3JUWA

Putative gnat-family acetyltransferase from bordetella pertussis.
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
167
structure length
167
Chain Sequence
RQVLKTDRLVLEPQSMARFDQWFAMERQRDEAGHRDLTEDQAWLRLCARQGMWDAYACGFYYLLDPVSGEMRGEAGFQFRRRGFGPGFDNHPEAAWAVASAHQGRGLAAEAMQALLAHHDRSSGRQRVVALIARSNLPSLRLAERLGFRGYSDVAFDGAAHLLLERA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-ray crystal structure of putative GnaT-family acetyltransferase from Bordetella pertussis.
rcsb
source organism Bordetella pertussis
molecule tags Transferase
molecule keywords Probable GnaT-family acetyltransferase
total genus 46
structure length 167
sequence length 167
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2009-09-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13302 Acetyltransf_3 Acetyltransferase (GNAT) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 3juwA00
1B6BA 3C26A 1WWZA 4KOUA 1M44A 3WR7A 3BLNA 1IYKA 2ARHA 2F5IA 4CRYB 1Y9KA 2AE6A 4QUSA 2P6EA 2Q4YA 2C27A 2JDDA 4AG7A 3F5BA 1VHSA 2ATRA 3TT2A 4MI4A 3TO7A 4PV6A 2FS5A 1TIQA 4KOYA 3DNSA 2R1IA 2REFA 1N71A 4U9YA 2Z10A 4HNXB 4JJXA 4KOVA 2Q04A 3TO9A 1MJAA 2OU2A 4HNYB 5I0CA 2BSWA 1XMTA 3D8PA 1YR0A 1NE9A 1XF8A 2Q0YA 4UWJA 4E0AA 2WPWA 4YFJA 4HNWB 5F49A 1XIXA 2VXKA 1S60A 5HH1A 4PSWA 4H89A 3P2HA 2G0BA 3FB3A 4B5OA 4MHDA 5FVJA 3EFAA 4ONUA 3G8WA 4R3LA 4CAXA 3W6SA 4XPKA 3S6HA 5HMNA 1KUXA 3LD2A 1Z9UA 3FNCA 3G3SA 4YGOA 3F8KA 1BOBA 2WPXA 4CRZB 4PK2A 1QSTA 3S6FA 1L0CA 5H86A 4MJ8A 5F46A 3IWGA 2O28A 1XEBA 5DWMA 4NSQA 4R87A 3FRMA 4QC6A 4AB7A 2Q4VA 2BEIA 3P2FA 4CAWA 1I12A 4E2AA 4L89A 2B4DB 2G3TA 2VQYA 2VZZA 1S7NA 2OB0A 5IB0A 4H6ZA 2J8RA 3SHPA 3DSBA 3FYNA 3K9UA 5IX3A 4UBRA 5EC4A 3TOAA 5E96A 3EC4A 5GCNA 5ISVA 3V8IA 2Y0MA 1GHEA 5C82A 2GE3A 4FD5A 4KOXA 2QMLA 2K5TA 2Q7BA 2A4NA 1XE4A 4XNHB 4E8OA 5JQ4A 4DNCA 1M4DA 1S7KA 3I3GA 2GIVA 4U5YA 3KKWA 4II9A 4OLLA 4LUAA 1SQHA 2HUZA 3SXNA 4MY3A 2R7HA 3R95A 2Z11A 4KOSA 1PU9A 1NMTA 3EO4A 3R9EA 2B5GB 1IB1E 4NF1A 1S3ZA 4EVYA 3B8GA 4AG9A 1I21A 2FIWA 2CY2A 4ZBGA 2HV2A 2B3UA 3TO6A 2PQ8A 4QVTA 4R3KA 2B4BA 4R9MA 1LRZA 1CJWA 4MBUA 4M85A 1Y7RA 4OAEA 4KOTA 2FCKA 1FY7A 4RI1A 4Y49C 3UY5A 4AVAA 1YVOA 1YK3A 3TE4A 3BJ7A 2ZW6A 4F0YA 4H6UA 4B5PB 4MY0A 3TCVA 2P6FA 1Z4EA 3BJ8A 2FL4A 1KUVA 3TOBA 1YLEA 3VWEA 4UA3A 1KUYA 4I49A 4JLYA 2FXFA 3I9SA 2X7BA 4HKFA 1M1DA 2I79A 2AJ6A 3JUWA 1NSLA 2R98A 4GS4A 2B58A 1Y9WA 2R8VA 4NEXA 2GANA 3DR8A 5H84A 1M4GA 1QSRA 2J8NA 3QAHA 1U6MA 4AVBA 1IYLA 2JEVA 3T9YA 3N7ZA 3W6XA 2BUEA 2ZW4A 1B87A 4X5KA 3CXPA 3R9FA 2VI7A 2NMTA 3CXSA 3LODA 4OADA 5J8CA 3IGRA 4J3GA 2VEZA 5CNPA 4KVME 1IICA 2G3AA 3D2MA 2VZYA 4JD6A 5EBVA 2D4PA 2FE7A 3QB8A 2FIAA 4ORFA 4KVOE 3TTHA 1MJBA 2D4OA 3DDDA 2H5MA 2P6GA 1MK4A 4AVCA 2PRBA 2JLMA 3PP9A 5JPHA 2IL4A 4F6AA 4K30A 1KZFA 2HQYA 3CXQA 2PC1A 1RO5A 1Z4RA 1K4JA 4KZTA 1P4NA 1Q2YA 1IIDA 5KTDA 1S5KA 2B5GA 4FD4A 3R96A 2ZW7A 2BL1A 4IUSA 1UFHA 4Y49B 2I00A 3GYAA 3GY9A 2Z0ZA 1P0HA 3DR6A 2ZPAA 3ZZIA 3GKRA 3ZJ0A 1I1DA 2ZW5A 2EVNA 1M4IA 4CAVA 4XPDB 1QSOA 5KTCA 1RXTA 2P0WA 4KLWA 2Q44A 1YX0A 2RC4A 1QSNA 4KOWA 3R9GA 1ON0A 1QSMA 5IV0A 4BMHA 3FBUA 1YVKA 2QIRA 2PR1A 3R1KA 4KUBA 3TFYA 5C88A 2CNTA 3H4QA 5KTAA 3FIXA 3VWDA 5J8FA 3E0KA 3PGPA 1VKCA 3NE7A 2ZXVA 4YRHA 4NXYA 1Q2CA 1WK4A 1V0CA 1PUAA 3F0AA 4L8AA 3JVNA 1S7FA 2DXQA 4PSXA 2EUIA 3EY5A 1Q2DA 4IF5A 2B3VA 4XNHC 4M3SA 1R57A 3EXNA 2CNSA 4NCZA 4UWIA 2OZGA 4JWPA 2QECA 1MJ9A 3RYOA 2PSWA 4KVXA 1J4JA 4KORA 4KUAA 3OWCA 4JXRA 3W91A 2KCWA 2PR8A 4RS2A 2B4DA 4B5PA 2J8MA 4XPLA 4R57A 2REEA 5F47A 2PDOA 3MGDA 2FT0A 4XPDC 3T90A 1BO4A 3D3SA 1OZPA 4U9ZA 4CS0B 2OZHA 1YREA 3S6GA 4QB9A 3FXTA 5F48A 4QBJA 2CNMA 2JDCA 2OH1A 2VBQA 4PK3A 3SXOA 3S6KA 4FD6A 1YGHA 1CM0A 5DWNA 2OZUA 4LX9A 1S7LA 2FSRA 4KLVA 4FD7A 3D2PA 4JXQA 3PZJA
chains in the Genus database with same CATH superfamily
1B6BA 3C26A 1WWZA 4KOUA 1M44A 3WR7A 3BLNA 4F9VA 2NYQA 1IYKA 2ARHA 4OC0A 4BINA 1UWYA 4ZYQA 4P4BA 3KR5A 1YSJA 4MCQA 3NA6A 4MFZA 3IJ3A 2PJ3A 1YW6A 1CX8A 1IOFA 4MFLA 4ZX8A 2F5IA 4CPAA 4CRYB 1Y9KA 4OMEA 4TWEA 2AE6A 4QUSA 3ISXA 2P6EA 2Q4YA 2GLFA 2PJ9A 4MXUA 3JTKA 3RNZA 1LOKA 2C27A 2JDDA 2JBJA 3GUXA 4A94A 2NSMA 1JWQA 4CAFA 4CAEA 4AG7A 2BOAA 2Z3NA 3F5BA 5AGEA 4RUHA 1ARMA 1VHSA 2ATRA 1F57A 4YWYA 4OP4A 3TT2A 4CYQA 3D67A 4KSIA 4MI4A 3TO7A 4PV6A 2PVVA 4MRIA 2FS5A 1TIQA 4KOYA 3DNSA 2R1IA 2REFA 1N71A 4Q7AA 2Z10A 3IWWA 4HNXB 4U9YA 4C2ZA 4JJXA 4IAVA 4KOVA 4MCRA 4A2ZA 5HVFA 4C7IA 2Q04A 3TO9A 2HB6A 5K8PA 1MJAA 2OU2A 4HNYB 5I0CA 2BSWA 3H5ZA 1XMTA 2Z3MA 4CGLA 3D68A 5G20A 3D8PA 4ZGYB 4P10A 3PB8X 1YR0A 1NE9A 1XF8A 5D8NA 2YNCA 1TKFA 2DF5A 4OC3A 5J1QA 3KZWA 3WC7A 2GREA 1Y0YA 2Q0YA 4OC1A 4P44A 4UWJA 4AXVA 4E0AA 4BBHA 2WPWA 1XRYA 4YFJA 2EWBA 4HNWB 1DTDA 3BHXA 5F49A 4UF4A 1XIXA 2VXKA 4G1PA 4CYNA 2XEJA 2AFZA 1S60A 5HH1A 4PSWA 3H8EA 4H89A 1QMUA 1BPNA 2Q43A 5BWAB 3DLJA 1IOIA 3P2HA 4KS9A 3FH4A 4M6GA 3D7GA 2G0BA 3FB3A 4B5OA 4MHDA 4R6TA 3RBUA 5FVJA 3EFAA 3D4UA 2AFOA 4NJRA 2PJ0A 3G8WA 4ONUA 4R3LA 4UEEA 3W6SA 4CAXA 4XPKA 2ZEHA 3S6HA 5HMNA 2EK9A 2J9AA 1KUXA 3LD2A 1Z9UA 3FNCA 3A9LA 3G3SA 5K8MA 4YGOA 3F8KA 2PJ2A 1BOBA 2WPXA 4FWUA 2EK8A 4CRZB 4PK2A 1Z8LA 1QSTA 5CBMA 3KQXA 1BAVA 3S6FA 3KHZA 1L0CA 5H86A 3KL9A 2PIZA 3B3CA 4MJ8A 2HC9A 5LRKA 2ZEEA 5F46A 4A38A 3IWGA 4RN7A 2O28A 1XEBA 2ZOFA 6CPAA 5DWMA 4K3NA 4NSQA 4R87A 3FRMA 4QC6A 2ZEGA 4KSFA 4AB7A 2Q4VA 2BEIA 2XEGA 4MFQA 3P2FA 1YQEA 1I12A 4CAWA 4UCPA 4E2AA 1LAPA 4L89A 4C2YA 4F0XA 3B3WA 2B4DB 2G3TA 2VQYA 3KQZA 1S7NA 2V77A 2VZZA 3PRTA 2OB0A 1ARLA 4H6ZA 3RZAA 5IB0A 2J8RA 4NGPA 3SHPA 1QQ9A 2YGWA 3DSBA 4NGRA 2DEAA 3FYNA 3RO0A 3K9UA 4LQGA 5IX3A 1TKHA 4UBRA 4A37A 5EC4A 3TOAA 4O23A 4JYWA 5E96A 4IK2A 3EC4A 3LMSA 5GCNA 3RAMA 5ISVA 3V8IA 2PJ5A 2Y0MA 1GHEA 2PE3A 2BCOA 2GE3A 4FD5A 4KOXA 5C82A 2QMLA 3WC5A 2K5TA 2Q7BA 3BXMA 2A4NA 1IY7A 3SI0A 1XE4A 3KI9A 4XNHB 4W9YA 4E8OA 5JQ4A 3B7IA 5JH9A 1Y0RA 4DNCA 1M4DA 2ZEOA 4UCNA 1S7KA 2RFHA 2I3CA 3I3GA 2GIVA 4Q36A 3PBBA 4U5YA 3HUVA 5IB9A 3KKWA 2O4HA 4II9A 4OLLA 3K2KA 4LUAA 3IO1A 4F8ZA 3ISZA 3CDXA 1SQHA 1YLOA 2HUZA 2Q4ZA 3SXNA 5LYDA 4MY3A 2R7HA 2AFSA 3GB0A 3R95A 8CPAA 1CP7A 2Z11A 4KOSA 1PU9A 1NMTA 3EO4A 1AYEA 4H2KA 3R9EA 2B5GB 2PVWA 1IB1E 3PB9X 4NF1A 1S3ZA 2XEIA 1LANA 3FMCA 3NH4A 4EVYA 3CPXA 1VGYA 3B8GA 4AG9A 4CGMA 1XJOA 4CYPA 1I21A 2WUUA 2ABZA 4CYOA 2FIWA 2CY2A 3PFOA 4R7MA 2BO9A 4ZBGA 3IU2A 2HV2A 2ODFA 4PXCA 5HXDA 2B3UA 4PPZA 2IJZA 3NE8A 2PJAA 3TO6A 2PQ8A 2PJ6A 2XEFA 4QVTA 4R3KA 2B4BA 2G9DA 3V38A 4NGQA 4R9MA 1LRZA 2Q7SA 4DYOA 1GYTA 1CJWA 2O53A 4M85A 4MBUA 1Y7RA 3N5FA 1VIXA 1ZLHA 4EMEA 4MCPA 2F8HA 1TKJA 4OAEA 4BD9A 3LWUA 4NGTA 4KOTA 2FCKA 3S9MA 1FY7A 4RI1A 1Y7EA 4Y49C 1VHEA 3UY5A 4AVAA 1YVOA 1YK3A 2CTBA 5JM6A 3TE4A 3CZXA 3GLJA 2CIJA 3BJ7A 3JRUA 5EMIA 2ZW6A 4F0YA 3MRUA 4H6UA 2GLJA 3FECA 4LQ6A 4MY0A 3TCVA 3NFZA 4B5PB 3VARA 4MHYA 4UIAA 4YU9A 2P6FA 4B14A 4KSAA 1Z4EA 3BJ8A 2FL4A 5LRJA 4ZY0A 2GFQA 1KUVA 2C6PA 1YW4A 1NSAA 4FUUA 3TOBA 1EE3P 1YLEA 3VWEA 3PB6X 1ZG8A 4UA3A 1ZO0A 1KUYA 2V8VA 4I49A 2PJBA 4JLYA 2PCUA 4C68A 3H8FA 2FXFA 1HDQA 3I9SA 4M6IA 2X7BA 4HKFA 5A28A 1M1DA 3FJUA 2I79A 1LFWA 2WSAA 4R8FA 2AJ6A 3IC1A 3QNVA 3D7DA 2CTCA 3JUWA 4PQAA 4NGSA 1NSLA 2R98A 4GS4A 1FT7A 4B13A 2B58A 4MMOA 1Y9WA 2R8VA 4NEXA 5K8OA 2GANA 3DR8A 3TX8A 4DJLA 5H84A 4M6HA 1M4GA 1QSRA 1LAMA 2J8NA 2Z3KA 4CGOA 1XMBA 4ZY2A 3S9LA 3QAHA 1U6MA 2OOTA 4AVBA 4UFWA 1IYLA 2JEVA 3T9YA 4UFVA 3SI2A 3N7ZA 1Z8WA 4OC5A 2POKA 3VATA 2BUEA 3B35A 3W6XA 2ZW4A 2PJCA 4B11A 1B87A 3FEEA 3T8WA 4X5KA 2CXAA 1VHOA 1TXRA 2Z3OA 3CXPA 4NFRA 3R9FA 5I4MA 5LYFA 3IU1A 2ZEPA 2VI7A 4B6ZA 4Q38A 2NMTA 3CXSA 3FVLA 1R43A 2ZENA 4P6YA 3LODA 3B3VA 4OADA 5J8CA 4B12A 3IGRA 3DGVA 3B3SA 4J3GA 1LCPA 4P4IA 4MFJA 2VEZA 5CNPA 4KVME 1IICA 4MHZA 2YNEA 2G3AA 3D2MA 1HDUA 3PEIA 4CGPA 2VZYA 4JD6A 4UFXA 1XBUA 2ZELA 5EBVA 2D4PA 2IMOA 5LRGA 1M4LA 3D66A 2FE7A 4JZ0A 4X3RA 3QB8A 1ZLIA 1DE4C 3IIBA 3KASA 4UCMA 2FIAA 5HVGA 4ORFA 4A39A 4KVOE 3TTHA 1MJBA 2D4OA 3PB7X 3PBEA 5AG5A 3DDDA 2V8DA 4UEZA 5ELYA 4DUKA 3QAYA 5AG4A 2H5MA 2P6GA 1MK4A 3SI1A 3IWEA 4AVCA 2PRBA 2JLMA 1X10A 3FX6A 3PP9A 4P4DA 5JPHA 2IL4A 1A2ZA 4F6AA 4ZY1A 3NH5A 4K30A 3WABA 1KZFA 2RB7A 2HQYA 2PIYA 3CXQA 2PC1A 1RO5A 1Z4RA 2V8HA 4B10A 1CP6A 1K4JA 1Z8TA 4HPSA 4KZTA 1IGBA 4R76A 3IFEA 4NGMA 1P4NA 1Q2YA 1IIDA 4P4FA 1CG2A 1Z5RA 3PB4X 1S5KA 5KTDA 2B5GA 4FD4A 3R96A 2ZW7A 2BL1A 4MFPA 4IUSA 1UFHA 4OIDA 4X8IA 4Y49B 5LYLA 7CPAA 4A32A 1ELMP 2I00A 1AMPA 2DPTA 3FF3A 3GY9A 1CPSA 3GYAA 3KHXA 4P4EA 2Z0ZA 2ZOGA 1P0HA 3DR6A 2QVPA 1CBXA 2ZPAA 4P45A 3GKRA 3TC8A 3ZZIA 1Q7LA 3KR4A 3ZJ0A 2ZEFA 3H8GA 2YNDA 1I1DA 2ZW5A 3D7FA 2EVNA 1M4IA 1PYTB 4XPDB 4ZX9A 1QSOA 4CAVA 5KTCA 1BPMA 1RXTA 2P0WA 4MCSA 5G1ZA 4PXDA 3IEHA 4KLWA 1XFOA 2Q44A 1YX0A 2RC4A 1QSNA 2CF4A 4KOWA 3R9GA 1ON0A 1QSMA 5IV0A 4BMHA 3FBUA 2WZNA 4A95A 1YVKA 1PCAA 5JGFA 2QIRA 2PR1A 3R1KA 1AUGA 4KUBA 3TFYA 1BLLE 1R3NA 1Z2LA 3FEDA 5C88A 2CNTA 5THWA 3H4QA 4C2XA 3B2YA 3LACA 5K8NA 5KTAA 2YNCC 3SJEA 3FIXA 4NJQA 4IHMA 1X12A 5G21A 2JEWA 3VWDA 3CPAA 4A30A 2FVGA 5J8FA 3WT4A 4WJBA 5A27A 3E0KA 1CPXA 3PGPA 4A31A 1VKCA 3NE7A 1FNOA 3V7ZA 2Z3LA 1TF9A 1H8LA 2ZXVA 4YRHA 1YMEA 4NXYA 1Q2CA 1WK4A 1V0CA 1PUAA 3F0AA 4EFDA 4GXHA 3JVNA 4L8AA 3KGQA 1S7FA 3I1UA 5D29A 4WWVA 2DXQA 4FAIA 4PSXA 1IU8A 2ZEDA 3HLPA 2IQ6A 2ANPA 2EUIA 1RTQA 2AFUA 3EY5A 1Q2DA 4IF5A 2B3VA 4XNHC 4M3SA 4PXBA 1R57A 2F7VA 3EXNA 3MN8A 4MHPA 2Q51A 3D7HA 2ZEMA 1KWMA 2CNSA 4NCZA 4UWIA 2OZGA 5HVHA 4JWPA 2QECA 1MJ9A 3PFEA 4GM5A 4OKOA 3RYOA 5G22A 1ELLP 2EBJA 2PSWA 2AFMA 4KVXA 4MHNA 1J4JA 5CPAA 2PJ4A 1ZG9A 2QYVA 5F09A 4KORA 4KUAA 3OWCA 4JXRA 1HEEA 3W91A 2KCWA 2PR8A 4RS2A 3WC6A 2B4DA 5LYIA 3SJGA 4B5PA 2J8MA 3GIUA 4XPLA 1JQGA 3VH9A 4FBEA 2PJ8A 2C6GA 4R57A 2REEA 2AFXA 4OIWA 3BI1A 3BI0A 4F9UA 2JBKA 5F47A 2PDOA 3K9TA 2FT0A 2V8GA 3MGDA 4XPDC 5AG7A 4NGNA 3T90A 4Z65A 3CT9A 1BO4A 1ZG7A 2Z3PA 4TNUA 4A33A 3D3SA 1OZPA 2PJ1A 4U9ZA 1XOVA 2C1CA 1Z8XA 4CS0B 2QJ8A 3B3TA 2OZHA 1YREA 4P4JA 2AFWA 4QB9A 3S6GA 4MFKA 4CGNA 2DPSA 3FXTA 5F48A 4QBJA 1TF8A 3S9NA 2CNMA 2PRQA 2JDCA 2OH1A 2VL1A 2VBQA 4PXEA 5AG6A 2GU2A 5DS0A 1OBRA 4PK3A 3SXOA 1F2PA 4ZI6A 4X2TA 4FD6A 3S6KA 4UIBA 4ONWA 1YGHA 4OC2A 4OC4A 1CM0A 4C7HA 3SJFA 5DWNA 3SJXA 4EWTA 2OR4A 2OZUA 2C6CA 4LX9A 2PJ7A 2WYRA 1S7LA 2EO8A 1F2OA 2FSRA 4FD7A 4KLVA 3L2NA 3NH8A 3D2PA 4UEFA 4JXQA 3PZJA
chains in the Genus database with same CATH topology
1B6BA 3C26A 1WWZA 4KOUA 1M44A 3WR7A 3BLNA 1IYKA 2ARHA 4MFZA 4MFLA 2F5IA 4CRYB 1Y9KA 2AE6A 4QUSA 2P6EA 2Q4YA 3JTKA 2C27A 2JDDA 4CAFA 4CAEA 4AG7A 2Z3NA 5AGEA 3F5BA 1VHSA 2ATRA 3TT2A 4CYQA 4MI4A 3TO7A 4PV6A 2FS5A 1TIQA 4KOYA 3DNSA 2R1IA 2REFA 1N71A 4U9YA 2Z10A 4HNXB 4C2ZA 4JJXA 4KOVA 4A2ZA 4C7IA 2Q04A 3TO9A 1MJAA 2OU2A 4HNYB 5I0CA 2BSWA 3H5ZA 1XMTA 2Z3MA 4CGLA 5G20A 3D8PA 4ZGYB 1YR0A 1NE9A 1XF8A 2YNCA 2Q0YA 4UWJA 4E0AA 4BBHA 2WPWA 4YFJA 4HNWB 5F49A 1XIXA 2VXKA 4CYNA 1S60A 5HH1A 4PSWA 4H89A 5BWAB 3P2HA 4KS9A 2G0BA 3FB3A 4B5OA 4MHDA 5FVJA 3EFAA 4ONUA 3G8WA 4R3LA 4CAXA 3W6SA 4XPKA 3S6HA 5HMNA 1KUXA 3LD2A 1Z9UA 3FNCA 3A9LA 3G3SA 4YGOA 3F8KA 1BOBA 2WPXA 4CRZB 4PK2A 1QSTA 3S6FA 1L0CA 5H86A 4MJ8A 5F46A 3IWGA 2O28A 1XEBA 5DWMA 4NSQA 4R87A 3FRMA 4QC6A 4KSFA 4AB7A 2Q4VA 2BEIA 4MFQA 3P2FA 4CAWA 1I12A 4UCPA 4E2AA 4L89A 4F0XA 4C2YA 2B4DB 2G3TA 2VQYA 2VZZA 1S7NA 2OB0A 5IB0A 4H6ZA 2J8RA 3SHPA 2YGWA 3DSBA 3FYNA 3K9UA 5IX3A 4UBRA 5EC4A 3TOAA 5E96A 3EC4A 5GCNA 5ISVA 3V8IA 2Y0MA 1GHEA 5C82A 2GE3A 4FD5A 4KOXA 2QMLA 2K5TA 2Q7BA 2A4NA 1XE4A 4XNHB 4E8OA 5JQ4A 4DNCA 1M4DA 4UCNA 1S7KA 3I3GA 2GIVA 4Q36A 4U5YA 3KKWA 4II9A 4OLLA 4LUAA 1SQHA 2HUZA 3SXNA 4MY3A 2R7HA 3R95A 2Z11A 4KOSA 1PU9A 1NMTA 3EO4A 3R9EA 2B5GB 1IB1E 4NF1A 1S3ZA 4EVYA 3B8GA 4AG9A 4CGMA 4CYPA 1I21A 2WUUA 4CYOA 2FIWA 2CY2A 4ZBGA 3IU2A 2HV2A 2B3UA 3TO6A 2PQ8A 4QVTA 4R3KA 2B4BA 4R9MA 1LRZA 1CJWA 4MBUA 4M85A 1Y7RA 4OAEA 4KOTA 2FCKA 1FY7A 4RI1A 4Y49C 3UY5A 4AVAA 1YVOA 1YK3A 3TE4A 3BJ7A 2ZW6A 4F0YA 4H6UA 4B5PB 4MY0A 3TCVA 2P6FA 4B14A 4KSAA 1Z4EA 3BJ8A 2FL4A 1KUVA 3TOBA 1YLEA 3VWEA 4UA3A 1ZO0A 1KUYA 4I49A 4JLYA 4C68A 2FXFA 3I9SA 2X7BA 4HKFA 5A28A 1M1DA 2I79A 2WSAA 2AJ6A 3JUWA 1NSLA 2R98A 4GS4A 4B13A 2B58A 1Y9WA 2R8VA 4NEXA 2GANA 3DR8A 5H84A 1M4GA 1QSRA 2J8NA 2Z3KA 4CGOA 3QAHA 1U6MA 4AVBA 4UFWA 1IYLA 2JEVA 3T9YA 4UFVA 3N7ZA 3W6XA 2BUEA 4B11A 2ZW4A 1B87A 4X5KA 2CXAA 3CXPA 2Z3OA 3R9FA 3IU1A 2VI7A 4Q38A 2NMTA 3CXSA 3LODA 4OADA 5J8CA 4B12A 3IGRA 4J3GA 4MFJA 2VEZA 5CNPA 4KVME 1IICA 2YNEA 2G3AA 3D2MA 4CGPA 2VZYA 4JD6A 4UFXA 5EBVA 2D4PA 2FE7A 3QB8A 4UCMA 2FIAA 4ORFA 4KVOE 3TTHA 1MJBA 2D4OA 5AG5A 5AG4A 3DDDA 2H5MA 2P6GA 1MK4A 3IWEA 4AVCA 2PRBA 2JLMA 3PP9A 5JPHA 2IL4A 4F6AA 4K30A 1KZFA 2HQYA 3CXQA 2PC1A 1RO5A 1Z4RA 4B10A 1K4JA 4KZTA 1P4NA 1Q2YA 1IIDA 5KTDA 1S5KA 2B5GA 4FD4A 3R96A 2ZW7A 2BL1A 4MFPA 4IUSA 1UFHA 4Y49B 4A32A 2I00A 2DPTA 3GYAA 3GY9A 2Z0ZA 1P0HA 3DR6A 2ZPAA 3ZZIA 3GKRA 3ZJ0A 2YNDA 1I1DA 2ZW5A 2EVNA 1M4IA 4CAVA 4XPDB 1QSOA 5KTCA 1RXTA 2P0WA 5G1ZA 4KLWA 2Q44A 1YX0A 2RC4A 1QSNA 4KOWA 3R9GA 1ON0A 1QSMA 5IV0A 4BMHA 3FBUA 4A95A 1YVKA 2QIRA 2PR1A 3R1KA 4KUBA 3TFYA 5C88A 2CNTA 3H4QA 4C2XA 5KTAA 2YNCC 3FIXA 5G21A 3VWDA 4A30A 5J8FA 5A27A 3E0KA 3PGPA 4A31A 1VKCA 3NE7A 2Z3LA 2ZXVA 4YRHA 4NXYA 1Q2CA 1WK4A 1V0CA 1PUAA 3F0AA 4L8AA 3JVNA 1S7FA 2DXQA 4PSXA 2EUIA 3EY5A 1Q2DA 4IF5A 2B3VA 4XNHC 4M3SA 1R57A 3EXNA 2CNSA 4NCZA 4UWIA 2OZGA 4JWPA 2QECA 1MJ9A 3RYOA 5G22A 2PSWA 4KVXA 1J4JA 4KORA 4KUAA 3OWCA 4JXRA 3W91A 2KCWA 2PR8A 4RS2A 2B4DA 4B5PA 2J8MA 4XPLA 4R57A 2REEA 5F47A 2PDOA 3MGDA 2FT0A 4XPDC 5AG7A 3T90A 1BO4A 2Z3PA 4A33A 3D3SA 1OZPA 4U9ZA 4CS0B 2OZHA 1YREA 3S6GA 4CGNA 4QB9A 4MFKA 2DPSA 3FXTA 5F48A 4QBJA 2CNMA 2JDCA 2OH1A 2VBQA 5AG6A 4PK3A 3SXOA 3S6KA 4FD6A 1YGHA 1CM0A 4C7HA 5DWNA 2OZUA 4LX9A 1S7LA 2FSRA 4KLVA 4FD7A 3D2PA 4JXQA 3PZJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1B6B A;  3C26 A;  1WWZ A;  4KOU A;  1M44 A;  3WR7 A;  3BLN A;  1IYK A;  2ARH A;  2F5I A;  4CRY B;  1Y9K A;  2AE6 A;  4QUS A;  2P6E A;  2Q4Y A;  2C27 A;  2JDD A;  4AG7 A;  3F5B A;  1VHS A;  2ATR A;  3TT2 A;  4MI4 A;  3TO7 A;  4PV6 A;  2FS5 A;  1TIQ A;  4KOY A;  3DNS A;  2R1I A;  2REF A;  1N71 A;  4U9Y A;  2Z10 A;  4HNX B;  4JJX A;  4KOV A;  2Q04 A;  3TO9 A;  1MJA A;  2OU2 A;  4HNY B;  5I0C A;  2BSW A;  1XMT A;  3D8P A;  1YR0 A;  1NE9 A;  1XF8 A;  2Q0Y A;  4UWJ A;  4E0A A;  2WPW A;  4YFJ A;  4HNW B;  5F49 A;  1XIX A;  2VXK A;  1S60 A;  5HH1 A;  4PSW A;  4H89 A;  3P2H A;  2G0B A;  3FB3 A;  4B5O A;  4MHD A;  5FVJ A;  3EFA A;  4ONU A;  3G8W A;  4R3L A;  4CAX A;  3W6S A;  4XPK A;  3S6H A;  5HMN A;  1KUX A;  3LD2 A;  1Z9U A;  3FNC A;  3G3S A;  4YGO A;  3F8K A;  1BOB A;  2WPX A;  4CRZ B;  4PK2 A;  1QST A;  3S6F A;  1L0C A;  5H86 A;  4MJ8 A;  5F46 A;  3IWG A;  2O28 A;  1XEB A;  5DWM A;  4NSQ A;  4R87 A;  3FRM A;  4QC6 A;  4AB7 A;  2Q4V A;  2BEI A;  3P2F A;  4CAW A;  1I12 A;  4E2A A;  4L89 A;  2B4D B;  2G3T A;  2VQY A;  2VZZ A;  1S7N A;  2OB0 A;  5IB0 A;  4H6Z A;  2J8R A;  3SHP A;  3DSB A;  3FYN A;  3K9U A;  5IX3 A;  4UBR A;  5EC4 A;  3TOA A;  5E96 A;  3EC4 A;  5GCN A;  5ISV A;  3V8I A;  2Y0M A;  1GHE A;  5C82 A;  2GE3 A;  4FD5 A;  4KOX A;  2QML A;  2K5T A;  2Q7B A;  2A4N A;  1XE4 A;  4XNH B;  4E8O A;  5JQ4 A;  4DNC A;  1M4D A;  1S7K A;  3I3G A;  2GIV A;  4U5Y A;  3KKW A;  4II9 A;  4OLL A;  4LUA A;  1SQH A;  2HUZ A;  3SXN A;  4MY3 A;  2R7H A;  3R95 A;  2Z11 A;  4KOS A;  1PU9 A;  1NMT A;  3EO4 A;  3R9E A;  2B5G B;  1IB1 E;  4NF1 A;  1S3Z A;  4EVY A;  3B8G A;  4AG9 A;  1I21 A;  2FIW A;  2CY2 A;  4ZBG A;  2HV2 A;  2B3U A;  3TO6 A;  2PQ8 A;  4QVT A;  4R3K A;  2B4B A;  4R9M A;  1LRZ A;  1CJW A;  4MBU A;  4M85 A;  1Y7R A;  4OAE A;  4KOT A;  2FCK A;  1FY7 A;  4RI1 A;  4Y49 C;  3UY5 A;  4AVA A;  1YVO A;  1YK3 A;  3TE4 A;  3BJ7 A;  2ZW6 A;  4F0Y A;  4H6U A;  4B5P B;  4MY0 A;  3TCV A;  2P6F A;  1Z4E A;  3BJ8 A;  2FL4 A;  1KUV A;  3TOB A;  1YLE A;  3VWE A;  4UA3 A;  1KUY A;  4I49 A;  4JLY A;  2FXF A;  3I9S A;  2X7B A;  4HKF A;  1M1D A;  2I79 A;  2AJ6 A;  3JUW A;  1NSL A;  2R98 A;  4GS4 A;  2B58 A;  1Y9W A;  2R8V A;  4NEX A;  2GAN A;  3DR8 A;  5H84 A;  1M4G A;  1QSR A;  2J8N A;  3QAH A;  1U6M A;  4AVB A;  1IYL A;  2JEV A;  3T9Y A;  3N7Z A;  3W6X A;  2BUE A;  2ZW4 A;  1B87 A;  4X5K A;  3CXP A;  3R9F A;  2VI7 A;  2NMT A;  3CXS A;  3LOD A;  4OAD A;  5J8C A;  3IGR A;  4J3G A;  2VEZ A;  5CNP A;  4KVM E;  1IIC A;  2G3A A;  3D2M A;  2VZY A;  4JD6 A;  5EBV A;  2D4P A;  2FE7 A;  3QB8 A;  2FIA A;  4ORF A;  4KVO E;  3TTH A;  1MJB A;  2D4O A;  3DDD A;  2H5M A;  2P6G A;  1MK4 A;  4AVC A;  2PRB A;  2JLM A;  3PP9 A;  5JPH A;  2IL4 A;  4F6A A;  4K30 A;  1KZF A;  2HQY A;  3CXQ A;  2PC1 A;  1RO5 A;  1Z4R A;  1K4J A;  4KZT A;  1P4N A;  1Q2Y A;  1IID A;  5KTD A;  1S5K A;  2B5G A;  4FD4 A;  3R96 A;  2ZW7 A;  2BL1 A;  4IUS A;  1UFH A;  4Y49 B;  2I00 A;  3GYA A;  3GY9 A;  2Z0Z A;  1P0H A;  3DR6 A;  2ZPA A;  3ZZI A;  3GKR A;  3ZJ0 A;  1I1D A;  2ZW5 A;  2EVN A;  1M4I A;  4CAV A;  4XPD B;  1QSO A;  5KTC A;  1RXT A;  2P0W A;  4KLW A;  2Q44 A;  1YX0 A;  2RC4 A;  1QSN A;  4KOW A;  3R9G A;  1ON0 A;  1QSM A;  5IV0 A;  4BMH A;  3FBU A;  1YVK A;  2QIR A;  2PR1 A;  3R1K A;  4KUB A;  3TFY A;  5C88 A;  2CNT A;  3H4Q A;  5KTA A;  3FIX A;  3VWD A;  5J8F A;  3E0K A;  3PGP A;  1VKC A;  3NE7 A;  2ZXV A;  4YRH A;  4NXY A;  1Q2C A;  1WK4 A;  1V0C A;  1PUA A;  3F0A A;  4L8A A;  3JVN A;  1S7F A;  2DXQ A;  4PSX A;  2EUI A;  3EY5 A;  1Q2D A;  4IF5 A;  2B3V A;  4XNH C;  4M3S A;  1R57 A;  3EXN A;  2CNS A;  4NCZ A;  4UWI A;  2OZG A;  4JWP A;  2QEC A;  1MJ9 A;  3RYO A;  2PSW A;  4KVX A;  1J4J A;  4KOR A;  4KUA A;  3OWC A;  4JXR A;  3W91 A;  2KCW A;  2PR8 A;  4RS2 A;  2B4D A;  4B5P A;  2J8M A;  4XPL A;  4R57 A;  2REE A;  5F47 A;  2PDO A;  3MGD A;  2FT0 A;  4XPD C;  3T90 A;  1BO4 A;  3D3S A;  1OZP A;  4U9Z A;  4CS0 B;  2OZH A;  1YRE A;  3S6G A;  4QB9 A;  3FXT A;  5F48 A;  4QBJ A;  2CNM A;  2JDC A;  2OH1 A;  2VBQ A;  4PK3 A;  3SXO A;  3S6K A;  4FD6 A;  1YGH A;  1CM0 A;  5DWN A;  2OZU A;  4LX9 A;  1S7L A;  2FSR A;  4KLV A;  4FD7 A;  3D2P A;  4JXQ A;  3PZJ A; 
#chains in the Genus database with same CATH topology
 1B6B A;  3C26 A;  1WWZ A;  4KOU A;  1M44 A;  3WR7 A;  3BLN A;  4F9V A;  2NYQ A;  1IYK A;  2ARH A;  4OC0 A;  4BIN A;  1UWY A;  4ZYQ A;  4P4B A;  3KR5 A;  1YSJ A;  4MCQ A;  3NA6 A;  4MFZ A;  3IJ3 A;  2PJ3 A;  1YW6 A;  1CX8 A;  1IOF A;  4MFL A;  4ZX8 A;  2F5I A;  4CPA A;  4CRY B;  1Y9K A;  4OME A;  4TWE A;  2AE6 A;  4QUS A;  3ISX A;  2P6E A;  2Q4Y A;  2GLF A;  2PJ9 A;  4MXU A;  3JTK A;  3RNZ A;  1LOK A;  2C27 A;  2JDD A;  2JBJ A;  3GUX A;  4A94 A;  2NSM A;  1JWQ A;  4CAF A;  4CAE A;  4AG7 A;  2BOA A;  2Z3N A;  3F5B A;  5AGE A;  4RUH A;  1ARM A;  1VHS A;  2ATR A;  1F57 A;  4YWY A;  4OP4 A;  3TT2 A;  4CYQ A;  3D67 A;  4KSI A;  4MI4 A;  3TO7 A;  4PV6 A;  2PVV A;  4MRI A;  2FS5 A;  1TIQ A;  4KOY A;  3DNS A;  2R1I A;  2REF A;  1N71 A;  4Q7A A;  2Z10 A;  3IWW A;  4HNX B;  4U9Y A;  4C2Z A;  4JJX A;  4IAV A;  4KOV A;  4MCR A;  4A2Z A;  5HVF A;  4C7I A;  2Q04 A;  3TO9 A;  2HB6 A;  5K8P A;  1MJA A;  2OU2 A;  4HNY B;  5I0C A;  2BSW A;  3H5Z A;  1XMT A;  2Z3M A;  4CGL A;  3D68 A;  5G20 A;  3D8P A;  4ZGY B;  4P10 A;  3PB8 X;  1YR0 A;  1NE9 A;  1XF8 A;  5D8N A;  2YNC A;  1TKF A;  2DF5 A;  4OC3 A;  5J1Q A;  3KZW A;  3WC7 A;  2GRE A;  1Y0Y A;  2Q0Y A;  4OC1 A;  4P44 A;  4UWJ A;  4AXV A;  4E0A A;  4BBH A;  2WPW A;  1XRY A;  4YFJ A;  2EWB A;  4HNW B;  1DTD A;  3BHX A;  5F49 A;  4UF4 A;  1XIX A;  2VXK A;  4G1P A;  4CYN A;  2XEJ A;  2AFZ A;  1S60 A;  5HH1 A;  4PSW A;  3H8E A;  4H89 A;  1QMU A;  1BPN A;  2Q43 A;  5BWA B;  3DLJ A;  1IOI A;  3P2H A;  4KS9 A;  3FH4 A;  4M6G A;  3D7G A;  2G0B A;  3FB3 A;  4B5O A;  4MHD A;  4R6T A;  3RBU A;  5FVJ A;  3EFA A;  3D4U A;  2AFO A;  4NJR A;  2PJ0 A;  3G8W A;  4ONU A;  4R3L A;  4UEE A;  3W6S A;  4CAX A;  4XPK A;  2ZEH A;  3S6H A;  5HMN A;  2EK9 A;  2J9A A;  1KUX A;  3LD2 A;  1Z9U A;  3FNC A;  3A9L A;  3G3S A;  5K8M A;  4YGO A;  3F8K A;  2PJ2 A;  1BOB A;  2WPX A;  4FWU A;  2EK8 A;  4CRZ B;  4PK2 A;  1Z8L A;  1QST A;  5CBM A;  3KQX A;  1BAV A;  3S6F A;  3KHZ A;  1L0C A;  5H86 A;  3KL9 A;  2PIZ A;  3B3C A;  4MJ8 A;  2HC9 A;  5LRK A;  2ZEE A;  5F46 A;  4A38 A;  3IWG A;  4RN7 A;  2O28 A;  1XEB A;  2ZOF A;  6CPA A;  5DWM A;  4K3N A;  4NSQ A;  4R87 A;  3FRM A;  4QC6 A;  2ZEG A;  4KSF A;  4AB7 A;  2Q4V A;  2BEI A;  2XEG A;  4MFQ A;  3P2F A;  1YQE A;  1I12 A;  4CAW A;  4UCP A;  4E2A A;  1LAP A;  4L89 A;  4C2Y A;  4F0X A;  3B3W A;  2B4D B;  2G3T A;  2VQY A;  3KQZ A;  1S7N A;  2V77 A;  2VZZ A;  3PRT A;  2OB0 A;  1ARL A;  4H6Z A;  3RZA A;  5IB0 A;  2J8R A;  4NGP A;  3SHP A;  1QQ9 A;  2YGW A;  3DSB A;  4NGR A;  2DEA A;  3FYN A;  3RO0 A;  3K9U A;  4LQG A;  5IX3 A;  1TKH A;  4UBR A;  4A37 A;  5EC4 A;  3TOA A;  4O23 A;  4JYW A;  5E96 A;  4IK2 A;  3EC4 A;  3LMS A;  5GCN A;  3RAM A;  5ISV A;  3V8I A;  2PJ5 A;  2Y0M A;  1GHE A;  2PE3 A;  2BCO A;  2GE3 A;  4FD5 A;  4KOX A;  5C82 A;  2QML A;  3WC5 A;  2K5T A;  2Q7B A;  3BXM A;  2A4N A;  1IY7 A;  3SI0 A;  1XE4 A;  3KI9 A;  4XNH B;  4W9Y A;  4E8O A;  5JQ4 A;  3B7I A;  5JH9 A;  1Y0R A;  4DNC A;  1M4D A;  2ZEO A;  4UCN A;  1S7K A;  2RFH A;  2I3C A;  3I3G A;  2GIV A;  4Q36 A;  3PBB A;  4U5Y A;  3HUV A;  5IB9 A;  3KKW A;  2O4H A;  4II9 A;  4OLL A;  3K2K A;  4LUA A;  3IO1 A;  4F8Z A;  3ISZ A;  3CDX A;  1SQH A;  1YLO A;  2HUZ A;  2Q4Z A;  3SXN A;  5LYD A;  4MY3 A;  2R7H A;  2AFS A;  3GB0 A;  3R95 A;  8CPA A;  1CP7 A;  2Z11 A;  4KOS A;  1PU9 A;  1NMT A;  3EO4 A;  1AYE A;  4H2K A;  3R9E A;  2B5G B;  2PVW A;  1IB1 E;  3PB9 X;  4NF1 A;  1S3Z A;  2XEI A;  1LAN A;  3FMC A;  3NH4 A;  4EVY A;  3CPX A;  1VGY A;  3B8G A;  4AG9 A;  4CGM A;  1XJO A;  4CYP A;  1I21 A;  2WUU A;  2ABZ A;  4CYO A;  2FIW A;  2CY2 A;  3PFO A;  4R7M A;  2BO9 A;  4ZBG A;  3IU2 A;  2HV2 A;  2ODF A;  4PXC A;  5HXD A;  2B3U A;  4PPZ A;  2IJZ A;  3NE8 A;  2PJA A;  3TO6 A;  2PQ8 A;  2PJ6 A;  2XEF A;  4QVT A;  4R3K A;  2B4B A;  2G9D A;  3V38 A;  4NGQ A;  4R9M A;  1LRZ A;  2Q7S A;  4DYO A;  1GYT A;  1CJW A;  2O53 A;  4M85 A;  4MBU A;  1Y7R A;  3N5F A;  1VIX A;  1ZLH A;  4EME A;  4MCP A;  2F8H A;  1TKJ A;  4OAE A;  4BD9 A;  3LWU A;  4NGT A;  4KOT A;  2FCK A;  3S9M A;  1FY7 A;  4RI1 A;  1Y7E A;  4Y49 C;  1VHE A;  3UY5 A;  4AVA A;  1YVO A;  1YK3 A;  2CTB A;  5JM6 A;  3TE4 A;  3CZX A;  3GLJ A;  2CIJ A;  3BJ7 A;  3JRU A;  5EMI A;  2ZW6 A;  4F0Y A;  3MRU A;  4H6U A;  2GLJ A;  3FEC A;  4LQ6 A;  4MY0 A;  3TCV A;  3NFZ A;  4B5P B;  3VAR A;  4MHY A;  4UIA A;  4YU9 A;  2P6F A;  4B14 A;  4KSA A;  1Z4E A;  3BJ8 A;  2FL4 A;  5LRJ A;  4ZY0 A;  2GFQ A;  1KUV A;  2C6P A;  1YW4 A;  1NSA A;  4FUU A;  3TOB A;  1EE3 P;  1YLE A;  3VWE A;  3PB6 X;  1ZG8 A;  4UA3 A;  1ZO0 A;  1KUY A;  2V8V A;  4I49 A;  2PJB A;  4JLY A;  2PCU A;  4C68 A;  3H8F A;  2FXF A;  1HDQ A;  3I9S A;  4M6I A;  2X7B A;  4HKF A;  5A28 A;  1M1D A;  3FJU A;  2I79 A;  1LFW A;  2WSA A;  4R8F A;  2AJ6 A;  3IC1 A;  3QNV A;  3D7D A;  2CTC A;  3JUW A;  4PQA A;  4NGS A;  1NSL A;  2R98 A;  4GS4 A;  1FT7 A;  4B13 A;  2B58 A;  4MMO A;  1Y9W A;  2R8V A;  4NEX A;  5K8O A;  2GAN A;  3DR8 A;  3TX8 A;  4DJL A;  5H84 A;  4M6H A;  1M4G A;  1QSR A;  1LAM A;  2J8N A;  2Z3K A;  4CGO A;  1XMB A;  4ZY2 A;  3S9L A;  3QAH A;  1U6M A;  2OOT A;  4AVB A;  4UFW A;  1IYL A;  2JEV A;  3T9Y A;  4UFV A;  3SI2 A;  3N7Z A;  1Z8W A;  4OC5 A;  2POK A;  3VAT A;  2BUE A;  3B35 A;  3W6X A;  2ZW4 A;  2PJC A;  4B11 A;  1B87 A;  3FEE A;  3T8W A;  4X5K A;  2CXA A;  1VHO A;  1TXR A;  2Z3O A;  3CXP A;  4NFR A;  3R9F A;  5I4M A;  5LYF A;  3IU1 A;  2ZEP A;  2VI7 A;  4B6Z A;  4Q38 A;  2NMT A;  3CXS A;  3FVL A;  1R43 A;  2ZEN A;  4P6Y A;  3LOD A;  3B3V A;  4OAD A;  5J8C A;  4B12 A;  3IGR A;  3DGV A;  3B3S A;  4J3G A;  1LCP A;  4P4I A;  4MFJ A;  2VEZ A;  5CNP A;  4KVM E;  1IIC A;  4MHZ A;  2YNE A;  2G3A A;  3D2M A;  1HDU A;  3PEI A;  4CGP A;  2VZY A;  4JD6 A;  4UFX A;  1XBU A;  2ZEL A;  5EBV A;  2D4P A;  2IMO A;  5LRG A;  1M4L A;  3D66 A;  2FE7 A;  4JZ0 A;  4X3R A;  3QB8 A;  1ZLI A;  1DE4 C;  3IIB A;  3KAS A;  4UCM A;  2FIA A;  5HVG A;  4ORF A;  4A39 A;  4KVO E;  3TTH A;  1MJB A;  2D4O A;  3PB7 X;  3PBE A;  5AG5 A;  3DDD A;  2V8D A;  4UEZ A;  5ELY A;  4DUK A;  3QAY A;  5AG4 A;  2H5M A;  2P6G A;  1MK4 A;  3SI1 A;  3IWE A;  4AVC A;  2PRB A;  2JLM A;  1X10 A;  3FX6 A;  3PP9 A;  4P4D A;  5JPH A;  2IL4 A;  1A2Z A;  4F6A A;  4ZY1 A;  3NH5 A;  4K30 A;  3WAB A;  1KZF A;  2RB7 A;  2HQY A;  2PIY A;  3CXQ A;  2PC1 A;  1RO5 A;  1Z4R A;  2V8H A;  4B10 A;  1CP6 A;  1K4J A;  1Z8T A;  4HPS A;  4KZT A;  1IGB A;  4R76 A;  3IFE A;  4NGM A;  1P4N A;  1Q2Y A;  1IID A;  4P4F A;  1CG2 A;  1Z5R A;  3PB4 X;  1S5K A;  5KTD A;  2B5G A;  4FD4 A;  3R96 A;  2ZW7 A;  2BL1 A;  4MFP A;  4IUS A;  1UFH A;  4OID A;  4X8I A;  4Y49 B;  5LYL A;  7CPA A;  4A32 A;  1ELM P;  2I00 A;  1AMP A;  2DPT A;  3FF3 A;  3GY9 A;  1CPS A;  3GYA A;  3KHX A;  4P4E A;  2Z0Z A;  2ZOG A;  1P0H A;  3DR6 A;  2QVP A;  1CBX A;  2ZPA A;  4P45 A;  3GKR A;  3TC8 A;  3ZZI A;  1Q7L A;  3KR4 A;  3ZJ0 A;  2ZEF A;  3H8G A;  2YND A;  1I1D A;  2ZW5 A;  3D7F A;  2EVN A;  1M4I A;  1PYT B;  4XPD B;  4ZX9 A;  1QSO A;  4CAV A;  5KTC A;  1BPM A;  1RXT A;  2P0W A;  4MCS A;  5G1Z A;  4PXD A;  3IEH A;  4KLW A;  1XFO A;  2Q44 A;  1YX0 A;  2RC4 A;  1QSN A;  2CF4 A;  4KOW A;  3R9G A;  1ON0 A;  1QSM A;  5IV0 A;  4BMH A;  3FBU A;  2WZN A;  4A95 A;  1YVK A;  1PCA A;  5JGF A;  2QIR A;  2PR1 A;  3R1K A;  1AUG A;  4KUB A;  3TFY A;  1BLL E;  1R3N A;  1Z2L A;  3FED A;  5C88 A;  2CNT A;  5THW A;  3H4Q A;  4C2X A;  3B2Y A;  3LAC A;  5K8N A;  5KTA A;  2YNC C;  3SJE A;  3FIX A;  4NJQ A;  4IHM A;  1X12 A;  5G21 A;  2JEW A;  3VWD A;  3CPA A;  4A30 A;  2FVG A;  5J8F A;  3WT4 A;  4WJB A;  5A27 A;  3E0K A;  1CPX A;  3PGP A;  4A31 A;  1VKC A;  3NE7 A;  1FNO A;  3V7Z A;  2Z3L A;  1TF9 A;  1H8L A;  2ZXV A;  4YRH A;  1YME A;  4NXY A;  1Q2C A;  1WK4 A;  1V0C A;  1PUA A;  3F0A A;  4EFD A;  4GXH A;  3JVN A;  4L8A A;  3KGQ A;  1S7F A;  3I1U A;  5D29 A;  4WWV A;  2DXQ A;  4FAI A;  4PSX A;  1IU8 A;  2ZED A;  3HLP A;  2IQ6 A;  2ANP A;  2EUI A;  1RTQ A;  2AFU A;  3EY5 A;  1Q2D A;  4IF5 A;  2B3V A;  4XNH C;  4M3S A;  4PXB A;  1R57 A;  2F7V A;  3EXN A;  3MN8 A;  4MHP A;  2Q51 A;  3D7H A;  2ZEM A;  1KWM A;  2CNS A;  4NCZ A;  4UWI A;  2OZG A;  5HVH A;  4JWP A;  2QEC A;  1MJ9 A;  3PFE A;  4GM5 A;  4OKO A;  3RYO A;  5G22 A;  1ELL P;  2EBJ A;  2PSW A;  2AFM A;  4KVX A;  4MHN A;  1J4J A;  5CPA A;  2PJ4 A;  1ZG9 A;  2QYV A;  5F09 A;  4KOR A;  4KUA A;  3OWC A;  4JXR A;  1HEE A;  3W91 A;  2KCW A;  2PR8 A;  4RS2 A;  3WC6 A;  2B4D A;  5LYI A;  3SJG A;  4B5P A;  2J8M A;  3GIU A;  4XPL A;  1JQG A;  3VH9 A;  4FBE A;  2PJ8 A;  2C6G A;  4R57 A;  2REE A;  2AFX A;  4OIW A;  3BI1 A;  3BI0 A;  4F9U A;  2JBK A;  5F47 A;  2PDO A;  3K9T A;  2FT0 A;  2V8G A;  3MGD A;  4XPD C;  5AG7 A;  4NGN A;  3T90 A;  4Z65 A;  3CT9 A;  1BO4 A;  1ZG7 A;  2Z3P A;  4TNU A;  4A33 A;  3D3S A;  1OZP A;  2PJ1 A;  4U9Z A;  1XOV A;  2C1C A;  1Z8X A;  4CS0 B;  2QJ8 A;  3B3T A;  2OZH A;  1YRE A;  4P4J A;  2AFW A;  4QB9 A;  3S6G A;  4MFK A;  4CGN A;  2DPS A;  3FXT A;  5F48 A;  4QBJ A;  1TF8 A;  3S9N A;  2CNM A;  2PRQ A;  2JDC A;  2OH1 A;  2VL1 A;  2VBQ A;  4PXE A;  5AG6 A;  2GU2 A;  5DS0 A;  1OBR A;  4PK3 A;  3SXO A;  1F2P A;  4ZI6 A;  4X2T A;  4FD6 A;  3S6K A;  4UIB A;  4ONW A;  1YGH A;  4OC2 A;  4OC4 A;  1CM0 A;  4C7H A;  3SJF A;  5DWN A;  3SJX A;  4EWT A;  2OR4 A;  2OZU A;  2C6C A;  4LX9 A;  2PJ7 A;  2WYR A;  1S7L A;  2EO8 A;  1F2O A;  2FSR A;  4FD7 A;  4KLV A;  3L2N A;  3NH8 A;  3D2P A;  4UEF A;  4JXQ A;  3PZJ A; 
#chains in the Genus database with same CATH homology
 1B6B A;  3C26 A;  1WWZ A;  4KOU A;  1M44 A;  3WR7 A;  3BLN A;  1IYK A;  2ARH A;  4MFZ A;  4MFL A;  2F5I A;  4CRY B;  1Y9K A;  2AE6 A;  4QUS A;  2P6E A;  2Q4Y A;  3JTK A;  2C27 A;  2JDD A;  4CAF A;  4CAE A;  4AG7 A;  2Z3N A;  5AGE A;  3F5B A;  1VHS A;  2ATR A;  3TT2 A;  4CYQ A;  4MI4 A;  3TO7 A;  4PV6 A;  2FS5 A;  1TIQ A;  4KOY A;  3DNS A;  2R1I A;  2REF A;  1N71 A;  4U9Y A;  2Z10 A;  4HNX B;  4C2Z A;  4JJX A;  4KOV A;  4A2Z A;  4C7I A;  2Q04 A;  3TO9 A;  1MJA A;  2OU2 A;  4HNY B;  5I0C A;  2BSW A;  3H5Z A;  1XMT A;  2Z3M A;  4CGL A;  5G20 A;  3D8P A;  4ZGY B;  1YR0 A;  1NE9 A;  1XF8 A;  2YNC A;  2Q0Y A;  4UWJ A;  4E0A A;  4BBH A;  2WPW A;  4YFJ A;  4HNW B;  5F49 A;  1XIX A;  2VXK A;  4CYN A;  1S60 A;  5HH1 A;  4PSW A;  4H89 A;  5BWA B;  3P2H A;  4KS9 A;  2G0B A;  3FB3 A;  4B5O A;  4MHD A;  5FVJ A;  3EFA A;  4ONU A;  3G8W A;  4R3L A;  4CAX A;  3W6S A;  4XPK A;  3S6H A;  5HMN A;  1KUX A;  3LD2 A;  1Z9U A;  3FNC A;  3A9L A;  3G3S A;  4YGO A;  3F8K A;  1BOB A;  2WPX A;  4CRZ B;  4PK2 A;  1QST A;  3S6F A;  1L0C A;  5H86 A;  4MJ8 A;  5F46 A;  3IWG A;  2O28 A;  1XEB A;  5DWM A;  4NSQ A;  4R87 A;  3FRM A;  4QC6 A;  4KSF A;  4AB7 A;  2Q4V A;  2BEI A;  4MFQ A;  3P2F A;  4CAW A;  1I12 A;  4UCP A;  4E2A A;  4L89 A;  4F0X A;  4C2Y A;  2B4D B;  2G3T A;  2VQY A;  2VZZ A;  1S7N A;  2OB0 A;  5IB0 A;  4H6Z A;  2J8R A;  3SHP A;  2YGW A;  3DSB A;  3FYN A;  3K9U A;  5IX3 A;  4UBR A;  5EC4 A;  3TOA A;  5E96 A;  3EC4 A;  5GCN A;  5ISV A;  3V8I A;  2Y0M A;  1GHE A;  5C82 A;  2GE3 A;  4FD5 A;  4KOX A;  2QML A;  2K5T A;  2Q7B A;  2A4N A;  1XE4 A;  4XNH B;  4E8O A;  5JQ4 A;  4DNC A;  1M4D A;  4UCN A;  1S7K A;  3I3G A;  2GIV A;  4Q36 A;  4U5Y A;  3KKW A;  4II9 A;  4OLL A;  4LUA A;  1SQH A;  2HUZ A;  3SXN A;  4MY3 A;  2R7H A;  3R95 A;  2Z11 A;  4KOS A;  1PU9 A;  1NMT A;  3EO4 A;  3R9E A;  2B5G B;  1IB1 E;  4NF1 A;  1S3Z A;  4EVY A;  3B8G A;  4AG9 A;  4CGM A;  4CYP A;  1I21 A;  2WUU A;  4CYO A;  2FIW A;  2CY2 A;  4ZBG A;  3IU2 A;  2HV2 A;  2B3U A;  3TO6 A;  2PQ8 A;  4QVT A;  4R3K A;  2B4B A;  4R9M A;  1LRZ A;  1CJW A;  4MBU A;  4M85 A;  1Y7R A;  4OAE A;  4KOT A;  2FCK A;  1FY7 A;  4RI1 A;  4Y49 C;  3UY5 A;  4AVA A;  1YVO A;  1YK3 A;  3TE4 A;  3BJ7 A;  2ZW6 A;  4F0Y A;  4H6U A;  4B5P B;  4MY0 A;  3TCV A;  2P6F A;  4B14 A;  4KSA A;  1Z4E A;  3BJ8 A;  2FL4 A;  1KUV A;  3TOB A;  1YLE A;  3VWE A;  4UA3 A;  1ZO0 A;  1KUY A;  4I49 A;  4JLY A;  4C68 A;  2FXF A;  3I9S A;  2X7B A;  4HKF A;  5A28 A;  1M1D A;  2I79 A;  2WSA A;  2AJ6 A;  3JUW A;  1NSL A;  2R98 A;  4GS4 A;  4B13 A;  2B58 A;  1Y9W A;  2R8V A;  4NEX A;  2GAN A;  3DR8 A;  5H84 A;  1M4G A;  1QSR A;  2J8N A;  2Z3K A;  4CGO A;  3QAH A;  1U6M A;  4AVB A;  4UFW A;  1IYL A;  2JEV A;  3T9Y A;  4UFV A;  3N7Z A;  3W6X A;  2BUE A;  4B11 A;  2ZW4 A;  1B87 A;  4X5K A;  2CXA A;  3CXP A;  2Z3O A;  3R9F A;  3IU1 A;  2VI7 A;  4Q38 A;  2NMT A;  3CXS A;  3LOD A;  4OAD A;  5J8C A;  4B12 A;  3IGR A;  4J3G A;  4MFJ A;  2VEZ A;  5CNP A;  4KVM E;  1IIC A;  2YNE A;  2G3A A;  3D2M A;  4CGP A;  2VZY A;  4JD6 A;  4UFX A;  5EBV A;  2D4P A;  2FE7 A;  3QB8 A;  4UCM A;  2FIA A;  4ORF A;  4KVO E;  3TTH A;  1MJB A;  2D4O A;  5AG5 A;  5AG4 A;  3DDD A;  2H5M A;  2P6G A;  1MK4 A;  3IWE A;  4AVC A;  2PRB A;  2JLM A;  3PP9 A;  5JPH A;  2IL4 A;  4F6A A;  4K30 A;  1KZF A;  2HQY A;  3CXQ A;  2PC1 A;  1RO5 A;  1Z4R A;  4B10 A;  1K4J A;  4KZT A;  1P4N A;  1Q2Y A;  1IID A;  5KTD A;  1S5K A;  2B5G A;  4FD4 A;  3R96 A;  2ZW7 A;  2BL1 A;  4MFP A;  4IUS A;  1UFH A;  4Y49 B;  4A32 A;  2I00 A;  2DPT A;  3GYA A;  3GY9 A;  2Z0Z A;  1P0H A;  3DR6 A;  2ZPA A;  3ZZI A;  3GKR A;  3ZJ0 A;  2YND A;  1I1D A;  2ZW5 A;  2EVN A;  1M4I A;  4CAV A;  4XPD B;  1QSO A;  5KTC A;  1RXT A;  2P0W A;  5G1Z A;  4KLW A;  2Q44 A;  1YX0 A;  2RC4 A;  1QSN A;  4KOW A;  3R9G A;  1ON0 A;  1QSM A;  5IV0 A;  4BMH A;  3FBU A;  4A95 A;  1YVK A;  2QIR A;  2PR1 A;  3R1K A;  4KUB A;  3TFY A;  5C88 A;  2CNT A;  3H4Q A;  4C2X A;  5KTA A;  2YNC C;  3FIX A;  5G21 A;  3VWD A;  4A30 A;  5J8F A;  5A27 A;  3E0K A;  3PGP A;  4A31 A;  1VKC A;  3NE7 A;  2Z3L A;  2ZXV A;  4YRH A;  4NXY A;  1Q2C A;  1WK4 A;  1V0C A;  1PUA A;  3F0A A;  4L8A A;  3JVN A;  1S7F A;  2DXQ A;  4PSX A;  2EUI A;  3EY5 A;  1Q2D A;  4IF5 A;  2B3V A;  4XNH C;  4M3S A;  1R57 A;  3EXN A;  2CNS A;  4NCZ A;  4UWI A;  2OZG A;  4JWP A;  2QEC A;  1MJ9 A;  3RYO A;  5G22 A;  2PSW A;  4KVX A;  1J4J A;  4KOR A;  4KUA A;  3OWC A;  4JXR A;  3W91 A;  2KCW A;  2PR8 A;  4RS2 A;  2B4D A;  4B5P A;  2J8M A;  4XPL A;  4R57 A;  2REE A;  5F47 A;  2PDO A;  3MGD A;  2FT0 A;  4XPD C;  5AG7 A;  3T90 A;  1BO4 A;  2Z3P A;  4A33 A;  3D3S A;  1OZP A;  4U9Z A;  4CS0 B;  2OZH A;  1YRE A;  3S6G A;  4CGN A;  4QB9 A;  4MFK A;  2DPS A;  3FXT A;  5F48 A;  4QBJ A;  2CNM A;  2JDC A;  2OH1 A;  2VBQ A;  5AG6 A;  4PK3 A;  3SXO A;  3S6K A;  4FD6 A;  1YGH A;  1CM0 A;  4C7H A;  5DWN A;  2OZU A;  4LX9 A;  1S7L A;  2FSR A;  4KLV A;  4FD7 A;  3D2P A;  4JXQ A;  3PZJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...