2DXQA

Putative acetyltransferase from agrobacterium tumefaciens str. c58
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
147
structure length
147
Chain Sequence
DAISLRAAGPGDLPGLLELYQVLNPSDPELTTQEAGAVFAAMLAQPGLTIFVATENGKPVATATLLIVPNLTRAARPYAFIENVVTLEARRGRGYGRTVVRHAIETAFGANCYKVMLLTGRHDPAVHAFYESCGFVQNKTGFQIRQD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Acetyltransferase
publication title Putative acetyltransferase from Agrobacterium tumefaciens str. C58
rcsb
source organism Agrobacterium tumefaciens str.
molecule tags Transferase
total genus 33
structure length 147
sequence length 147
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-08-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 2dxqA00
3PP9A 1XMTA 4PK2A 3R1KA 1J4JA 2FIAA 4L89A 3D8PA 1M44A 2J8MA 1YK3A 4Y49B 3FNCA 2WPWA 3R9FA 3TTHA 4L8AA 5H86A 4X5KA 3SXOA 1FY7A 4OLLA 4ZBGA 4H6ZA 2KCWA 2B4DB 1RXTA 4Y49C 1BOBA 1TIQA 1QSOA 4MBUA 4KLWA 2OZGA 1S5KA 1CJWA 3CXSA 1QSRA 2JLMA 3K9UA 3SHPA 4JXQA 2WPXA 5EBVA 5C88A 3DR8A 5KTDA 5KTAA 2O28A 4IUSA 3G8WA 3OWCA 1B87A 2P6EA 2DXQA 2CNTA 3DSBA 2OZHA 3FXTA 3T90A 4JD6A 4UWJA 1MK4A 3S6GA 4GS4A 1I21A 4UBRA 4H6UA 4I49A 5I0CA 5C82A 4E0AA 2R98A 3S6FA 4MI4A 2EVNA 4PSXA 4AVBA 2FT0A 1IYKA 4NXYA 3R95A 2B5GB 1NSLA 1UFHA 1U6MA 2OB0A 2PR8A 3I9SA 2CNMA 3JVNA 4CRYB 1P4NA 4H89A 1M4IA 1NMTA 1Y9KA 3GYAA 4QB9A 4XNHB 1P0HA 5J8CA 4HNXB 1MJBA 3PZJA 3PGPA 4NCZA 2BSWA 4XPKA 5F46A 4KUBA 1XE4A 1SQHA 2FE7A 4XNHC 5IX3A 3RYOA 4FD7A 4KVME 1GHEA 1Z4EA 2PC1A 4HKFA 3KKWA 1XIXA 2R1IA 2Z11A 1XF8A 1RO5A 4JWPA 4KZTA 3F8KA 4KOUA 2VXKA 3IGRA 2QIRA 3N7ZA 4KOWA 1QSMA 1Q2DA 2ARHA 3ZZIA 4CAXA 4F0YA 3SXNA 3B8GA 2PRBA 5IB0A 1CM0A 1S3ZA 3CXQA 3VWEA 3D2MA 2C27A 2FL4A 3FB3A 5F49A 2R8VA 4AB7A 4DNCA 1L0CA 2OZUA 1MJAA 3GY9A 1BO4A 4AG7A 2ZPAA 4R3LA 2VEZA 1PU9A 2JDCA 3VWDA 4HNWB 1YREA 4FD6A 3P2FA 4MY0A 4ONUA 3R9GA 5HH1A 3FBUA 4M3SA 2FS5A 4J3GA 4NF1A 4B5PA 2PSWA 3FRMA 4OADA 4YGOA 4CAWA 2G3TA 2J8RA 2ZW6A 5H84A 3LD2A 3R9EA 3IWGA 2OU2A 4RS2A 4YRHA 1ON0A 2B4BA 1PUAA 5F47A 2HV2A 4NSQA 1YLEA 4LX9A 1KUYA 3W91A 3W6SA 3EXNA 4XPDB 3W6XA 4IF5A 2BEIA 2ATRA 2B3UA 4KVOE 2BUEA 2JDDA 5DWNA 4K30A 2BL1A 4XPDC 4QVTA 3V8IA 2ZW5A 3TO9A 2HQYA 3LODA 5ISVA 4CRZB 1S7NA 2Q04A 4UWIA 2OH1A 4II9A 3F0AA 2VZZA 1M1DA 2Q4VA 3TO7A 3P2HA 4LUAA 1WWZA 4AVAA 3DDDA 1Y7RA 4MJ8A 1MJ9A 2Z0ZA 3H4QA 2REFA 2Q0YA 3TE4A 3I3GA 4PV6A 4R57A 4BMHA 1NE9A 4E8OA 4KLVA 5E96A 3C26A 1M4DA 2AE6A 2D4PA 4PK3A 3GKRA 4M85A 2PR1A 2VI7A 5HMNA 3MGDA 2I79A 4MHDA 2FCKA 4B5OA 5F48A 3QAHA 1VKCA 4KOSA 2K5TA 3EO4A 4JLYA 4ORFA 4U9YA 2X7BA 1S7LA 3BJ7A 3DNSA 2VZYA 4YFJA 4U9ZA 3FIXA 1YGHA 4PSWA 1Q2CA 3WR7A 4AG9A 5FVJA 2ZW4A 3QB8A 4KVXA 3S6HA 3TT2A 1IICA 1YX0A 2P0WA 2QECA 2FIWA 2ZW7A 2B3VA 3NE7A 1LRZA 4FD4A 2FSRA 2PDOA 4R3KA 3TO6A 2J8NA 3UY5A 2G0BA 2IL4A 3TFYA 3BLNA 5CNPA 5JPHA 5JQ4A 2PQ8A 1QSNA 3ZJ0A 2RC4A 4E2AA 2Y0MA 2REEA 1R57A 2A4NA 4XPLA 3JUWA 3CXPA 3TOAA 1B6BA 1V0CA 2B58A 3D2PA 4B5PB 1I12A 1I1DA 1KZFA 2QMLA 2P6GA 3E0KA 4FD5A 1YR0A 3G3SA 1IYLA 1KUVA 4R9MA 5KTCA 1M4GA 2Q7BA 4KUAA 2R7HA 2VQYA 4UA3A 5J8FA 3BJ8A 1IB1E 2ZXVA 2B5GA 5EC4A 3R96A 2FXFA 4R87A 3F5BA 1Z4RA 1N71A 2Z10A 4QC6A 2H5MA 1K4JA 1IIDA 2AJ6A 2Q4YA 1WK4A 1OZPA 4HNYB 1KUXA 3S6KA 5DWMA 1YVKA 4NEXA 3TCVA 1Z9UA 2CNSA 4CS0B 2EUIA 4RI1A 4JJXA 1S60A 1Q2YA 1YVOA 2I00A 1S7KA 5GCNA 4AVCA 2GANA 2CY2A 1S7FA 2Q44A 4QUSA 4F6AA 3D3SA 5IV0A 3DR6A 2D4OA 4U5YA 1Y9WA 2JEVA 2GIVA 4JXRA 2NMTA 4KOXA 4KORA 1QSTA 4KOVA 2GE3A 4CAVA 2VBQA 3EY5A 3EFAA 2G3AA 4QBJA 3TOBA 4MY3A 2P6FA 4KOTA 3FYNA 2B4DA 3T9YA 1VHSA 2HUZA 2F5IA 3EC4A 1XEBA 4KOYA 4OAEA 4EVYA
chains in the Genus database with same CATH superfamily
2DPSA 2PJ9A 3PP9A 1XMTA 4PK2A 4HPSA 2GLFA 1Z2LA 1J4JA 2FIAA 3R1KA 3D8PA 4L89A 4C2XA 2IMOA 1ZG7A 4PXDA 3KZWA 4Z65A 1M44A 3B3CA 4MCRA 2J8MA 4UCPA 1YK3A 4Y49B 3FNCA 1TKFA 2WPWA 3R9FA 3PEIA 3CDXA 3TTHA 4L8AA 5H86A 4X5KA 3SXOA 1FNOA 1FY7A 1ELMP 4IK2A 4OLLA 4Q38A 4ZBGA 5CPAA 4H6ZA 4FAIA 4M6HA 2KCWA 1LAMA 3IU2A 2B4DB 1RXTA 3NA6A 4OC3A 2YGWA 2POKA 4Y49C 1BOBA 3GB0A 3IC1A 4C2ZA 3B3VA 5HVGA 4P4IA 4KSIA 1TIQA 4CGMA 1QSOA 1ZG8A 2ZEDA 3KQZA 4KLWA 4MBUA 4NGPA 7CPAA 2OZGA 1S5KA 1CJWA 3CXSA 1QSRA 2JLMA 3K2KA 3K9UA 4JXQA 2WPXA 1Z8WA 5EBVA 3SHPA 4BBHA 5C88A 3DR8A 5AG7A 5KTDA 3CPXA 4EFDA 5KTAA 2JBJA 4B14A 3RAMA 2O28A 4IUSA 3G8WA 5LRJA 4OC1A 3OWCA 2ZOFA 1B87A 2P6EA 4R8FA 2JBKA 1ARLA 1TF8A 2DXQA 3SJGA 2CNTA 4DJLA 2DEAA 3DSBA 4UEZA 2OZHA 3D7HA 2QYVA 3VATA 4GM5A 3FXTA 3T90A 1LAPA 4JD6A 4UIAA 4UWJA 1MK4A 3WC5A 3S6GA 4GS4A 4KSAA 1I21A 3H8EA 4UBRA 3LMSA 4H6UA 4I49A 4P4BA 2ZEEA 1BPNA 2GREA 1PCAA 5I0CA 5AG4A 5C82A 2DF5A 2R98A 2Z3PA 3S6FA 4E0AA 2QVPA 4X2TA 4FUUA 4MI4A 3PB6X 1OBRA 5ELYA 2ABZA 2EVNA 4PSXA 4F8ZA 4CYNA 1Y0RA 4AVBA 4KS9A 1CG2A 2FT0A 1IYKA 4NXYA 4G1PA 4OP4A 2ZEFA 4TNUA 3SI1A 3R95A 2B5GB 1NSLA 1UFHA 2Z3KA 1U6MA 2OB0A 2PR8A 2Z3OA 3I9SA 1Z8XA 5G21A 5HVFA 2CTBA 2CNMA 3JVNA 4CRYB 5K8NA 4CAFA 1H8LA 2PVWA 1P4NA 2AFXA 3SI0A 3PBBA 2EO8A 2CF4A 2PJ2A 4F9VA 2AFMA 4ZX8A 1M4IA 1NMTA 3GYAA 1KWMA 1Y9KA 3H5ZA 3PRTA 4H89A 4QB9A 4RUHA 3KR4A 4XNHB 3WC6A 3SJEA 1P0HA 4OKOA 4M6IA 4F9UA 3T8WA 4HNXB 1MJBA 3PZJA 2ZEPA 2ZEOA 2ZENA 3PGPA 4NCZA 3LWUA 5K8OA 2BSWA 4XPKA 5F46A 5JGFA 4KUBA 1XE4A 1SQHA 2PJ4A 3V7ZA 2FE7A 4XNHC 5IX3A 3RYOA 4FBEA 5K8PA 2HB6A 4FD7A 2RB7A 4KVME 4RN7A 8CPAA 1GHEA 1Z4EA 4OIWA 6CPAA 3SJFA 2C1CA 2PC1A 1A2ZA 4HKFA 3KKWA 5AGEA 1XIXA 2R1IA 2Z11A 3KI9A 1XF8A 3VARA 4GXHA 1F2OA 1RO5A 4JWPA 2CIJA 4KZTA 3F8KA 4KOUA 2G9DA 1IOFA 2VXKA 1HDUA 3IGRA 3WC7A 3WT4A 2QIRA 3N7ZA 4KOWA 1QSMA 1Q2DA 2ARHA 4P4DA 3NH5A 5D8NA 4OC2A 3ZZIA 3IEHA 2NSMA 4CAXA 4F0YA 3SXNA 3B8GA 2PRBA 5IB0A 1CM0A 1S3ZA 3CXQA 3VWEA 3D2MA 2Q7SA 3TC8A 2C27A 4A30A 2FL4A 2EBJA 1CP7A 3FB3A 5F49A 4BD9A 1TKJA 2R8VA 2EK8A 4AB7A 4DNCA 1L0CA 4UEEA 3KQXA 4P10A 4Q36A 2OZUA 1MJAA 2PJ6A 3GY9A 1BO4A 4AG7A 2ZEGA 3N5FA 4PPZA 2PJCA 2CTCA 2ZPAA 4R3LA 2VEZA 1PU9A 2JDCA 3VWDA 3NFZA 4HNWB 2V77A 4H2KA 1YREA 4FD6A 4YU9A 3IIBA 3P2FA 4MFQA 4MY0A 4PXBA 5THWA 3KL9A 1Z5RA 2C6CA 2ODFA 4ONUA 1CX8A 3R9GA 4C7IA 4MFLA 4OC4A 5HH1A 3FBUA 1XBUA 4M3SA 4B12A 5LYFA 4ZI6A 2FS5A 4J3GA 4NF1A 4B5PA 4R6TA 5BWAB 1XOVA 2PSWA 3FRMA 4OADA 1IU8A 4WJBA 1XJOA 4YGOA 4CAWA 4C68A 2G3TA 2J8RA 2ZW6A 3GLJA 1YW4A 3IJ3A 5H84A 3LD2A 3R9EA 3IWGA 4NGSA 2OU2A 4RS2A 4YRHA 1BAVA 2NYQA 1ON0A 4CYOA 2CXAA 2B4BA 4NGRA 2ZOGA 3BI1A 1PUAA 2BOAA 4PQAA 5F47A 1ZLIA 2HV2A 4NSQA 1YLEA 4P4FA 5AG5A 4LX9A 3B7IA 4CYQA 3FX6A 1KUYA 2V8HA 3FH4A 3W91A 3BXMA 3W6SA 3IFEA 3EXNA 4XPDB 2C6PA 2PIZA 3K9TA 3D7DA 4UF4A 3W6XA 4IF5A 2BEIA 2YNCA 2ATRA 1CBXA 2B3UA 4TWEA 5J8CA 4KVOE 2AFZA 2GLJA 2BUEA 2JDDA 5DWNA 4K30A 2BL1A 4XPDC 1LFWA 2PRQA 3KGQA 3PB7X 1DTDA 4QVTA 3D7FA 3V8IA 2V8DA 4DUKA 2ZW5A 4JZ0A 3TO9A 1X10A 3D7GA 2HQYA 3H8FA 3LODA 2Q51A 4FWUA 5ISVA 4BINA 2J9AA 4CRZB 3SI2A 1LOKA 1S7NA 2Q04A 4UEFA 4UWIA 2OH1A 5JM6A 5J1QA 3F0AA 4II9A 2PJ8A 2VZZA 4NJRA 1M1DA 2F8HA 4MHYA 2Q4VA 1ZLHA 1IGBA 2AFUA 3TO7A 3P2HA 4UIBA 4P4EA 4ZY0A 4LUAA 3B35A 3RZAA 4NFRA 4EMEA 2Z3NA 2ZELA 1WWZA 3I1UA 4A39A 2JEWA 2YNDA 4AVAA 2EK9A 3NH4A 1Y7RA 3DDDA 3NH8A 3VH9A 4MJ8A 1MJ9A 4UFVA 2Z0ZA 3H4QA 2REFA 2Q0YA 3TE4A 4A95A 3I3GA 1EE3P 3B2YA 3V38A 4PV6A 4R57A 4MCSA 1HEEA 4O23A 4BMHA 1NE9A 5LYLA 4E8OA 3HUVA 4AXVA 2QJ8A 2WYRA 4CGNA 2VL1A 4KLVA 2PJ7A 5E96A 3B3SA 1CP6A 3C26A 1QMUA 3QNVA 4WWVA 1M4DA 2V8VA 1ELLP 5A27A 2AE6A 2D4PA 3CT9A 3S9MA 4PK3A 2BCOA 3GKRA 4MCPA 3FVLA 1CPSA 4M85A 2WSAA 2PR1A 3RBUA 2VI7A 5HMNA 4ZY1A 2Z3LA 2PJ5A 3MGDA 2I79A 3KR5A 1ARMA 4MMOA 5LRKA 4MHDA 3FEEA 2FCKA 4B5OA 5CBMA 5F48A 3QAHA 5F09A 1VKCA 3CPAA 4KOSA 2K5TA 3EO4A 4JLYA 1IOIA 2Q43A 1LANA 4CGOA 1JQGA 4ORFA 4UFWA 4C2YA 4PXCA 4U9YA 2X7BA 4B6ZA 1S7LA 4ZYQA 3BJ7A 4MFPA 4CGPA 3DNSA 5LYDA 4A33A 1JWQA 4NGNA 4ZY2A 3IWEA 2VZYA 3RNZA 4MFKA 4YFJA 2Q4ZA 5DS0A 4U9ZA 5D29A 3FIXA 3KHZA 2ZEMA 1YGHA 4PSWA 4B11A 1Q2CA 3WR7A 4AG9A 5FVJA 3A9LA 1YMEA 2ZW4A 3QB8A 4KVXA 3DGVA 4IHMA 3S6HA 3TT2A 3FEDA 1IICA 4OMEA 4NJQA 5IB9A 2ZEHA 4UCNA 1Y0YA 1YX0A 2P0WA 2QECA 4K3NA 2FIWA 2ZW7A 2OOTA 2B3VA 4C7HA 1XMBA 3NE7A 3KHXA 1LRZA 1AYEA 3JTKA 4F0XA 4YWYA 4FD4A 1YLOA 2FSRA 2ANPA 5JH9A 2PDOA 4CPAA 4R3KA 5LRGA 3TO6A 4OIDA 4MXUA 1NSAA 4MHNA 2J8NA 4IAVA 3UY5A 2PIYA 1GYTA 2WUUA 2WZNA 3DLJA 2O4HA 2G0BA 2IL4A 3TFYA 1VHEA 3BLNA 5CNPA 5JPHA 4OC5A 4B13A 5JQ4A 2PQ8A 5LYIA 1QSNA 3ZJ0A 2RC4A 1PYTB 5HVHA 1F2PA 1AMPA 2XEGA 4E2AA 2Y0MA 2REEA 1R57A 2YNEA 2A4NA 4XPLA 3JUWA 2XEJA 3CXPA 3TOAA 2IQ6A 1B6BA 2XEFA 5AG6A 1R3NA 1V0CA 2GU2A 1RTQA 2B58A 3D2PA 5IV0A 1TF9A 1Q7LA 2PJ3A 3HLPA 3ISXA 3RO0A 4B5PB 2Z3MA 3IO1A 1I12A 1I1DA 1KZFA 4A31A 2QMLA 4EWTA 2P6GA 3E0KA 4FD5A 2FVGA 1QQ9A 1Z8TA 1YR0A 2PJ0A 3G3SA 1IYLA 4CAEA 1KUVA 3MRUA 2OR4A 4R9MA 5KTCA 3FF3A 3PFEA 1M4GA 2Q7BA 5HXDA 4KUAA 2R7HA 4MRIA 4JYWA 2AFOA 3WABA 2VQYA 4PXEA 2I3CA 3BJ8A 4UA3A 3SJXA 5J8FA 1IB1E 5G1ZA 2HC9A 3FECA 1TKHA 2ZXVA 4R76A 2B5GA 4LQGA 1ZO0A 4A32A 3BHXA 5EC4A 2PVVA 3R96A 4ZGYB 2FXFA 4P4JA 4R87A 2IJZA 1VIXA 4P44A 3F5BA 2C6GA 2PJAA 4P6YA 4KSFA 3FJUA 1Z4RA 3IU1A 1N71A 2Z10A 4QC6A 3JRUA 5A28A 2H5MA 1K4JA 2EWBA 1BPMA 1Z8LA 2GFQA 1FT7A 1IIDA 3FMCA 2AJ6A 2Q4YA 4CYPA 1WK4A 1OZPA 5G22A 5I4MA 1VHOA 2YNCC 3PB8X 1CPXA 4HNYB 1KUXA 1XRYA 3S6KA 2PJBA 1M4LA 2V8GA 4M6GA 3GUXA 3D68A 4MFZA 5DWMA 1YVKA 3LACA 3H8GA 4NEXA 3S9NA 3TCVA 4CGLA 1ZG9A 1Z9UA 2CNSA 1DE4C 1X12A 4CS0B 4X3RA 1HDQA 2EUIA 4RI1A 4JJXA 3MN8A 1S60A 1Q2YA 1YVOA 1YW6A 4A37A 4OC0A 2I00A 3KASA 2AFSA 5G20A 3D66A 1Y7EA 1S7KA 1UWYA 2RFHA 4MCQA 3B3WA 4X8IA 5GCNA 2PCUA 1YQEA 4AVCA 1BLLE 2GANA 2CY2A 1S7FA 2F7VA 4P45A 2Q44A 4NGMA 4QUSA 1AUGA 4F6AA 2BO9A 3D3SA 3D4UA 3D67A 3DR6A 3TX8A 4R7MA 3CZXA 3PB4X 2D4OA 4MFJA 1Y9WA 4U5YA 4A2ZA 5K8MA 4Q7AA 2JEVA 3BI0A 4NGQA 4UFXA 2GIVA 3S9LA 3PFOA 4JXRA 2NMTA 3QAYA 4KOXA 4KORA 1VGYA 3NE8A 2O53A 1QSTA 4ZX9A 4KOVA 2GE3A 4CAVA 2PJ1A 2VBQA 4UCMA 4DYOA 3EY5A 1YSJA 3PB9X 1XFOA 4A94A 3B3TA 4LQ6A 5EMIA 4NGTA 2XEIA 3EFAA 3PBEA 2PE3A 4A38A 3IWWA 1R43A 2G3AA 4QBJA 1LCPA 3TOBA 4MY3A 3ISZA 4W9YA 1F57A 1IY7A 2P6FA 4ONWA 4KOTA 3FYNA 2B4DA 3T9YA 3L2NA 4MHZA 1VHSA 2HUZA 4MHPA 2F5IA 3EC4A 1XEBA 2AFWA 1TXRA 4KOYA 4OAEA 3GIUA 4EVYA 2DPTA 4B10A
chains in the Genus database with same CATH topology
2DPSA 3PP9A 1XMTA 4PK2A 4C2XA 3R1KA 1J4JA 2FIAA 4L89A 3D8PA 1M44A 4UCPA 2J8MA 1YK3A 4Y49B 3FNCA 2WPWA 3R9FA 3TTHA 4L8AA 5H86A 4X5KA 3SXOA 1FY7A 4OLLA 4Q38A 4ZBGA 4H6ZA 2KCWA 3IU2A 2B4DB 1RXTA 2YGWA 4Y49C 1BOBA 4C2ZA 1TIQA 4CGMA 1QSOA 4MBUA 4KLWA 2OZGA 1S5KA 1CJWA 3CXSA 1QSRA 2JLMA 3K9UA 3SHPA 4JXQA 2WPXA 5EBVA 4BBHA 5C88A 3DR8A 5AG7A 5KTDA 5KTAA 4B14A 2O28A 4IUSA 3G8WA 3OWCA 1B87A 2P6EA 2DXQA 2CNTA 3DSBA 2OZHA 3FXTA 3T90A 4JD6A 4UWJA 1MK4A 3S6GA 4GS4A 4KSAA 1I21A 4UBRA 4H6UA 4I49A 5I0CA 5AG4A 5C82A 4E0AA 2R98A 2Z3PA 3S6FA 4MI4A 2EVNA 4PSXA 4CYNA 4AVBA 4KS9A 2FT0A 1IYKA 4NXYA 3R95A 2B5GB 1NSLA 1UFHA 2Z3KA 1U6MA 2OB0A 2PR8A 2Z3OA 3I9SA 5G21A 2CNMA 3JVNA 4CRYB 4CAFA 1P4NA 4H89A 1M4IA 1NMTA 1Y9KA 3GYAA 3H5ZA 4QB9A 4XNHB 1P0HA 5J8CA 4HNXB 1MJBA 3PZJA 3PGPA 4NCZA 2BSWA 4XPKA 5F46A 4KUBA 1XE4A 1SQHA 2FE7A 4XNHC 5IX3A 3RYOA 4FD7A 4KVME 1GHEA 1Z4EA 2PC1A 4HKFA 3KKWA 5AGEA 1XIXA 2R1IA 2Z11A 1XF8A 1RO5A 4JWPA 4KZTA 3F8KA 4KOUA 2VXKA 3IGRA 2QIRA 3N7ZA 4KOWA 1QSMA 1Q2DA 2ARHA 3ZZIA 4CAXA 4F0YA 3SXNA 3B8GA 2PRBA 5IB0A 1CM0A 1S3ZA 3CXQA 3VWEA 3D2MA 4A30A 2C27A 2FL4A 3FB3A 5F49A 2R8VA 4AB7A 4DNCA 1L0CA 4Q36A 2OZUA 1MJAA 3GY9A 1BO4A 4AG7A 2ZPAA 4R3LA 2VEZA 1PU9A 2JDCA 3VWDA 4HNWB 1YREA 4FD6A 3P2FA 4MFQA 4MY0A 4ONUA 3R9GA 4C7IA 4MFLA 5HH1A 3FBUA 4M3SA 4B12A 2FS5A 4J3GA 4NF1A 4B5PA 5BWAB 2PSWA 3FRMA 4OADA 4YGOA 4CAWA 4C68A 2G3TA 2J8RA 2ZW6A 5H84A 3LD2A 3R9EA 3IWGA 2OU2A 4RS2A 4YRHA 1ON0A 4CYOA 2CXAA 2B4BA 1PUAA 5F47A 2HV2A 4NSQA 1YLEA 5AG5A 4LX9A 4CYQA 1KUYA 3W91A 3W6SA 3EXNA 4XPDB 3W6XA 4IF5A 2BEIA 2YNCA 2ATRA 2B3UA 4KVOE 2BUEA 2JDDA 5DWNA 4K30A 2BL1A 4XPDC 4QVTA 3V8IA 2ZW5A 3TO9A 2HQYA 3LODA 5ISVA 4CRZB 1S7NA 2Q04A 4UWIA 2OH1A 4II9A 3F0AA 2VZZA 1M1DA 2Q4VA 3TO7A 3P2HA 4LUAA 2Z3NA 1WWZA 2YNDA 4AVAA 3DDDA 1Y7RA 4MJ8A 1MJ9A 4UFVA 2Z0ZA 3H4QA 2REFA 2Q0YA 3TE4A 4A95A 3I3GA 4PV6A 4R57A 4BMHA 1NE9A 4E8OA 4CGNA 4KLVA 5E96A 3C26A 1M4DA 5A27A 2AE6A 2D4PA 4PK3A 3GKRA 4M85A 2WSAA 2PR1A 2VI7A 5HMNA 2Z3LA 3MGDA 2I79A 4MHDA 2FCKA 4B5OA 5F48A 3QAHA 1VKCA 4KOSA 2K5TA 3EO4A 4JLYA 4CGOA 4ORFA 4UFWA 4C2YA 4U9YA 2X7BA 1S7LA 3BJ7A 4MFPA 4CGPA 3DNSA 4A33A 3IWEA 2VZYA 4MFKA 4YFJA 4U9ZA 3FIXA 1YGHA 4PSWA 4B11A 1Q2CA 3WR7A 4AG9A 5FVJA 3A9LA 2ZW4A 3QB8A 4KVXA 3S6HA 3TT2A 1IICA 4UCNA 1YX0A 2P0WA 2QECA 2FIWA 2ZW7A 2B3VA 4C7HA 3NE7A 1LRZA 3JTKA 4F0XA 4FD4A 2FSRA 2PDOA 4R3KA 3TO6A 2J8NA 3UY5A 2WUUA 2G0BA 2IL4A 3TFYA 3BLNA 5CNPA 5JPHA 4B13A 5JQ4A 2PQ8A 1QSNA 3ZJ0A 2RC4A 4E2AA 2Y0MA 2REEA 1R57A 2YNEA 2A4NA 4XPLA 3JUWA 3CXPA 3TOAA 1B6BA 5AG6A 1V0CA 2B58A 3D2PA 4B5PB 2Z3MA 4A31A 1I12A 1I1DA 1KZFA 2QMLA 2P6GA 3E0KA 4FD5A 1YR0A 3G3SA 1IYLA 4CAEA 1KUVA 4R9MA 5KTCA 1M4GA 2Q7BA 4KUAA 2R7HA 2VQYA 4UA3A 5J8FA 3BJ8A 1IB1E 5G1ZA 2ZXVA 2B5GA 1ZO0A 4A32A 5EC4A 3R96A 4ZGYB 2FXFA 4R87A 3F5BA 4KSFA 1Z4RA 3IU1A 1N71A 2Z10A 4QC6A 5A28A 2H5MA 1K4JA 1IIDA 2AJ6A 2Q4YA 4CYPA 1WK4A 1OZPA 5G22A 2YNCC 4HNYB 1KUXA 3S6KA 4MFZA 5DWMA 1YVKA 4NEXA 3TCVA 4CGLA 1Z9UA 2CNSA 4CS0B 2EUIA 4RI1A 4JJXA 1S60A 1Q2YA 1YVOA 2I00A 5G20A 1S7KA 5GCNA 4AVCA 2GANA 2CY2A 1S7FA 2Q44A 4QUSA 4F6AA 3D3SA 5IV0A 3DR6A 4A2ZA 2D4OA 4MFJA 1Y9WA 4U5YA 2JEVA 4UFXA 2GIVA 4JXRA 2NMTA 4KOXA 4KORA 1QSTA 4KOVA 2GE3A 4CAVA 2VBQA 4UCMA 3EY5A 3EFAA 2G3AA 4QBJA 3TOBA 4MY3A 2P6FA 4KOTA 3FYNA 2B4DA 3T9YA 1VHSA 2HUZA 3EC4A 2F5IA 1XEBA 4KOYA 4OAEA 4EVYA 2DPTA 4B10A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PP9 A;  1XMT A;  4PK2 A;  3R1K A;  1J4J A;  2FIA A;  4L89 A;  3D8P A;  1M44 A;  2J8M A;  1YK3 A;  4Y49 B;  3FNC A;  2WPW A;  3R9F A;  3TTH A;  4L8A A;  5H86 A;  4X5K A;  3SXO A;  1FY7 A;  4OLL A;  4ZBG A;  4H6Z A;  2KCW A;  2B4D B;  1RXT A;  4Y49 C;  1BOB A;  1TIQ A;  1QSO A;  4MBU A;  4KLW A;  2OZG A;  1S5K A;  1CJW A;  3CXS A;  1QSR A;  2JLM A;  3K9U A;  3SHP A;  4JXQ A;  2WPX A;  5EBV A;  5C88 A;  3DR8 A;  5KTD A;  5KTA A;  2O28 A;  4IUS A;  3G8W A;  3OWC A;  1B87 A;  2P6E A;  2DXQ A;  2CNT A;  3DSB A;  2OZH A;  3FXT A;  3T90 A;  4JD6 A;  4UWJ A;  1MK4 A;  3S6G A;  4GS4 A;  1I21 A;  4UBR A;  4H6U A;  4I49 A;  5I0C A;  5C82 A;  4E0A A;  2R98 A;  3S6F A;  4MI4 A;  2EVN A;  4PSX A;  4AVB A;  2FT0 A;  1IYK A;  4NXY A;  3R95 A;  2B5G B;  1NSL A;  1UFH A;  1U6M A;  2OB0 A;  2PR8 A;  3I9S A;  2CNM A;  3JVN A;  4CRY B;  1P4N A;  4H89 A;  1M4I A;  1NMT A;  1Y9K A;  3GYA A;  4QB9 A;  4XNH B;  1P0H A;  5J8C A;  4HNX B;  1MJB A;  3PZJ A;  3PGP A;  4NCZ A;  2BSW A;  4XPK A;  5F46 A;  4KUB A;  1XE4 A;  1SQH A;  2FE7 A;  4XNH C;  5IX3 A;  3RYO A;  4FD7 A;  4KVM E;  1GHE A;  1Z4E A;  2PC1 A;  4HKF A;  3KKW A;  1XIX A;  2R1I A;  2Z11 A;  1XF8 A;  1RO5 A;  4JWP A;  4KZT A;  3F8K A;  4KOU A;  2VXK A;  3IGR A;  2QIR A;  3N7Z A;  4KOW A;  1QSM A;  1Q2D A;  2ARH A;  3ZZI A;  4CAX A;  4F0Y A;  3SXN A;  3B8G A;  2PRB A;  5IB0 A;  1CM0 A;  1S3Z A;  3CXQ A;  3VWE A;  3D2M A;  2C27 A;  2FL4 A;  3FB3 A;  5F49 A;  2R8V A;  4AB7 A;  4DNC A;  1L0C A;  2OZU A;  1MJA A;  3GY9 A;  1BO4 A;  4AG7 A;  2ZPA A;  4R3L A;  2VEZ A;  1PU9 A;  2JDC A;  3VWD A;  4HNW B;  1YRE A;  4FD6 A;  3P2F A;  4MY0 A;  4ONU A;  3R9G A;  5HH1 A;  3FBU A;  4M3S A;  2FS5 A;  4J3G A;  4NF1 A;  4B5P A;  2PSW A;  3FRM A;  4OAD A;  4YGO A;  4CAW A;  2G3T A;  2J8R A;  2ZW6 A;  5H84 A;  3LD2 A;  3R9E A;  3IWG A;  2OU2 A;  4RS2 A;  4YRH A;  1ON0 A;  2B4B A;  1PUA A;  5F47 A;  2HV2 A;  4NSQ A;  1YLE A;  4LX9 A;  1KUY A;  3W91 A;  3W6S A;  3EXN A;  4XPD B;  3W6X A;  4IF5 A;  2BEI A;  2ATR A;  2B3U A;  4KVO E;  2BUE A;  2JDD A;  5DWN A;  4K30 A;  2BL1 A;  4XPD C;  4QVT A;  3V8I A;  2ZW5 A;  3TO9 A;  2HQY A;  3LOD A;  5ISV A;  4CRZ B;  1S7N A;  2Q04 A;  4UWI A;  2OH1 A;  4II9 A;  3F0A A;  2VZZ A;  1M1D A;  2Q4V A;  3TO7 A;  3P2H A;  4LUA A;  1WWZ A;  4AVA A;  3DDD A;  1Y7R A;  4MJ8 A;  1MJ9 A;  2Z0Z A;  3H4Q A;  2REF A;  2Q0Y A;  3TE4 A;  3I3G A;  4PV6 A;  4R57 A;  4BMH A;  1NE9 A;  4E8O A;  4KLV A;  5E96 A;  3C26 A;  1M4D A;  2AE6 A;  2D4P A;  4PK3 A;  3GKR A;  4M85 A;  2PR1 A;  2VI7 A;  5HMN A;  3MGD A;  2I79 A;  4MHD A;  2FCK A;  4B5O A;  5F48 A;  3QAH A;  1VKC A;  4KOS A;  2K5T A;  3EO4 A;  4JLY A;  4ORF A;  4U9Y A;  2X7B A;  1S7L A;  3BJ7 A;  3DNS A;  2VZY A;  4YFJ A;  4U9Z A;  3FIX A;  1YGH A;  4PSW A;  1Q2C A;  3WR7 A;  4AG9 A;  5FVJ A;  2ZW4 A;  3QB8 A;  4KVX A;  3S6H A;  3TT2 A;  1IIC A;  1YX0 A;  2P0W A;  2QEC A;  2FIW A;  2ZW7 A;  2B3V A;  3NE7 A;  1LRZ A;  4FD4 A;  2FSR A;  2PDO A;  4R3K A;  3TO6 A;  2J8N A;  3UY5 A;  2G0B A;  2IL4 A;  3TFY A;  3BLN A;  5CNP A;  5JPH A;  5JQ4 A;  2PQ8 A;  1QSN A;  3ZJ0 A;  2RC4 A;  4E2A A;  2Y0M A;  2REE A;  1R57 A;  2A4N A;  4XPL A;  3JUW A;  3CXP A;  3TOA A;  1B6B A;  1V0C A;  2B58 A;  3D2P A;  4B5P B;  1I12 A;  1I1D A;  1KZF A;  2QML A;  2P6G A;  3E0K A;  4FD5 A;  1YR0 A;  3G3S A;  1IYL A;  1KUV A;  4R9M A;  5KTC A;  1M4G A;  2Q7B A;  4KUA A;  2R7H A;  2VQY A;  4UA3 A;  5J8F A;  3BJ8 A;  1IB1 E;  2ZXV A;  2B5G A;  5EC4 A;  3R96 A;  2FXF A;  4R87 A;  3F5B A;  1Z4R A;  1N71 A;  2Z10 A;  4QC6 A;  2H5M A;  1K4J A;  1IID A;  2AJ6 A;  2Q4Y A;  1WK4 A;  1OZP A;  4HNY B;  1KUX A;  3S6K A;  5DWM A;  1YVK A;  4NEX A;  3TCV A;  1Z9U A;  2CNS A;  4CS0 B;  2EUI A;  4RI1 A;  4JJX A;  1S60 A;  1Q2Y A;  1YVO A;  2I00 A;  1S7K A;  5GCN A;  4AVC A;  2GAN A;  2CY2 A;  1S7F A;  2Q44 A;  4QUS A;  4F6A A;  3D3S A;  5IV0 A;  3DR6 A;  2D4O A;  4U5Y A;  1Y9W A;  2JEV A;  2GIV A;  4JXR A;  2NMT A;  4KOX A;  4KOR A;  1QST A;  4KOV A;  2GE3 A;  4CAV A;  2VBQ A;  3EY5 A;  3EFA A;  2G3A A;  4QBJ A;  3TOB A;  4MY3 A;  2P6F A;  4KOT A;  3FYN A;  2B4D A;  3T9Y A;  1VHS A;  2HUZ A;  2F5I A;  3EC4 A;  1XEB A;  4KOY A;  4OAE A;  4EVY A; 
#chains in the Genus database with same CATH topology
 2DPS A;  2PJ9 A;  3PP9 A;  1XMT A;  4PK2 A;  4HPS A;  2GLF A;  1Z2L A;  1J4J A;  2FIA A;  3R1K A;  3D8P A;  4L89 A;  4C2X A;  2IMO A;  1ZG7 A;  4PXD A;  3KZW A;  4Z65 A;  1M44 A;  3B3C A;  4MCR A;  2J8M A;  4UCP A;  1YK3 A;  4Y49 B;  3FNC A;  1TKF A;  2WPW A;  3R9F A;  3PEI A;  3CDX A;  3TTH A;  4L8A A;  5H86 A;  4X5K A;  3SXO A;  1FNO A;  1FY7 A;  1ELM P;  4IK2 A;  4OLL A;  4Q38 A;  4ZBG A;  5CPA A;  4H6Z A;  4FAI A;  4M6H A;  2KCW A;  1LAM A;  3IU2 A;  2B4D B;  1RXT A;  3NA6 A;  4OC3 A;  2YGW A;  2POK A;  4Y49 C;  1BOB A;  3GB0 A;  3IC1 A;  4C2Z A;  3B3V A;  5HVG A;  4P4I A;  4KSI A;  1TIQ A;  4CGM A;  1QSO A;  1ZG8 A;  2ZED A;  3KQZ A;  4KLW A;  4MBU A;  4NGP A;  7CPA A;  2OZG A;  1S5K A;  1CJW A;  3CXS A;  1QSR A;  2JLM A;  3K2K A;  3K9U A;  4JXQ A;  2WPX A;  1Z8W A;  5EBV A;  3SHP A;  4BBH A;  5C88 A;  3DR8 A;  5AG7 A;  5KTD A;  3CPX A;  4EFD A;  5KTA A;  2JBJ A;  4B14 A;  3RAM A;  2O28 A;  4IUS A;  3G8W A;  5LRJ A;  4OC1 A;  3OWC A;  2ZOF A;  1B87 A;  2P6E A;  4R8F A;  2JBK A;  1ARL A;  1TF8 A;  2DXQ A;  3SJG A;  2CNT A;  4DJL A;  2DEA A;  3DSB A;  4UEZ A;  2OZH A;  3D7H A;  2QYV A;  3VAT A;  4GM5 A;  3FXT A;  3T90 A;  1LAP A;  4JD6 A;  4UIA A;  4UWJ A;  1MK4 A;  3WC5 A;  3S6G A;  4GS4 A;  4KSA A;  1I21 A;  3H8E A;  4UBR A;  3LMS A;  4H6U A;  4I49 A;  4P4B A;  2ZEE A;  1BPN A;  2GRE A;  1PCA A;  5I0C A;  5AG4 A;  5C82 A;  2DF5 A;  2R98 A;  2Z3P A;  3S6F A;  4E0A A;  2QVP A;  4X2T A;  4FUU A;  4MI4 A;  3PB6 X;  1OBR A;  5ELY A;  2ABZ A;  2EVN A;  4PSX A;  4F8Z A;  4CYN A;  1Y0R A;  4AVB A;  4KS9 A;  1CG2 A;  2FT0 A;  1IYK A;  4NXY A;  4G1P A;  4OP4 A;  2ZEF A;  4TNU A;  3SI1 A;  3R95 A;  2B5G B;  1NSL A;  1UFH A;  2Z3K A;  1U6M A;  2OB0 A;  2PR8 A;  2Z3O A;  3I9S A;  1Z8X A;  5G21 A;  5HVF A;  2CTB A;  2CNM A;  3JVN A;  4CRY B;  5K8N A;  4CAF A;  1H8L A;  2PVW A;  1P4N A;  2AFX A;  3SI0 A;  3PBB A;  2EO8 A;  2CF4 A;  2PJ2 A;  4F9V A;  2AFM A;  4ZX8 A;  1M4I A;  1NMT A;  3GYA A;  1KWM A;  1Y9K A;  3H5Z A;  3PRT A;  4H89 A;  4QB9 A;  4RUH A;  3KR4 A;  4XNH B;  3WC6 A;  3SJE A;  1P0H A;  4OKO A;  4M6I A;  4F9U A;  3T8W A;  4HNX B;  1MJB A;  3PZJ A;  2ZEP A;  2ZEO A;  2ZEN A;  3PGP A;  4NCZ A;  3LWU A;  5K8O A;  2BSW A;  4XPK A;  5F46 A;  5JGF A;  4KUB A;  1XE4 A;  1SQH A;  2PJ4 A;  3V7Z A;  2FE7 A;  4XNH C;  5IX3 A;  3RYO A;  4FBE A;  5K8P A;  2HB6 A;  4FD7 A;  2RB7 A;  4KVM E;  4RN7 A;  8CPA A;  1GHE A;  1Z4E A;  4OIW A;  6CPA A;  3SJF A;  2C1C A;  2PC1 A;  1A2Z A;  4HKF A;  3KKW A;  5AGE A;  1XIX A;  2R1I A;  2Z11 A;  3KI9 A;  1XF8 A;  3VAR A;  4GXH A;  1F2O A;  1RO5 A;  4JWP A;  2CIJ A;  4KZT A;  3F8K A;  4KOU A;  2G9D A;  1IOF A;  2VXK A;  1HDU A;  3IGR A;  3WC7 A;  3WT4 A;  2QIR A;  3N7Z A;  4KOW A;  1QSM A;  1Q2D A;  2ARH A;  4P4D A;  3NH5 A;  5D8N A;  4OC2 A;  3ZZI A;  3IEH A;  2NSM A;  4CAX A;  4F0Y A;  3SXN A;  3B8G A;  2PRB A;  5IB0 A;  1CM0 A;  1S3Z A;  3CXQ A;  3VWE A;  3D2M A;  2Q7S A;  3TC8 A;  2C27 A;  4A30 A;  2FL4 A;  2EBJ A;  1CP7 A;  3FB3 A;  5F49 A;  4BD9 A;  1TKJ A;  2R8V A;  2EK8 A;  4AB7 A;  4DNC A;  1L0C A;  4UEE A;  3KQX A;  4P10 A;  4Q36 A;  2OZU A;  1MJA A;  2PJ6 A;  3GY9 A;  1BO4 A;  4AG7 A;  2ZEG A;  3N5F A;  4PPZ A;  2PJC A;  2CTC A;  2ZPA A;  4R3L A;  2VEZ A;  1PU9 A;  2JDC A;  3VWD A;  3NFZ A;  4HNW B;  2V77 A;  4H2K A;  1YRE A;  4FD6 A;  4YU9 A;  3IIB A;  3P2F A;  4MFQ A;  4MY0 A;  4PXB A;  5THW A;  3KL9 A;  1Z5R A;  2C6C A;  2ODF A;  4ONU A;  1CX8 A;  3R9G A;  4C7I A;  4MFL A;  4OC4 A;  5HH1 A;  3FBU A;  1XBU A;  4M3S A;  4B12 A;  5LYF A;  4ZI6 A;  2FS5 A;  4J3G A;  4NF1 A;  4B5P A;  4R6T A;  5BWA B;  1XOV A;  2PSW A;  3FRM A;  4OAD A;  1IU8 A;  4WJB A;  1XJO A;  4YGO A;  4CAW A;  4C68 A;  2G3T A;  2J8R A;  2ZW6 A;  3GLJ A;  1YW4 A;  3IJ3 A;  5H84 A;  3LD2 A;  3R9E A;  3IWG A;  4NGS A;  2OU2 A;  4RS2 A;  4YRH A;  1BAV A;  2NYQ A;  1ON0 A;  4CYO A;  2CXA A;  2B4B A;  4NGR A;  2ZOG A;  3BI1 A;  1PUA A;  2BOA A;  4PQA A;  5F47 A;  1ZLI A;  2HV2 A;  4NSQ A;  1YLE A;  4P4F A;  5AG5 A;  4LX9 A;  3B7I A;  4CYQ A;  3FX6 A;  1KUY A;  2V8H A;  3FH4 A;  3W91 A;  3BXM A;  3W6S A;  3IFE A;  3EXN A;  4XPD B;  2C6P A;  2PIZ A;  3K9T A;  3D7D A;  4UF4 A;  3W6X A;  4IF5 A;  2BEI A;  2YNC A;  2ATR A;  1CBX A;  2B3U A;  4TWE A;  5J8C A;  4KVO E;  2AFZ A;  2GLJ A;  2BUE A;  2JDD A;  5DWN A;  4K30 A;  2BL1 A;  4XPD C;  1LFW A;  2PRQ A;  3KGQ A;  3PB7 X;  1DTD A;  4QVT A;  3D7F A;  3V8I A;  2V8D A;  4DUK A;  2ZW5 A;  4JZ0 A;  3TO9 A;  1X10 A;  3D7G A;  2HQY A;  3H8F A;  3LOD A;  2Q51 A;  4FWU A;  5ISV A;  4BIN A;  2J9A A;  4CRZ B;  3SI2 A;  1LOK A;  1S7N A;  2Q04 A;  4UEF A;  4UWI A;  2OH1 A;  5JM6 A;  5J1Q A;  3F0A A;  4II9 A;  2PJ8 A;  2VZZ A;  4NJR A;  1M1D A;  2F8H A;  4MHY A;  2Q4V A;  1ZLH A;  1IGB A;  2AFU A;  3TO7 A;  3P2H A;  4UIB A;  4P4E A;  4ZY0 A;  4LUA A;  3B35 A;  3RZA A;  4NFR A;  4EME A;  2Z3N A;  2ZEL A;  1WWZ A;  3I1U A;  4A39 A;  2JEW A;  2YND A;  4AVA A;  2EK9 A;  3NH4 A;  1Y7R A;  3DDD A;  3NH8 A;  3VH9 A;  4MJ8 A;  1MJ9 A;  4UFV A;  2Z0Z A;  3H4Q A;  2REF A;  2Q0Y A;  3TE4 A;  4A95 A;  3I3G A;  1EE3 P;  3B2Y A;  3V38 A;  4PV6 A;  4R57 A;  4MCS A;  1HEE A;  4O23 A;  4BMH A;  1NE9 A;  5LYL A;  4E8O A;  3HUV A;  4AXV A;  2QJ8 A;  2WYR A;  4CGN A;  2VL1 A;  4KLV A;  2PJ7 A;  5E96 A;  3B3S A;  1CP6 A;  3C26 A;  1QMU A;  3QNV A;  4WWV A;  1M4D A;  2V8V A;  1ELL P;  5A27 A;  2AE6 A;  2D4P A;  3CT9 A;  3S9M A;  4PK3 A;  2BCO A;  3GKR A;  4MCP A;  3FVL A;  1CPS A;  4M85 A;  2WSA A;  2PR1 A;  3RBU A;  2VI7 A;  5HMN A;  4ZY1 A;  2Z3L A;  2PJ5 A;  3MGD A;  2I79 A;  3KR5 A;  1ARM A;  4MMO A;  5LRK A;  4MHD A;  3FEE A;  2FCK A;  4B5O A;  5CBM A;  5F48 A;  3QAH A;  5F09 A;  1VKC A;  3CPA A;  4KOS A;  2K5T A;  3EO4 A;  4JLY A;  1IOI A;  2Q43 A;  1LAN A;  4CGO A;  1JQG A;  4ORF A;  4UFW A;  4C2Y A;  4PXC A;  4U9Y A;  2X7B A;  4B6Z A;  1S7L A;  4ZYQ A;  3BJ7 A;  4MFP A;  4CGP A;  3DNS A;  5LYD A;  4A33 A;  1JWQ A;  4NGN A;  4ZY2 A;  3IWE A;  2VZY A;  3RNZ A;  4MFK A;  4YFJ A;  2Q4Z A;  5DS0 A;  4U9Z A;  5D29 A;  3FIX A;  3KHZ A;  2ZEM A;  1YGH A;  4PSW A;  4B11 A;  1Q2C A;  3WR7 A;  4AG9 A;  5FVJ A;  3A9L A;  1YME A;  2ZW4 A;  3QB8 A;  4KVX A;  3DGV A;  4IHM A;  3S6H A;  3TT2 A;  3FED A;  1IIC A;  4OME A;  4NJQ A;  5IB9 A;  2ZEH A;  4UCN A;  1Y0Y A;  1YX0 A;  2P0W A;  2QEC A;  4K3N A;  2FIW A;  2ZW7 A;  2OOT A;  2B3V A;  4C7H A;  1XMB A;  3NE7 A;  3KHX A;  1LRZ A;  1AYE A;  3JTK A;  4F0X A;  4YWY A;  4FD4 A;  1YLO A;  2FSR A;  2ANP A;  5JH9 A;  2PDO A;  4CPA A;  4R3K A;  5LRG A;  3TO6 A;  4OID A;  4MXU A;  1NSA A;  4MHN A;  2J8N A;  4IAV A;  3UY5 A;  2PIY A;  1GYT A;  2WUU A;  2WZN A;  3DLJ A;  2O4H A;  2G0B A;  2IL4 A;  3TFY A;  1VHE A;  3BLN A;  5CNP A;  5JPH A;  4OC5 A;  4B13 A;  5JQ4 A;  2PQ8 A;  5LYI A;  1QSN A;  3ZJ0 A;  2RC4 A;  1PYT B;  5HVH A;  1F2P A;  1AMP A;  2XEG A;  4E2A A;  2Y0M A;  2REE A;  1R57 A;  2YNE A;  2A4N A;  4XPL A;  3JUW A;  2XEJ A;  3CXP A;  3TOA A;  2IQ6 A;  1B6B A;  2XEF A;  5AG6 A;  1R3N A;  1V0C A;  2GU2 A;  1RTQ A;  2B58 A;  3D2P A;  5IV0 A;  1TF9 A;  1Q7L A;  2PJ3 A;  3HLP A;  3ISX A;  3RO0 A;  4B5P B;  2Z3M A;  3IO1 A;  1I12 A;  1I1D A;  1KZF A;  4A31 A;  2QML A;  4EWT A;  2P6G A;  3E0K A;  4FD5 A;  2FVG A;  1QQ9 A;  1Z8T A;  1YR0 A;  2PJ0 A;  3G3S A;  1IYL A;  4CAE A;  1KUV A;  3MRU A;  2OR4 A;  4R9M A;  5KTC A;  3FF3 A;  3PFE A;  1M4G A;  2Q7B A;  5HXD A;  4KUA A;  2R7H A;  4MRI A;  4JYW A;  2AFO A;  3WAB A;  2VQY A;  4PXE A;  2I3C A;  3BJ8 A;  4UA3 A;  3SJX A;  5J8F A;  1IB1 E;  5G1Z A;  2HC9 A;  3FEC A;  1TKH A;  2ZXV A;  4R76 A;  2B5G A;  4LQG A;  1ZO0 A;  4A32 A;  3BHX A;  5EC4 A;  2PVV A;  3R96 A;  4ZGY B;  2FXF A;  4P4J A;  4R87 A;  2IJZ A;  1VIX A;  4P44 A;  3F5B A;  2C6G A;  2PJA A;  4P6Y A;  4KSF A;  3FJU A;  1Z4R A;  3IU1 A;  1N71 A;  2Z10 A;  4QC6 A;  3JRU A;  5A28 A;  2H5M A;  1K4J A;  2EWB A;  1BPM A;  1Z8L A;  2GFQ A;  1FT7 A;  1IID A;  3FMC A;  2AJ6 A;  2Q4Y A;  4CYP A;  1WK4 A;  1OZP A;  5G22 A;  5I4M A;  1VHO A;  2YNC C;  3PB8 X;  1CPX A;  4HNY B;  1KUX A;  1XRY A;  3S6K A;  2PJB A;  1M4L A;  2V8G A;  4M6G A;  3GUX A;  3D68 A;  4MFZ A;  5DWM A;  1YVK A;  3LAC A;  3H8G A;  4NEX A;  3S9N A;  3TCV A;  4CGL A;  1ZG9 A;  1Z9U A;  2CNS A;  1DE4 C;  1X12 A;  4CS0 B;  4X3R A;  1HDQ A;  2EUI A;  4RI1 A;  4JJX A;  3MN8 A;  1S60 A;  1Q2Y A;  1YVO A;  1YW6 A;  4A37 A;  4OC0 A;  2I00 A;  3KAS A;  2AFS A;  5G20 A;  3D66 A;  1Y7E A;  1S7K A;  1UWY A;  2RFH A;  4MCQ A;  3B3W A;  4X8I A;  5GCN A;  2PCU A;  1YQE A;  4AVC A;  1BLL E;  2GAN A;  2CY2 A;  1S7F A;  2F7V A;  4P45 A;  2Q44 A;  4NGM A;  4QUS A;  1AUG A;  4F6A A;  2BO9 A;  3D3S A;  3D4U A;  3D67 A;  3DR6 A;  3TX8 A;  4R7M A;  3CZX A;  3PB4 X;  2D4O A;  4MFJ A;  1Y9W A;  4U5Y A;  4A2Z A;  5K8M A;  4Q7A A;  2JEV A;  3BI0 A;  4NGQ A;  4UFX A;  2GIV A;  3S9L A;  3PFO A;  4JXR A;  2NMT A;  3QAY A;  4KOX A;  4KOR A;  1VGY A;  3NE8 A;  2O53 A;  1QST A;  4ZX9 A;  4KOV A;  2GE3 A;  4CAV A;  2PJ1 A;  2VBQ A;  4UCM A;  4DYO A;  3EY5 A;  1YSJ A;  3PB9 X;  1XFO A;  4A94 A;  3B3T A;  4LQ6 A;  5EMI A;  4NGT A;  2XEI A;  3EFA A;  3PBE A;  2PE3 A;  4A38 A;  3IWW A;  1R43 A;  2G3A A;  4QBJ A;  1LCP A;  3TOB A;  4MY3 A;  3ISZ A;  4W9Y A;  1F57 A;  1IY7 A;  2P6F A;  4ONW A;  4KOT A;  3FYN A;  2B4D A;  3T9Y A;  3L2N A;  4MHZ A;  1VHS A;  2HUZ A;  4MHP A;  2F5I A;  3EC4 A;  1XEB A;  2AFW A;  1TXR A;  4KOY A;  4OAE A;  3GIU A;  4EVY A;  2DPT A;  4B10 A; 
#chains in the Genus database with same CATH homology
 2DPS A;  3PP9 A;  1XMT A;  4PK2 A;  4C2X A;  3R1K A;  1J4J A;  2FIA A;  4L89 A;  3D8P A;  1M44 A;  4UCP A;  2J8M A;  1YK3 A;  4Y49 B;  3FNC A;  2WPW A;  3R9F A;  3TTH A;  4L8A A;  5H86 A;  4X5K A;  3SXO A;  1FY7 A;  4OLL A;  4Q38 A;  4ZBG A;  4H6Z A;  2KCW A;  3IU2 A;  2B4D B;  1RXT A;  2YGW A;  4Y49 C;  1BOB A;  4C2Z A;  1TIQ A;  4CGM A;  1QSO A;  4MBU A;  4KLW A;  2OZG A;  1S5K A;  1CJW A;  3CXS A;  1QSR A;  2JLM A;  3K9U A;  3SHP A;  4JXQ A;  2WPX A;  5EBV A;  4BBH A;  5C88 A;  3DR8 A;  5AG7 A;  5KTD A;  5KTA A;  4B14 A;  2O28 A;  4IUS A;  3G8W A;  3OWC A;  1B87 A;  2P6E A;  2DXQ A;  2CNT A;  3DSB A;  2OZH A;  3FXT A;  3T90 A;  4JD6 A;  4UWJ A;  1MK4 A;  3S6G A;  4GS4 A;  4KSA A;  1I21 A;  4UBR A;  4H6U A;  4I49 A;  5I0C A;  5AG4 A;  5C82 A;  4E0A A;  2R98 A;  2Z3P A;  3S6F A;  4MI4 A;  2EVN A;  4PSX A;  4CYN A;  4AVB A;  4KS9 A;  2FT0 A;  1IYK A;  4NXY A;  3R95 A;  2B5G B;  1NSL A;  1UFH A;  2Z3K A;  1U6M A;  2OB0 A;  2PR8 A;  2Z3O A;  3I9S A;  5G21 A;  2CNM A;  3JVN A;  4CRY B;  4CAF A;  1P4N A;  4H89 A;  1M4I A;  1NMT A;  1Y9K A;  3GYA A;  3H5Z A;  4QB9 A;  4XNH B;  1P0H A;  5J8C A;  4HNX B;  1MJB A;  3PZJ A;  3PGP A;  4NCZ A;  2BSW A;  4XPK A;  5F46 A;  4KUB A;  1XE4 A;  1SQH A;  2FE7 A;  4XNH C;  5IX3 A;  3RYO A;  4FD7 A;  4KVM E;  1GHE A;  1Z4E A;  2PC1 A;  4HKF A;  3KKW A;  5AGE A;  1XIX A;  2R1I A;  2Z11 A;  1XF8 A;  1RO5 A;  4JWP A;  4KZT A;  3F8K A;  4KOU A;  2VXK A;  3IGR A;  2QIR A;  3N7Z A;  4KOW A;  1QSM A;  1Q2D A;  2ARH A;  3ZZI A;  4CAX A;  4F0Y A;  3SXN A;  3B8G A;  2PRB A;  5IB0 A;  1CM0 A;  1S3Z A;  3CXQ A;  3VWE A;  3D2M A;  4A30 A;  2C27 A;  2FL4 A;  3FB3 A;  5F49 A;  2R8V A;  4AB7 A;  4DNC A;  1L0C A;  4Q36 A;  2OZU A;  1MJA A;  3GY9 A;  1BO4 A;  4AG7 A;  2ZPA A;  4R3L A;  2VEZ A;  1PU9 A;  2JDC A;  3VWD A;  4HNW B;  1YRE A;  4FD6 A;  3P2F A;  4MFQ A;  4MY0 A;  4ONU A;  3R9G A;  4C7I A;  4MFL A;  5HH1 A;  3FBU A;  4M3S A;  4B12 A;  2FS5 A;  4J3G A;  4NF1 A;  4B5P A;  5BWA B;  2PSW A;  3FRM A;  4OAD A;  4YGO A;  4CAW A;  4C68 A;  2G3T A;  2J8R A;  2ZW6 A;  5H84 A;  3LD2 A;  3R9E A;  3IWG A;  2OU2 A;  4RS2 A;  4YRH A;  1ON0 A;  4CYO A;  2CXA A;  2B4B A;  1PUA A;  5F47 A;  2HV2 A;  4NSQ A;  1YLE A;  5AG5 A;  4LX9 A;  4CYQ A;  1KUY A;  3W91 A;  3W6S A;  3EXN A;  4XPD B;  3W6X A;  4IF5 A;  2BEI A;  2YNC A;  2ATR A;  2B3U A;  4KVO E;  2BUE A;  2JDD A;  5DWN A;  4K30 A;  2BL1 A;  4XPD C;  4QVT A;  3V8I A;  2ZW5 A;  3TO9 A;  2HQY A;  3LOD A;  5ISV A;  4CRZ B;  1S7N A;  2Q04 A;  4UWI A;  2OH1 A;  4II9 A;  3F0A A;  2VZZ A;  1M1D A;  2Q4V A;  3TO7 A;  3P2H A;  4LUA A;  2Z3N A;  1WWZ A;  2YND A;  4AVA A;  3DDD A;  1Y7R A;  4MJ8 A;  1MJ9 A;  4UFV A;  2Z0Z A;  3H4Q A;  2REF A;  2Q0Y A;  3TE4 A;  4A95 A;  3I3G A;  4PV6 A;  4R57 A;  4BMH A;  1NE9 A;  4E8O A;  4CGN A;  4KLV A;  5E96 A;  3C26 A;  1M4D A;  5A27 A;  2AE6 A;  2D4P A;  4PK3 A;  3GKR A;  4M85 A;  2WSA A;  2PR1 A;  2VI7 A;  5HMN A;  2Z3L A;  3MGD A;  2I79 A;  4MHD A;  2FCK A;  4B5O A;  5F48 A;  3QAH A;  1VKC A;  4KOS A;  2K5T A;  3EO4 A;  4JLY A;  4CGO A;  4ORF A;  4UFW A;  4C2Y A;  4U9Y A;  2X7B A;  1S7L A;  3BJ7 A;  4MFP A;  4CGP A;  3DNS A;  4A33 A;  3IWE A;  2VZY A;  4MFK A;  4YFJ A;  4U9Z A;  3FIX A;  1YGH A;  4PSW A;  4B11 A;  1Q2C A;  3WR7 A;  4AG9 A;  5FVJ A;  3A9L A;  2ZW4 A;  3QB8 A;  4KVX A;  3S6H A;  3TT2 A;  1IIC A;  4UCN A;  1YX0 A;  2P0W A;  2QEC A;  2FIW A;  2ZW7 A;  2B3V A;  4C7H A;  3NE7 A;  1LRZ A;  3JTK A;  4F0X A;  4FD4 A;  2FSR A;  2PDO A;  4R3K A;  3TO6 A;  2J8N A;  3UY5 A;  2WUU A;  2G0B A;  2IL4 A;  3TFY A;  3BLN A;  5CNP A;  5JPH A;  4B13 A;  5JQ4 A;  2PQ8 A;  1QSN A;  3ZJ0 A;  2RC4 A;  4E2A A;  2Y0M A;  2REE A;  1R57 A;  2YNE A;  2A4N A;  4XPL A;  3JUW A;  3CXP A;  3TOA A;  1B6B A;  5AG6 A;  1V0C A;  2B58 A;  3D2P A;  4B5P B;  2Z3M A;  4A31 A;  1I12 A;  1I1D A;  1KZF A;  2QML A;  2P6G A;  3E0K A;  4FD5 A;  1YR0 A;  3G3S A;  1IYL A;  4CAE A;  1KUV A;  4R9M A;  5KTC A;  1M4G A;  2Q7B A;  4KUA A;  2R7H A;  2VQY A;  4UA3 A;  5J8F A;  3BJ8 A;  1IB1 E;  5G1Z A;  2ZXV A;  2B5G A;  1ZO0 A;  4A32 A;  5EC4 A;  3R96 A;  4ZGY B;  2FXF A;  4R87 A;  3F5B A;  4KSF A;  1Z4R A;  3IU1 A;  1N71 A;  2Z10 A;  4QC6 A;  5A28 A;  2H5M A;  1K4J A;  1IID A;  2AJ6 A;  2Q4Y A;  4CYP A;  1WK4 A;  1OZP A;  5G22 A;  2YNC C;  4HNY B;  1KUX A;  3S6K A;  4MFZ A;  5DWM A;  1YVK A;  4NEX A;  3TCV A;  4CGL A;  1Z9U A;  2CNS A;  4CS0 B;  2EUI A;  4RI1 A;  4JJX A;  1S60 A;  1Q2Y A;  1YVO A;  2I00 A;  5G20 A;  1S7K A;  5GCN A;  4AVC A;  2GAN A;  2CY2 A;  1S7F A;  2Q44 A;  4QUS A;  4F6A A;  3D3S A;  5IV0 A;  3DR6 A;  4A2Z A;  2D4O A;  4MFJ A;  1Y9W A;  4U5Y A;  2JEV A;  4UFX A;  2GIV A;  4JXR A;  2NMT A;  4KOX A;  4KOR A;  1QST A;  4KOV A;  2GE3 A;  4CAV A;  2VBQ A;  4UCM A;  3EY5 A;  3EFA A;  2G3A A;  4QBJ A;  3TOB A;  4MY3 A;  2P6F A;  4KOT A;  3FYN A;  2B4D A;  3T9Y A;  1VHS A;  2HUZ A;  3EC4 A;  2F5I A;  1XEB A;  4KOY A;  4OAE A;  4EVY A;  2DPT A;  4B10 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...