2PR8A

Crystal structure of aminoglycoside n-acetyltransferase aac(6')-ib11
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
173
structure length
173
Chain Sequence
b'DSVTLRLMTEHDLAMLYEWLNRSHIVEWWGGEEARPTLADVQEQYLPSVLAQESVTPYIAMLNGEPIGYAQSYVALGSGDGWWEEETDPGVRGIDLSLANASQLGKGLGTKLVRALVELLFNDPEVTKIQTDPSPSNLRAIRCYEKAGFERQGTVTTPDGPAVYMVQTRQAFE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aminoglycoside 6-N-acetyltransferase type Ib11
publication title Enzyme structural plasticity and the emergence of broad-spectrum antibiotic resistance.
pubmed doi rcsb
source organism Salmonella typhimurium
molecule tags Transferase
total genus 44
structure length 173
sequence length 173
chains with identical sequence B
ec nomenclature ec 2.3.1.82: Aminoglycoside 6'-N-acetyltransferase.
pdb deposition date 2007-05-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13523 Acetyltransf_8 Acetyltransferase (GNAT) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 2pr8A00
4UA3A 2Z0ZA 4RI1A 2IL4A 2B58A 2ARHA 2X7BA 1PUAA 2B5GA 2C27A 3W6SA 5HH1A 2GANA 1NE9A 4CS0B 3NE7A 4PV6A 4QBJA 2G3AA 4CAVA 4KORA 3T90A 1YVOA 2B3UA 2P6GA 4JWPA 2KCWA 4R9MA 1I21A 2B4BA 3FYNA 3D2MA 3EY5A 4KOTA 3S6KA 1SQHA 4MI4A 2I79A 2ZXVA 1LRZA 2PR1A 4X5KA 5JQ4A 3ZJ0A 4KOWA 5H86A 4YGOA 3FB3A 3P2HA 4CAWA 2J8MA 2QIRA 4XPKA 3SXNA 2ATRA 3OWCA 2Q04A 1CM0A 1M4GA 3I3GA 2JDCA 1YGHA 2GIVA 2PC1A 1VKCA 2JLMA 3JVNA 1K4JA 5EC4A 5F48A 4LX9A 2PSWA 2QECA 1S7NA 3B8GA 1IB1E 5C82A 5E96A 4R57A 1M1DA 2VI7A 4E2AA 3DSBA 1P4NA 5CNPA 1WK4A 1WWZA 5H84A 3SXOA 3W91A 4JD6A 3S6FA 4KZTA 2O28A 2Q4VA 3F5BA 3BLNA 3TCVA 3KKWA 2WPXA 3FXTA 3TT2A 5IX3A 1KUYA 1YK3A 2PRBA 1S7LA 1TIQA 2HV2A 2AJ6A 1KUXA 3F0AA 3LD2A 4ORFA 3D8PA 4M3SA 1UFHA 2ZW7A 1GHEA 2J8RA 2G0BA 3TE4A 1B87A 4L89A 1QSOA 1M4DA 2EVNA 3EXNA 4KLVA 2QMLA 1OZPA 2ZW5A 2D4PA 4FD7A 3R9EA 1MJ9A 4CRYB 2FSRA 1QSMA 3P2FA 3R96A 3FRMA 1PU9A 4IF5A 4YFJA 3T9YA 2B5GB 2OZGA 1Q2CA 4PSXA 1Q2DA 1I12A 4FD4A 2Q0YA 4J3GA 5IB0A 3TO7A 4B5PA 1IYLA 5EBVA 4U5YA 5KTAA 4XNHC 3E0KA 4MBUA 4CRZB 1V0CA 4KVOE 4U9YA 4AVAA 4YRHA 2Q44A 4R87A 5ISVA 2CNMA 1S60A 4HNWB 1Y9KA 2JEVA 4MY0A 3MGDA 4KLWA 3CXSA 1XEBA 2B3VA 3TFYA 2WPWA 2DXQA 1B6BA 5F46A 1YR0A 1RXTA 1Y9WA 3H4QA 1QSTA 2R8VA 1MK4A 1L0CA 3FIXA 2CNTA 4IUSA 3DNSA 4JXRA 2FT0A 4AG7A 2BUEA 1S7KA 4LUAA 1VHSA 1J4JA 1S3ZA 2OB0A 2F5IA 3F8KA 2R1IA 1R57A 5KTCA 2AE6A 2FL4A 3VWEA 4R3KA 4ZBGA 4H89A 3R9FA 3CXQA 4QB9A 2REFA 2BSWA 2RC4A 3RYOA 2OH1A 2B4DA 4MJ8A 1KZFA 4NSQA 1YX0A 3TOAA 2A4NA 3GYAA 4E8OA 1QSRA 1IICA 4KUAA 4B5OA 3SHPA 4UWIA 2BEIA 4XNHB 2NMTA 3DR6A 4CAXA 3PZJA 3I9SA 4JXQA 2FIWA 1KUVA 3VWDA 2Q4YA 4MY3A 2FS5A 5I0CA 2FCKA 4HNYB 4NEXA 3WR7A 1CJWA 1NMTA 1S7FA 1YLEA 3N7ZA 4R3LA 1I1DA 1M44A 4DNCA 2FIAA 3G8WA 3DR8A 2REEA 4UBRA 3C26A 2OU2A 1Y7RA 2VBQA 1FY7A 1MJBA 3R9GA 3W6XA 1MJAA 4NCZA 4B5PB 3JUWA 4F6AA 1Z4EA 2R98A 1BOBA 3PP9A 4XPLA 1U6MA 4ONUA 2VZYA 2Z10A 5F47A 5DWMA 3S6GA 4XPDB 2D4OA 4AVCA 4KOUA 3GKRA 4JJXA 1XIXA 4L8AA 1Z9UA 4K30A 4MHDA 4E0AA 4KOYA 1BO4A 4Y49C 4GS4A 2G3TA 4I49A 2JDDA 3BJ7A 2ZPAA 5DWNA 3TO6A 3IWGA 2R7HA 4II9A 4OAEA 4EVYA 2FE7A 1Z4RA 1ON0A 4KVME 3BJ8A 2OZUA 4OLLA 4QC6A 2J8NA 4PK3A 3G3SA 4UWJA 2BL1A 4KOXA 2OZHA 3EC4A 4KUBA 4FD5A 4JLYA 3IGRA 3QB8A 1M4IA 3D2PA 3TO9A 2VZZA 3CXPA 4OADA 1Q2YA 3TTHA 4U9ZA 4XPDC 4KOSA 3V8IA 5F49A 2GE3A 2PR8A 4PSWA 4NXYA 3GY9A 3R95A 2HQYA 3LODA 3ZZIA 4BMHA 3S6HA 4H6ZA 5J8CA 2PQ8A 3DDDA 2Q7BA 5J8FA 3FBUA 4H6UA 1S5KA 2B4DB 1QSNA 4KVXA 2PDOA 4F0YA 3PGPA 4AVBA 2H5MA 4PK2A 5FVJA 3EFAA 4HKFA 1YVKA 1IYKA 1YREA 3UY5A 4QUSA 4RS2A 2VXKA 2Y0MA 3D3SA 3TOBA 1P0HA 2P0WA 1RO5A 2CNSA 3K9UA 2P6EA 2ZW6A 5HMNA 5IV0A 3QAHA 2EUIA 4Y49B 4AB7A 1XE4A 2FXFA 5KTDA 1IIDA 2HUZA 2I00A 2ZW4A 4KOVA 5GCNA 4AG9A 1N71A 5JPHA 2K5TA 2Z11A 4HNXB 2P6FA 4M85A 2VEZA 4FD6A 1NSLA 1XF8A 2VQYA 2CY2A 4QVTA 3FNCA 3EO4A 3R1KA 5C88A 1XMTA 4NF1A
chains in the Genus database with same CATH superfamily
1R3NA 4UA3A 1TXRA 2Z0ZA 4RI1A 2IL4A 2B58A 2ARHA 2X7BA 1QQ9A 1FNOA 1PUAA 4B10A 2PJ7A 2B5GA 2C27A 2FVGA 5ELYA 3PBBA 3W6SA 5HH1A 3B7IA 2GANA 1BPNA 1NE9A 3NE7A 4P4BA 4YU9A 4CS0B 4PV6A 4QBJA 2G3AA 5LRKA 4CAVA 4KORA 2RFHA 1CX8A 3T90A 3A9LA 3KQXA 3KHZA 1YVOA 3BI0A 3IWEA 5AG4A 2B3UA 2P6GA 4JWPA 2KCWA 4R9MA 1I21A 2B4BA 1LOKA 3FYNA 3D2MA 3EY5A 4A95A 4KOTA 4A30A 2PIZA 4ZX9A 3PB8X 2ZEEA 3S6KA 1SQHA 2ANPA 2I79A 4MI4A 2ZXVA 1LRZA 5LRJA 4OC2A 2PR1A 1Z8XA 4IAVA 4FUUA 4X5KA 5D29A 5JQ4A 3ZJ0A 1LAMA 1TKJA 4GM5A 3GB0A 4KOWA 5H86A 4YGOA 3FB3A 4UEEA 2C1CA 2PJBA 3LACA 3P2HA 4CAWA 3PEIA 2J8MA 2QIRA 4XPKA 1CG2A 4NGPA 3SXNA 3FH4A 2ATRA 4M6HA 4Q36A 3OWCA 4Z65A 2PJ2A 2Q04A 2QVPA 5AG6A 1CM0A 1M4GA 4A33A 3I3GA 4UIBA 1QMUA 1X12A 3WC5A 2JDCA 1YGHA 2GIVA 1ZO0A 3KHXA 2PC1A 2ZEFA 1VKCA 2CTBA 4X8IA 4MFQA 2PVVA 3BXMA 2JLMA 3JVNA 1XBUA 2JBKA 2AFZA 1K4JA 5EC4A 5G1ZA 2PJ0A 4PXBA 4P4EA 2ZEHA 4CAFA 5F48A 5G21A 4LX9A 2PSWA 2QECA 4OP4A 4X2TA 2EO8A 1S7NA 3B8GA 1IB1E 3KQZA 1VHEA 5C82A 2C6PA 5E96A 4R57A 4A37A 1Z8TA 1M1DA 2VI7A 2G9DA 4E2AA 3DGVA 2PE3A 3DSBA 4LQ6A 1P4NA 4P10A 4C68A 4IHMA 3PFOA 3DLJA 4PXCA 5CNPA 2PRQA 2QJ8A 2AFUA 1WK4A 3QAYA 1IOIA 1IOFA 4RN7A 3WT4A 4CYOA 1WWZA 3FMCA 5H84A 3SXOA 3W91A 4JD6A 4JYWA 3S6FA 1A2ZA 3NH8A 4KZTA 2Z3LA 2ZEDA 5AGEA 4HPSA 3PFEA 4KSAA 3QNVA 4WWVA 5A28A 2O28A 2Q4VA 2Z3PA 2Z3OA 2F8HA 3F5BA 4EFDA 2DEAA 3WC7A 2Q4ZA 1IY7A 2PIYA 3BLNA 3TCVA 3IWWA 4MFJA 3FF3A 1PYTB 2WPXA 3FXTA 2XEFA 3KKWA 3I1UA 3TT2A 2WYRA 2OOTA 5IX3A 4A32A 1KUYA 3FX6A 1ZG9A 1YK3A 3CZXA 4GXHA 5DS0A 3B3VA 1R43A 2PRBA 4MFZA 3FECA 3IIBA 5K8PA 1S7LA 1TIQA 2HV2A 2AJ6A 1KUXA 4CYNA 4O23A 1BLLE 3F0AA 3LD2A 4ORFA 5K8NA 4X3RA 3D8PA 2V8HA 3V38A 4M3SA 4FBEA 1UFHA 4MRIA 3WC6A 4FWUA 2ZW7A 1TKHA 2C6CA 4OC0A 1GHEA 2C6GA 2G0BA 2J8RA 3TE4A 1B87A 4A31A 3PB9X 4L89A 1OBRA 2JBJA 2PJAA 1QSOA 3WABA 4KSFA 3S9MA 3FEDA 1HDQA 1M4DA 2EVNA 3EXNA 3PB7X 4KLVA 2QMLA 1OZPA 2AFWA 1Z5RA 2ZW5A 2D4PA 4FD7A 3R9EA 2CIJA 1MJ9A 5K8MA 4CRYB 2FSRA 1QSMA 1LFWA 3P2FA 3R96A 3FRMA 1PU9A 2Z3KA 2ZOGA 4NGSA 4NFRA 4IF5A 4YFJA 4CGPA 3T9YA 1CBXA 1ZLIA 2B5GB 4ZI6A 3FJUA 2OZGA 4UCNA 1Q2CA 1M4LA 4R6TA 4PSXA 4R76A 1Q2DA 3RO0A 1I12A 4W9YA 2PJCA 4FD4A 2Q0YA 3D4UA 4J3GA 1CP6A 4PQAA 3TO7A 3TX8A 1IYLA 1H8LA 4B5PA 5IB0A 5EBVA 2OR4A 3GLJA 2CF4A 2PJ4A 3K9TA 3S9LA 4CYPA 1HEEA 4P4IA 1UWYA 4U5YA 4XNHC 5KTAA 3E0KA 3D68A 4MBUA 2PJ1A 4CRZB 1V0CA 4MHPA 1VHOA 4KVOE 4OIDA 4U9YA 4AVAA 4YRHA 4UEFA 1XRYA 2Q44A 2AFSA 4R87A 5ISVA 2ZEOA 1ZG8A 3SJFA 5A27A 4R8FA 4MHZA 4NGMA 1YQEA 1S60A 2CNMA 2NSMA 4HNWB 4OC3A 1Y9KA 3H8EA 3H8GA 1YSJA 2JEVA 7CPAA 3NH4A 2AFOA 4MY0A 3MGDA 4JZ0A 4CYQA 3IO1A 4B11A 2NYQA 4Q7AA 4KLWA 4MCRA 3CXSA 3RBUA 4MFLA 1XEBA 4M6IA 5LYLA 4F9UA 2B3VA 4OC1A 1CP7A 3TFYA 4NGTA 4F8ZA 1ARLA 5F09A 2WPWA 2O53A 2DXQA 1B6BA 5F46A 1YR0A 1RXTA 1Y9WA 3KL9A 1Y0RA 3JRUA 3H4QA 3CPAA 1QSTA 1Y0YA 1XJOA 2R8VA 2IQ6A 2YNDA 4UIAA 3CDXA 4AXVA 3IU2A 3PB6X 4MCQA 1TF8A 3B2YA 5HVFA 3D7HA 4ZYQA 1Z8LA 2XEGA 5JH9A 1KWMA 1MK4A 1L0CA 4A39A 3FIXA 5HVHA 2CNTA 2DPSA 4IUSA 4KS9A 3VH9A 4B6ZA 2HC9A 2O4HA 1NSAA 3B3CA 2EK8A 3PB4X 3DNSA 2DPTA 4CGLA 1VIXA 2FT0A 2PJ3A 4JXRA 3SI0A 3HUVA 4NGQA 3B3TA 2BUEA 3D7GA 4PXEA 3IU1A 1DTDA 1S7KA 4AG7A 4ZY1A 1AYEA 4LUAA 2RB7A 1VHSA 2WUUA 5THWA 1J4JA 4EWTA 1S3ZA 2OB0A 2F5IA 3MRUA 1Y7EA 3F8KA 2AFMA 4CGOA 2R1IA 4EMEA 1R57A 4A38A 5KTCA 2AE6A 3BI1A 2FL4A 3VWEA 3H5ZA 4R3KA 1LANA 1BAVA 4H89A 4ZBGA 4FAIA 3PBEA 4P4JA 3R9FA 3CXQA 4QB9A 1DE4C 2PJ9A 3K2KA 4P44A 3RZAA 2REFA 3GUXA 2ZEGA 4MHYA 1F2OA 1JWQA 2BSWA 2RC4A 5JGFA 2F7VA 3RYOA 2OH1A 4UCPA 2B4DA 3SJXA 5HXDA 4MJ8A 1KZFA 4NSQA 2CTCA 1YX0A 3TOAA 2A4NA 3KZWA 4CGNA 5LYDA 4DYOA 3IC1A 4RUHA 2ZEMA 3GIUA 3GYAA 2QYVA 1QSRA 1IU8A 5AG5A 4E8OA 4PXDA 1IICA 4KUAA 4B5OA 3B3WA 3SHPA 4UWIA 2BEIA 2IJZA 4XNHB 3KI9A 4C2ZA 2NMTA 2ABZA 1XOVA 3DR6A 1F57A 1GYTA 1LCPA 3D66A 2AFXA 2YNCA 5I4MA 2ZEPA 4CAXA 3PRTA 3PZJA 3I9SA 1YLOA 4JXQA 3IEHA 1IGBA 2FIWA 4NGNA 3D7FA 4CPAA 1ARMA 1KUVA 4P4FA 3VWDA 2Q4YA 4MY3A 3T8WA 4B14A 2FS5A 5I0CA 2XEIA 2FCKA 4HNYB 4NEXA 3WR7A 1YW4A 1CJWA 4ZGYB 5CBMA 4CAEA 1NMTA 3L2NA 1S7FA 5IB9A 1YLEA 3N7ZA 4R3LA 1I1DA 3JTKA 2GFQA 1M44A 4DNCA 2FIAA 3G8WA 3DR8A 2ODFA 2REEA 2V8DA 2J9AA 4UBRA 3C26A 2GU2A 4ZX8A 2PJ8A 2OU2A 3CT9A 3VATA 4C2YA 4DJLA 1Y7RA 2VBQA 3KR4A 1FY7A 1RTQA 4UFWA 4MMOA 1MJBA 3R9GA 2GLFA 3W6XA 1MJAA 1VGYA 4NCZA 4IK2A 2WZNA 1JQGA 4NGRA 4B5PB 3JUWA 3NH5A 4F6AA 1PCAA 4MCSA 1Z4EA 4OMEA 2R98A 1BOBA 3B3SA 1ZLHA 3PP9A 2BCOA 2YNCC 2ZELA 4XPLA 1U6MA 4ONUA 3NE8A 4M6GA 3SI2A 2VZYA 2Z10A 5F47A 3LMSA 5DWMA 2Z3MA 3S6GA 4XPDB 2D4OA 4P6YA 4AVCA 4KOUA 4P4DA 2ZENA 3GKRA 4JJXA 4F0XA 4K3NA 4UFXA 2PVWA 1ELMP 2IMOA 1XIXA 4L8AA 4A94A 1Z9UA 4K30A 1CPXA 1EE3P 4MHDA 3NA6A 4E0AA 1HDUA 4KOYA 1BO4A 4KSIA 4Y49C 5LYFA 4GS4A 4OC5A 2G3TA 2V8GA 4I49A 5K8OA 2JDDA 6CPAA 3BJ7A 2ZPAA 3MN8A 5DWNA 3TO6A 1TF9A 3IWGA 2R7HA 4II9A 3KGQA 4OAEA 4UFVA 5LRGA 4EVYA 2FE7A 1Z4RA 4F9VA 4TNUA 4UEZA 1ON0A 4LQGA 2EK9A 1FT7A 3BJ8A 4KVME 2OZUA 4TWEA 4H2KA 4OLLA 4QC6A 2J8NA 3SJGA 3VARA 4B12A 4ZY2A 4NJQA 4DUKA 2JEWA 2Z3NA 3G3SA 4MCPA 4PK3A 4UWJA 1ZG7A 4ZY0A 2BL1A 2PJ5A 2BO9A 3KASA 4KOXA 2OZHA 3EC4A 4KUBA 4FD5A 1AMPA 4JLYA 3IGRA 3QB8A 1M4IA 1F2PA 3D2PA 3TO9A 2PJ6A 2VZZA 3CXPA 2I3CA 4MHNA 2Q7SA 3BHXA 2YGWA 4OADA 1XFOA 1Q2YA 4CGMA 4MFKA 4MFPA 1XMBA 4UF4A 3TTHA 4U9ZA 1Z8WA 1LAPA 4XPDC 4KOSA 3V8IA 2V77A 4UCMA 3NFZA 4MXUA 3ISXA 5F49A 2GE3A 2PR8A 2YNEA 5CPAA 5G20A 4PSWA 2BOAA 2Q51A 3HLPA 3IFEA 4NXYA 3GY9A 3R95A 2HQYA 3LODA 3ZZIA 4BMHA 3S6HA 5BWAB 4H6ZA 5D8NA 1TKFA 5J8CA 4WJBA 2PQ8A 3DDDA 1AUGA 4NJRA 2Q7BA 3SJEA 5J8FA 8CPAA 3V7ZA 3FBUA 4ONWA 3D7DA 3D67A 4H6UA 1YMEA 1S5KA 4PPZA 2B4DB 1QSNA 4KVXA 2PDOA 2VL1A 4F0YA 3PGPA 4AVBA 3S9NA 2H5MA 4PK2A 5FVJA 1BPMA 3H8FA 4BD9A 2EBJA 3EFAA 5LYIA 3CPXA 3FVLA 4C7IA 1X10A 3RAMA 3KR5A 4HKFA 3RNZA 4B13A 1YVKA 1ELLP 1IYKA 2HB6A 1YREA 3B35A 5HVGA 2PCUA 5J1QA 3TC8A 3UY5A 4QUSA 4G1PA 1CPSA 4RS2A 2VXKA 2Y0MA 3D3SA 1Q7LA 3N5FA 3TOBA 3FEEA 1P0HA 2P0WA 1Z2LA 2DF5A 2EWBA 1RO5A 2CNSA 3K9UA 4R7MA 2P6EA 3LWUA 2GREA 2ZW6A 2V8VA 2POKA 5HMNA 4C7HA 5IV0A 2XEJA 5EMIA 3QAHA 2EUIA 2GLJA 4Y49B 4P45A 3IJ3A 1XE4A 5G22A 2FXFA 4AB7A 1YW6A 3SI1A 1IIDA 5AG7A 4A2ZA 5KTDA 2HUZA 2I00A 2Q43A 2ZW4A 4KOVA 5GCNA 4AG9A 5JM6A 1N71A 5JPHA 2K5TA 2Z11A 2ZOFA 4HNXB 4OIWA 4C2XA 2P6FA 4M85A 4BINA 2VEZA 4FD6A 4OC4A 1NSLA 1XF8A 2VQYA 2CY2A 4QVTA 4YWYA 2WSAA 4Q38A 3FNCA 3ISZA 4BBHA 2CXAA 3EO4A 3R1KA 5C88A 1XMTA 4NF1A 4OKOA
chains in the Genus database with same CATH topology
4UA3A 2Z0ZA 4RI1A 2IL4A 2B58A 2ARHA 2X7BA 4B10A 1PUAA 2B5GA 2C27A 3W6SA 5HH1A 2GANA 1NE9A 4CS0B 3NE7A 4PV6A 4QBJA 2G3AA 4CAVA 4KORA 3T90A 3A9LA 1YVOA 3IWEA 5AG4A 2B3UA 2P6GA 4JWPA 2KCWA 4R9MA 1I21A 2B4BA 3FYNA 3D2MA 3EY5A 4A95A 4KOTA 4A30A 3S6KA 1SQHA 4MI4A 2I79A 2ZXVA 1LRZA 2PR1A 4X5KA 5JQ4A 3ZJ0A 4KOWA 5H86A 4YGOA 3FB3A 3P2HA 4CAWA 2J8MA 2QIRA 4XPKA 3SXNA 2ATRA 4Q36A 3OWCA 2Q04A 5AG6A 1CM0A 1M4GA 4A33A 3I3GA 2JDCA 1YGHA 2GIVA 1ZO0A 2PC1A 1VKCA 4MFQA 2JLMA 3JVNA 1K4JA 5EC4A 5G1ZA 4CAFA 5F48A 5G21A 4LX9A 2PSWA 2QECA 1S7NA 3B8GA 1IB1E 5C82A 5E96A 4R57A 1M1DA 2VI7A 4E2AA 3DSBA 1P4NA 4C68A 5CNPA 1WK4A 4CYOA 1WWZA 5H84A 3SXOA 3W91A 4JD6A 3S6FA 4KZTA 2Z3LA 5AGEA 4KSAA 5A28A 2O28A 2Q4VA 2Z3PA 2Z3OA 3F5BA 3BLNA 3TCVA 4MFJA 3KKWA 2WPXA 3FXTA 3TT2A 5IX3A 4A32A 1KUYA 1YK3A 2PRBA 4MFZA 1S7LA 1TIQA 2HV2A 2AJ6A 1KUXA 4CYNA 3F0AA 3LD2A 4ORFA 3D8PA 4M3SA 1UFHA 2ZW7A 1GHEA 2J8RA 2G0BA 3TE4A 1B87A 4A31A 4L89A 1QSOA 4KSFA 1M4DA 2EVNA 3EXNA 4KLVA 2QMLA 1OZPA 2ZW5A 2D4PA 4FD7A 3R9EA 1MJ9A 4CRYB 2FSRA 1QSMA 3P2FA 3R96A 3FRMA 1PU9A 2Z3KA 4IF5A 4YFJA 4CGPA 3T9YA 2B5GB 2OZGA 4UCNA 1Q2CA 4PSXA 1Q2DA 1I12A 4FD4A 2Q0YA 4J3GA 5IB0A 3TO7A 4B5PA 1IYLA 5EBVA 4CYPA 4U5YA 5KTAA 4XNHC 3E0KA 4MBUA 4CRZB 1V0CA 4KVOE 4U9YA 4AVAA 4YRHA 2Q44A 4R87A 5ISVA 5A27A 2CNMA 1S60A 4HNWB 1Y9KA 2JEVA 4MY0A 3MGDA 4CYQA 4B11A 4KLWA 3CXSA 4MFLA 1XEBA 2B3VA 3TFYA 2WPWA 2DXQA 1B6BA 5F46A 1YR0A 1RXTA 1Y9WA 3H4QA 1QSTA 2R8VA 2YNDA 3IU2A 1MK4A 1L0CA 3FIXA 2CNTA 2DPSA 4IUSA 4KS9A 3DNSA 2DPTA 4CGLA 4JXRA 2FT0A 4AG7A 2BUEA 3IU1A 1S7KA 4LUAA 1VHSA 2WUUA 1J4JA 1S3ZA 2OB0A 2F5IA 3F8KA 4CGOA 2R1IA 1R57A 5KTCA 2AE6A 2FL4A 3VWEA 3H5ZA 4R3KA 4ZBGA 4H89A 3R9FA 3CXQA 4QB9A 2REFA 2BSWA 2RC4A 3RYOA 2OH1A 4UCPA 2B4DA 4MJ8A 1KZFA 4NSQA 1YX0A 3TOAA 2A4NA 4CGNA 3GYAA 4E8OA 1QSRA 5AG5A 1IICA 4KUAA 4B5OA 3SHPA 4UWIA 2BEIA 4XNHB 4C2ZA 2NMTA 3DR6A 2YNCA 4CAXA 3PZJA 3I9SA 4JXQA 2FIWA 1KUVA 3VWDA 2Q4YA 4MY3A 4B14A 2FS5A 5I0CA 2FCKA 4HNYB 4NEXA 3WR7A 1CJWA 4ZGYB 4CAEA 1NMTA 1S7FA 1YLEA 3N7ZA 4R3LA 1I1DA 3JTKA 1M44A 4DNCA 2FIAA 3G8WA 3DR8A 2REEA 4UBRA 3C26A 2OU2A 4C2YA 1Y7RA 2VBQA 1FY7A 4UFWA 1MJBA 3R9GA 3W6XA 1MJAA 4NCZA 4B5PB 3JUWA 4F6AA 1Z4EA 2R98A 1BOBA 3PP9A 2YNCC 4XPLA 1U6MA 4ONUA 2VZYA 2Z10A 5F47A 5DWMA 3S6GA 2Z3MA 4XPDB 2D4OA 4AVCA 4KOUA 3GKRA 4JJXA 4F0XA 4UFXA 1XIXA 4L8AA 1Z9UA 4K30A 4MHDA 4E0AA 4KOYA 1BO4A 4Y49C 4GS4A 2G3TA 4I49A 2JDDA 3BJ7A 2ZPAA 5DWNA 3TO6A 3IWGA 2R7HA 4II9A 4OAEA 4UFVA 4EVYA 2FE7A 1Z4RA 1ON0A 4KVME 3BJ8A 2OZUA 4OLLA 4QC6A 2J8NA 4B12A 4PK3A 2Z3NA 3G3SA 4UWJA 2BL1A 4KOXA 2OZHA 3EC4A 4KUBA 4FD5A 4JLYA 3IGRA 3QB8A 1M4IA 3D2PA 3TO9A 2VZZA 3CXPA 2YGWA 4OADA 1Q2YA 4CGMA 4MFKA 4MFPA 3TTHA 4U9ZA 4XPDC 4KOSA 3V8IA 4UCMA 5F49A 2GE3A 2PR8A 2YNEA 5G20A 4PSWA 4NXYA 3GY9A 3R95A 2HQYA 3LODA 3ZZIA 4BMHA 3S6HA 5BWAB 4H6ZA 5J8CA 2PQ8A 3DDDA 2Q7BA 5J8FA 3FBUA 4H6UA 1S5KA 2B4DB 1QSNA 4KVXA 2PDOA 4F0YA 3PGPA 4AVBA 2H5MA 4PK2A 5FVJA 3EFAA 4C7IA 4HKFA 4B13A 1YVKA 1IYKA 1YREA 3UY5A 4QUSA 4RS2A 2VXKA 2Y0MA 3D3SA 3TOBA 1P0HA 2P0WA 1RO5A 2CNSA 3K9UA 2P6EA 2ZW6A 5HMNA 4C7HA 5IV0A 3QAHA 2EUIA 4Y49B 4AB7A 5G22A 1XE4A 2FXFA 5KTDA 1IIDA 5AG7A 4A2ZA 2HUZA 2I00A 2ZW4A 4KOVA 5GCNA 4AG9A 1N71A 5JPHA 2K5TA 2Z11A 4HNXB 4C2XA 2P6FA 4M85A 2VEZA 4FD6A 1NSLA 1XF8A 2VQYA 2CY2A 4QVTA 2WSAA 4Q38A 3FNCA 4BBHA 2CXAA 3EO4A 3R1KA 5C88A 1XMTA 4NF1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4UA3 A;  2Z0Z A;  4RI1 A;  2IL4 A;  2B58 A;  2ARH A;  2X7B A;  1PUA A;  2B5G A;  2C27 A;  3W6S A;  5HH1 A;  2GAN A;  1NE9 A;  4CS0 B;  3NE7 A;  4PV6 A;  4QBJ A;  2G3A A;  4CAV A;  4KOR A;  3T90 A;  1YVO A;  2B3U A;  2P6G A;  4JWP A;  2KCW A;  4R9M A;  1I21 A;  2B4B A;  3FYN A;  3D2M A;  3EY5 A;  4KOT A;  3S6K A;  1SQH A;  4MI4 A;  2I79 A;  2ZXV A;  1LRZ A;  2PR1 A;  4X5K A;  5JQ4 A;  3ZJ0 A;  4KOW A;  5H86 A;  4YGO A;  3FB3 A;  3P2H A;  4CAW A;  2J8M A;  2QIR A;  4XPK A;  3SXN A;  2ATR A;  3OWC A;  2Q04 A;  1CM0 A;  1M4G A;  3I3G A;  2JDC A;  1YGH A;  2GIV A;  2PC1 A;  1VKC A;  2JLM A;  3JVN A;  1K4J A;  5EC4 A;  5F48 A;  4LX9 A;  2PSW A;  2QEC A;  1S7N A;  3B8G A;  1IB1 E;  5C82 A;  5E96 A;  4R57 A;  1M1D A;  2VI7 A;  4E2A A;  3DSB A;  1P4N A;  5CNP A;  1WK4 A;  1WWZ A;  5H84 A;  3SXO A;  3W91 A;  4JD6 A;  3S6F A;  4KZT A;  2O28 A;  2Q4V A;  3F5B A;  3BLN A;  3TCV A;  3KKW A;  2WPX A;  3FXT A;  3TT2 A;  5IX3 A;  1KUY A;  1YK3 A;  2PRB A;  1S7L A;  1TIQ A;  2HV2 A;  2AJ6 A;  1KUX A;  3F0A A;  3LD2 A;  4ORF A;  3D8P A;  4M3S A;  1UFH A;  2ZW7 A;  1GHE A;  2J8R A;  2G0B A;  3TE4 A;  1B87 A;  4L89 A;  1QSO A;  1M4D A;  2EVN A;  3EXN A;  4KLV A;  2QML A;  1OZP A;  2ZW5 A;  2D4P A;  4FD7 A;  3R9E A;  1MJ9 A;  4CRY B;  2FSR A;  1QSM A;  3P2F A;  3R96 A;  3FRM A;  1PU9 A;  4IF5 A;  4YFJ A;  3T9Y A;  2B5G B;  2OZG A;  1Q2C A;  4PSX A;  1Q2D A;  1I12 A;  4FD4 A;  2Q0Y A;  4J3G A;  5IB0 A;  3TO7 A;  4B5P A;  1IYL A;  5EBV A;  4U5Y A;  5KTA A;  4XNH C;  3E0K A;  4MBU A;  4CRZ B;  1V0C A;  4KVO E;  4U9Y A;  4AVA A;  4YRH A;  2Q44 A;  4R87 A;  5ISV A;  2CNM A;  1S60 A;  4HNW B;  1Y9K A;  2JEV A;  4MY0 A;  3MGD A;  4KLW A;  3CXS A;  1XEB A;  2B3V A;  3TFY A;  2WPW A;  2DXQ A;  1B6B A;  5F46 A;  1YR0 A;  1RXT A;  1Y9W A;  3H4Q A;  1QST A;  2R8V A;  1MK4 A;  1L0C A;  3FIX A;  2CNT A;  4IUS A;  3DNS A;  4JXR A;  2FT0 A;  4AG7 A;  2BUE A;  1S7K A;  4LUA A;  1VHS A;  1J4J A;  1S3Z A;  2OB0 A;  2F5I A;  3F8K A;  2R1I A;  1R57 A;  5KTC A;  2AE6 A;  2FL4 A;  3VWE A;  4R3K A;  4ZBG A;  4H89 A;  3R9F A;  3CXQ A;  4QB9 A;  2REF A;  2BSW A;  2RC4 A;  3RYO A;  2OH1 A;  2B4D A;  4MJ8 A;  1KZF A;  4NSQ A;  1YX0 A;  3TOA A;  2A4N A;  3GYA A;  4E8O A;  1QSR A;  1IIC A;  4KUA A;  4B5O A;  3SHP A;  4UWI A;  2BEI A;  4XNH B;  2NMT A;  3DR6 A;  4CAX A;  3PZJ A;  3I9S A;  4JXQ A;  2FIW A;  1KUV A;  3VWD A;  2Q4Y A;  4MY3 A;  2FS5 A;  5I0C A;  2FCK A;  4HNY B;  4NEX A;  3WR7 A;  1CJW A;  1NMT A;  1S7F A;  1YLE A;  3N7Z A;  4R3L A;  1I1D A;  1M44 A;  4DNC A;  2FIA A;  3G8W A;  3DR8 A;  2REE A;  4UBR A;  3C26 A;  2OU2 A;  1Y7R A;  2VBQ A;  1FY7 A;  1MJB A;  3R9G A;  3W6X A;  1MJA A;  4NCZ A;  4B5P B;  3JUW A;  4F6A A;  1Z4E A;  2R98 A;  1BOB A;  3PP9 A;  4XPL A;  1U6M A;  4ONU A;  2VZY A;  2Z10 A;  5F47 A;  5DWM A;  3S6G A;  4XPD B;  2D4O A;  4AVC A;  4KOU A;  3GKR A;  4JJX A;  1XIX A;  4L8A A;  1Z9U A;  4K30 A;  4MHD A;  4E0A A;  4KOY A;  1BO4 A;  4Y49 C;  4GS4 A;  2G3T A;  4I49 A;  2JDD A;  3BJ7 A;  2ZPA A;  5DWN A;  3TO6 A;  3IWG A;  2R7H A;  4II9 A;  4OAE A;  4EVY A;  2FE7 A;  1Z4R A;  1ON0 A;  4KVM E;  3BJ8 A;  2OZU A;  4OLL A;  4QC6 A;  2J8N A;  4PK3 A;  3G3S A;  4UWJ A;  2BL1 A;  4KOX A;  2OZH A;  3EC4 A;  4KUB A;  4FD5 A;  4JLY A;  3IGR A;  3QB8 A;  1M4I A;  3D2P A;  3TO9 A;  2VZZ A;  3CXP A;  4OAD A;  1Q2Y A;  3TTH A;  4U9Z A;  4XPD C;  4KOS A;  3V8I A;  5F49 A;  2GE3 A;  2PR8 A;  4PSW A;  4NXY A;  3GY9 A;  3R95 A;  2HQY A;  3LOD A;  3ZZI A;  4BMH A;  3S6H A;  4H6Z A;  5J8C A;  2PQ8 A;  3DDD A;  2Q7B A;  5J8F A;  3FBU A;  4H6U A;  1S5K A;  2B4D B;  1QSN A;  4KVX A;  2PDO A;  4F0Y A;  3PGP A;  4AVB A;  2H5M A;  4PK2 A;  5FVJ A;  3EFA A;  4HKF A;  1YVK A;  1IYK A;  1YRE A;  3UY5 A;  4QUS A;  4RS2 A;  2VXK A;  2Y0M A;  3D3S A;  3TOB A;  1P0H A;  2P0W A;  1RO5 A;  2CNS A;  3K9U A;  2P6E A;  2ZW6 A;  5HMN A;  5IV0 A;  3QAH A;  2EUI A;  4Y49 B;  4AB7 A;  1XE4 A;  2FXF A;  5KTD A;  1IID A;  2HUZ A;  2I00 A;  2ZW4 A;  4KOV A;  5GCN A;  4AG9 A;  1N71 A;  5JPH A;  2K5T A;  2Z11 A;  4HNX B;  2P6F A;  4M85 A;  2VEZ A;  4FD6 A;  1NSL A;  1XF8 A;  2VQY A;  2CY2 A;  4QVT A;  3FNC A;  3EO4 A;  3R1K A;  5C88 A;  1XMT A;  4NF1 A; 
#chains in the Genus database with same CATH topology
 1R3N A;  4UA3 A;  1TXR A;  2Z0Z A;  4RI1 A;  2IL4 A;  2B58 A;  2ARH A;  2X7B A;  1QQ9 A;  1FNO A;  1PUA A;  4B10 A;  2PJ7 A;  2B5G A;  2C27 A;  2FVG A;  5ELY A;  3PBB A;  3W6S A;  5HH1 A;  3B7I A;  2GAN A;  1BPN A;  1NE9 A;  3NE7 A;  4P4B A;  4YU9 A;  4CS0 B;  4PV6 A;  4QBJ A;  2G3A A;  5LRK A;  4CAV A;  4KOR A;  2RFH A;  1CX8 A;  3T90 A;  3A9L A;  3KQX A;  3KHZ A;  1YVO A;  3BI0 A;  3IWE A;  5AG4 A;  2B3U A;  2P6G A;  4JWP A;  2KCW A;  4R9M A;  1I21 A;  2B4B A;  1LOK A;  3FYN A;  3D2M A;  3EY5 A;  4A95 A;  4KOT A;  4A30 A;  2PIZ A;  4ZX9 A;  3PB8 X;  2ZEE A;  3S6K A;  1SQH A;  2ANP A;  2I79 A;  4MI4 A;  2ZXV A;  1LRZ A;  5LRJ A;  4OC2 A;  2PR1 A;  1Z8X A;  4IAV A;  4FUU A;  4X5K A;  5D29 A;  5JQ4 A;  3ZJ0 A;  1LAM A;  1TKJ A;  4GM5 A;  3GB0 A;  4KOW A;  5H86 A;  4YGO A;  3FB3 A;  4UEE A;  2C1C A;  2PJB A;  3LAC A;  3P2H A;  4CAW A;  3PEI A;  2J8M A;  2QIR A;  4XPK A;  1CG2 A;  4NGP A;  3SXN A;  3FH4 A;  2ATR A;  4M6H A;  4Q36 A;  3OWC A;  4Z65 A;  2PJ2 A;  2Q04 A;  2QVP A;  5AG6 A;  1CM0 A;  1M4G A;  4A33 A;  3I3G A;  4UIB A;  1QMU A;  1X12 A;  3WC5 A;  2JDC A;  1YGH A;  2GIV A;  1ZO0 A;  3KHX A;  2PC1 A;  2ZEF A;  1VKC A;  2CTB A;  4X8I A;  4MFQ A;  2PVV A;  3BXM A;  2JLM A;  3JVN A;  1XBU A;  2JBK A;  2AFZ A;  1K4J A;  5EC4 A;  5G1Z A;  2PJ0 A;  4PXB A;  4P4E A;  2ZEH A;  4CAF A;  5F48 A;  5G21 A;  4LX9 A;  2PSW A;  2QEC A;  4OP4 A;  4X2T A;  2EO8 A;  1S7N A;  3B8G A;  1IB1 E;  3KQZ A;  1VHE A;  5C82 A;  2C6P A;  5E96 A;  4R57 A;  4A37 A;  1Z8T A;  1M1D A;  2VI7 A;  2G9D A;  4E2A A;  3DGV A;  2PE3 A;  3DSB A;  4LQ6 A;  1P4N A;  4P10 A;  4C68 A;  4IHM A;  3PFO A;  3DLJ A;  4PXC A;  5CNP A;  2PRQ A;  2QJ8 A;  2AFU A;  1WK4 A;  3QAY A;  1IOI A;  1IOF A;  4RN7 A;  3WT4 A;  4CYO A;  1WWZ A;  3FMC A;  5H84 A;  3SXO A;  3W91 A;  4JD6 A;  4JYW A;  3S6F A;  1A2Z A;  3NH8 A;  4KZT A;  2Z3L A;  2ZED A;  5AGE A;  4HPS A;  3PFE A;  4KSA A;  3QNV A;  4WWV A;  5A28 A;  2O28 A;  2Q4V A;  2Z3P A;  2Z3O A;  2F8H A;  3F5B A;  4EFD A;  2DEA A;  3WC7 A;  2Q4Z A;  1IY7 A;  2PIY A;  3BLN A;  3TCV A;  3IWW A;  4MFJ A;  3FF3 A;  1PYT B;  2WPX A;  3FXT A;  2XEF A;  3KKW A;  3I1U A;  3TT2 A;  2WYR A;  2OOT A;  5IX3 A;  4A32 A;  1KUY A;  3FX6 A;  1ZG9 A;  1YK3 A;  3CZX A;  4GXH A;  5DS0 A;  3B3V A;  1R43 A;  2PRB A;  4MFZ A;  3FEC A;  3IIB A;  5K8P A;  1S7L A;  1TIQ A;  2HV2 A;  2AJ6 A;  1KUX A;  4CYN A;  4O23 A;  1BLL E;  3F0A A;  3LD2 A;  4ORF A;  5K8N A;  4X3R A;  3D8P A;  2V8H A;  3V38 A;  4M3S A;  4FBE A;  1UFH A;  4MRI A;  3WC6 A;  4FWU A;  2ZW7 A;  1TKH A;  2C6C A;  4OC0 A;  1GHE A;  2C6G A;  2G0B A;  2J8R A;  3TE4 A;  1B87 A;  4A31 A;  3PB9 X;  4L89 A;  1OBR A;  2JBJ A;  2PJA A;  1QSO A;  3WAB A;  4KSF A;  3S9M A;  3FED A;  1HDQ A;  1M4D A;  2EVN A;  3EXN A;  3PB7 X;  4KLV A;  2QML A;  1OZP A;  2AFW A;  1Z5R A;  2ZW5 A;  2D4P A;  4FD7 A;  3R9E A;  2CIJ A;  1MJ9 A;  5K8M A;  4CRY B;  2FSR A;  1QSM A;  1LFW A;  3P2F A;  3R96 A;  3FRM A;  1PU9 A;  2Z3K A;  2ZOG A;  4NGS A;  4NFR A;  4IF5 A;  4YFJ A;  4CGP A;  3T9Y A;  1CBX A;  1ZLI A;  2B5G B;  4ZI6 A;  3FJU A;  2OZG A;  4UCN A;  1Q2C A;  1M4L A;  4R6T A;  4PSX A;  4R76 A;  1Q2D A;  3RO0 A;  1I12 A;  4W9Y A;  2PJC A;  4FD4 A;  2Q0Y A;  3D4U A;  4J3G A;  1CP6 A;  4PQA A;  3TO7 A;  3TX8 A;  1IYL A;  1H8L A;  4B5P A;  5IB0 A;  5EBV A;  2OR4 A;  3GLJ A;  2CF4 A;  2PJ4 A;  3K9T A;  3S9L A;  4CYP A;  1HEE A;  4P4I A;  1UWY A;  4U5Y A;  4XNH C;  5KTA A;  3E0K A;  3D68 A;  4MBU A;  2PJ1 A;  4CRZ B;  1V0C A;  4MHP A;  1VHO A;  4KVO E;  4OID A;  4U9Y A;  4AVA A;  4YRH A;  4UEF A;  1XRY A;  2Q44 A;  2AFS A;  4R87 A;  5ISV A;  2ZEO A;  1ZG8 A;  3SJF A;  5A27 A;  4R8F A;  4MHZ A;  4NGM A;  1YQE A;  1S60 A;  2CNM A;  2NSM A;  4HNW B;  4OC3 A;  1Y9K A;  3H8E A;  3H8G A;  1YSJ A;  2JEV A;  7CPA A;  3NH4 A;  2AFO A;  4MY0 A;  3MGD A;  4JZ0 A;  4CYQ A;  3IO1 A;  4B11 A;  2NYQ A;  4Q7A A;  4KLW A;  4MCR A;  3CXS A;  3RBU A;  4MFL A;  1XEB A;  4M6I A;  5LYL A;  4F9U A;  2B3V A;  4OC1 A;  1CP7 A;  3TFY A;  4NGT A;  4F8Z A;  1ARL A;  5F09 A;  2WPW A;  2O53 A;  2DXQ A;  1B6B A;  5F46 A;  1YR0 A;  1RXT A;  1Y9W A;  3KL9 A;  1Y0R A;  3JRU A;  3H4Q A;  3CPA A;  1QST A;  1Y0Y A;  1XJO A;  2R8V A;  2IQ6 A;  2YND A;  4UIA A;  3CDX A;  4AXV A;  3IU2 A;  3PB6 X;  4MCQ A;  1TF8 A;  3B2Y A;  5HVF A;  3D7H A;  4ZYQ A;  1Z8L A;  2XEG A;  5JH9 A;  1KWM A;  1MK4 A;  1L0C A;  4A39 A;  3FIX A;  5HVH A;  2CNT A;  2DPS A;  4IUS A;  4KS9 A;  3VH9 A;  4B6Z A;  2HC9 A;  2O4H A;  1NSA A;  3B3C A;  2EK8 A;  3PB4 X;  3DNS A;  2DPT A;  4CGL A;  1VIX A;  2FT0 A;  2PJ3 A;  4JXR A;  3SI0 A;  3HUV A;  4NGQ A;  3B3T A;  2BUE A;  3D7G A;  4PXE A;  3IU1 A;  1DTD A;  1S7K A;  4AG7 A;  4ZY1 A;  1AYE A;  4LUA A;  2RB7 A;  1VHS A;  2WUU A;  5THW A;  1J4J A;  4EWT A;  1S3Z A;  2OB0 A;  2F5I A;  3MRU A;  1Y7E A;  3F8K A;  2AFM A;  4CGO A;  2R1I A;  4EME A;  1R57 A;  4A38 A;  5KTC A;  2AE6 A;  3BI1 A;  2FL4 A;  3VWE A;  3H5Z A;  4R3K A;  1LAN A;  1BAV A;  4H89 A;  4ZBG A;  4FAI A;  3PBE A;  4P4J A;  3R9F A;  3CXQ A;  4QB9 A;  1DE4 C;  2PJ9 A;  3K2K A;  4P44 A;  3RZA A;  2REF A;  3GUX A;  2ZEG A;  4MHY A;  1F2O A;  1JWQ A;  2BSW A;  2RC4 A;  5JGF A;  2F7V A;  3RYO A;  2OH1 A;  4UCP A;  2B4D A;  3SJX A;  5HXD A;  4MJ8 A;  1KZF A;  4NSQ A;  2CTC A;  1YX0 A;  3TOA A;  2A4N A;  3KZW A;  4CGN A;  5LYD A;  4DYO A;  3IC1 A;  4RUH A;  2ZEM A;  3GIU A;  3GYA A;  2QYV A;  1QSR A;  1IU8 A;  5AG5 A;  4E8O A;  4PXD A;  1IIC A;  4KUA A;  4B5O A;  3B3W A;  3SHP A;  4UWI A;  2BEI A;  2IJZ A;  4XNH B;  3KI9 A;  4C2Z A;  2NMT A;  2ABZ A;  1XOV A;  3DR6 A;  1F57 A;  1GYT A;  1LCP A;  3D66 A;  2AFX A;  2YNC A;  5I4M A;  2ZEP A;  4CAX A;  3PRT A;  3PZJ A;  3I9S A;  1YLO A;  4JXQ A;  3IEH A;  1IGB A;  2FIW A;  4NGN A;  3D7F A;  4CPA A;  1ARM A;  1KUV A;  4P4F A;  3VWD A;  2Q4Y A;  4MY3 A;  3T8W A;  4B14 A;  2FS5 A;  5I0C A;  2XEI A;  2FCK A;  4HNY B;  4NEX A;  3WR7 A;  1YW4 A;  1CJW A;  4ZGY B;  5CBM A;  4CAE A;  1NMT A;  3L2N A;  1S7F A;  5IB9 A;  1YLE A;  3N7Z A;  4R3L A;  1I1D A;  3JTK A;  2GFQ A;  1M44 A;  4DNC A;  2FIA A;  3G8W A;  3DR8 A;  2ODF A;  2REE A;  2V8D A;  2J9A A;  4UBR A;  3C26 A;  2GU2 A;  4ZX8 A;  2PJ8 A;  2OU2 A;  3CT9 A;  3VAT A;  4C2Y A;  4DJL A;  1Y7R A;  2VBQ A;  3KR4 A;  1FY7 A;  1RTQ A;  4UFW A;  4MMO A;  1MJB A;  3R9G A;  2GLF A;  3W6X A;  1MJA A;  1VGY A;  4NCZ A;  4IK2 A;  2WZN A;  1JQG A;  4NGR A;  4B5P B;  3JUW A;  3NH5 A;  4F6A A;  1PCA A;  4MCS A;  1Z4E A;  4OME A;  2R98 A;  1BOB A;  3B3S A;  1ZLH A;  3PP9 A;  2BCO A;  2YNC C;  2ZEL A;  4XPL A;  1U6M A;  4ONU A;  3NE8 A;  4M6G A;  3SI2 A;  2VZY A;  2Z10 A;  5F47 A;  3LMS A;  5DWM A;  2Z3M A;  3S6G A;  4XPD B;  2D4O A;  4P6Y A;  4AVC A;  4KOU A;  4P4D A;  2ZEN A;  3GKR A;  4JJX A;  4F0X A;  4K3N A;  4UFX A;  2PVW A;  1ELM P;  2IMO A;  1XIX A;  4L8A A;  4A94 A;  1Z9U A;  4K30 A;  1CPX A;  1EE3 P;  4MHD A;  3NA6 A;  4E0A A;  1HDU A;  4KOY A;  1BO4 A;  4KSI A;  4Y49 C;  5LYF A;  4GS4 A;  4OC5 A;  2G3T A;  2V8G A;  4I49 A;  5K8O A;  2JDD A;  6CPA A;  3BJ7 A;  2ZPA A;  3MN8 A;  5DWN A;  3TO6 A;  1TF9 A;  3IWG A;  2R7H A;  4II9 A;  3KGQ A;  4OAE A;  4UFV A;  5LRG A;  4EVY A;  2FE7 A;  1Z4R A;  4F9V A;  4TNU A;  4UEZ A;  1ON0 A;  4LQG A;  2EK9 A;  1FT7 A;  3BJ8 A;  4KVM E;  2OZU A;  4TWE A;  4H2K A;  4OLL A;  4QC6 A;  2J8N A;  3SJG A;  3VAR A;  4B12 A;  4ZY2 A;  4NJQ A;  4DUK A;  2JEW A;  2Z3N A;  3G3S A;  4MCP A;  4PK3 A;  4UWJ A;  1ZG7 A;  4ZY0 A;  2BL1 A;  2PJ5 A;  2BO9 A;  3KAS A;  4KOX A;  2OZH A;  3EC4 A;  4KUB A;  4FD5 A;  1AMP A;  4JLY A;  3IGR A;  3QB8 A;  1M4I A;  1F2P A;  3D2P A;  3TO9 A;  2PJ6 A;  2VZZ A;  3CXP A;  2I3C A;  4MHN A;  2Q7S A;  3BHX A;  2YGW A;  4OAD A;  1XFO A;  1Q2Y A;  4CGM A;  4MFK A;  4MFP A;  1XMB A;  4UF4 A;  3TTH A;  4U9Z A;  1Z8W A;  1LAP A;  4XPD C;  4KOS A;  3V8I A;  2V77 A;  4UCM A;  3NFZ A;  4MXU A;  3ISX A;  5F49 A;  2GE3 A;  2PR8 A;  2YNE A;  5CPA A;  5G20 A;  4PSW A;  2BOA A;  2Q51 A;  3HLP A;  3IFE A;  4NXY A;  3GY9 A;  3R95 A;  2HQY A;  3LOD A;  3ZZI A;  4BMH A;  3S6H A;  5BWA B;  4H6Z A;  5D8N A;  1TKF A;  5J8C A;  4WJB A;  2PQ8 A;  3DDD A;  1AUG A;  4NJR A;  2Q7B A;  3SJE A;  5J8F A;  8CPA A;  3V7Z A;  3FBU A;  4ONW A;  3D7D A;  3D67 A;  4H6U A;  1YME A;  1S5K A;  4PPZ A;  2B4D B;  1QSN A;  4KVX A;  2PDO A;  2VL1 A;  4F0Y A;  3PGP A;  4AVB A;  3S9N A;  2H5M A;  4PK2 A;  5FVJ A;  1BPM A;  3H8F A;  4BD9 A;  2EBJ A;  3EFA A;  5LYI A;  3CPX A;  3FVL A;  4C7I A;  1X10 A;  3RAM A;  3KR5 A;  4HKF A;  3RNZ A;  4B13 A;  1YVK A;  1ELL P;  1IYK A;  2HB6 A;  1YRE A;  3B35 A;  5HVG A;  2PCU A;  5J1Q A;  3TC8 A;  3UY5 A;  4QUS A;  4G1P A;  1CPS A;  4RS2 A;  2VXK A;  2Y0M A;  3D3S A;  1Q7L A;  3N5F A;  3TOB A;  3FEE A;  1P0H A;  2P0W A;  1Z2L A;  2DF5 A;  2EWB A;  1RO5 A;  2CNS A;  3K9U A;  4R7M A;  2P6E A;  3LWU A;  2GRE A;  2ZW6 A;  2V8V A;  2POK A;  5HMN A;  4C7H A;  5IV0 A;  2XEJ A;  5EMI A;  3QAH A;  2EUI A;  2GLJ A;  4Y49 B;  4P45 A;  3IJ3 A;  1XE4 A;  5G22 A;  2FXF A;  4AB7 A;  1YW6 A;  3SI1 A;  1IID A;  5AG7 A;  4A2Z A;  5KTD A;  2HUZ A;  2I00 A;  2Q43 A;  2ZW4 A;  4KOV A;  5GCN A;  4AG9 A;  5JM6 A;  1N71 A;  5JPH A;  2K5T A;  2Z11 A;  2ZOF A;  4HNX B;  4OIW A;  4C2X A;  2P6F A;  4M85 A;  4BIN A;  2VEZ A;  4FD6 A;  4OC4 A;  1NSL A;  1XF8 A;  2VQY A;  2CY2 A;  4QVT A;  4YWY A;  2WSA A;  4Q38 A;  3FNC A;  3ISZ A;  4BBH A;  2CXA A;  3EO4 A;  3R1K A;  5C88 A;  1XMT A;  4NF1 A;  4OKO A; 
#chains in the Genus database with same CATH homology
 4UA3 A;  2Z0Z A;  4RI1 A;  2IL4 A;  2B58 A;  2ARH A;  2X7B A;  4B10 A;  1PUA A;  2B5G A;  2C27 A;  3W6S A;  5HH1 A;  2GAN A;  1NE9 A;  4CS0 B;  3NE7 A;  4PV6 A;  4QBJ A;  2G3A A;  4CAV A;  4KOR A;  3T90 A;  3A9L A;  1YVO A;  3IWE A;  5AG4 A;  2B3U A;  2P6G A;  4JWP A;  2KCW A;  4R9M A;  1I21 A;  2B4B A;  3FYN A;  3D2M A;  3EY5 A;  4A95 A;  4KOT A;  4A30 A;  3S6K A;  1SQH A;  4MI4 A;  2I79 A;  2ZXV A;  1LRZ A;  2PR1 A;  4X5K A;  5JQ4 A;  3ZJ0 A;  4KOW A;  5H86 A;  4YGO A;  3FB3 A;  3P2H A;  4CAW A;  2J8M A;  2QIR A;  4XPK A;  3SXN A;  2ATR A;  4Q36 A;  3OWC A;  2Q04 A;  5AG6 A;  1CM0 A;  1M4G A;  4A33 A;  3I3G A;  2JDC A;  1YGH A;  2GIV A;  1ZO0 A;  2PC1 A;  1VKC A;  4MFQ A;  2JLM A;  3JVN A;  1K4J A;  5EC4 A;  5G1Z A;  4CAF A;  5F48 A;  5G21 A;  4LX9 A;  2PSW A;  2QEC A;  1S7N A;  3B8G A;  1IB1 E;  5C82 A;  5E96 A;  4R57 A;  1M1D A;  2VI7 A;  4E2A A;  3DSB A;  1P4N A;  4C68 A;  5CNP A;  1WK4 A;  4CYO A;  1WWZ A;  5H84 A;  3SXO A;  3W91 A;  4JD6 A;  3S6F A;  4KZT A;  2Z3L A;  5AGE A;  4KSA A;  5A28 A;  2O28 A;  2Q4V A;  2Z3P A;  2Z3O A;  3F5B A;  3BLN A;  3TCV A;  4MFJ A;  3KKW A;  2WPX A;  3FXT A;  3TT2 A;  5IX3 A;  4A32 A;  1KUY A;  1YK3 A;  2PRB A;  4MFZ A;  1S7L A;  1TIQ A;  2HV2 A;  2AJ6 A;  1KUX A;  4CYN A;  3F0A A;  3LD2 A;  4ORF A;  3D8P A;  4M3S A;  1UFH A;  2ZW7 A;  1GHE A;  2J8R A;  2G0B A;  3TE4 A;  1B87 A;  4A31 A;  4L89 A;  1QSO A;  4KSF A;  1M4D A;  2EVN A;  3EXN A;  4KLV A;  2QML A;  1OZP A;  2ZW5 A;  2D4P A;  4FD7 A;  3R9E A;  1MJ9 A;  4CRY B;  2FSR A;  1QSM A;  3P2F A;  3R96 A;  3FRM A;  1PU9 A;  2Z3K A;  4IF5 A;  4YFJ A;  4CGP A;  3T9Y A;  2B5G B;  2OZG A;  4UCN A;  1Q2C A;  4PSX A;  1Q2D A;  1I12 A;  4FD4 A;  2Q0Y A;  4J3G A;  5IB0 A;  3TO7 A;  4B5P A;  1IYL A;  5EBV A;  4CYP A;  4U5Y A;  5KTA A;  4XNH C;  3E0K A;  4MBU A;  4CRZ B;  1V0C A;  4KVO E;  4U9Y A;  4AVA A;  4YRH A;  2Q44 A;  4R87 A;  5ISV A;  5A27 A;  2CNM A;  1S60 A;  4HNW B;  1Y9K A;  2JEV A;  4MY0 A;  3MGD A;  4CYQ A;  4B11 A;  4KLW A;  3CXS A;  4MFL A;  1XEB A;  2B3V A;  3TFY A;  2WPW A;  2DXQ A;  1B6B A;  5F46 A;  1YR0 A;  1RXT A;  1Y9W A;  3H4Q A;  1QST A;  2R8V A;  2YND A;  3IU2 A;  1MK4 A;  1L0C A;  3FIX A;  2CNT A;  2DPS A;  4IUS A;  4KS9 A;  3DNS A;  2DPT A;  4CGL A;  4JXR A;  2FT0 A;  4AG7 A;  2BUE A;  3IU1 A;  1S7K A;  4LUA A;  1VHS A;  2WUU A;  1J4J A;  1S3Z A;  2OB0 A;  2F5I A;  3F8K A;  4CGO A;  2R1I A;  1R57 A;  5KTC A;  2AE6 A;  2FL4 A;  3VWE A;  3H5Z A;  4R3K A;  4ZBG A;  4H89 A;  3R9F A;  3CXQ A;  4QB9 A;  2REF A;  2BSW A;  2RC4 A;  3RYO A;  2OH1 A;  4UCP A;  2B4D A;  4MJ8 A;  1KZF A;  4NSQ A;  1YX0 A;  3TOA A;  2A4N A;  4CGN A;  3GYA A;  4E8O A;  1QSR A;  5AG5 A;  1IIC A;  4KUA A;  4B5O A;  3SHP A;  4UWI A;  2BEI A;  4XNH B;  4C2Z A;  2NMT A;  3DR6 A;  2YNC A;  4CAX A;  3PZJ A;  3I9S A;  4JXQ A;  2FIW A;  1KUV A;  3VWD A;  2Q4Y A;  4MY3 A;  4B14 A;  2FS5 A;  5I0C A;  2FCK A;  4HNY B;  4NEX A;  3WR7 A;  1CJW A;  4ZGY B;  4CAE A;  1NMT A;  1S7F A;  1YLE A;  3N7Z A;  4R3L A;  1I1D A;  3JTK A;  1M44 A;  4DNC A;  2FIA A;  3G8W A;  3DR8 A;  2REE A;  4UBR A;  3C26 A;  2OU2 A;  4C2Y A;  1Y7R A;  2VBQ A;  1FY7 A;  4UFW A;  1MJB A;  3R9G A;  3W6X A;  1MJA A;  4NCZ A;  4B5P B;  3JUW A;  4F6A A;  1Z4E A;  2R98 A;  1BOB A;  3PP9 A;  2YNC C;  4XPL A;  1U6M A;  4ONU A;  2VZY A;  2Z10 A;  5F47 A;  5DWM A;  3S6G A;  2Z3M A;  4XPD B;  2D4O A;  4AVC A;  4KOU A;  3GKR A;  4JJX A;  4F0X A;  4UFX A;  1XIX A;  4L8A A;  1Z9U A;  4K30 A;  4MHD A;  4E0A A;  4KOY A;  1BO4 A;  4Y49 C;  4GS4 A;  2G3T A;  4I49 A;  2JDD A;  3BJ7 A;  2ZPA A;  5DWN A;  3TO6 A;  3IWG A;  2R7H A;  4II9 A;  4OAE A;  4UFV A;  4EVY A;  2FE7 A;  1Z4R A;  1ON0 A;  4KVM E;  3BJ8 A;  2OZU A;  4OLL A;  4QC6 A;  2J8N A;  4B12 A;  4PK3 A;  2Z3N A;  3G3S A;  4UWJ A;  2BL1 A;  4KOX A;  2OZH A;  3EC4 A;  4KUB A;  4FD5 A;  4JLY A;  3IGR A;  3QB8 A;  1M4I A;  3D2P A;  3TO9 A;  2VZZ A;  3CXP A;  2YGW A;  4OAD A;  1Q2Y A;  4CGM A;  4MFK A;  4MFP A;  3TTH A;  4U9Z A;  4XPD C;  4KOS A;  3V8I A;  4UCM A;  5F49 A;  2GE3 A;  2PR8 A;  2YNE A;  5G20 A;  4PSW A;  4NXY A;  3GY9 A;  3R95 A;  2HQY A;  3LOD A;  3ZZI A;  4BMH A;  3S6H A;  5BWA B;  4H6Z A;  5J8C A;  2PQ8 A;  3DDD A;  2Q7B A;  5J8F A;  3FBU A;  4H6U A;  1S5K A;  2B4D B;  1QSN A;  4KVX A;  2PDO A;  4F0Y A;  3PGP A;  4AVB A;  2H5M A;  4PK2 A;  5FVJ A;  3EFA A;  4C7I A;  4HKF A;  4B13 A;  1YVK A;  1IYK A;  1YRE A;  3UY5 A;  4QUS A;  4RS2 A;  2VXK A;  2Y0M A;  3D3S A;  3TOB A;  1P0H A;  2P0W A;  1RO5 A;  2CNS A;  3K9U A;  2P6E A;  2ZW6 A;  5HMN A;  4C7H A;  5IV0 A;  3QAH A;  2EUI A;  4Y49 B;  4AB7 A;  5G22 A;  1XE4 A;  2FXF A;  5KTD A;  1IID A;  5AG7 A;  4A2Z A;  2HUZ A;  2I00 A;  2ZW4 A;  4KOV A;  5GCN A;  4AG9 A;  1N71 A;  5JPH A;  2K5T A;  2Z11 A;  4HNX B;  4C2X A;  2P6F A;  4M85 A;  2VEZ A;  4FD6 A;  1NSL A;  1XF8 A;  2VQY A;  2CY2 A;  4QVT A;  2WSA A;  4Q38 A;  3FNC A;  4BBH A;  2CXA A;  3EO4 A;  3R1K A;  5C88 A;  1XMT A;  4NF1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...