3JUWA

Putative gnat-family acetyltransferase from bordetella pertussis.
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
167
structure length
167
Chain Sequence
RQVLKTDRLVLEPQSMARFDQWFAMERQRDEAGHRDLTEDQAWLRLCARQGMWDAYACGFYYLLDPVSGEMRGEAGFQFRRRGFGPGFDNHPEAAWAVASAHQGRGLAAEAMQALLAHHDRSSGRQRVVALIARSNLPSLRLAERLGFRGYSDVAFDGAAHLLLERA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Probable GnaT-family acetyltransferase
publication title X-ray crystal structure of putative GnaT-family acetyltransferase from Bordetella pertussis.
rcsb
source organism Bordetella pertussis
molecule tags Transferase
total genus 46
structure length 167
sequence length 167
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2009-09-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13302 Acetyltransf_3 Acetyltransferase (GNAT) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 3juwA00
2PR1A 3E0KA 3DDDA 4U9ZA 4QC6A 4AG9A 2PQ8A 3SXNA 4YRHA 4NEXA 4MI4A 2BSWA 1N71A 1YX0A 3T9YA 3S6GA 2AJ6A 4II9A 2Q44A 3BLNA 3JUWA 4QB9A 2B5GA 1TIQA 4LX9A 2Z0ZA 1U6MA 2B3UA 2R7HA 5FVJA 1M1DA 3DSBA 4R9MA 4FD5A 4KOTA 2G3TA 4R3LA 2JEVA 2B4DA 3FXTA 3N7ZA 2P6EA 1KUYA 3MGDA 3FB3A 1QSOA 2REEA 2Z11A 2CNSA 3TOBA 4CRZB 4H89A 1J4JA 4X5KA 2CNMA 2VI7A 2G0BA 1WK4A 4KOYA 2JLMA 3G3SA 4ZBGA 3VWEA 5DWMA 3TOAA 5I0CA 5H86A 3R9FA 2DXQA 4B5OA 1I1DA 1KZFA 4MY0A 1M4IA 3R96A 1I21A 4OLLA 4NXYA 4JLYA 2BUEA 4EVYA 2H5MA 1P0HA 5CNPA 3C26A 3K9UA 3T90A 4Y49C 4R3KA 1S7FA 5H84A 2EVNA 2OH1A 4XPDC 4BMHA 5J8CA 1S7LA 1XF8A 2ZPAA 4B5PB 1S5KA 1SQHA 5C88A 4PSWA 2BEIA 4ONUA 3QAHA 2HQYA 2OZGA 2PRBA 4CS0B 1XMTA 1Y9WA 4CAXA 4KZTA 2WPWA 4H6UA 1S3ZA 4I49A 1RO5A 1QSNA 3R9GA 3D2PA 2FSRA 4AB7A 1Z4EA 4M85A 1YR0A 5JPHA 4Y49B 3G8WA 1VHSA 3CXPA 3RYOA 4L89A 4NCZA 5EBVA 4UWIA 3TO6A 4XPDB 4JXRA 3LODA 2FIAA 1QSRA 3SXOA 2HUZA 2B5GB 2P0WA 3PZJA 5JQ4A 1BO4A 1CJWA 3PGPA 1Q2DA 3TCVA 1S7KA 4ORFA 2QIRA 3V8IA 1IYKA 1PU9A 3TT2A 1LRZA 3GKRA 2FIWA 4JJXA 5F49A 3TFYA 3F5BA 1M44A 5F46A 5C82A 3W6SA 1MJ9A 2RC4A 4PK2A 1YK3A 3FYNA 3EO4A 4MBUA 3GY9A 2QECA 2IL4A 5J8FA 4QUSA 3CXQA 3BJ8A 3QB8A 2D4PA 4KOUA 3W6XA 4YGOA 3B8GA 3EC4A 2FCKA 4H6ZA 3FNCA 3S6KA 1I12A 4PSXA 2JDCA 4OADA 2CY2A 2VZYA 2Y0MA 2ZXVA 3I3GA 5F47A 3S6HA 4IF5A 2ATRA 2I79A 2Q4VA 3EXNA 5GCNA 3WR7A 4QVTA 1GHEA 2VQYA 1XE4A 3GYAA 1MJAA 2B3VA 4KOSA 4KVOE 2OZUA 2G3AA 1YGHA 4FD6A 5IB0A 4F0YA 1BOBA 3EFAA 4PV6A 1YVKA 4CRYB 1YVOA 2HV2A 4UWJA 2FS5A 1YLEA 1IICA 4FD4A 4XNHC 1Z9UA 4KOXA 3SHPA 2Q7BA 4AVAA 4HNYB 4R87A 2GIVA 4KOWA 4FD7A 3P2HA 3VWDA 3OWCA 2VBQA 4UBRA 2B58A 3D8PA 3DNSA 1K4JA 2VZZA 4K30A 2ZW7A 4OAEA 1QSTA 2ZW6A 4NSQA 3ZZIA 1WWZA 3IWGA 4MY3A 1S60A 1KUXA 2CNTA 2ZW4A 4KUBA 4E0AA 4R57A 4B5PA 4KLVA 2OZHA 4DNCA 4KVME 2FXFA 2D4OA 2GANA 4AG7A 1YREA 3FRMA 3EY5A 1NSLA 2NMTA 2P6FA 4KOVA 4UA3A 1PUAA 2R1IA 2J8NA 5DWNA 2OB0A 2EUIA 2Z10A 2C27A 3DR6A 4MHDA 1CM0A 4XNHB 3BJ7A 4U9YA 4JXQA 2K5TA 1NE9A 3FBUA 2P6GA 1IYLA 2B4DB 2J8RA 2Q04A 2PR8A 2X7BA 4KUAA 4HKFA 4NF1A 4AVBA 3NE7A 4YFJA 2AE6A 4U5YA 5EC4A 3ZJ0A 5KTCA 5E96A 1M4GA 4F6AA 1XIXA 4QBJA 1Y9KA 3I9SA 5KTAA 3IGRA 2WPXA 3W91A 1RXTA 4RS2A 2Q0YA 2PSWA 3R9EA 2O28A 1V0CA 3DR8A 2OU2A 1B6BA 4HNXB 1OZPA 4AVCA 3S6FA 3F8KA 2F5IA 1Q2CA 2FT0A 2Q4YA 2A4NA 1P4NA 3LD2A 3KKWA 1MK4A 1UFHA 2REFA 1KUVA 2JDDA 4MJ8A 4E2AA 2FE7A 4XPLA 5HH1A 1Z4RA 2PC1A 5IX3A 1QSMA 3F0AA 4JD6A 4J3GA 4IUSA 3PP9A 5F48A 2ARHA 2R8VA 3D3SA 2QMLA 4LUAA 5KTDA 1NMTA 2PDOA 3TO9A 3FIXA 4JWPA 3R95A 2KCWA 1R57A 1XEBA 1IIDA 3UY5A 2R98A 2FL4A 1L0CA 3TTHA 4PK3A 2ZW5A 5IV0A 4KLWA 1M4DA 1VKCA 3H4QA 2I00A 4GS4A 2BL1A 2VXKA 1Y7RA 4L8AA 1MJBA 1S7NA 1B87A 5HMNA 4CAVA 4KORA 4KVXA 2VEZA 3JVNA 3TE4A 1IB1E 3CXSA 4M3SA 3P2FA 2B4BA 3TO7A 4HNWB 4E8OA 5ISVA 1FY7A 2GE3A 1ON0A 2J8MA 3D2MA 4CAWA 3R1KA 1Q2YA 4RI1A 4XPKA
chains in the Genus database with same CATH superfamily
2PR1A 3E0KA 3DDDA 4U9ZA 4A38A 2CTCA 4IHMA 3PFEA 4QC6A 3A9LA 2PJAA 4AG9A 4RUHA 4RN7A 2PQ8A 3SXNA 4YRHA 3CPAA 4MI4A 4NEXA 2BSWA 1ELMP 1N71A 1CX8A 2F7VA 1YX0A 3T9YA 2V77A 3S6GA 2AJ6A 1NSAA 2CTBA 3SJEA 2Q44A 4II9A 3BLNA 3JUWA 3WC5A 3QNVA 4QB9A 7CPAA 2B5GA 1TIQA 4LX9A 2Z0ZA 2XEJA 3FEEA 4CYQA 1U6MA 2PE3A 2B3UA 2R7HA 5D8NA 5FVJA 1F57A 1M1DA 5K8MA 3DSBA 4R9MA 4FD5A 2J9AA 4KOTA 2G3TA 2AFWA 2V8HA 4A33A 4R3LA 4UCMA 2JEVA 3B3VA 2B4DA 2PJ9A 1BPNA 3FXTA 3N7ZA 3NA6A 3PFOA 2FVGA 3PEIA 4G1PA 4UEZA 2YNCA 2P6EA 3IC1A 1KUYA 4NGNA 1TXRA 3K2KA 4C7IA 4ZGYB 3MGDA 1ZLHA 3BHXA 3FB3A 3L2NA 1QSOA 2REEA 2Z11A 4FAIA 3SI0A 2CNSA 1LAMA 1XMBA 3TOBA 4CRZB 3D66A 2BO9A 2PJCA 5G1ZA 4C68A 2ANPA 4H89A 2WYRA 4AXVA 1J4JA 4X5KA 1RTQA 4B11A 3RAMA 4UFXA 2CNMA 2VI7A 2G0BA 1ZG8A 3K9TA 4DJLA 1YMEA 1WK4A 4KOYA 3PB7X 2JLMA 1M4LA 1XBUA 2ZEPA 3G3SA 3JTKA 4ZBGA 2CIJA 1BAVA 4FBEA 4B6ZA 3VWEA 5DWMA 3TOAA 3H8FA 4A32A 5I0CA 3RNZA 5H86A 2Z3LA 3R9FA 2DPSA 2ZEOA 2Q43A 4OC1A 2PIZA 4MMOA 2DXQA 4B5OA 2AFZA 1I1DA 4CGOA 1KZFA 3D7DA 1XJOA 4UEFA 4MY0A 5LYLA 3B7IA 1M4IA 3R96A 1HDQA 1I21A 4O23A 1H8LA 4NXYA 4OLLA 5F09A 4H2KA 2BUEA 2PJ1A 4JLYA 1QQ9A 5AGEA 4EVYA 2H5MA 1P0HA 5CNPA 3C26A 5D29A 3K9UA 3T90A 4Y49C 4R3KA 4JZ0A 1S7FA 5G21A 4MHNA 2Q4ZA 1DTDA 4TWEA 1VHEA 3PB9X 5H84A 2EVNA 2OH1A 2PJ8A 3KHXA 4OC4A 2PRQA 4XPDC 3IU1A 4BMHA 5LYFA 3H8GA 4NGTA 3WC6A 1ARMA 2V8GA 3RO0A 4GM5A 1VHOA 5J8CA 1CBXA 1Y7EA 4PXBA 1S7LA 2I3CA 3B3SA 3TX8A 1CG2A 1XF8A 2ZPAA 4B5PB 1S5KA 3NH5A 4MHZA 4MXUA 1VIXA 4KSAA 3QAYA 1SQHA 4M6GA 5C88A 3T8WA 3DLJA 4PSWA 3N5FA 2BEIA 1YW6A 4ONUA 4MFZA 4HPSA 3FF3A 3MN8A 3QAHA 2HQYA 2PVWA 2OZGA 4MCPA 3D4UA 2PRBA 5LRGA 1AMPA 4CS0B 1XMTA 2JBJA 1Y9WA 3B35A 4P4IA 4CAXA 4KZTA 2WPWA 4H6UA 4OC5A 1S3ZA 1F2OA 5JGFA 4I49A 1RO5A 1TF9A 1QSNA 4PXDA 3R9GA 1XRYA 4YU9A 3D2PA 3FEDA 2FSRA 4UF4A 1Q7LA 2PIYA 3DGVA 3HUVA 4PQAA 4UFWA 4BBHA 4AB7A 1Z4EA 4M85A 1YR0A 5JPHA 4MFJA 4Y49B 3G8WA 1VHSA 2Z3KA 1TF8A 3CXPA 3KZWA 2EK8A 3RYOA 4B13A 4L89A 3KASA 3WABA 4CAFA 4NCZA 5EBVA 2C6PA 2DPTA 4UWIA 4XPDB 3TO6A 4A31A 4JXRA 5LYDA 3LODA 2FIAA 5HVHA 4A94A 1QSRA 3SXOA 2HUZA 1AYEA 2B5GB 2AFSA 2P0WA 4OC3A 3PZJA 5JQ4A 1BO4A 1CJWA 2JEWA 3PGPA 1Q2DA 4DUKA 3TCVA 1S7KA 2AFOA 2POKA 3V7ZA 4ORFA 4BD9A 2QIRA 2Z3NA 3V8IA 1IYKA 2G9DA 4MCRA 5HVGA 1PU9A 5JM6A 3TT2A 3CZXA 4CGLA 4P4DA 2ABZA 1LRZA 4F8ZA 3BXMA 4ZYQA 3V38A 5K8OA 3GKRA 2FIWA 4JJXA 2ZEHA 2IJZA 5AG5A 5F49A 3TFYA 2HC9A 3F5BA 5LRKA 3D67A 5HVFA 1M44A 5F46A 4F9VA 1ZG9A 2PJ6A 3IU2A 4MHYA 5C82A 2GREA 3W6SA 1MJ9A 1R43A 2RC4A 4PK2A 1YK3A 3FYNA 2C6GA 4WJBA 5K8PA 3EO4A 3PB4X 3S9LA 4MBUA 4FUUA 3GLJA 1IY7A 2NSMA 3GY9A 1QMUA 4MFLA 1Y0YA 2QECA 2IL4A 1IOIA 3FX6A 3MRUA 5J8FA 4QUSA 3CXQA 2ZOFA 1CPSA 3BJ8A 3QB8A 5A27A 1R3NA 2PJ3A 2Z3PA 3D68A 4PPZA 3TC8A 2D4PA 2ZEEA 3B3TA 4KOUA 3W6XA 4B10A 4YGOA 2ZENA 1IGBA 3B8GA 3EC4A 2FCKA 4H6ZA 1ZO0A 3FNCA 3S6KA 1CP7A 1I12A 4FWUA 2V8DA 4PSXA 2PJ0A 4A2ZA 2AFUA 2JDCA 4OADA 4PXCA 2CY2A 2VZYA 2Y0MA 2ZXVA 3I3GA 3IO1A 5F47A 3S6HA 4P4FA 2WUUA 2ATRA 4IF5A 2I79A 2Q4VA 1YSJA 1AUGA 3EXNA 3KL9A 5GCNA 3NH4A 4R76A 3WR7A 4P10A 4QVTA 1GHEA 2PVVA 2VQYA 1XE4A 3GYAA 3LMSA 1MJAA 2B3VA 5A28A 2WSAA 4KOSA 1ARLA 1HEEA 2C6CA 3IFEA 4C2ZA 4KVOE 2OZUA 2G3AA 1YGHA 3LACA 2Q7SA 4P4JA 4TNUA 1HDUA 3KR5A 4FD6A 5CPAA 2QYVA 4ZY0A 5IB0A 4F0YA 1BOBA 1XFOA 3EFAA 3NH8A 3PB8X 4PV6A 4NJRA 1YVKA 4CRYB 1YVOA 2HV2A 4P44A 4UWJA 4ZY1A 2FS5A 1JWQA 4UEEA 1YLEA 1IICA 2V8VA 2XEGA 1A2ZA 4FD4A 3B3WA 4XNHC 4C7HA 1Z9UA 3KHZA 3IEHA 4X2TA 3KI9A 4KOXA 4IAVA 3SHPA 2GLFA 2Q7BA 1YQEA 4AVAA 5AG6A 4KSFA 4KSIA 4HNYB 2GFQA 4OC2A 4R87A 6CPAA 2ZOGA 2YNCC 2GIVA 4KOWA 4FD7A 4K3NA 3GB0A 1IU8A 3P2HA 3OWCA 3VWDA 4MCQA 2VBQA 4UBRA 2B58A 2DEAA 3D8PA 4R6TA 4YWYA 2PJBA 3DNSA 3CDXA 1K4JA 4UFVA 2VZZA 1PYTB 4P4BA 4K30A 4UIBA 1CP6A 2ZW7A 5AG4A 1Z8XA 1QSTA 3IIBA 4OAEA 4C2YA 2YGWA 2ZW6A 4NSQA 5IB9A 2F8HA 4R7MA 3ZZIA 1WWZA 3IWGA 4MY3A 1S60A 1KUXA 2CNTA 4WWVA 2ZW4A 4KUBA 1X12A 4E0AA 4R57A 4B5PA 4KLVA 2OZHA 4DNCA 4KVME 2FXFA 2ZEFA 3GIUA 4M6HA 2D4OA 2GANA 4AG7A 1YREA 4B12A 2QVPA 3VH9A 1LCPA 5THWA 1FT7A 3FRMA 3EY5A 1KWMA 1NSLA 4CAEA 2NMTA 2P6FA 4RI1A 4KOVA 4UA3A 1PUAA 4UCPA 3CT9A 2R1IA 2J8NA 1Y0RA 3S9MA 4CGNA 4A30A 5DWNA 3VARA 2OB0A 4MHPA 2EUIA 5HXDA 3SJGA 5LYIA 3LWUA 2Z10A 2GU2A 2C27A 3DR6A 5DS0A 4MHDA 4LQGA 4MFPA 1CM0A 4XNHB 5BWAB 3BJ7A 4EFDA 4U9YA 4JXQA 2K5TA 1TKFA 2ZELA 2ZEGA 5G22A 1NE9A 3FBUA 4Z65A 5CBMA 1F2PA 4P4EA 2RFHA 2P6GA 5I4MA 1IYLA 2B4DB 2HB6A 2J8RA 3NE8A 2CXAA 1LOKA 2Q04A 1FNOA 4GXHA 1CPXA 1BPMA 2PR8A 2X7BA 3KQZA 5G20A 3KR4A 5J1QA 4ZX9A 4KUAA 2EWBA 3H5ZA 4HKFA 4NF1A 4AVBA 1YLOA 2XEIA 5JH9A 2QJ8A 3NE7A 4YFJA 2PJ5A 2AE6A 4MFKA 4U5YA 2AFMA 5EC4A 4LQ6A 3ZJ0A 5K8NA 2EK9A 3H8EA 4X8IA 3PB6X 1M4GA 5E96A 4CGPA 5KTCA 4F6AA 1XIXA 4CYOA 4QBJA 3SJFA 2C1CA 4CYPA 3FJUA 1Y9KA 1ZG7A 3I9SA 2EBJA 3D7HA 3IGRA 4OIDA 5KTAA 2WPXA 3W91A 2ZEMA 1RXTA 1Z5RA 2O53A 2IQ6A 1LANA 2Q0YA 4RS2A 3SJXA 2PSWA 3R9EA 4P6YA 2O28A 4X3RA 4F0XA 4MFQA 3FECA 3D7GA 1V0CA 1Z8TA 2O4HA 2Z3MA 3BI0A 3DR8A 2OU2A 1EE3P 2RB7A 1B6BA 2Q51A 4Q38A 2NYQA 4ZX8A 4HNXB 1XOVA 1OZPA 3KQXA 4AVCA 4P45A 3S6FA 3F8KA 2F5IA 3I1UA 3FVLA 1Q2CA 2FT0A 1UWYA 4IK2A 4ONWA 2AFXA 2Q4YA 4NFRA 4PXEA 3SI1A 1X10A 4DYOA 2A4NA 1P4NA 3LD2A 4EMEA 1ZLIA 3KKWA 4R8FA 2OOTA 1TKJA 4Q36A 1MK4A 1Z2LA 3RBUA 4NJQA 1UFHA 4NGPA 2REFA 3FH4A 1KUVA 1BLLE 2JDDA 3HLPA 4MJ8A 3IWEA 2FE7A 4E2AA 4XPLA 5HH1A 1Z8LA 4F9UA 1Z4RA 2JBKA 2PC1A 5IX3A 1QSMA 3F0AA 4JD6A 1YW4A 4J3GA 4OMEA 4IUSA 4NGMA 1PCAA 3PP9A 5F48A 3SI2A 4ZI6A 4OKOA 2ARHA 2R8VA 1LFWA 5AG7A 3D3SA 2QMLA 3KGQA 3WC7A 3FMCA 4LUAA 5KTDA 1NMTA 1Z8WA 3B3CA 2PDOA 3TO9A 3FIXA 3VATA 4A39A 5EMIA 4MCSA 4JWPA 3R95A 2KCWA 4CYNA 4OIWA 1R57A 1XEBA 4NGQA 3ISXA 1IIDA 3UY5A 2ZEDA 2R98A 4W9YA 2WZNA 8CPAA 2FL4A 1L0CA 2BCOA 3TTHA 4PK3A 4C2XA 4CGMA 2ZW5A 5ELYA 4NGSA 3B2YA 5IV0A 4KLWA 4A37A 2YNDA 1M4DA 1VKCA 1JQGA 2Z3OA 3H4QA 3JRUA 2IMOA 4BINA 5LRJA 3PBEA 2I00A 1VGYA 3D7FA 2PCUA 4MRIA 1GYTA 4GS4A 1IOFA 2BL1A 2VXKA 1Y7RA 4L8AA 3ISZA 1DE4C 2EO8A 1MJBA 1S7NA 4CPAA 3PRTA 1B87A 2PJ4A 5HMNA 1LAPA 4CAVA 4KORA 4KVXA 2VEZA 4NGRA 2DF5A 1TKHA 3NFZA 4OP4A 3GUXA 3PBBA 3JVNA 2ODFA 3BI1A 3TE4A 3IJ3A 4UIAA 3IWWA 1IB1E 4UCNA 4B14A 2PJ2A 1OBRA 3CPXA 3CXSA 4M3SA 3P2FA 2CF4A 2GLJA 2B4BA 3RZAA 4A95A 3TO7A 4ZY2A 4HNWB 4OC0A 4E8OA 4KS9A 5ISVA 1FY7A 2GE3A 1ON0A 2OR4A 4Q7AA 2J8MA 2BOAA 2PJ7A 3D2MA 4M6IA 4CAWA 3R1KA 3WT4A 4EWTA 3S9NA 4JYWA 1ELLP 1Q2YA 2YNEA 4XPKA 2VL1A 2XEFA
chains in the Genus database with same CATH topology
2PR1A 3E0KA 3DDDA 4U9ZA 4QC6A 3A9LA 4AG9A 2PQ8A 3SXNA 4YRHA 4NEXA 4MI4A 2BSWA 1N71A 1YX0A 3T9YA 3S6GA 2AJ6A 4II9A 2Q44A 3BLNA 3JUWA 4QB9A 2B5GA 1TIQA 4LX9A 2Z0ZA 4CYQA 1U6MA 2B3UA 2R7HA 5FVJA 1M1DA 3DSBA 4R9MA 4FD5A 4KOTA 2G3TA 4A33A 4R3LA 4UCMA 2JEVA 2B4DA 3FXTA 3N7ZA 2YNCA 2P6EA 1KUYA 4C7IA 4ZGYB 3MGDA 3FB3A 1QSOA 2REEA 2Z11A 2CNSA 3TOBA 4CRZB 5G1ZA 4C68A 4H89A 1J4JA 4X5KA 4B11A 4UFXA 2CNMA 2VI7A 2G0BA 1WK4A 4KOYA 2JLMA 3G3SA 3JTKA 4ZBGA 3VWEA 5DWMA 3TOAA 4A32A 5I0CA 5H86A 2Z3LA 3R9FA 2DPSA 2DXQA 4B5OA 4CGOA 1I1DA 1KZFA 4MY0A 1M4IA 3R96A 1I21A 4OLLA 4NXYA 4JLYA 2BUEA 5AGEA 4EVYA 2H5MA 1P0HA 5CNPA 3C26A 3K9UA 3T90A 4Y49C 4R3KA 1S7FA 5G21A 5H84A 2EVNA 2OH1A 4XPDC 3IU1A 4BMHA 5J8CA 1S7LA 1XF8A 2ZPAA 4B5PB 1S5KA 4KSAA 1SQHA 5C88A 4PSWA 2BEIA 4ONUA 4MFZA 3QAHA 2HQYA 2OZGA 2PRBA 4CS0B 1XMTA 1Y9WA 4CAXA 4KZTA 2WPWA 4H6UA 1S3ZA 4I49A 1RO5A 1QSNA 3R9GA 3D2PA 2FSRA 4UFWA 4BBHA 4AB7A 1Z4EA 4M85A 1YR0A 5JPHA 4MFJA 4Y49B 3G8WA 1VHSA 2Z3KA 3CXPA 3RYOA 4CAFA 4B13A 4L89A 4NCZA 5EBVA 2DPTA 4UWIA 4XPDB 3TO6A 4A31A 4JXRA 3LODA 2FIAA 1QSRA 3SXOA 2HUZA 2B5GB 2P0WA 3PZJA 5JQ4A 1BO4A 1CJWA 3PGPA 1Q2DA 3TCVA 1S7KA 4ORFA 2QIRA 2Z3NA 3V8IA 1IYKA 1PU9A 3TT2A 4CGLA 1LRZA 3GKRA 2FIWA 4JJXA 5AG5A 5F49A 3TFYA 3F5BA 1M44A 5F46A 3IU2A 5C82A 3W6SA 1MJ9A 2RC4A 4PK2A 1YK3A 3FYNA 3EO4A 4MBUA 3GY9A 4MFLA 2QECA 2IL4A 5J8FA 4QUSA 3CXQA 3BJ8A 3QB8A 5A27A 2Z3PA 2D4PA 4KOUA 4B10A 3W6XA 4YGOA 3B8GA 3EC4A 2FCKA 4H6ZA 1ZO0A 3FNCA 3S6KA 1I12A 4PSXA 4A2ZA 2JDCA 4OADA 2CY2A 2VZYA 2Y0MA 2ZXVA 3I3GA 5F47A 3S6HA 2WUUA 2ATRA 4IF5A 2I79A 2Q4VA 3EXNA 5GCNA 3WR7A 4QVTA 1GHEA 2VQYA 1XE4A 3GYAA 1MJAA 2B3VA 5A28A 2WSAA 4KOSA 4C2ZA 4KVOE 2OZUA 2G3AA 1YGHA 4FD6A 5IB0A 4F0YA 1BOBA 3EFAA 4PV6A 1YVKA 4CRYB 1YVOA 2HV2A 4UWJA 2FS5A 1YLEA 1IICA 4C7HA 4FD4A 4XNHC 1Z9UA 4KOXA 3SHPA 2Q7BA 4AVAA 5AG6A 4KSFA 4HNYB 4R87A 2YNCC 2GIVA 4KOWA 4FD7A 3P2HA 3VWDA 3OWCA 2VBQA 4UBRA 2B58A 3D8PA 3DNSA 1K4JA 4UFVA 2VZZA 4K30A 2ZW7A 5AG4A 4OAEA 1QSTA 4C2YA 2YGWA 2ZW6A 4NSQA 3ZZIA 1WWZA 3IWGA 4MY3A 1S60A 1KUXA 2CNTA 2ZW4A 4KUBA 4E0AA 4R57A 4B5PA 4KLVA 2OZHA 4DNCA 4KVME 2FXFA 2D4OA 2GANA 4AG7A 1YREA 4B12A 3FRMA 3EY5A 1NSLA 4CAEA 2NMTA 2P6FA 4KOVA 4UA3A 1PUAA 4UCPA 2R1IA 2J8NA 4CGNA 4A30A 5DWNA 2OB0A 2EUIA 2Z10A 2C27A 3DR6A 4MHDA 4MFPA 1CM0A 4XNHB 5BWAB 3BJ7A 4U9YA 4JXQA 2K5TA 5G22A 1NE9A 3FBUA 2P6GA 1IYLA 2B4DB 2J8RA 2CXAA 2Q04A 2PR8A 2X7BA 5G20A 4KUAA 3H5ZA 4HKFA 4NF1A 4AVBA 3NE7A 4YFJA 2AE6A 4MFKA 4U5YA 5EC4A 3ZJ0A 4CGPA 5E96A 5KTCA 1M4GA 4F6AA 1XIXA 4CYOA 4QBJA 4CYPA 1Y9KA 3I9SA 5KTAA 3IGRA 2WPXA 3W91A 1RXTA 4RS2A 2Q0YA 2PSWA 3R9EA 2O28A 4F0XA 4MFQA 1V0CA 2Z3MA 3DR8A 2OU2A 1B6BA 4Q38A 4HNXB 1OZPA 4AVCA 3S6FA 3F8KA 2F5IA 1Q2CA 2FT0A 2Q4YA 2A4NA 1P4NA 3LD2A 3KKWA 4Q36A 1MK4A 1UFHA 2REFA 1KUVA 2JDDA 4MJ8A 4E2AA 3IWEA 2FE7A 4XPLA 5HH1A 1Z4RA 2PC1A 5IX3A 1QSMA 3F0AA 4JD6A 4J3GA 4IUSA 3PP9A 5F48A 2ARHA 2R8VA 5AG7A 3D3SA 2QMLA 4LUAA 5KTDA 1NMTA 2PDOA 3TO9A 3FIXA 4JWPA 3R95A 2KCWA 4CYNA 1R57A 1XEBA 1IIDA 3UY5A 2R98A 2FL4A 1L0CA 3TTHA 4PK3A 4C2XA 4CGMA 2ZW5A 5IV0A 4KLWA 2YNDA 1M4DA 1VKCA 2Z3OA 3H4QA 2I00A 4GS4A 2BL1A 2VXKA 1Y7RA 4L8AA 1MJBA 1S7NA 1B87A 5HMNA 4CAVA 4KORA 4KVXA 2VEZA 3JVNA 3TE4A 4UCNA 1IB1E 4B14A 3CXSA 4M3SA 3P2FA 2B4BA 4A95A 3TO7A 4HNWB 4E8OA 4KS9A 5ISVA 1FY7A 2GE3A 1ON0A 2J8MA 3D2MA 4CAWA 3R1KA 1Q2YA 4RI1A 2YNEA 4XPKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PR1 A;  3E0K A;  3DDD A;  4U9Z A;  4QC6 A;  4AG9 A;  2PQ8 A;  3SXN A;  4YRH A;  4NEX A;  4MI4 A;  2BSW A;  1N71 A;  1YX0 A;  3T9Y A;  3S6G A;  2AJ6 A;  4II9 A;  2Q44 A;  3BLN A;  3JUW A;  4QB9 A;  2B5G A;  1TIQ A;  4LX9 A;  2Z0Z A;  1U6M A;  2B3U A;  2R7H A;  5FVJ A;  1M1D A;  3DSB A;  4R9M A;  4FD5 A;  4KOT A;  2G3T A;  4R3L A;  2JEV A;  2B4D A;  3FXT A;  3N7Z A;  2P6E A;  1KUY A;  3MGD A;  3FB3 A;  1QSO A;  2REE A;  2Z11 A;  2CNS A;  3TOB A;  4CRZ B;  4H89 A;  1J4J A;  4X5K A;  2CNM A;  2VI7 A;  2G0B A;  1WK4 A;  4KOY A;  2JLM A;  3G3S A;  4ZBG A;  3VWE A;  5DWM A;  3TOA A;  5I0C A;  5H86 A;  3R9F A;  2DXQ A;  4B5O A;  1I1D A;  1KZF A;  4MY0 A;  1M4I A;  3R96 A;  1I21 A;  4OLL A;  4NXY A;  4JLY A;  2BUE A;  4EVY A;  2H5M A;  1P0H A;  5CNP A;  3C26 A;  3K9U A;  3T90 A;  4Y49 C;  4R3K A;  1S7F A;  5H84 A;  2EVN A;  2OH1 A;  4XPD C;  4BMH A;  5J8C A;  1S7L A;  1XF8 A;  2ZPA A;  4B5P B;  1S5K A;  1SQH A;  5C88 A;  4PSW A;  2BEI A;  4ONU A;  3QAH A;  2HQY A;  2OZG A;  2PRB A;  4CS0 B;  1XMT A;  1Y9W A;  4CAX A;  4KZT A;  2WPW A;  4H6U A;  1S3Z A;  4I49 A;  1RO5 A;  1QSN A;  3R9G A;  3D2P A;  2FSR A;  4AB7 A;  1Z4E A;  4M85 A;  1YR0 A;  5JPH A;  4Y49 B;  3G8W A;  1VHS A;  3CXP A;  3RYO A;  4L89 A;  4NCZ A;  5EBV A;  4UWI A;  3TO6 A;  4XPD B;  4JXR A;  3LOD A;  2FIA A;  1QSR A;  3SXO A;  2HUZ A;  2B5G B;  2P0W A;  3PZJ A;  5JQ4 A;  1BO4 A;  1CJW A;  3PGP A;  1Q2D A;  3TCV A;  1S7K A;  4ORF A;  2QIR A;  3V8I A;  1IYK A;  1PU9 A;  3TT2 A;  1LRZ A;  3GKR A;  2FIW A;  4JJX A;  5F49 A;  3TFY A;  3F5B A;  1M44 A;  5F46 A;  5C82 A;  3W6S A;  1MJ9 A;  2RC4 A;  4PK2 A;  1YK3 A;  3FYN A;  3EO4 A;  4MBU A;  3GY9 A;  2QEC A;  2IL4 A;  5J8F A;  4QUS A;  3CXQ A;  3BJ8 A;  3QB8 A;  2D4P A;  4KOU A;  3W6X A;  4YGO A;  3B8G A;  3EC4 A;  2FCK A;  4H6Z A;  3FNC A;  3S6K A;  1I12 A;  4PSX A;  2JDC A;  4OAD A;  2CY2 A;  2VZY A;  2Y0M A;  2ZXV A;  3I3G A;  5F47 A;  3S6H A;  4IF5 A;  2ATR A;  2I79 A;  2Q4V A;  3EXN A;  5GCN A;  3WR7 A;  4QVT A;  1GHE A;  2VQY A;  1XE4 A;  3GYA A;  1MJA A;  2B3V A;  4KOS A;  4KVO E;  2OZU A;  2G3A A;  1YGH A;  4FD6 A;  5IB0 A;  4F0Y A;  1BOB A;  3EFA A;  4PV6 A;  1YVK A;  4CRY B;  1YVO A;  2HV2 A;  4UWJ A;  2FS5 A;  1YLE A;  1IIC A;  4FD4 A;  4XNH C;  1Z9U A;  4KOX A;  3SHP A;  2Q7B A;  4AVA A;  4HNY B;  4R87 A;  2GIV A;  4KOW A;  4FD7 A;  3P2H A;  3VWD A;  3OWC A;  2VBQ A;  4UBR A;  2B58 A;  3D8P A;  3DNS A;  1K4J A;  2VZZ A;  4K30 A;  2ZW7 A;  4OAE A;  1QST A;  2ZW6 A;  4NSQ A;  3ZZI A;  1WWZ A;  3IWG A;  4MY3 A;  1S60 A;  1KUX A;  2CNT A;  2ZW4 A;  4KUB A;  4E0A A;  4R57 A;  4B5P A;  4KLV A;  2OZH A;  4DNC A;  4KVM E;  2FXF A;  2D4O A;  2GAN A;  4AG7 A;  1YRE A;  3FRM A;  3EY5 A;  1NSL A;  2NMT A;  2P6F A;  4KOV A;  4UA3 A;  1PUA A;  2R1I A;  2J8N A;  5DWN A;  2OB0 A;  2EUI A;  2Z10 A;  2C27 A;  3DR6 A;  4MHD A;  1CM0 A;  4XNH B;  3BJ7 A;  4U9Y A;  4JXQ A;  2K5T A;  1NE9 A;  3FBU A;  2P6G A;  1IYL A;  2B4D B;  2J8R A;  2Q04 A;  2PR8 A;  2X7B A;  4KUA A;  4HKF A;  4NF1 A;  4AVB A;  3NE7 A;  4YFJ A;  2AE6 A;  4U5Y A;  5EC4 A;  3ZJ0 A;  5KTC A;  5E96 A;  1M4G A;  4F6A A;  1XIX A;  4QBJ A;  1Y9K A;  3I9S A;  5KTA A;  3IGR A;  2WPX A;  3W91 A;  1RXT A;  4RS2 A;  2Q0Y A;  2PSW A;  3R9E A;  2O28 A;  1V0C A;  3DR8 A;  2OU2 A;  1B6B A;  4HNX B;  1OZP A;  4AVC A;  3S6F A;  3F8K A;  2F5I A;  1Q2C A;  2FT0 A;  2Q4Y A;  2A4N A;  1P4N A;  3LD2 A;  3KKW A;  1MK4 A;  1UFH A;  2REF A;  1KUV A;  2JDD A;  4MJ8 A;  4E2A A;  2FE7 A;  4XPL A;  5HH1 A;  1Z4R A;  2PC1 A;  5IX3 A;  1QSM A;  3F0A A;  4JD6 A;  4J3G A;  4IUS A;  3PP9 A;  5F48 A;  2ARH A;  2R8V A;  3D3S A;  2QML A;  4LUA A;  5KTD A;  1NMT A;  2PDO A;  3TO9 A;  3FIX A;  4JWP A;  3R95 A;  2KCW A;  1R57 A;  1XEB A;  1IID A;  3UY5 A;  2R98 A;  2FL4 A;  1L0C A;  3TTH A;  4PK3 A;  2ZW5 A;  5IV0 A;  4KLW A;  1M4D A;  1VKC A;  3H4Q A;  2I00 A;  4GS4 A;  2BL1 A;  2VXK A;  1Y7R A;  4L8A A;  1MJB A;  1S7N A;  1B87 A;  5HMN A;  4CAV A;  4KOR A;  4KVX A;  2VEZ A;  3JVN A;  3TE4 A;  1IB1 E;  3CXS A;  4M3S A;  3P2F A;  2B4B A;  3TO7 A;  4HNW B;  4E8O A;  5ISV A;  1FY7 A;  2GE3 A;  1ON0 A;  2J8M A;  3D2M A;  4CAW A;  3R1K A;  1Q2Y A;  4RI1 A;  4XPK A; 
#chains in the Genus database with same CATH topology
 2PR1 A;  3E0K A;  3DDD A;  4U9Z A;  4A38 A;  2CTC A;  4IHM A;  3PFE A;  4QC6 A;  3A9L A;  2PJA A;  4AG9 A;  4RUH A;  4RN7 A;  2PQ8 A;  3SXN A;  4YRH A;  3CPA A;  4MI4 A;  4NEX A;  2BSW A;  1ELM P;  1N71 A;  1CX8 A;  2F7V A;  1YX0 A;  3T9Y A;  2V77 A;  3S6G A;  2AJ6 A;  1NSA A;  2CTB A;  3SJE A;  2Q44 A;  4II9 A;  3BLN A;  3JUW A;  3WC5 A;  3QNV A;  4QB9 A;  7CPA A;  2B5G A;  1TIQ A;  4LX9 A;  2Z0Z A;  2XEJ A;  3FEE A;  4CYQ A;  1U6M A;  2PE3 A;  2B3U A;  2R7H A;  5D8N A;  5FVJ A;  1F57 A;  1M1D A;  5K8M A;  3DSB A;  4R9M A;  4FD5 A;  2J9A A;  4KOT A;  2G3T A;  2AFW A;  2V8H A;  4A33 A;  4R3L A;  4UCM A;  2JEV A;  3B3V A;  2B4D A;  2PJ9 A;  1BPN A;  3FXT A;  3N7Z A;  3NA6 A;  3PFO A;  2FVG A;  3PEI A;  4G1P A;  4UEZ A;  2YNC A;  2P6E A;  3IC1 A;  1KUY A;  4NGN A;  1TXR A;  3K2K A;  4C7I A;  4ZGY B;  3MGD A;  1ZLH A;  3BHX A;  3FB3 A;  3L2N A;  1QSO A;  2REE A;  2Z11 A;  4FAI A;  3SI0 A;  2CNS A;  1LAM A;  1XMB A;  3TOB A;  4CRZ B;  3D66 A;  2BO9 A;  2PJC A;  5G1Z A;  4C68 A;  2ANP A;  4H89 A;  2WYR A;  4AXV A;  1J4J A;  4X5K A;  1RTQ A;  4B11 A;  3RAM A;  4UFX A;  2CNM A;  2VI7 A;  2G0B A;  1ZG8 A;  3K9T A;  4DJL A;  1YME A;  1WK4 A;  4KOY A;  3PB7 X;  2JLM A;  1M4L A;  1XBU A;  2ZEP A;  3G3S A;  3JTK A;  4ZBG A;  2CIJ A;  1BAV A;  4FBE A;  4B6Z A;  3VWE A;  5DWM A;  3TOA A;  3H8F A;  4A32 A;  5I0C A;  3RNZ A;  5H86 A;  2Z3L A;  3R9F A;  2DPS A;  2ZEO A;  2Q43 A;  4OC1 A;  2PIZ A;  4MMO A;  2DXQ A;  4B5O A;  2AFZ A;  1I1D A;  4CGO A;  1KZF A;  3D7D A;  1XJO A;  4UEF A;  4MY0 A;  5LYL A;  3B7I A;  1M4I A;  3R96 A;  1HDQ A;  1I21 A;  4O23 A;  1H8L A;  4NXY A;  4OLL A;  5F09 A;  4H2K A;  2BUE A;  2PJ1 A;  4JLY A;  1QQ9 A;  5AGE A;  4EVY A;  2H5M A;  1P0H A;  5CNP A;  3C26 A;  5D29 A;  3K9U A;  3T90 A;  4Y49 C;  4R3K A;  4JZ0 A;  1S7F A;  5G21 A;  4MHN A;  2Q4Z A;  1DTD A;  4TWE A;  1VHE A;  3PB9 X;  5H84 A;  2EVN A;  2OH1 A;  2PJ8 A;  3KHX A;  4OC4 A;  2PRQ A;  4XPD C;  3IU1 A;  4BMH A;  5LYF A;  3H8G A;  4NGT A;  3WC6 A;  1ARM A;  2V8G A;  3RO0 A;  4GM5 A;  1VHO A;  5J8C A;  1CBX A;  1Y7E A;  4PXB A;  1S7L A;  2I3C A;  3B3S A;  3TX8 A;  1CG2 A;  1XF8 A;  2ZPA A;  4B5P B;  1S5K A;  3NH5 A;  4MHZ A;  4MXU A;  1VIX A;  4KSA A;  3QAY A;  1SQH A;  4M6G A;  5C88 A;  3T8W A;  3DLJ A;  4PSW A;  3N5F A;  2BEI A;  1YW6 A;  4ONU A;  4MFZ A;  4HPS A;  3FF3 A;  3MN8 A;  3QAH A;  2HQY A;  2PVW A;  2OZG A;  4MCP A;  3D4U A;  2PRB A;  5LRG A;  1AMP A;  4CS0 B;  1XMT A;  2JBJ A;  1Y9W A;  3B35 A;  4P4I A;  4CAX A;  4KZT A;  2WPW A;  4H6U A;  4OC5 A;  1S3Z A;  1F2O A;  5JGF A;  4I49 A;  1RO5 A;  1TF9 A;  1QSN A;  4PXD A;  3R9G A;  1XRY A;  4YU9 A;  3D2P A;  3FED A;  2FSR A;  4UF4 A;  1Q7L A;  2PIY A;  3DGV A;  3HUV A;  4PQA A;  4UFW A;  4BBH A;  4AB7 A;  1Z4E A;  4M85 A;  1YR0 A;  5JPH A;  4MFJ A;  4Y49 B;  3G8W A;  1VHS A;  2Z3K A;  1TF8 A;  3CXP A;  3KZW A;  2EK8 A;  3RYO A;  4B13 A;  4L89 A;  3KAS A;  3WAB A;  4CAF A;  4NCZ A;  5EBV A;  2C6P A;  2DPT A;  4UWI A;  4XPD B;  3TO6 A;  4A31 A;  4JXR A;  5LYD A;  3LOD A;  2FIA A;  5HVH A;  4A94 A;  1QSR A;  3SXO A;  2HUZ A;  1AYE A;  2B5G B;  2AFS A;  2P0W A;  4OC3 A;  3PZJ A;  5JQ4 A;  1BO4 A;  1CJW A;  2JEW A;  3PGP A;  1Q2D A;  4DUK A;  3TCV A;  1S7K A;  2AFO A;  2POK A;  3V7Z A;  4ORF A;  4BD9 A;  2QIR A;  2Z3N A;  3V8I A;  1IYK A;  2G9D A;  4MCR A;  5HVG A;  1PU9 A;  5JM6 A;  3TT2 A;  3CZX A;  4CGL A;  4P4D A;  2ABZ A;  1LRZ A;  4F8Z A;  3BXM A;  4ZYQ A;  3V38 A;  5K8O A;  3GKR A;  2FIW A;  4JJX A;  2ZEH A;  2IJZ A;  5AG5 A;  5F49 A;  3TFY A;  2HC9 A;  3F5B A;  5LRK A;  3D67 A;  5HVF A;  1M44 A;  5F46 A;  4F9V A;  1ZG9 A;  2PJ6 A;  3IU2 A;  4MHY A;  5C82 A;  2GRE A;  3W6S A;  1MJ9 A;  1R43 A;  2RC4 A;  4PK2 A;  1YK3 A;  3FYN A;  2C6G A;  4WJB A;  5K8P A;  3EO4 A;  3PB4 X;  3S9L A;  4MBU A;  4FUU A;  3GLJ A;  1IY7 A;  2NSM A;  3GY9 A;  1QMU A;  4MFL A;  1Y0Y A;  2QEC A;  2IL4 A;  1IOI A;  3FX6 A;  3MRU A;  5J8F A;  4QUS A;  3CXQ A;  2ZOF A;  1CPS A;  3BJ8 A;  3QB8 A;  5A27 A;  1R3N A;  2PJ3 A;  2Z3P A;  3D68 A;  4PPZ A;  3TC8 A;  2D4P A;  2ZEE A;  3B3T A;  4KOU A;  3W6X A;  4B10 A;  4YGO A;  2ZEN A;  1IGB A;  3B8G A;  3EC4 A;  2FCK A;  4H6Z A;  1ZO0 A;  3FNC A;  3S6K A;  1CP7 A;  1I12 A;  4FWU A;  2V8D A;  4PSX A;  2PJ0 A;  4A2Z A;  2AFU A;  2JDC A;  4OAD A;  4PXC A;  2CY2 A;  2VZY A;  2Y0M A;  2ZXV A;  3I3G A;  3IO1 A;  5F47 A;  3S6H A;  4P4F A;  2WUU A;  2ATR A;  4IF5 A;  2I79 A;  2Q4V A;  1YSJ A;  1AUG A;  3EXN A;  3KL9 A;  5GCN A;  3NH4 A;  4R76 A;  3WR7 A;  4P10 A;  4QVT A;  1GHE A;  2PVV A;  2VQY A;  1XE4 A;  3GYA A;  3LMS A;  1MJA A;  2B3V A;  5A28 A;  2WSA A;  4KOS A;  1ARL A;  1HEE A;  2C6C A;  3IFE A;  4C2Z A;  4KVO E;  2OZU A;  2G3A A;  1YGH A;  3LAC A;  2Q7S A;  4P4J A;  4TNU A;  1HDU A;  3KR5 A;  4FD6 A;  5CPA A;  2QYV A;  4ZY0 A;  5IB0 A;  4F0Y A;  1BOB A;  1XFO A;  3EFA A;  3NH8 A;  3PB8 X;  4PV6 A;  4NJR A;  1YVK A;  4CRY B;  1YVO A;  2HV2 A;  4P44 A;  4UWJ A;  4ZY1 A;  2FS5 A;  1JWQ A;  4UEE A;  1YLE A;  1IIC A;  2V8V A;  2XEG A;  1A2Z A;  4FD4 A;  3B3W A;  4XNH C;  4C7H A;  1Z9U A;  3KHZ A;  3IEH A;  4X2T A;  3KI9 A;  4KOX A;  4IAV A;  3SHP A;  2GLF A;  2Q7B A;  1YQE A;  4AVA A;  5AG6 A;  4KSF A;  4KSI A;  4HNY B;  2GFQ A;  4OC2 A;  4R87 A;  6CPA A;  2ZOG A;  2YNC C;  2GIV A;  4KOW A;  4FD7 A;  4K3N A;  3GB0 A;  1IU8 A;  3P2H A;  3OWC A;  3VWD A;  4MCQ A;  2VBQ A;  4UBR A;  2B58 A;  2DEA A;  3D8P A;  4R6T A;  4YWY A;  2PJB A;  3DNS A;  3CDX A;  1K4J A;  4UFV A;  2VZZ A;  1PYT B;  4P4B A;  4K30 A;  4UIB A;  1CP6 A;  2ZW7 A;  5AG4 A;  1Z8X A;  1QST A;  3IIB A;  4OAE A;  4C2Y A;  2YGW A;  2ZW6 A;  4NSQ A;  5IB9 A;  2F8H A;  4R7M A;  3ZZI A;  1WWZ A;  3IWG A;  4MY3 A;  1S60 A;  1KUX A;  2CNT A;  4WWV A;  2ZW4 A;  4KUB A;  1X12 A;  4E0A A;  4R57 A;  4B5P A;  4KLV A;  2OZH A;  4DNC A;  4KVM E;  2FXF A;  2ZEF A;  3GIU A;  4M6H A;  2D4O A;  2GAN A;  4AG7 A;  1YRE A;  4B12 A;  2QVP A;  3VH9 A;  1LCP A;  5THW A;  1FT7 A;  3FRM A;  3EY5 A;  1KWM A;  1NSL A;  4CAE A;  2NMT A;  2P6F A;  4RI1 A;  4KOV A;  4UA3 A;  1PUA A;  4UCP A;  3CT9 A;  2R1I A;  2J8N A;  1Y0R A;  3S9M A;  4CGN A;  4A30 A;  5DWN A;  3VAR A;  2OB0 A;  4MHP A;  2EUI A;  5HXD A;  3SJG A;  5LYI A;  3LWU A;  2Z10 A;  2GU2 A;  2C27 A;  3DR6 A;  5DS0 A;  4MHD A;  4LQG A;  4MFP A;  1CM0 A;  4XNH B;  5BWA B;  3BJ7 A;  4EFD A;  4U9Y A;  4JXQ A;  2K5T A;  1TKF A;  2ZEL A;  2ZEG A;  5G22 A;  1NE9 A;  3FBU A;  4Z65 A;  5CBM A;  1F2P A;  4P4E A;  2RFH A;  2P6G A;  5I4M A;  1IYL A;  2B4D B;  2HB6 A;  2J8R A;  3NE8 A;  2CXA A;  1LOK A;  2Q04 A;  1FNO A;  4GXH A;  1CPX A;  1BPM A;  2PR8 A;  2X7B A;  3KQZ A;  5G20 A;  3KR4 A;  5J1Q A;  4ZX9 A;  4KUA A;  2EWB A;  3H5Z A;  4HKF A;  4NF1 A;  4AVB A;  1YLO A;  2XEI A;  5JH9 A;  2QJ8 A;  3NE7 A;  4YFJ A;  2PJ5 A;  2AE6 A;  4MFK A;  4U5Y A;  2AFM A;  5EC4 A;  4LQ6 A;  3ZJ0 A;  5K8N A;  2EK9 A;  3H8E A;  4X8I A;  3PB6 X;  1M4G A;  5E96 A;  4CGP A;  5KTC A;  4F6A A;  1XIX A;  4CYO A;  4QBJ A;  3SJF A;  2C1C A;  4CYP A;  3FJU A;  1Y9K A;  1ZG7 A;  3I9S A;  2EBJ A;  3D7H A;  3IGR A;  4OID A;  5KTA A;  2WPX A;  3W91 A;  2ZEM A;  1RXT A;  1Z5R A;  2O53 A;  2IQ6 A;  1LAN A;  2Q0Y A;  4RS2 A;  3SJX A;  2PSW A;  3R9E A;  4P6Y A;  2O28 A;  4X3R A;  4F0X A;  4MFQ A;  3FEC A;  3D7G A;  1V0C A;  1Z8T A;  2O4H A;  2Z3M A;  3BI0 A;  3DR8 A;  2OU2 A;  1EE3 P;  2RB7 A;  1B6B A;  2Q51 A;  4Q38 A;  2NYQ A;  4ZX8 A;  4HNX B;  1XOV A;  1OZP A;  3KQX A;  4AVC A;  4P45 A;  3S6F A;  3F8K A;  2F5I A;  3I1U A;  3FVL A;  1Q2C A;  2FT0 A;  1UWY A;  4IK2 A;  4ONW A;  2AFX A;  2Q4Y A;  4NFR A;  4PXE A;  3SI1 A;  1X10 A;  4DYO A;  2A4N A;  1P4N A;  3LD2 A;  4EME A;  1ZLI A;  3KKW A;  4R8F A;  2OOT A;  1TKJ A;  4Q36 A;  1MK4 A;  1Z2L A;  3RBU A;  4NJQ A;  1UFH A;  4NGP A;  2REF A;  3FH4 A;  1KUV A;  1BLL E;  2JDD A;  3HLP A;  4MJ8 A;  3IWE A;  2FE7 A;  4E2A A;  4XPL A;  5HH1 A;  1Z8L A;  4F9U A;  1Z4R A;  2JBK A;  2PC1 A;  5IX3 A;  1QSM A;  3F0A A;  4JD6 A;  1YW4 A;  4J3G A;  4OME A;  4IUS A;  4NGM A;  1PCA A;  3PP9 A;  5F48 A;  3SI2 A;  4ZI6 A;  4OKO A;  2ARH A;  2R8V A;  1LFW A;  5AG7 A;  3D3S A;  2QML A;  3KGQ A;  3WC7 A;  3FMC A;  4LUA A;  5KTD A;  1NMT A;  1Z8W A;  3B3C A;  2PDO A;  3TO9 A;  3FIX A;  3VAT A;  4A39 A;  5EMI A;  4MCS A;  4JWP A;  3R95 A;  2KCW A;  4CYN A;  4OIW A;  1R57 A;  1XEB A;  4NGQ A;  3ISX A;  1IID A;  3UY5 A;  2ZED A;  2R98 A;  4W9Y A;  2WZN A;  8CPA A;  2FL4 A;  1L0C A;  2BCO A;  3TTH A;  4PK3 A;  4C2X A;  4CGM A;  2ZW5 A;  5ELY A;  4NGS A;  3B2Y A;  5IV0 A;  4KLW A;  4A37 A;  2YND A;  1M4D A;  1VKC A;  1JQG A;  2Z3O A;  3H4Q A;  3JRU A;  2IMO A;  4BIN A;  5LRJ A;  3PBE A;  2I00 A;  1VGY A;  3D7F A;  2PCU A;  4MRI A;  1GYT A;  4GS4 A;  1IOF A;  2BL1 A;  2VXK A;  1Y7R A;  4L8A A;  3ISZ A;  1DE4 C;  2EO8 A;  1MJB A;  1S7N A;  4CPA A;  3PRT A;  1B87 A;  2PJ4 A;  5HMN A;  1LAP A;  4CAV A;  4KOR A;  4KVX A;  2VEZ A;  4NGR A;  2DF5 A;  1TKH A;  3NFZ A;  4OP4 A;  3GUX A;  3PBB A;  3JVN A;  2ODF A;  3BI1 A;  3TE4 A;  3IJ3 A;  4UIA A;  3IWW A;  1IB1 E;  4UCN A;  4B14 A;  2PJ2 A;  1OBR A;  3CPX A;  3CXS A;  4M3S A;  3P2F A;  2CF4 A;  2GLJ A;  2B4B A;  3RZA A;  4A95 A;  3TO7 A;  4ZY2 A;  4HNW B;  4OC0 A;  4E8O A;  4KS9 A;  5ISV A;  1FY7 A;  2GE3 A;  1ON0 A;  2OR4 A;  4Q7A A;  2J8M A;  2BOA A;  2PJ7 A;  3D2M A;  4M6I A;  4CAW A;  3R1K A;  3WT4 A;  4EWT A;  3S9N A;  4JYW A;  1ELL P;  1Q2Y A;  2YNE A;  4XPK A;  2VL1 A;  2XEF A; 
#chains in the Genus database with same CATH homology
 2PR1 A;  3E0K A;  3DDD A;  4U9Z A;  4QC6 A;  3A9L A;  4AG9 A;  2PQ8 A;  3SXN A;  4YRH A;  4NEX A;  4MI4 A;  2BSW A;  1N71 A;  1YX0 A;  3T9Y A;  3S6G A;  2AJ6 A;  4II9 A;  2Q44 A;  3BLN A;  3JUW A;  4QB9 A;  2B5G A;  1TIQ A;  4LX9 A;  2Z0Z A;  4CYQ A;  1U6M A;  2B3U A;  2R7H A;  5FVJ A;  1M1D A;  3DSB A;  4R9M A;  4FD5 A;  4KOT A;  2G3T A;  4A33 A;  4R3L A;  4UCM A;  2JEV A;  2B4D A;  3FXT A;  3N7Z A;  2YNC A;  2P6E A;  1KUY A;  4C7I A;  4ZGY B;  3MGD A;  3FB3 A;  1QSO A;  2REE A;  2Z11 A;  2CNS A;  3TOB A;  4CRZ B;  5G1Z A;  4C68 A;  4H89 A;  1J4J A;  4X5K A;  4B11 A;  4UFX A;  2CNM A;  2VI7 A;  2G0B A;  1WK4 A;  4KOY A;  2JLM A;  3G3S A;  3JTK A;  4ZBG A;  3VWE A;  5DWM A;  3TOA A;  4A32 A;  5I0C A;  5H86 A;  2Z3L A;  3R9F A;  2DPS A;  2DXQ A;  4B5O A;  4CGO A;  1I1D A;  1KZF A;  4MY0 A;  1M4I A;  3R96 A;  1I21 A;  4OLL A;  4NXY A;  4JLY A;  2BUE A;  5AGE A;  4EVY A;  2H5M A;  1P0H A;  5CNP A;  3C26 A;  3K9U A;  3T90 A;  4Y49 C;  4R3K A;  1S7F A;  5G21 A;  5H84 A;  2EVN A;  2OH1 A;  4XPD C;  3IU1 A;  4BMH A;  5J8C A;  1S7L A;  1XF8 A;  2ZPA A;  4B5P B;  1S5K A;  4KSA A;  1SQH A;  5C88 A;  4PSW A;  2BEI A;  4ONU A;  4MFZ A;  3QAH A;  2HQY A;  2OZG A;  2PRB A;  4CS0 B;  1XMT A;  1Y9W A;  4CAX A;  4KZT A;  2WPW A;  4H6U A;  1S3Z A;  4I49 A;  1RO5 A;  1QSN A;  3R9G A;  3D2P A;  2FSR A;  4UFW A;  4BBH A;  4AB7 A;  1Z4E A;  4M85 A;  1YR0 A;  5JPH A;  4MFJ A;  4Y49 B;  3G8W A;  1VHS A;  2Z3K A;  3CXP A;  3RYO A;  4CAF A;  4B13 A;  4L89 A;  4NCZ A;  5EBV A;  2DPT A;  4UWI A;  4XPD B;  3TO6 A;  4A31 A;  4JXR A;  3LOD A;  2FIA A;  1QSR A;  3SXO A;  2HUZ A;  2B5G B;  2P0W A;  3PZJ A;  5JQ4 A;  1BO4 A;  1CJW A;  3PGP A;  1Q2D A;  3TCV A;  1S7K A;  4ORF A;  2QIR A;  2Z3N A;  3V8I A;  1IYK A;  1PU9 A;  3TT2 A;  4CGL A;  1LRZ A;  3GKR A;  2FIW A;  4JJX A;  5AG5 A;  5F49 A;  3TFY A;  3F5B A;  1M44 A;  5F46 A;  3IU2 A;  5C82 A;  3W6S A;  1MJ9 A;  2RC4 A;  4PK2 A;  1YK3 A;  3FYN A;  3EO4 A;  4MBU A;  3GY9 A;  4MFL A;  2QEC A;  2IL4 A;  5J8F A;  4QUS A;  3CXQ A;  3BJ8 A;  3QB8 A;  5A27 A;  2Z3P A;  2D4P A;  4KOU A;  4B10 A;  3W6X A;  4YGO A;  3B8G A;  3EC4 A;  2FCK A;  4H6Z A;  1ZO0 A;  3FNC A;  3S6K A;  1I12 A;  4PSX A;  4A2Z A;  2JDC A;  4OAD A;  2CY2 A;  2VZY A;  2Y0M A;  2ZXV A;  3I3G A;  5F47 A;  3S6H A;  2WUU A;  2ATR A;  4IF5 A;  2I79 A;  2Q4V A;  3EXN A;  5GCN A;  3WR7 A;  4QVT A;  1GHE A;  2VQY A;  1XE4 A;  3GYA A;  1MJA A;  2B3V A;  5A28 A;  2WSA A;  4KOS A;  4C2Z A;  4KVO E;  2OZU A;  2G3A A;  1YGH A;  4FD6 A;  5IB0 A;  4F0Y A;  1BOB A;  3EFA A;  4PV6 A;  1YVK A;  4CRY B;  1YVO A;  2HV2 A;  4UWJ A;  2FS5 A;  1YLE A;  1IIC A;  4C7H A;  4FD4 A;  4XNH C;  1Z9U A;  4KOX A;  3SHP A;  2Q7B A;  4AVA A;  5AG6 A;  4KSF A;  4HNY B;  4R87 A;  2YNC C;  2GIV A;  4KOW A;  4FD7 A;  3P2H A;  3VWD A;  3OWC A;  2VBQ A;  4UBR A;  2B58 A;  3D8P A;  3DNS A;  1K4J A;  4UFV A;  2VZZ A;  4K30 A;  2ZW7 A;  5AG4 A;  4OAE A;  1QST A;  4C2Y A;  2YGW A;  2ZW6 A;  4NSQ A;  3ZZI A;  1WWZ A;  3IWG A;  4MY3 A;  1S60 A;  1KUX A;  2CNT A;  2ZW4 A;  4KUB A;  4E0A A;  4R57 A;  4B5P A;  4KLV A;  2OZH A;  4DNC A;  4KVM E;  2FXF A;  2D4O A;  2GAN A;  4AG7 A;  1YRE A;  4B12 A;  3FRM A;  3EY5 A;  1NSL A;  4CAE A;  2NMT A;  2P6F A;  4KOV A;  4UA3 A;  1PUA A;  4UCP A;  2R1I A;  2J8N A;  4CGN A;  4A30 A;  5DWN A;  2OB0 A;  2EUI A;  2Z10 A;  2C27 A;  3DR6 A;  4MHD A;  4MFP A;  1CM0 A;  4XNH B;  5BWA B;  3BJ7 A;  4U9Y A;  4JXQ A;  2K5T A;  5G22 A;  1NE9 A;  3FBU A;  2P6G A;  1IYL A;  2B4D B;  2J8R A;  2CXA A;  2Q04 A;  2PR8 A;  2X7B A;  5G20 A;  4KUA A;  3H5Z A;  4HKF A;  4NF1 A;  4AVB A;  3NE7 A;  4YFJ A;  2AE6 A;  4MFK A;  4U5Y A;  5EC4 A;  3ZJ0 A;  4CGP A;  5E96 A;  5KTC A;  1M4G A;  4F6A A;  1XIX A;  4CYO A;  4QBJ A;  4CYP A;  1Y9K A;  3I9S A;  5KTA A;  3IGR A;  2WPX A;  3W91 A;  1RXT A;  4RS2 A;  2Q0Y A;  2PSW A;  3R9E A;  2O28 A;  4F0X A;  4MFQ A;  1V0C A;  2Z3M A;  3DR8 A;  2OU2 A;  1B6B A;  4Q38 A;  4HNX B;  1OZP A;  4AVC A;  3S6F A;  3F8K A;  2F5I A;  1Q2C A;  2FT0 A;  2Q4Y A;  2A4N A;  1P4N A;  3LD2 A;  3KKW A;  4Q36 A;  1MK4 A;  1UFH A;  2REF A;  1KUV A;  2JDD A;  4MJ8 A;  4E2A A;  3IWE A;  2FE7 A;  4XPL A;  5HH1 A;  1Z4R A;  2PC1 A;  5IX3 A;  1QSM A;  3F0A A;  4JD6 A;  4J3G A;  4IUS A;  3PP9 A;  5F48 A;  2ARH A;  2R8V A;  5AG7 A;  3D3S A;  2QML A;  4LUA A;  5KTD A;  1NMT A;  2PDO A;  3TO9 A;  3FIX A;  4JWP A;  3R95 A;  2KCW A;  4CYN A;  1R57 A;  1XEB A;  1IID A;  3UY5 A;  2R98 A;  2FL4 A;  1L0C A;  3TTH A;  4PK3 A;  4C2X A;  4CGM A;  2ZW5 A;  5IV0 A;  4KLW A;  2YND A;  1M4D A;  1VKC A;  2Z3O A;  3H4Q A;  2I00 A;  4GS4 A;  2BL1 A;  2VXK A;  1Y7R A;  4L8A A;  1MJB A;  1S7N A;  1B87 A;  5HMN A;  4CAV A;  4KOR A;  4KVX A;  2VEZ A;  3JVN A;  3TE4 A;  4UCN A;  1IB1 E;  4B14 A;  3CXS A;  4M3S A;  3P2F A;  2B4B A;  4A95 A;  3TO7 A;  4HNW B;  4E8O A;  4KS9 A;  5ISV A;  1FY7 A;  2GE3 A;  1ON0 A;  2J8M A;  3D2M A;  4CAW A;  3R1K A;  1Q2Y A;  4RI1 A;  2YNE A;  4XPK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...