3JUWA

Putative gnat-family acetyltransferase from bordetella pertussis.
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
167
structure length
167
Chain Sequence
b'RQVLKTDRLVLEPQSMARFDQWFAMERQRDEAGHRDLTEDQAWLRLCARQGMWDAYACGFYYLLDPVSGEMRGEAGFQFRRRGFGPGFDNHPEAAWAVASAHQGRGLAAEAMQALLAHHDRSSGRQRVVALIARSNLPSLRLAERLGFRGYSDVAFDGAAHLLLERA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Probable GnaT-family acetyltransferase
publication title X-ray crystal structure of putative GnaT-family acetyltransferase from Bordetella pertussis.
rcsb
source organism Bordetella pertussis
molecule tags Transferase
total genus 46
structure length 167
sequence length 167
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2009-09-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13302 Acetyltransf_3 Acetyltransferase (GNAT) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 3juwA00
2OZGA 5H86A 2Z10A 1PUAA 2FT0A 3DNSA 3K9UA 1PU9A 2OH1A 2B4DB 1TIQA 4KOYA 2FIWA 1M1DA 1Y7RA 4JD6A 3W6XA 1CM0A 1SQHA 3JUWA 4ORFA 4MBUA 5E96A 3PGPA 2R7HA 2R8VA 2ZPAA 2FS5A 1LRZA 2B3UA 3CXSA 1UFHA 5EC4A 2GIVA 4CAVA 4FD6A 5KTCA 1V0CA 1I1DA 4MY0A 3QB8A 1Z4EA 4U5YA 4E8OA 2REEA 3FIXA 2VI7A 1YGHA 2WPXA 4KOWA 5ISVA 1Y9WA 3D2PA 2R98A 4F6AA 3R9FA 3TOAA 2B58A 4M3SA 1IYKA 3T9YA 3TE4A 1N71A 4PK2A 3DSBA 1KUVA 1NSLA 1WK4A 3H4QA 1WWZA 1YVKA 2CNMA 2Q0YA 3F5BA 4OAEA 5I0CA 1B87A 2R1IA 2HV2A 2ARHA 4PSWA 4CS0B 4KVME 3EC4A 2HUZA 1M4DA 3SXNA 2JDCA 4X5KA 2FXFA 2VEZA 4KLVA 3FBUA 2Q7BA 2G3AA 4EVYA 5C88A 5HH1A 4AVBA 1YK3A 2Y0MA 5JPHA 2D4OA 1S7KA 4R87A 2I00A 2ZW5A 4F0YA 5DWNA 3FB3A 1YREA 3R1KA 1RXTA 1M44A 3DR8A 4MI4A 2AJ6A 4RI1A 4MJ8A 4FD5A 3E0KA 3FXTA 4PSXA 1QSRA 3ZZIA 4LX9A 3DR6A 3EO4A 3SXOA 3SHPA 4R3KA 2BL1A 1YVOA 2QMLA 4Y49C 3W6SA 3FNCA 3R96A 4KOUA 5DWMA 1NE9A 2X7BA 1P0HA 2JDDA 2IL4A 3CXQA 4HNYB 4ONUA 4CAXA 3TOBA 3PP9A 3D2MA 1Q2YA 2BUEA 2P0WA 3C26A 4UWIA 2B3VA 4R3LA 3F8KA 2CNTA 2BSWA 1XIXA 2P6FA 3P2HA 3R9EA 4XPDC 4KORA 2Z0ZA 3TO7A 2B5GA 3R95A 2JLMA 5HMNA 2B4BA 4J3GA 2J8MA 3MGDA 4YRHA 3TFYA 4KLWA 2VBQA 1J4JA 4YGOA 2G3TA 2VXKA 5F49A 4RS2A 4ZBGA 3UY5A 2Q4VA 1Q2DA 2O28A 4NXYA 3LODA 3NE7A 4MHDA 3N7ZA 1QSTA 1MJBA 2VQYA 2OU2A 1KZFA 4AVAA 1Y9KA 4H89A 5F48A 4B5PB 3GY9A 2H5MA 2PQ8A 4FD4A 3GKRA 3EXNA 4DNCA 2BEIA 2REFA 1IICA 1VKCA 3CXPA 2VZYA 5IV0A 2I79A 3VWEA 2PRBA 3TCVA 4NF1A 3FYNA 3BJ7A 1IB1E 3QAHA 3PZJA 2NMTA 4XNHB 3RYOA 4OADA 3TT2A 4QB9A 2Z11A 2GE3A 2RC4A 1QSMA 4QUSA 4GS4A 1VHSA 4L8AA 4JWPA 4KVOE 1I21A 4Y49B 4PK3A 3V8IA 2J8RA 3TTHA 4R57A 1I12A 3F0AA 4I49A 1Z9UA 1IIDA 2CNSA 2OZUA 5IX3A 1M4GA 4CRYB 3G8WA 5EBVA 1YX0A 4UA3A 1BOBA 5H84A 1RO5A 2B5GB 3ZJ0A 2DXQA 1QSNA 4KUBA 4IF5A 1MJAA 2ZXVA 1KUYA 3WR7A 3B8GA 4AVCA 2EVNA 1B6BA 5JQ4A 1MJ9A 2Q44A 1S3ZA 2OB0A 4U9YA 2C27A 3S6GA 4XPKA 4L89A 4B5OA 2VZZA 4MY3A 1YR0A 4QBJA 3OWCA 4HNXB 1IYLA 4LUAA 4XPLA 5F46A 5J8CA 2FCKA 4JXRA 1YLEA 2FSRA 4IUSA 3EFAA 4KZTA 1ON0A 2QECA 4HKFA 4UBRA 3BJ8A 1K4JA 5GCNA 4JXQA 1R57A 3S6HA 3I9SA 1S7FA 4JJXA 4II9A 4KUAA 2P6EA 1MK4A 2B4DA 4KOTA 4NSQA 1U6MA 2F5IA 2ZW7A 4CAWA 1XMTA 4R9MA 3DDDA 2Q04A 5C82A 2QIRA 2JEVA 1L0CA 4OLLA 5CNPA 4CRZB 2P6GA 1Z4RA 3BLNA 4JLYA 4U9ZA 2ZW6A 5KTAA 3P2FA 3D3SA 2PR8A 4AB7A 4BMHA 1CJWA 4NEXA 2EUIA 3TO6A 3T90A 1KUXA 2D4PA 1NMTA 4AG7A 2GANA 2PDOA 2J8NA 2ATRA 2KCWA 2FE7A 2FIAA 4YFJA 1BO4A 4QVTA 4K30A 5J8FA 4KOSA 2G0BA 4NCZA 2OZHA 3FRMA 1XF8A 1S7NA 4QC6A 1P4NA 4M85A 3W91A 4H6ZA 4E2AA 1S60A 4B5PA 3LD2A 3S6FA 5F47A 2HQYA 1M4IA 2AE6A 4H6UA 4FD7A 3TO9A 3IGRA 3EY5A 4HNWB 2FL4A 2PC1A 4E0AA 2PSWA 5KTDA 3S6KA 1FY7A 4AG9A 3I3GA 3D8PA 2A4NA 3KKWA 1Q2CA 3GYAA 5FVJA 3R9GA 4XNHC 3VWDA 1GHEA 4KVXA 4KOXA 3IWGA 1QSOA 4PV6A 4XPDB 2K5TA 4KOVA 1XE4A 1S5KA 3JVNA 5IB0A 2ZW4A 1OZPA 1XEBA 4UWJA 2CY2A 3G3SA 2WPWA 1S7LA 2PR1A 2Q4YA
chains in the Genus database with same CATH superfamily
2OZGA 5G21A 5H86A 3WC5A 1RTQA 5JM6A 2Z10A 1PUAA 2FT0A 4LQGA 3DNSA 4M6GA 4MRIA 4DYOA 3K9UA 1PU9A 2OH1A 2B4DB 3ISZA 4A38A 1TIQA 4KOYA 3D7HA 2FIWA 2PJ0A 1M1DA 1Y7RA 4JD6A 4R8FA 3W6XA 4MHZA 1CM0A 2CF4A 4OC4A 2QYVA 3GIUA 3L2NA 4NGPA 3RZAA 4UEFA 2J9AA 4B10A 4NJQA 4H2KA 1CP7A 1SQHA 3JUWA 4ORFA 1R43A 1LAPA 2CXAA 4MBUA 4OMEA 5E96A 3RO0A 3PGPA 2R7HA 2R8VA 2V8DA 3B7IA 2AFSA 2ZPAA 3D68A 2FS5A 1CX8A 5CPAA 4NGTA 1IGBA 1LRZA 2B3UA 4GM5A 3CXSA 4JZ0A 1VHEA 1UFHA 3PB6X 2GIVA 5EC4A 1BLLE 4CAVA 4CYNA 3A9LA 4FD6A 2I3CA 5KTCA 1V0CA 1I1DA 2NSMA 3DLJA 4MY0A 5ELYA 3QB8A 1ZLIA 1Z4EA 2XEIA 4OIWA 4U5YA 3V7ZA 4NGQA 4E8OA 2AFWA 2REEA 2EK8A 3D4UA 2PE3A 3FIXA 2VI7A 3JTKA 2YNDA 1YGHA 2WPXA 2XEGA 4KOWA 2Z3NA 3KQZA 4A95A 5ISVA 1Y9WA 1XRYA 3D2PA 2R98A 4Q38A 2CTCA 1Q7LA 4F6AA 3R9FA 2PVVA 3TOAA 1ZG9A 2B58A 4OC3A 4M3SA 4P4JA 3IIBA 1IYKA 3T9YA 3TE4A 1N71A 4UIAA 3V38A 4PK2A 2AFUA 5A28A 4NGNA 4OP4A 3DSBA 3WC6A 1ELMP 2F7VA 5AG5A 4AXVA 1KUVA 3H8EA 3KASA 1NSLA 1WK4A 4UEZA 3B3WA 3LACA 3H4QA 1WWZA 1YVKA 3NE8A 3RNZA 4PXCA 2CNMA 2Q0YA 2ANPA 3F5BA 2GFQA 2PJ7A 4OAEA 2ZEMA 3FX6A 1YQEA 2ZEHA 1B87A 4M6IA 1KWMA 5I0CA 4IAVA 2R1IA 4UCNA 2HV2A 2ARHA 4KSFA 4PSWA 2ZOFA 4CS0B 4MHNA 2PJ9A 3EC4A 4KVME 1XFOA 2HUZA 1M4DA 3CT9A 1IOFA 4F8ZA 3SXNA 2JDCA 4X5KA 2FXFA 2VEZA 2BCOA 3FBUA 2RFHA 4KLVA 4ONWA 4PXEA 2Q7BA 4YU9A 2G3AA 2WSAA 4EVYA 5C88A 5LYFA 5HH1A 4AVBA 1YK3A 4MFLA 2Y0MA 3VATA 5JPHA 3K9TA 3SJGA 2D4OA 1S7KA 4UCPA 3IEHA 4ZI6A 4R87A 3S9NA 3FMCA 2I00A 2ZW5A 4F0YA 5DWNA 2ZEDA 3FB3A 3H5ZA 4A30A 1YREA 4P6YA 5K8NA 5D8NA 3R1KA 2C6GA 1RXTA 1M44A 3DR8A 3WC7A 4MI4A 4C7HA 7CPAA 3SJEA 3KGQA 2AJ6A 1Z8LA 3KL9A 5HXDA 4RI1A 2GREA 5AG7A 2VL1A 2AFOA 4MJ8A 4FD5A 3E0KA 3FXTA 1VIXA 1QSRA 1VGYA 1ZG7A 3D7DA 3DR6A 3EO4A 4LX9A 4PSXA 3ZZIA 3SXOA 5LYLA 3MN8A 3SHPA 4DJLA 4R3KA 3HLPA 2BL1A 2GLJA 3KR5A 1YVOA 2QMLA 3FVLA 2YNCC 4Y49C 3W6SA 1ARMA 4UFWA 3FNCA 2PJ4A 3PFEA 4MCSA 4BD9A 2GU2A 3R96A 1NSAA 4KOUA 3CPAA 4YWYA 4R76A 5DWMA 1NE9A 2X7BA 2QVPA 1P0HA 2JDDA 1AMPA 3BHXA 3BXMA 4MFPA 4B13A 2IL4A 4DUKA 1LOKA 3CXQA 3FEDA 4HNYB 2BOAA 2Z3LA 4ONUA 2O53A 2V8HA 4Q36A 4CAXA 1PYTB 3HUVA 3S9MA 3KHXA 1XMBA 3TOBA 3PP9A 3H8FA 3D2MA 1Q2YA 2BUEA 2G9DA 2P0WA 1TXRA 3C26A 1TKHA 2Q51A 4UWIA 2B3VA 4R3LA 3F8KA 4MFQA 2CNTA 4OIDA 6CPAA 4OC5A 4A94A 1X10A 2BSWA 1XIXA 2P6FA 3P2HA 4OC2A 1IY7A 4JYWA 3KZWA 4KORA 1Y0YA 4XPDC 2Z0ZA 4MCPA 2B5GA 5D29A 3TO7A 4CGPA 3NH4A 3R95A 3RAMA 3TFYA 2JLMA 5HMNA 2B4BA 4J3GA 3TC8A 2ZENA 4IK2A 4UFXA 2J8MA 3MGDA 1F57A 3WT4A 4UCMA 4YRHA 4BBHA 3NA6A 2VBQA 1JQGA 2EBJA 1J4JA 4KLWA 2G3TA 2VXKA 4YGOA 5F49A 4ZX9A 4RS2A 4ZBGA 4PPZA 3UY5A 1TKFA 2Q4VA 4G1PA 1CBXA 4MXUA 4MFKA 1Q2DA 2ZEFA 3S9LA 1H8LA 2O28A 5LYDA 4NJRA 1FNOA 4NXYA 3PBBA 3LODA 3NE7A 4GXHA 2ZOGA 2PCUA 3IWEA 1QSTA 3N7ZA 4MHDA 4TWEA 1MJBA 3PB7X 2VQYA 1TF8A 2OU2A 4B6ZA 2XEJA 4P4EA 3R9EA 2AFXA 2Z3PA 1KZFA 2JBJA 3PBEA 3GLJA 4OKOA 5K8MA 5A27A 4AVAA 1Y9KA 2ABZA 4H89A 3CDXA 1ZLHA 5F48A 4FWUA 5THWA 4B5PB 3GY9A 2NYQA 4MHPA 3KHZA 2C6PA 2H5MA 1GYTA 2PIZA 2PQ8A 3B3CA 3LMSA 4FD4A 3GKRA 3EXNA 4DNCA 2BEIA 4A2ZA 3FH4A 1A2ZA 5AG6A 2PJCA 1CP6A 1DTDA 2REFA 1IICA 1VKCA 4EFDA 2FVGA 3CXPA 3WABA 2VZYA 4C2ZA 4CGLA 5IV0A 1CG2A 4ZY2A 2I79A 5BWAB 3VWEA 1PCAA 2PRBA 3CZXA 1XJOA 3TCVA 4NF1A 4A39A 3FYNA 4PQAA 2ZEOA 2WUUA 4CYQA 4RUHA 3BJ7A 1IB1E 3QAHA 3TX8A 3PZJA 4KSAA 3B35A 2Q43A 2AFZA 2NMTA 4XNHB 4C68A 4CYOA 3RYOA 2BO9A 4ZY1A 3SI1A 2F8HA 4OADA 2C1CA 3KI9A 4ZY0A 1AUGA 3IC1A 1LFWA 1YLOA 3IO1A 4Q7AA 4QB9A 3TT2A 4K3NA 4P44A 4KS9A 2PJ2A 2Z11A 2GE3A 4UF4A 2RC4A 1QSMA 2PJ8A 4QUSA 4GS4A 1VHSA 3FECA 1VHOA 2PJ1A 3JRUA 3K2KA 4JWPA 4KVOE 4L8AA 4NGRA 1I21A 2QJ8A 3MRUA 2PJBA 4Y49B 4PK3A 1F2PA 3V8IA 1QMUA 2J8RA 3TTHA 4R57A 4PXDA 1I12A 3F0AA 4I49A 2IMOA 1DE4C 4X3RA 2XEFA 4A33A 4P4BA 1Z9UA 1IIDA 2POKA 1TF9A 5K8PA 2CNSA 2AFMA 3SI2A 4HPSA 2OZUA 5IX3A 1M4GA 4CRYB 3ISXA 3G8WA 3FJUA 2V77A 3B3TA 1ZG8A 5EBVA 1YX0A 4UA3A 4CGNA 3B2YA 1BOBA 2HC9A 5H84A 1RO5A 2JBKA 2B5GB 1IOIA 3ZJ0A 2DXQA 1QSNA 3SI0A 4KUBA 4ZX8A 2CIJA 2YNCA 3PFOA 4IF5A 5J1QA 4UFVA 2YNEA 1MJAA 3NH8A 2ZXVA 1KUYA 8CPAA 3WR7A 3B8GA 1FT7A 4EMEA 4TNUA 4ZGYB 4AVCA 2EVNA 2PRQA 2OR4A 3PB9X 1B6BA 5JQ4A 1MJ9A 1Z2LA 1S3ZA 2Q44A 2JEWA 2V8VA 4F9UA 4FBEA 2OB0A 2ODFA 4U9YA 4A32A 2C27A 3S6GA 1IU8A 1Z8XA 3N5FA 4XPKA 1YMEA 4L89A 4MHYA 4B5OA 2VZZA 4MY3A 1YR0A 4QBJA 3OWCA 4HNXB 3GUXA 1IYLA 4LUAA 4XPLA 5F46A 2DPTA 5J8CA 4KSIA 2FCKA 4JXRA 1BPNA 2IJZA 1YLEA 2FSRA 4IUSA 3EFAA 3FEEA 4KZTA 4B14A 4FAIA 3DGVA 1Z8TA 1ON0A 2QECA 4HKFA 4MFJA 4MMOA 2HB6A 4NGSA 4W9YA 2O4HA 4R7MA 3IJ3A 2ZELA 4UBRA 4MCRA 1AYEA 3BJ8A 4FUUA 1HEEA 1K4JA 3D7GA 5GCNA 5K8OA 4JXQA 1ARLA 1BAVA 1R57A 3S6HA 3I9SA 1S7FA 4JJXA 3IU2A 3LWUA 4II9A 4KUAA 4P45A 1OBRA 2P6EA 2Z3OA 1YW4A 3B3SA 5I4MA 4EWTA 1MK4A 1HDUA 3VARA 2B4DA 2ZEEA 3CPXA 4A37A 3PB4X 1F2OA 4KOTA 1M4LA 4NSQA 2Z3MA 2PJ6A 1JWQA 2DF5A 4F9VA 3SJFA 4P4FA 1U6MA 2F5IA 4R6TA 4BINA 2ZW7A 4CAWA 1XMTA 4R9MA 3DDDA 1R3NA 4B11A 4CGOA 2Q04A 5C82A 2QIRA 2JEVA 1L0CA 2DEAA 4OLLA 2C6CA 5CNPA 2Q7SA 4CRZB 4ZYQA 2P6GA 1Z4RA 2EK9A 2PJ5A 1LANA 3BLNA 4JLYA 4U9ZA 2ZW6A 4O23A 5KTAA 3IWWA 3D67A 4CPAA 3P2FA 3D3SA 5G20A 3PB8X 4MFZA 2PR8A 4AB7A 4BMHA 4P4DA 1CJWA 3QNVA 4NEXA 2Q4ZA 3RBUA 2EUIA 4WWVA 4C2YA 3TO6A 1XOVA 1YSJA 3D66A 3GB0A 2PVWA 3NFZA 3T90A 5AG4A 4CGMA 5F09A 5LRKA 1KUXA 4LQ6A 2D4PA 4A31A 4OC1A 1NMTA 2V8GA 4AG7A 2PJAA 3T8WA 2GANA 4UIBA 2PDOA 3IFEA 5G22A 2J8NA 2WZNA 3VH9A 3I1UA 2ATRA 1Z8WA 2KCWA 3KR4A 5HVFA 2FE7A 2FIAA 4YFJA 1BO4A 1CPSA 4K30A 4QVTA 3FF3A 2ZEPA 4KOSA 5HVGA 5J8FA 2G0BA 4NCZA 2EWBA 2OZHA 3FRMA 4X8IA 4CAEA 1CPXA 1XF8A 1S7NA 4QC6A 1P4NA 4M85A 3W91A 4H6ZA 2OOTA 5EMIA 4E2AA 4PXBA 4UEEA 1S60A 2CTBA 1HDQA 4B5PA 1Z5RA 4CAFA 3LD2A 3NH5A 5IB9A 1UWYA 1EE3P 5LRJA 5LRGA 2ZEGA 1LCPA 1BPMA 5DS0A 5F47A 3S6FA 2HQYA 3PRTA 1M4IA 2AE6A 2YGWA 4H6UA 4F0XA 1Y0RA 4FD7A 3TO9A 4RN7A 3IGRA 3KQXA 4C2XA 3IU1A 4WJBA 3EY5A 4HNWB 2FL4A 2PC1A 3PEIA 4IHMA 4E0AA 1YW6A 2PSWA 3BI0A 3D7FA 4NGMA 4P4IA 1LAMA 3S6KA 5KTDA 1FY7A 2GLFA 2PJ3A 1Y7EA 5JGFA 1ELLP 4AG9A 1QQ9A 2WYRA 3I3GA 5LYIA 3D8PA 4MCQA 2A4NA 3B3VA 3BI1A 3KKWA 1TKJA 3SJXA 1Q2CA 3GYAA 5FVJA 3R9GA 4Z65A 3H8GA 2RB7A 2DPSA 3QAYA 4NFRA 2PIYA 4XNHC 3VWDA 2EO8A 1GHEA 1XBUA 2IQ6A 4KOXA 3IWGA 1QSOA 4KVXA 4PV6A 4C7IA 4XPDB 4OC0A 2K5TA 4M6HA 4KOVA 1XE4A 1S5KA 3JVNA 5IB0A 2ZW4A 1ZO0A 1OZPA 2Z3KA 4P10A 1XEBA 4UWJA 5HVHA 5JH9A 4B12A 2CY2A 5G1ZA 3G3SA 2WPWA 5AGEA 1S7LA 2PR1A 2Q4YA 5CBMA 4X2TA 4CYPA 1X12A
chains in the Genus database with same CATH topology
2OZGA 5G21A 5H86A 2Z10A 1PUAA 2FT0A 3DNSA 3K9UA 1PU9A 2OH1A 2B4DB 1TIQA 4KOYA 2FIWA 1M1DA 1Y7RA 4JD6A 3W6XA 1CM0A 4B10A 1SQHA 3JUWA 4ORFA 4MBUA 2CXAA 5E96A 3PGPA 2R7HA 2R8VA 2ZPAA 2FS5A 1LRZA 2B3UA 3CXSA 1UFHA 5EC4A 2GIVA 4CAVA 4CYNA 3A9LA 4FD6A 5KTCA 1V0CA 1I1DA 4MY0A 3QB8A 1Z4EA 4U5YA 4E8OA 2REEA 3FIXA 2VI7A 3JTKA 2YNDA 1YGHA 2WPXA 4KOWA 2Z3NA 4A95A 5ISVA 1Y9WA 3D2PA 4Q38A 2R98A 4F6AA 3R9FA 3TOAA 2B58A 4M3SA 1IYKA 3T9YA 3TE4A 1N71A 4PK2A 5A28A 3DSBA 5AG5A 1KUVA 1NSLA 1WK4A 3H4QA 1WWZA 1YVKA 2CNMA 2Q0YA 3F5BA 4OAEA 5I0CA 1B87A 2R1IA 4UCNA 2HV2A 2ARHA 4KSFA 4PSWA 4CS0B 4KVME 3EC4A 2HUZA 1M4DA 3SXNA 2JDCA 4X5KA 2FXFA 2VEZA 4KLVA 3FBUA 2Q7BA 2G3AA 2WSAA 4EVYA 5C88A 5HH1A 4AVBA 1YK3A 4MFLA 2Y0MA 5JPHA 2D4OA 1S7KA 4UCPA 4R87A 2I00A 2ZW5A 4F0YA 5DWNA 4A30A 3FB3A 3H5ZA 1YREA 3R1KA 1RXTA 1M44A 3DR8A 4MI4A 4C7HA 2AJ6A 4RI1A 5AG7A 4MJ8A 4FD5A 3E0KA 3FXTA 4PSXA 1QSRA 3ZZIA 4LX9A 3DR6A 3EO4A 3SXOA 3SHPA 4R3KA 2BL1A 1YVOA 2QMLA 2YNCC 4Y49C 3W6SA 4UFWA 3FNCA 3R96A 4KOUA 5DWMA 1NE9A 2X7BA 1P0HA 2JDDA 4MFPA 4B13A 2IL4A 3CXQA 4HNYB 2Z3LA 4Q36A 4ONUA 4CAXA 3TOBA 3PP9A 3D2MA 1Q2YA 2BUEA 2P0WA 3C26A 4UWIA 2B3VA 4R3LA 3F8KA 4MFQA 2CNTA 2BSWA 1XIXA 2P6FA 3P2HA 3R9EA 4XPDC 4KORA 4CYQA 4CGPA 2Z0ZA 3TO7A 2B5GA 3R95A 2JLMA 5HMNA 2B4BA 4J3GA 4UFXA 2J8MA 3MGDA 4UCMA 4YRHA 4BBHA 3TFYA 2VBQA 4KLWA 1J4JA 4YGOA 2G3TA 2VXKA 5F49A 4RS2A 4ZBGA 3UY5A 2Q4VA 4MFKA 1Q2DA 2O28A 4NXYA 3LODA 3NE7A 3IWEA 3N7ZA 1QSTA 4MHDA 1MJBA 2VQYA 2OU2A 2Z3PA 1KZFA 5A27A 4AVAA 1Y9KA 4H89A 5F48A 4B5PB 3GY9A 2H5MA 2PQ8A 4FD4A 3GKRA 3EXNA 4DNCA 2BEIA 4A2ZA 5AG6A 2REFA 1IICA 1VKCA 3CXPA 4C2ZA 2VZYA 4CGLA 5IV0A 2I79A 5BWAB 3VWEA 2PRBA 3TCVA 4NF1A 3FYNA 2WUUA 3BJ7A 1IB1E 3QAHA 3PZJA 4KSAA 2NMTA 4XNHB 4C68A 4CYOA 3RYOA 4OADA 3TT2A 4QB9A 4KS9A 2Z11A 2GE3A 2RC4A 1QSMA 4QUSA 4GS4A 1VHSA 4L8AA 4JWPA 4KVOE 1I21A 4Y49B 4PK3A 3V8IA 2J8RA 3TTHA 4R57A 1I12A 3F0AA 4I49A 4A33A 1Z9UA 1IIDA 2CNSA 2OZUA 5IX3A 1M4GA 4CRYB 3G8WA 5EBVA 1YX0A 4UA3A 4CGNA 1BOBA 5H84A 1RO5A 2B5GB 3ZJ0A 2DXQA 1QSNA 4KUBA 2YNCA 4IF5A 4UFVA 2YNEA 1MJAA 2ZXVA 1KUYA 3WR7A 3B8GA 4ZGYB 4AVCA 2EVNA 1B6BA 5JQ4A 1MJ9A 2Q44A 1S3ZA 2OB0A 4A32A 4U9YA 2C27A 3S6GA 4XPKA 4L89A 4B5OA 2VZZA 4MY3A 1YR0A 4QBJA 3OWCA 4HNXB 1IYLA 4LUAA 4XPLA 5F46A 2DPTA 5J8CA 2FCKA 4JXRA 1YLEA 2FSRA 4IUSA 3EFAA 4KZTA 4B14A 1ON0A 2QECA 4HKFA 4MFJA 4UBRA 3BJ8A 1K4JA 5GCNA 4JXQA 1R57A 3S6HA 3I9SA 1S7FA 4JJXA 3IU2A 4II9A 4KUAA 2P6EA 2Z3OA 1MK4A 2B4DA 4KOTA 4NSQA 2Z3MA 1U6MA 2F5IA 2ZW7A 4CAWA 1XMTA 4R9MA 3DDDA 4B11A 4CGOA 2Q04A 5C82A 2QIRA 2JEVA 1L0CA 4OLLA 5CNPA 4CRZB 2P6GA 1Z4RA 3BLNA 4JLYA 4U9ZA 2ZW6A 5KTAA 3P2FA 3D3SA 5G20A 4MFZA 2PR8A 4AB7A 4BMHA 1CJWA 4NEXA 2EUIA 4C2YA 3TO6A 3T90A 5AG4A 4CGMA 1KUXA 2D4PA 4A31A 1NMTA 4AG7A 2GANA 2PDOA 5G22A 2J8NA 2ATRA 2KCWA 2FE7A 2FIAA 4YFJA 1BO4A 4QVTA 4K30A 5J8FA 4KOSA 2G0BA 4NCZA 2OZHA 3FRMA 4CAEA 1XF8A 1S7NA 4QC6A 1P4NA 4M85A 3W91A 4H6ZA 4E2AA 1S60A 4CAFA 4B5PA 3LD2A 3S6FA 5F47A 2HQYA 1M4IA 2AE6A 2YGWA 4H6UA 4F0XA 4FD7A 3TO9A 3IGRA 4C2XA 3IU1A 3EY5A 4HNWB 2FL4A 2PC1A 4E0AA 2PSWA 5KTDA 3S6KA 1FY7A 4AG9A 3I3GA 3D8PA 2A4NA 3KKWA 1Q2CA 3GYAA 5FVJA 3R9GA 2DPSA 4XNHC 3VWDA 1GHEA 4KVXA 4KOXA 3IWGA 1QSOA 4PV6A 4C7IA 4XPDB 2K5TA 4KOVA 1XE4A 1S5KA 3JVNA 5IB0A 2ZW4A 1ZO0A 1OZPA 2Z3KA 1XEBA 4UWJA 4B12A 2CY2A 5G1ZA 3G3SA 2WPWA 5AGEA 1S7LA 2PR1A 2Q4YA 4CYPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OZG A;  5H86 A;  2Z10 A;  1PUA A;  2FT0 A;  3DNS A;  3K9U A;  1PU9 A;  2OH1 A;  2B4D B;  1TIQ A;  4KOY A;  2FIW A;  1M1D A;  1Y7R A;  4JD6 A;  3W6X A;  1CM0 A;  1SQH A;  3JUW A;  4ORF A;  4MBU A;  5E96 A;  3PGP A;  2R7H A;  2R8V A;  2ZPA A;  2FS5 A;  1LRZ A;  2B3U A;  3CXS A;  1UFH A;  5EC4 A;  2GIV A;  4CAV A;  4FD6 A;  5KTC A;  1V0C A;  1I1D A;  4MY0 A;  3QB8 A;  1Z4E A;  4U5Y A;  4E8O A;  2REE A;  3FIX A;  2VI7 A;  1YGH A;  2WPX A;  4KOW A;  5ISV A;  1Y9W A;  3D2P A;  2R98 A;  4F6A A;  3R9F A;  3TOA A;  2B58 A;  4M3S A;  1IYK A;  3T9Y A;  3TE4 A;  1N71 A;  4PK2 A;  3DSB A;  1KUV A;  1NSL A;  1WK4 A;  3H4Q A;  1WWZ A;  1YVK A;  2CNM A;  2Q0Y A;  3F5B A;  4OAE A;  5I0C A;  1B87 A;  2R1I A;  2HV2 A;  2ARH A;  4PSW A;  4CS0 B;  4KVM E;  3EC4 A;  2HUZ A;  1M4D A;  3SXN A;  2JDC A;  4X5K A;  2FXF A;  2VEZ A;  4KLV A;  3FBU A;  2Q7B A;  2G3A A;  4EVY A;  5C88 A;  5HH1 A;  4AVB A;  1YK3 A;  2Y0M A;  5JPH A;  2D4O A;  1S7K A;  4R87 A;  2I00 A;  2ZW5 A;  4F0Y A;  5DWN A;  3FB3 A;  1YRE A;  3R1K A;  1RXT A;  1M44 A;  3DR8 A;  4MI4 A;  2AJ6 A;  4RI1 A;  4MJ8 A;  4FD5 A;  3E0K A;  3FXT A;  4PSX A;  1QSR A;  3ZZI A;  4LX9 A;  3DR6 A;  3EO4 A;  3SXO A;  3SHP A;  4R3K A;  2BL1 A;  1YVO A;  2QML A;  4Y49 C;  3W6S A;  3FNC A;  3R96 A;  4KOU A;  5DWM A;  1NE9 A;  2X7B A;  1P0H A;  2JDD A;  2IL4 A;  3CXQ A;  4HNY B;  4ONU A;  4CAX A;  3TOB A;  3PP9 A;  3D2M A;  1Q2Y A;  2BUE A;  2P0W A;  3C26 A;  4UWI A;  2B3V A;  4R3L A;  3F8K A;  2CNT A;  2BSW A;  1XIX A;  2P6F A;  3P2H A;  3R9E A;  4XPD C;  4KOR A;  2Z0Z A;  3TO7 A;  2B5G A;  3R95 A;  2JLM A;  5HMN A;  2B4B A;  4J3G A;  2J8M A;  3MGD A;  4YRH A;  3TFY A;  4KLW A;  2VBQ A;  1J4J A;  4YGO A;  2G3T A;  2VXK A;  5F49 A;  4RS2 A;  4ZBG A;  3UY5 A;  2Q4V A;  1Q2D A;  2O28 A;  4NXY A;  3LOD A;  3NE7 A;  4MHD A;  3N7Z A;  1QST A;  1MJB A;  2VQY A;  2OU2 A;  1KZF A;  4AVA A;  1Y9K A;  4H89 A;  5F48 A;  4B5P B;  3GY9 A;  2H5M A;  2PQ8 A;  4FD4 A;  3GKR A;  3EXN A;  4DNC A;  2BEI A;  2REF A;  1IIC A;  1VKC A;  3CXP A;  2VZY A;  5IV0 A;  2I79 A;  3VWE A;  2PRB A;  3TCV A;  4NF1 A;  3FYN A;  3BJ7 A;  1IB1 E;  3QAH A;  3PZJ A;  2NMT A;  4XNH B;  3RYO A;  4OAD A;  3TT2 A;  4QB9 A;  2Z11 A;  2GE3 A;  2RC4 A;  1QSM A;  4QUS A;  4GS4 A;  1VHS A;  4L8A A;  4JWP A;  4KVO E;  1I21 A;  4Y49 B;  4PK3 A;  3V8I A;  2J8R A;  3TTH A;  4R57 A;  1I12 A;  3F0A A;  4I49 A;  1Z9U A;  1IID A;  2CNS A;  2OZU A;  5IX3 A;  1M4G A;  4CRY B;  3G8W A;  5EBV A;  1YX0 A;  4UA3 A;  1BOB A;  5H84 A;  1RO5 A;  2B5G B;  3ZJ0 A;  2DXQ A;  1QSN A;  4KUB A;  4IF5 A;  1MJA A;  2ZXV A;  1KUY A;  3WR7 A;  3B8G A;  4AVC A;  2EVN A;  1B6B A;  5JQ4 A;  1MJ9 A;  2Q44 A;  1S3Z A;  2OB0 A;  4U9Y A;  2C27 A;  3S6G A;  4XPK A;  4L89 A;  4B5O A;  2VZZ A;  4MY3 A;  1YR0 A;  4QBJ A;  3OWC A;  4HNX B;  1IYL A;  4LUA A;  4XPL A;  5F46 A;  5J8C A;  2FCK A;  4JXR A;  1YLE A;  2FSR A;  4IUS A;  3EFA A;  4KZT A;  1ON0 A;  2QEC A;  4HKF A;  4UBR A;  3BJ8 A;  1K4J A;  5GCN A;  4JXQ A;  1R57 A;  3S6H A;  3I9S A;  1S7F A;  4JJX A;  4II9 A;  4KUA A;  2P6E A;  1MK4 A;  2B4D A;  4KOT A;  4NSQ A;  1U6M A;  2F5I A;  2ZW7 A;  4CAW A;  1XMT A;  4R9M A;  3DDD A;  2Q04 A;  5C82 A;  2QIR A;  2JEV A;  1L0C A;  4OLL A;  5CNP A;  4CRZ B;  2P6G A;  1Z4R A;  3BLN A;  4JLY A;  4U9Z A;  2ZW6 A;  5KTA A;  3P2F A;  3D3S A;  2PR8 A;  4AB7 A;  4BMH A;  1CJW A;  4NEX A;  2EUI A;  3TO6 A;  3T90 A;  1KUX A;  2D4P A;  1NMT A;  4AG7 A;  2GAN A;  2PDO A;  2J8N A;  2ATR A;  2KCW A;  2FE7 A;  2FIA A;  4YFJ A;  1BO4 A;  4QVT A;  4K30 A;  5J8F A;  4KOS A;  2G0B A;  4NCZ A;  2OZH A;  3FRM A;  1XF8 A;  1S7N A;  4QC6 A;  1P4N A;  4M85 A;  3W91 A;  4H6Z A;  4E2A A;  1S60 A;  4B5P A;  3LD2 A;  3S6F A;  5F47 A;  2HQY A;  1M4I A;  2AE6 A;  4H6U A;  4FD7 A;  3TO9 A;  3IGR A;  3EY5 A;  4HNW B;  2FL4 A;  2PC1 A;  4E0A A;  2PSW A;  5KTD A;  3S6K A;  1FY7 A;  4AG9 A;  3I3G A;  3D8P A;  2A4N A;  3KKW A;  1Q2C A;  3GYA A;  5FVJ A;  3R9G A;  4XNH C;  3VWD A;  1GHE A;  4KVX A;  4KOX A;  3IWG A;  1QSO A;  4PV6 A;  4XPD B;  2K5T A;  4KOV A;  1XE4 A;  1S5K A;  3JVN A;  5IB0 A;  2ZW4 A;  1OZP A;  1XEB A;  4UWJ A;  2CY2 A;  3G3S A;  2WPW A;  1S7L A;  2PR1 A;  2Q4Y A; 
#chains in the Genus database with same CATH topology
 2OZG A;  5G21 A;  5H86 A;  3WC5 A;  1RTQ A;  5JM6 A;  2Z10 A;  1PUA A;  2FT0 A;  4LQG A;  3DNS A;  4M6G A;  4MRI A;  4DYO A;  3K9U A;  1PU9 A;  2OH1 A;  2B4D B;  3ISZ A;  4A38 A;  1TIQ A;  4KOY A;  3D7H A;  2FIW A;  2PJ0 A;  1M1D A;  1Y7R A;  4JD6 A;  4R8F A;  3W6X A;  4MHZ A;  1CM0 A;  2CF4 A;  4OC4 A;  2QYV A;  3GIU A;  3L2N A;  4NGP A;  3RZA A;  4UEF A;  2J9A A;  4B10 A;  4NJQ A;  4H2K A;  1CP7 A;  1SQH A;  3JUW A;  4ORF A;  1R43 A;  1LAP A;  2CXA A;  4MBU A;  4OME A;  5E96 A;  3RO0 A;  3PGP A;  2R7H A;  2R8V A;  2V8D A;  3B7I A;  2AFS A;  2ZPA A;  3D68 A;  2FS5 A;  1CX8 A;  5CPA A;  4NGT A;  1IGB A;  1LRZ A;  2B3U A;  4GM5 A;  3CXS A;  4JZ0 A;  1VHE A;  1UFH A;  3PB6 X;  2GIV A;  5EC4 A;  1BLL E;  4CAV A;  4CYN A;  3A9L A;  4FD6 A;  2I3C A;  5KTC A;  1V0C A;  1I1D A;  2NSM A;  3DLJ A;  4MY0 A;  5ELY A;  3QB8 A;  1ZLI A;  1Z4E A;  2XEI A;  4OIW A;  4U5Y A;  3V7Z A;  4NGQ A;  4E8O A;  2AFW A;  2REE A;  2EK8 A;  3D4U A;  2PE3 A;  3FIX A;  2VI7 A;  3JTK A;  2YND A;  1YGH A;  2WPX A;  2XEG A;  4KOW A;  2Z3N A;  3KQZ A;  4A95 A;  5ISV A;  1Y9W A;  1XRY A;  3D2P A;  2R98 A;  4Q38 A;  2CTC A;  1Q7L A;  4F6A A;  3R9F A;  2PVV A;  3TOA A;  1ZG9 A;  2B58 A;  4OC3 A;  4M3S A;  4P4J A;  3IIB A;  1IYK A;  3T9Y A;  3TE4 A;  1N71 A;  4UIA A;  3V38 A;  4PK2 A;  2AFU A;  5A28 A;  4NGN A;  4OP4 A;  3DSB A;  3WC6 A;  1ELM P;  2F7V A;  5AG5 A;  4AXV A;  1KUV A;  3H8E A;  3KAS A;  1NSL A;  1WK4 A;  4UEZ A;  3B3W A;  3LAC A;  3H4Q A;  1WWZ A;  1YVK A;  3NE8 A;  3RNZ A;  4PXC A;  2CNM A;  2Q0Y A;  2ANP A;  3F5B A;  2GFQ A;  2PJ7 A;  4OAE A;  2ZEM A;  3FX6 A;  1YQE A;  2ZEH A;  1B87 A;  4M6I A;  1KWM A;  5I0C A;  4IAV A;  2R1I A;  4UCN A;  2HV2 A;  2ARH A;  4KSF A;  4PSW A;  2ZOF A;  4CS0 B;  4MHN A;  2PJ9 A;  3EC4 A;  4KVM E;  1XFO A;  2HUZ A;  1M4D A;  3CT9 A;  1IOF A;  4F8Z A;  3SXN A;  2JDC A;  4X5K A;  2FXF A;  2VEZ A;  2BCO A;  3FBU A;  2RFH A;  4KLV A;  4ONW A;  4PXE A;  2Q7B A;  4YU9 A;  2G3A A;  2WSA A;  4EVY A;  5C88 A;  5LYF A;  5HH1 A;  4AVB A;  1YK3 A;  4MFL A;  2Y0M A;  3VAT A;  5JPH A;  3K9T A;  3SJG A;  2D4O A;  1S7K A;  4UCP A;  3IEH A;  4ZI6 A;  4R87 A;  3S9N A;  3FMC A;  2I00 A;  2ZW5 A;  4F0Y A;  5DWN A;  2ZED A;  3FB3 A;  3H5Z A;  4A30 A;  1YRE A;  4P6Y A;  5K8N A;  5D8N A;  3R1K A;  2C6G A;  1RXT A;  1M44 A;  3DR8 A;  3WC7 A;  4MI4 A;  4C7H A;  7CPA A;  3SJE A;  3KGQ A;  2AJ6 A;  1Z8L A;  3KL9 A;  5HXD A;  4RI1 A;  2GRE A;  5AG7 A;  2VL1 A;  2AFO A;  4MJ8 A;  4FD5 A;  3E0K A;  3FXT A;  1VIX A;  1QSR A;  1VGY A;  1ZG7 A;  3D7D A;  3DR6 A;  3EO4 A;  4LX9 A;  4PSX A;  3ZZI A;  3SXO A;  5LYL A;  3MN8 A;  3SHP A;  4DJL A;  4R3K A;  3HLP A;  2BL1 A;  2GLJ A;  3KR5 A;  1YVO A;  2QML A;  3FVL A;  2YNC C;  4Y49 C;  3W6S A;  1ARM A;  4UFW A;  3FNC A;  2PJ4 A;  3PFE A;  4MCS A;  4BD9 A;  2GU2 A;  3R96 A;  1NSA A;  4KOU A;  3CPA A;  4YWY A;  4R76 A;  5DWM A;  1NE9 A;  2X7B A;  2QVP A;  1P0H A;  2JDD A;  1AMP A;  3BHX A;  3BXM A;  4MFP A;  4B13 A;  2IL4 A;  4DUK A;  1LOK A;  3CXQ A;  3FED A;  4HNY B;  2BOA A;  2Z3L A;  4ONU A;  2O53 A;  2V8H A;  4Q36 A;  4CAX A;  1PYT B;  3HUV A;  3S9M A;  3KHX A;  1XMB A;  3TOB A;  3PP9 A;  3H8F A;  3D2M A;  1Q2Y A;  2BUE A;  2G9D A;  2P0W A;  1TXR A;  3C26 A;  1TKH A;  2Q51 A;  4UWI A;  2B3V A;  4R3L A;  3F8K A;  4MFQ A;  2CNT A;  4OID A;  6CPA A;  4OC5 A;  4A94 A;  1X10 A;  2BSW A;  1XIX A;  2P6F A;  3P2H A;  4OC2 A;  1IY7 A;  4JYW A;  3KZW A;  4KOR A;  1Y0Y A;  4XPD C;  2Z0Z A;  4MCP A;  2B5G A;  5D29 A;  3TO7 A;  4CGP A;  3NH4 A;  3R95 A;  3RAM A;  3TFY A;  2JLM A;  5HMN A;  2B4B A;  4J3G A;  3TC8 A;  2ZEN A;  4IK2 A;  4UFX A;  2J8M A;  3MGD A;  1F57 A;  3WT4 A;  4UCM A;  4YRH A;  4BBH A;  3NA6 A;  2VBQ A;  1JQG A;  2EBJ A;  1J4J A;  4KLW A;  2G3T A;  2VXK A;  4YGO A;  5F49 A;  4ZX9 A;  4RS2 A;  4ZBG A;  4PPZ A;  3UY5 A;  1TKF A;  2Q4V A;  4G1P A;  1CBX A;  4MXU A;  4MFK A;  1Q2D A;  2ZEF A;  3S9L A;  1H8L A;  2O28 A;  5LYD A;  4NJR A;  1FNO A;  4NXY A;  3PBB A;  3LOD A;  3NE7 A;  4GXH A;  2ZOG A;  2PCU A;  3IWE A;  1QST A;  3N7Z A;  4MHD A;  4TWE A;  1MJB A;  3PB7 X;  2VQY A;  1TF8 A;  2OU2 A;  4B6Z A;  2XEJ A;  4P4E A;  3R9E A;  2AFX A;  2Z3P A;  1KZF A;  2JBJ A;  3PBE A;  3GLJ A;  4OKO A;  5K8M A;  5A27 A;  4AVA A;  1Y9K A;  2ABZ A;  4H89 A;  3CDX A;  1ZLH A;  5F48 A;  4FWU A;  5THW A;  4B5P B;  3GY9 A;  2NYQ A;  4MHP A;  3KHZ A;  2C6P A;  2H5M A;  1GYT A;  2PIZ A;  2PQ8 A;  3B3C A;  3LMS A;  4FD4 A;  3GKR A;  3EXN A;  4DNC A;  2BEI A;  4A2Z A;  3FH4 A;  1A2Z A;  5AG6 A;  2PJC A;  1CP6 A;  1DTD A;  2REF A;  1IIC A;  1VKC A;  4EFD A;  2FVG A;  3CXP A;  3WAB A;  2VZY A;  4C2Z A;  4CGL A;  5IV0 A;  1CG2 A;  4ZY2 A;  2I79 A;  5BWA B;  3VWE A;  1PCA A;  2PRB A;  3CZX A;  1XJO A;  3TCV A;  4NF1 A;  4A39 A;  3FYN A;  4PQA A;  2ZEO A;  2WUU A;  4CYQ A;  4RUH A;  3BJ7 A;  1IB1 E;  3QAH A;  3TX8 A;  3PZJ A;  4KSA A;  3B35 A;  2Q43 A;  2AFZ A;  2NMT A;  4XNH B;  4C68 A;  4CYO A;  3RYO A;  2BO9 A;  4ZY1 A;  3SI1 A;  2F8H A;  4OAD A;  2C1C A;  3KI9 A;  4ZY0 A;  1AUG A;  3IC1 A;  1LFW A;  1YLO A;  3IO1 A;  4Q7A A;  4QB9 A;  3TT2 A;  4K3N A;  4P44 A;  4KS9 A;  2PJ2 A;  2Z11 A;  2GE3 A;  4UF4 A;  2RC4 A;  1QSM A;  2PJ8 A;  4QUS A;  4GS4 A;  1VHS A;  3FEC A;  1VHO A;  2PJ1 A;  3JRU A;  3K2K A;  4JWP A;  4KVO E;  4L8A A;  4NGR A;  1I21 A;  2QJ8 A;  3MRU A;  2PJB A;  4Y49 B;  4PK3 A;  1F2P A;  3V8I A;  1QMU A;  2J8R A;  3TTH A;  4R57 A;  4PXD A;  1I12 A;  3F0A A;  4I49 A;  2IMO A;  1DE4 C;  4X3R A;  2XEF A;  4A33 A;  4P4B A;  1Z9U A;  1IID A;  2POK A;  1TF9 A;  5K8P A;  2CNS A;  2AFM A;  3SI2 A;  4HPS A;  2OZU A;  5IX3 A;  1M4G A;  4CRY B;  3ISX A;  3G8W A;  3FJU A;  2V77 A;  3B3T A;  1ZG8 A;  5EBV A;  1YX0 A;  4UA3 A;  4CGN A;  3B2Y A;  1BOB A;  2HC9 A;  5H84 A;  1RO5 A;  2JBK A;  2B5G B;  1IOI A;  3ZJ0 A;  2DXQ A;  1QSN A;  3SI0 A;  4KUB A;  4ZX8 A;  2CIJ A;  2YNC A;  3PFO A;  4IF5 A;  5J1Q A;  4UFV A;  2YNE A;  1MJA A;  3NH8 A;  2ZXV A;  1KUY A;  8CPA A;  3WR7 A;  3B8G A;  1FT7 A;  4EME A;  4TNU A;  4ZGY B;  4AVC A;  2EVN A;  2PRQ A;  2OR4 A;  3PB9 X;  1B6B A;  5JQ4 A;  1MJ9 A;  1Z2L A;  1S3Z A;  2Q44 A;  2JEW A;  2V8V A;  4F9U A;  4FBE A;  2OB0 A;  2ODF A;  4U9Y A;  4A32 A;  2C27 A;  3S6G A;  1IU8 A;  1Z8X A;  3N5F A;  4XPK A;  1YME A;  4L89 A;  4MHY A;  4B5O A;  2VZZ A;  4MY3 A;  1YR0 A;  4QBJ A;  3OWC A;  4HNX B;  3GUX A;  1IYL A;  4LUA A;  4XPL A;  5F46 A;  2DPT A;  5J8C A;  4KSI A;  2FCK A;  4JXR A;  1BPN A;  2IJZ A;  1YLE A;  2FSR A;  4IUS A;  3EFA A;  3FEE A;  4KZT A;  4B14 A;  4FAI A;  3DGV A;  1Z8T A;  1ON0 A;  2QEC A;  4HKF A;  4MFJ A;  4MMO A;  2HB6 A;  4NGS A;  4W9Y A;  2O4H A;  4R7M A;  3IJ3 A;  2ZEL A;  4UBR A;  4MCR A;  1AYE A;  3BJ8 A;  4FUU A;  1HEE A;  1K4J A;  3D7G A;  5GCN A;  5K8O A;  4JXQ A;  1ARL A;  1BAV A;  1R57 A;  3S6H A;  3I9S A;  1S7F A;  4JJX A;  3IU2 A;  3LWU A;  4II9 A;  4KUA A;  4P45 A;  1OBR A;  2P6E A;  2Z3O A;  1YW4 A;  3B3S A;  5I4M A;  4EWT A;  1MK4 A;  1HDU A;  3VAR A;  2B4D A;  2ZEE A;  3CPX A;  4A37 A;  3PB4 X;  1F2O A;  4KOT A;  1M4L A;  4NSQ A;  2Z3M A;  2PJ6 A;  1JWQ A;  2DF5 A;  4F9V A;  3SJF A;  4P4F A;  1U6M A;  2F5I A;  4R6T A;  4BIN A;  2ZW7 A;  4CAW A;  1XMT A;  4R9M A;  3DDD A;  1R3N A;  4B11 A;  4CGO A;  2Q04 A;  5C82 A;  2QIR A;  2JEV A;  1L0C A;  2DEA A;  4OLL A;  2C6C A;  5CNP A;  2Q7S A;  4CRZ B;  4ZYQ A;  2P6G A;  1Z4R A;  2EK9 A;  2PJ5 A;  1LAN A;  3BLN A;  4JLY A;  4U9Z A;  2ZW6 A;  4O23 A;  5KTA A;  3IWW A;  3D67 A;  4CPA A;  3P2F A;  3D3S A;  5G20 A;  3PB8 X;  4MFZ A;  2PR8 A;  4AB7 A;  4BMH A;  4P4D A;  1CJW A;  3QNV A;  4NEX A;  2Q4Z A;  3RBU A;  2EUI A;  4WWV A;  4C2Y A;  3TO6 A;  1XOV A;  1YSJ A;  3D66 A;  3GB0 A;  2PVW A;  3NFZ A;  3T90 A;  5AG4 A;  4CGM A;  5F09 A;  5LRK A;  1KUX A;  4LQ6 A;  2D4P A;  4A31 A;  4OC1 A;  1NMT A;  2V8G A;  4AG7 A;  2PJA A;  3T8W A;  2GAN A;  4UIB A;  2PDO A;  3IFE A;  5G22 A;  2J8N A;  2WZN A;  3VH9 A;  3I1U A;  2ATR A;  1Z8W A;  2KCW A;  3KR4 A;  5HVF A;  2FE7 A;  2FIA A;  4YFJ A;  1BO4 A;  1CPS A;  4K30 A;  4QVT A;  3FF3 A;  2ZEP A;  4KOS A;  5HVG A;  5J8F A;  2G0B A;  4NCZ A;  2EWB A;  2OZH A;  3FRM A;  4X8I A;  4CAE A;  1CPX A;  1XF8 A;  1S7N A;  4QC6 A;  1P4N A;  4M85 A;  3W91 A;  4H6Z A;  2OOT A;  5EMI A;  4E2A A;  4PXB A;  4UEE A;  1S60 A;  2CTB A;  1HDQ A;  4B5P A;  1Z5R A;  4CAF A;  3LD2 A;  3NH5 A;  5IB9 A;  1UWY A;  1EE3 P;  5LRJ A;  5LRG A;  2ZEG A;  1LCP A;  1BPM A;  5DS0 A;  5F47 A;  3S6F A;  2HQY A;  3PRT A;  1M4I A;  2AE6 A;  2YGW A;  4H6U A;  4F0X A;  1Y0R A;  4FD7 A;  3TO9 A;  4RN7 A;  3IGR A;  3KQX A;  4C2X A;  3IU1 A;  4WJB A;  3EY5 A;  4HNW B;  2FL4 A;  2PC1 A;  3PEI A;  4IHM A;  4E0A A;  1YW6 A;  2PSW A;  3BI0 A;  3D7F A;  4NGM A;  4P4I A;  1LAM A;  3S6K A;  5KTD A;  1FY7 A;  2GLF A;  2PJ3 A;  1Y7E A;  5JGF A;  1ELL P;  4AG9 A;  1QQ9 A;  2WYR A;  3I3G A;  5LYI A;  3D8P A;  4MCQ A;  2A4N A;  3B3V A;  3BI1 A;  3KKW A;  1TKJ A;  3SJX A;  1Q2C A;  3GYA A;  5FVJ A;  3R9G A;  4Z65 A;  3H8G A;  2RB7 A;  2DPS A;  3QAY A;  4NFR A;  2PIY A;  4XNH C;  3VWD A;  2EO8 A;  1GHE A;  1XBU A;  2IQ6 A;  4KOX A;  3IWG A;  1QSO A;  4KVX A;  4PV6 A;  4C7I A;  4XPD B;  4OC0 A;  2K5T A;  4M6H A;  4KOV A;  1XE4 A;  1S5K A;  3JVN A;  5IB0 A;  2ZW4 A;  1ZO0 A;  1OZP A;  2Z3K A;  4P10 A;  1XEB A;  4UWJ A;  5HVH A;  5JH9 A;  4B12 A;  2CY2 A;  5G1Z A;  3G3S A;  2WPW A;  5AGE A;  1S7L A;  2PR1 A;  2Q4Y A;  5CBM A;  4X2T A;  4CYP A;  1X12 A; 
#chains in the Genus database with same CATH homology
 2OZG A;  5G21 A;  5H86 A;  2Z10 A;  1PUA A;  2FT0 A;  3DNS A;  3K9U A;  1PU9 A;  2OH1 A;  2B4D B;  1TIQ A;  4KOY A;  2FIW A;  1M1D A;  1Y7R A;  4JD6 A;  3W6X A;  1CM0 A;  4B10 A;  1SQH A;  3JUW A;  4ORF A;  4MBU A;  2CXA A;  5E96 A;  3PGP A;  2R7H A;  2R8V A;  2ZPA A;  2FS5 A;  1LRZ A;  2B3U A;  3CXS A;  1UFH A;  5EC4 A;  2GIV A;  4CAV A;  4CYN A;  3A9L A;  4FD6 A;  5KTC A;  1V0C A;  1I1D A;  4MY0 A;  3QB8 A;  1Z4E A;  4U5Y A;  4E8O A;  2REE A;  3FIX A;  2VI7 A;  3JTK A;  2YND A;  1YGH A;  2WPX A;  4KOW A;  2Z3N A;  4A95 A;  5ISV A;  1Y9W A;  3D2P A;  4Q38 A;  2R98 A;  4F6A A;  3R9F A;  3TOA A;  2B58 A;  4M3S A;  1IYK A;  3T9Y A;  3TE4 A;  1N71 A;  4PK2 A;  5A28 A;  3DSB A;  5AG5 A;  1KUV A;  1NSL A;  1WK4 A;  3H4Q A;  1WWZ A;  1YVK A;  2CNM A;  2Q0Y A;  3F5B A;  4OAE A;  5I0C A;  1B87 A;  2R1I A;  4UCN A;  2HV2 A;  2ARH A;  4KSF A;  4PSW A;  4CS0 B;  4KVM E;  3EC4 A;  2HUZ A;  1M4D A;  3SXN A;  2JDC A;  4X5K A;  2FXF A;  2VEZ A;  4KLV A;  3FBU A;  2Q7B A;  2G3A A;  2WSA A;  4EVY A;  5C88 A;  5HH1 A;  4AVB A;  1YK3 A;  4MFL A;  2Y0M A;  5JPH A;  2D4O A;  1S7K A;  4UCP A;  4R87 A;  2I00 A;  2ZW5 A;  4F0Y A;  5DWN A;  4A30 A;  3FB3 A;  3H5Z A;  1YRE A;  3R1K A;  1RXT A;  1M44 A;  3DR8 A;  4MI4 A;  4C7H A;  2AJ6 A;  4RI1 A;  5AG7 A;  4MJ8 A;  4FD5 A;  3E0K A;  3FXT A;  4PSX A;  1QSR A;  3ZZI A;  4LX9 A;  3DR6 A;  3EO4 A;  3SXO A;  3SHP A;  4R3K A;  2BL1 A;  1YVO A;  2QML A;  2YNC C;  4Y49 C;  3W6S A;  4UFW A;  3FNC A;  3R96 A;  4KOU A;  5DWM A;  1NE9 A;  2X7B A;  1P0H A;  2JDD A;  4MFP A;  4B13 A;  2IL4 A;  3CXQ A;  4HNY B;  2Z3L A;  4Q36 A;  4ONU A;  4CAX A;  3TOB A;  3PP9 A;  3D2M A;  1Q2Y A;  2BUE A;  2P0W A;  3C26 A;  4UWI A;  2B3V A;  4R3L A;  3F8K A;  4MFQ A;  2CNT A;  2BSW A;  1XIX A;  2P6F A;  3P2H A;  3R9E A;  4XPD C;  4KOR A;  4CYQ A;  4CGP A;  2Z0Z A;  3TO7 A;  2B5G A;  3R95 A;  2JLM A;  5HMN A;  2B4B A;  4J3G A;  4UFX A;  2J8M A;  3MGD A;  4UCM A;  4YRH A;  4BBH A;  3TFY A;  2VBQ A;  4KLW A;  1J4J A;  4YGO A;  2G3T A;  2VXK A;  5F49 A;  4RS2 A;  4ZBG A;  3UY5 A;  2Q4V A;  4MFK A;  1Q2D A;  2O28 A;  4NXY A;  3LOD A;  3NE7 A;  3IWE A;  3N7Z A;  1QST A;  4MHD A;  1MJB A;  2VQY A;  2OU2 A;  2Z3P A;  1KZF A;  5A27 A;  4AVA A;  1Y9K A;  4H89 A;  5F48 A;  4B5P B;  3GY9 A;  2H5M A;  2PQ8 A;  4FD4 A;  3GKR A;  3EXN A;  4DNC A;  2BEI A;  4A2Z A;  5AG6 A;  2REF A;  1IIC A;  1VKC A;  3CXP A;  4C2Z A;  2VZY A;  4CGL A;  5IV0 A;  2I79 A;  5BWA B;  3VWE A;  2PRB A;  3TCV A;  4NF1 A;  3FYN A;  2WUU A;  3BJ7 A;  1IB1 E;  3QAH A;  3PZJ A;  4KSA A;  2NMT A;  4XNH B;  4C68 A;  4CYO A;  3RYO A;  4OAD A;  3TT2 A;  4QB9 A;  4KS9 A;  2Z11 A;  2GE3 A;  2RC4 A;  1QSM A;  4QUS A;  4GS4 A;  1VHS A;  4L8A A;  4JWP A;  4KVO E;  1I21 A;  4Y49 B;  4PK3 A;  3V8I A;  2J8R A;  3TTH A;  4R57 A;  1I12 A;  3F0A A;  4I49 A;  4A33 A;  1Z9U A;  1IID A;  2CNS A;  2OZU A;  5IX3 A;  1M4G A;  4CRY B;  3G8W A;  5EBV A;  1YX0 A;  4UA3 A;  4CGN A;  1BOB A;  5H84 A;  1RO5 A;  2B5G B;  3ZJ0 A;  2DXQ A;  1QSN A;  4KUB A;  2YNC A;  4IF5 A;  4UFV A;  2YNE A;  1MJA A;  2ZXV A;  1KUY A;  3WR7 A;  3B8G A;  4ZGY B;  4AVC A;  2EVN A;  1B6B A;  5JQ4 A;  1MJ9 A;  2Q44 A;  1S3Z A;  2OB0 A;  4A32 A;  4U9Y A;  2C27 A;  3S6G A;  4XPK A;  4L89 A;  4B5O A;  2VZZ A;  4MY3 A;  1YR0 A;  4QBJ A;  3OWC A;  4HNX B;  1IYL A;  4LUA A;  4XPL A;  5F46 A;  2DPT A;  5J8C A;  2FCK A;  4JXR A;  1YLE A;  2FSR A;  4IUS A;  3EFA A;  4KZT A;  4B14 A;  1ON0 A;  2QEC A;  4HKF A;  4MFJ A;  4UBR A;  3BJ8 A;  1K4J A;  5GCN A;  4JXQ A;  1R57 A;  3S6H A;  3I9S A;  1S7F A;  4JJX A;  3IU2 A;  4II9 A;  4KUA A;  2P6E A;  2Z3O A;  1MK4 A;  2B4D A;  4KOT A;  4NSQ A;  2Z3M A;  1U6M A;  2F5I A;  2ZW7 A;  4CAW A;  1XMT A;  4R9M A;  3DDD A;  4B11 A;  4CGO A;  2Q04 A;  5C82 A;  2QIR A;  2JEV A;  1L0C A;  4OLL A;  5CNP A;  4CRZ B;  2P6G A;  1Z4R A;  3BLN A;  4JLY A;  4U9Z A;  2ZW6 A;  5KTA A;  3P2F A;  3D3S A;  5G20 A;  4MFZ A;  2PR8 A;  4AB7 A;  4BMH A;  1CJW A;  4NEX A;  2EUI A;  4C2Y A;  3TO6 A;  3T90 A;  5AG4 A;  4CGM A;  1KUX A;  2D4P A;  4A31 A;  1NMT A;  4AG7 A;  2GAN A;  2PDO A;  5G22 A;  2J8N A;  2ATR A;  2KCW A;  2FE7 A;  2FIA A;  4YFJ A;  1BO4 A;  4QVT A;  4K30 A;  5J8F A;  4KOS A;  2G0B A;  4NCZ A;  2OZH A;  3FRM A;  4CAE A;  1XF8 A;  1S7N A;  4QC6 A;  1P4N A;  4M85 A;  3W91 A;  4H6Z A;  4E2A A;  1S60 A;  4CAF A;  4B5P A;  3LD2 A;  3S6F A;  5F47 A;  2HQY A;  1M4I A;  2AE6 A;  2YGW A;  4H6U A;  4F0X A;  4FD7 A;  3TO9 A;  3IGR A;  4C2X A;  3IU1 A;  3EY5 A;  4HNW B;  2FL4 A;  2PC1 A;  4E0A A;  2PSW A;  5KTD A;  3S6K A;  1FY7 A;  4AG9 A;  3I3G A;  3D8P A;  2A4N A;  3KKW A;  1Q2C A;  3GYA A;  5FVJ A;  3R9G A;  2DPS A;  4XNH C;  3VWD A;  1GHE A;  4KVX A;  4KOX A;  3IWG A;  1QSO A;  4PV6 A;  4C7I A;  4XPD B;  2K5T A;  4KOV A;  1XE4 A;  1S5K A;  3JVN A;  5IB0 A;  2ZW4 A;  1ZO0 A;  1OZP A;  2Z3K A;  1XEB A;  4UWJ A;  4B12 A;  2CY2 A;  5G1Z A;  3G3S A;  2WPW A;  5AGE A;  1S7L A;  2PR1 A;  2Q4Y A;  4CYP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...