2DXQA

Putative acetyltransferase from agrobacterium tumefaciens str. c58
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
147
structure length
147
Chain Sequence
DAISLRAAGPGDLPGLLELYQVLNPSDPELTTQEAGAVFAAMLAQPGLTIFVATENGKPVATATLLIVPNLTRAARPYAFIENVVTLEARRGRGYGRTVVRHAIETAFGANCYKVMLLTGRHDPAVHAFYESCGFVQNKTGFQIRQD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Acetyltransferase
publication title Putative acetyltransferase from Agrobacterium tumefaciens str. C58
rcsb
source organism Agrobacterium tumefaciens str.
total genus 33
structure length 147
sequence length 147
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-08-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 2dxqA00
1V0CA 4XNHC 3W91A 3F8KA 1U6MA 1IYLA 1VHSA 4HNYB 2EVNA 2I00A 5J8CA 4OADA 1B87A 4BMHA 4H6ZA 1FY7A 5I0CA 2K5TA 4PV6A 4KOWA 5F48A 1YK3A 1IIDA 1OZPA 4ORFA 4JWPA 2FIAA 5IB0A 4NEXA 4HKFA 1KUVA 3EXNA 1QSRA 3B8GA 4DNCA 1PUAA 1S60A 2R8VA 2PRBA 3S6KA 4XPLA 2PR1A 1PU9A 3I3GA 3F5BA 1YGHA 3JUWA 2GIVA 2J8RA 4FD5A 3WR7A 1IICA 4NF1A 5IV0A 3OWCA 1BO4A 2QECA 1MJ9A 4H89A 4QVTA 4KUBA 1M4GA 1YVOA 2R1IA 1IYKA 1XMTA 2BEIA 4UA3A 2B5GB 1I12A 1Q2YA 4QC6A 3PZJA 3K9UA 4B5OA 2D4OA 1S7NA 1MK4A 2NMTA 4FD4A 4RI1A 2ATRA 4F6AA 2P0WA 4KLVA 3R96A 2Q0YA 3PP9A 3R9EA 3FB3A 2Q7BA 2QIRA 1Y7RA 3EY5A 1XEBA 1CM0A 4Y49C 4IUSA 1QSTA 3TO6A 5EBVA 4JJXA 2B4DA 4PK2A 2JDCA 1Z4EA 3IGRA 4LUAA 2R7HA 3MGDA 3VWDA 2PQ8A 2GE3A 3TO7A 2Q4VA 2KCWA 2FXFA 4KOUA 4X5KA 3TO9A 4AVCA 3R95A 1RXTA 3BLNA 3D8PA 4YFJA 4MY3A 4MHDA 1CJWA 4CRZB 3GKRA 4NXYA 2WPXA 3R1KA 3TE4A 4E8OA 2O28A 4B5PB 4XNHB 4HNWB 4JXQA 1J4JA 2JLMA 2B58A 4KOSA 3TTHA 4U9ZA 3RYOA 2PC1A 1M1DA 2VEZA 3S6FA 1I21A 4KOVA 4AVBA 4MI4A 3DNSA 3BJ7A 4HNXB 3ZZIA 4U9YA 3CXQA 3R9FA 3P2HA 3P2FA 4CAXA 2J8MA 2I79A 1SQHA 1R57A 1GHEA 3TCVA 4UWJA 5JQ4A 2R98A 4AB7A 4AG9A 2Q44A 4B5PA 1P4NA 2FT0A 2FCKA 4KVOE 5KTCA 1IB1E 2PDOA 3SHPA 1B6BA 2A4NA 3D2PA 2Q04A 4JXRA 1VKCA 4CAWA 1YR0A 2B4DB 2G3AA 3TFYA 1YREA 1LRZA 4M3SA 3R9GA 5KTAA 4XPDC 4OLLA 3DR8A 3FNCA 2OZUA 4R9MA 3UY5A 1UFHA 1QSMA 4EVYA 4PSXA 2JEVA 1KZFA 4JLYA 2G0BA 4R3KA 1S7FA 4NSQA 1M4DA 4QB9A 4XPKA 2CNMA 1XE4A 3DDDA 3W6XA 2X7BA 3GY9A 5DWNA 3FRMA 4L8AA 4K30A 1MJBA 3T9YA 1K4JA 3W6SA 3ZJ0A 3S6HA 5J8FA 1RO5A 3NE7A 3DR6A 2Q4YA 2GANA 2AE6A 3LD2A 2ZXVA 5DWMA 2P6FA 4H6UA 2OZHA 3G8WA 4KOYA 2F5IA 4CRYB 2B3UA 4AG7A 2CY2A 3FXTA 4JD6A 1N71A 2Z0ZA 1ON0A 3CXSA 3JVNA 4QUSA 1NSLA 4MBUA 1S3ZA 1MJAA 3EO4A 1M44A 4KOTA 2IL4A 3QB8A 1KUXA 4R57A 5EC4A 5JPHA 1NMTA 4LX9A 1Y9KA 1S5KA 2Z10A 4MY0A 2ZW5A 4FD6A 3F0AA 1TIQA 4R87A 4YGOA 5FVJA 4RS2A 2VXKA 5HMNA 2REFA 1KUYA 4R3LA 2G3TA 3FYNA 2AJ6A 4GS4A 2VI7A 1QSNA 3FIXA 3N7ZA 4KLWA 4PK3A 4QBJA 5KTDA 2PSWA 3DSBA 5GCNA 3VWEA 2C27A 2VZZA 2HUZA 4FD7A 3GYAA 3PGPA 3BJ8A 4E0AA 3T90A 5HH1A 4J3GA 4F0YA 2ZW7A 2OU2A 5F47A 2FS5A 4II9A 5CNPA 4KUAA 1YX0A 1YLEA 5E96A 4L89A 4MJ8A 3G3SA 1Z9UA 4KOXA 2WPWA 2B4BA 2FL4A 2CNSA 4I49A 1L0CA 2FSRA 3EFAA 2VZYA 1Z4RA 2J8NA 3TOBA 5F49A 4NCZA 2OZGA 1P0HA 4KZTA 3S6GA 2ARHA 3TOAA 3H4QA 4IF5A 1Q2CA 1NE9A 4XPDB 4E2AA 2REEA 1Y9WA 5C82A 3IWGA 5H84A 3TT2A 5H86A 3SXOA 2H5MA 2ZPAA 4CS0B 1M4IA 1QSOA 3C26A 1S7LA 5ISVA 2VQYA 2D4PA 4KVME 4Y49B 4UWIA 4OAEA 2Z11A 1WWZA 2OH1A 3KKWA 2Y0MA 1I1DA 2PR8A 3EC4A 5F46A 3LODA 2HV2A 4ZBGA 3E0KA 2JDDA 1WK4A 2B3VA 2FE7A 4ONUA 2OB0A 2FIWA 4AVAA 2ZW4A 2P6EA 2BL1A 2BSWA 4PSWA 2VBQA 3D2MA 2QMLA 2B5GA 2RC4A 1XF8A 3D3SA 4YRHA 1S7KA 1YVKA 2ZW6A 2DXQA 3V8IA 3FBUA 5IX3A 3CXPA 1Q2DA 2P6GA 2CNTA 4KVXA 4M85A 1XIXA 2HQYA 4U5YA 2EUIA 1BOBA 2BUEA 4UBRA 3SXNA 5C88A 3I9SA 4KORA 4CAVA 3QAHA
chains in the Genus database with same CATH superfamily
4C7IA 3KI9A 4UCMA 1V0CA 3KR5A 4XNHC 3W91A 4A30A 2G9DA 3F8KA 2Q43A 4RUHA 4F9UA 1U6MA 1IYLA 1VHSA 4HNYB 2EVNA 2I00A 4P4IA 4OADA 4A39A 5J8CA 2YNDA 3IU1A 1CG2A 1B87A 3FX6A 4PQAA 4WJBA 4A2ZA 4BMHA 3ISXA 3FJUA 4H6ZA 4MCSA 4CGPA 1FNOA 1BPNA 1FY7A 4DUKA 5I0CA 2K5TA 4PV6A 3MN8A 2WYRA 4R6TA 4KOWA 5F48A 1YK3A 4UEZA 1IIDA 1OZPA 3CZXA 4JWPA 4ORFA 5D8NA 2ZOGA 4CPAA 2FIAA 5IB0A 4NEXA 3KASA 4MFQA 3QAYA 4HKFA 1KUVA 3EXNA 1QSRA 4JYWA 4ONWA 2YGWA 3B8GA 4DNCA 3LMSA 3LWUA 1PUAA 4CYOA 1LANA 4UFWA 4UFVA 2V8HA 1S60A 2R8VA 3PB4X 2PRBA 4PXCA 4XPLA 3S6KA 4AXVA 2PR1A 4OC3A 1PU9A 1CBXA 4A37A 2RFHA 4B12A 1EE3P 1ZLIA 4MCRA 2C6PA 1Z8WA 3I3GA 3F5BA 3SJXA 2BO9A 2O53A 3N5FA 2AFSA 2EO8A 1YGHA 4KSIA 4NGRA 4P4JA 3B3WA 3JUWA 5IB9A 2GIVA 2J8RA 4HPSA 4FD5A 4UCNA 4M6HA 2C1CA 4EWTA 3WR7A 2AFXA 1IICA 2PJ2A 4NF1A 1YMEA 3BXMA 3KGQA 3OWCA 5IV0A 2PJ8A 4F9VA 1BO4A 2QECA 1CPSA 1MJ9A 4H89A 2ZEPA 4QVTA 5AGEA 3PBBA 4KUBA 4OMEA 4FBEA 1ARMA 1LFWA 1CP6A 4X8IA 3GB0A 3WABA 1M4GA 1YVOA 2YNCA 2PCUA 2R1IA 4GXHA 1IYKA 1XMTA 2CTCA 2BEIA 4UA3A 2B5GB 3V38A 4ZY2A 3V7ZA 4G1PA 3VATA 1HEEA 1I12A 1Q2YA 4OC1A 4QC6A 3PZJA 2FVGA 3K9UA 1YW4A 1YSJA 4B5OA 2D4OA 3HLPA 4UIBA 3S9LA 1S7NA 3B3CA 1MK4A 2NMTA 4FD4A 4Q36A 4RI1A 2IQ6A 2ATRA 1AUGA 2AFZA 4F6AA 5DS0A 3D7HA 2P0WA 4KLVA 4B11A 5D29A 3BI0A 4IHMA 4UF4A 3R96A 4MCQA 4PXEA 1F57A 2Q0YA 3PP9A 3R9EA 1F2PA 3FB3A 4B13A 2Z3PA 2Q7BA 4NJQA 2QIRA 4PXBA 1Y7RA 3BHXA 3EY5A 1XEBA 3TX8A 2BOAA 4KSAA 5HXDA 1CM0A 3KL9A 4Y49C 2Q7SA 2XEFA 1Z8XA 4IUSA 1QSTA 2VL1A 3TO6A 5EBVA 4JJXA 2B4DA 4PK2A 3LACA 2JDCA 1Z4EA 3IGRA 4CGMA 2ZENA 2R7HA 4IK2A 3MGDA 4LUAA 1HDQA 4UEFA 1LOKA 1VHEA 3VWDA 2PQ8A 1ZG7A 2GE3A 3D4UA 3TO7A 1Z8LA 2Q4VA 2KCWA 2FXFA 4KOUA 4X5KA 3TO9A 4AVCA 4EMEA 4ZY1A 3R95A 4B10A 2ZEEA 1RXTA 1M4LA 4MXUA 5AG4A 3BLNA 3D8PA 3RAMA 4YFJA 4A38A 3MRUA 4MY3A 5AG6A 5K8PA 3D66A 4MHDA 1CJWA 1TKFA 4CRZB 3GKRA 2POKA 4NXYA 4O23A 2WPXA 4Q7AA 3R1KA 3TE4A 1XBUA 3H8EA 1PYTB 3WC5A 1NSAA 3L2NA 1LAMA 3RZAA 1FT7A 2Z3MA 4TNUA 4E8OA 4DJLA 2Z3NA 2O28A 3H8FA 4B5PB 5LRJA 4R7MA 2DPSA 4X3RA 4FWUA 5AG5A 4Q38A 4XNHB 1DE4C 8CPAA 2CTBA 1ZO0A 4HNWB 4JXQA 1J4JA 4A32A 4A94A 3FMCA 4KSFA 4OKOA 1VHOA 4ZY0A 3I1UA 2JLMA 2B58A 2J9AA 2EBJA 2EWBA 2RB7A 4KOSA 3TTHA 4U9ZA 3RYOA 2PC1A 4OC5A 4RN7A 1M1DA 3SJEA 2Z3OA 2VEZA 2AFWA 4TWEA 4W9YA 2V77A 1Y7EA 3S6FA 1I21A 4KOVA 1XJOA 4AVBA 4MI4A 3DNSA 3BJ7A 4HNXB 5K8NA 3ZZIA 2Q4ZA 2ZEMA 4FUUA 1QQ9A 1ARLA 1ZLHA 4NGSA 4U9YA 2PJAA 3CXQA 2PIZA 4IAVA 3P2HA 3R9FA 1R43A 3P2FA 3FEEA 4JZ0A 4GM5A 3DGVA 4CAXA 2DPTA 2J8MA 2I79A 1SQHA 1AYEA 1R57A 2GLJA 1VGYA 1GHEA 2GFQA 3D68A 3SI0A 3TCVA 5G1ZA 5AG7A 2GLFA 2PIYA 2AFMA 2PJBA 4UWJA 5JQ4A 2CXAA 7CPAA 2DEAA 2OOTA 3B3VA 4A95A 2OR4A 2XEJA 2R98A 1AMPA 1CP7A 3A9LA 5G20A 2PJ3A 2Q44A 1XMBA 4YWYA 4AB7A 1P4NA 4AG9A 2PJ6A 2FT0A 2FCKA 3RNZA 1ZG8A 4B5PA 4P4DA 4OC2A 4KVOE 4BINA 5KTCA 1IB1E 2PDOA 5THWA 3SHPA 1B6BA 1ZG9A 2JBKA 3B7IA 2A4NA 4MHZA 3D2PA 4F0XA 2EK9A 2Q04A 4JXRA 1VKCA 5LYIA 1YR0A 3WT4A 2B4DB 2G3AA 4CAWA 4UEEA 3IEHA 3TFYA 1YREA 1LRZA 1IOIA 2Z3LA 3FVLA 1Y0YA 1OBRA 4M3SA 4PPZA 3R9GA 3B3TA 5KTAA 4XPDC 3VARA 5F09A 1TXRA 4OLLA 5G22A 2QVPA 2ZOFA 3DR8A 3FNCA 2OZUA 2JBJA 4R9MA 3UY5A 1UFHA 1QSMA 4EVYA 1GYTA 4MFPA 5LYLA 2Z3KA 4PSXA 2YNEA 2JEVA 1KZFA 4JLYA 2ZEGA 2G0BA 4CGOA 4R3KA 5HVFA 1S7FA 4NSQA 3TC8A 1M4DA 4QB9A 4XPKA 2CNMA 1XE4A 3DDDA 5A28A 3S9MA 3SI2A 3W6XA 2X7BA 3GY9A 5DWNA 3FRMA 4L8AA 4K30A 5LYDA 1MJBA 2ODFA 3T9YA 1F2OA 1K4JA 3W6SA 4M6GA 3PB9X 1CX8A 1VIXA 3ZJ0A 4CGNA 3S6HA 2GU2A 5J8FA 1RO5A 3NE7A 3DR6A 3PB6X 2PRQA 2Q4YA 4OP4A 2GANA 2AE6A 3LD2A 2ZXVA 1R3NA 5DWMA 4OC4A 5CBMA 3NE8A 5HVHA 2P6FA 4H6UA 4MFLA 2OZHA 1A2ZA 4X2TA 3D7FA 3G8WA 4LQ6A 3BI1A 2C6GA 3NH4A 4KOYA 2F5IA 4CRYB 2B3UA 1TF9A 2AFOA 3KHXA 4AG7A 2PJ5A 2CY2A 3FXTA 4JD6A 1N71A 2QJ8A 2WSAA 4Z65A 5K8OA 2Z0ZA 4C2YA 1ON0A 3CXSA 3JVNA 4QUSA 1NSLA 1BAVA 3B2YA 5LRKA 4MBUA 3IC1A 2V8GA 4UIAA 1CPXA 2GREA 1JWQA 3KQXA 2ABZA 3D7DA 3T8WA 3IO1A 1HDUA 3IIBA 1S3ZA 3ISZA 1MJAA 3EO4A 4MHPA 1M44A 3B3SA 3CT9A 4KOTA 2IL4A 3D7GA 5EMIA 2EK8A 4NJRA 3QB8A 1KUXA 4R57A 1ELMP 5EC4A 5JPHA 1NMTA 4C7HA 4LX9A 1DTDA 1Y9KA 4P4EA 1S5KA 2Z10A 4M6IA 3IJ3A 2ZW5A 4FD6A 3F0AA 1TIQA 1YW6A 4MY0A 4R87A 4R8FA 4UCPA 4RS2A 2VXKA 1TKJA 2REFA 5FVJA 5HMNA 5I4MA 1KUYA 4R3LA 4DYOA 2G3TA 3FYNA 1Z8TA 3PRTA 2AJ6A 3NA6A 2AFUA 2VI7A 4GS4A 4NGMA 1QSNA 2XEIA 4NGNA 4ZX8A 3K9TA 4CAFA 3FIXA 3GUXA 3N7ZA 4KLWA 4PK3A 4YGOA 4QBJA 5KTDA 2PSWA 3SJGA 3PFOA 4A33A 2PJ0A 3DSBA 3KR4A 5LRGA 5GCNA 3VWEA 1XOVA 2C27A 2VZZA 4R76A 2HUZA 4FD7A 3GYAA 1XFOA 2WZNA 3PGPA 3BJ8A 4E0AA 3T90A 5HH1A 3SJFA 4BD9A 3IWEA 4NFRA 4J3GA 4F0YA 2ZW7A 2OU2A 5F47A 2FS5A 1IU8A 1Q7LA 2NYQA 4II9A 3RO0A 5CNPA 4KUAA 1YX0A 4KS9A 4B14A 3FEDA 1YLEA 2YNCC 4P4FA 5E96A 3GIUA 3PEIA 4L89A 4MJ8A 3G3SA 2PVVA 1Z9UA 4P6YA 4P44A 4KOXA 2WPWA 3GLJA 2B4BA 4OC0A 3PBEA 2FL4A 3CPXA 4FAIA 2CNSA 4I49A 5JGFA 2QYVA 1L0CA 4NGPA 2FSRA 4NGQA 2DF5A 3EFAA 2VZYA 3FF3A 1Z4RA 2J8NA 3SI1A 3TOBA 2ZEOA 4CYNA 5F49A 4MFJA 2OZGA 3B35A 4MHNA 1P0HA 4NCZA 4C68A 4OIWA 5JH9A 1IOFA 1BPMA 4KZTA 3S6GA 2PE3A 2ARHA 2PJ7A 1LAPA 3JRUA 3DLJA 3TOAA 3H4QA 2ZEDA 4YU9A 3H8GA 3KZWA 3WC7A 4IF5A 5LYFA 1Q2CA 1Z2LA 1NE9A 3FH4A 4XPDB 4EFDA 4E2AA 2I3CA 4MFZA 4UFXA 1PCAA 2REEA 4MHYA 4CGLA 1X10A 1Y9WA 4ZGYB 4MFKA 1H8LA 2PJCA 4PXDA 5C82A 3S9NA 3NH8A 3IFEA 2ZEHA 3IWGA 4OIDA 5A27A 2PJ4A 3NFZA 1JQGA 5H84A 3TT2A 2BCOA 3KQZA 1ELLP 3QNVA 1YLOA 4P4BA 2PVWA 5H86A 3SXOA 4MRIA 4CYQA 2H5MA 3K2KA 2ZPAA 4CS0B 2NSMA 1M4IA 1QSOA 2HC9A 3C26A 3IU2A 2IJZA 2JEWA 2ZEFA 1S7LA 3CDXA 5ISVA 2ZELA 1Y0RA 2VQYA 1Z5RA 2D4PA 3CPAA 3NH5A 4ZX9A 4KVME 5HVGA 4B6ZA 3IWWA 4Y49B 2XEGA 4UWIA 5J1QA 1IGBA 2V8VA 4OAEA 1QMUA 1IY7A 2Z11A 4H2KA 1WWZA 4MCPA 2C6CA 2OH1A 3KKWA 4F8ZA 2Y0MA 1I1DA 3VH9A 2PR8A 2F7VA 1UWYA 3EC4A 4CAEA 5JM6A 3HUVA 4CYPA 5F46A 3PB7X 4BBHA 3LODA 2HV2A 4ZBGA 3E0KA 4P45A 2JDDA 1WK4A 3D67A 2F8HA 2B3VA 5CPAA 1YQEA 2FE7A 4LQGA 2IMOA 3RBUA 4ONUA 1KWMA 2OB0A 2FIWA 4AVAA 2ZW4A 2P6EA 1X12A 2V8DA 2BL1A 2BSWA 3JTKA 4PSWA 2VBQA 1BLLE 3D2MA 4WWVA 4A31A 2QMLA 2B5GA 2PJ9A 2RC4A 1XF8A 3D3SA 4YRHA 1TKHA 5ELYA 5K8MA 1S7KA 1YVKA 2ZW6A 2DXQA 3V8IA 3FBUA 5IX3A 3CXPA 2PJ1A 1Q2DA 2P6GA 3FECA 2CNTA 4C2XA 4KVXA 4M85A 6CPAA 1XIXA 2O4HA 3H5ZA 5G21A 4K3NA 4C2ZA 4ZI6A 3PB8X 2HQYA 2HB6A 1RTQA 2Q51A 1TF8A 4U5YA 2CIJA 2EUIA 1XRYA 2CF4A 3PFEA 2WUUA 4MMOA 1BOBA 2BUEA 4UBRA 3SXNA 5C88A 3I9SA 4KORA 3WC6A 4CAVA 3KHZA 3QAHA 4NGTA 2ANPA 4P10A 1LCPA 4ZYQA 5BWAB
chains in the Genus database with same CATH topology
4C7IA 4UCMA 1V0CA 4XNHC 3W91A 4A30A 3F8KA 1U6MA 1IYLA 1VHSA 4HNYB 2EVNA 2I00A 5J8CA 4OADA 2YNDA 3IU1A 1B87A 4A2ZA 4BMHA 4H6ZA 4CGPA 1FY7A 5I0CA 2K5TA 4PV6A 4KOWA 5F48A 1YK3A 1IIDA 1OZPA 4ORFA 4JWPA 2FIAA 5IB0A 4NEXA 4MFQA 4HKFA 1KUVA 3EXNA 1QSRA 2YGWA 3B8GA 4DNCA 1PUAA 4CYOA 4UFWA 4UFVA 1S60A 2R8VA 2PRBA 3S6KA 4XPLA 2PR1A 1PU9A 4B12A 3I3GA 3F5BA 1YGHA 3JUWA 2GIVA 2J8RA 4FD5A 4UCNA 3WR7A 1IICA 4NF1A 5IV0A 3OWCA 1BO4A 2QECA 1MJ9A 5AGEA 4H89A 4QVTA 4KUBA 1M4GA 1YVOA 2YNCA 2R1IA 1IYKA 1XMTA 2BEIA 4UA3A 2B5GB 1I12A 1Q2YA 4QC6A 3PZJA 3K9UA 4B5OA 2D4OA 1S7NA 4Q36A 1MK4A 2NMTA 4FD4A 4RI1A 2ATRA 4F6AA 2P0WA 4KLVA 4B11A 3R96A 2Q0YA 3PP9A 3R9EA 3FB3A 4B13A 2Z3PA 2Q7BA 2QIRA 1Y7RA 3EY5A 1XEBA 4KSAA 1CM0A 4Y49C 4IUSA 1QSTA 3TO6A 5EBVA 4JJXA 2B4DA 4PK2A 2JDCA 1Z4EA 3IGRA 4CGMA 4LUAA 2R7HA 3MGDA 3VWDA 2PQ8A 2GE3A 3TO7A 2Q4VA 2KCWA 2FXFA 4KOUA 4X5KA 3TO9A 4AVCA 3R95A 4B10A 1RXTA 5AG4A 3BLNA 3D8PA 4YFJA 4MY3A 5AG6A 4MHDA 1CJWA 4CRZB 3GKRA 4NXYA 2WPXA 3R1KA 3TE4A 2Z3MA 4E8OA 2Z3NA 2O28A 4B5PB 2DPSA 5AG5A 4Q38A 4XNHB 1ZO0A 4HNWB 4JXQA 1J4JA 4A32A 4KSFA 2JLMA 2B58A 4KOSA 3TTHA 4U9ZA 3RYOA 2PC1A 1M1DA 2Z3OA 2VEZA 3S6FA 1I21A 4KOVA 4AVBA 4MI4A 3DNSA 3BJ7A 4HNXB 3ZZIA 4U9YA 3CXQA 3R9FA 3P2HA 3P2FA 4CAXA 2DPTA 2J8MA 2I79A 1SQHA 1R57A 1GHEA 3TCVA 5G1ZA 5AG7A 4UWJA 5JQ4A 2CXAA 4A95A 2R98A 5G20A 3A9LA 4AB7A 4AG9A 2Q44A 4B5PA 1P4NA 2FT0A 2FCKA 4KVOE 5KTCA 1IB1E 2PDOA 3SHPA 1B6BA 2A4NA 3D2PA 4F0XA 2Q04A 4JXRA 1VKCA 4CAWA 1YR0A 2B4DB 2G3AA 3TFYA 1YREA 1LRZA 2Z3LA 4M3SA 3R9GA 5KTAA 4XPDC 4OLLA 5G22A 3DR8A 3FNCA 2OZUA 4R9MA 3UY5A 1UFHA 1QSMA 4EVYA 4MFPA 2Z3KA 4PSXA 2YNEA 2JEVA 1KZFA 4JLYA 4CGOA 2G0BA 4R3KA 1S7FA 4NSQA 1M4DA 4QB9A 4XPKA 2CNMA 1XE4A 3DDDA 5A28A 3W6XA 2X7BA 3GY9A 5DWNA 3FRMA 4L8AA 4K30A 1MJBA 3T9YA 1K4JA 3W6SA 4CGNA 3ZJ0A 3S6HA 5J8FA 1RO5A 3NE7A 3DR6A 2Q4YA 2GANA 2AE6A 3LD2A 2ZXVA 5DWMA 2P6FA 4H6UA 4MFLA 2OZHA 3G8WA 4KOYA 2F5IA 4CRYB 2B3UA 4AG7A 2CY2A 3FXTA 4JD6A 1N71A 2WSAA 2Z0ZA 4C2YA 1ON0A 3CXSA 3JVNA 4QUSA 1NSLA 4MBUA 1S3ZA 1MJAA 3EO4A 1M44A 4KOTA 2IL4A 3QB8A 1KUXA 4R57A 5EC4A 5JPHA 1NMTA 4C7HA 4LX9A 1Y9KA 1S5KA 2Z10A 4MY0A 2ZW5A 4FD6A 3F0AA 1TIQA 4R87A 4UCPA 4YGOA 5FVJA 4RS2A 2VXKA 5HMNA 2REFA 1KUYA 4R3LA 2G3TA 3FYNA 2AJ6A 4GS4A 2VI7A 1QSNA 4CAFA 3FIXA 3N7ZA 4KLWA 4PK3A 4QBJA 5KTDA 2PSWA 4A33A 3DSBA 5GCNA 3VWEA 2C27A 2VZZA 2HUZA 4FD7A 3GYAA 3PGPA 3BJ8A 4E0AA 3T90A 5HH1A 3IWEA 4J3GA 4F0YA 2ZW7A 2OU2A 5F47A 2FS5A 4II9A 5CNPA 4KUAA 1YX0A 4KS9A 4B14A 1YLEA 2YNCC 5E96A 4L89A 4MJ8A 3G3SA 1Z9UA 4KOXA 2WPWA 2B4BA 2FL4A 2CNSA 4I49A 1L0CA 2FSRA 3EFAA 2VZYA 1Z4RA 2J8NA 3TOBA 4CYNA 5F49A 4MFJA 2OZGA 4NCZA 4C68A 1P0HA 4KZTA 3S6GA 2ARHA 3TOAA 3H4QA 4IF5A 1Q2CA 1NE9A 4XPDB 4E2AA 4MFZA 4UFXA 2REEA 4CGLA 1Y9WA 4ZGYB 4MFKA 5C82A 3IWGA 5A27A 5H84A 3TT2A 5H86A 3SXOA 4CYQA 2H5MA 2ZPAA 4CS0B 1M4IA 1QSOA 3C26A 3IU2A 1S7LA 5ISVA 2VQYA 2D4PA 4KVME 4Y49B 4UWIA 4OAEA 2Z11A 1WWZA 2OH1A 3KKWA 2Y0MA 1I1DA 2PR8A 3EC4A 4CAEA 4CYPA 5F46A 4BBHA 3LODA 2HV2A 4ZBGA 3E0KA 2JDDA 1WK4A 2B3VA 2FE7A 4ONUA 2OB0A 2FIWA 4AVAA 2ZW4A 2P6EA 2BL1A 2BSWA 3JTKA 4PSWA 2VBQA 3D2MA 4A31A 2QMLA 2B5GA 2RC4A 1XF8A 3D3SA 4YRHA 1S7KA 1YVKA 2ZW6A 2DXQA 3V8IA 3FBUA 5IX3A 3CXPA 1Q2DA 2P6GA 4C2XA 2CNTA 4KVXA 4M85A 1XIXA 3H5ZA 5G21A 4C2ZA 2HQYA 4U5YA 2EUIA 2WUUA 1BOBA 2BUEA 4UBRA 3SXNA 5C88A 3I9SA 4KORA 4CAVA 3QAHA 5BWAB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1V0C A;  4XNH C;  3W91 A;  3F8K A;  1U6M A;  1IYL A;  1VHS A;  4HNY B;  2EVN A;  2I00 A;  5J8C A;  4OAD A;  1B87 A;  4BMH A;  4H6Z A;  1FY7 A;  5I0C A;  2K5T A;  4PV6 A;  4KOW A;  5F48 A;  1YK3 A;  1IID A;  1OZP A;  4ORF A;  4JWP A;  2FIA A;  5IB0 A;  4NEX A;  4HKF A;  1KUV A;  3EXN A;  1QSR A;  3B8G A;  4DNC A;  1PUA A;  1S60 A;  2R8V A;  2PRB A;  3S6K A;  4XPL A;  2PR1 A;  1PU9 A;  3I3G A;  3F5B A;  1YGH A;  3JUW A;  2GIV A;  2J8R A;  4FD5 A;  3WR7 A;  1IIC A;  4NF1 A;  5IV0 A;  3OWC A;  1BO4 A;  2QEC A;  1MJ9 A;  4H89 A;  4QVT A;  4KUB A;  1M4G A;  1YVO A;  2R1I A;  1IYK A;  1XMT A;  2BEI A;  4UA3 A;  2B5G B;  1I12 A;  1Q2Y A;  4QC6 A;  3PZJ A;  3K9U A;  4B5O A;  2D4O A;  1S7N A;  1MK4 A;  2NMT A;  4FD4 A;  4RI1 A;  2ATR A;  4F6A A;  2P0W A;  4KLV A;  3R96 A;  2Q0Y A;  3PP9 A;  3R9E A;  3FB3 A;  2Q7B A;  2QIR A;  1Y7R A;  3EY5 A;  1XEB A;  1CM0 A;  4Y49 C;  4IUS A;  1QST A;  3TO6 A;  5EBV A;  4JJX A;  2B4D A;  4PK2 A;  2JDC A;  1Z4E A;  3IGR A;  4LUA A;  2R7H A;  3MGD A;  3VWD A;  2PQ8 A;  2GE3 A;  3TO7 A;  2Q4V A;  2KCW A;  2FXF A;  4KOU A;  4X5K A;  3TO9 A;  4AVC A;  3R95 A;  1RXT A;  3BLN A;  3D8P A;  4YFJ A;  4MY3 A;  4MHD A;  1CJW A;  4CRZ B;  3GKR A;  4NXY A;  2WPX A;  3R1K A;  3TE4 A;  4E8O A;  2O28 A;  4B5P B;  4XNH B;  4HNW B;  4JXQ A;  1J4J A;  2JLM A;  2B58 A;  4KOS A;  3TTH A;  4U9Z A;  3RYO A;  2PC1 A;  1M1D A;  2VEZ A;  3S6F A;  1I21 A;  4KOV A;  4AVB A;  4MI4 A;  3DNS A;  3BJ7 A;  4HNX B;  3ZZI A;  4U9Y A;  3CXQ A;  3R9F A;  3P2H A;  3P2F A;  4CAX A;  2J8M A;  2I79 A;  1SQH A;  1R57 A;  1GHE A;  3TCV A;  4UWJ A;  5JQ4 A;  2R98 A;  4AB7 A;  4AG9 A;  2Q44 A;  4B5P A;  1P4N A;  2FT0 A;  2FCK A;  4KVO E;  5KTC A;  1IB1 E;  2PDO A;  3SHP A;  1B6B A;  2A4N A;  3D2P A;  2Q04 A;  4JXR A;  1VKC A;  4CAW A;  1YR0 A;  2B4D B;  2G3A A;  3TFY A;  1YRE A;  1LRZ A;  4M3S A;  3R9G A;  5KTA A;  4XPD C;  4OLL A;  3DR8 A;  3FNC A;  2OZU A;  4R9M A;  3UY5 A;  1UFH A;  1QSM A;  4EVY A;  4PSX A;  2JEV A;  1KZF A;  4JLY A;  2G0B A;  4R3K A;  1S7F A;  4NSQ A;  1M4D A;  4QB9 A;  4XPK A;  2CNM A;  1XE4 A;  3DDD A;  3W6X A;  2X7B A;  3GY9 A;  5DWN A;  3FRM A;  4L8A A;  4K30 A;  1MJB A;  3T9Y A;  1K4J A;  3W6S A;  3ZJ0 A;  3S6H A;  5J8F A;  1RO5 A;  3NE7 A;  3DR6 A;  2Q4Y A;  2GAN A;  2AE6 A;  3LD2 A;  2ZXV A;  5DWM A;  2P6F A;  4H6U A;  2OZH A;  3G8W A;  4KOY A;  2F5I A;  4CRY B;  2B3U A;  4AG7 A;  2CY2 A;  3FXT A;  4JD6 A;  1N71 A;  2Z0Z A;  1ON0 A;  3CXS A;  3JVN A;  4QUS A;  1NSL A;  4MBU A;  1S3Z A;  1MJA A;  3EO4 A;  1M44 A;  4KOT A;  2IL4 A;  3QB8 A;  1KUX A;  4R57 A;  5EC4 A;  5JPH A;  1NMT A;  4LX9 A;  1Y9K A;  1S5K A;  2Z10 A;  4MY0 A;  2ZW5 A;  4FD6 A;  3F0A A;  1TIQ A;  4R87 A;  4YGO A;  5FVJ A;  4RS2 A;  2VXK A;  5HMN A;  2REF A;  1KUY A;  4R3L A;  2G3T A;  3FYN A;  2AJ6 A;  4GS4 A;  2VI7 A;  1QSN A;  3FIX A;  3N7Z A;  4KLW A;  4PK3 A;  4QBJ A;  5KTD A;  2PSW A;  3DSB A;  5GCN A;  3VWE A;  2C27 A;  2VZZ A;  2HUZ A;  4FD7 A;  3GYA A;  3PGP A;  3BJ8 A;  4E0A A;  3T90 A;  5HH1 A;  4J3G A;  4F0Y A;  2ZW7 A;  2OU2 A;  5F47 A;  2FS5 A;  4II9 A;  5CNP A;  4KUA A;  1YX0 A;  1YLE A;  5E96 A;  4L89 A;  4MJ8 A;  3G3S A;  1Z9U A;  4KOX A;  2WPW A;  2B4B A;  2FL4 A;  2CNS A;  4I49 A;  1L0C A;  2FSR A;  3EFA A;  2VZY A;  1Z4R A;  2J8N A;  3TOB A;  5F49 A;  4NCZ A;  2OZG A;  1P0H A;  4KZT A;  3S6G A;  2ARH A;  3TOA A;  3H4Q A;  4IF5 A;  1Q2C A;  1NE9 A;  4XPD B;  4E2A A;  2REE A;  1Y9W A;  5C82 A;  3IWG A;  5H84 A;  3TT2 A;  5H86 A;  3SXO A;  2H5M A;  2ZPA A;  4CS0 B;  1M4I A;  1QSO A;  3C26 A;  1S7L A;  5ISV A;  2VQY A;  2D4P A;  4KVM E;  4Y49 B;  4UWI A;  4OAE A;  2Z11 A;  1WWZ A;  2OH1 A;  3KKW A;  2Y0M A;  1I1D A;  2PR8 A;  3EC4 A;  5F46 A;  3LOD A;  2HV2 A;  4ZBG A;  3E0K A;  2JDD A;  1WK4 A;  2B3V A;  2FE7 A;  4ONU A;  2OB0 A;  2FIW A;  4AVA A;  2ZW4 A;  2P6E A;  2BL1 A;  2BSW A;  4PSW A;  2VBQ A;  3D2M A;  2QML A;  2B5G A;  2RC4 A;  1XF8 A;  3D3S A;  4YRH A;  1S7K A;  1YVK A;  2ZW6 A;  2DXQ A;  3V8I A;  3FBU A;  5IX3 A;  3CXP A;  1Q2D A;  2P6G A;  2CNT A;  4KVX A;  4M85 A;  1XIX A;  2HQY A;  4U5Y A;  2EUI A;  1BOB A;  2BUE A;  4UBR A;  3SXN A;  5C88 A;  3I9S A;  4KOR A;  4CAV A;  3QAH A; 
#chains in the Genus database with same CATH topology
 4C7I A;  3KI9 A;  4UCM A;  1V0C A;  3KR5 A;  4XNH C;  3W91 A;  4A30 A;  2G9D A;  3F8K A;  2Q43 A;  4RUH A;  4F9U A;  1U6M A;  1IYL A;  1VHS A;  4HNY B;  2EVN A;  2I00 A;  4P4I A;  4OAD A;  4A39 A;  5J8C A;  2YND A;  3IU1 A;  1CG2 A;  1B87 A;  3FX6 A;  4PQA A;  4WJB A;  4A2Z A;  4BMH A;  3ISX A;  3FJU A;  4H6Z A;  4MCS A;  4CGP A;  1FNO A;  1BPN A;  1FY7 A;  4DUK A;  5I0C A;  2K5T A;  4PV6 A;  3MN8 A;  2WYR A;  4R6T A;  4KOW A;  5F48 A;  1YK3 A;  4UEZ A;  1IID A;  1OZP A;  3CZX A;  4JWP A;  4ORF A;  5D8N A;  2ZOG A;  4CPA A;  2FIA A;  5IB0 A;  4NEX A;  3KAS A;  4MFQ A;  3QAY A;  4HKF A;  1KUV A;  3EXN A;  1QSR A;  4JYW A;  4ONW A;  2YGW A;  3B8G A;  4DNC A;  3LMS A;  3LWU A;  1PUA A;  4CYO A;  1LAN A;  4UFW A;  4UFV A;  2V8H A;  1S60 A;  2R8V A;  3PB4 X;  2PRB A;  4PXC A;  4XPL A;  3S6K A;  4AXV A;  2PR1 A;  4OC3 A;  1PU9 A;  1CBX A;  4A37 A;  2RFH A;  4B12 A;  1EE3 P;  1ZLI A;  4MCR A;  2C6P A;  1Z8W A;  3I3G A;  3F5B A;  3SJX A;  2BO9 A;  2O53 A;  3N5F A;  2AFS A;  2EO8 A;  1YGH A;  4KSI A;  4NGR A;  4P4J A;  3B3W A;  3JUW A;  5IB9 A;  2GIV A;  2J8R A;  4HPS A;  4FD5 A;  4UCN A;  4M6H A;  2C1C A;  4EWT A;  3WR7 A;  2AFX A;  1IIC A;  2PJ2 A;  4NF1 A;  1YME A;  3BXM A;  3KGQ A;  3OWC A;  5IV0 A;  2PJ8 A;  4F9V A;  1BO4 A;  2QEC A;  1CPS A;  1MJ9 A;  4H89 A;  2ZEP A;  4QVT A;  5AGE A;  3PBB A;  4KUB A;  4OME A;  4FBE A;  1ARM A;  1LFW A;  1CP6 A;  4X8I A;  3GB0 A;  3WAB A;  1M4G A;  1YVO A;  2YNC A;  2PCU A;  2R1I A;  4GXH A;  1IYK A;  1XMT A;  2CTC A;  2BEI A;  4UA3 A;  2B5G B;  3V38 A;  4ZY2 A;  3V7Z A;  4G1P A;  3VAT A;  1HEE A;  1I12 A;  1Q2Y A;  4OC1 A;  4QC6 A;  3PZJ A;  2FVG A;  3K9U A;  1YW4 A;  1YSJ A;  4B5O A;  2D4O A;  3HLP A;  4UIB A;  3S9L A;  1S7N A;  3B3C A;  1MK4 A;  2NMT A;  4FD4 A;  4Q36 A;  4RI1 A;  2IQ6 A;  2ATR A;  1AUG A;  2AFZ A;  4F6A A;  5DS0 A;  3D7H A;  2P0W A;  4KLV A;  4B11 A;  5D29 A;  3BI0 A;  4IHM A;  4UF4 A;  3R96 A;  4MCQ A;  4PXE A;  1F57 A;  2Q0Y A;  3PP9 A;  3R9E A;  1F2P A;  3FB3 A;  4B13 A;  2Z3P A;  2Q7B A;  4NJQ A;  2QIR A;  4PXB A;  1Y7R A;  3BHX A;  3EY5 A;  1XEB A;  3TX8 A;  2BOA A;  4KSA A;  5HXD A;  1CM0 A;  3KL9 A;  4Y49 C;  2Q7S A;  2XEF A;  1Z8X A;  4IUS A;  1QST A;  2VL1 A;  3TO6 A;  5EBV A;  4JJX A;  2B4D A;  4PK2 A;  3LAC A;  2JDC A;  1Z4E A;  3IGR A;  4CGM A;  2ZEN A;  2R7H A;  4IK2 A;  3MGD A;  4LUA A;  1HDQ A;  4UEF A;  1LOK A;  1VHE A;  3VWD A;  2PQ8 A;  1ZG7 A;  2GE3 A;  3D4U A;  3TO7 A;  1Z8L A;  2Q4V A;  2KCW A;  2FXF A;  4KOU A;  4X5K A;  3TO9 A;  4AVC A;  4EME A;  4ZY1 A;  3R95 A;  4B10 A;  2ZEE A;  1RXT A;  1M4L A;  4MXU A;  5AG4 A;  3BLN A;  3D8P A;  3RAM A;  4YFJ A;  4A38 A;  3MRU A;  4MY3 A;  5AG6 A;  5K8P A;  3D66 A;  4MHD A;  1CJW A;  1TKF A;  4CRZ B;  3GKR A;  2POK A;  4NXY A;  4O23 A;  2WPX A;  4Q7A A;  3R1K A;  3TE4 A;  1XBU A;  3H8E A;  1PYT B;  3WC5 A;  1NSA A;  3L2N A;  1LAM A;  3RZA A;  1FT7 A;  2Z3M A;  4TNU A;  4E8O A;  4DJL A;  2Z3N A;  2O28 A;  3H8F A;  4B5P B;  5LRJ A;  4R7M A;  2DPS A;  4X3R A;  4FWU A;  5AG5 A;  4Q38 A;  4XNH B;  1DE4 C;  8CPA A;  2CTB A;  1ZO0 A;  4HNW B;  4JXQ A;  1J4J A;  4A32 A;  4A94 A;  3FMC A;  4KSF A;  4OKO A;  1VHO A;  4ZY0 A;  3I1U A;  2JLM A;  2B58 A;  2J9A A;  2EBJ A;  2EWB A;  2RB7 A;  4KOS A;  3TTH A;  4U9Z A;  3RYO A;  2PC1 A;  4OC5 A;  4RN7 A;  1M1D A;  3SJE A;  2Z3O A;  2VEZ A;  2AFW A;  4TWE A;  4W9Y A;  2V77 A;  1Y7E A;  3S6F A;  1I21 A;  4KOV A;  1XJO A;  4AVB A;  4MI4 A;  3DNS A;  3BJ7 A;  4HNX B;  5K8N A;  3ZZI A;  2Q4Z A;  2ZEM A;  4FUU A;  1QQ9 A;  1ARL A;  1ZLH A;  4NGS A;  4U9Y A;  2PJA A;  3CXQ A;  2PIZ A;  4IAV A;  3P2H A;  3R9F A;  1R43 A;  3P2F A;  3FEE A;  4JZ0 A;  4GM5 A;  3DGV A;  4CAX A;  2DPT A;  2J8M A;  2I79 A;  1SQH A;  1AYE A;  1R57 A;  2GLJ A;  1VGY A;  1GHE A;  2GFQ A;  3D68 A;  3SI0 A;  3TCV A;  5G1Z A;  5AG7 A;  2GLF A;  2PIY A;  2AFM A;  2PJB A;  4UWJ A;  5JQ4 A;  2CXA A;  7CPA A;  2DEA A;  2OOT A;  3B3V A;  4A95 A;  2OR4 A;  2XEJ A;  2R98 A;  1AMP A;  1CP7 A;  3A9L A;  5G20 A;  2PJ3 A;  2Q44 A;  1XMB A;  4YWY A;  4AB7 A;  1P4N A;  4AG9 A;  2PJ6 A;  2FT0 A;  2FCK A;  3RNZ A;  1ZG8 A;  4B5P A;  4P4D A;  4OC2 A;  4KVO E;  4BIN A;  5KTC A;  1IB1 E;  2PDO A;  5THW A;  3SHP A;  1B6B A;  1ZG9 A;  2JBK A;  3B7I A;  2A4N A;  4MHZ A;  3D2P A;  4F0X A;  2EK9 A;  2Q04 A;  4JXR A;  1VKC A;  5LYI A;  1YR0 A;  3WT4 A;  2B4D B;  2G3A A;  4CAW A;  4UEE A;  3IEH A;  3TFY A;  1YRE A;  1LRZ A;  1IOI A;  2Z3L A;  3FVL A;  1Y0Y A;  1OBR A;  4M3S A;  4PPZ A;  3R9G A;  3B3T A;  5KTA A;  4XPD C;  3VAR A;  5F09 A;  1TXR A;  4OLL A;  5G22 A;  2QVP A;  2ZOF A;  3DR8 A;  3FNC A;  2OZU A;  2JBJ A;  4R9M A;  3UY5 A;  1UFH A;  1QSM A;  4EVY A;  1GYT A;  4MFP A;  5LYL A;  2Z3K A;  4PSX A;  2YNE A;  2JEV A;  1KZF A;  4JLY A;  2ZEG A;  2G0B A;  4CGO A;  4R3K A;  5HVF A;  1S7F A;  4NSQ A;  3TC8 A;  1M4D A;  4QB9 A;  4XPK A;  2CNM A;  1XE4 A;  3DDD A;  5A28 A;  3S9M A;  3SI2 A;  3W6X A;  2X7B A;  3GY9 A;  5DWN A;  3FRM A;  4L8A A;  4K30 A;  5LYD A;  1MJB A;  2ODF A;  3T9Y A;  1F2O A;  1K4J A;  3W6S A;  4M6G A;  3PB9 X;  1CX8 A;  1VIX A;  3ZJ0 A;  4CGN A;  3S6H A;  2GU2 A;  5J8F A;  1RO5 A;  3NE7 A;  3DR6 A;  3PB6 X;  2PRQ A;  2Q4Y A;  4OP4 A;  2GAN A;  2AE6 A;  3LD2 A;  2ZXV A;  1R3N A;  5DWM A;  4OC4 A;  5CBM A;  3NE8 A;  5HVH A;  2P6F A;  4H6U A;  4MFL A;  2OZH A;  1A2Z A;  4X2T A;  3D7F A;  3G8W A;  4LQ6 A;  3BI1 A;  2C6G A;  3NH4 A;  4KOY A;  2F5I A;  4CRY B;  2B3U A;  1TF9 A;  2AFO A;  3KHX A;  4AG7 A;  2PJ5 A;  2CY2 A;  3FXT A;  4JD6 A;  1N71 A;  2QJ8 A;  2WSA A;  4Z65 A;  5K8O A;  2Z0Z A;  4C2Y A;  1ON0 A;  3CXS A;  3JVN A;  4QUS A;  1NSL A;  1BAV A;  3B2Y A;  5LRK A;  4MBU A;  3IC1 A;  2V8G A;  4UIA A;  1CPX A;  2GRE A;  1JWQ A;  3KQX A;  2ABZ A;  3D7D A;  3T8W A;  3IO1 A;  1HDU A;  3IIB A;  1S3Z A;  3ISZ A;  1MJA A;  3EO4 A;  4MHP A;  1M44 A;  3B3S A;  3CT9 A;  4KOT A;  2IL4 A;  3D7G A;  5EMI A;  2EK8 A;  4NJR A;  3QB8 A;  1KUX A;  4R57 A;  1ELM P;  5EC4 A;  5JPH A;  1NMT A;  4C7H A;  4LX9 A;  1DTD A;  1Y9K A;  4P4E A;  1S5K A;  2Z10 A;  4M6I A;  3IJ3 A;  2ZW5 A;  4FD6 A;  3F0A A;  1TIQ A;  1YW6 A;  4MY0 A;  4R87 A;  4R8F A;  4UCP A;  4RS2 A;  2VXK A;  1TKJ A;  2REF A;  5FVJ A;  5HMN A;  5I4M A;  1KUY A;  4R3L A;  4DYO A;  2G3T A;  3FYN A;  1Z8T A;  3PRT A;  2AJ6 A;  3NA6 A;  2AFU A;  2VI7 A;  4GS4 A;  4NGM A;  1QSN A;  2XEI A;  4NGN A;  4ZX8 A;  3K9T A;  4CAF A;  3FIX A;  3GUX A;  3N7Z A;  4KLW A;  4PK3 A;  4YGO A;  4QBJ A;  5KTD A;  2PSW A;  3SJG A;  3PFO A;  4A33 A;  2PJ0 A;  3DSB A;  3KR4 A;  5LRG A;  5GCN A;  3VWE A;  1XOV A;  2C27 A;  2VZZ A;  4R76 A;  2HUZ A;  4FD7 A;  3GYA A;  1XFO A;  2WZN A;  3PGP A;  3BJ8 A;  4E0A A;  3T90 A;  5HH1 A;  3SJF A;  4BD9 A;  3IWE A;  4NFR A;  4J3G A;  4F0Y A;  2ZW7 A;  2OU2 A;  5F47 A;  2FS5 A;  1IU8 A;  1Q7L A;  2NYQ A;  4II9 A;  3RO0 A;  5CNP A;  4KUA A;  1YX0 A;  4KS9 A;  4B14 A;  3FED A;  1YLE A;  2YNC C;  4P4F A;  5E96 A;  3GIU A;  3PEI A;  4L89 A;  4MJ8 A;  3G3S A;  2PVV A;  1Z9U A;  4P6Y A;  4P44 A;  4KOX A;  2WPW A;  3GLJ A;  2B4B A;  4OC0 A;  3PBE A;  2FL4 A;  3CPX A;  4FAI A;  2CNS A;  4I49 A;  5JGF A;  2QYV A;  1L0C A;  4NGP A;  2FSR A;  4NGQ A;  2DF5 A;  3EFA A;  2VZY A;  3FF3 A;  1Z4R A;  2J8N A;  3SI1 A;  3TOB A;  2ZEO A;  4CYN A;  5F49 A;  4MFJ A;  2OZG A;  3B35 A;  4MHN A;  1P0H A;  4NCZ A;  4C68 A;  4OIW A;  5JH9 A;  1IOF A;  1BPM A;  4KZT A;  3S6G A;  2PE3 A;  2ARH A;  2PJ7 A;  1LAP A;  3JRU A;  3DLJ A;  3TOA A;  3H4Q A;  2ZED A;  4YU9 A;  3H8G A;  3KZW A;  3WC7 A;  4IF5 A;  5LYF A;  1Q2C A;  1Z2L A;  1NE9 A;  3FH4 A;  4XPD B;  4EFD A;  4E2A A;  2I3C A;  4MFZ A;  4UFX A;  1PCA A;  2REE A;  4MHY A;  4CGL A;  1X10 A;  1Y9W A;  4ZGY B;  4MFK A;  1H8L A;  2PJC A;  4PXD A;  5C82 A;  3S9N A;  3NH8 A;  3IFE A;  2ZEH A;  3IWG A;  4OID A;  5A27 A;  2PJ4 A;  3NFZ A;  1JQG A;  5H84 A;  3TT2 A;  2BCO A;  3KQZ A;  1ELL P;  3QNV A;  1YLO A;  4P4B A;  2PVW A;  5H86 A;  3SXO A;  4MRI A;  4CYQ A;  2H5M A;  3K2K A;  2ZPA A;  4CS0 B;  2NSM A;  1M4I A;  1QSO A;  2HC9 A;  3C26 A;  3IU2 A;  2IJZ A;  2JEW A;  2ZEF A;  1S7L A;  3CDX A;  5ISV A;  2ZEL A;  1Y0R A;  2VQY A;  1Z5R A;  2D4P A;  3CPA A;  3NH5 A;  4ZX9 A;  4KVM E;  5HVG A;  4B6Z A;  3IWW A;  4Y49 B;  2XEG A;  4UWI A;  5J1Q A;  1IGB A;  2V8V A;  4OAE A;  1QMU A;  1IY7 A;  2Z11 A;  4H2K A;  1WWZ A;  4MCP A;  2C6C A;  2OH1 A;  3KKW A;  4F8Z A;  2Y0M A;  1I1D A;  3VH9 A;  2PR8 A;  2F7V A;  1UWY A;  3EC4 A;  4CAE A;  5JM6 A;  3HUV A;  4CYP A;  5F46 A;  3PB7 X;  4BBH A;  3LOD A;  2HV2 A;  4ZBG A;  3E0K A;  4P45 A;  2JDD A;  1WK4 A;  3D67 A;  2F8H A;  2B3V A;  5CPA A;  1YQE A;  2FE7 A;  4LQG A;  2IMO A;  3RBU A;  4ONU A;  1KWM A;  2OB0 A;  2FIW A;  4AVA A;  2ZW4 A;  2P6E A;  1X12 A;  2V8D A;  2BL1 A;  2BSW A;  3JTK A;  4PSW A;  2VBQ A;  1BLL E;  3D2M A;  4WWV A;  4A31 A;  2QML A;  2B5G A;  2PJ9 A;  2RC4 A;  1XF8 A;  3D3S A;  4YRH A;  1TKH A;  5ELY A;  5K8M A;  1S7K A;  1YVK A;  2ZW6 A;  2DXQ A;  3V8I A;  3FBU A;  5IX3 A;  3CXP A;  2PJ1 A;  1Q2D A;  2P6G A;  3FEC A;  2CNT A;  4C2X A;  4KVX A;  4M85 A;  6CPA A;  1XIX A;  2O4H A;  3H5Z A;  5G21 A;  4K3N A;  4C2Z A;  4ZI6 A;  3PB8 X;  2HQY A;  2HB6 A;  1RTQ A;  2Q51 A;  1TF8 A;  4U5Y A;  2CIJ A;  2EUI A;  1XRY A;  2CF4 A;  3PFE A;  2WUU A;  4MMO A;  1BOB A;  2BUE A;  4UBR A;  3SXN A;  5C88 A;  3I9S A;  4KOR A;  3WC6 A;  4CAV A;  3KHZ A;  3QAH A;  4NGT A;  2ANP A;  4P10 A;  1LCP A;  4ZYQ A;  5BWA B; 
#chains in the Genus database with same CATH homology
 4C7I A;  4UCM A;  1V0C A;  4XNH C;  3W91 A;  4A30 A;  3F8K A;  1U6M A;  1IYL A;  1VHS A;  4HNY B;  2EVN A;  2I00 A;  5J8C A;  4OAD A;  2YND A;  3IU1 A;  1B87 A;  4A2Z A;  4BMH A;  4H6Z A;  4CGP A;  1FY7 A;  5I0C A;  2K5T A;  4PV6 A;  4KOW A;  5F48 A;  1YK3 A;  1IID A;  1OZP A;  4ORF A;  4JWP A;  2FIA A;  5IB0 A;  4NEX A;  4MFQ A;  4HKF A;  1KUV A;  3EXN A;  1QSR A;  2YGW A;  3B8G A;  4DNC A;  1PUA A;  4CYO A;  4UFW A;  4UFV A;  1S60 A;  2R8V A;  2PRB A;  3S6K A;  4XPL A;  2PR1 A;  1PU9 A;  4B12 A;  3I3G A;  3F5B A;  1YGH A;  3JUW A;  2GIV A;  2J8R A;  4FD5 A;  4UCN A;  3WR7 A;  1IIC A;  4NF1 A;  5IV0 A;  3OWC A;  1BO4 A;  2QEC A;  1MJ9 A;  5AGE A;  4H89 A;  4QVT A;  4KUB A;  1M4G A;  1YVO A;  2YNC A;  2R1I A;  1IYK A;  1XMT A;  2BEI A;  4UA3 A;  2B5G B;  1I12 A;  1Q2Y A;  4QC6 A;  3PZJ A;  3K9U A;  4B5O A;  2D4O A;  1S7N A;  4Q36 A;  1MK4 A;  2NMT A;  4FD4 A;  4RI1 A;  2ATR A;  4F6A A;  2P0W A;  4KLV A;  4B11 A;  3R96 A;  2Q0Y A;  3PP9 A;  3R9E A;  3FB3 A;  4B13 A;  2Z3P A;  2Q7B A;  2QIR A;  1Y7R A;  3EY5 A;  1XEB A;  4KSA A;  1CM0 A;  4Y49 C;  4IUS A;  1QST A;  3TO6 A;  5EBV A;  4JJX A;  2B4D A;  4PK2 A;  2JDC A;  1Z4E A;  3IGR A;  4CGM A;  4LUA A;  2R7H A;  3MGD A;  3VWD A;  2PQ8 A;  2GE3 A;  3TO7 A;  2Q4V A;  2KCW A;  2FXF A;  4KOU A;  4X5K A;  3TO9 A;  4AVC A;  3R95 A;  4B10 A;  1RXT A;  5AG4 A;  3BLN A;  3D8P A;  4YFJ A;  4MY3 A;  5AG6 A;  4MHD A;  1CJW A;  4CRZ B;  3GKR A;  4NXY A;  2WPX A;  3R1K A;  3TE4 A;  2Z3M A;  4E8O A;  2Z3N A;  2O28 A;  4B5P B;  2DPS A;  5AG5 A;  4Q38 A;  4XNH B;  1ZO0 A;  4HNW B;  4JXQ A;  1J4J A;  4A32 A;  4KSF A;  2JLM A;  2B58 A;  4KOS A;  3TTH A;  4U9Z A;  3RYO A;  2PC1 A;  1M1D A;  2Z3O A;  2VEZ A;  3S6F A;  1I21 A;  4KOV A;  4AVB A;  4MI4 A;  3DNS A;  3BJ7 A;  4HNX B;  3ZZI A;  4U9Y A;  3CXQ A;  3R9F A;  3P2H A;  3P2F A;  4CAX A;  2DPT A;  2J8M A;  2I79 A;  1SQH A;  1R57 A;  1GHE A;  3TCV A;  5G1Z A;  5AG7 A;  4UWJ A;  5JQ4 A;  2CXA A;  4A95 A;  2R98 A;  5G20 A;  3A9L A;  4AB7 A;  4AG9 A;  2Q44 A;  4B5P A;  1P4N A;  2FT0 A;  2FCK A;  4KVO E;  5KTC A;  1IB1 E;  2PDO A;  3SHP A;  1B6B A;  2A4N A;  3D2P A;  4F0X A;  2Q04 A;  4JXR A;  1VKC A;  4CAW A;  1YR0 A;  2B4D B;  2G3A A;  3TFY A;  1YRE A;  1LRZ A;  2Z3L A;  4M3S A;  3R9G A;  5KTA A;  4XPD C;  4OLL A;  5G22 A;  3DR8 A;  3FNC A;  2OZU A;  4R9M A;  3UY5 A;  1UFH A;  1QSM A;  4EVY A;  4MFP A;  2Z3K A;  4PSX A;  2YNE A;  2JEV A;  1KZF A;  4JLY A;  4CGO A;  2G0B A;  4R3K A;  1S7F A;  4NSQ A;  1M4D A;  4QB9 A;  4XPK A;  2CNM A;  1XE4 A;  3DDD A;  5A28 A;  3W6X A;  2X7B A;  3GY9 A;  5DWN A;  3FRM A;  4L8A A;  4K30 A;  1MJB A;  3T9Y A;  1K4J A;  3W6S A;  4CGN A;  3ZJ0 A;  3S6H A;  5J8F A;  1RO5 A;  3NE7 A;  3DR6 A;  2Q4Y A;  2GAN A;  2AE6 A;  3LD2 A;  2ZXV A;  5DWM A;  2P6F A;  4H6U A;  4MFL A;  2OZH A;  3G8W A;  4KOY A;  2F5I A;  4CRY B;  2B3U A;  4AG7 A;  2CY2 A;  3FXT A;  4JD6 A;  1N71 A;  2WSA A;  2Z0Z A;  4C2Y A;  1ON0 A;  3CXS A;  3JVN A;  4QUS A;  1NSL A;  4MBU A;  1S3Z A;  1MJA A;  3EO4 A;  1M44 A;  4KOT A;  2IL4 A;  3QB8 A;  1KUX A;  4R57 A;  5EC4 A;  5JPH A;  1NMT A;  4C7H A;  4LX9 A;  1Y9K A;  1S5K A;  2Z10 A;  4MY0 A;  2ZW5 A;  4FD6 A;  3F0A A;  1TIQ A;  4R87 A;  4UCP A;  4YGO A;  5FVJ A;  4RS2 A;  2VXK A;  5HMN A;  2REF A;  1KUY A;  4R3L A;  2G3T A;  3FYN A;  2AJ6 A;  4GS4 A;  2VI7 A;  1QSN A;  4CAF A;  3FIX A;  3N7Z A;  4KLW A;  4PK3 A;  4QBJ A;  5KTD A;  2PSW A;  4A33 A;  3DSB A;  5GCN A;  3VWE A;  2C27 A;  2VZZ A;  2HUZ A;  4FD7 A;  3GYA A;  3PGP A;  3BJ8 A;  4E0A A;  3T90 A;  5HH1 A;  3IWE A;  4J3G A;  4F0Y A;  2ZW7 A;  2OU2 A;  5F47 A;  2FS5 A;  4II9 A;  5CNP A;  4KUA A;  1YX0 A;  4KS9 A;  4B14 A;  1YLE A;  2YNC C;  5E96 A;  4L89 A;  4MJ8 A;  3G3S A;  1Z9U A;  4KOX A;  2WPW A;  2B4B A;  2FL4 A;  2CNS A;  4I49 A;  1L0C A;  2FSR A;  3EFA A;  2VZY A;  1Z4R A;  2J8N A;  3TOB A;  4CYN A;  5F49 A;  4MFJ A;  2OZG A;  4NCZ A;  4C68 A;  1P0H A;  4KZT A;  3S6G A;  2ARH A;  3TOA A;  3H4Q A;  4IF5 A;  1Q2C A;  1NE9 A;  4XPD B;  4E2A A;  4MFZ A;  4UFX A;  2REE A;  4CGL A;  1Y9W A;  4ZGY B;  4MFK A;  5C82 A;  3IWG A;  5A27 A;  5H84 A;  3TT2 A;  5H86 A;  3SXO A;  4CYQ A;  2H5M A;  2ZPA A;  4CS0 B;  1M4I A;  1QSO A;  3C26 A;  3IU2 A;  1S7L A;  5ISV A;  2VQY A;  2D4P A;  4KVM E;  4Y49 B;  4UWI A;  4OAE A;  2Z11 A;  1WWZ A;  2OH1 A;  3KKW A;  2Y0M A;  1I1D A;  2PR8 A;  3EC4 A;  4CAE A;  4CYP A;  5F46 A;  4BBH A;  3LOD A;  2HV2 A;  4ZBG A;  3E0K A;  2JDD A;  1WK4 A;  2B3V A;  2FE7 A;  4ONU A;  2OB0 A;  2FIW A;  4AVA A;  2ZW4 A;  2P6E A;  2BL1 A;  2BSW A;  3JTK A;  4PSW A;  2VBQ A;  3D2M A;  4A31 A;  2QML A;  2B5G A;  2RC4 A;  1XF8 A;  3D3S A;  4YRH A;  1S7K A;  1YVK A;  2ZW6 A;  2DXQ A;  3V8I A;  3FBU A;  5IX3 A;  3CXP A;  1Q2D A;  2P6G A;  4C2X A;  2CNT A;  4KVX A;  4M85 A;  1XIX A;  3H5Z A;  5G21 A;  4C2Z A;  2HQY A;  4U5Y A;  2EUI A;  2WUU A;  1BOB A;  2BUE A;  4UBR A;  3SXN A;  5C88 A;  3I9S A;  4KOR A;  4CAV A;  3QAH A;  5BWA B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...