3MGDA

Crystal structure of predicted acetyltransferase with acetyl-coa from clostridium acetobutylicum at the resolution 1.9a, northeast structural genomics consortium target car165
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
153
structure length
153
Chain Sequence
MMNYRKADMKDISLLVSIRKRQLIDEGIEPNIDIDKELTRYFNNKLANNLLVEWIAEENNQIIATAAIAFIDFPPTYTNKTGRKGYITNMYTEPTSRGNGIATGMLDRLVNEAKERNIHKICLVASKLGRPVYKKYGFQDTDEWLELNLLEHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Predicted acetyltransferase
publication title Northeast Structural Genomics Consortium Target CaR165
rcsb
source organism Clostridium acetobutylicum
total genus 43
structure length 153
sequence length 153
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-04-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13508 Acetyltransf_7 Acetyltransferase (GNAT) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 3mgdA00
4MI4A 2B4DB 2B5GB 4KVME 1Y9WA 2VXKA 1XEBA 2HUZA 3PZJA 4L8AA 4AVBA 3R96A 5J8FA 4EVYA 4PV6A 5JPHA 3CXSA 3E0KA 4JJXA 1VHSA 4PK3A 3TOBA 4ORFA 3IGRA 1PUAA 1FY7A 4R3KA 4NEXA 1YLEA 3W91A 3TO7A 1U6MA 2P6EA 5F48A 1KUYA 2JLMA 4NF1A 5GCNA 4OAEA 5EBVA 3TE4A 3DR6A 3G8WA 4M3SA 1YVKA 2AJ6A 1IB1E 4H6ZA 2Z11A 3LODA 2BEIA 3TT2A 4B5PA 4KOTA 1S60A 1YR0A 3I3GA 1WK4A 3I9SA 4B5OA 1YX0A 3C26A 4MY3A 1CJWA 2OZGA 2CY2A 5HH1A 3W6SA 4E8OA 3W6XA 1XIXA 4GS4A 4B5PB 4DNCA 4RI1A 3TTHA 4KORA 2PQ8A 5KTAA 2GANA 2CNSA 3SXNA 1UFHA 3P2FA 4QB9A 3FBUA 4AG9A 5E96A 3BJ8A 2VZYA 2PC1A 2PDOA 1Q2CA 4E0AA 4HKFA 2OU2A 2PRBA 2C27A 1SQHA 2ARHA 2H5MA 1VKCA 5FVJA 5DWNA 1TIQA 1I21A 2G0BA 4X5KA 1J4JA 2CNMA 4XPDB 5C88A 1ON0A 2REEA 3FIXA 1NE9A 2FL4A 5F49A 2K5TA 4AVCA 2REFA 4F6AA 4F0YA 2ZW6A 4KZTA 3EC4A 4IF5A 4IUSA 3PGPA 4OADA 2Z0ZA 3F8KA 4KLVA 4CRYB 1XE4A 4PSWA 2ZW7A 1MJAA 3FB3A 4KOSA 4HNXB 4CRZB 1S7KA 2P6FA 4QUSA 1QSRA 1QSTA 4R3LA 3R9FA 4R9MA 4MHDA 4JXQA 4KOXA 4UWJA 1RO5A 3N7ZA 4PSXA 4ONUA 3R9EA 3V8IA 3BJ7A 2J8RA 3FXTA 2VQYA 5DWMA 1Q2DA 2FSRA 2PSWA 2X7BA 3QB8A 1Y9KA 1MK4A 1IYLA 4QBJA 4YGOA 4KUAA 3D2PA 1IIDA 3OWCA 4RS2A 2FS5A 3TCVA 1OZPA 2RC4A 3SHPA 2OZHA 4LX9A 4XNHB 2J8MA 3NE7A 2R98A 4LUAA 3R9GA 2F5IA 4II9A 3R1KA 4JD6A 4U9ZA 4JXRA 4M85A 2QMLA 4U5YA 2FIWA 3RYOA 4E2AA 2CNTA 1B87A 1L0CA 2R8VA 4KVOE 2B4BA 2VBQA 2OZUA 2WPXA 3D8PA 1NSLA 2FT0A 2G3AA 2ZPAA 1LRZA 3WR7A 2FE7A 2R7HA 4PK2A 4XPKA 4R57A 1NMTA 2JEVA 2Q04A 1GHEA 3DSBA 2I79A 3H4QA 1K4JA 2FIAA 2I00A 1M4IA 2D4PA 4Y49B 3CXPA 4BMHA 1M1DA 3TO6A 2B58A 1B6BA 5IB0A 4KLWA 1KUXA 1M44A 2J8NA 4CAWA 2D4OA 2BSWA 3GYAA 3GKRA 3TO9A 3G3SA 5IX3A 4AVAA 4I49A 4MY0A 4FD5A 1XF8A 1MJ9A 3D3SA 4NCZA 3GY9A 4CAVA 3PP9A 4U9YA 3JUWA 2IL4A 5I0CA 1M4GA 5JQ4A 1S7LA 2Q4YA 3ZZIA 1P4NA 1P0HA 4KOYA 5J8CA 3F0AA 4XPDC 2Q0YA 2BL1A 4L89A 4FD6A 3LD2A 3F5BA 1Z4EA 2ZXVA 5KTDA 4YFJA 4AB7A 3JVNA 3EFAA 3UY5A 4HNYB 1V0CA 2HQYA 1QSMA 2OB0A 2BUEA 5H86A 4XPLA 1KZFA 1S7FA 4H89A 2B4DA 2B5GA 4UWIA 3ZJ0A 3DR8A 1S5KA 4CAXA 4ZBGA 4OLLA 5CNPA 1MJBA 3CXQA 4FD4A 2HV2A 3BLNA 1Z4RA 3FNCA 1RXTA 2ZW5A 3FRMA 3K9UA 1IICA 2JDDA 3MGDA 3S6FA 4H6UA 3FYNA 1YGHA 4KVXA 3KKWA 3VWDA 1PU9A 4R87A 1BO4A 4UBRA 3QAHA 4NXYA 1KUVA 4CS0B 1XMTA 2G3TA 2VEZA 3SXOA 1I12A 1CM0A 2Q7BA 4KOVA 4AG7A 2B3VA 3EY5A 2Z10A 5ISVA 1S7NA 5H84A 1YREA 4XNHC 2ATRA 2EUIA 3DDDA 3EXNA 2DXQA 1Q2YA 3TOAA 1S3ZA 3B8GA 2P0WA 3DNSA 4MBUA 5HMNA 1YVOA 4HNWB 1M4DA 5KTCA 5IV0A 5F47A 2A4NA 2B3UA 4KOWA 2QIRA 2QECA 5F46A 2OH1A 1Y7RA 1QSOA 4FD7A 3S6GA 2GE3A 2VI7A 3R95A 1I1DA 2WPWA 2EVNA 2R1IA 4MJ8A 4JLYA 2JDCA 2NMTA 2O28A 1YK3A 5C82A 4Y49C 2FCKA 4KOUA 5EC4A 2VZZA 2FXFA 1BOBA 4KUBA 2ZW4A 2Y0MA 2AE6A 4K30A 2GIVA 3D2MA 2Q44A 3S6KA 2P6GA 2Q4VA 4UA3A 4QC6A 2KCWA 1WWZA 2PR8A 2PR1A 3T9YA 1IYKA 4YRHA 1QSNA 4NSQA 4J3GA 1Z9UA 1R57A 4JWPA 3EO4A 1N71A 3VWEA 3S6HA 4QVTA 3T90A 3TFYA 3IWGA 3P2HA
chains in the Genus database with same CATH superfamily
4BINA 4PQAA 1ZLIA 2PJ6A 4MFQA 3D67A 4MI4A 5BWAB 2B4DB 2B5GB 2VXKA 1Y9WA 4KVME 1XEBA 2HUZA 3PZJA 4CAFA 2Q51A 4L8AA 4AVBA 3R96A 2PRQA 4EVYA 4HPSA 4B11A 5J8FA 4PV6A 5JPHA 1R3NA 3RO0A 3CXSA 2AFWA 4ONWA 3E0KA 2DEAA 4JJXA 1VHSA 2C6PA 2PCUA 4PK3A 4P45A 1JWQA 2C6CA 3T8WA 3TOBA 1PYTB 4ORFA 3IGRA 3KASA 1PUAA 3B3SA 1FY7A 3KHZA 4R3KA 3KR4A 3PFOA 4NEXA 1YLEA 3W91A 5HVHA 1HDQA 1YW6A 3TO7A 2XEFA 1U6MA 4OC1A 4NGQA 2P6EA 5F48A 1F57A 1KUYA 2JLMA 4NF1A 5GCNA 4OC3A 4OAEA 5EBVA 3ISZA 3TE4A 4EWTA 3DR6A 3G8WA 2AFZA 4M3SA 1YVKA 2EK9A 2AJ6A 3WC6A 1IB1E 3CDXA 3IU2A 5LRKA 4H6ZA 2Z11A 1R43A 1YLOA 4YWYA 4A95A 4KSFA 3LODA 4MFLA 2BEIA 3TT2A 4PXEA 4B5PA 4KOTA 1S60A 2IMOA 4ZY0A 1YR0A 1OBRA 3I3GA 2GU2A 4P44A 4KSIA 4MFKA 1WK4A 3I9SA 4M6IA 4UFVA 2C1CA 4MFPA 4B5OA 1YX0A 4X8IA 3C26A 4MY3A 1CJWA 2OZGA 2CY2A 5HH1A 3W6SA 4E8OA 3W6XA 1IOIA 1XIXA 4GS4A 4B5PB 4DNCA 4OIDA 2YNEA 5CBMA 4RI1A 3TTHA 4KORA 2PQ8A 3CZXA 5KTAA 3WABA 4A39A 2VL1A 3B3CA 2Z3OA 2GANA 2CNSA 1AUGA 4MHYA 1UFHA 5G20A 3SXNA 3P2FA 5A28A 4QB9A 2O4HA 3FBUA 3SI1A 3NFZA 1TKFA 4AG9A 3BHXA 5E96A 3BJ8A 5JH9A 2VZYA 2PC1A 3KHXA 4NGPA 2PDOA 1Q2CA 3KR5A 4E0AA 1ARMA 2OU2A 4HKFA 2QVPA 4MCQA 3SJXA 2PRBA 5K8MA 1CPXA 3FMCA 3FVLA 1CP7A 2C27A 2PJ8A 3H8GA 1SQHA 1ZG9A 2ZEDA 2OOTA 2ARHA 2I3CA 1Z8LA 1JQGA 2H5MA 1Z8TA 3CPXA 1VKCA 2PJCA 3VH9A 3KGQA 5FVJA 5DWNA 2Z3LA 4M6GA 3PFEA 1TIQA 1Z8WA 4EMEA 1I21A 2G0BA 4H2KA 4X5KA 1J4JA 3IEHA 2J9AA 2CNMA 5AGEA 1ZG7A 4XPDB 1Z8XA 5C88A 4UIBA 2EBJA 3V7ZA 5J1QA 4P4JA 1ON0A 2REEA 2NSMA 3FIXA 4MFZA 1NE9A 3SI0A 1RTQA 4CGNA 2FL4A 4X3RA 5JGFA 4CGPA 4UF4A 4YU9A 1TF8A 5IB9A 5F49A 2ZEFA 2C6GA 2F7VA 3FJUA 4EFDA 3D7DA 3FH4A 4AXVA 2CXAA 2K5TA 2Z3KA 2V8GA 1AMPA 5LYFA 1TXRA 3RAMA 4AVCA 2REFA 4F6AA 4F0YA 2ZW6A 5HVGA 5DS0A 4KZTA 3EC4A 4LQGA 4OIWA 1FT7A 4IF5A 4IUSA 3PBEA 3PB7X 3PGPA 4OADA 3BXMA 2Z0ZA 3F8KA 4KLVA 4RN7A 2YNCC 3NH8A 3D68A 4CRYB 2WZNA 1XJOA 4B12A 1XE4A 3D7GA 4PSWA 2ZW7A 1MJAA 3FB3A 5LYIA 4KOSA 1IGBA 3D7HA 3SJEA 4HNXB 3QAYA 4CRZB 1S7KA 2P6FA 2WYRA 4QUSA 1QSRA 4ZI6A 1QSTA 4R3LA 3R9FA 4DUKA 2GLFA 2ZENA 1ZO0A 3PB6X 4R9MA 3V38A 4MHDA 4A37A 1Y7EA 4JXQA 2Z3PA 4KOXA 3NA6A 4MHNA 3PB8X 4UWJA 1HEEA 4PXBA 1RO5A 2XEIA 2RB7A 3N7ZA 1CG2A 1LAMA 4P4IA 4RUHA 4PSXA 2EK8A 3RNZA 4ONUA 2GLJA 3R9EA 1TKJA 2PIZA 3V8IA 3BJ7A 3A9LA 2J8RA 3FXTA 8CPAA 1Y0YA 1ZLHA 2EO8A 2RFHA 2VQYA 3KQXA 5DWMA 4W9YA 1Q2DA 2FSRA 2PSWA 2X7BA 3QB8A 4C2ZA 4JZ0A 1Y9KA 3MN8A 3IWEA 1MK4A 1IYLA 1BPNA 4IHMA 4NGNA 4CGOA 1YMEA 4QBJA 7CPAA 4YGOA 4KUAA 3D2PA 1CP6A 1IIDA 3PRTA 3RBUA 3OWCA 4A2ZA 4RS2A 2FS5A 3TCVA 1YSJA 1OZPA 2RC4A 3SHPA 2OZHA 4LX9A 4XNHB 4C2YA 1PCAA 2AFXA 2J8MA 1AYEA 3NE7A 2R98A 2PJAA 4LUAA 5LRJA 1XMBA 2F5IA 3R9GA 2V8HA 4P10A 2XEJA 4II9A 3R1KA 4JD6A 3S9MA 3LWUA 4U9ZA 4JXRA 2QMLA 4M85A 4U5YA 2FIWA 3IWWA 3RYOA 6CPAA 4MHZA 4E2AA 2PJBA 4KS9A 4Q38A 2PJ7A 3D7FA 2CNTA 1B87A 2AFOA 1L0CA 4TWEA 2R8VA 4KVOE 5AG4A 4UFWA 2B4BA 2VBQA 1FNOA 2OZUA 2WPXA 3D8PA 3NH4A 4FWUA 4OC4A 1GYTA 2GREA 1VHOA 2NYQA 2FVGA 2QJ8A 1NSLA 3SI2A 4ZY2A 3VATA 2IJZA 2FT0A 2G3AA 2ZPAA 1XOVA 1LRZA 3WR7A 4R7MA 4BD9A 2FE7A 2R7HA 4PK2A 2ANPA 3WC5A 4XPKA 4R57A 1NMTA 4Q36A 4R6TA 2JEVA 4C2XA 3IU1A 2Q04A 4R8FA 1GHEA 2CF4A 1X12A 3DSBA 2I79A 1LAPA 3H4QA 4CYQA 3H8EA 5K8PA 1K4JA 3BI1A 1ZG8A 5D29A 1EE3P 2I00A 2FIAA 1M4IA 2D4PA 4NGSA 3B35A 3CXPA 4Y49B 1QMUA 1M1DA 4BMHA 2PJ2A 3TO6A 5AG7A 3HLPA 2B58A 1B6BA 4NGMA 5IB0A 4KLWA 1KUXA 3S9NA 1M44A 2ZEPA 2J8NA 4CAWA 2WUUA 3RZAA 3KI9A 2D4OA 4CGLA 2BSWA 4F8ZA 5THWA 3GYAA 3GKRA 3TO9A 2ZEOA 1BPMA 3G3SA 5G1ZA 4AVAA 4CYPA 2CIJA 2EWBA 2JBKA 5IX3A 4I49A 4MY0A 4FD5A 2AFUA 4K3NA 3FEDA 1XF8A 4DJLA 1MJ9A 4F0XA 4MCPA 4WWVA 3D3SA 4NCZA 4CPAA 3GY9A 3BI0A 3K9TA 3D4UA 3KZWA 4CAVA 2V77A 2YNCA 3PP9A 3IO1A 4X2TA 4U9YA 3SJGA 4MHPA 2ODFA 1QQ9A 3JUWA 4M6HA 2IL4A 3TX8A 3S9LA 5I0CA 4ZY1A 2DPSA 4MFJA 4A38A 1HDUA 1M4GA 5JQ4A 4KSAA 1CPSA 1S7LA 2Q4YA 2PVWA 3ZZIA 1P4NA 1A2ZA 1P0HA 4ZX9A 4KOYA 5J8CA 3CT9A 2YGWA 3F0AA 4UEEA 3PEIA 4XPDC 4CAEA 2Q0YA 3FECA 2BL1A 3D66A 4FUUA 3WC7A 1F2OA 3IC1A 4L89A 4FD6A 2O53A 3PBBA 2AFMA 4PXCA 5K8OA 3LD2A 2V8VA 4OC5A 3F5BA 1Z4EA 2ZXVA 4CYOA 3GIUA 3FEEA 2JEWA 1LOKA 4O23A 5KTDA 4YFJA 1ARLA 4AB7A 4CYNA 3JVNA 3EFAA 4NJRA 3UY5A 4HNYB 1LANA 3NE8A 3IIBA 4F9UA 2PIYA 3GUXA 1V0CA 2HQYA 5ELYA 1QSMA 2OB0A 2ZEGA 2BUEA 4C7HA 4MXUA 3B7IA 1VIXA 5H86A 1X10A 4A30A 4XPLA 1KZFA 2PJ4A 3KQZA 2ZEMA 3GB0A 4TNUA 4UCPA 1S7FA 1ELMP 3CPAA 2B4DA 4H89A 2B5GA 4NGRA 4Q7AA 4UWIA 4A94A 4OMEA 3H8FA 3GLJA 4UFXA 3ZJ0A 2BCOA 5K8NA 4UCNA 2GFQA 1S5KA 3DR8A 4CAXA 3JTKA 4OLLA 4ZBGA 2YNDA 5CNPA 1MJBA 2CTBA 3CXQA 4NJQA 4ZGYB 2Z3NA 4IAVA 2ZEHA 4FD4A 2HV2A 3BLNA 4UEZA 4NGTA 1Z4RA 3FNCA 4P4DA 1YW4A 4B14A 1RXTA 1VHEA 2ZW5A 4G1PA 1KWMA 4PPZA 3DGVA 3FRMA 1BLLE 3FX6A 3K9UA 1IICA 2F8HA 3B2YA 2JDDA 3MRUA 1Q7LA 4MCSA 3TC8A 1F2PA 3H5ZA 3MGDA 1H8LA 4C68A 5LRGA 3S6FA 4H6UA 3SJFA 1YQEA 1BAVA 3FYNA 1YGHA 4OC2A 4FBEA 1Z5RA 1LFWA 4UIAA 1XBUA 4KVXA 3LACA 1TF9A 3KKWA 5F09A 3K2KA 3VWDA 1PU9A 4R87A 3VARA 1BO4A 4UBRA 5LYDA 2CTCA 3IJ3A 3ISXA 1ELLP 2Q4ZA 3QAHA 4NXYA 4ZX8A 1KUVA 4UEFA 4CS0B 1XMTA 2PJ3A 2G3TA 2VEZA 2JBJA 4ZYQA 2G9DA 5G21A 3SXOA 1I12A 1CM0A 5EMIA 1VGYA 2Q7BA 4KOVA 4AG7A 2B3VA 3EY5A 5HXDA 2Z10A 5ISVA 4GXHA 4B6ZA 1S7NA 4F9VA 5H84A 1YREA 3DLJA 4XNHC 5A27A 2ATRA 2EUIA 2QYVA 2Z3MA 4R76A 3B3WA 3DDDA 3WT4A 3EXNA 4PXDA 2DXQA 1Q2YA 1DTDA 3JRUA 4LQ6A 5AG6A 1S3ZA 3B8GA 5CPAA 3TOAA 3PB9X 2P0WA 4MCRA 1Y0RA 3DNSA 2ZOGA 5G22A 4P4FA 5JM6A 5HVFA 4MBUA 1LCPA 5HMNA 2ZELA 4OP4A 1YVOA 2DF5A 4HNWB 1M4DA 2WSAA 4GM5A 5KTCA 2PJ0A 5IV0A 5F47A 2POKA 3LMSA 1CX8A 2A4NA 4FAIA 2B3UA 4KOWA 2QIRA 2Q43A 2QECA 2AFSA 5F46A 2OH1A 5LYLA 1Y7RA 4MRIA 2PE3A 4UCMA 1QSOA 4FD7A 4B13A 2XEGA 3I1UA 3S6GA 2GE3A 4P4BA 3QNVA 2VI7A 4OC0A 3R95A 3KL9A 1I1DA 2WPWA 1XRYA 2BO9A 2EVNA 1UWYA 3NH5A 2ZEEA 4BBHA 1Z2LA 2R1IA 4B10A 4MJ8A 4JLYA 2JDCA 2NMTA 2O28A 3IFEA 1YK3A 4CGMA 5C82A 4Y49C 1DE4C 2FCKA 2HB6A 2PJ9A 4KOUA 4WJBA 4NFRA 5EC4A 2VZZA 2FXFA 1BOBA 2OR4A 2ZOFA 5I4MA 1NSAA 4P6YA 1IOFA 5AG5A 4KUBA 4C7IA 2ZW4A 2Q7SA 1M4LA 2BOAA 2V8DA 3FF3A 2Y0MA 2AE6A 1XFOA 4K30A 3L2NA 2PVVA 2GIVA 3D2MA 5D8NA 3HUVA 2PJ1A 2Q44A 4OKOA 3S6KA 2P6GA 1TKHA 2Q4VA 4UA3A 4QC6A 2KCWA 4A32A 1WWZA 1IU8A 2PR8A 4DYOA 2PR1A 4P4EA 3T9YA 1IYKA 4YRHA 1QSNA 4JYWA 4MMOA 4NSQA 4J3GA 2IQ6A 3N5FA 2DPTA 1Z9UA 1IY7A 1R57A 4JWPA 3EO4A 1N71A 3VWEA 2HC9A 4IK2A 3S6HA 2PJ5A 4QVTA 1CBXA 3B3TA 3PB4X 3T90A 2ABZA 3IWGA 4A31A 3P2HA 4Z65A 4A33A 3TFYA 3B3VA
chains in the Genus database with same CATH topology
4MFQA 4MI4A 5BWAB 2B4DB 2B5GB 2VXKA 1Y9WA 4KVME 1XEBA 2HUZA 3PZJA 4CAFA 4L8AA 4AVBA 3R96A 5J8FA 4EVYA 4B11A 4PV6A 5JPHA 3CXSA 3E0KA 4JJXA 1VHSA 4PK3A 3TOBA 4ORFA 3IGRA 1PUAA 1FY7A 4R3KA 4NEXA 1YLEA 3W91A 3TO7A 1U6MA 2P6EA 5F48A 1KUYA 2JLMA 4NF1A 5GCNA 4OAEA 5EBVA 3TE4A 3DR6A 3G8WA 4M3SA 1YVKA 2AJ6A 1IB1E 3IU2A 4H6ZA 2Z11A 4A95A 4KSFA 3LODA 4MFLA 2BEIA 3TT2A 4B5PA 4KOTA 1S60A 1YR0A 3I3GA 4MFKA 1WK4A 3I9SA 4UFVA 4B5OA 4MFPA 1YX0A 3C26A 4MY3A 1CJWA 2OZGA 2CY2A 5HH1A 3W6SA 4E8OA 3W6XA 1XIXA 4GS4A 4B5PB 4DNCA 2YNEA 4RI1A 3TTHA 4KORA 2PQ8A 5KTAA 2Z3OA 2GANA 2CNSA 5G20A 1UFHA 3SXNA 3P2FA 5A28A 4QB9A 3FBUA 4AG9A 5E96A 3BJ8A 2VZYA 2PC1A 2PDOA 1Q2CA 4E0AA 4HKFA 2OU2A 2PRBA 2C27A 1SQHA 2ARHA 2H5MA 1VKCA 5FVJA 5DWNA 2Z3LA 1TIQA 1I21A 2G0BA 4X5KA 1J4JA 2CNMA 5AGEA 4XPDB 5C88A 1ON0A 2REEA 3FIXA 4MFZA 1NE9A 4CGNA 2FL4A 4CGPA 5F49A 2CXAA 2K5TA 2Z3KA 4AVCA 2REFA 4F6AA 4F0YA 2ZW6A 4KZTA 3EC4A 4IF5A 4IUSA 3PGPA 4OADA 2Z0ZA 3F8KA 4KLVA 2YNCC 4CRYB 4B12A 1XE4A 4PSWA 2ZW7A 1MJAA 3FB3A 4KOSA 4HNXB 4CRZB 1S7KA 2P6FA 4QUSA 1QSRA 1QSTA 4R3LA 3R9FA 1ZO0A 4R9MA 4MHDA 4JXQA 2Z3PA 4KOXA 4UWJA 1RO5A 3N7ZA 4PSXA 4ONUA 3R9EA 3V8IA 3BJ7A 3A9LA 2J8RA 3FXTA 2VQYA 5DWMA 1Q2DA 2FSRA 2PSWA 2X7BA 3QB8A 4C2ZA 1Y9KA 3IWEA 1MK4A 1IYLA 4CGOA 4QBJA 4YGOA 4KUAA 3D2PA 1IIDA 3OWCA 4A2ZA 4RS2A 2FS5A 3TCVA 1OZPA 2RC4A 3SHPA 2OZHA 4LX9A 4XNHB 4C2YA 2J8MA 3NE7A 2R98A 4LUAA 3R9GA 2F5IA 4II9A 3R1KA 4JD6A 4U9ZA 4JXRA 2QMLA 4M85A 4U5YA 2FIWA 3RYOA 4E2AA 4KS9A 4Q38A 2CNTA 1B87A 1L0CA 2R8VA 4KVOE 5AG4A 4UFWA 2B4BA 2VBQA 2OZUA 2WPXA 3D8PA 1NSLA 2FT0A 2G3AA 2ZPAA 1LRZA 3WR7A 2FE7A 2R7HA 4PK2A 4XPKA 4R57A 1NMTA 4Q36A 4C2XA 2JEVA 3IU1A 2Q04A 1GHEA 3DSBA 2I79A 4CYQA 3H4QA 1K4JA 2FIAA 2I00A 1M4IA 2D4PA 4Y49B 3CXPA 4BMHA 1M1DA 3TO6A 5AG7A 2B58A 1B6BA 5IB0A 4KLWA 1KUXA 1M44A 2J8NA 4CAWA 2WUUA 2D4OA 4CGLA 2BSWA 3GYAA 3GKRA 3TO9A 3G3SA 5IX3A 4CYPA 5G1ZA 4AVAA 4I49A 4MY0A 4FD5A 1XF8A 1MJ9A 4F0XA 3D3SA 4NCZA 3GY9A 4CAVA 2YNCA 3PP9A 4U9YA 3JUWA 2IL4A 5I0CA 2DPSA 4MFJA 1M4GA 5JQ4A 4KSAA 1S7LA 2Q4YA 3ZZIA 1P4NA 1P0HA 4KOYA 5J8CA 2YGWA 3F0AA 4XPDC 4CAEA 2Q0YA 2BL1A 4L89A 4FD6A 3LD2A 3F5BA 1Z4EA 2ZXVA 4CYOA 5KTDA 4YFJA 4AB7A 4CYNA 3JVNA 3EFAA 3UY5A 4HNYB 1V0CA 2HQYA 4C7HA 1QSMA 2OB0A 2BUEA 5H86A 4A30A 4XPLA 1KZFA 4UCPA 1S7FA 4H89A 2B4DA 2B5GA 4UWIA 4UFXA 3ZJ0A 4UCNA 3DR8A 1S5KA 4CAXA 3JTKA 4OLLA 4ZBGA 2YNDA 5CNPA 1MJBA 3CXQA 4ZGYB 2Z3NA 4FD4A 2HV2A 3BLNA 1Z4RA 3FNCA 4B14A 1RXTA 2ZW5A 3FRMA 3K9UA 1IICA 2JDDA 3H5ZA 3MGDA 4C68A 3S6FA 4H6UA 3FYNA 1YGHA 4KVXA 3KKWA 3VWDA 1PU9A 4R87A 1BO4A 4UBRA 3QAHA 4NXYA 1KUVA 4CS0B 1XMTA 2G3TA 2VEZA 5G21A 3SXOA 1I12A 1CM0A 2Q7BA 4KOVA 4AG7A 2B3VA 3EY5A 2Z10A 5ISVA 1S7NA 5H84A 1YREA 4XNHC 5A27A 2ATRA 2EUIA 2Z3MA 3DDDA 3EXNA 2DXQA 1Q2YA 3TOAA 5AG6A 1S3ZA 3B8GA 2P0WA 3DNSA 5G22A 4MBUA 5HMNA 1YVOA 4HNWB 1M4DA 2WSAA 5KTCA 5IV0A 5F47A 2A4NA 2B3UA 4KOWA 2QIRA 2QECA 5F46A 2OH1A 1Y7RA 4UCMA 1QSOA 4FD7A 4B13A 3S6GA 2GE3A 2VI7A 3R95A 1I1DA 2WPWA 2EVNA 4BBHA 2R1IA 4B10A 4MJ8A 4JLYA 2JDCA 2NMTA 2O28A 1YK3A 4CGMA 5C82A 4Y49C 2FCKA 4KOUA 5EC4A 2VZZA 2FXFA 1BOBA 5AG5A 4KUBA 4C7IA 2ZW4A 2Y0MA 2AE6A 4K30A 2GIVA 3D2MA 2Q44A 3S6KA 2P6GA 2Q4VA 4UA3A 4QC6A 2KCWA 4A32A 1WWZA 2PR8A 2PR1A 3T9YA 1IYKA 4YRHA 1QSNA 4NSQA 4J3GA 2DPTA 1Z9UA 1R57A 4JWPA 3EO4A 1N71A 3VWEA 3S6HA 4QVTA 3T90A 4A31A 3IWGA 3TFYA 3P2HA 4A33A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MI4 A;  2B4D B;  2B5G B;  4KVM E;  1Y9W A;  2VXK A;  1XEB A;  2HUZ A;  3PZJ A;  4L8A A;  4AVB A;  3R96 A;  5J8F A;  4EVY A;  4PV6 A;  5JPH A;  3CXS A;  3E0K A;  4JJX A;  1VHS A;  4PK3 A;  3TOB A;  4ORF A;  3IGR A;  1PUA A;  1FY7 A;  4R3K A;  4NEX A;  1YLE A;  3W91 A;  3TO7 A;  1U6M A;  2P6E A;  5F48 A;  1KUY A;  2JLM A;  4NF1 A;  5GCN A;  4OAE A;  5EBV A;  3TE4 A;  3DR6 A;  3G8W A;  4M3S A;  1YVK A;  2AJ6 A;  1IB1 E;  4H6Z A;  2Z11 A;  3LOD A;  2BEI A;  3TT2 A;  4B5P A;  4KOT A;  1S60 A;  1YR0 A;  3I3G A;  1WK4 A;  3I9S A;  4B5O A;  1YX0 A;  3C26 A;  4MY3 A;  1CJW A;  2OZG A;  2CY2 A;  5HH1 A;  3W6S A;  4E8O A;  3W6X A;  1XIX A;  4GS4 A;  4B5P B;  4DNC A;  4RI1 A;  3TTH A;  4KOR A;  2PQ8 A;  5KTA A;  2GAN A;  2CNS A;  3SXN A;  1UFH A;  3P2F A;  4QB9 A;  3FBU A;  4AG9 A;  5E96 A;  3BJ8 A;  2VZY A;  2PC1 A;  2PDO A;  1Q2C A;  4E0A A;  4HKF A;  2OU2 A;  2PRB A;  2C27 A;  1SQH A;  2ARH A;  2H5M A;  1VKC A;  5FVJ A;  5DWN A;  1TIQ A;  1I21 A;  2G0B A;  4X5K A;  1J4J A;  2CNM A;  4XPD B;  5C88 A;  1ON0 A;  2REE A;  3FIX A;  1NE9 A;  2FL4 A;  5F49 A;  2K5T A;  4AVC A;  2REF A;  4F6A A;  4F0Y A;  2ZW6 A;  4KZT A;  3EC4 A;  4IF5 A;  4IUS A;  3PGP A;  4OAD A;  2Z0Z A;  3F8K A;  4KLV A;  4CRY B;  1XE4 A;  4PSW A;  2ZW7 A;  1MJA A;  3FB3 A;  4KOS A;  4HNX B;  4CRZ B;  1S7K A;  2P6F A;  4QUS A;  1QSR A;  1QST A;  4R3L A;  3R9F A;  4R9M A;  4MHD A;  4JXQ A;  4KOX A;  4UWJ A;  1RO5 A;  3N7Z A;  4PSX A;  4ONU A;  3R9E A;  3V8I A;  3BJ7 A;  2J8R A;  3FXT A;  2VQY A;  5DWM A;  1Q2D A;  2FSR A;  2PSW A;  2X7B A;  3QB8 A;  1Y9K A;  1MK4 A;  1IYL A;  4QBJ A;  4YGO A;  4KUA A;  3D2P A;  1IID A;  3OWC A;  4RS2 A;  2FS5 A;  3TCV A;  1OZP A;  2RC4 A;  3SHP A;  2OZH A;  4LX9 A;  4XNH B;  2J8M A;  3NE7 A;  2R98 A;  4LUA A;  3R9G A;  2F5I A;  4II9 A;  3R1K A;  4JD6 A;  4U9Z A;  4JXR A;  4M85 A;  2QML A;  4U5Y A;  2FIW A;  3RYO A;  4E2A A;  2CNT A;  1B87 A;  1L0C A;  2R8V A;  4KVO E;  2B4B A;  2VBQ A;  2OZU A;  2WPX A;  3D8P A;  1NSL A;  2FT0 A;  2G3A A;  2ZPA A;  1LRZ A;  3WR7 A;  2FE7 A;  2R7H A;  4PK2 A;  4XPK A;  4R57 A;  1NMT A;  2JEV A;  2Q04 A;  1GHE A;  3DSB A;  2I79 A;  3H4Q A;  1K4J A;  2FIA A;  2I00 A;  1M4I A;  2D4P A;  4Y49 B;  3CXP A;  4BMH A;  1M1D A;  3TO6 A;  2B58 A;  1B6B A;  5IB0 A;  4KLW A;  1KUX A;  1M44 A;  2J8N A;  4CAW A;  2D4O A;  2BSW A;  3GYA A;  3GKR A;  3TO9 A;  3G3S A;  5IX3 A;  4AVA A;  4I49 A;  4MY0 A;  4FD5 A;  1XF8 A;  1MJ9 A;  3D3S A;  4NCZ A;  3GY9 A;  4CAV A;  3PP9 A;  4U9Y A;  3JUW A;  2IL4 A;  5I0C A;  1M4G A;  5JQ4 A;  1S7L A;  2Q4Y A;  3ZZI A;  1P4N A;  1P0H A;  4KOY A;  5J8C A;  3F0A A;  4XPD C;  2Q0Y A;  2BL1 A;  4L89 A;  4FD6 A;  3LD2 A;  3F5B A;  1Z4E A;  2ZXV A;  5KTD A;  4YFJ A;  4AB7 A;  3JVN A;  3EFA A;  3UY5 A;  4HNY B;  1V0C A;  2HQY A;  1QSM A;  2OB0 A;  2BUE A;  5H86 A;  4XPL A;  1KZF A;  1S7F A;  4H89 A;  2B4D A;  2B5G A;  4UWI A;  3ZJ0 A;  3DR8 A;  1S5K A;  4CAX A;  4ZBG A;  4OLL A;  5CNP A;  1MJB A;  3CXQ A;  4FD4 A;  2HV2 A;  3BLN A;  1Z4R A;  3FNC A;  1RXT A;  2ZW5 A;  3FRM A;  3K9U A;  1IIC A;  2JDD A;  3MGD A;  3S6F A;  4H6U A;  3FYN A;  1YGH A;  4KVX A;  3KKW A;  3VWD A;  1PU9 A;  4R87 A;  1BO4 A;  4UBR A;  3QAH A;  4NXY A;  1KUV A;  4CS0 B;  1XMT A;  2G3T A;  2VEZ A;  3SXO A;  1I12 A;  1CM0 A;  2Q7B A;  4KOV A;  4AG7 A;  2B3V A;  3EY5 A;  2Z10 A;  5ISV A;  1S7N A;  5H84 A;  1YRE A;  4XNH C;  2ATR A;  2EUI A;  3DDD A;  3EXN A;  2DXQ A;  1Q2Y A;  3TOA A;  1S3Z A;  3B8G A;  2P0W A;  3DNS A;  4MBU A;  5HMN A;  1YVO A;  4HNW B;  1M4D A;  5KTC A;  5IV0 A;  5F47 A;  2A4N A;  2B3U A;  4KOW A;  2QIR A;  2QEC A;  5F46 A;  2OH1 A;  1Y7R A;  1QSO A;  4FD7 A;  3S6G A;  2GE3 A;  2VI7 A;  3R95 A;  1I1D A;  2WPW A;  2EVN A;  2R1I A;  4MJ8 A;  4JLY A;  2JDC A;  2NMT A;  2O28 A;  1YK3 A;  5C82 A;  4Y49 C;  2FCK A;  4KOU A;  5EC4 A;  2VZZ A;  2FXF A;  1BOB A;  4KUB A;  2ZW4 A;  2Y0M A;  2AE6 A;  4K30 A;  2GIV A;  3D2M A;  2Q44 A;  3S6K A;  2P6G A;  2Q4V A;  4UA3 A;  4QC6 A;  2KCW A;  1WWZ A;  2PR8 A;  2PR1 A;  3T9Y A;  1IYK A;  4YRH A;  1QSN A;  4NSQ A;  4J3G A;  1Z9U A;  1R57 A;  4JWP A;  3EO4 A;  1N71 A;  3VWE A;  3S6H A;  4QVT A;  3T90 A;  3TFY A;  3IWG A;  3P2H A; 
#chains in the Genus database with same CATH topology
 4BIN A;  4PQA A;  1ZLI A;  2PJ6 A;  4MFQ A;  3D67 A;  4MI4 A;  5BWA B;  2B4D B;  2B5G B;  2VXK A;  1Y9W A;  4KVM E;  1XEB A;  2HUZ A;  3PZJ A;  4CAF A;  2Q51 A;  4L8A A;  4AVB A;  3R96 A;  2PRQ A;  4EVY A;  4HPS A;  4B11 A;  5J8F A;  4PV6 A;  5JPH A;  1R3N A;  3RO0 A;  3CXS A;  2AFW A;  4ONW A;  3E0K A;  2DEA A;  4JJX A;  1VHS A;  2C6P A;  2PCU A;  4PK3 A;  4P45 A;  1JWQ A;  2C6C A;  3T8W A;  3TOB A;  1PYT B;  4ORF A;  3IGR A;  3KAS A;  1PUA A;  3B3S A;  1FY7 A;  3KHZ A;  4R3K A;  3KR4 A;  3PFO A;  4NEX A;  1YLE A;  3W91 A;  5HVH A;  1HDQ A;  1YW6 A;  3TO7 A;  2XEF A;  1U6M A;  4OC1 A;  4NGQ A;  2P6E A;  5F48 A;  1F57 A;  1KUY A;  2JLM A;  4NF1 A;  5GCN A;  4OC3 A;  4OAE A;  5EBV A;  3ISZ A;  3TE4 A;  4EWT A;  3DR6 A;  3G8W A;  2AFZ A;  4M3S A;  1YVK A;  2EK9 A;  2AJ6 A;  3WC6 A;  1IB1 E;  3CDX A;  3IU2 A;  5LRK A;  4H6Z A;  2Z11 A;  1R43 A;  1YLO A;  4YWY A;  4A95 A;  4KSF A;  3LOD A;  4MFL A;  2BEI A;  3TT2 A;  4PXE A;  4B5P A;  4KOT A;  1S60 A;  2IMO A;  4ZY0 A;  1YR0 A;  1OBR A;  3I3G A;  2GU2 A;  4P44 A;  4KSI A;  4MFK A;  1WK4 A;  3I9S A;  4M6I A;  4UFV A;  2C1C A;  4MFP A;  4B5O A;  1YX0 A;  4X8I A;  3C26 A;  4MY3 A;  1CJW A;  2OZG A;  2CY2 A;  5HH1 A;  3W6S A;  4E8O A;  3W6X A;  1IOI A;  1XIX A;  4GS4 A;  4B5P B;  4DNC A;  4OID A;  2YNE A;  5CBM A;  4RI1 A;  3TTH A;  4KOR A;  2PQ8 A;  3CZX A;  5KTA A;  3WAB A;  4A39 A;  2VL1 A;  3B3C A;  2Z3O A;  2GAN A;  2CNS A;  1AUG A;  4MHY A;  1UFH A;  5G20 A;  3SXN A;  3P2F A;  5A28 A;  4QB9 A;  2O4H A;  3FBU A;  3SI1 A;  3NFZ A;  1TKF A;  4AG9 A;  3BHX A;  5E96 A;  3BJ8 A;  5JH9 A;  2VZY A;  2PC1 A;  3KHX A;  4NGP A;  2PDO A;  1Q2C A;  3KR5 A;  4E0A A;  1ARM A;  2OU2 A;  4HKF A;  2QVP A;  4MCQ A;  3SJX A;  2PRB A;  5K8M A;  1CPX A;  3FMC A;  3FVL A;  1CP7 A;  2C27 A;  2PJ8 A;  3H8G A;  1SQH A;  1ZG9 A;  2ZED A;  2OOT A;  2ARH A;  2I3C A;  1Z8L A;  1JQG A;  2H5M A;  1Z8T A;  3CPX A;  1VKC A;  2PJC A;  3VH9 A;  3KGQ A;  5FVJ A;  5DWN A;  2Z3L A;  4M6G A;  3PFE A;  1TIQ A;  1Z8W A;  4EME A;  1I21 A;  2G0B A;  4H2K A;  4X5K A;  1J4J A;  3IEH A;  2J9A A;  2CNM A;  5AGE A;  1ZG7 A;  4XPD B;  1Z8X A;  5C88 A;  4UIB A;  2EBJ A;  3V7Z A;  5J1Q A;  4P4J A;  1ON0 A;  2REE A;  2NSM A;  3FIX A;  4MFZ A;  1NE9 A;  3SI0 A;  1RTQ A;  4CGN A;  2FL4 A;  4X3R A;  5JGF A;  4CGP A;  4UF4 A;  4YU9 A;  1TF8 A;  5IB9 A;  5F49 A;  2ZEF A;  2C6G A;  2F7V A;  3FJU A;  4EFD A;  3D7D A;  3FH4 A;  4AXV A;  2CXA A;  2K5T A;  2Z3K A;  2V8G A;  1AMP A;  5LYF A;  1TXR A;  3RAM A;  4AVC A;  2REF A;  4F6A A;  4F0Y A;  2ZW6 A;  5HVG A;  5DS0 A;  4KZT A;  3EC4 A;  4LQG A;  4OIW A;  1FT7 A;  4IF5 A;  4IUS A;  3PBE A;  3PB7 X;  3PGP A;  4OAD A;  3BXM A;  2Z0Z A;  3F8K A;  4KLV A;  4RN7 A;  2YNC C;  3NH8 A;  3D68 A;  4CRY B;  2WZN A;  1XJO A;  4B12 A;  1XE4 A;  3D7G A;  4PSW A;  2ZW7 A;  1MJA A;  3FB3 A;  5LYI A;  4KOS A;  1IGB A;  3D7H A;  3SJE A;  4HNX B;  3QAY A;  4CRZ B;  1S7K A;  2P6F A;  2WYR A;  4QUS A;  1QSR A;  4ZI6 A;  1QST A;  4R3L A;  3R9F A;  4DUK A;  2GLF A;  2ZEN A;  1ZO0 A;  3PB6 X;  4R9M A;  3V38 A;  4MHD A;  4A37 A;  1Y7E A;  4JXQ A;  2Z3P A;  4KOX A;  3NA6 A;  4MHN A;  3PB8 X;  4UWJ A;  1HEE A;  4PXB A;  1RO5 A;  2XEI A;  2RB7 A;  3N7Z A;  1CG2 A;  1LAM A;  4P4I A;  4RUH A;  4PSX A;  2EK8 A;  3RNZ A;  4ONU A;  2GLJ A;  3R9E A;  1TKJ A;  2PIZ A;  3V8I A;  3BJ7 A;  3A9L A;  2J8R A;  3FXT A;  8CPA A;  1Y0Y A;  1ZLH A;  2EO8 A;  2RFH A;  2VQY A;  3KQX A;  5DWM A;  4W9Y A;  1Q2D A;  2FSR A;  2PSW A;  2X7B A;  3QB8 A;  4C2Z A;  4JZ0 A;  1Y9K A;  3MN8 A;  3IWE A;  1MK4 A;  1IYL A;  1BPN A;  4IHM A;  4NGN A;  4CGO A;  1YME A;  4QBJ A;  7CPA A;  4YGO A;  4KUA A;  3D2P A;  1CP6 A;  1IID A;  3PRT A;  3RBU A;  3OWC A;  4A2Z A;  4RS2 A;  2FS5 A;  3TCV A;  1YSJ A;  1OZP A;  2RC4 A;  3SHP A;  2OZH A;  4LX9 A;  4XNH B;  4C2Y A;  1PCA A;  2AFX A;  2J8M A;  1AYE A;  3NE7 A;  2R98 A;  2PJA A;  4LUA A;  5LRJ A;  1XMB A;  2F5I A;  3R9G A;  2V8H A;  4P10 A;  2XEJ A;  4II9 A;  3R1K A;  4JD6 A;  3S9M A;  3LWU A;  4U9Z A;  4JXR A;  2QML A;  4M85 A;  4U5Y A;  2FIW A;  3IWW A;  3RYO A;  6CPA A;  4MHZ A;  4E2A A;  2PJB A;  4KS9 A;  4Q38 A;  2PJ7 A;  3D7F A;  2CNT A;  1B87 A;  2AFO A;  1L0C A;  4TWE A;  2R8V A;  4KVO E;  5AG4 A;  4UFW A;  2B4B A;  2VBQ A;  1FNO A;  2OZU A;  2WPX A;  3D8P A;  3NH4 A;  4FWU A;  4OC4 A;  1GYT A;  2GRE A;  1VHO A;  2NYQ A;  2FVG A;  2QJ8 A;  1NSL A;  3SI2 A;  4ZY2 A;  3VAT A;  2IJZ A;  2FT0 A;  2G3A A;  2ZPA A;  1XOV A;  1LRZ A;  3WR7 A;  4R7M A;  4BD9 A;  2FE7 A;  2R7H A;  4PK2 A;  2ANP A;  3WC5 A;  4XPK A;  4R57 A;  1NMT A;  4Q36 A;  4R6T A;  2JEV A;  4C2X A;  3IU1 A;  2Q04 A;  4R8F A;  1GHE A;  2CF4 A;  1X12 A;  3DSB A;  2I79 A;  1LAP A;  3H4Q A;  4CYQ A;  3H8E A;  5K8P A;  1K4J A;  3BI1 A;  1ZG8 A;  5D29 A;  1EE3 P;  2I00 A;  2FIA A;  1M4I A;  2D4P A;  4NGS A;  3B35 A;  3CXP A;  4Y49 B;  1QMU A;  1M1D A;  4BMH A;  2PJ2 A;  3TO6 A;  5AG7 A;  3HLP A;  2B58 A;  1B6B A;  4NGM A;  5IB0 A;  4KLW A;  1KUX A;  3S9N A;  1M44 A;  2ZEP A;  2J8N A;  4CAW A;  2WUU A;  3RZA A;  3KI9 A;  2D4O A;  4CGL A;  2BSW A;  4F8Z A;  5THW A;  3GYA A;  3GKR A;  3TO9 A;  2ZEO A;  1BPM A;  3G3S A;  5G1Z A;  4AVA A;  4CYP A;  2CIJ A;  2EWB A;  2JBK A;  5IX3 A;  4I49 A;  4MY0 A;  4FD5 A;  2AFU A;  4K3N A;  3FED A;  1XF8 A;  4DJL A;  1MJ9 A;  4F0X A;  4MCP A;  4WWV A;  3D3S A;  4NCZ A;  4CPA A;  3GY9 A;  3BI0 A;  3K9T A;  3D4U A;  3KZW A;  4CAV A;  2V77 A;  2YNC A;  3PP9 A;  3IO1 A;  4X2T A;  4U9Y A;  3SJG A;  4MHP A;  2ODF A;  1QQ9 A;  3JUW A;  4M6H A;  2IL4 A;  3TX8 A;  3S9L A;  5I0C A;  4ZY1 A;  2DPS A;  4MFJ A;  4A38 A;  1HDU A;  1M4G A;  5JQ4 A;  4KSA A;  1CPS A;  1S7L A;  2Q4Y A;  2PVW A;  3ZZI A;  1P4N A;  1A2Z A;  1P0H A;  4ZX9 A;  4KOY A;  5J8C A;  3CT9 A;  2YGW A;  3F0A A;  4UEE A;  3PEI A;  4XPD C;  4CAE A;  2Q0Y A;  3FEC A;  2BL1 A;  3D66 A;  4FUU A;  3WC7 A;  1F2O A;  3IC1 A;  4L89 A;  4FD6 A;  2O53 A;  3PBB A;  2AFM A;  4PXC A;  5K8O A;  3LD2 A;  2V8V A;  4OC5 A;  3F5B A;  1Z4E A;  2ZXV A;  4CYO A;  3GIU A;  3FEE A;  2JEW A;  1LOK A;  4O23 A;  5KTD A;  4YFJ A;  1ARL A;  4AB7 A;  4CYN A;  3JVN A;  3EFA A;  4NJR A;  3UY5 A;  4HNY B;  1LAN A;  3NE8 A;  3IIB A;  4F9U A;  2PIY A;  3GUX A;  1V0C A;  2HQY A;  5ELY A;  1QSM A;  2OB0 A;  2ZEG A;  2BUE A;  4C7H A;  4MXU A;  3B7I A;  1VIX A;  5H86 A;  1X10 A;  4A30 A;  4XPL A;  1KZF A;  2PJ4 A;  3KQZ A;  2ZEM A;  3GB0 A;  4TNU A;  4UCP A;  1S7F A;  1ELM P;  3CPA A;  2B4D A;  4H89 A;  2B5G A;  4NGR A;  4Q7A A;  4UWI A;  4A94 A;  4OME A;  3H8F A;  3GLJ A;  4UFX A;  3ZJ0 A;  2BCO A;  5K8N A;  4UCN A;  2GFQ A;  1S5K A;  3DR8 A;  4CAX A;  3JTK A;  4OLL A;  4ZBG A;  2YND A;  5CNP A;  1MJB A;  2CTB A;  3CXQ A;  4NJQ A;  4ZGY B;  2Z3N A;  4IAV A;  2ZEH A;  4FD4 A;  2HV2 A;  3BLN A;  4UEZ A;  4NGT A;  1Z4R A;  3FNC A;  4P4D A;  1YW4 A;  4B14 A;  1RXT A;  1VHE A;  2ZW5 A;  4G1P A;  1KWM A;  4PPZ A;  3DGV A;  3FRM A;  1BLL E;  3FX6 A;  3K9U A;  1IIC A;  2F8H A;  3B2Y A;  2JDD A;  3MRU A;  1Q7L A;  4MCS A;  3TC8 A;  1F2P A;  3H5Z A;  3MGD A;  1H8L A;  4C68 A;  5LRG A;  3S6F A;  4H6U A;  3SJF A;  1YQE A;  1BAV A;  3FYN A;  1YGH A;  4OC2 A;  4FBE A;  1Z5R A;  1LFW A;  4UIA A;  1XBU A;  4KVX A;  3LAC A;  1TF9 A;  3KKW A;  5F09 A;  3K2K A;  3VWD A;  1PU9 A;  4R87 A;  3VAR A;  1BO4 A;  4UBR A;  5LYD A;  2CTC A;  3IJ3 A;  3ISX A;  1ELL P;  2Q4Z A;  3QAH A;  4NXY A;  4ZX8 A;  1KUV A;  4UEF A;  4CS0 B;  1XMT A;  2PJ3 A;  2G3T A;  2VEZ A;  2JBJ A;  4ZYQ A;  2G9D A;  5G21 A;  3SXO A;  1I12 A;  1CM0 A;  5EMI A;  1VGY A;  2Q7B A;  4KOV A;  4AG7 A;  2B3V A;  3EY5 A;  5HXD A;  2Z10 A;  5ISV A;  4GXH A;  4B6Z A;  1S7N A;  4F9V A;  5H84 A;  1YRE A;  3DLJ A;  4XNH C;  5A27 A;  2ATR A;  2EUI A;  2QYV A;  2Z3M A;  4R76 A;  3B3W A;  3DDD A;  3WT4 A;  3EXN A;  4PXD A;  2DXQ A;  1Q2Y A;  1DTD A;  3JRU A;  4LQ6 A;  5AG6 A;  1S3Z A;  3B8G A;  5CPA A;  3TOA A;  3PB9 X;  2P0W A;  4MCR A;  1Y0R A;  3DNS A;  2ZOG A;  5G22 A;  4P4F A;  5JM6 A;  5HVF A;  4MBU A;  1LCP A;  5HMN A;  2ZEL A;  4OP4 A;  1YVO A;  2DF5 A;  4HNW B;  1M4D A;  2WSA A;  4GM5 A;  5KTC A;  2PJ0 A;  5IV0 A;  5F47 A;  2POK A;  3LMS A;  1CX8 A;  2A4N A;  4FAI A;  2B3U A;  4KOW A;  2QIR A;  2Q43 A;  2QEC A;  2AFS A;  5F46 A;  2OH1 A;  5LYL A;  1Y7R A;  4MRI A;  2PE3 A;  4UCM A;  1QSO A;  4FD7 A;  4B13 A;  2XEG A;  3I1U A;  3S6G A;  2GE3 A;  4P4B A;  3QNV A;  2VI7 A;  4OC0 A;  3R95 A;  3KL9 A;  1I1D A;  2WPW A;  1XRY A;  2BO9 A;  2EVN A;  1UWY A;  3NH5 A;  2ZEE A;  4BBH A;  1Z2L A;  2R1I A;  4B10 A;  4MJ8 A;  4JLY A;  2JDC A;  2NMT A;  2O28 A;  3IFE A;  1YK3 A;  4CGM A;  5C82 A;  4Y49 C;  1DE4 C;  2FCK A;  2HB6 A;  2PJ9 A;  4KOU A;  4WJB A;  4NFR A;  5EC4 A;  2VZZ A;  2FXF A;  1BOB A;  2OR4 A;  2ZOF A;  5I4M A;  1NSA A;  4P6Y A;  1IOF A;  5AG5 A;  4KUB A;  4C7I A;  2ZW4 A;  2Q7S A;  1M4L A;  2BOA A;  2V8D A;  3FF3 A;  2Y0M A;  2AE6 A;  1XFO A;  4K30 A;  3L2N A;  2PVV A;  2GIV A;  3D2M A;  5D8N A;  3HUV A;  2PJ1 A;  2Q44 A;  4OKO A;  3S6K A;  2P6G A;  1TKH A;  2Q4V A;  4UA3 A;  4QC6 A;  2KCW A;  4A32 A;  1WWZ A;  1IU8 A;  2PR8 A;  4DYO A;  2PR1 A;  4P4E A;  3T9Y A;  1IYK A;  4YRH A;  1QSN A;  4JYW A;  4MMO A;  4NSQ A;  4J3G A;  2IQ6 A;  3N5F A;  2DPT A;  1Z9U A;  1IY7 A;  1R57 A;  4JWP A;  3EO4 A;  1N71 A;  3VWE A;  2HC9 A;  4IK2 A;  3S6H A;  2PJ5 A;  4QVT A;  1CBX A;  3B3T A;  3PB4 X;  3T90 A;  2ABZ A;  3IWG A;  4A31 A;  3P2H A;  4Z65 A;  4A33 A;  3TFY A;  3B3V A; 
#chains in the Genus database with same CATH homology
 4MFQ A;  4MI4 A;  5BWA B;  2B4D B;  2B5G B;  2VXK A;  1Y9W A;  4KVM E;  1XEB A;  2HUZ A;  3PZJ A;  4CAF A;  4L8A A;  4AVB A;  3R96 A;  5J8F A;  4EVY A;  4B11 A;  4PV6 A;  5JPH A;  3CXS A;  3E0K A;  4JJX A;  1VHS A;  4PK3 A;  3TOB A;  4ORF A;  3IGR A;  1PUA A;  1FY7 A;  4R3K A;  4NEX A;  1YLE A;  3W91 A;  3TO7 A;  1U6M A;  2P6E A;  5F48 A;  1KUY A;  2JLM A;  4NF1 A;  5GCN A;  4OAE A;  5EBV A;  3TE4 A;  3DR6 A;  3G8W A;  4M3S A;  1YVK A;  2AJ6 A;  1IB1 E;  3IU2 A;  4H6Z A;  2Z11 A;  4A95 A;  4KSF A;  3LOD A;  4MFL A;  2BEI A;  3TT2 A;  4B5P A;  4KOT A;  1S60 A;  1YR0 A;  3I3G A;  4MFK A;  1WK4 A;  3I9S A;  4UFV A;  4B5O A;  4MFP A;  1YX0 A;  3C26 A;  4MY3 A;  1CJW A;  2OZG A;  2CY2 A;  5HH1 A;  3W6S A;  4E8O A;  3W6X A;  1XIX A;  4GS4 A;  4B5P B;  4DNC A;  2YNE A;  4RI1 A;  3TTH A;  4KOR A;  2PQ8 A;  5KTA A;  2Z3O A;  2GAN A;  2CNS A;  5G20 A;  1UFH A;  3SXN A;  3P2F A;  5A28 A;  4QB9 A;  3FBU A;  4AG9 A;  5E96 A;  3BJ8 A;  2VZY A;  2PC1 A;  2PDO A;  1Q2C A;  4E0A A;  4HKF A;  2OU2 A;  2PRB A;  2C27 A;  1SQH A;  2ARH A;  2H5M A;  1VKC A;  5FVJ A;  5DWN A;  2Z3L A;  1TIQ A;  1I21 A;  2G0B A;  4X5K A;  1J4J A;  2CNM A;  5AGE A;  4XPD B;  5C88 A;  1ON0 A;  2REE A;  3FIX A;  4MFZ A;  1NE9 A;  4CGN A;  2FL4 A;  4CGP A;  5F49 A;  2CXA A;  2K5T A;  2Z3K A;  4AVC A;  2REF A;  4F6A A;  4F0Y A;  2ZW6 A;  4KZT A;  3EC4 A;  4IF5 A;  4IUS A;  3PGP A;  4OAD A;  2Z0Z A;  3F8K A;  4KLV A;  2YNC C;  4CRY B;  4B12 A;  1XE4 A;  4PSW A;  2ZW7 A;  1MJA A;  3FB3 A;  4KOS A;  4HNX B;  4CRZ B;  1S7K A;  2P6F A;  4QUS A;  1QSR A;  1QST A;  4R3L A;  3R9F A;  1ZO0 A;  4R9M A;  4MHD A;  4JXQ A;  2Z3P A;  4KOX A;  4UWJ A;  1RO5 A;  3N7Z A;  4PSX A;  4ONU A;  3R9E A;  3V8I A;  3BJ7 A;  3A9L A;  2J8R A;  3FXT A;  2VQY A;  5DWM A;  1Q2D A;  2FSR A;  2PSW A;  2X7B A;  3QB8 A;  4C2Z A;  1Y9K A;  3IWE A;  1MK4 A;  1IYL A;  4CGO A;  4QBJ A;  4YGO A;  4KUA A;  3D2P A;  1IID A;  3OWC A;  4A2Z A;  4RS2 A;  2FS5 A;  3TCV A;  1OZP A;  2RC4 A;  3SHP A;  2OZH A;  4LX9 A;  4XNH B;  4C2Y A;  2J8M A;  3NE7 A;  2R98 A;  4LUA A;  3R9G A;  2F5I A;  4II9 A;  3R1K A;  4JD6 A;  4U9Z A;  4JXR A;  2QML A;  4M85 A;  4U5Y A;  2FIW A;  3RYO A;  4E2A A;  4KS9 A;  4Q38 A;  2CNT A;  1B87 A;  1L0C A;  2R8V A;  4KVO E;  5AG4 A;  4UFW A;  2B4B A;  2VBQ A;  2OZU A;  2WPX A;  3D8P A;  1NSL A;  2FT0 A;  2G3A A;  2ZPA A;  1LRZ A;  3WR7 A;  2FE7 A;  2R7H A;  4PK2 A;  4XPK A;  4R57 A;  1NMT A;  4Q36 A;  4C2X A;  2JEV A;  3IU1 A;  2Q04 A;  1GHE A;  3DSB A;  2I79 A;  4CYQ A;  3H4Q A;  1K4J A;  2FIA A;  2I00 A;  1M4I A;  2D4P A;  4Y49 B;  3CXP A;  4BMH A;  1M1D A;  3TO6 A;  5AG7 A;  2B58 A;  1B6B A;  5IB0 A;  4KLW A;  1KUX A;  1M44 A;  2J8N A;  4CAW A;  2WUU A;  2D4O A;  4CGL A;  2BSW A;  3GYA A;  3GKR A;  3TO9 A;  3G3S A;  5IX3 A;  4CYP A;  5G1Z A;  4AVA A;  4I49 A;  4MY0 A;  4FD5 A;  1XF8 A;  1MJ9 A;  4F0X A;  3D3S A;  4NCZ A;  3GY9 A;  4CAV A;  2YNC A;  3PP9 A;  4U9Y A;  3JUW A;  2IL4 A;  5I0C A;  2DPS A;  4MFJ A;  1M4G A;  5JQ4 A;  4KSA A;  1S7L A;  2Q4Y A;  3ZZI A;  1P4N A;  1P0H A;  4KOY A;  5J8C A;  2YGW A;  3F0A A;  4XPD C;  4CAE A;  2Q0Y A;  2BL1 A;  4L89 A;  4FD6 A;  3LD2 A;  3F5B A;  1Z4E A;  2ZXV A;  4CYO A;  5KTD A;  4YFJ A;  4AB7 A;  4CYN A;  3JVN A;  3EFA A;  3UY5 A;  4HNY B;  1V0C A;  2HQY A;  4C7H A;  1QSM A;  2OB0 A;  2BUE A;  5H86 A;  4A30 A;  4XPL A;  1KZF A;  4UCP A;  1S7F A;  4H89 A;  2B4D A;  2B5G A;  4UWI A;  4UFX A;  3ZJ0 A;  4UCN A;  3DR8 A;  1S5K A;  4CAX A;  3JTK A;  4OLL A;  4ZBG A;  2YND A;  5CNP A;  1MJB A;  3CXQ A;  4ZGY B;  2Z3N A;  4FD4 A;  2HV2 A;  3BLN A;  1Z4R A;  3FNC A;  4B14 A;  1RXT A;  2ZW5 A;  3FRM A;  3K9U A;  1IIC A;  2JDD A;  3H5Z A;  3MGD A;  4C68 A;  3S6F A;  4H6U A;  3FYN A;  1YGH A;  4KVX A;  3KKW A;  3VWD A;  1PU9 A;  4R87 A;  1BO4 A;  4UBR A;  3QAH A;  4NXY A;  1KUV A;  4CS0 B;  1XMT A;  2G3T A;  2VEZ A;  5G21 A;  3SXO A;  1I12 A;  1CM0 A;  2Q7B A;  4KOV A;  4AG7 A;  2B3V A;  3EY5 A;  2Z10 A;  5ISV A;  1S7N A;  5H84 A;  1YRE A;  4XNH C;  5A27 A;  2ATR A;  2EUI A;  2Z3M A;  3DDD A;  3EXN A;  2DXQ A;  1Q2Y A;  3TOA A;  5AG6 A;  1S3Z A;  3B8G A;  2P0W A;  3DNS A;  5G22 A;  4MBU A;  5HMN A;  1YVO A;  4HNW B;  1M4D A;  2WSA A;  5KTC A;  5IV0 A;  5F47 A;  2A4N A;  2B3U A;  4KOW A;  2QIR A;  2QEC A;  5F46 A;  2OH1 A;  1Y7R A;  4UCM A;  1QSO A;  4FD7 A;  4B13 A;  3S6G A;  2GE3 A;  2VI7 A;  3R95 A;  1I1D A;  2WPW A;  2EVN A;  4BBH A;  2R1I A;  4B10 A;  4MJ8 A;  4JLY A;  2JDC A;  2NMT A;  2O28 A;  1YK3 A;  4CGM A;  5C82 A;  4Y49 C;  2FCK A;  4KOU A;  5EC4 A;  2VZZ A;  2FXF A;  1BOB A;  5AG5 A;  4KUB A;  4C7I A;  2ZW4 A;  2Y0M A;  2AE6 A;  4K30 A;  2GIV A;  3D2M A;  2Q44 A;  3S6K A;  2P6G A;  2Q4V A;  4UA3 A;  4QC6 A;  2KCW A;  4A32 A;  1WWZ A;  2PR8 A;  2PR1 A;  3T9Y A;  1IYK A;  4YRH A;  1QSN A;  4NSQ A;  4J3G A;  2DPT A;  1Z9U A;  1R57 A;  4JWP A;  3EO4 A;  1N71 A;  3VWE A;  3S6H A;  4QVT A;  3T90 A;  4A31 A;  3IWG A;  3TFY A;  3P2H A;  4A33 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...