3JUWA

Putative gnat-family acetyltransferase from bordetella pertussis.
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
167
structure length
167
Chain Sequence
RQVLKTDRLVLEPQSMARFDQWFAMERQRDEAGHRDLTEDQAWLRLCARQGMWDAYACGFYYLLDPVSGEMRGEAGFQFRRRGFGPGFDNHPEAAWAVASAHQGRGLAAEAMQALLAHHDRSSGRQRVVALIARSNLPSLRLAERLGFRGYSDVAFDGAAHLLLERA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Probable GnaT-family acetyltransferase
publication title X-ray crystal structure of putative GnaT-family acetyltransferase from Bordetella pertussis.
rcsb
source organism Bordetella pertussis
molecule tags Transferase
total genus 46
structure length 167
sequence length 167
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2009-09-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13302 Acetyltransf_3 Acetyltransferase (GNAT) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 3juwA00
4CAVA 4QVTA 4YGOA 1LRZA 2QECA 2J8MA 4E2AA 1NE9A 3GY9A 4XNHB 2Q4VA 4XPKA 3T90A 4B5PA 3EC4A 4QB9A 4L89A 4FD7A 4CRZB 1XEBA 2Q04A 3S6FA 2FIAA 4LX9A 2Z10A 4YFJA 1U6MA 3PZJA 2P6EA 3S6HA 3BLNA 4KUBA 4AB7A 4I49A 1MJ9A 2ZW6A 5H84A 4XNHC 3DR8A 4KOUA 4K30A 3P2HA 3FIXA 4GS4A 2VXKA 3ZJ0A 2CNTA 4HNYB 1B87A 3IWGA 2OU2A 2G3AA 5KTCA 3T9YA 2OZGA 1M1DA 4JWPA 4UWJA 2O28A 2Z0ZA 3TOAA 1Y9WA 3N7ZA 2JEVA 2B4BA 1P0HA 3R9EA 2KCWA 2REFA 2VZZA 4R9MA 2JDDA 2J8RA 4PV6A 4IUSA 2FIWA 2DXQA 2OZHA 4MY3A 1S7NA 3R96A 2IL4A 3TO9A 2ZXVA 5H86A 2B3UA 1Z4RA 2GE3A 3D8PA 3SXOA 1OZPA 1I1DA 4RS2A 1BO4A 2PDOA 1XE4A 3D2MA 4E0AA 1IB1E 1MJAA 2REEA 4U5YA 2R7HA 4ORFA 2BSWA 5I0CA 1M4IA 5KTDA 5DWNA 2OZUA 4PSXA 1VKCA 5F47A 5IX3A 2JLMA 1P4NA 4KLWA 3IGRA 4OAEA 4HKFA 2X7BA 1YR0A 1Y9KA 3BJ8A 2HQYA 1NSLA 4F6AA 3UY5A 2WPXA 5HMNA 1IICA 3OWCA 3R1KA 3W6XA 2AE6A 1V0CA 4B5PB 2C27A 1CM0A 3EFAA 2GIVA 4JLYA 2Q0YA 5EBVA 2JDCA 1YK3A 3GKRA 3R9FA 5DWMA 4ZBGA 4HNWB 2P6GA 4QC6A 4CAXA 2J8NA 2Z11A 1I21A 1YREA 4H89A 3FNCA 5J8FA 1PU9A 3SHPA 1Q2DA 2B3VA 2ZPAA 4JD6A 2EVNA 3JUWA 4CRYB 1S7FA 4Y49B 1R57A 1B6BA 4KOYA 3VWDA 2CNSA 2H5MA 2BUEA 1WK4A 1S7KA 5F48A 5ISVA 2VZYA 4YRHA 5E96A 3MGDA 3QB8A 3CXSA 4KZTA 2R1IA 2HUZA 3PGPA 4AG9A 5CNPA 4KVXA 2Q7BA 1K4JA 1QSMA 2F5IA 2VQYA 3NE7A 2B58A 5IV0A 2QMLA 2HV2A 3K9UA 2FXFA 4NEXA 4PK3A 2FE7A 3F5BA 3QAHA 3H4QA 1YGHA 4KLVA 4AVBA 2B4DA 3TT2A 1WWZA 1IYKA 2B5GB 1KUVA 2FS5A 5J8CA 2CNMA 2G3TA 2Q44A 3D3SA 4JJXA 5GCNA 1PUAA 5F49A 1L0CA 2B5GA 4KOWA 3FXTA 1N71A 3TE4A 2PSWA 1QSTA 2CY2A 4BMHA 3EY5A 1Y7RA 2PC1A 2I79A 4KOXA 2Y0MA 2FT0A 2NMTA 4NCZA 4AVCA 5F46A 2BEIA 2P6FA 2ZW7A 3FRMA 5JPHA 4EVYA 2ARHA 3KKWA 4UBRA 4HNXB 4KVOE 3D2PA 3LODA 1ON0A 1RO5A 1XIXA 1YLEA 2FCKA 4MBUA 2RC4A 3WR7A 1Z9UA 1TIQA 4L8AA 3VWEA 2PQ8A 4J3GA 4JXQA 1RXTA 2VBQA 4R3KA 4MJ8A 3W6SA 3FYNA 4U9ZA 1S7LA 1KUXA 1QSOA 4FD6A 4LUAA 1BOBA 2ATRA 5EC4A 3W91A 2FL4A 3EO4A 1M4GA 4H6UA 4KUAA 1I12A 2ZW5A 4KOSA 3E0KA 3JVNA 2VEZA 1M44A 2QIRA 3B8GA 4MHDA 2D4PA 2D4OA 1Q2YA 3TCVA 2GANA 4UA3A 1VHSA 4R87A 4XPLA 4QBJA 2G0BA 3FBUA 3S6KA 5FVJA 4KVME 4Y49C 3G3SA 2EUIA 3F0AA 2R98A 1Z4EA 4U9YA 5JQ4A 2VI7A 4PSWA 2FSRA 1IYLA 4MI4A 1FY7A 2PR1A 4RI1A 1YVKA 2BL1A 4MY0A 2B4DB 4AG7A 4M3SA 2Q4YA 3TOBA 1KZFA 1IIDA 1SQHA 4R3LA 2OH1A 5IB0A 4KORA 3R95A 1Q2CA 1XF8A 3EXNA 3TFYA 1QSNA 3DDDA 3CXPA 3GYAA 2PR8A 1MK4A 3DSBA 4IF5A 5HH1A 2AJ6A 3R9GA 2OB0A 2ZW4A 3FB3A 4CS0B 3G8WA 3CXQA 4B5OA 1S3ZA 3SXNA 3P2FA 4UWIA 3TTHA 4H6ZA 3F8KA 3DNSA 4FD4A 3TO6A 4F0YA 5C88A 4AVAA 3RYOA 2WPWA 2A4NA 4QUSA 2P0WA 5C82A 3PP9A 4NF1A 1NMTA 3LD2A 2I00A 4CAWA 4ONUA 4DNCA 4XPDB 1MJBA 4II9A 4M85A 2PRBA 4X5KA 2K5TA 3C26A 1YX0A 4OADA 3DR6A 3I3GA 1CJWA 1QSRA 3BJ7A 1UFHA 4NXYA 4PK2A 3I9SA 3V8IA 4E8OA 1XMTA 1YVOA 4JXRA 1S5KA 1S60A 3S6GA 1J4JA 4NSQA 1KUYA 2R8VA 4R57A 5KTAA 1M4DA 4XPDC 4KOTA 1GHEA 3TO7A 4OLLA 4FD5A 3ZZIA 4KOVA
chains in the Genus database with same CATH superfamily
1XRYA 4CGOA 3B3CA 4CAVA 4QVTA 1X10A 1XBUA 4UCMA 4YGOA 2Z3NA 4P4JA 1LRZA 1IGBA 3IFEA 2QECA 4P6YA 2J8MA 4E2AA 4X2TA 4EWTA 1NE9A 5JM6A 3GY9A 3VH9A 5I4MA 5K8OA 4XNHB 3KZWA 3FF3A 2Q4VA 2ZELA 4XPKA 5CBMA 3B7IA 2V8GA 1BAVA 3T90A 4B5PA 3EC4A 4QB9A 2PJ2A 4L89A 4FD7A 3SJXA 4CRZB 1XEBA 2Z3MA 3V7ZA 4CYQA 2Q04A 3S6FA 3IU1A 2FIAA 4LX9A 2Z10A 4YFJA 4BD9A 1U6MA 3PZJA 1OBRA 2P6EA 1Z8LA 3BLNA 3S6HA 2CF4A 2XEGA 3H8FA 3K9TA 3KGQA 4KUBA 3WABA 4AB7A 7CPAA 4I49A 4KSIA 1Q7LA 1YMEA 1NSAA 1MJ9A 3PB8X 2ZOGA 3PBBA 1DE4C 2YNCA 2ZW6A 2ZEDA 5H84A 3PEIA 4XNHC 3DR8A 4KOUA 4K30A 3S9MA 1ZG9A 2BCOA 2ZEEA 4IHMA 3S9LA 3P2HA 4NGSA 4R7MA 3RAMA 1TKFA 1R43A 1TXRA 4LQGA 4Z65A 3FIXA 4GS4A 4MHNA 2VXKA 4AXVA 3ZJ0A 2CNTA 4HNYB 1B87A 2ABZA 4UF4A 1ARLA 3IWGA 2OU2A 2G3AA 5KTCA 4ZY2A 3T9YA 2OZGA 1M1DA 1XOVA 2ZEHA 1TF9A 4JWPA 2O28A 2Z0ZA 4UWJA 1Y9WA 3N7ZA 2JEVA 3TOAA 2B4BA 4C2ZA 1P0HA 4FUUA 3R9EA 2CTCA 2KCWA 1F2OA 2REFA 3D66A 4P44A 2VZZA 4MFPA 4R9MA 2JDDA 4UFWA 4O23A 3B3WA 2J8RA 3B2YA 4PV6A 4IUSA 2CXAA 4Q7AA 2FIWA 2DXQA 3SJGA 2OZHA 1ZLHA 3KR4A 3RO0A 3MRUA 1LAMA 3WC6A 4MY3A 2ZOFA 1S7NA 3R96A 2IL4A 3TO9A 2ZXVA 5H86A 2B3UA 2EBJA 1Z4RA 4JZ0A 2GE3A 3D8PA 1ELMP 1A2ZA 2QYVA 3SXOA 1OZPA 1I1DA 4RS2A 1BO4A 2ZEMA 2PDOA 3WC5A 2WUUA 1XE4A 2XEJA 3D2MA 1ELLP 4A94A 4E0AA 1IB1E 5AG6A 1MJAA 3B3TA 2REEA 3SI2A 2EK9A 4U5YA 4A30A 1Y0RA 2R7HA 2BSWA 4ORFA 4LQ6A 4OP4A 5I0CA 2C1CA 3GIUA 4B11A 1M4IA 5KTDA 4A39A 4OC2A 3PB9X 5DWNA 3B3VA 2OZUA 4MHPA 1LCPA 3PB7X 4PSXA 1VKCA 4MFZA 4MCRA 4TNUA 5F47A 4RUHA 5IX3A 2IMOA 2JLMA 1P4NA 4KLWA 2G9DA 3IGRA 1X12A 3QAYA 1LANA 4OAEA 1AMPA 1LAPA 4HKFA 2X7BA 4M6IA 1YR0A 1Y9KA 4ZI6A 2NYQA 3BJ8A 2VL1A 2HQYA 1HDUA 3JRUA 5D8NA 3FMCA 4MFKA 2QVPA 1NSLA 1AUGA 4F6AA 4P4IA 3UY5A 2WPXA 3IEHA 5HMNA 1IICA 2RFHA 4B13A 4CYNA 4FBEA 3IU2A 2WZNA 2OR4A 2ZEPA 3JTKA 3OWCA 4C68A 3R1KA 3W6XA 2AE6A 1V0CA 4OMEA 4CGNA 1LFWA 1Z8XA 4B5PB 2C27A 1CM0A 2O4HA 3EFAA 3KQXA 2GIVA 4RN7A 3TX8A 3KR5A 4JLYA 4BINA 4CYOA 2C6CA 3GUXA 2Q0YA 5EBVA 3KQZA 2JDCA 4CAEA 4FWUA 3WT4A 1YK3A 3GKRA 3LACA 2Q43A 1ZG8A 4NGPA 3CZXA 3R9FA 1AYEA 3CPAA 5DWMA 4ZBGA 2GFQA 4HNWB 4MRIA 2DF5A 3CDXA 3D4UA 4BBHA 2P6GA 4QC6A 4ZY1A 1VIXA 3B35A 2AFZA 2PJBA 4OC3A 2PE3A 4NGQA 4CAXA 5AG5A 2J8NA 2Z11A 4MXUA 1I21A 2EWBA 5LRJA 1VHOA 1YREA 4H89A 2ZEFA 1XFOA 3PBEA 2CTBA 3FNCA 1PU9A 5G20A 3SHPA 1Q2DA 2B3VA 5J8FA 1YW6A 3ISXA 1M4LA 1PCAA 5LRGA 2ZPAA 5JH9A 4JD6A 2EVNA 3QNVA 4P4BA 3JUWA 4PQAA 3V38A 4CRYB 1S7FA 4Y49B 5BWAB 2WSAA 4P45A 5HVGA 1R57A 1B6BA 3PFEA 4NFRA 2YNCC 4KOYA 3VWDA 2CNSA 5AG7A 2H5MA 4MCPA 1BPNA 5HVFA 2BUEA 1WK4A 4MFQA 2EO8A 4OC4A 1QMUA 1S7KA 4UEFA 2DPSA 5F48A 5ISVA 3H8EA 2VZYA 5LYLA 4YRHA 5G1ZA 3PB6X 5E96A 2V77A 2PJAA 3ISZA 3MGDA 3QB8A 2AFSA 3CXSA 4KZTA 4IK2A 2R1IA 1H8LA 2V8DA 2XEFA 2EK8A 2HUZA 3LWUA 1F57A 3PGPA 4UCNA 4A37A 4AG9A 2PCUA 4B12A 4EMEA 5CNPA 1JWQA 1RTQA 3DLJA 4PXBA 4KVXA 2Q7BA 3VARA 4MFLA 1K4JA 3FEDA 4YU9A 4PXDA 1QSMA 4UFXA 5F09A 1CPSA 4PXCA 3SI1A 2F5IA 3IJ3A 2VQYA 2F7VA 1ZLIA 2QJ8A 3NE7A 2B58A 5IV0A 2NSMA 4UFVA 4IAVA 2QMLA 4G1PA 2HV2A 3K9UA 4PPZA 1YSJA 2FXFA 5LYFA 3D68A 4HPSA 4NEXA 4P10A 3KI9A 4PK3A 4ZY0A 2ZEOA 1CG2A 3CT9A 4H2KA 2FE7A 3F5BA 3QAHA 4MHZA 3T8WA 3H4QA 1YGHA 4KLVA 4A95A 4DJLA 4WWVA 3D7FA 4NJQA 4AVBA 2B4DA 3TT2A 1WWZA 3A9LA 4F0XA 2ZEGA 2Z3KA 1IYKA 2B5GB 1KUVA 2FS5A 2DEAA 4MMOA 5J8CA 2JBKA 3IWEA 2AFMA 1DTDA 4ONWA 2CNMA 2G3TA 2Q44A 3D3SA 2OOTA 3BXMA 2PJ3A 2IQ6A 3FJUA 2ZENA 4JJXA 1XMBA 4UCPA 1Z8TA 5GCNA 2PJ1A 2Z3LA 1PUAA 1CX8A 5F49A 2AFWA 2GREA 4OKOA 3IC1A 4Q38A 3LMSA 1L0CA 3SJEA 5D29A 4FAIA 2B5GA 4ZGYB 4KOWA 3FXTA 5AGEA 5LRKA 1N71A 4CGPA 3TE4A 4KSFA 2PSWA 3TC8A 2PIZA 1QSTA 3N5FA 1HDQA 2BO9A 2CY2A 2HC9A 3NH4A 2PJ9A 2JBJA 4BMHA 3EY5A 3B3SA 1Y7RA 2PC1A 1TKJA 2I79A 3NH8A 4ZYQA 4KOXA 5CPAA 4ZX8A 2Y0MA 2YGWA 2FT0A 2NMTA 4NCZA 4W9YA 5ELYA 4CPAA 4AVCA 4C2XA 5F46A 4DYOA 3DGVA 4WJBA 2BEIA 1ARMA 1YW4A 2P6FA 4UIBA 2ZW7A 3FRMA 3KL9A 1Z5RA 4EVYA 5JPHA 2ARHA 3KKWA 4UBRA 4HNXB 4KVOE 3D2PA 4JYWA 3LODA 1ON0A 1RO5A 1XIXA 1YLEA 3NA6A 2FCKA 2ODFA 4MBUA 3GB0A 3PB4X 4OC5A 2RC4A 1Z2LA 2J9AA 1Z9UA 1TIQA 1F2PA 2PJ6A 4L8AA 3VWEA 3WR7A 5JGFA 1Y0YA 6CPAA 2PQ8A 3FX6A 4J3GA 4JXQA 4OIDA 2Q4ZA 2PJ8A 4C7IA 5K8NA 4F8ZA 1RXTA 2VBQA 2PRQA 2YNDA 1CP6A 4R3KA 1Z8WA 4UEEA 4A38A 4MJ8A 2PVVA 3W6SA 3D67A 3L2NA 2F8HA 3FYNA 4U9ZA 1S7LA 4A2ZA 3CPXA 1KUXA 3D7HA 3BI1A 1QSOA 4FD6A 4LUAA 2PJ7A 1BOBA 4NJRA 4NGRA 2ATRA 5EC4A 4R76A 2CIJA 3W91A 2FL4A 3EO4A 1M4GA 4H6UA 4KUAA 5DS0A 3WC7A 1I12A 3BI0A 2DPTA 2Z3OA 2ZW5A 2Q51A 4KOSA 3E0KA 3PFOA 2AFUA 4UEZA 3K2KA 4UIAA 3RZAA 2GLFA 3JVNA 2VEZA 1M44A 2QIRA 3B8GA 4K3NA 2C6GA 3FVLA 4MHDA 3KASA 2JEWA 1IOIA 3IIBA 2PIYA 4R6TA 4OIWA 2D4PA 5THWA 2D4OA 1Q2YA 2XEIA 3TCVA 4Q36A 5G21A 3RNZA 2GANA 1ZO0A 4UA3A 4F9VA 1VHSA 4MCQA 4R87A 4XPLA 3IO1A 3H5ZA 3NE8A 2G0BA 4QBJA 4P4EA 3FBUA 3S6KA 5FVJA 4KVME 4Y49C 4C7HA 1GYTA 2GLJA 1HEEA 2EUIA 1YQEA 3F0AA 3G3SA 2R98A 1Z4EA 1KWMA 2V8VA 1XJOA 3RBUA 3NH5A 1CBXA 4U9YA 5JQ4A 1PYTB 1IU8A 2VI7A 1BLLE 2FSRA 1IYLA 4PSWA 3S9NA 4MI4A 1FY7A 2PR1A 4DUKA 4RI1A 4X8IA 2Z3PA 4M6GA 1TKHA 2PVWA 2AFXA 1YVKA 2BL1A 4MY0A 4R8FA 2B4DB 1LOKA 2Q7SA 2C6PA 2PJCA 4M3SA 1IY7A 2Q4YA 4AG7A 3TOBA 1KZFA 1IIDA 1SQHA 5HXDA 4R3LA 2OH1A 5IB0A 4KORA 3R95A 2ANPA 4B6ZA 1Q2CA 1IOFA 2PJ5A 5A27A 1XF8A 1VGYA 4YWYA 3EXNA 3TFYA 2GU2A 1QSNA 1YLOA 3H8GA 2AFOA 4MCSA 3DDDA 3SJFA 3CXPA 3GYAA 3MN8A 2PR8A 3FH4A 1MK4A 5K8PA 3DSBA 4GXHA 4CGLA 4KSAA 4OC0A 4IF5A 5EMIA 5HH1A 2AJ6A 3R9GA 2OB0A 4NGMA 2ZW4A 3FB3A 1ZG7A 4MFJA 2RB7A 4CS0B 2V8HA 3G8WA 2WYRA 1CPXA 3CXQA 4F9UA 3FEEA 1UWYA 4KS9A 4C2YA 4B5OA 3SI0A 1S3ZA 3SXNA 3P2FA 4UWIA 4M6HA 3TTHA 4MHYA 5AG4A 4H6ZA 4CYPA 3F8KA 3HLPA 3DNSA 4FD4A 3TO6A 4F0YA 5A28A 5C88A 3D7DA 4AVAA 5HVHA 4EFDA 3RYOA 2WPWA 4ZX9A 5IB9A 3I1UA 2A4NA 4QUSA 2P0WA 4P4DA 1CP7A 5C82A 3NFZA 3D7GA 3PP9A 4NF1A 3PRTA 4PXEA 3KHZA 1VHEA 1NMTA 2PJ4A 3LD2A 1FT7A 2I00A 1BPMA 4CAWA 2POKA 4GM5A 3HUVA 2YNEA 8CPAA 2O53A 4ONUA 4DNCA 4XPDB 1MJBA 2BOAA 4II9A 4M85A 2PRBA 4X5KA 2K5TA 3C26A 3GLJA 1YX0A 4OADA 3DR6A 3BHXA 3I3GA 4P4FA 4A31A 5LYDA 1CJWA 1QSRA 3BJ7A 1JQGA 1UFHA 4X3RA 4B10A 3IWWA 4NXYA 4PK2A 2PJ0A 1QQ9A 3I9SA 3V8IA 4E8OA 1XMTA 1YVOA 2IJZA 4JXRA 4CAFA 1S5KA 2FVGA 1EE3P 3VATA 1R3NA 1TF8A 4OC1A 5J1QA 1S60A 3S6GA 1J4JA 4NSQA 5G22A 1KUYA 4B14A 4NGNA 2R8VA 4R57A 5KTAA 4CGMA 1M4DA 4XPDC 4KOTA 4A33A 4A32A 1GHEA 2I3CA 3TO7A 3FECA 1Y7EA 3KHXA 4FD5A 4OLLA 3ZZIA 5LYIA 5K8MA 2HB6A 4KOVA 4NGTA 4TWEA 1FNOA
chains in the Genus database with same CATH topology
4CGOA 4CAVA 4QVTA 4UCMA 4YGOA 2Z3NA 1LRZA 2QECA 2J8MA 4E2AA 1NE9A 3GY9A 4XNHB 2Q4VA 4XPKA 3T90A 4B5PA 3EC4A 4QB9A 4L89A 4FD7A 4CRZB 1XEBA 2Z3MA 4CYQA 2Q04A 3S6FA 3IU1A 2FIAA 4LX9A 2Z10A 4YFJA 1U6MA 3PZJA 2P6EA 3S6HA 3BLNA 4KUBA 4AB7A 4I49A 1MJ9A 2YNCA 2ZW6A 5H84A 4XNHC 3DR8A 4KOUA 4K30A 3P2HA 3FIXA 4GS4A 2VXKA 3ZJ0A 2CNTA 4HNYB 1B87A 3IWGA 2OU2A 2G3AA 5KTCA 3T9YA 2OZGA 1M1DA 4JWPA 4UWJA 2O28A 2Z0ZA 3TOAA 1Y9WA 3N7ZA 2JEVA 2B4BA 4C2ZA 1P0HA 3R9EA 2KCWA 2REFA 2VZZA 4MFPA 4R9MA 2JDDA 4UFWA 2J8RA 4PV6A 4IUSA 2CXAA 2FIWA 2DXQA 2OZHA 4MY3A 1S7NA 3R96A 2IL4A 3TO9A 2ZXVA 5H86A 2B3UA 1Z4RA 2GE3A 3D8PA 3SXOA 1OZPA 1I1DA 4RS2A 1BO4A 2PDOA 2WUUA 1XE4A 3D2MA 4E0AA 1IB1E 5AG6A 1MJAA 2REEA 4A30A 4U5YA 2R7HA 4ORFA 2BSWA 5I0CA 4B11A 1M4IA 5KTDA 5DWNA 2OZUA 4PSXA 1VKCA 4MFZA 5F47A 5IX3A 2JLMA 1P4NA 4KLWA 3IGRA 4OAEA 4HKFA 2X7BA 1YR0A 1Y9KA 3BJ8A 2HQYA 4MFKA 1NSLA 4F6AA 3UY5A 2WPXA 5HMNA 1IICA 4B13A 4CYNA 3IU2A 3JTKA 3OWCA 4C68A 3R1KA 3W6XA 2AE6A 1V0CA 4CGNA 4B5PB 2C27A 1CM0A 3EFAA 2GIVA 4CYOA 4JLYA 2Q0YA 5EBVA 2JDCA 4CAEA 1YK3A 3GKRA 3R9FA 5DWMA 4ZBGA 4HNWB 4BBHA 2P6GA 4QC6A 4CAXA 5AG5A 2J8NA 2Z11A 1I21A 1YREA 4H89A 5G20A 3FNCA 5J8FA 1PU9A 3SHPA 1Q2DA 2B3VA 2ZPAA 4JD6A 2EVNA 3JUWA 4CRYB 1S7FA 4Y49B 5BWAB 2WSAA 1R57A 1B6BA 2YNCC 4KOYA 3VWDA 2CNSA 5AG7A 2H5MA 2BUEA 1WK4A 4MFQA 1S7KA 5F48A 2DPSA 5ISVA 2VZYA 4YRHA 5G1ZA 5E96A 3MGDA 3QB8A 3CXSA 4KZTA 2R1IA 2HUZA 4UCNA 3PGPA 4B12A 4AG9A 5CNPA 4KVXA 2Q7BA 4MFLA 1K4JA 1QSMA 4UFXA 2F5IA 2VQYA 3NE7A 2B58A 5IV0A 4UFVA 2QMLA 2HV2A 3K9UA 2FXFA 4NEXA 4PK3A 2FE7A 3F5BA 3QAHA 3H4QA 1YGHA 4KLVA 4A95A 4AVBA 2B4DA 3TT2A 1WWZA 3A9LA 4F0XA 2Z3KA 1IYKA 2B5GB 1KUVA 2FS5A 5J8CA 3IWEA 2CNMA 2G3TA 2Q44A 3D3SA 4JJXA 4UCPA 5GCNA 2Z3LA 1PUAA 5F49A 4Q38A 1L0CA 2B5GA 4ZGYB 4KOWA 3FXTA 5AGEA 1N71A 4CGPA 3TE4A 4KSFA 2PSWA 1QSTA 2CY2A 4BMHA 3EY5A 1Y7RA 2PC1A 2I79A 4KOXA 2Y0MA 2YGWA 2FT0A 2NMTA 4NCZA 4AVCA 4C2XA 5F46A 2BEIA 2P6FA 2ZW7A 3FRMA 5JPHA 4EVYA 2ARHA 3KKWA 4UBRA 4HNXB 4KVOE 3D2PA 3LODA 1ON0A 1RO5A 1XIXA 1YLEA 2FCKA 4MBUA 2RC4A 3WR7A 1Z9UA 1TIQA 4L8AA 3VWEA 2PQ8A 4J3GA 4JXQA 4C7IA 1RXTA 2VBQA 4R3KA 2YNDA 4MJ8A 3W6SA 3FYNA 4U9ZA 1S7LA 4A2ZA 1KUXA 1QSOA 4FD6A 4LUAA 1BOBA 2ATRA 5EC4A 3W91A 2FL4A 3EO4A 1M4GA 4H6UA 4KUAA 1I12A 2DPTA 2Z3OA 2ZW5A 4KOSA 3E0KA 3JVNA 2VEZA 1M44A 2QIRA 3B8GA 4MHDA 2D4PA 2D4OA 1Q2YA 3TCVA 4Q36A 5G21A 2GANA 1ZO0A 4UA3A 1VHSA 4R87A 4XPLA 3H5ZA 4QBJA 2G0BA 3FBUA 3S6KA 5FVJA 4KVME 4Y49C 4C7HA 3G3SA 2EUIA 3F0AA 2R98A 1Z4EA 4U9YA 5JQ4A 2VI7A 4PSWA 2FSRA 1IYLA 4MI4A 1FY7A 2PR1A 4RI1A 2Z3PA 1YVKA 2BL1A 4MY0A 2B4DB 4AG7A 4M3SA 2Q4YA 3TOBA 1KZFA 1IIDA 1SQHA 4R3LA 2OH1A 5IB0A 4KORA 3R95A 1Q2CA 5A27A 1XF8A 3EXNA 3TFYA 1QSNA 3DDDA 3CXPA 3GYAA 2PR8A 1MK4A 3DSBA 4CGLA 4KSAA 4IF5A 5HH1A 2AJ6A 3R9GA 2OB0A 2ZW4A 3FB3A 4MFJA 4CS0B 3G8WA 3CXQA 4KS9A 4C2YA 4B5OA 1S3ZA 3SXNA 3P2FA 4UWIA 3TTHA 5AG4A 4H6ZA 4CYPA 3F8KA 3DNSA 4FD4A 3TO6A 4F0YA 5A28A 5C88A 4AVAA 3RYOA 2WPWA 2A4NA 4QUSA 2P0WA 5C82A 3PP9A 4NF1A 1NMTA 3LD2A 2I00A 4CAWA 2YNEA 4ONUA 4DNCA 4XPDB 1MJBA 4II9A 4M85A 2PRBA 4X5KA 2K5TA 3C26A 1YX0A 4OADA 3DR6A 3I3GA 4A31A 1CJWA 1QSRA 3BJ7A 1UFHA 4B10A 4NXYA 4PK2A 3I9SA 3V8IA 4E8OA 1XMTA 1YVOA 4JXRA 4CAFA 1S5KA 1S60A 3S6GA 1J4JA 4NSQA 5G22A 1KUYA 4B14A 2R8VA 4R57A 5KTAA 4CGMA 1M4DA 4XPDC 4KOTA 4A33A 4A32A 1GHEA 3TO7A 4OLLA 4FD5A 3ZZIA 4KOVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CAV A;  4QVT A;  4YGO A;  1LRZ A;  2QEC A;  2J8M A;  4E2A A;  1NE9 A;  3GY9 A;  4XNH B;  2Q4V A;  4XPK A;  3T90 A;  4B5P A;  3EC4 A;  4QB9 A;  4L89 A;  4FD7 A;  4CRZ B;  1XEB A;  2Q04 A;  3S6F A;  2FIA A;  4LX9 A;  2Z10 A;  4YFJ A;  1U6M A;  3PZJ A;  2P6E A;  3S6H A;  3BLN A;  4KUB A;  4AB7 A;  4I49 A;  1MJ9 A;  2ZW6 A;  5H84 A;  4XNH C;  3DR8 A;  4KOU A;  4K30 A;  3P2H A;  3FIX A;  4GS4 A;  2VXK A;  3ZJ0 A;  2CNT A;  4HNY B;  1B87 A;  3IWG A;  2OU2 A;  2G3A A;  5KTC A;  3T9Y A;  2OZG A;  1M1D A;  4JWP A;  4UWJ A;  2O28 A;  2Z0Z A;  3TOA A;  1Y9W A;  3N7Z A;  2JEV A;  2B4B A;  1P0H A;  3R9E A;  2KCW A;  2REF A;  2VZZ A;  4R9M A;  2JDD A;  2J8R A;  4PV6 A;  4IUS A;  2FIW A;  2DXQ A;  2OZH A;  4MY3 A;  1S7N A;  3R96 A;  2IL4 A;  3TO9 A;  2ZXV A;  5H86 A;  2B3U A;  1Z4R A;  2GE3 A;  3D8P A;  3SXO A;  1OZP A;  1I1D A;  4RS2 A;  1BO4 A;  2PDO A;  1XE4 A;  3D2M A;  4E0A A;  1IB1 E;  1MJA A;  2REE A;  4U5Y A;  2R7H A;  4ORF A;  2BSW A;  5I0C A;  1M4I A;  5KTD A;  5DWN A;  2OZU A;  4PSX A;  1VKC A;  5F47 A;  5IX3 A;  2JLM A;  1P4N A;  4KLW A;  3IGR A;  4OAE A;  4HKF A;  2X7B A;  1YR0 A;  1Y9K A;  3BJ8 A;  2HQY A;  1NSL A;  4F6A A;  3UY5 A;  2WPX A;  5HMN A;  1IIC A;  3OWC A;  3R1K A;  3W6X A;  2AE6 A;  1V0C A;  4B5P B;  2C27 A;  1CM0 A;  3EFA A;  2GIV A;  4JLY A;  2Q0Y A;  5EBV A;  2JDC A;  1YK3 A;  3GKR A;  3R9F A;  5DWM A;  4ZBG A;  4HNW B;  2P6G A;  4QC6 A;  4CAX A;  2J8N A;  2Z11 A;  1I21 A;  1YRE A;  4H89 A;  3FNC A;  5J8F A;  1PU9 A;  3SHP A;  1Q2D A;  2B3V A;  2ZPA A;  4JD6 A;  2EVN A;  3JUW A;  4CRY B;  1S7F A;  4Y49 B;  1R57 A;  1B6B A;  4KOY A;  3VWD A;  2CNS A;  2H5M A;  2BUE A;  1WK4 A;  1S7K A;  5F48 A;  5ISV A;  2VZY A;  4YRH A;  5E96 A;  3MGD A;  3QB8 A;  3CXS A;  4KZT A;  2R1I A;  2HUZ A;  3PGP A;  4AG9 A;  5CNP A;  4KVX A;  2Q7B A;  1K4J A;  1QSM A;  2F5I A;  2VQY A;  3NE7 A;  2B58 A;  5IV0 A;  2QML A;  2HV2 A;  3K9U A;  2FXF A;  4NEX A;  4PK3 A;  2FE7 A;  3F5B A;  3QAH A;  3H4Q A;  1YGH A;  4KLV A;  4AVB A;  2B4D A;  3TT2 A;  1WWZ A;  1IYK A;  2B5G B;  1KUV A;  2FS5 A;  5J8C A;  2CNM A;  2G3T A;  2Q44 A;  3D3S A;  4JJX A;  5GCN A;  1PUA A;  5F49 A;  1L0C A;  2B5G A;  4KOW A;  3FXT A;  1N71 A;  3TE4 A;  2PSW A;  1QST A;  2CY2 A;  4BMH A;  3EY5 A;  1Y7R A;  2PC1 A;  2I79 A;  4KOX A;  2Y0M A;  2FT0 A;  2NMT A;  4NCZ A;  4AVC A;  5F46 A;  2BEI A;  2P6F A;  2ZW7 A;  3FRM A;  5JPH A;  4EVY A;  2ARH A;  3KKW A;  4UBR A;  4HNX B;  4KVO E;  3D2P A;  3LOD A;  1ON0 A;  1RO5 A;  1XIX A;  1YLE A;  2FCK A;  4MBU A;  2RC4 A;  3WR7 A;  1Z9U A;  1TIQ A;  4L8A A;  3VWE A;  2PQ8 A;  4J3G A;  4JXQ A;  1RXT A;  2VBQ A;  4R3K A;  4MJ8 A;  3W6S A;  3FYN A;  4U9Z A;  1S7L A;  1KUX A;  1QSO A;  4FD6 A;  4LUA A;  1BOB A;  2ATR A;  5EC4 A;  3W91 A;  2FL4 A;  3EO4 A;  1M4G A;  4H6U A;  4KUA A;  1I12 A;  2ZW5 A;  4KOS A;  3E0K A;  3JVN A;  2VEZ A;  1M44 A;  2QIR A;  3B8G A;  4MHD A;  2D4P A;  2D4O A;  1Q2Y A;  3TCV A;  2GAN A;  4UA3 A;  1VHS A;  4R87 A;  4XPL A;  4QBJ A;  2G0B A;  3FBU A;  3S6K A;  5FVJ A;  4KVM E;  4Y49 C;  3G3S A;  2EUI A;  3F0A A;  2R98 A;  1Z4E A;  4U9Y A;  5JQ4 A;  2VI7 A;  4PSW A;  2FSR A;  1IYL A;  4MI4 A;  1FY7 A;  2PR1 A;  4RI1 A;  1YVK A;  2BL1 A;  4MY0 A;  2B4D B;  4AG7 A;  4M3S A;  2Q4Y A;  3TOB A;  1KZF A;  1IID A;  1SQH A;  4R3L A;  2OH1 A;  5IB0 A;  4KOR A;  3R95 A;  1Q2C A;  1XF8 A;  3EXN A;  3TFY A;  1QSN A;  3DDD A;  3CXP A;  3GYA A;  2PR8 A;  1MK4 A;  3DSB A;  4IF5 A;  5HH1 A;  2AJ6 A;  3R9G A;  2OB0 A;  2ZW4 A;  3FB3 A;  4CS0 B;  3G8W A;  3CXQ A;  4B5O A;  1S3Z A;  3SXN A;  3P2F A;  4UWI A;  3TTH A;  4H6Z A;  3F8K A;  3DNS A;  4FD4 A;  3TO6 A;  4F0Y A;  5C88 A;  4AVA A;  3RYO A;  2WPW A;  2A4N A;  4QUS A;  2P0W A;  5C82 A;  3PP9 A;  4NF1 A;  1NMT A;  3LD2 A;  2I00 A;  4CAW A;  4ONU A;  4DNC A;  4XPD B;  1MJB A;  4II9 A;  4M85 A;  2PRB A;  4X5K A;  2K5T A;  3C26 A;  1YX0 A;  4OAD A;  3DR6 A;  3I3G A;  1CJW A;  1QSR A;  3BJ7 A;  1UFH A;  4NXY A;  4PK2 A;  3I9S A;  3V8I A;  4E8O A;  1XMT A;  1YVO A;  4JXR A;  1S5K A;  1S60 A;  3S6G A;  1J4J A;  4NSQ A;  1KUY A;  2R8V A;  4R57 A;  5KTA A;  1M4D A;  4XPD C;  4KOT A;  1GHE A;  3TO7 A;  4OLL A;  4FD5 A;  3ZZI A;  4KOV A; 
#chains in the Genus database with same CATH topology
 1XRY A;  4CGO A;  3B3C A;  4CAV A;  4QVT A;  1X10 A;  1XBU A;  4UCM A;  4YGO A;  2Z3N A;  4P4J A;  1LRZ A;  1IGB A;  3IFE A;  2QEC A;  4P6Y A;  2J8M A;  4E2A A;  4X2T A;  4EWT A;  1NE9 A;  5JM6 A;  3GY9 A;  3VH9 A;  5I4M A;  5K8O A;  4XNH B;  3KZW A;  3FF3 A;  2Q4V A;  2ZEL A;  4XPK A;  5CBM A;  3B7I A;  2V8G A;  1BAV A;  3T90 A;  4B5P A;  3EC4 A;  4QB9 A;  2PJ2 A;  4L89 A;  4FD7 A;  3SJX A;  4CRZ B;  1XEB A;  2Z3M A;  3V7Z A;  4CYQ A;  2Q04 A;  3S6F A;  3IU1 A;  2FIA A;  4LX9 A;  2Z10 A;  4YFJ A;  4BD9 A;  1U6M A;  3PZJ A;  1OBR A;  2P6E A;  1Z8L A;  3BLN A;  3S6H A;  2CF4 A;  2XEG A;  3H8F A;  3K9T A;  3KGQ A;  4KUB A;  3WAB A;  4AB7 A;  7CPA A;  4I49 A;  4KSI A;  1Q7L A;  1YME A;  1NSA A;  1MJ9 A;  3PB8 X;  2ZOG A;  3PBB A;  1DE4 C;  2YNC A;  2ZW6 A;  2ZED A;  5H84 A;  3PEI A;  4XNH C;  3DR8 A;  4KOU A;  4K30 A;  3S9M A;  1ZG9 A;  2BCO A;  2ZEE A;  4IHM A;  3S9L A;  3P2H A;  4NGS A;  4R7M A;  3RAM A;  1TKF A;  1R43 A;  1TXR A;  4LQG A;  4Z65 A;  3FIX A;  4GS4 A;  4MHN A;  2VXK A;  4AXV A;  3ZJ0 A;  2CNT A;  4HNY B;  1B87 A;  2ABZ A;  4UF4 A;  1ARL A;  3IWG A;  2OU2 A;  2G3A A;  5KTC A;  4ZY2 A;  3T9Y A;  2OZG A;  1M1D A;  1XOV A;  2ZEH A;  1TF9 A;  4JWP A;  2O28 A;  2Z0Z A;  4UWJ A;  1Y9W A;  3N7Z A;  2JEV A;  3TOA A;  2B4B A;  4C2Z A;  1P0H A;  4FUU A;  3R9E A;  2CTC A;  2KCW A;  1F2O A;  2REF A;  3D66 A;  4P44 A;  2VZZ A;  4MFP A;  4R9M A;  2JDD A;  4UFW A;  4O23 A;  3B3W A;  2J8R A;  3B2Y A;  4PV6 A;  4IUS A;  2CXA A;  4Q7A A;  2FIW A;  2DXQ A;  3SJG A;  2OZH A;  1ZLH A;  3KR4 A;  3RO0 A;  3MRU A;  1LAM A;  3WC6 A;  4MY3 A;  2ZOF A;  1S7N A;  3R96 A;  2IL4 A;  3TO9 A;  2ZXV A;  5H86 A;  2B3U A;  2EBJ A;  1Z4R A;  4JZ0 A;  2GE3 A;  3D8P A;  1ELM P;  1A2Z A;  2QYV A;  3SXO A;  1OZP A;  1I1D A;  4RS2 A;  1BO4 A;  2ZEM A;  2PDO A;  3WC5 A;  2WUU A;  1XE4 A;  2XEJ A;  3D2M A;  1ELL P;  4A94 A;  4E0A A;  1IB1 E;  5AG6 A;  1MJA A;  3B3T A;  2REE A;  3SI2 A;  2EK9 A;  4U5Y A;  4A30 A;  1Y0R A;  2R7H A;  2BSW A;  4ORF A;  4LQ6 A;  4OP4 A;  5I0C A;  2C1C A;  3GIU A;  4B11 A;  1M4I A;  5KTD A;  4A39 A;  4OC2 A;  3PB9 X;  5DWN A;  3B3V A;  2OZU A;  4MHP A;  1LCP A;  3PB7 X;  4PSX A;  1VKC A;  4MFZ A;  4MCR A;  4TNU A;  5F47 A;  4RUH A;  5IX3 A;  2IMO A;  2JLM A;  1P4N A;  4KLW A;  2G9D A;  3IGR A;  1X12 A;  3QAY A;  1LAN A;  4OAE A;  1AMP A;  1LAP A;  4HKF A;  2X7B A;  4M6I A;  1YR0 A;  1Y9K A;  4ZI6 A;  2NYQ A;  3BJ8 A;  2VL1 A;  2HQY A;  1HDU A;  3JRU A;  5D8N A;  3FMC A;  4MFK A;  2QVP A;  1NSL A;  1AUG A;  4F6A A;  4P4I A;  3UY5 A;  2WPX A;  3IEH A;  5HMN A;  1IIC A;  2RFH A;  4B13 A;  4CYN A;  4FBE A;  3IU2 A;  2WZN A;  2OR4 A;  2ZEP A;  3JTK A;  3OWC A;  4C68 A;  3R1K A;  3W6X A;  2AE6 A;  1V0C A;  4OME A;  4CGN A;  1LFW A;  1Z8X A;  4B5P B;  2C27 A;  1CM0 A;  2O4H A;  3EFA A;  3KQX A;  2GIV A;  4RN7 A;  3TX8 A;  3KR5 A;  4JLY A;  4BIN A;  4CYO A;  2C6C A;  3GUX A;  2Q0Y A;  5EBV A;  3KQZ A;  2JDC A;  4CAE A;  4FWU A;  3WT4 A;  1YK3 A;  3GKR A;  3LAC A;  2Q43 A;  1ZG8 A;  4NGP A;  3CZX A;  3R9F A;  1AYE A;  3CPA A;  5DWM A;  4ZBG A;  2GFQ A;  4HNW B;  4MRI A;  2DF5 A;  3CDX A;  3D4U A;  4BBH A;  2P6G A;  4QC6 A;  4ZY1 A;  1VIX A;  3B35 A;  2AFZ A;  2PJB A;  4OC3 A;  2PE3 A;  4NGQ A;  4CAX A;  5AG5 A;  2J8N A;  2Z11 A;  4MXU A;  1I21 A;  2EWB A;  5LRJ A;  1VHO A;  1YRE A;  4H89 A;  2ZEF A;  1XFO A;  3PBE A;  2CTB A;  3FNC A;  1PU9 A;  5G20 A;  3SHP A;  1Q2D A;  2B3V A;  5J8F A;  1YW6 A;  3ISX A;  1M4L A;  1PCA A;  5LRG A;  2ZPA A;  5JH9 A;  4JD6 A;  2EVN A;  3QNV A;  4P4B A;  3JUW A;  4PQA A;  3V38 A;  4CRY B;  1S7F A;  4Y49 B;  5BWA B;  2WSA A;  4P45 A;  5HVG A;  1R57 A;  1B6B A;  3PFE A;  4NFR A;  2YNC C;  4KOY A;  3VWD A;  2CNS A;  5AG7 A;  2H5M A;  4MCP A;  1BPN A;  5HVF A;  2BUE A;  1WK4 A;  4MFQ A;  2EO8 A;  4OC4 A;  1QMU A;  1S7K A;  4UEF A;  2DPS A;  5F48 A;  5ISV A;  3H8E A;  2VZY A;  5LYL A;  4YRH A;  5G1Z A;  3PB6 X;  5E96 A;  2V77 A;  2PJA A;  3ISZ A;  3MGD A;  3QB8 A;  2AFS A;  3CXS A;  4KZT A;  4IK2 A;  2R1I A;  1H8L A;  2V8D A;  2XEF A;  2EK8 A;  2HUZ A;  3LWU A;  1F57 A;  3PGP A;  4UCN A;  4A37 A;  4AG9 A;  2PCU A;  4B12 A;  4EME A;  5CNP A;  1JWQ A;  1RTQ A;  3DLJ A;  4PXB A;  4KVX A;  2Q7B A;  3VAR A;  4MFL A;  1K4J A;  3FED A;  4YU9 A;  4PXD A;  1QSM A;  4UFX A;  5F09 A;  1CPS A;  4PXC A;  3SI1 A;  2F5I A;  3IJ3 A;  2VQY A;  2F7V A;  1ZLI A;  2QJ8 A;  3NE7 A;  2B58 A;  5IV0 A;  2NSM A;  4UFV A;  4IAV A;  2QML A;  4G1P A;  2HV2 A;  3K9U A;  4PPZ A;  1YSJ A;  2FXF A;  5LYF A;  3D68 A;  4HPS A;  4NEX A;  4P10 A;  3KI9 A;  4PK3 A;  4ZY0 A;  2ZEO A;  1CG2 A;  3CT9 A;  4H2K A;  2FE7 A;  3F5B A;  3QAH A;  4MHZ A;  3T8W A;  3H4Q A;  1YGH A;  4KLV A;  4A95 A;  4DJL A;  4WWV A;  3D7F A;  4NJQ A;  4AVB A;  2B4D A;  3TT2 A;  1WWZ A;  3A9L A;  4F0X A;  2ZEG A;  2Z3K A;  1IYK A;  2B5G B;  1KUV A;  2FS5 A;  2DEA A;  4MMO A;  5J8C A;  2JBK A;  3IWE A;  2AFM A;  1DTD A;  4ONW A;  2CNM A;  2G3T A;  2Q44 A;  3D3S A;  2OOT A;  3BXM A;  2PJ3 A;  2IQ6 A;  3FJU A;  2ZEN A;  4JJX A;  1XMB A;  4UCP A;  1Z8T A;  5GCN A;  2PJ1 A;  2Z3L A;  1PUA A;  1CX8 A;  5F49 A;  2AFW A;  2GRE A;  4OKO A;  3IC1 A;  4Q38 A;  3LMS A;  1L0C A;  3SJE A;  5D29 A;  4FAI A;  2B5G A;  4ZGY B;  4KOW A;  3FXT A;  5AGE A;  5LRK A;  1N71 A;  4CGP A;  3TE4 A;  4KSF A;  2PSW A;  3TC8 A;  2PIZ A;  1QST A;  3N5F A;  1HDQ A;  2BO9 A;  2CY2 A;  2HC9 A;  3NH4 A;  2PJ9 A;  2JBJ A;  4BMH A;  3EY5 A;  3B3S A;  1Y7R A;  2PC1 A;  1TKJ A;  2I79 A;  3NH8 A;  4ZYQ A;  4KOX A;  5CPA A;  4ZX8 A;  2Y0M A;  2YGW A;  2FT0 A;  2NMT A;  4NCZ A;  4W9Y A;  5ELY A;  4CPA A;  4AVC A;  4C2X A;  5F46 A;  4DYO A;  3DGV A;  4WJB A;  2BEI A;  1ARM A;  1YW4 A;  2P6F A;  4UIB A;  2ZW7 A;  3FRM A;  3KL9 A;  1Z5R A;  4EVY A;  5JPH A;  2ARH A;  3KKW A;  4UBR A;  4HNX B;  4KVO E;  3D2P A;  4JYW A;  3LOD A;  1ON0 A;  1RO5 A;  1XIX A;  1YLE A;  3NA6 A;  2FCK A;  2ODF A;  4MBU A;  3GB0 A;  3PB4 X;  4OC5 A;  2RC4 A;  1Z2L A;  2J9A A;  1Z9U A;  1TIQ A;  1F2P A;  2PJ6 A;  4L8A A;  3VWE A;  3WR7 A;  5JGF A;  1Y0Y A;  6CPA A;  2PQ8 A;  3FX6 A;  4J3G A;  4JXQ A;  4OID A;  2Q4Z A;  2PJ8 A;  4C7I A;  5K8N A;  4F8Z A;  1RXT A;  2VBQ A;  2PRQ A;  2YND A;  1CP6 A;  4R3K A;  1Z8W A;  4UEE A;  4A38 A;  4MJ8 A;  2PVV A;  3W6S A;  3D67 A;  3L2N A;  2F8H A;  3FYN A;  4U9Z A;  1S7L A;  4A2Z A;  3CPX A;  1KUX A;  3D7H A;  3BI1 A;  1QSO A;  4FD6 A;  4LUA A;  2PJ7 A;  1BOB A;  4NJR A;  4NGR A;  2ATR A;  5EC4 A;  4R76 A;  2CIJ A;  3W91 A;  2FL4 A;  3EO4 A;  1M4G A;  4H6U A;  4KUA A;  5DS0 A;  3WC7 A;  1I12 A;  3BI0 A;  2DPT A;  2Z3O A;  2ZW5 A;  2Q51 A;  4KOS A;  3E0K A;  3PFO A;  2AFU A;  4UEZ A;  3K2K A;  4UIA A;  3RZA A;  2GLF A;  3JVN A;  2VEZ A;  1M44 A;  2QIR A;  3B8G A;  4K3N A;  2C6G A;  3FVL A;  4MHD A;  3KAS A;  2JEW A;  1IOI A;  3IIB A;  2PIY A;  4R6T A;  4OIW A;  2D4P A;  5THW A;  2D4O A;  1Q2Y A;  2XEI A;  3TCV A;  4Q36 A;  5G21 A;  3RNZ A;  2GAN A;  1ZO0 A;  4UA3 A;  4F9V A;  1VHS A;  4MCQ A;  4R87 A;  4XPL A;  3IO1 A;  3H5Z A;  3NE8 A;  2G0B A;  4QBJ A;  4P4E A;  3FBU A;  3S6K A;  5FVJ A;  4KVM E;  4Y49 C;  4C7H A;  1GYT A;  2GLJ A;  1HEE A;  2EUI A;  1YQE A;  3F0A A;  3G3S A;  2R98 A;  1Z4E A;  1KWM A;  2V8V A;  1XJO A;  3RBU A;  3NH5 A;  1CBX A;  4U9Y A;  5JQ4 A;  1PYT B;  1IU8 A;  2VI7 A;  1BLL E;  2FSR A;  1IYL A;  4PSW A;  3S9N A;  4MI4 A;  1FY7 A;  2PR1 A;  4DUK A;  4RI1 A;  4X8I A;  2Z3P A;  4M6G A;  1TKH A;  2PVW A;  2AFX A;  1YVK A;  2BL1 A;  4MY0 A;  4R8F A;  2B4D B;  1LOK A;  2Q7S A;  2C6P A;  2PJC A;  4M3S A;  1IY7 A;  2Q4Y A;  4AG7 A;  3TOB A;  1KZF A;  1IID A;  1SQH A;  5HXD A;  4R3L A;  2OH1 A;  5IB0 A;  4KOR A;  3R95 A;  2ANP A;  4B6Z A;  1Q2C A;  1IOF A;  2PJ5 A;  5A27 A;  1XF8 A;  1VGY A;  4YWY A;  3EXN A;  3TFY A;  2GU2 A;  1QSN A;  1YLO A;  3H8G A;  2AFO A;  4MCS A;  3DDD A;  3SJF A;  3CXP A;  3GYA A;  3MN8 A;  2PR8 A;  3FH4 A;  1MK4 A;  5K8P A;  3DSB A;  4GXH A;  4CGL A;  4KSA A;  4OC0 A;  4IF5 A;  5EMI A;  5HH1 A;  2AJ6 A;  3R9G A;  2OB0 A;  4NGM A;  2ZW4 A;  3FB3 A;  1ZG7 A;  4MFJ A;  2RB7 A;  4CS0 B;  2V8H A;  3G8W A;  2WYR A;  1CPX A;  3CXQ A;  4F9U A;  3FEE A;  1UWY A;  4KS9 A;  4C2Y A;  4B5O A;  3SI0 A;  1S3Z A;  3SXN A;  3P2F A;  4UWI A;  4M6H A;  3TTH A;  4MHY A;  5AG4 A;  4H6Z A;  4CYP A;  3F8K A;  3HLP A;  3DNS A;  4FD4 A;  3TO6 A;  4F0Y A;  5A28 A;  5C88 A;  3D7D A;  4AVA A;  5HVH A;  4EFD A;  3RYO A;  2WPW A;  4ZX9 A;  5IB9 A;  3I1U A;  2A4N A;  4QUS A;  2P0W A;  4P4D A;  1CP7 A;  5C82 A;  3NFZ A;  3D7G A;  3PP9 A;  4NF1 A;  3PRT A;  4PXE A;  3KHZ A;  1VHE A;  1NMT A;  2PJ4 A;  3LD2 A;  1FT7 A;  2I00 A;  1BPM A;  4CAW A;  2POK A;  4GM5 A;  3HUV A;  2YNE A;  8CPA A;  2O53 A;  4ONU A;  4DNC A;  4XPD B;  1MJB A;  2BOA A;  4II9 A;  4M85 A;  2PRB A;  4X5K A;  2K5T A;  3C26 A;  3GLJ A;  1YX0 A;  4OAD A;  3DR6 A;  3BHX A;  3I3G A;  4P4F A;  4A31 A;  5LYD A;  1CJW A;  1QSR A;  3BJ7 A;  1JQG A;  1UFH A;  4X3R A;  4B10 A;  3IWW A;  4NXY A;  4PK2 A;  2PJ0 A;  1QQ9 A;  3I9S A;  3V8I A;  4E8O A;  1XMT A;  1YVO A;  2IJZ A;  4JXR A;  4CAF A;  1S5K A;  2FVG A;  1EE3 P;  3VAT A;  1R3N A;  1TF8 A;  4OC1 A;  5J1Q A;  1S60 A;  3S6G A;  1J4J A;  4NSQ A;  5G22 A;  1KUY A;  4B14 A;  4NGN A;  2R8V A;  4R57 A;  5KTA A;  4CGM A;  1M4D A;  4XPD C;  4KOT A;  4A33 A;  4A32 A;  1GHE A;  2I3C A;  3TO7 A;  3FEC A;  1Y7E A;  3KHX A;  4FD5 A;  4OLL A;  3ZZI A;  5LYI A;  5K8M A;  2HB6 A;  4KOV A;  4NGT A;  4TWE A;  1FNO A; 
#chains in the Genus database with same CATH homology
 4CGO A;  4CAV A;  4QVT A;  4UCM A;  4YGO A;  2Z3N A;  1LRZ A;  2QEC A;  2J8M A;  4E2A A;  1NE9 A;  3GY9 A;  4XNH B;  2Q4V A;  4XPK A;  3T90 A;  4B5P A;  3EC4 A;  4QB9 A;  4L89 A;  4FD7 A;  4CRZ B;  1XEB A;  2Z3M A;  4CYQ A;  2Q04 A;  3S6F A;  3IU1 A;  2FIA A;  4LX9 A;  2Z10 A;  4YFJ A;  1U6M A;  3PZJ A;  2P6E A;  3S6H A;  3BLN A;  4KUB A;  4AB7 A;  4I49 A;  1MJ9 A;  2YNC A;  2ZW6 A;  5H84 A;  4XNH C;  3DR8 A;  4KOU A;  4K30 A;  3P2H A;  3FIX A;  4GS4 A;  2VXK A;  3ZJ0 A;  2CNT A;  4HNY B;  1B87 A;  3IWG A;  2OU2 A;  2G3A A;  5KTC A;  3T9Y A;  2OZG A;  1M1D A;  4JWP A;  4UWJ A;  2O28 A;  2Z0Z A;  3TOA A;  1Y9W A;  3N7Z A;  2JEV A;  2B4B A;  4C2Z A;  1P0H A;  3R9E A;  2KCW A;  2REF A;  2VZZ A;  4MFP A;  4R9M A;  2JDD A;  4UFW A;  2J8R A;  4PV6 A;  4IUS A;  2CXA A;  2FIW A;  2DXQ A;  2OZH A;  4MY3 A;  1S7N A;  3R96 A;  2IL4 A;  3TO9 A;  2ZXV A;  5H86 A;  2B3U A;  1Z4R A;  2GE3 A;  3D8P A;  3SXO A;  1OZP A;  1I1D A;  4RS2 A;  1BO4 A;  2PDO A;  2WUU A;  1XE4 A;  3D2M A;  4E0A A;  1IB1 E;  5AG6 A;  1MJA A;  2REE A;  4A30 A;  4U5Y A;  2R7H A;  4ORF A;  2BSW A;  5I0C A;  4B11 A;  1M4I A;  5KTD A;  5DWN A;  2OZU A;  4PSX A;  1VKC A;  4MFZ A;  5F47 A;  5IX3 A;  2JLM A;  1P4N A;  4KLW A;  3IGR A;  4OAE A;  4HKF A;  2X7B A;  1YR0 A;  1Y9K A;  3BJ8 A;  2HQY A;  4MFK A;  1NSL A;  4F6A A;  3UY5 A;  2WPX A;  5HMN A;  1IIC A;  4B13 A;  4CYN A;  3IU2 A;  3JTK A;  3OWC A;  4C68 A;  3R1K A;  3W6X A;  2AE6 A;  1V0C A;  4CGN A;  4B5P B;  2C27 A;  1CM0 A;  3EFA A;  2GIV A;  4CYO A;  4JLY A;  2Q0Y A;  5EBV A;  2JDC A;  4CAE A;  1YK3 A;  3GKR A;  3R9F A;  5DWM A;  4ZBG A;  4HNW B;  4BBH A;  2P6G A;  4QC6 A;  4CAX A;  5AG5 A;  2J8N A;  2Z11 A;  1I21 A;  1YRE A;  4H89 A;  5G20 A;  3FNC A;  5J8F A;  1PU9 A;  3SHP A;  1Q2D A;  2B3V A;  2ZPA A;  4JD6 A;  2EVN A;  3JUW A;  4CRY B;  1S7F A;  4Y49 B;  5BWA B;  2WSA A;  1R57 A;  1B6B A;  2YNC C;  4KOY A;  3VWD A;  2CNS A;  5AG7 A;  2H5M A;  2BUE A;  1WK4 A;  4MFQ A;  1S7K A;  5F48 A;  2DPS A;  5ISV A;  2VZY A;  4YRH A;  5G1Z A;  5E96 A;  3MGD A;  3QB8 A;  3CXS A;  4KZT A;  2R1I A;  2HUZ A;  4UCN A;  3PGP A;  4B12 A;  4AG9 A;  5CNP A;  4KVX A;  2Q7B A;  4MFL A;  1K4J A;  1QSM A;  4UFX A;  2F5I A;  2VQY A;  3NE7 A;  2B58 A;  5IV0 A;  4UFV A;  2QML A;  2HV2 A;  3K9U A;  2FXF A;  4NEX A;  4PK3 A;  2FE7 A;  3F5B A;  3QAH A;  3H4Q A;  1YGH A;  4KLV A;  4A95 A;  4AVB A;  2B4D A;  3TT2 A;  1WWZ A;  3A9L A;  4F0X A;  2Z3K A;  1IYK A;  2B5G B;  1KUV A;  2FS5 A;  5J8C A;  3IWE A;  2CNM A;  2G3T A;  2Q44 A;  3D3S A;  4JJX A;  4UCP A;  5GCN A;  2Z3L A;  1PUA A;  5F49 A;  4Q38 A;  1L0C A;  2B5G A;  4ZGY B;  4KOW A;  3FXT A;  5AGE A;  1N71 A;  4CGP A;  3TE4 A;  4KSF A;  2PSW A;  1QST A;  2CY2 A;  4BMH A;  3EY5 A;  1Y7R A;  2PC1 A;  2I79 A;  4KOX A;  2Y0M A;  2YGW A;  2FT0 A;  2NMT A;  4NCZ A;  4AVC A;  4C2X A;  5F46 A;  2BEI A;  2P6F A;  2ZW7 A;  3FRM A;  5JPH A;  4EVY A;  2ARH A;  3KKW A;  4UBR A;  4HNX B;  4KVO E;  3D2P A;  3LOD A;  1ON0 A;  1RO5 A;  1XIX A;  1YLE A;  2FCK A;  4MBU A;  2RC4 A;  3WR7 A;  1Z9U A;  1TIQ A;  4L8A A;  3VWE A;  2PQ8 A;  4J3G A;  4JXQ A;  4C7I A;  1RXT A;  2VBQ A;  4R3K A;  2YND A;  4MJ8 A;  3W6S A;  3FYN A;  4U9Z A;  1S7L A;  4A2Z A;  1KUX A;  1QSO A;  4FD6 A;  4LUA A;  1BOB A;  2ATR A;  5EC4 A;  3W91 A;  2FL4 A;  3EO4 A;  1M4G A;  4H6U A;  4KUA A;  1I12 A;  2DPT A;  2Z3O A;  2ZW5 A;  4KOS A;  3E0K A;  3JVN A;  2VEZ A;  1M44 A;  2QIR A;  3B8G A;  4MHD A;  2D4P A;  2D4O A;  1Q2Y A;  3TCV A;  4Q36 A;  5G21 A;  2GAN A;  1ZO0 A;  4UA3 A;  1VHS A;  4R87 A;  4XPL A;  3H5Z A;  4QBJ A;  2G0B A;  3FBU A;  3S6K A;  5FVJ A;  4KVM E;  4Y49 C;  4C7H A;  3G3S A;  2EUI A;  3F0A A;  2R98 A;  1Z4E A;  4U9Y A;  5JQ4 A;  2VI7 A;  4PSW A;  2FSR A;  1IYL A;  4MI4 A;  1FY7 A;  2PR1 A;  4RI1 A;  2Z3P A;  1YVK A;  2BL1 A;  4MY0 A;  2B4D B;  4AG7 A;  4M3S A;  2Q4Y A;  3TOB A;  1KZF A;  1IID A;  1SQH A;  4R3L A;  2OH1 A;  5IB0 A;  4KOR A;  3R95 A;  1Q2C A;  5A27 A;  1XF8 A;  3EXN A;  3TFY A;  1QSN A;  3DDD A;  3CXP A;  3GYA A;  2PR8 A;  1MK4 A;  3DSB A;  4CGL A;  4KSA A;  4IF5 A;  5HH1 A;  2AJ6 A;  3R9G A;  2OB0 A;  2ZW4 A;  3FB3 A;  4MFJ A;  4CS0 B;  3G8W A;  3CXQ A;  4KS9 A;  4C2Y A;  4B5O A;  1S3Z A;  3SXN A;  3P2F A;  4UWI A;  3TTH A;  5AG4 A;  4H6Z A;  4CYP A;  3F8K A;  3DNS A;  4FD4 A;  3TO6 A;  4F0Y A;  5A28 A;  5C88 A;  4AVA A;  3RYO A;  2WPW A;  2A4N A;  4QUS A;  2P0W A;  5C82 A;  3PP9 A;  4NF1 A;  1NMT A;  3LD2 A;  2I00 A;  4CAW A;  2YNE A;  4ONU A;  4DNC A;  4XPD B;  1MJB A;  4II9 A;  4M85 A;  2PRB A;  4X5K A;  2K5T A;  3C26 A;  1YX0 A;  4OAD A;  3DR6 A;  3I3G A;  4A31 A;  1CJW A;  1QSR A;  3BJ7 A;  1UFH A;  4B10 A;  4NXY A;  4PK2 A;  3I9S A;  3V8I A;  4E8O A;  1XMT A;  1YVO A;  4JXR A;  4CAF A;  1S5K A;  1S60 A;  3S6G A;  1J4J A;  4NSQ A;  5G22 A;  1KUY A;  4B14 A;  2R8V A;  4R57 A;  5KTA A;  4CGM A;  1M4D A;  4XPD C;  4KOT A;  4A33 A;  4A32 A;  1GHE A;  3TO7 A;  4OLL A;  4FD5 A;  3ZZI A;  4KOV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...