3MGDA

Crystal structure of predicted acetyltransferase with acetyl-coa from clostridium acetobutylicum at the resolution 1.9a, northeast structural genomics consortium target car165
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
153
structure length
153
Chain Sequence
MMNYRKADMKDISLLVSIRKRQLIDEGIEPNIDIDKELTRYFNNKLANNLLVEWIAEENNQIIATAAIAFIDFPPTYTNKTGRKGYITNMYTEPTSRGNGIATGMLDRLVNEAKERNIHKICLVASKLGRPVYKKYGFQDTDEWLELNLLEHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Predicted acetyltransferase
publication title Northeast Structural Genomics Consortium Target CaR165
rcsb
source organism Clostridium acetobutylicum
molecule tags Transferase
total genus 43
structure length 153
sequence length 153
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-04-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13508 Acetyltransf_7 Acetyltransferase (GNAT) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 3mgdA00
2BSWA 3FNCA 5IB0A 2B5GB 4II9A 1GHEA 4QVTA 3NE7A 4JXQA 2GE3A 2G3TA 2QECA 1YR0A 4KVOE 3CXSA 3H4QA 4XPLA 4PSWA 1NMTA 2J8RA 2VXKA 4R57A 2FS5A 2R1IA 4KOXA 3OWCA 2ARHA 2PQ8A 4IUSA 2K5TA 3EXNA 1I12A 5GCNA 3T90A 3S6FA 2P0WA 1XEBA 4UWIA 2QMLA 1YLEA 3FIXA 4QC6A 1IYKA 2P6GA 2VQYA 4FD7A 2O28A 1Q2DA 4CAVA 1S3ZA 2HQYA 1NE9A 2Z10A 3IGRA 3E0KA 1J4JA 2J8MA 2OZGA 1XIXA 5KTAA 2CY2A 3F5BA 1FY7A 4F6AA 3VWDA 3MGDA 5ISVA 1VHSA 1UFHA 5KTDA 2C27A 4ZBGA 2ATRA 1K4JA 3QAHA 2HUZA 2HV2A 5I0CA 2X7BA 4MI4A 5H86A 5F46A 1Y9KA 3DR6A 4X5KA 1KUXA 4OLLA 4U5YA 4FD6A 5CNPA 2R98A 2VI7A 2Q44A 2B5GA 2R7HA 3FB3A 1LRZA 3ZZIA 3G3SA 2Q7BA 3LODA 3SXNA 1YX0A 4BMHA 1S7LA 4MY3A 2ZW5A 3SHPA 2CNSA 5H84A 4HNYB 1Y7RA 1Y9WA 1KUVA 4NXYA 3PP9A 4CAXA 3D2PA 4MJ8A 2VZYA 3DNSA 1YK3A 2IL4A 3FXTA 3TO6A 3RYOA 4PK3A 4XNHC 5F49A 3TE4A 1MJAA 3KKWA 4CS0B 4KUBA 3EO4A 2RC4A 2FIWA 4R3LA 4QBJA 2EVNA 2OH1A 4LX9A 3TT2A 2JDDA 1WWZA 3R96A 4NCZA 3PZJA 2FL4A 3S6GA 5J8FA 2FE7A 1BOBA 1YREA 1I21A 3G8WA 1YVKA 4MHDA 2R8VA 2B3VA 2Q4YA 3V8IA 1RXTA 3P2HA 3S6KA 2BUEA 1Z9UA 3EFAA 4NEXA 2PSWA 2B4BA 3D3SA 1M4GA 4FD4A 2Y0MA 3TFYA 5EBVA 2I00A 4GS4A 4KVXA 2ZXVA 4ORFA 5F47A 4Y49C 4R3KA 5JQ4A 3DSBA 4AG7A 1S7NA 2J8NA 2ZPAA 5J8CA 3F0AA 4KVME 2KCWA 4B5PB 1SQHA 2P6EA 2ZW7A 2OU2A 3BJ8A 4KOWA 4CRZB 4KOTA 1N71A 5FVJA 4KOVA 3EY5A 4PK2A 2VBQA 3S6HA 4H6ZA 3EC4A 4PSXA 3SXOA 5EC4A 1M4DA 1S7KA 3CXQA 5IV0A 2REEA 3F8KA 4KOUA 1I1DA 4R87A 3BJ7A 4AG9A 1M1DA 3WR7A 2PR8A 3FYNA 4DNCA 1QSRA 2REFA 3I3GA 5KTCA 4KUAA 3R9FA 1S7FA 4XPDB 2JDCA 3BLNA 3IWGA 1XMTA 4HKFA 4QUSA 1QSOA 1XE4A 1P4NA 3JVNA 4IF5A 2D4PA 5IX3A 3PGPA 1BO4A 2CNMA 3DDDA 3TO7A 4UWJA 4EVYA 2EUIA 2WPWA 4J3GA 1TIQA 1P0HA 2P6FA 2FSRA 4UBRA 1U6MA 2BL1A 4B5PA 3R1KA 4KOSA 1WK4A 5C88A 2OB0A 3W91A 1Q2CA 1PUAA 4OAEA 3FBUA 4R9MA 4AVAA 4JXRA 4E2AA 3GYAA 4KZTA 2CNTA 1Z4EA 4AVBA 2JEVA 1ON0A 2A4NA 1XF8A 2AE6A 4NSQA 1S60A 2ZW6A 2NMTA 5DWMA 2F5IA 3K9UA 1B6BA 2FIAA 1V0CA 1Z4RA 4H6UA 4E0AA 1MJBA 4LUAA 3TTHA 2BEIA 2Z11A 2Z0ZA 4M85A 3QB8A 1MK4A 4I49A 4NF1A 2VEZA 1IB1E 2FCKA 4UA3A 3TOAA 4U9YA 2B4DB 4FD5A 2QIRA 2OZHA 3ZJ0A 1PU9A 4PV6A 5F48A 1IICA 1M4IA 5DWNA 4K30A 3CXPA 5E96A 1S5KA 2I79A 4RI1A 4YRHA 3TO9A 4MBUA 5HH1A 4JD6A 1IYLA 4QB9A 2D4OA 2GIVA 1NSLA 2JLMA 1CJWA 3N7ZA 1OZPA 4ONUA 3UY5A 5C82A 2PC1A 4JLYA 3D8PA 3P2FA 1RO5A 4HNXB 2Q04A 4HNWB 3R9GA 1M44A 4B5OA 3VWEA 4AVCA 3B8GA 2G0BA 3GY9A 2FXFA 2PDOA 4MY0A 4H89A 2OZUA 4CRYB 4OADA 1B87A 1QSTA 2DXQA 4U9ZA 4YFJA 2G3AA 4AB7A 4XPDC 3I9SA 1QSMA 1KZFA 1YGHA 4KOYA 1QSNA 1KUYA 1YVOA 3JUWA 3R95A 2FT0A 4M3SA 2Q4VA 2B4DA 2Q0YA 4XNHB 2AJ6A 3C26A 1MJ9A 2B58A 4L89A 4XPKA 2B3UA 1L0CA 3W6XA 3W6SA 3TCVA 2GANA 4L8AA 4F0YA 3TOBA 2VZZA 4CAWA 4RS2A 3DR8A 1R57A 2ZW4A 5HMNA 4JJXA 1VKCA 4JWPA 5JPHA 4YGOA 2H5MA 3GKRA 1IIDA 3D2MA 1CM0A 1Q2YA 3T9YA 3FRMA 3LD2A 3R9EA 4KORA 4KLVA 2PRBA 4KLWA 2PR1A 2WPXA 4E8OA 4Y49B
chains in the Genus database with same CATH superfamily
2BSWA 3FNCA 3KHZA 3A9LA 4MFKA 5IB0A 2ABZA 1UWYA 2B5GB 2F8HA 4II9A 1GHEA 1YW6A 4B6ZA 4MMOA 4NGRA 4QVTA 3NE7A 4DUKA 4JXQA 3D7FA 2GE3A 4ZX9A 5LRJA 2G3TA 3L2NA 4X3RA 2QECA 2PE3A 1YR0A 4KVOE 3CXSA 3H4QA 3NA6A 2WZNA 4OMEA 4XPLA 1HEEA 4PSWA 1NMTA 2GREA 2J8RA 4Q7AA 2VXKA 4R57A 2O4HA 3SJGA 2FS5A 4ZYQA 2C6GA 3GIUA 4OC3A 4MHPA 3SJFA 2R1IA 4KOXA 5A27A 4OC4A 1Z8LA 4CAFA 2PJ0A 3OWCA 2ARHA 2PQ8A 4NGQA 4OC2A 2DEAA 3KR5A 4IUSA 3HLPA 2K5TA 3BI0A 1Y0YA 1Z5RA 3EXNA 3PFEA 5JM6A 1I12A 5GCNA 3T90A 3FX6A 4C2XA 1LCPA 1ARLA 1ZLHA 4NGTA 2Z3KA 3S6FA 2AFWA 2P0WA 1XEBA 4UWIA 2QMLA 1YLEA 2CTCA 3D7GA 2IMOA 1IOFA 1IYKA 2P6GA 3FIXA 4QC6A 2VQYA 1TF8A 1AUGA 2O53A 4FD7A 2O28A 4FWUA 4NGNA 1Q2DA 5LRGA 4CAVA 2POKA 1S3ZA 4WWVA 4UFXA 4KS9A 2HQYA 1NE9A 2Z10A 3BI1A 3JRUA 3E0KA 3IGRA 2JBJA 1J4JA 2J8MA 2OZGA 4CPAA 3B3TA 4CYQA 4P45A 4MCRA 2Q43A 1XIXA 2GFQA 5KTAA 2CY2A 3F5BA 3S9LA 5JGFA 2PJ8A 3TX8A 3WT4A 1FY7A 4A37A 4UFVA 4A30A 4F6AA 3VWDA 1LANA 2GLJA 3MGDA 5ISVA 1VHSA 4R8FA 1UFHA 4B12A 2C27A 5KTDA 4C7IA 4ZBGA 2ATRA 1K4JA 4K3NA 3QAHA 2Z3OA 4X8IA 3B35A 1ARMA 2HUZA 2HC9A 2PCUA 4UEEA 2ZEEA 4ZY1A 2PVWA 4P4FA 5D8NA 2HV2A 3D67A 5I0CA 2X7BA 5EMIA 4MI4A 4P4JA 5H86A 5F46A 1Y9KA 3DR6A 4X5KA 1KUXA 2EBJA 4OLLA 4FD6A 4LQ6A 4U5YA 2R98A 2VI7A 4UFWA 5CNPA 5LYIA 2HB6A 2YNCA 2Q44A 2B5GA 2R7HA 3FB3A 1LRZA 4JZ0A 3ZZIA 2QVPA 1F57A 2Q51A 2PJ1A 3G3SA 3LODA 3GUXA 4H2KA 4NGMA 2Q7BA 3SXNA 4B13A 1YX0A 5I4MA 1HDUA 1NSAA 1Q7LA 4BMHA 4DYOA 1OBRA 1S7LA 1YLOA 4MY3A 4M6HA 4C68A 2ZW5A 3GB0A 3SHPA 3JTKA 3KGQA 4FBEA 2CNSA 5H84A 4HNYB 2PJCA 3B2YA 3SI0A 1Y7RA 1Y9WA 2PJ5A 1KUVA 2GU2A 2ZEOA 3PP9A 2V77A 4NXYA 3KZWA 4CAXA 3D2PA 4MJ8A 2VZYA 4A32A 4ZGYB 5F09A 2ZEMA 3DNSA 1IU8A 1YK3A 2IL4A 4NJQA 3FXTA 3TO6A 3RYOA 3BXMA 2PJBA 4PK3A 4PXCA 3PB9X 4XNHC 4C2ZA 5F49A 2ZENA 3TE4A 3MRUA 1MJAA 4UF4A 3KKWA 2AFSA 2PVVA 4Q38A 4CS0B 2ZEHA 1VGYA 4KUBA 3EO4A 2RC4A 2FIWA 3I1UA 2XEFA 4R3LA 4QBJA 2EVNA 2AFXA 2OH1A 4LX9A 2EO8A 2JDDA 4R76A 1WWZA 3TT2A 2PIYA 4CGOA 3R96A 3B3VA 4NCZA 3CT9A 1X10A 2FVGA 3WC5A 3PZJA 2QYVA 3IEHA 1FNOA 5HVFA 4DJLA 2FL4A 3KHXA 3S6GA 5J8FA 2FE7A 3QNVA 1BOBA 1YREA 5G21A 3SI1A 1I21A 3G8WA 1YVKA 4MHDA 4KSIA 2R8VA 4KSFA 2B3VA 5BWAB 2Q4YA 3V8IA 3FJUA 2OOTA 1RXTA 3P2HA 3S6KA 2BUEA 1Z9UA 3EFAA 4NEXA 2PSWA 4OC1A 3D7DA 5K8MA 3D66A 2B4BA 5CBMA 1IGBA 3D3SA 1M4GA 3KR4A 4FD4A 2Q4ZA 2Y0MA 3TFYA 1Z8WA 1CX8A 1ZG7A 5EBVA 2I00A 3WC7A 3FH4A 2XEIA 5JH9A 5K8PA 4GS4A 4KVXA 4IAVA 2ZXVA 3H5ZA 4ORFA 4MHYA 5F47A 4Y49C 4R3KA 5JQ4A 3VARA 5J1QA 3DSBA 2YNCC 3FECA 4AG7A 1ELLP 1S7NA 2XEJA 2J8NA 2ZPAA 5J8CA 3F0AA 3S9MA 3SJXA 4KVME 2KCWA 4B5PB 1LAMA 1SQHA 2ZEPA 2P6EA 2VL1A 2IQ6A 4BD9A 1A2ZA 2ZW7A 3IIBA 3IU2A 2OU2A 3BJ8A 4OC0A 4KOWA 4EMEA 4CRZB 4KOTA 2NSMA 5D29A 4CGPA 1BPNA 1N71A 5FVJA 4UIAA 4MHNA 4KOVA 3EY5A 5IB9A 2C6CA 3FVLA 5HVHA 4PK2A 2VBQA 1ELMP 3PEIA 4H6ZA 3S6HA 2GLFA 2AFUA 3EC4A 1QMUA 1CP6A 4PSXA 3SXOA 5EC4A 1M4DA 1S7KA 2G9DA 3K2KA 3CXQA 3VATA 5IV0A 2REEA 2PJ2A 3NE8A 4CYOA 5LRKA 3F8KA 4KOUA 1FT7A 1I1DA 4P10A 4B10A 3B3CA 1CPXA 4R87A 2WUUA 1M4LA 3BJ7A 4AG9A 1M1DA 3WR7A 4AXVA 2IJZA 2PR8A 3FYNA 1F2OA 2OR4A 2RFHA 3CDXA 4DNCA 3GLJA 1QSRA 2REFA 3KQZA 2ZEFA 3LWUA 5CPAA 3I3GA 5KTCA 3BHXA 4ZX8A 6CPAA 2J9AA 4KUAA 3R9FA 1S7FA 7CPAA 4XPDB 4CAEA 4MCPA 2JDCA 3BLNA 4F8ZA 1TKHA 4MHZA 2CF4A 3IWGA 1CP7A 1DTDA 1XBUA 3T8WA 3IFEA 1YMEA 1XMTA 2PJ3A 1YSJA 4OC5A 4WJBA 4HKFA 3PRTA 4QUSA 4Z65A 3SI2A 3RAMA 1QSOA 1XE4A 2C1CA 1P4NA 3JVNA 4CYPA 4IF5A 2D4PA 1TKFA 1VHEA 5IX3A 3PGPA 1BO4A 2CNMA 2V8VA 5G20A 3DDDA 3S9NA 4FAIA 3TO7A 4IHMA 1PYTB 3DLJA 4UWJA 4CYNA 4EVYA 2EUIA 4MFZA 4UIBA 2ODFA 2WPWA 4J3GA 4MFPA 3NH8A 1TIQA 3TC8A 3IJ3A 3LACA 1P0HA 4C7HA 4F0XA 2P6FA 3CPAA 4B11A 4PPZA 3NH4A 2BOAA 2FSRA 4M6IA 3RNZA 4UBRA 1U6MA 2BL1A 1F2PA 3QAYA 4B5PA 4CGLA 2EK8A 2I3CA 3R1KA 4P4IA 2Q7SA 4KOSA 2F7VA 3LMSA 4MXUA 4ONWA 1WK4A 4PXEA 4CGMA 2OB0A 1XRYA 1HDQA 4MCSA 3RBUA 3W91A 1Z8TA 1Q2CA 5C88A 1PUAA 4YU9A 2DPTA 3V38A 4W9YA 4OAEA 4RN7A 3FBUA 4R9MA 4AVAA 4JXRA 4TNUA 1R43A 3GYAA 4E2AA 1IY7A 3IWWA 4KZTA 2CNTA 3FEEA 1Z4EA 4AVBA 2JEVA 1XMBA 1ON0A 4PXBA 2A4NA 4UCPA 5G1ZA 1H8LA 3IWEA 1XF8A 2AE6A 1XJOA 1LAPA 4NSQA 1S60A 2ZW6A 2Z3LA 2NMTA 4EFDA 1X12A 2F5IA 5DWMA 4A95A 3PB8X 3K9UA 1Z8XA 1B6BA 2FIAA 4NGPA 2ANPA 3PBBA 4A38A 1V0CA 8CPAA 5HVGA 1LOKA 1Z4RA 3B7IA 5AG6A 4H6UA 4E0AA 2ZOFA 2YNDA 3PBEA 1MJBA 2DF5A 3H8FA 4LUAA 4P4BA 3TTHA 2BEIA 3FEDA 2WSAA 2Z11A 2RB7A 2Z0ZA 3WABA 4M85A 3QB8A 2PJ7A 1MK4A 4I49A 2YNEA 4OKOA 4YWYA 4NF1A 3NFZA 3D4UA 2VEZA 1IB1E 2FCKA 4UA3A 3TOAA 4U9YA 2B4DB 4FD5A 2QIRA 2OZHA 3ZJ0A 1PU9A 4PV6A 5ELYA 5F48A 1IICA 1M4IA 2CXAA 4K30A 5DWNA 3CXPA 5E96A 3V7ZA 4M6GA 1S5KA 2I79A 2ZEDA 4RI1A 1IOIA 3KASA 1R3NA 3B3WA 4P4EA 4YRHA 3TO9A 4MBUA 5AG5A 3D68A 5HH1A 2BCOA 3SJEA 4ZY0A 2PJ6A 1Y7EA 4JD6A 4A39A 1XFOA 1IYLA 4QB9A 2D4OA 2ZEGA 2GIVA 3K9TA 4RUHA 2NYQA 1RTQA 2JLMA 5G22A 1NSLA 4C2YA 2EWBA 1CJWA 5K8NA 3N7ZA 1OZPA 1ZG8A 3H8GA 4ONUA 4HPSA 4LQGA 4UEZA 3UY5A 1VHOA 4NJRA 1VIXA 5AGEA 1AYEA 4OP4A 5C82A 2PC1A 4JLYA 3D8PA 2V8GA 3P2FA 1DE4C 2ZOGA 4MFQA 5THWA 5HXDA 1ZO0A 2CIJA 4UEFA 1TF9A 1LFWA 1CG2A 1RO5A 4MRIA 4HNXB 1ZG9A 1BPMA 5LYDA 4G1PA 4BBHA 3B3SA 4P6YA 4FUUA 4EWTA 4TWEA 1Z2LA 4A94A 2Q04A 3FF3A 4HNWB 3R9GA 1M44A 2JBKA 1JQGA 4P4DA 4B5OA 4R6TA 4B14A 4NGSA 3VWEA 4AVCA 3B8GA 2G0BA 3GY9A 2FXFA 2PDOA 4MY0A 5DS0A 2XEGA 4H89A 4PQAA 2OZUA 4CRYB 3HUVA 4KSAA 4OADA 2AFOA 1CPSA 1B87A 1QSTA 4PXDA 4P44A 4GM5A 2DXQA 3PB7X 4U9ZA 4YFJA 2G3AA 4AB7A 5AG4A 3N5FA 4XPDC 3I9SA 1QSMA 4ZY2A 1KZFA 1YGHA 4KOYA 4A31A 4Q36A 1YQEA 1QSNA 1KUYA 3PB4X 4MCQA 4X2TA 3RZAA 1YVOA 1TKJA 4OIDA 3JUWA 3IO1A 3NH5A 3R95A 2FT0A 4M3SA 1BAVA 2PJ4A 2Q4VA 5LYLA 2Z3NA 2B4DA 1QQ9A 3IC1A 2Q0YA 4XNHB 2AJ6A 3DGVA 1YW4A 1Y0RA 3C26A 4GXHA 1MJ9A 2B58A 3H8EA 3ISZA 4L89A 4XPKA 2B3UA 2CTBA 2PJAA 1L0CA 4MFJA 3W6XA 3MN8A 2V8HA 2Z3MA 2BO9A 3W6SA 3TCVA 5LYFA 1CBXA 3RO0A 5K8OA 2GANA 4L8AA 3VH9A 3TOBA 4A33A 4F0YA 3CZXA 1KWMA 2VZZA 3PB6X 1JWQA 2V8DA 3CPXA 4CGNA 4CAWA 4RS2A 3DR8A 4IK2A 1R57A 2PRQA 2ZW4A 5HMNA 1BLLE 4JJXA 1GYTA 3WC6A 3IU1A 4UCMA 1VKCA 3KL9A 2AFMA 3KI9A 3FMCA 4JWPA 5JPHA 2DPSA 4YGOA 2H5MA 2C6PA 2PIZA 3GKRA 1IIDA 3D2MA 2JEWA 3ISXA 3PFOA 5A28A 4F9VA 2EK9A 1TXRA 4O23A 2AFZA 4A2ZA 1CM0A 1PCAA 1Q2YA 4MFLA 1ZLIA 4UCNA 3T9YA 4F9UA 2WYRA 3FRMA 3LD2A 2YGWA 4BINA 2QJ8A 4OIWA 3R9EA 3KQXA 3D7HA 4ZI6A 1AMPA 4KORA 1XOVA 4KLVA 2PJ9A 4NFRA 2PRBA 4R7MA 4JYWA 4KLWA 2PR1A 2WPXA 2Z3PA 5AG7A 4E8OA 1EE3P 4Y49B 2ZELA
chains in the Genus database with same CATH topology
2BSWA 3FNCA 3A9LA 4MFKA 5IB0A 2B5GB 4II9A 1GHEA 4QVTA 3NE7A 4JXQA 2GE3A 2G3TA 2QECA 1YR0A 4KVOE 3CXSA 3H4QA 4XPLA 4PSWA 1NMTA 2J8RA 2VXKA 4R57A 2FS5A 2R1IA 4KOXA 5A27A 4CAFA 3OWCA 2ARHA 2PQ8A 4IUSA 2K5TA 3EXNA 1I12A 5GCNA 3T90A 4C2XA 2Z3KA 3S6FA 2P0WA 1XEBA 4UWIA 2QMLA 1YLEA 3FIXA 4QC6A 1IYKA 2P6GA 2VQYA 4FD7A 2O28A 1Q2DA 4CAVA 1S3ZA 4UFXA 4KS9A 2HQYA 1NE9A 2Z10A 3E0KA 3IGRA 1J4JA 2J8MA 2OZGA 4CYQA 1XIXA 5KTAA 2CY2A 3F5BA 1FY7A 4UFVA 4A30A 4F6AA 3VWDA 3MGDA 5ISVA 1VHSA 1UFHA 4B12A 2C27A 5KTDA 4C7IA 4ZBGA 2ATRA 1K4JA 3QAHA 2Z3OA 2HUZA 2HV2A 5I0CA 2X7BA 4MI4A 5H86A 5F46A 1Y9KA 3DR6A 4X5KA 1KUXA 4OLLA 4U5YA 4FD6A 5CNPA 2R98A 2VI7A 4UFWA 2YNCA 2Q44A 2B5GA 2R7HA 3FB3A 1LRZA 3ZZIA 3G3SA 2Q7BA 3LODA 3SXNA 4B13A 1YX0A 4BMHA 1S7LA 4MY3A 4C68A 2ZW5A 3SHPA 3JTKA 2CNSA 5H84A 4HNYB 1Y7RA 1Y9WA 1KUVA 4NXYA 3PP9A 4CAXA 3D2PA 4MJ8A 2VZYA 4A32A 4ZGYB 3DNSA 1YK3A 2IL4A 3FXTA 3TO6A 3RYOA 4PK3A 4XNHC 4C2ZA 5F49A 3TE4A 1MJAA 3KKWA 4Q38A 4CS0B 4KUBA 3EO4A 2RC4A 2FIWA 4R3LA 4QBJA 2EVNA 2OH1A 4LX9A 3TT2A 2JDDA 1WWZA 4CGOA 3R96A 4NCZA 3PZJA 2FL4A 3S6GA 5J8FA 2FE7A 5G21A 1BOBA 1YREA 1I21A 3G8WA 1YVKA 4MHDA 2R8VA 4KSFA 2B3VA 5BWAB 2Q4YA 3V8IA 1RXTA 3P2HA 3S6KA 2BUEA 1Z9UA 3EFAA 4NEXA 2PSWA 2B4BA 3D3SA 1M4GA 4FD4A 2Y0MA 3TFYA 5EBVA 2I00A 4GS4A 4KVXA 2ZXVA 3H5ZA 4ORFA 5F47A 4Y49C 4R3KA 5JQ4A 3DSBA 2YNCC 4AG7A 1S7NA 2J8NA 2ZPAA 5J8CA 3F0AA 4KVME 2KCWA 4B5PB 1SQHA 2P6EA 2ZW7A 3IU2A 2OU2A 3BJ8A 4KOWA 4CRZB 4KOTA 4CGPA 1N71A 5FVJA 4KOVA 3EY5A 4PK2A 2VBQA 3S6HA 4H6ZA 3EC4A 4PSXA 3SXOA 5EC4A 1M4DA 1S7KA 3CXQA 5IV0A 2REEA 4CYOA 3F8KA 4KOUA 1I1DA 4B10A 4R87A 2WUUA 3BJ7A 4AG9A 1M1DA 3WR7A 2PR8A 3FYNA 4DNCA 1QSRA 2REFA 3I3GA 5KTCA 4KUAA 3R9FA 1S7FA 4XPDB 4CAEA 2JDCA 3BLNA 3IWGA 1XMTA 4HKFA 4QUSA 1QSOA 1XE4A 1P4NA 3JVNA 4CYPA 4IF5A 2D4PA 5IX3A 3PGPA 1BO4A 2CNMA 5G20A 3DDDA 3TO7A 4CYNA 4UWJA 4EVYA 2EUIA 4MFZA 2WPWA 4J3GA 4MFPA 1TIQA 1P0HA 4C7HA 4F0XA 2P6FA 4B11A 2FSRA 4UBRA 1U6MA 2BL1A 4B5PA 4CGLA 3R1KA 4KOSA 1WK4A 4CGMA 2OB0A 3W91A 5C88A 1Q2CA 1PUAA 2DPTA 4OAEA 3FBUA 4R9MA 4AVAA 4JXRA 4E2AA 3GYAA 4KZTA 2CNTA 1Z4EA 4AVBA 2JEVA 1ON0A 2A4NA 4UCPA 5G1ZA 3IWEA 1XF8A 2AE6A 4NSQA 1S60A 2ZW6A 2Z3LA 2NMTA 5DWMA 2F5IA 4A95A 3K9UA 1B6BA 2FIAA 1V0CA 1Z4RA 5AG6A 4H6UA 4E0AA 2YNDA 1MJBA 4LUAA 3TTHA 2BEIA 2WSAA 2Z11A 2Z0ZA 4M85A 3QB8A 1MK4A 4I49A 2YNEA 4NF1A 2VEZA 1IB1E 2FCKA 4UA3A 3TOAA 4U9YA 2B4DB 4FD5A 2QIRA 2OZHA 3ZJ0A 1PU9A 4PV6A 5F48A 1IICA 1M4IA 2CXAA 4K30A 5DWNA 3CXPA 5E96A 1S5KA 2I79A 4RI1A 4YRHA 3TO9A 4MBUA 5AG5A 5HH1A 4JD6A 1IYLA 4QB9A 2D4OA 2GIVA 5G22A 1NSLA 2JLMA 4C2YA 1CJWA 3N7ZA 1OZPA 4ONUA 3UY5A 5AGEA 5C82A 2PC1A 4JLYA 3D8PA 3P2FA 4MFQA 1ZO0A 1RO5A 4HNXB 4BBHA 2Q04A 4HNWB 3R9GA 1M44A 4B5OA 4B14A 3VWEA 4AVCA 3B8GA 2G0BA 3GY9A 2FXFA 2PDOA 4MY0A 4H89A 2OZUA 4CRYB 4KSAA 4OADA 1B87A 1QSTA 2DXQA 4U9ZA 4YFJA 2G3AA 4AB7A 5AG4A 4XPDC 3I9SA 1QSMA 1KZFA 1YGHA 4KOYA 4A31A 4Q36A 1QSNA 1KUYA 1YVOA 3JUWA 3R95A 2FT0A 4M3SA 2Q4VA 2Z3NA 2B4DA 2Q0YA 4XNHB 2AJ6A 3C26A 1MJ9A 2B58A 4L89A 4XPKA 2B3UA 1L0CA 4MFJA 3W6XA 3W6SA 2Z3MA 3TCVA 2GANA 4L8AA 4F0YA 3TOBA 4A33A 2VZZA 4CGNA 4CAWA 4RS2A 3DR8A 1R57A 2ZW4A 5HMNA 4JJXA 3IU1A 4UCMA 1VKCA 4JWPA 5JPHA 2DPSA 4YGOA 2H5MA 3GKRA 1IIDA 3D2MA 5A28A 4A2ZA 1CM0A 4MFLA 1Q2YA 4UCNA 3T9YA 3FRMA 3LD2A 2YGWA 3R9EA 4KORA 4KLVA 2PRBA 4KLWA 2PR1A 2WPXA 2Z3PA 5AG7A 4E8OA 4Y49B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BSW A;  3FNC A;  5IB0 A;  2B5G B;  4II9 A;  1GHE A;  4QVT A;  3NE7 A;  4JXQ A;  2GE3 A;  2G3T A;  2QEC A;  1YR0 A;  4KVO E;  3CXS A;  3H4Q A;  4XPL A;  4PSW A;  1NMT A;  2J8R A;  2VXK A;  4R57 A;  2FS5 A;  2R1I A;  4KOX A;  3OWC A;  2ARH A;  2PQ8 A;  4IUS A;  2K5T A;  3EXN A;  1I12 A;  5GCN A;  3T90 A;  3S6F A;  2P0W A;  1XEB A;  4UWI A;  2QML A;  1YLE A;  3FIX A;  4QC6 A;  1IYK A;  2P6G A;  2VQY A;  4FD7 A;  2O28 A;  1Q2D A;  4CAV A;  1S3Z A;  2HQY A;  1NE9 A;  2Z10 A;  3IGR A;  3E0K A;  1J4J A;  2J8M A;  2OZG A;  1XIX A;  5KTA A;  2CY2 A;  3F5B A;  1FY7 A;  4F6A A;  3VWD A;  3MGD A;  5ISV A;  1VHS A;  1UFH A;  5KTD A;  2C27 A;  4ZBG A;  2ATR A;  1K4J A;  3QAH A;  2HUZ A;  2HV2 A;  5I0C A;  2X7B A;  4MI4 A;  5H86 A;  5F46 A;  1Y9K A;  3DR6 A;  4X5K A;  1KUX A;  4OLL A;  4U5Y A;  4FD6 A;  5CNP A;  2R98 A;  2VI7 A;  2Q44 A;  2B5G A;  2R7H A;  3FB3 A;  1LRZ A;  3ZZI A;  3G3S A;  2Q7B A;  3LOD A;  3SXN A;  1YX0 A;  4BMH A;  1S7L A;  4MY3 A;  2ZW5 A;  3SHP A;  2CNS A;  5H84 A;  4HNY B;  1Y7R A;  1Y9W A;  1KUV A;  4NXY A;  3PP9 A;  4CAX A;  3D2P A;  4MJ8 A;  2VZY A;  3DNS A;  1YK3 A;  2IL4 A;  3FXT A;  3TO6 A;  3RYO A;  4PK3 A;  4XNH C;  5F49 A;  3TE4 A;  1MJA A;  3KKW A;  4CS0 B;  4KUB A;  3EO4 A;  2RC4 A;  2FIW A;  4R3L A;  4QBJ A;  2EVN A;  2OH1 A;  4LX9 A;  3TT2 A;  2JDD A;  1WWZ A;  3R96 A;  4NCZ A;  3PZJ A;  2FL4 A;  3S6G A;  5J8F A;  2FE7 A;  1BOB A;  1YRE A;  1I21 A;  3G8W A;  1YVK A;  4MHD A;  2R8V A;  2B3V A;  2Q4Y A;  3V8I A;  1RXT A;  3P2H A;  3S6K A;  2BUE A;  1Z9U A;  3EFA A;  4NEX A;  2PSW A;  2B4B A;  3D3S A;  1M4G A;  4FD4 A;  2Y0M A;  3TFY A;  5EBV A;  2I00 A;  4GS4 A;  4KVX A;  2ZXV A;  4ORF A;  5F47 A;  4Y49 C;  4R3K A;  5JQ4 A;  3DSB A;  4AG7 A;  1S7N A;  2J8N A;  2ZPA A;  5J8C A;  3F0A A;  4KVM E;  2KCW A;  4B5P B;  1SQH A;  2P6E A;  2ZW7 A;  2OU2 A;  3BJ8 A;  4KOW A;  4CRZ B;  4KOT A;  1N71 A;  5FVJ A;  4KOV A;  3EY5 A;  4PK2 A;  2VBQ A;  3S6H A;  4H6Z A;  3EC4 A;  4PSX A;  3SXO A;  5EC4 A;  1M4D A;  1S7K A;  3CXQ A;  5IV0 A;  2REE A;  3F8K A;  4KOU A;  1I1D A;  4R87 A;  3BJ7 A;  4AG9 A;  1M1D A;  3WR7 A;  2PR8 A;  3FYN A;  4DNC A;  1QSR A;  2REF A;  3I3G A;  5KTC A;  4KUA A;  3R9F A;  1S7F A;  4XPD B;  2JDC A;  3BLN A;  3IWG A;  1XMT A;  4HKF A;  4QUS A;  1QSO A;  1XE4 A;  1P4N A;  3JVN A;  4IF5 A;  2D4P A;  5IX3 A;  3PGP A;  1BO4 A;  2CNM A;  3DDD A;  3TO7 A;  4UWJ A;  4EVY A;  2EUI A;  2WPW A;  4J3G A;  1TIQ A;  1P0H A;  2P6F A;  2FSR A;  4UBR A;  1U6M A;  2BL1 A;  4B5P A;  3R1K A;  4KOS A;  1WK4 A;  5C88 A;  2OB0 A;  3W91 A;  1Q2C A;  1PUA A;  4OAE A;  3FBU A;  4R9M A;  4AVA A;  4JXR A;  4E2A A;  3GYA A;  4KZT A;  2CNT A;  1Z4E A;  4AVB A;  2JEV A;  1ON0 A;  2A4N A;  1XF8 A;  2AE6 A;  4NSQ A;  1S60 A;  2ZW6 A;  2NMT A;  5DWM A;  2F5I A;  3K9U A;  1B6B A;  2FIA A;  1V0C A;  1Z4R A;  4H6U A;  4E0A A;  1MJB A;  4LUA A;  3TTH A;  2BEI A;  2Z11 A;  2Z0Z A;  4M85 A;  3QB8 A;  1MK4 A;  4I49 A;  4NF1 A;  2VEZ A;  1IB1 E;  2FCK A;  4UA3 A;  3TOA A;  4U9Y A;  2B4D B;  4FD5 A;  2QIR A;  2OZH A;  3ZJ0 A;  1PU9 A;  4PV6 A;  5F48 A;  1IIC A;  1M4I A;  5DWN A;  4K30 A;  3CXP A;  5E96 A;  1S5K A;  2I79 A;  4RI1 A;  4YRH A;  3TO9 A;  4MBU A;  5HH1 A;  4JD6 A;  1IYL A;  4QB9 A;  2D4O A;  2GIV A;  1NSL A;  2JLM A;  1CJW A;  3N7Z A;  1OZP A;  4ONU A;  3UY5 A;  5C82 A;  2PC1 A;  4JLY A;  3D8P A;  3P2F A;  1RO5 A;  4HNX B;  2Q04 A;  4HNW B;  3R9G A;  1M44 A;  4B5O A;  3VWE A;  4AVC A;  3B8G A;  2G0B A;  3GY9 A;  2FXF A;  2PDO A;  4MY0 A;  4H89 A;  2OZU A;  4CRY B;  4OAD A;  1B87 A;  1QST A;  2DXQ A;  4U9Z A;  4YFJ A;  2G3A A;  4AB7 A;  4XPD C;  3I9S A;  1QSM A;  1KZF A;  1YGH A;  4KOY A;  1QSN A;  1KUY A;  1YVO A;  3JUW A;  3R95 A;  2FT0 A;  4M3S A;  2Q4V A;  2B4D A;  2Q0Y A;  4XNH B;  2AJ6 A;  3C26 A;  1MJ9 A;  2B58 A;  4L89 A;  4XPK A;  2B3U A;  1L0C A;  3W6X A;  3W6S A;  3TCV A;  2GAN A;  4L8A A;  4F0Y A;  3TOB A;  2VZZ A;  4CAW A;  4RS2 A;  3DR8 A;  1R57 A;  2ZW4 A;  5HMN A;  4JJX A;  1VKC A;  4JWP A;  5JPH A;  4YGO A;  2H5M A;  3GKR A;  1IID A;  3D2M A;  1CM0 A;  1Q2Y A;  3T9Y A;  3FRM A;  3LD2 A;  3R9E A;  4KOR A;  4KLV A;  2PRB A;  4KLW A;  2PR1 A;  2WPX A;  4E8O A;  4Y49 B; 
#chains in the Genus database with same CATH topology
 2BSW A;  3FNC A;  3KHZ A;  3A9L A;  4MFK A;  5IB0 A;  2ABZ A;  1UWY A;  2B5G B;  2F8H A;  4II9 A;  1GHE A;  1YW6 A;  4B6Z A;  4MMO A;  4NGR A;  4QVT A;  3NE7 A;  4DUK A;  4JXQ A;  3D7F A;  2GE3 A;  4ZX9 A;  5LRJ A;  2G3T A;  3L2N A;  4X3R A;  2QEC A;  2PE3 A;  1YR0 A;  4KVO E;  3CXS A;  3H4Q A;  3NA6 A;  2WZN A;  4OME A;  4XPL A;  1HEE A;  4PSW A;  1NMT A;  2GRE A;  2J8R A;  4Q7A A;  2VXK A;  4R57 A;  2O4H A;  3SJG A;  2FS5 A;  4ZYQ A;  2C6G A;  3GIU A;  4OC3 A;  4MHP A;  3SJF A;  2R1I A;  4KOX A;  5A27 A;  4OC4 A;  1Z8L A;  4CAF A;  2PJ0 A;  3OWC A;  2ARH A;  2PQ8 A;  4NGQ A;  4OC2 A;  2DEA A;  3KR5 A;  4IUS A;  3HLP A;  2K5T A;  3BI0 A;  1Y0Y A;  1Z5R A;  3EXN A;  3PFE A;  5JM6 A;  1I12 A;  5GCN A;  3T90 A;  3FX6 A;  4C2X A;  1LCP A;  1ARL A;  1ZLH A;  4NGT A;  2Z3K A;  3S6F A;  2AFW A;  2P0W A;  1XEB A;  4UWI A;  2QML A;  1YLE A;  2CTC A;  3D7G A;  2IMO A;  1IOF A;  1IYK A;  2P6G A;  3FIX A;  4QC6 A;  2VQY A;  1TF8 A;  1AUG A;  2O53 A;  4FD7 A;  2O28 A;  4FWU A;  4NGN A;  1Q2D A;  5LRG A;  4CAV A;  2POK A;  1S3Z A;  4WWV A;  4UFX A;  4KS9 A;  2HQY A;  1NE9 A;  2Z10 A;  3BI1 A;  3JRU A;  3E0K A;  3IGR A;  2JBJ A;  1J4J A;  2J8M A;  2OZG A;  4CPA A;  3B3T A;  4CYQ A;  4P45 A;  4MCR A;  2Q43 A;  1XIX A;  2GFQ A;  5KTA A;  2CY2 A;  3F5B A;  3S9L A;  5JGF A;  2PJ8 A;  3TX8 A;  3WT4 A;  1FY7 A;  4A37 A;  4UFV A;  4A30 A;  4F6A A;  3VWD A;  1LAN A;  2GLJ A;  3MGD A;  5ISV A;  1VHS A;  4R8F A;  1UFH A;  4B12 A;  2C27 A;  5KTD A;  4C7I A;  4ZBG A;  2ATR A;  1K4J A;  4K3N A;  3QAH A;  2Z3O A;  4X8I A;  3B35 A;  1ARM A;  2HUZ A;  2HC9 A;  2PCU A;  4UEE A;  2ZEE A;  4ZY1 A;  2PVW A;  4P4F A;  5D8N A;  2HV2 A;  3D67 A;  5I0C A;  2X7B A;  5EMI A;  4MI4 A;  4P4J A;  5H86 A;  5F46 A;  1Y9K A;  3DR6 A;  4X5K A;  1KUX A;  2EBJ A;  4OLL A;  4FD6 A;  4LQ6 A;  4U5Y A;  2R98 A;  2VI7 A;  4UFW A;  5CNP A;  5LYI A;  2HB6 A;  2YNC A;  2Q44 A;  2B5G A;  2R7H A;  3FB3 A;  1LRZ A;  4JZ0 A;  3ZZI A;  2QVP A;  1F57 A;  2Q51 A;  2PJ1 A;  3G3S A;  3LOD A;  3GUX A;  4H2K A;  4NGM A;  2Q7B A;  3SXN A;  4B13 A;  1YX0 A;  5I4M A;  1HDU A;  1NSA A;  1Q7L A;  4BMH A;  4DYO A;  1OBR A;  1S7L A;  1YLO A;  4MY3 A;  4M6H A;  4C68 A;  2ZW5 A;  3GB0 A;  3SHP A;  3JTK A;  3KGQ A;  4FBE A;  2CNS A;  5H84 A;  4HNY B;  2PJC A;  3B2Y A;  3SI0 A;  1Y7R A;  1Y9W A;  2PJ5 A;  1KUV A;  2GU2 A;  2ZEO A;  3PP9 A;  2V77 A;  4NXY A;  3KZW A;  4CAX A;  3D2P A;  4MJ8 A;  2VZY A;  4A32 A;  4ZGY B;  5F09 A;  2ZEM A;  3DNS A;  1IU8 A;  1YK3 A;  2IL4 A;  4NJQ A;  3FXT A;  3TO6 A;  3RYO A;  3BXM A;  2PJB A;  4PK3 A;  4PXC A;  3PB9 X;  4XNH C;  4C2Z A;  5F49 A;  2ZEN A;  3TE4 A;  3MRU A;  1MJA A;  4UF4 A;  3KKW A;  2AFS A;  2PVV A;  4Q38 A;  4CS0 B;  2ZEH A;  1VGY A;  4KUB A;  3EO4 A;  2RC4 A;  2FIW A;  3I1U A;  2XEF A;  4R3L A;  4QBJ A;  2EVN A;  2AFX A;  2OH1 A;  4LX9 A;  2EO8 A;  2JDD A;  4R76 A;  1WWZ A;  3TT2 A;  2PIY A;  4CGO A;  3R96 A;  3B3V A;  4NCZ A;  3CT9 A;  1X10 A;  2FVG A;  3WC5 A;  3PZJ A;  2QYV A;  3IEH A;  1FNO A;  5HVF A;  4DJL A;  2FL4 A;  3KHX A;  3S6G A;  5J8F A;  2FE7 A;  3QNV A;  1BOB A;  1YRE A;  5G21 A;  3SI1 A;  1I21 A;  3G8W A;  1YVK A;  4MHD A;  4KSI A;  2R8V A;  4KSF A;  2B3V A;  5BWA B;  2Q4Y A;  3V8I A;  3FJU A;  2OOT A;  1RXT A;  3P2H A;  3S6K A;  2BUE A;  1Z9U A;  3EFA A;  4NEX A;  2PSW A;  4OC1 A;  3D7D A;  5K8M A;  3D66 A;  2B4B A;  5CBM A;  1IGB A;  3D3S A;  1M4G A;  3KR4 A;  4FD4 A;  2Q4Z A;  2Y0M A;  3TFY A;  1Z8W A;  1CX8 A;  1ZG7 A;  5EBV A;  2I00 A;  3WC7 A;  3FH4 A;  2XEI A;  5JH9 A;  5K8P A;  4GS4 A;  4KVX A;  4IAV A;  2ZXV A;  3H5Z A;  4ORF A;  4MHY A;  5F47 A;  4Y49 C;  4R3K A;  5JQ4 A;  3VAR A;  5J1Q A;  3DSB A;  2YNC C;  3FEC A;  4AG7 A;  1ELL P;  1S7N A;  2XEJ A;  2J8N A;  2ZPA A;  5J8C A;  3F0A A;  3S9M A;  3SJX A;  4KVM E;  2KCW A;  4B5P B;  1LAM A;  1SQH A;  2ZEP A;  2P6E A;  2VL1 A;  2IQ6 A;  4BD9 A;  1A2Z A;  2ZW7 A;  3IIB A;  3IU2 A;  2OU2 A;  3BJ8 A;  4OC0 A;  4KOW A;  4EME A;  4CRZ B;  4KOT A;  2NSM A;  5D29 A;  4CGP A;  1BPN A;  1N71 A;  5FVJ A;  4UIA A;  4MHN A;  4KOV A;  3EY5 A;  5IB9 A;  2C6C A;  3FVL A;  5HVH A;  4PK2 A;  2VBQ A;  1ELM P;  3PEI A;  4H6Z A;  3S6H A;  2GLF A;  2AFU A;  3EC4 A;  1QMU A;  1CP6 A;  4PSX A;  3SXO A;  5EC4 A;  1M4D A;  1S7K A;  2G9D A;  3K2K A;  3CXQ A;  3VAT A;  5IV0 A;  2REE A;  2PJ2 A;  3NE8 A;  4CYO A;  5LRK A;  3F8K A;  4KOU A;  1FT7 A;  1I1D A;  4P10 A;  4B10 A;  3B3C A;  1CPX A;  4R87 A;  2WUU A;  1M4L A;  3BJ7 A;  4AG9 A;  1M1D A;  3WR7 A;  4AXV A;  2IJZ A;  2PR8 A;  3FYN A;  1F2O A;  2OR4 A;  2RFH A;  3CDX A;  4DNC A;  3GLJ A;  1QSR A;  2REF A;  3KQZ A;  2ZEF A;  3LWU A;  5CPA A;  3I3G A;  5KTC A;  3BHX A;  4ZX8 A;  6CPA A;  2J9A A;  4KUA A;  3R9F A;  1S7F A;  7CPA A;  4XPD B;  4CAE A;  4MCP A;  2JDC A;  3BLN A;  4F8Z A;  1TKH A;  4MHZ A;  2CF4 A;  3IWG A;  1CP7 A;  1DTD A;  1XBU A;  3T8W A;  3IFE A;  1YME A;  1XMT A;  2PJ3 A;  1YSJ A;  4OC5 A;  4WJB A;  4HKF A;  3PRT A;  4QUS A;  4Z65 A;  3SI2 A;  3RAM A;  1QSO A;  1XE4 A;  2C1C A;  1P4N A;  3JVN A;  4CYP A;  4IF5 A;  2D4P A;  1TKF A;  1VHE A;  5IX3 A;  3PGP A;  1BO4 A;  2CNM A;  2V8V A;  5G20 A;  3DDD A;  3S9N A;  4FAI A;  3TO7 A;  4IHM A;  1PYT B;  3DLJ A;  4UWJ A;  4CYN A;  4EVY A;  2EUI A;  4MFZ A;  4UIB A;  2ODF A;  2WPW A;  4J3G A;  4MFP A;  3NH8 A;  1TIQ A;  3TC8 A;  3IJ3 A;  3LAC A;  1P0H A;  4C7H A;  4F0X A;  2P6F A;  3CPA A;  4B11 A;  4PPZ A;  3NH4 A;  2BOA A;  2FSR A;  4M6I A;  3RNZ A;  4UBR A;  1U6M A;  2BL1 A;  1F2P A;  3QAY A;  4B5P A;  4CGL A;  2EK8 A;  2I3C A;  3R1K A;  4P4I A;  2Q7S A;  4KOS A;  2F7V A;  3LMS A;  4MXU A;  4ONW A;  1WK4 A;  4PXE A;  4CGM A;  2OB0 A;  1XRY A;  1HDQ A;  4MCS A;  3RBU A;  3W91 A;  1Z8T A;  1Q2C A;  5C88 A;  1PUA A;  4YU9 A;  2DPT A;  3V38 A;  4W9Y A;  4OAE A;  4RN7 A;  3FBU A;  4R9M A;  4AVA A;  4JXR A;  4TNU A;  1R43 A;  3GYA A;  4E2A A;  1IY7 A;  3IWW A;  4KZT A;  2CNT A;  3FEE A;  1Z4E A;  4AVB A;  2JEV A;  1XMB A;  1ON0 A;  4PXB A;  2A4N A;  4UCP A;  5G1Z A;  1H8L A;  3IWE A;  1XF8 A;  2AE6 A;  1XJO A;  1LAP A;  4NSQ A;  1S60 A;  2ZW6 A;  2Z3L A;  2NMT A;  4EFD A;  1X12 A;  2F5I A;  5DWM A;  4A95 A;  3PB8 X;  3K9U A;  1Z8X A;  1B6B A;  2FIA A;  4NGP A;  2ANP A;  3PBB A;  4A38 A;  1V0C A;  8CPA A;  5HVG A;  1LOK A;  1Z4R A;  3B7I A;  5AG6 A;  4H6U A;  4E0A A;  2ZOF A;  2YND A;  3PBE A;  1MJB A;  2DF5 A;  3H8F A;  4LUA A;  4P4B A;  3TTH A;  2BEI A;  3FED A;  2WSA A;  2Z11 A;  2RB7 A;  2Z0Z A;  3WAB A;  4M85 A;  3QB8 A;  2PJ7 A;  1MK4 A;  4I49 A;  2YNE A;  4OKO A;  4YWY A;  4NF1 A;  3NFZ A;  3D4U A;  2VEZ A;  1IB1 E;  2FCK A;  4UA3 A;  3TOA A;  4U9Y A;  2B4D B;  4FD5 A;  2QIR A;  2OZH A;  3ZJ0 A;  1PU9 A;  4PV6 A;  5ELY A;  5F48 A;  1IIC A;  1M4I A;  2CXA A;  4K30 A;  5DWN A;  3CXP A;  5E96 A;  3V7Z A;  4M6G A;  1S5K A;  2I79 A;  2ZED A;  4RI1 A;  1IOI A;  3KAS A;  1R3N A;  3B3W A;  4P4E A;  4YRH A;  3TO9 A;  4MBU A;  5AG5 A;  3D68 A;  5HH1 A;  2BCO A;  3SJE A;  4ZY0 A;  2PJ6 A;  1Y7E A;  4JD6 A;  4A39 A;  1XFO A;  1IYL A;  4QB9 A;  2D4O A;  2ZEG A;  2GIV A;  3K9T A;  4RUH A;  2NYQ A;  1RTQ A;  2JLM A;  5G22 A;  1NSL A;  4C2Y A;  2EWB A;  1CJW A;  5K8N A;  3N7Z A;  1OZP A;  1ZG8 A;  3H8G A;  4ONU A;  4HPS A;  4LQG A;  4UEZ A;  3UY5 A;  1VHO A;  4NJR A;  1VIX A;  5AGE A;  1AYE A;  4OP4 A;  5C82 A;  2PC1 A;  4JLY A;  3D8P A;  2V8G A;  3P2F A;  1DE4 C;  2ZOG A;  4MFQ A;  5THW A;  5HXD A;  1ZO0 A;  2CIJ A;  4UEF A;  1TF9 A;  1LFW A;  1CG2 A;  1RO5 A;  4MRI A;  4HNX B;  1ZG9 A;  1BPM A;  5LYD A;  4G1P A;  4BBH A;  3B3S A;  4P6Y A;  4FUU A;  4EWT A;  4TWE A;  1Z2L A;  4A94 A;  2Q04 A;  3FF3 A;  4HNW B;  3R9G A;  1M44 A;  2JBK A;  1JQG A;  4P4D A;  4B5O A;  4R6T A;  4B14 A;  4NGS A;  3VWE A;  4AVC A;  3B8G A;  2G0B A;  3GY9 A;  2FXF A;  2PDO A;  4MY0 A;  5DS0 A;  2XEG A;  4H89 A;  4PQA A;  2OZU A;  4CRY B;  3HUV A;  4KSA A;  4OAD A;  2AFO A;  1CPS A;  1B87 A;  1QST A;  4PXD A;  4P44 A;  4GM5 A;  2DXQ A;  3PB7 X;  4U9Z A;  4YFJ A;  2G3A A;  4AB7 A;  5AG4 A;  3N5F A;  4XPD C;  3I9S A;  1QSM A;  4ZY2 A;  1KZF A;  1YGH A;  4KOY A;  4A31 A;  4Q36 A;  1YQE A;  1QSN A;  1KUY A;  3PB4 X;  4MCQ A;  4X2T A;  3RZA A;  1YVO A;  1TKJ A;  4OID A;  3JUW A;  3IO1 A;  3NH5 A;  3R95 A;  2FT0 A;  4M3S A;  1BAV A;  2PJ4 A;  2Q4V A;  5LYL A;  2Z3N A;  2B4D A;  1QQ9 A;  3IC1 A;  2Q0Y A;  4XNH B;  2AJ6 A;  3DGV A;  1YW4 A;  1Y0R A;  3C26 A;  4GXH A;  1MJ9 A;  2B58 A;  3H8E A;  3ISZ A;  4L89 A;  4XPK A;  2B3U A;  2CTB A;  2PJA A;  1L0C A;  4MFJ A;  3W6X A;  3MN8 A;  2V8H A;  2Z3M A;  2BO9 A;  3W6S A;  3TCV A;  5LYF A;  1CBX A;  3RO0 A;  5K8O A;  2GAN A;  4L8A A;  3VH9 A;  3TOB A;  4A33 A;  4F0Y A;  3CZX A;  1KWM A;  2VZZ A;  3PB6 X;  1JWQ A;  2V8D A;  3CPX A;  4CGN A;  4CAW A;  4RS2 A;  3DR8 A;  4IK2 A;  1R57 A;  2PRQ A;  2ZW4 A;  5HMN A;  1BLL E;  4JJX A;  1GYT A;  3WC6 A;  3IU1 A;  4UCM A;  1VKC A;  3KL9 A;  2AFM A;  3KI9 A;  3FMC A;  4JWP A;  5JPH A;  2DPS A;  4YGO A;  2H5M A;  2C6P A;  2PIZ A;  3GKR A;  1IID A;  3D2M A;  2JEW A;  3ISX A;  3PFO A;  5A28 A;  4F9V A;  2EK9 A;  1TXR A;  4O23 A;  2AFZ A;  4A2Z A;  1CM0 A;  1PCA A;  1Q2Y A;  4MFL A;  1ZLI A;  4UCN A;  3T9Y A;  4F9U A;  2WYR A;  3FRM A;  3LD2 A;  2YGW A;  4BIN A;  2QJ8 A;  4OIW A;  3R9E A;  3KQX A;  3D7H A;  4ZI6 A;  1AMP A;  4KOR A;  1XOV A;  4KLV A;  2PJ9 A;  4NFR A;  2PRB A;  4R7M A;  4JYW A;  4KLW A;  2PR1 A;  2WPX A;  2Z3P A;  5AG7 A;  4E8O A;  1EE3 P;  4Y49 B;  2ZEL A; 
#chains in the Genus database with same CATH homology
 2BSW A;  3FNC A;  3A9L A;  4MFK A;  5IB0 A;  2B5G B;  4II9 A;  1GHE A;  4QVT A;  3NE7 A;  4JXQ A;  2GE3 A;  2G3T A;  2QEC A;  1YR0 A;  4KVO E;  3CXS A;  3H4Q A;  4XPL A;  4PSW A;  1NMT A;  2J8R A;  2VXK A;  4R57 A;  2FS5 A;  2R1I A;  4KOX A;  5A27 A;  4CAF A;  3OWC A;  2ARH A;  2PQ8 A;  4IUS A;  2K5T A;  3EXN A;  1I12 A;  5GCN A;  3T90 A;  4C2X A;  2Z3K A;  3S6F A;  2P0W A;  1XEB A;  4UWI A;  2QML A;  1YLE A;  3FIX A;  4QC6 A;  1IYK A;  2P6G A;  2VQY A;  4FD7 A;  2O28 A;  1Q2D A;  4CAV A;  1S3Z A;  4UFX A;  4KS9 A;  2HQY A;  1NE9 A;  2Z10 A;  3E0K A;  3IGR A;  1J4J A;  2J8M A;  2OZG A;  4CYQ A;  1XIX A;  5KTA A;  2CY2 A;  3F5B A;  1FY7 A;  4UFV A;  4A30 A;  4F6A A;  3VWD A;  3MGD A;  5ISV A;  1VHS A;  1UFH A;  4B12 A;  2C27 A;  5KTD A;  4C7I A;  4ZBG A;  2ATR A;  1K4J A;  3QAH A;  2Z3O A;  2HUZ A;  2HV2 A;  5I0C A;  2X7B A;  4MI4 A;  5H86 A;  5F46 A;  1Y9K A;  3DR6 A;  4X5K A;  1KUX A;  4OLL A;  4U5Y A;  4FD6 A;  5CNP A;  2R98 A;  2VI7 A;  4UFW A;  2YNC A;  2Q44 A;  2B5G A;  2R7H A;  3FB3 A;  1LRZ A;  3ZZI A;  3G3S A;  2Q7B A;  3LOD A;  3SXN A;  4B13 A;  1YX0 A;  4BMH A;  1S7L A;  4MY3 A;  4C68 A;  2ZW5 A;  3SHP A;  3JTK A;  2CNS A;  5H84 A;  4HNY B;  1Y7R A;  1Y9W A;  1KUV A;  4NXY A;  3PP9 A;  4CAX A;  3D2P A;  4MJ8 A;  2VZY A;  4A32 A;  4ZGY B;  3DNS A;  1YK3 A;  2IL4 A;  3FXT A;  3TO6 A;  3RYO A;  4PK3 A;  4XNH C;  4C2Z A;  5F49 A;  3TE4 A;  1MJA A;  3KKW A;  4Q38 A;  4CS0 B;  4KUB A;  3EO4 A;  2RC4 A;  2FIW A;  4R3L A;  4QBJ A;  2EVN A;  2OH1 A;  4LX9 A;  3TT2 A;  2JDD A;  1WWZ A;  4CGO A;  3R96 A;  4NCZ A;  3PZJ A;  2FL4 A;  3S6G A;  5J8F A;  2FE7 A;  5G21 A;  1BOB A;  1YRE A;  1I21 A;  3G8W A;  1YVK A;  4MHD A;  2R8V A;  4KSF A;  2B3V A;  5BWA B;  2Q4Y A;  3V8I A;  1RXT A;  3P2H A;  3S6K A;  2BUE A;  1Z9U A;  3EFA A;  4NEX A;  2PSW A;  2B4B A;  3D3S A;  1M4G A;  4FD4 A;  2Y0M A;  3TFY A;  5EBV A;  2I00 A;  4GS4 A;  4KVX A;  2ZXV A;  3H5Z A;  4ORF A;  5F47 A;  4Y49 C;  4R3K A;  5JQ4 A;  3DSB A;  2YNC C;  4AG7 A;  1S7N A;  2J8N A;  2ZPA A;  5J8C A;  3F0A A;  4KVM E;  2KCW A;  4B5P B;  1SQH A;  2P6E A;  2ZW7 A;  3IU2 A;  2OU2 A;  3BJ8 A;  4KOW A;  4CRZ B;  4KOT A;  4CGP A;  1N71 A;  5FVJ A;  4KOV A;  3EY5 A;  4PK2 A;  2VBQ A;  3S6H A;  4H6Z A;  3EC4 A;  4PSX A;  3SXO A;  5EC4 A;  1M4D A;  1S7K A;  3CXQ A;  5IV0 A;  2REE A;  4CYO A;  3F8K A;  4KOU A;  1I1D A;  4B10 A;  4R87 A;  2WUU A;  3BJ7 A;  4AG9 A;  1M1D A;  3WR7 A;  2PR8 A;  3FYN A;  4DNC A;  1QSR A;  2REF A;  3I3G A;  5KTC A;  4KUA A;  3R9F A;  1S7F A;  4XPD B;  4CAE A;  2JDC A;  3BLN A;  3IWG A;  1XMT A;  4HKF A;  4QUS A;  1QSO A;  1XE4 A;  1P4N A;  3JVN A;  4CYP A;  4IF5 A;  2D4P A;  5IX3 A;  3PGP A;  1BO4 A;  2CNM A;  5G20 A;  3DDD A;  3TO7 A;  4CYN A;  4UWJ A;  4EVY A;  2EUI A;  4MFZ A;  2WPW A;  4J3G A;  4MFP A;  1TIQ A;  1P0H A;  4C7H A;  4F0X A;  2P6F A;  4B11 A;  2FSR A;  4UBR A;  1U6M A;  2BL1 A;  4B5P A;  4CGL A;  3R1K A;  4KOS A;  1WK4 A;  4CGM A;  2OB0 A;  3W91 A;  5C88 A;  1Q2C A;  1PUA A;  2DPT A;  4OAE A;  3FBU A;  4R9M A;  4AVA A;  4JXR A;  4E2A A;  3GYA A;  4KZT A;  2CNT A;  1Z4E A;  4AVB A;  2JEV A;  1ON0 A;  2A4N A;  4UCP A;  5G1Z A;  3IWE A;  1XF8 A;  2AE6 A;  4NSQ A;  1S60 A;  2ZW6 A;  2Z3L A;  2NMT A;  5DWM A;  2F5I A;  4A95 A;  3K9U A;  1B6B A;  2FIA A;  1V0C A;  1Z4R A;  5AG6 A;  4H6U A;  4E0A A;  2YND A;  1MJB A;  4LUA A;  3TTH A;  2BEI A;  2WSA A;  2Z11 A;  2Z0Z A;  4M85 A;  3QB8 A;  1MK4 A;  4I49 A;  2YNE A;  4NF1 A;  2VEZ A;  1IB1 E;  2FCK A;  4UA3 A;  3TOA A;  4U9Y A;  2B4D B;  4FD5 A;  2QIR A;  2OZH A;  3ZJ0 A;  1PU9 A;  4PV6 A;  5F48 A;  1IIC A;  1M4I A;  2CXA A;  4K30 A;  5DWN A;  3CXP A;  5E96 A;  1S5K A;  2I79 A;  4RI1 A;  4YRH A;  3TO9 A;  4MBU A;  5AG5 A;  5HH1 A;  4JD6 A;  1IYL A;  4QB9 A;  2D4O A;  2GIV A;  5G22 A;  1NSL A;  2JLM A;  4C2Y A;  1CJW A;  3N7Z A;  1OZP A;  4ONU A;  3UY5 A;  5AGE A;  5C82 A;  2PC1 A;  4JLY A;  3D8P A;  3P2F A;  4MFQ A;  1ZO0 A;  1RO5 A;  4HNX B;  4BBH A;  2Q04 A;  4HNW B;  3R9G A;  1M44 A;  4B5O A;  4B14 A;  3VWE A;  4AVC A;  3B8G A;  2G0B A;  3GY9 A;  2FXF A;  2PDO A;  4MY0 A;  4H89 A;  2OZU A;  4CRY B;  4KSA A;  4OAD A;  1B87 A;  1QST A;  2DXQ A;  4U9Z A;  4YFJ A;  2G3A A;  4AB7 A;  5AG4 A;  4XPD C;  3I9S A;  1QSM A;  1KZF A;  1YGH A;  4KOY A;  4A31 A;  4Q36 A;  1QSN A;  1KUY A;  1YVO A;  3JUW A;  3R95 A;  2FT0 A;  4M3S A;  2Q4V A;  2Z3N A;  2B4D A;  2Q0Y A;  4XNH B;  2AJ6 A;  3C26 A;  1MJ9 A;  2B58 A;  4L89 A;  4XPK A;  2B3U A;  1L0C A;  4MFJ A;  3W6X A;  3W6S A;  2Z3M A;  3TCV A;  2GAN A;  4L8A A;  4F0Y A;  3TOB A;  4A33 A;  2VZZ A;  4CGN A;  4CAW A;  4RS2 A;  3DR8 A;  1R57 A;  2ZW4 A;  5HMN A;  4JJX A;  3IU1 A;  4UCM A;  1VKC A;  4JWP A;  5JPH A;  2DPS A;  4YGO A;  2H5M A;  3GKR A;  1IID A;  3D2M A;  5A28 A;  4A2Z A;  1CM0 A;  4MFL A;  1Q2Y A;  4UCN A;  3T9Y A;  3FRM A;  3LD2 A;  2YGW A;  3R9E A;  4KOR A;  4KLV A;  2PRB A;  4KLW A;  2PR1 A;  2WPX A;  2Z3P A;  5AG7 A;  4E8O A;  4Y49 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...