3JUWA

Putative gnat-family acetyltransferase from bordetella pertussis.
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
167
structure length
167
Chain Sequence
RQVLKTDRLVLEPQSMARFDQWFAMERQRDEAGHRDLTEDQAWLRLCARQGMWDAYACGFYYLLDPVSGEMRGEAGFQFRRRGFGPGFDNHPEAAWAVASAHQGRGLAAEAMQALLAHHDRSSGRQRVVALIARSNLPSLRLAERLGFRGYSDVAFDGAAHLLLERA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Probable GnaT-family acetyltransferase
publication title X-ray crystal structure of putative GnaT-family acetyltransferase from Bordetella pertussis.
rcsb
source organism Bordetella pertussis
total genus 46
structure length 167
sequence length 167
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2009-09-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13302 Acetyltransf_3 Acetyltransferase (GNAT) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 3juwA00
2OB0A 3LODA 3D3SA 1BO4A 3MGDA 3BLNA 5DWNA 2Q7BA 3TOAA 2FIAA 2R1IA 4KVOE 2IL4A 3SXOA 4H89A 4CS0B 3D8PA 2FE7A 2NMTA 1OZPA 3C26A 2CNSA 3TTHA 1ON0A 2F5IA 2JEVA 2O28A 2Q04A 2R98A 5HH1A 4PK3A 3TFYA 4R3LA 1YGHA 2OZHA 1MK4A 3S6GA 3F5BA 2VZZA 2X7BA 1CJWA 1BOBA 3S6HA 2QMLA 4NF1A 3DNSA 1S7LA 2VBQA 5IX3A 4PSWA 1NE9A 1S7FA 2J8MA 5E96A 2FT0A 1Q2YA 1VHSA 4M85A 4U9YA 2WPXA 2J8RA 2PQ8A 4HNYB 2HQYA 4LX9A 2BEIA 4NCZA 3R9GA 3R1KA 2B58A 4IF5A 4K30A 3R96A 4R57A 5CNPA 1QSNA 5KTCA 2QECA 1LRZA 2REEA 2AJ6A 2G0BA 4U5YA 3R95A 5JQ4A 2Z11A 4E2AA 2P6FA 3TO9A 3PP9A 2FXFA 2JLMA 1M4IA 4AVBA 5IB0A 3V8IA 3D2MA 4J3GA 1KZFA 2G3TA 3T9YA 3WR7A 4KOWA 4CAXA 1XIXA 2P0WA 4MY3A 4KLWA 2VQYA 3FRMA 3T90A 4FD5A 2GE3A 3TO6A 3W6SA 4QC6A 3OWCA 2OH1A 2Z10A 4HNWB 4B5PB 1FY7A 4XNHB 4PV6A 2OU2A 2RC4A 4UWIA 3JUWA 2BSWA 2Y0MA 2PR8A 1IICA 2H5MA 1B6BA 3CXQA 1M4DA 4ORFA 3SHPA 1I12A 2GIVA 3UY5A 4MHDA 1Y9KA 2Q0YA 3EC4A 4KLVA 4LUAA 2ZW5A 5HMNA 5KTDA 2KCWA 3GKRA 2BUEA 2I00A 1V0CA 2JDDA 2D4OA 4JXRA 3QAHA 4H6ZA 4B5PA 3QB8A 3P2HA 3ZJ0A 4KOTA 4IUSA 1RO5A 3PZJA 5EBVA 3S6KA 5ISVA 3TE4A 2VI7A 3IWGA 1M4GA 5IV0A 1MJAA 4E8OA 3CXPA 1S5KA 1KUVA 1NSLA 2ZXVA 4YRHA 4KOSA 4KOVA 5JPHA 2EVNA 1MJBA 3R9FA 4KVXA 4HNXB 2P6EA 3GYAA 3KKWA 1I21A 4HKFA 1KUYA 5F48A 4R3KA 3PGPA 4KUBA 3ZZIA 1TIQA 4QUSA 3NE7A 2K5TA 1J4JA 4AVAA 4AVCA 4H6UA 4B5OA 2B5GB 4UBRA 1S60A 1S7NA 4PSXA 1I1DA 4NEXA 3TOBA 1MJ9A 4RI1A 5F46A 1S3ZA 1Z4EA 3VWDA 4ONUA 3DR8A 1Z9UA 2FIWA 4L89A 1IB1E 1GHEA 3TO7A 4BMHA 2J8NA 4U9ZA 4ZBGA 1SQHA 2R7HA 3B8GA 3DR6A 4KORA 2EUIA 3K9UA 2Q4YA 4X5KA 4XNHC 2B4BA 2ZPAA 2OZGA 2FL4A 4AB7A 4KUAA 1YREA 4DNCA 1QSMA 3N7ZA 4JLYA 1UFHA 4XPDB 3G8WA 2B5GA 5GCNA 2B3UA 4AG9A 2Q44A 2PDOA 2ZW6A 4FD4A 1YVOA 2R8VA 2PC1A 1NMTA 2HUZA 5F49A 3DDDA 5I0CA 2FCKA 1L0CA 1PU9A 3BJ8A 2B3VA 1IYKA 3W91A 1WK4A 3P2FA 4KZTA 4KOYA 3EY5A 1YLEA 3EXNA 1Q2DA 2JDCA 4OAEA 1P0HA 1YK3A 4JWPA 4QBJA 4M3SA 2QIRA 5H86A 4JJXA 1P4NA 5EC4A 4E0AA 2B4DB 4Y49B 5J8CA 1M44A 3EFAA 1B87A 2PSWA 2PRBA 4PK2A 4MBUA 4R87A 4RS2A 2P6GA 4XPLA 2C27A 2AE6A 4CAVA 2WPWA 3E0KA 2GANA 2FSRA 4XPKA 3D2PA 2BL1A 4YGOA 1YR0A 1Q2CA 2HV2A 4NSQA 3TCVA 1R57A 3FXTA 3F0AA 3FNCA 4YFJA 2Q4VA 3GY9A 2CNTA 1QSRA 2B4DA 3FBUA 2ATRA 3G3SA 2VZYA 3R9EA 2D4PA 4F0YA 5KTAA 3JVNA 1IIDA 3EO4A 5C82A 3W6XA 4L8AA 2CY2A 1N71A 2G3AA 3BJ7A 4MJ8A 4XPDC 3TT2A 4KVME 3SXNA 1IYLA 3I3GA 4OADA 2ZW7A 4CRZB 4FD6A 2Z0ZA 4JD6A 1U6MA 1S7KA 1XE4A 3S6FA 4MI4A 3IGRA 4QB9A 2ZW4A 4AG7A 2FS5A 4KOUA 1Y7RA 3CXSA 3H4QA 1Y9WA 4NXYA 1Z4RA 1XEBA 3FB3A 4UA3A 4EVYA 5F47A 3FIXA 1KUXA 1WWZA 4F6AA 1QSTA 4OLLA 2REFA 5J8FA 4KOXA 3RYOA 3F8KA 1PUAA 1RXTA 4Y49C 2A4NA 3FYNA 2ARHA 4JXQA 4CRYB 4MY0A 4FD7A 1VKCA 2I79A 4I49A 2CNMA 5FVJA 4QVTA 2DXQA 4R9MA 5H84A 1CM0A 2VEZA 1K4JA 1YX0A 2PR1A 1YVKA 1XMTA 2OZUA 4UWJA 1XF8A 4GS4A 3I9SA 5C88A 1QSOA 4II9A 3VWEA 3LD2A 3DSBA 2VXKA 4CAWA 5DWMA 1M1DA
chains in the Genus database with same CATH superfamily
4UEZA 4P44A 2OB0A 3LODA 3D3SA 1BO4A 5G21A 3H8EA 3MGDA 3RZAA 3BLNA 5DWNA 2Q7SA 2Q7BA 2Z3PA 2HB6A 3TOAA 4CGPA 2FIAA 2R1IA 2WZNA 2IL4A 4KVOE 3SXOA 4MCPA 4H89A 1AUGA 4CS0B 4MFLA 4A2ZA 2WYRA 4ZX8A 3D4UA 4BBHA 2PVWA 3D8PA 4PXDA 4UCMA 2FE7A 2NMTA 5HXDA 1OZPA 4Q38A 3C26A 2CNSA 4KSFA 4B6ZA 3TTHA 3NH4A 1ON0A 2F5IA 2JEVA 1XBUA 2O28A 4IHMA 2Q04A 2R98A 1Y7EA 5HH1A 3NH8A 4P4DA 4PK3A 3TFYA 1JQGA 4R3LA 1YGHA 2V8VA 2OZHA 4UFWA 4UCNA 3JRUA 4P10A 1HDQA 1CPSA 1MK4A 3PB4X 1YQEA 3S6GA 2V77A 3F5BA 2VZZA 2X7BA 1CJWA 1BOBA 3KHXA 3S6HA 2QMLA 3NA6A 3D66A 4NJRA 1ELMP 5K8OA 2PIZA 1XRYA 3B3SA 4FUUA 4NF1A 1XMBA 3DNSA 1S7LA 2VBQA 5IX3A 3KR5A 3MN8A 4PSWA 2NYQA 2J9AA 2ZEHA 1Z8WA 2QVPA 1NE9A 1S7FA 4G1PA 4UEFA 3H8FA 2IJZA 1VHEA 2J8MA 2PJ5A 2PJAA 5E96A 4B10A 4ZYQA 3IU1A 2FT0A 4C68A 1Q2YA 1VHSA 2POKA 3N5FA 4M85A 4U9YA 2I3CA 1CPXA 3D68A 2IQ6A 2WPXA 2J8RA 2PQ8A 5LYIA 5K8MA 4HNYB 2HQYA 4LX9A 3CPXA 2BEIA 2GLFA 2FVGA 2AFSA 3CT9A 6CPAA 1LOKA 4NCZA 3R9GA 3DGVA 4WJBA 2EK8A 3R1KA 4KSAA 2B58A 2YNDA 4IF5A 1GYTA 2PJ0A 2EK9A 2Q43A 4K30A 1Q7LA 4M6GA 3T8WA 3R96A 4R57A 5CNPA 3FEDA 1QSNA 5KTCA 2QECA 1LRZA 2G9DA 2REEA 5ELYA 5AG5A 1H8LA 2AJ6A 2G0BA 4U5YA 3R95A 4B12A 3BHXA 5JQ4A 2Z11A 2ZEPA 3B35A 2P6FA 4E2AA 3TO9A 3PP9A 4NGNA 2FXFA 2JLMA 1CX8A 1M4IA 4P6YA 4AVBA 4JZ0A 5IB0A 3IFEA 1KWMA 3QAYA 3WC7A 5THWA 4MFJA 1IOIA 4EWTA 4ZI6A 5EMIA 4P4JA 2OOTA 3V8IA 4CYOA 1YW6A 2YNEA 4DYOA 1Z2LA 1PYTB 3D2MA 1TKHA 4J3GA 1KZFA 2G3TA 3T9YA 3WR7A 4MCSA 4F9VA 4KOWA 4CAXA 1XIXA 2P0WA 5CBMA 1BLLE 3GB0A 4MY3A 3KQZA 1ZG9A 1AMPA 2EBJA 4KLWA 2AFWA 1JWQA 2VQYA 5A27A 3FRMA 1IGBA 3T90A 2Z3MA 4FD5A 1TF8A 1CP7A 2JBKA 3PB6X 2GE3A 3HLPA 2YNCA 4NFRA 3TO6A 3W6SA 4EFDA 4QC6A 1LAMA 2OH1A 3OWCA 2Z10A 3FMCA 3SJFA 2F8HA 2PCUA 4HNWB 4B5PB 1FY7A 4XNHB 1TKJA 4PQAA 2ZEFA 4PV6A 2OU2A 4C2YA 2F7VA 5AG7A 2RC4A 3D7DA 1AYEA 1TF9A 2PJ7A 2ZOFA 4UWIA 3RO0A 3SI2A 5LYLA 3JUWA 4CAEA 2C1CA 2BSWA 2PJ9A 2Y0MA 3WC5A 2PR8A 3GLJA 3GUXA 1IICA 2H5MA 5D8NA 3S9MA 2XEFA 2Q4ZA 2GREA 1B6BA 3CXQA 5CPAA 1M4DA 4B11A 4MXUA 3I1UA 4ORFA 3SI1A 2ZENA 3NH5A 3FX6A 3SHPA 3VARA 3B3WA 1I12A 2GIVA 3WT4A 4OIDA 3UY5A 4MHDA 2XEIA 2IMOA 1Y9KA 3K2KA 3VATA 2AFXA 5D29A 4LQ6A 4B13A 2Q0YA 3EC4A 4KLVA 4LUAA 3KQXA 2ZW5A 5HMNA 2GLJA 4UIBA 5KTDA 3D7HA 1BAVA 2KCWA 3GKRA 3MRUA 2ABZA 2BUEA 1F2OA 1FT7A 1Z8LA 4PPZA 3PB9X 2I00A 4NJQA 2C6GA 1V0CA 2PE3A 2JDDA 3B3TA 4B14A 4OC1A 3B3VA 4C7IA 2D4OA 4JXRA 2BOAA 3QAHA 4A37A 4H6ZA 4B5PA 2HC9A 3QB8A 3B2YA 3P2HA 2BCOA 3D67A 3ZJ0A 5F09A 4KOTA 2JEWA 3RBUA 4IUSA 1RO5A 3PZJA 5EBVA 3S6KA 5ISVA 2ANPA 3TE4A 2VI7A 3IWGA 1M4GA 3PFOA 4HPSA 4OC2A 1MJAA 5IV0A 4P4IA 2ODFA 1Y0YA 3CXPA 1LANA 4E8OA 1OBRA 1QQ9A 1S5KA 4FAIA 1CP6A 3FH4A 3H5ZA 1KUVA 1NSLA 2ZXVA 3CDXA 4KOSA 2YNCC 4KOVA 4YRHA 3TC8A 4MCRA 1Z5RA 5JPHA 2QJ8A 2DEAA 2PJ2A 5LRJA 4ZX9A 3KHZA 2EVNA 4X2TA 2AFMA 5I4MA 3SJEA 1MJBA 4RN7A 3R9FA 4KVXA 4HNXB 2P6EA 3GYAA 3KKWA 1I21A 4HKFA 3PEIA 3FVLA 4X3RA 4OC4A 1KUYA 5F48A 4F9UA 4R3KA 3WC6A 3PGPA 4KUBA 3ZZIA 1TIQA 2Z3OA 4QUSA 3IWWA 2ZOGA 3NE7A 4C7HA 2K5TA 1J4JA 1R3NA 3V7ZA 4Q36A 4AVAA 4H2KA 2DPSA 5JGFA 4AVCA 4LQGA 4H6UA 2ZEEA 4R76A 4IK2A 2B5GB 4B5OA 1ELLP 4IAVA 4OP4A 4UBRA 1PCAA 2Z3NA 4CGLA 3DLJA 1FNOA 1S60A 1S7NA 4CGOA 1M4LA 4PSXA 3BI0A 1I1DA 4NEXA 3TOBA 1MJ9A 4RI1A 5G22A 3VH9A 4CYPA 5F46A 2CIJA 1ZG8A 1S3ZA 1Z4EA 3KASA 3VWDA 4ONUA 3DR8A 1Z9UA 4P45A 4TNUA 2FIWA 1LAPA 1IB1E 1GHEA 4L89A 3TO7A 4BMHA 5AG4A 3S9LA 1XJOA 3IJ3A 2J8NA 4U9ZA 4ZBGA 2ZEDA 5LRGA 1SQHA 4OC5A 3KR4A 2PIYA 2EWBA 2R7HA 3B8GA 3DR6A 4KORA 4EMEA 2EUIA 3K9UA 2Q4YA 4X5KA 4XNHC 2B4BA 2ZPAA 2OZGA 1RTQA 3B3CA 2FL4A 4AB7A 4KUAA 1YREA 2DF5A 3NFZA 4F0XA 2AFUA 4DNCA 1QSMA 1Z8XA 4CGNA 2V8GA 3N7ZA 2QYVA 3IO1A 3IC1A 2Q51A 4AXVA 3GIUA 1A2ZA 4JLYA 2ZEMA 2ZEGA 1UFHA 3RAMA 4XPDB 4ZGYB 3G8WA 3NE8A 1ZO0A 2B5GA 5GCNA 2B3UA 3FECA 4AG9A 4DJLA 4M6IA 2Q44A 4ZY2A 1UWYA 2PDOA 2ZW6A 4FD4A 1YVOA 1XOVA 1YMEA 2PC1A 2R8VA 1NMTA 2HUZA 4MFZA 5F49A 2EO8A 3DDDA 5I0CA 2FCKA 1ZG7A 4MMOA 1L0CA 1CG2A 5G1ZA 2VL1A 5JH9A 1PU9A 1TKFA 3BJ8A 1X12A 2B3VA 4K3NA 4M6HA 4FWUA 1IYKA 1Y0RA 1WK4A 3KGQA 3W91A 4BINA 3IWEA 3P2FA 4UFXA 4YU9A 3SJGA 3FJUA 2V8DA 5LYDA 4C2ZA 3A9LA 4BD9A 3D7GA 4F8ZA 4KZTA 4WWVA 2PJ3A 8CPAA 1IOFA 1ZLHA 3K9TA 4KOYA 3LACA 4P4BA 2RFHA 3EY5A 4MHNA 1YLEA 3EXNA 2XEJA 1Q2DA 2JDCA 4NGQA 1QMUA 1P0HA 4OAEA 3L2NA 4UEEA 1YK3A 4CYNA 4JWPA 4A94A 4M3SA 2QIRA 4QBJA 5DS0A 3KL9A 5H86A 2CTCA 2PRQA 1P4NA 4JJXA 5EC4A 4E0AA 2B4DB 4Y49B 5K8NA 2AFZA 5J8CA 2C6CA 1NSAA 1M44A 3EFAA 3LWUA 4MFKA 3S9NA 1B87A 2PSWA 2PRBA 3KI9A 3PRTA 4UFVA 4W9YA 4PK2A 4MBUA 4NGTA 4R87A 4RS2A 4P4EA 3SI0A 2P6GA 4XPLA 2C6PA 2C27A 2AE6A 4CAVA 2WPWA 4X8IA 2ZELA 1ARMA 1XFOA 3E0KA 2GANA 4RUHA 2FSRA 4XPKA 3D2PA 4MFQA 2Z3LA 2BL1A 4YGOA 1YR0A 5BWAB 4O23A 4Q7AA 4OKOA 4A38A 1Q2CA 2OR4A 2PJ1A 2O4HA 4OIWA 1ZLIA 2HV2A 2CTBA 4NSQA 3ISZA 3TCVA 1R57A 3FXTA 4YWYA 3F0AA 4A95A 3FNCA 1YSJA 4MCQA 4YFJA 3H8GA 4KS9A 3PBBA 2Q4VA 4PXCA 3GY9A 2NSMA 2CNTA 1QSRA 2BO9A 2B4DA 4NGRA 2PJ4A 2ATRA 3FBUA 4PXBA 3PB8X 3G3SA 2VZYA 3ISXA 4UCPA 3R9EA 3CZXA 2D4PA 3PBEA 4F0YA 4R8FA 3B7IA 3SJXA 5KTAA 3JVNA 2PJ8A 1IIDA 4C2XA 3EO4A 4ZY1A 3HUVA 5C82A 1X10A 3QNVA 2RB7A 5LRKA 1VIXA 1HEEA 4OMEA 3W6XA 4L8AA 2CY2A 3D7FA 2YGWA 1N71A 2G3AA 3IU2A 3BJ7A 4MHYA 4NGSA 4MJ8A 4XPDC 4UIAA 3TT2A 1ARLA 4DUKA 1DTDA 3IIBA 4KVME 4OC0A 3SXNA 4GM5A 1EE3P 5HVFA 1IYLA 3I3GA 4OADA 2ZW7A 4CRZB 4FD6A 2Z0ZA 2JBJA 4JD6A 4CPAA 1BPNA 2PJ6A 2WSAA 1U6MA 3PFEA 1S7KA 3IEHA 1XE4A 4FBEA 3S6FA 4MI4A 4A39A 3IGRA 4QB9A 2O53A 2ZW4A 4OC3A 4AG7A 5A28A 2FS5A 4KOUA 1Y7RA 7CPAA 4UF4A 3CXSA 2CXAA 3H4QA 3RNZA 3FEEA 4A31A 1Y9WA 1HDUA 4MRIA 4NXYA 4ONWA 1Z4RA 1XEBA 3WABA 2DPTA 3V38A 5HVGA 3FB3A 4UA3A 4CYQA 4Z65A 4MHPA 4EVYA 5F47A 3FIXA 1KUXA 5IB9A 1TXRA 1R43A 1WWZA 4F6AA 1IU8A 1QSTA 4CAWA 5G20A 4OLLA 4KSIA 4A32A 2REFA 5J8FA 4KOXA 3JTKA 3RYOA 3F8KA 1PUAA 4A30A 4JYWA 4PXEA 1DE4C 4NGMA 1RXTA 4Y49C 2A4NA 5J1QA 4NGPA 3FF3A 3FYNA 5AG6A 2ARHA 1CBXA 4A33A 4JXQA 4CRYB 4MY0A 4MHZA 4FD7A 1VKCA 2I79A 1F2PA 4I49A 2CNMA 1VGYA 3KZWA 1LCPA 4MFPA 1IY7A 2AFOA 2PVVA 5FVJA 4QVTA 2DXQA 4R9MA 5H84A 4ZY0A 1CM0A 2VEZA 2PJCA 2WUUA 5AGEA 1K4JA 1YX0A 3BI1A 2CF4A 2PR1A 4CAFA 1BPMA 4CGMA 1YVKA 4R7MA 5JM6A 5K8PA 4TWEA 4GXHA 1Z8TA 5HVHA 1XMTA 1F57A 2GU2A 2OZUA 1LFWA 4P4FA 4UWJA 2Z3KA 3BXMA 1YLOA 1YW4A 2GFQA 2PJBA 1XF8A 3PB7X 3I9SA 4GS4A 3TX8A 5C88A 2ZEOA 4R6TA 1QSOA 3LMSA 4II9A 3VWEA 3LD2A 3DSBA 5LYFA 2VXKA 1VHOA 2XEGA 2V8HA 5DWMA 1M1DA 3CPAA
chains in the Genus database with same CATH topology
2OB0A 3LODA 3D3SA 1BO4A 5G21A 3MGDA 3BLNA 5DWNA 2Q7BA 2Z3PA 3TOAA 4CGPA 2FIAA 2R1IA 4KVOE 2IL4A 3SXOA 4H89A 4CS0B 4MFLA 4A2ZA 4BBHA 3D8PA 4UCMA 2FE7A 2NMTA 1OZPA 4Q38A 3C26A 2CNSA 4KSFA 3TTHA 1ON0A 2F5IA 2JEVA 2O28A 2Q04A 2R98A 5HH1A 4PK3A 3TFYA 4R3LA 1YGHA 2OZHA 4UFWA 4UCNA 1MK4A 3S6GA 3F5BA 2VZZA 2X7BA 1CJWA 1BOBA 3S6HA 2QMLA 4NF1A 3DNSA 1S7LA 2VBQA 5IX3A 4PSWA 1NE9A 1S7FA 2J8MA 5E96A 4B10A 3IU1A 2FT0A 4C68A 1Q2YA 1VHSA 4M85A 4U9YA 2WPXA 2J8RA 2PQ8A 4HNYB 2HQYA 4LX9A 2BEIA 4NCZA 3R9GA 3R1KA 4KSAA 2B58A 2YNDA 4IF5A 4K30A 3R96A 4R57A 5CNPA 1QSNA 5KTCA 2QECA 1LRZA 2REEA 5AG5A 2AJ6A 2G0BA 4U5YA 3R95A 4B12A 5JQ4A 2Z11A 4E2AA 2P6FA 3TO9A 3PP9A 2FXFA 2JLMA 1M4IA 4AVBA 5IB0A 4MFJA 3V8IA 4CYOA 2YNEA 3D2MA 4J3GA 1KZFA 2G3TA 3T9YA 3WR7A 4KOWA 4CAXA 1XIXA 2P0WA 4MY3A 4KLWA 2VQYA 5A27A 3FRMA 3T90A 2Z3MA 4FD5A 2GE3A 2YNCA 3TO6A 3W6SA 4QC6A 3OWCA 2OH1A 2Z10A 4HNWB 4B5PB 1FY7A 4XNHB 4PV6A 2OU2A 4C2YA 5AG7A 2RC4A 4UWIA 3JUWA 4CAEA 2BSWA 2Y0MA 2PR8A 1IICA 2H5MA 1B6BA 3CXQA 1M4DA 4B11A 4ORFA 3SHPA 1I12A 2GIVA 3UY5A 4MHDA 1Y9KA 4B13A 2Q0YA 3EC4A 4KLVA 4LUAA 2ZW5A 5HMNA 5KTDA 2KCWA 3GKRA 2BUEA 2I00A 1V0CA 4B14A 2JDDA 4C7IA 2D4OA 4JXRA 3QAHA 4H6ZA 4B5PA 3QB8A 3P2HA 3ZJ0A 4KOTA 4IUSA 1RO5A 3PZJA 5EBVA 3S6KA 5ISVA 3TE4A 2VI7A 3IWGA 1M4GA 5IV0A 1MJAA 4E8OA 3CXPA 1S5KA 3H5ZA 1KUVA 1NSLA 2ZXVA 4YRHA 4KOSA 2YNCC 4KOVA 5JPHA 2EVNA 1MJBA 3R9FA 4KVXA 4HNXB 2P6EA 3GYAA 3KKWA 1I21A 4HKFA 1KUYA 5F48A 4R3KA 3PGPA 4KUBA 3ZZIA 1TIQA 2Z3OA 4QUSA 3NE7A 4C7HA 2K5TA 1J4JA 4Q36A 4AVAA 2DPSA 4AVCA 4H6UA 4B5OA 2B5GB 4UBRA 2Z3NA 4CGLA 4CGOA 1S60A 1S7NA 4PSXA 1I1DA 4NEXA 3TOBA 1MJ9A 4RI1A 5G22A 4CYPA 5F46A 1S3ZA 1Z4EA 3VWDA 4ONUA 3DR8A 1Z9UA 2FIWA 4L89A 1IB1E 1GHEA 3TO7A 5AG4A 4BMHA 2J8NA 4U9ZA 4ZBGA 1SQHA 2R7HA 3B8GA 3DR6A 4KORA 2EUIA 3K9UA 2Q4YA 4X5KA 4XNHC 2B4BA 2ZPAA 2OZGA 2FL4A 4AB7A 4KUAA 1YREA 4F0XA 4DNCA 1QSMA 4CGNA 3N7ZA 4JLYA 1UFHA 4XPDB 4ZGYB 3G8WA 1ZO0A 2B5GA 5GCNA 2B3UA 4AG9A 2Q44A 2PDOA 2ZW6A 4FD4A 1YVOA 2R8VA 2PC1A 1NMTA 2HUZA 4MFZA 5F49A 3DDDA 5I0CA 2FCKA 1L0CA 5G1ZA 1PU9A 3BJ8A 2B3VA 1IYKA 3W91A 1WK4A 3IWEA 3P2FA 4UFXA 4C2ZA 3A9LA 4KZTA 4KOYA 3EY5A 1YLEA 3EXNA 1Q2DA 2JDCA 4OAEA 1P0HA 4CYNA 1YK3A 4JWPA 4QBJA 4M3SA 2QIRA 5H86A 4JJXA 1P4NA 5EC4A 4E0AA 2B4DB 4Y49B 5J8CA 1M44A 3EFAA 4MFKA 1B87A 2PSWA 2PRBA 4UFVA 4PK2A 4MBUA 4R87A 4RS2A 2P6GA 4XPLA 2C27A 2AE6A 4CAVA 2WPWA 3E0KA 2GANA 2FSRA 4XPKA 3D2PA 4MFQA 2Z3LA 2BL1A 4YGOA 1YR0A 5BWAB 1Q2CA 2HV2A 4NSQA 3TCVA 1R57A 3FXTA 3F0AA 4A95A 3FNCA 4YFJA 4KS9A 2Q4VA 3GY9A 2CNTA 1QSRA 2B4DA 3FBUA 2ATRA 3G3SA 2VZYA 4UCPA 3R9EA 2D4PA 4F0YA 5KTAA 3JVNA 1IIDA 4C2XA 3EO4A 5C82A 3W6XA 4L8AA 2CY2A 2YGWA 1N71A 2G3AA 3IU2A 3BJ7A 4MJ8A 4XPDC 3TT2A 4KVME 3SXNA 1IYLA 3I3GA 4OADA 2ZW7A 4CRZB 4FD6A 2Z0ZA 4JD6A 2WSAA 1U6MA 1S7KA 1XE4A 3S6FA 4MI4A 3IGRA 4QB9A 2ZW4A 4AG7A 5A28A 2FS5A 4KOUA 1Y7RA 3CXSA 2CXAA 3H4QA 4A31A 1Y9WA 4NXYA 1Z4RA 1XEBA 2DPTA 3FB3A 4UA3A 4CYQA 4EVYA 5F47A 3FIXA 1KUXA 1WWZA 4F6AA 1QSTA 5G20A 4OLLA 4A32A 2REFA 5J8FA 4KOXA 3JTKA 3RYOA 3F8KA 1PUAA 4A30A 1RXTA 4Y49C 2A4NA 3FYNA 5AG6A 2ARHA 4A33A 4JXQA 4CRYB 4MY0A 4FD7A 1VKCA 2I79A 4I49A 2CNMA 5FVJA 4MFPA 4QVTA 2DXQA 4R9MA 5H84A 1CM0A 2VEZA 2WUUA 5AGEA 1K4JA 1YX0A 2PR1A 4CAFA 4CGMA 1YVKA 1XMTA 2OZUA 4UWJA 2Z3KA 1XF8A 4GS4A 3I9SA 5C88A 1QSOA 4II9A 3VWEA 3LD2A 3DSBA 2VXKA 4CAWA 5DWMA 1M1DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OB0 A;  3LOD A;  3D3S A;  1BO4 A;  3MGD A;  3BLN A;  5DWN A;  2Q7B A;  3TOA A;  2FIA A;  2R1I A;  4KVO E;  2IL4 A;  3SXO A;  4H89 A;  4CS0 B;  3D8P A;  2FE7 A;  2NMT A;  1OZP A;  3C26 A;  2CNS A;  3TTH A;  1ON0 A;  2F5I A;  2JEV A;  2O28 A;  2Q04 A;  2R98 A;  5HH1 A;  4PK3 A;  3TFY A;  4R3L A;  1YGH A;  2OZH A;  1MK4 A;  3S6G A;  3F5B A;  2VZZ A;  2X7B A;  1CJW A;  1BOB A;  3S6H A;  2QML A;  4NF1 A;  3DNS A;  1S7L A;  2VBQ A;  5IX3 A;  4PSW A;  1NE9 A;  1S7F A;  2J8M A;  5E96 A;  2FT0 A;  1Q2Y A;  1VHS A;  4M85 A;  4U9Y A;  2WPX A;  2J8R A;  2PQ8 A;  4HNY B;  2HQY A;  4LX9 A;  2BEI A;  4NCZ A;  3R9G A;  3R1K A;  2B58 A;  4IF5 A;  4K30 A;  3R96 A;  4R57 A;  5CNP A;  1QSN A;  5KTC A;  2QEC A;  1LRZ A;  2REE A;  2AJ6 A;  2G0B A;  4U5Y A;  3R95 A;  5JQ4 A;  2Z11 A;  4E2A A;  2P6F A;  3TO9 A;  3PP9 A;  2FXF A;  2JLM A;  1M4I A;  4AVB A;  5IB0 A;  3V8I A;  3D2M A;  4J3G A;  1KZF A;  2G3T A;  3T9Y A;  3WR7 A;  4KOW A;  4CAX A;  1XIX A;  2P0W A;  4MY3 A;  4KLW A;  2VQY A;  3FRM A;  3T90 A;  4FD5 A;  2GE3 A;  3TO6 A;  3W6S A;  4QC6 A;  3OWC A;  2OH1 A;  2Z10 A;  4HNW B;  4B5P B;  1FY7 A;  4XNH B;  4PV6 A;  2OU2 A;  2RC4 A;  4UWI A;  3JUW A;  2BSW A;  2Y0M A;  2PR8 A;  1IIC A;  2H5M A;  1B6B A;  3CXQ A;  1M4D A;  4ORF A;  3SHP A;  1I12 A;  2GIV A;  3UY5 A;  4MHD A;  1Y9K A;  2Q0Y A;  3EC4 A;  4KLV A;  4LUA A;  2ZW5 A;  5HMN A;  5KTD A;  2KCW A;  3GKR A;  2BUE A;  2I00 A;  1V0C A;  2JDD A;  2D4O A;  4JXR A;  3QAH A;  4H6Z A;  4B5P A;  3QB8 A;  3P2H A;  3ZJ0 A;  4KOT A;  4IUS A;  1RO5 A;  3PZJ A;  5EBV A;  3S6K A;  5ISV A;  3TE4 A;  2VI7 A;  3IWG A;  1M4G A;  5IV0 A;  1MJA A;  4E8O A;  3CXP A;  1S5K A;  1KUV A;  1NSL A;  2ZXV A;  4YRH A;  4KOS A;  4KOV A;  5JPH A;  2EVN A;  1MJB A;  3R9F A;  4KVX A;  4HNX B;  2P6E A;  3GYA A;  3KKW A;  1I21 A;  4HKF A;  1KUY A;  5F48 A;  4R3K A;  3PGP A;  4KUB A;  3ZZI A;  1TIQ A;  4QUS A;  3NE7 A;  2K5T A;  1J4J A;  4AVA A;  4AVC A;  4H6U A;  4B5O A;  2B5G B;  4UBR A;  1S60 A;  1S7N A;  4PSX A;  1I1D A;  4NEX A;  3TOB A;  1MJ9 A;  4RI1 A;  5F46 A;  1S3Z A;  1Z4E A;  3VWD A;  4ONU A;  3DR8 A;  1Z9U A;  2FIW A;  4L89 A;  1IB1 E;  1GHE A;  3TO7 A;  4BMH A;  2J8N A;  4U9Z A;  4ZBG A;  1SQH A;  2R7H A;  3B8G A;  3DR6 A;  4KOR A;  2EUI A;  3K9U A;  2Q4Y A;  4X5K A;  4XNH C;  2B4B A;  2ZPA A;  2OZG A;  2FL4 A;  4AB7 A;  4KUA A;  1YRE A;  4DNC A;  1QSM A;  3N7Z A;  4JLY A;  1UFH A;  4XPD B;  3G8W A;  2B5G A;  5GCN A;  2B3U A;  4AG9 A;  2Q44 A;  2PDO A;  2ZW6 A;  4FD4 A;  1YVO A;  2R8V A;  2PC1 A;  1NMT A;  2HUZ A;  5F49 A;  3DDD A;  5I0C A;  2FCK A;  1L0C A;  1PU9 A;  3BJ8 A;  2B3V A;  1IYK A;  3W91 A;  1WK4 A;  3P2F A;  4KZT A;  4KOY A;  3EY5 A;  1YLE A;  3EXN A;  1Q2D A;  2JDC A;  4OAE A;  1P0H A;  1YK3 A;  4JWP A;  4QBJ A;  4M3S A;  2QIR A;  5H86 A;  4JJX A;  1P4N A;  5EC4 A;  4E0A A;  2B4D B;  4Y49 B;  5J8C A;  1M44 A;  3EFA A;  1B87 A;  2PSW A;  2PRB A;  4PK2 A;  4MBU A;  4R87 A;  4RS2 A;  2P6G A;  4XPL A;  2C27 A;  2AE6 A;  4CAV A;  2WPW A;  3E0K A;  2GAN A;  2FSR A;  4XPK A;  3D2P A;  2BL1 A;  4YGO A;  1YR0 A;  1Q2C A;  2HV2 A;  4NSQ A;  3TCV A;  1R57 A;  3FXT A;  3F0A A;  3FNC A;  4YFJ A;  2Q4V A;  3GY9 A;  2CNT A;  1QSR A;  2B4D A;  3FBU A;  2ATR A;  3G3S A;  2VZY A;  3R9E A;  2D4P A;  4F0Y A;  5KTA A;  3JVN A;  1IID A;  3EO4 A;  5C82 A;  3W6X A;  4L8A A;  2CY2 A;  1N71 A;  2G3A A;  3BJ7 A;  4MJ8 A;  4XPD C;  3TT2 A;  4KVM E;  3SXN A;  1IYL A;  3I3G A;  4OAD A;  2ZW7 A;  4CRZ B;  4FD6 A;  2Z0Z A;  4JD6 A;  1U6M A;  1S7K A;  1XE4 A;  3S6F A;  4MI4 A;  3IGR A;  4QB9 A;  2ZW4 A;  4AG7 A;  2FS5 A;  4KOU A;  1Y7R A;  3CXS A;  3H4Q A;  1Y9W A;  4NXY A;  1Z4R A;  1XEB A;  3FB3 A;  4UA3 A;  4EVY A;  5F47 A;  3FIX A;  1KUX A;  1WWZ A;  4F6A A;  1QST A;  4OLL A;  2REF A;  5J8F A;  4KOX A;  3RYO A;  3F8K A;  1PUA A;  1RXT A;  4Y49 C;  2A4N A;  3FYN A;  2ARH A;  4JXQ A;  4CRY B;  4MY0 A;  4FD7 A;  1VKC A;  2I79 A;  4I49 A;  2CNM A;  5FVJ A;  4QVT A;  2DXQ A;  4R9M A;  5H84 A;  1CM0 A;  2VEZ A;  1K4J A;  1YX0 A;  2PR1 A;  1YVK A;  1XMT A;  2OZU A;  4UWJ A;  1XF8 A;  4GS4 A;  3I9S A;  5C88 A;  1QSO A;  4II9 A;  3VWE A;  3LD2 A;  3DSB A;  2VXK A;  4CAW A;  5DWM A;  1M1D A; 
#chains in the Genus database with same CATH topology
 4UEZ A;  4P44 A;  2OB0 A;  3LOD A;  3D3S A;  1BO4 A;  5G21 A;  3H8E A;  3MGD A;  3RZA A;  3BLN A;  5DWN A;  2Q7S A;  2Q7B A;  2Z3P A;  2HB6 A;  3TOA A;  4CGP A;  2FIA A;  2R1I A;  2WZN A;  2IL4 A;  4KVO E;  3SXO A;  4MCP A;  4H89 A;  1AUG A;  4CS0 B;  4MFL A;  4A2Z A;  2WYR A;  4ZX8 A;  3D4U A;  4BBH A;  2PVW A;  3D8P A;  4PXD A;  4UCM A;  2FE7 A;  2NMT A;  5HXD A;  1OZP A;  4Q38 A;  3C26 A;  2CNS A;  4KSF A;  4B6Z A;  3TTH A;  3NH4 A;  1ON0 A;  2F5I A;  2JEV A;  1XBU A;  2O28 A;  4IHM A;  2Q04 A;  2R98 A;  1Y7E A;  5HH1 A;  3NH8 A;  4P4D A;  4PK3 A;  3TFY A;  1JQG A;  4R3L A;  1YGH A;  2V8V A;  2OZH A;  4UFW A;  4UCN A;  3JRU A;  4P10 A;  1HDQ A;  1CPS A;  1MK4 A;  3PB4 X;  1YQE A;  3S6G A;  2V77 A;  3F5B A;  2VZZ A;  2X7B A;  1CJW A;  1BOB A;  3KHX A;  3S6H A;  2QML A;  3NA6 A;  3D66 A;  4NJR A;  1ELM P;  5K8O A;  2PIZ A;  1XRY A;  3B3S A;  4FUU A;  4NF1 A;  1XMB A;  3DNS A;  1S7L A;  2VBQ A;  5IX3 A;  3KR5 A;  3MN8 A;  4PSW A;  2NYQ A;  2J9A A;  2ZEH A;  1Z8W A;  2QVP A;  1NE9 A;  1S7F A;  4G1P A;  4UEF A;  3H8F A;  2IJZ A;  1VHE A;  2J8M A;  2PJ5 A;  2PJA A;  5E96 A;  4B10 A;  4ZYQ A;  3IU1 A;  2FT0 A;  4C68 A;  1Q2Y A;  1VHS A;  2POK A;  3N5F A;  4M85 A;  4U9Y A;  2I3C A;  1CPX A;  3D68 A;  2IQ6 A;  2WPX A;  2J8R A;  2PQ8 A;  5LYI A;  5K8M A;  4HNY B;  2HQY A;  4LX9 A;  3CPX A;  2BEI A;  2GLF A;  2FVG A;  2AFS A;  3CT9 A;  6CPA A;  1LOK A;  4NCZ A;  3R9G A;  3DGV A;  4WJB A;  2EK8 A;  3R1K A;  4KSA A;  2B58 A;  2YND A;  4IF5 A;  1GYT A;  2PJ0 A;  2EK9 A;  2Q43 A;  4K30 A;  1Q7L A;  4M6G A;  3T8W A;  3R96 A;  4R57 A;  5CNP A;  3FED A;  1QSN A;  5KTC A;  2QEC A;  1LRZ A;  2G9D A;  2REE A;  5ELY A;  5AG5 A;  1H8L A;  2AJ6 A;  2G0B A;  4U5Y A;  3R95 A;  4B12 A;  3BHX A;  5JQ4 A;  2Z11 A;  2ZEP A;  3B35 A;  2P6F A;  4E2A A;  3TO9 A;  3PP9 A;  4NGN A;  2FXF A;  2JLM A;  1CX8 A;  1M4I A;  4P6Y A;  4AVB A;  4JZ0 A;  5IB0 A;  3IFE A;  1KWM A;  3QAY A;  3WC7 A;  5THW A;  4MFJ A;  1IOI A;  4EWT A;  4ZI6 A;  5EMI A;  4P4J A;  2OOT A;  3V8I A;  4CYO A;  1YW6 A;  2YNE A;  4DYO A;  1Z2L A;  1PYT B;  3D2M A;  1TKH A;  4J3G A;  1KZF A;  2G3T A;  3T9Y A;  3WR7 A;  4MCS A;  4F9V A;  4KOW A;  4CAX A;  1XIX A;  2P0W A;  5CBM A;  1BLL E;  3GB0 A;  4MY3 A;  3KQZ A;  1ZG9 A;  1AMP A;  2EBJ A;  4KLW A;  2AFW A;  1JWQ A;  2VQY A;  5A27 A;  3FRM A;  1IGB A;  3T90 A;  2Z3M A;  4FD5 A;  1TF8 A;  1CP7 A;  2JBK A;  3PB6 X;  2GE3 A;  3HLP A;  2YNC A;  4NFR A;  3TO6 A;  3W6S A;  4EFD A;  4QC6 A;  1LAM A;  2OH1 A;  3OWC A;  2Z10 A;  3FMC A;  3SJF A;  2F8H A;  2PCU A;  4HNW B;  4B5P B;  1FY7 A;  4XNH B;  1TKJ A;  4PQA A;  2ZEF A;  4PV6 A;  2OU2 A;  4C2Y A;  2F7V A;  5AG7 A;  2RC4 A;  3D7D A;  1AYE A;  1TF9 A;  2PJ7 A;  2ZOF A;  4UWI A;  3RO0 A;  3SI2 A;  5LYL A;  3JUW A;  4CAE A;  2C1C A;  2BSW A;  2PJ9 A;  2Y0M A;  3WC5 A;  2PR8 A;  3GLJ A;  3GUX A;  1IIC A;  2H5M A;  5D8N A;  3S9M A;  2XEF A;  2Q4Z A;  2GRE A;  1B6B A;  3CXQ A;  5CPA A;  1M4D A;  4B11 A;  4MXU A;  3I1U A;  4ORF A;  3SI1 A;  2ZEN A;  3NH5 A;  3FX6 A;  3SHP A;  3VAR A;  3B3W A;  1I12 A;  2GIV A;  3WT4 A;  4OID A;  3UY5 A;  4MHD A;  2XEI A;  2IMO A;  1Y9K A;  3K2K A;  3VAT A;  2AFX A;  5D29 A;  4LQ6 A;  4B13 A;  2Q0Y A;  3EC4 A;  4KLV A;  4LUA A;  3KQX A;  2ZW5 A;  5HMN A;  2GLJ A;  4UIB A;  5KTD A;  3D7H A;  1BAV A;  2KCW A;  3GKR A;  3MRU A;  2ABZ A;  2BUE A;  1F2O A;  1FT7 A;  1Z8L A;  4PPZ A;  3PB9 X;  2I00 A;  4NJQ A;  2C6G A;  1V0C A;  2PE3 A;  2JDD A;  3B3T A;  4B14 A;  4OC1 A;  3B3V A;  4C7I A;  2D4O A;  4JXR A;  2BOA A;  3QAH A;  4A37 A;  4H6Z A;  4B5P A;  2HC9 A;  3QB8 A;  3B2Y A;  3P2H A;  2BCO A;  3D67 A;  3ZJ0 A;  5F09 A;  4KOT A;  2JEW A;  3RBU A;  4IUS A;  1RO5 A;  3PZJ A;  5EBV A;  3S6K A;  5ISV A;  2ANP A;  3TE4 A;  2VI7 A;  3IWG A;  1M4G A;  3PFO A;  4HPS A;  4OC2 A;  1MJA A;  5IV0 A;  4P4I A;  2ODF A;  1Y0Y A;  3CXP A;  1LAN A;  4E8O A;  1OBR A;  1QQ9 A;  1S5K A;  4FAI A;  1CP6 A;  3FH4 A;  3H5Z A;  1KUV A;  1NSL A;  2ZXV A;  3CDX A;  4KOS A;  2YNC C;  4KOV A;  4YRH A;  3TC8 A;  4MCR A;  1Z5R A;  5JPH A;  2QJ8 A;  2DEA A;  2PJ2 A;  5LRJ A;  4ZX9 A;  3KHZ A;  2EVN A;  4X2T A;  2AFM A;  5I4M A;  3SJE A;  1MJB A;  4RN7 A;  3R9F A;  4KVX A;  4HNX B;  2P6E A;  3GYA A;  3KKW A;  1I21 A;  4HKF A;  3PEI A;  3FVL A;  4X3R A;  4OC4 A;  1KUY A;  5F48 A;  4F9U A;  4R3K A;  3WC6 A;  3PGP A;  4KUB A;  3ZZI A;  1TIQ A;  2Z3O A;  4QUS A;  3IWW A;  2ZOG A;  3NE7 A;  4C7H A;  2K5T A;  1J4J A;  1R3N A;  3V7Z A;  4Q36 A;  4AVA A;  4H2K A;  2DPS A;  5JGF A;  4AVC A;  4LQG A;  4H6U A;  2ZEE A;  4R76 A;  4IK2 A;  2B5G B;  4B5O A;  1ELL P;  4IAV A;  4OP4 A;  4UBR A;  1PCA A;  2Z3N A;  4CGL A;  3DLJ A;  1FNO A;  1S60 A;  1S7N A;  4CGO A;  1M4L A;  4PSX A;  3BI0 A;  1I1D A;  4NEX A;  3TOB A;  1MJ9 A;  4RI1 A;  5G22 A;  3VH9 A;  4CYP A;  5F46 A;  2CIJ A;  1ZG8 A;  1S3Z A;  1Z4E A;  3KAS A;  3VWD A;  4ONU A;  3DR8 A;  1Z9U A;  4P45 A;  4TNU A;  2FIW A;  1LAP A;  1IB1 E;  1GHE A;  4L89 A;  3TO7 A;  4BMH A;  5AG4 A;  3S9L A;  1XJO A;  3IJ3 A;  2J8N A;  4U9Z A;  4ZBG A;  2ZED A;  5LRG A;  1SQH A;  4OC5 A;  3KR4 A;  2PIY A;  2EWB A;  2R7H A;  3B8G A;  3DR6 A;  4KOR A;  4EME A;  2EUI A;  3K9U A;  2Q4Y A;  4X5K A;  4XNH C;  2B4B A;  2ZPA A;  2OZG A;  1RTQ A;  3B3C A;  2FL4 A;  4AB7 A;  4KUA A;  1YRE A;  2DF5 A;  3NFZ A;  4F0X A;  2AFU A;  4DNC A;  1QSM A;  1Z8X A;  4CGN A;  2V8G A;  3N7Z A;  2QYV A;  3IO1 A;  3IC1 A;  2Q51 A;  4AXV A;  3GIU A;  1A2Z A;  4JLY A;  2ZEM A;  2ZEG A;  1UFH A;  3RAM A;  4XPD B;  4ZGY B;  3G8W A;  3NE8 A;  1ZO0 A;  2B5G A;  5GCN A;  2B3U A;  3FEC A;  4AG9 A;  4DJL A;  4M6I A;  2Q44 A;  4ZY2 A;  1UWY A;  2PDO A;  2ZW6 A;  4FD4 A;  1YVO A;  1XOV A;  1YME A;  2PC1 A;  2R8V A;  1NMT A;  2HUZ A;  4MFZ A;  5F49 A;  2EO8 A;  3DDD A;  5I0C A;  2FCK A;  1ZG7 A;  4MMO A;  1L0C A;  1CG2 A;  5G1Z A;  2VL1 A;  5JH9 A;  1PU9 A;  1TKF A;  3BJ8 A;  1X12 A;  2B3V A;  4K3N A;  4M6H A;  4FWU A;  1IYK A;  1Y0R A;  1WK4 A;  3KGQ A;  3W91 A;  4BIN A;  3IWE A;  3P2F A;  4UFX A;  4YU9 A;  3SJG A;  3FJU A;  2V8D A;  5LYD A;  4C2Z A;  3A9L A;  4BD9 A;  3D7G A;  4F8Z A;  4KZT A;  4WWV A;  2PJ3 A;  8CPA A;  1IOF A;  1ZLH A;  3K9T A;  4KOY A;  3LAC A;  4P4B A;  2RFH A;  3EY5 A;  4MHN A;  1YLE A;  3EXN A;  2XEJ A;  1Q2D A;  2JDC A;  4NGQ A;  1QMU A;  1P0H A;  4OAE A;  3L2N A;  4UEE A;  1YK3 A;  4CYN A;  4JWP A;  4A94 A;  4M3S A;  2QIR A;  4QBJ A;  5DS0 A;  3KL9 A;  5H86 A;  2CTC A;  2PRQ A;  1P4N A;  4JJX A;  5EC4 A;  4E0A A;  2B4D B;  4Y49 B;  5K8N A;  2AFZ A;  5J8C A;  2C6C A;  1NSA A;  1M44 A;  3EFA A;  3LWU A;  4MFK A;  3S9N A;  1B87 A;  2PSW A;  2PRB A;  3KI9 A;  3PRT A;  4UFV A;  4W9Y A;  4PK2 A;  4MBU A;  4NGT A;  4R87 A;  4RS2 A;  4P4E A;  3SI0 A;  2P6G A;  4XPL A;  2C6P A;  2C27 A;  2AE6 A;  4CAV A;  2WPW A;  4X8I A;  2ZEL A;  1ARM A;  1XFO A;  3E0K A;  2GAN A;  4RUH A;  2FSR A;  4XPK A;  3D2P A;  4MFQ A;  2Z3L A;  2BL1 A;  4YGO A;  1YR0 A;  5BWA B;  4O23 A;  4Q7A A;  4OKO A;  4A38 A;  1Q2C A;  2OR4 A;  2PJ1 A;  2O4H A;  4OIW A;  1ZLI A;  2HV2 A;  2CTB A;  4NSQ A;  3ISZ A;  3TCV A;  1R57 A;  3FXT A;  4YWY A;  3F0A A;  4A95 A;  3FNC A;  1YSJ A;  4MCQ A;  4YFJ A;  3H8G A;  4KS9 A;  3PBB A;  2Q4V A;  4PXC A;  3GY9 A;  2NSM A;  2CNT A;  1QSR A;  2BO9 A;  2B4D A;  4NGR A;  2PJ4 A;  2ATR A;  3FBU A;  4PXB A;  3PB8 X;  3G3S A;  2VZY A;  3ISX A;  4UCP A;  3R9E A;  3CZX A;  2D4P A;  3PBE A;  4F0Y A;  4R8F A;  3B7I A;  3SJX A;  5KTA A;  3JVN A;  2PJ8 A;  1IID A;  4C2X A;  3EO4 A;  4ZY1 A;  3HUV A;  5C82 A;  1X10 A;  3QNV A;  2RB7 A;  5LRK A;  1VIX A;  1HEE A;  4OME A;  3W6X A;  4L8A A;  2CY2 A;  3D7F A;  2YGW A;  1N71 A;  2G3A A;  3IU2 A;  3BJ7 A;  4MHY A;  4NGS A;  4MJ8 A;  4XPD C;  4UIA A;  3TT2 A;  1ARL A;  4DUK A;  1DTD A;  3IIB A;  4KVM E;  4OC0 A;  3SXN A;  4GM5 A;  1EE3 P;  5HVF A;  1IYL A;  3I3G A;  4OAD A;  2ZW7 A;  4CRZ B;  4FD6 A;  2Z0Z A;  2JBJ A;  4JD6 A;  4CPA A;  1BPN A;  2PJ6 A;  2WSA A;  1U6M A;  3PFE A;  1S7K A;  3IEH A;  1XE4 A;  4FBE A;  3S6F A;  4MI4 A;  4A39 A;  3IGR A;  4QB9 A;  2O53 A;  2ZW4 A;  4OC3 A;  4AG7 A;  5A28 A;  2FS5 A;  4KOU A;  1Y7R A;  7CPA A;  4UF4 A;  3CXS A;  2CXA A;  3H4Q A;  3RNZ A;  3FEE A;  4A31 A;  1Y9W A;  1HDU A;  4MRI A;  4NXY A;  4ONW A;  1Z4R A;  1XEB A;  3WAB A;  2DPT A;  3V38 A;  5HVG A;  3FB3 A;  4UA3 A;  4CYQ A;  4Z65 A;  4MHP A;  4EVY A;  5F47 A;  3FIX A;  1KUX A;  5IB9 A;  1TXR A;  1R43 A;  1WWZ A;  4F6A A;  1IU8 A;  1QST A;  4CAW A;  5G20 A;  4OLL A;  4KSI A;  4A32 A;  2REF A;  5J8F A;  4KOX A;  3JTK A;  3RYO A;  3F8K A;  1PUA A;  4A30 A;  4JYW A;  4PXE A;  1DE4 C;  4NGM A;  1RXT A;  4Y49 C;  2A4N A;  5J1Q A;  4NGP A;  3FF3 A;  3FYN A;  5AG6 A;  2ARH A;  1CBX A;  4A33 A;  4JXQ A;  4CRY B;  4MY0 A;  4MHZ A;  4FD7 A;  1VKC A;  2I79 A;  1F2P A;  4I49 A;  2CNM A;  1VGY A;  3KZW A;  1LCP A;  4MFP A;  1IY7 A;  2AFO A;  2PVV A;  5FVJ A;  4QVT A;  2DXQ A;  4R9M A;  5H84 A;  4ZY0 A;  1CM0 A;  2VEZ A;  2PJC A;  2WUU A;  5AGE A;  1K4J A;  1YX0 A;  3BI1 A;  2CF4 A;  2PR1 A;  4CAF A;  1BPM A;  4CGM A;  1YVK A;  4R7M A;  5JM6 A;  5K8P A;  4TWE A;  4GXH A;  1Z8T A;  5HVH A;  1XMT A;  1F57 A;  2GU2 A;  2OZU A;  1LFW A;  4P4F A;  4UWJ A;  2Z3K A;  3BXM A;  1YLO A;  1YW4 A;  2GFQ A;  2PJB A;  1XF8 A;  3PB7 X;  3I9S A;  4GS4 A;  3TX8 A;  5C88 A;  2ZEO A;  4R6T A;  1QSO A;  3LMS A;  4II9 A;  3VWE A;  3LD2 A;  3DSB A;  5LYF A;  2VXK A;  1VHO A;  2XEG A;  2V8H A;  5DWM A;  1M1D A;  3CPA A; 
#chains in the Genus database with same CATH homology
 2OB0 A;  3LOD A;  3D3S A;  1BO4 A;  5G21 A;  3MGD A;  3BLN A;  5DWN A;  2Q7B A;  2Z3P A;  3TOA A;  4CGP A;  2FIA A;  2R1I A;  4KVO E;  2IL4 A;  3SXO A;  4H89 A;  4CS0 B;  4MFL A;  4A2Z A;  4BBH A;  3D8P A;  4UCM A;  2FE7 A;  2NMT A;  1OZP A;  4Q38 A;  3C26 A;  2CNS A;  4KSF A;  3TTH A;  1ON0 A;  2F5I A;  2JEV A;  2O28 A;  2Q04 A;  2R98 A;  5HH1 A;  4PK3 A;  3TFY A;  4R3L A;  1YGH A;  2OZH A;  4UFW A;  4UCN A;  1MK4 A;  3S6G A;  3F5B A;  2VZZ A;  2X7B A;  1CJW A;  1BOB A;  3S6H A;  2QML A;  4NF1 A;  3DNS A;  1S7L A;  2VBQ A;  5IX3 A;  4PSW A;  1NE9 A;  1S7F A;  2J8M A;  5E96 A;  4B10 A;  3IU1 A;  2FT0 A;  4C68 A;  1Q2Y A;  1VHS A;  4M85 A;  4U9Y A;  2WPX A;  2J8R A;  2PQ8 A;  4HNY B;  2HQY A;  4LX9 A;  2BEI A;  4NCZ A;  3R9G A;  3R1K A;  4KSA A;  2B58 A;  2YND A;  4IF5 A;  4K30 A;  3R96 A;  4R57 A;  5CNP A;  1QSN A;  5KTC A;  2QEC A;  1LRZ A;  2REE A;  5AG5 A;  2AJ6 A;  2G0B A;  4U5Y A;  3R95 A;  4B12 A;  5JQ4 A;  2Z11 A;  4E2A A;  2P6F A;  3TO9 A;  3PP9 A;  2FXF A;  2JLM A;  1M4I A;  4AVB A;  5IB0 A;  4MFJ A;  3V8I A;  4CYO A;  2YNE A;  3D2M A;  4J3G A;  1KZF A;  2G3T A;  3T9Y A;  3WR7 A;  4KOW A;  4CAX A;  1XIX A;  2P0W A;  4MY3 A;  4KLW A;  2VQY A;  5A27 A;  3FRM A;  3T90 A;  2Z3M A;  4FD5 A;  2GE3 A;  2YNC A;  3TO6 A;  3W6S A;  4QC6 A;  3OWC A;  2OH1 A;  2Z10 A;  4HNW B;  4B5P B;  1FY7 A;  4XNH B;  4PV6 A;  2OU2 A;  4C2Y A;  5AG7 A;  2RC4 A;  4UWI A;  3JUW A;  4CAE A;  2BSW A;  2Y0M A;  2PR8 A;  1IIC A;  2H5M A;  1B6B A;  3CXQ A;  1M4D A;  4B11 A;  4ORF A;  3SHP A;  1I12 A;  2GIV A;  3UY5 A;  4MHD A;  1Y9K A;  4B13 A;  2Q0Y A;  3EC4 A;  4KLV A;  4LUA A;  2ZW5 A;  5HMN A;  5KTD A;  2KCW A;  3GKR A;  2BUE A;  2I00 A;  1V0C A;  4B14 A;  2JDD A;  4C7I A;  2D4O A;  4JXR A;  3QAH A;  4H6Z A;  4B5P A;  3QB8 A;  3P2H A;  3ZJ0 A;  4KOT A;  4IUS A;  1RO5 A;  3PZJ A;  5EBV A;  3S6K A;  5ISV A;  3TE4 A;  2VI7 A;  3IWG A;  1M4G A;  5IV0 A;  1MJA A;  4E8O A;  3CXP A;  1S5K A;  3H5Z A;  1KUV A;  1NSL A;  2ZXV A;  4YRH A;  4KOS A;  2YNC C;  4KOV A;  5JPH A;  2EVN A;  1MJB A;  3R9F A;  4KVX A;  4HNX B;  2P6E A;  3GYA A;  3KKW A;  1I21 A;  4HKF A;  1KUY A;  5F48 A;  4R3K A;  3PGP A;  4KUB A;  3ZZI A;  1TIQ A;  2Z3O A;  4QUS A;  3NE7 A;  4C7H A;  2K5T A;  1J4J A;  4Q36 A;  4AVA A;  2DPS A;  4AVC A;  4H6U A;  4B5O A;  2B5G B;  4UBR A;  2Z3N A;  4CGL A;  4CGO A;  1S60 A;  1S7N A;  4PSX A;  1I1D A;  4NEX A;  3TOB A;  1MJ9 A;  4RI1 A;  5G22 A;  4CYP A;  5F46 A;  1S3Z A;  1Z4E A;  3VWD A;  4ONU A;  3DR8 A;  1Z9U A;  2FIW A;  4L89 A;  1IB1 E;  1GHE A;  3TO7 A;  5AG4 A;  4BMH A;  2J8N A;  4U9Z A;  4ZBG A;  1SQH A;  2R7H A;  3B8G A;  3DR6 A;  4KOR A;  2EUI A;  3K9U A;  2Q4Y A;  4X5K A;  4XNH C;  2B4B A;  2ZPA A;  2OZG A;  2FL4 A;  4AB7 A;  4KUA A;  1YRE A;  4F0X A;  4DNC A;  1QSM A;  4CGN A;  3N7Z A;  4JLY A;  1UFH A;  4XPD B;  4ZGY B;  3G8W A;  1ZO0 A;  2B5G A;  5GCN A;  2B3U A;  4AG9 A;  2Q44 A;  2PDO A;  2ZW6 A;  4FD4 A;  1YVO A;  2R8V A;  2PC1 A;  1NMT A;  2HUZ A;  4MFZ A;  5F49 A;  3DDD A;  5I0C A;  2FCK A;  1L0C A;  5G1Z A;  1PU9 A;  3BJ8 A;  2B3V A;  1IYK A;  3W91 A;  1WK4 A;  3IWE A;  3P2F A;  4UFX A;  4C2Z A;  3A9L A;  4KZT A;  4KOY A;  3EY5 A;  1YLE A;  3EXN A;  1Q2D A;  2JDC A;  4OAE A;  1P0H A;  4CYN A;  1YK3 A;  4JWP A;  4QBJ A;  4M3S A;  2QIR A;  5H86 A;  4JJX A;  1P4N A;  5EC4 A;  4E0A A;  2B4D B;  4Y49 B;  5J8C A;  1M44 A;  3EFA A;  4MFK A;  1B87 A;  2PSW A;  2PRB A;  4UFV A;  4PK2 A;  4MBU A;  4R87 A;  4RS2 A;  2P6G A;  4XPL A;  2C27 A;  2AE6 A;  4CAV A;  2WPW A;  3E0K A;  2GAN A;  2FSR A;  4XPK A;  3D2P A;  4MFQ A;  2Z3L A;  2BL1 A;  4YGO A;  1YR0 A;  5BWA B;  1Q2C A;  2HV2 A;  4NSQ A;  3TCV A;  1R57 A;  3FXT A;  3F0A A;  4A95 A;  3FNC A;  4YFJ A;  4KS9 A;  2Q4V A;  3GY9 A;  2CNT A;  1QSR A;  2B4D A;  3FBU A;  2ATR A;  3G3S A;  2VZY A;  4UCP A;  3R9E A;  2D4P A;  4F0Y A;  5KTA A;  3JVN A;  1IID A;  4C2X A;  3EO4 A;  5C82 A;  3W6X A;  4L8A A;  2CY2 A;  2YGW A;  1N71 A;  2G3A A;  3IU2 A;  3BJ7 A;  4MJ8 A;  4XPD C;  3TT2 A;  4KVM E;  3SXN A;  1IYL A;  3I3G A;  4OAD A;  2ZW7 A;  4CRZ B;  4FD6 A;  2Z0Z A;  4JD6 A;  2WSA A;  1U6M A;  1S7K A;  1XE4 A;  3S6F A;  4MI4 A;  3IGR A;  4QB9 A;  2ZW4 A;  4AG7 A;  5A28 A;  2FS5 A;  4KOU A;  1Y7R A;  3CXS A;  2CXA A;  3H4Q A;  4A31 A;  1Y9W A;  4NXY A;  1Z4R A;  1XEB A;  2DPT A;  3FB3 A;  4UA3 A;  4CYQ A;  4EVY A;  5F47 A;  3FIX A;  1KUX A;  1WWZ A;  4F6A A;  1QST A;  5G20 A;  4OLL A;  4A32 A;  2REF A;  5J8F A;  4KOX A;  3JTK A;  3RYO A;  3F8K A;  1PUA A;  4A30 A;  1RXT A;  4Y49 C;  2A4N A;  3FYN A;  5AG6 A;  2ARH A;  4A33 A;  4JXQ A;  4CRY B;  4MY0 A;  4FD7 A;  1VKC A;  2I79 A;  4I49 A;  2CNM A;  5FVJ A;  4MFP A;  4QVT A;  2DXQ A;  4R9M A;  5H84 A;  1CM0 A;  2VEZ A;  2WUU A;  5AGE A;  1K4J A;  1YX0 A;  2PR1 A;  4CAF A;  4CGM A;  1YVK A;  1XMT A;  2OZU A;  4UWJ A;  2Z3K A;  1XF8 A;  4GS4 A;  3I9S A;  5C88 A;  1QSO A;  4II9 A;  3VWE A;  3LD2 A;  3DSB A;  2VXK A;  4CAW A;  5DWM A;  1M1D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...