 A;  4QBJ A;  2VEZ A;  4KSA A;  2QML A;  3EXN A;  1PU9 A;  4LX9 A;  4PV6 A;  4CAV A;  5H86 A;  3I9S A;  4MJ8 A;  2PRB A;  4FD7 A;  1VKC A;  4CAX A;  3S6K A;  3W6S A;  1KUY A;  2J8M A;  2Q04 A;  2REF A;  4MBU A;  3PZJ A;  4XNH B;  3MGD A;  2H5M A;  2Q44 A;  3W6X A;  3GYA A;  4U9Z A;  4PK3 A;  1S5K A;  2BSW A;  2BUE A;  2D4O A;  3G8W A;  4KOX A;  4MFJ A;  4A31 A;  2DPT A;  3W91 A;  2KCW A;  3LOD A;  2VZZ A;  3TOB A;  2Z10 A;  3F8K A;  4XPD B;  5A27 A;  4L89 A;  3UY5 A;  1B6B A;  2CNS A;  4ZGY B;  2B4B A;  3H4Q A;  4UFW A;  4RI1 A;  5G21 A;  2ZXV A;  3FYN A;  1P4N A;  3TO6 A;  1QSR A;  2GAN A;  3ZJ0 A;  5AGE A;  4YFJ A;  4MI4 A;  3I3G A;  4KOW A;  4NEX A;  2B5G B;  3T9Y A;  3SXN A;  4MFK A;  4CGM A;  3WR7 A;  2FE7 A;  2J8N A;  4MFQ A;  1IB1 E;  2Z0Z A;  5KTD A;  4KLV A;  1S7K A;  2OZH A;  1IID A;  4CGN A;  3IGR A;  4B5P B;  4F0Y A;  4NSQ A;  1OZP A;  2PDO A;  3QB8 A;  4MY3 A;  5JPH A;  4ONU A;  4H89 A;  1ON0 A;  4KOY A;  4C2Y A;  1RXT A;  4Y49 C;  4KOS A;  4FD6 A;  5G22 A;  3TFY A;  5F46 A;  2F5I A;  3BJ7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...