2PR8A

Crystal structure of aminoglycoside n-acetyltransferase aac(6')-ib11
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
173
structure length
173
Chain Sequence
DSVTLRLMTEHDLAMLYEWLNRSHIVEWWGGEEARPTLADVQEQYLPSVLAQESVTPYIAMLNGEPIGYAQSYVALGSGDGWWEEETDPGVRGIDLSLANASQLGKGLGTKLVRALVELLFNDPEVTKIQTDPSPSNLRAIRCYEKAGFERQGTVTTPDGPAVYMVQTRQAFE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aminoglycoside 6-N-acetyltransferase type Ib11
publication title Enzyme structural plasticity and the emergence of broad-spectrum antibiotic resistance.
pubmed doi rcsb
source organism Salmonella typhimurium
molecule tags Transferase
total genus 44
structure length 173
sequence length 173
chains with identical sequence B
ec nomenclature ec 2.3.1.82: Aminoglycoside 6'-N-acetyltransferase.
pdb deposition date 2007-05-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13523 Acetyltransf_8 Acetyltransferase (GNAT) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 2pr8A00
3TCVA 4AVAA 1ON0A 4K30A 4AG9A 1FY7A 3PZJA 4R3LA 5F48A 4PSWA 3QB8A 4R57A 1PU9A 3EY5A 4H6ZA 2QECA 3TOBA 2OZGA 1OZPA 4JXQA 4KOVA 1Q2YA 4B5PB 2P6FA 2AE6A 1KUYA 1IB1E 2R7HA 2B4BA 3F8KA 4PK2A 2FT0A 3P2FA 1IYKA 4LUAA 4UBRA 2HV2A 3LODA 1LRZA 1IICA 5J8CA 5JQ4A 4KUBA 3E0KA 2FS5A 3GKRA 1IIDA 3NE7A 1Y9KA 3V8IA 4KORA 3R9FA 4NSQA 4MI4A 4JWPA 2PDOA 3DR6A 4HNWB 3ZZIA 2G3AA 2FSRA 2I00A 2BEIA 2VBQA 1V0CA 1S60A 4OLLA 1YGHA 4FD7A 3EFAA 3W6XA 2C27A 5CNPA 2CNTA 4YGOA 1QSNA 1YR0A 4NF1A 3ZJ0A 2IL4A 4MHDA 3TT2A 4U9ZA 5DWMA 3CXSA 4GS4A 3TFYA 4R3KA 2GIVA 5KTAA 2G3TA 3R9EA 2HQYA 2FCKA 3S6KA 4MY0A 4KOUA 4MBUA 4KLWA 4H6UA 5IV0A 1CM0A 4CAXA 4DNCA 4MY3A 2JLMA 4Y49C 4PV6A 2ARHA 1YK3A 1Y9WA 2PSWA 4MJ8A 3F0AA 1S5KA 2Q44A 3FYNA 2F5IA 2K5TA 4F6AA 3FBUA 3N7ZA 2B3VA 1KUXA 3S6FA 4KZTA 2Y0MA 2VEZA 2GE3A 2J8NA 1UFHA 2D4PA 5J8FA 3F5BA 2PC1A 3EO4A 3FRMA 1P4NA 3TTHA 1MJBA 2ZW4A 2BL1A 2WPXA 3RYOA 2QIRA 4YRHA 4QB9A 3TOAA 2H5MA 4IF5A 3FB3A 3S6GA 4CAVA 4CRYB 1VHSA 2VXKA 1K4JA 2FXFA 1MJAA 3T9YA 1YREA 2VQYA 1Z4EA 5E96A 5FVJA 5GCNA 3W6SA 1M44A 4L89A 1NE9A 3R96A 1WK4A 5I0CA 1QSTA 2FE7A 2OH1A 2ZXVA 3SHPA 4XNHC 2CY2A 4NEXA 4JJXA 1S7KA 2P6EA 1N71A 1BOBA 1TIQA 3T90A 2EVNA 2Q04A 4JD6A 3EC4A 2ZW5A 1MJ9A 4PK3A 4R9MA 2DXQA 1S7FA 1I12A 1BO4A 2ZW7A 3IGRA 2VI7A 3G8WA 2ZPAA 3WR7A 2JEVA 3FXTA 4HNYB 3VWEA 3CXPA 2Q7BA 5HH1A 1NMTA 2OU2A 5ISVA 4M85A 4XPDB 1J4JA 3TO9A 2B58A 4KLVA 1M4GA 4ONUA 1M4DA 2CNSA 3DNSA 2KCWA 2A4NA 2REFA 3MGDA 4UA3A 4AB7A 5IX3A 3C26A 2FL4A 1Z4RA 1VKCA 3JUWA 1R57A 1XF8A 5F46A 2G0BA 4XPLA 2JDDA 4OAEA 4AVCA 4EVYA 4JXRA 3S6HA 1M1DA 1Q2DA 4OADA 3BLNA 2RC4A 3P2HA 1B6BA 2REEA 3DDDA 4YFJA 2B4DB 3TO6A 3UY5A 3B8GA 3GYAA 4UWIA 2HUZA 4KOTA 5C88A 2GANA 4PSXA 3BJ8A 5EC4A 3D8PA 4U5YA 4LX9A 3R9GA 5KTCA 3I9SA 4FD4A 1YVOA 1U6MA 4ORFA 4KVOE 2B5GB 2QMLA 1RXTA 1I21A 4FD6A 2R98A 3IWGA 5HMNA 1XEBA 3R1KA 4KOSA 3TE4A 2PRBA 3D2MA 4KOYA 1S7LA 1KZFA 1P0HA 1IYLA 4R87A 4M3SA 4F0YA 5F49A 4XPKA 5JPHA 2AJ6A 3R95A 1YX0A 1YLEA 1QSRA 4I49A 4UWJA 1NSLA 1GHEA 3LD2A 3VWDA 3D2PA 4RS2A 1XE4A 2PR1A 1Y7RA 4KOWA 3BJ7A 1WWZA 4B5PA 2JDCA 3SXOA 4KOXA 5H84A 4NCZA 4E0AA 4NXYA 4HNXB 2FIWA 2EUIA 3GY9A 2Q4YA 2VZYA 4II9A 4H89A 4Y49B 2OZUA 2Q0YA 2WPWA 5KTDA 2I79A 2PQ8A 3OWCA 3D3SA 3QAHA 1MK4A 4QC6A 3W91A 2NMTA 4JLYA 5IB0A 2Q4VA 2X7BA 4AVBA 1S3ZA 4QVTA 1XMTA 1I1DA 1QSMA 1PUAA 5H86A 3SXNA 2D4OA 1QSOA 2R1IA 3PGPA 2R8VA 4FD5A 5C82A 1Z9UA 2Z0ZA 4KUAA 2B3UA 2Z10A 2PR8A 4RI1A 4U9YA 1B87A 2BUEA 2P6GA 5EBVA 2J8MA 2B4DA 1SQHA 4XNHB 4E8OA 4QUSA 2ATRA 1XIXA 1S7NA 3DR8A 4KVXA 3FIXA 4CS0B 4XPDC 4CRZB 4AG7A 3FNCA 3CXQA 4CAWA 3PP9A 4BMHA 2CNMA 2Z11A 3H4QA 4ZBGA 2BSWA 1YVKA 3DSBA 1CJWA 2J8RA 2OZHA 2B5GA 4KVME 1M4IA 2FIAA 3K9UA 3TO7A 3JVNA 1KUVA 2ZW6A 1RO5A 5DWNA 4HKFA 4J3GA 4B5OA 3KKWA 4X5KA 3I3GA 3EXNA 1L0CA 3G3SA 4E2AA 4QBJA 2VZZA 5F47A 4IUSA 2OB0A 2O28A 1Q2CA 2P0WA 4L8AA
chains in the Genus database with same CATH superfamily
2PJAA 3TCVA 3QAYA 4AVAA 1ON0A 1DE4C 3LACA 2C1CA 4Q38A 3HUVA 4K30A 4AG9A 1FY7A 2ZEHA 4Q7AA 3PZJA 4R3LA 4A94A 5F48A 3B3TA 4PSWA 3SI0A 3QB8A 3B3VA 4MMOA 4R57A 3FH4A 1PU9A 2Z3KA 5LRGA 3EY5A 3IO1A 4RN7A 4H6ZA 5AG5A 4B10A 2QECA 4OP4A 1ELLP 3BXMA 2OZGA 3TOBA 1OZPA 1R3NA 2GREA 4JXQA 5LRJA 4KOVA 1Q2YA 3GUXA 4CGPA 1Z2LA 4B5PB 2V8DA 2P6FA 2AFUA 2F7VA 5D8NA 2AE6A 4UF4A 1KUYA 1IB1E 2R7HA 5G21A 1YQEA 1ARLA 1PYTB 2B4BA 4LQGA 3S9LA 1KWMA 2NSMA 3F8KA 3PB8X 4PK2A 2FT0A 3P2FA 1IYKA 4R7MA 3NFZA 4LUAA 2HV2A 3LODA 4UBRA 1LRZA 1IICA 4UFXA 5G22A 4KUBA 5J8CA 5JQ4A 3A9LA 3E0KA 3N5FA 3NH4A 7CPAA 2FS5A 2AFOA 3GKRA 4F8ZA 1IIDA 1F57A 5IB9A 2J9AA 3NE7A 1Y9KA 2GLFA 4KORA 3V8IA 3R9FA 3QNVA 4B6ZA 5HVHA 5I4MA 1NSAA 3KHZA 4F0XA 4NSQA 4H2KA 4MFZA 5AGEA 4MI4A 4EMEA 4JWPA 2ABZA 2PDOA 3DR6A 4HNWB 3ZZIA 2G3AA 2FSRA 2I00A 2BEIA 1LANA 2YGWA 1YW6A 4WJBA 1HDUA 3KQXA 2VBQA 1V0CA 1S60A 4OLLA 1YGHA 4MRIA 4FD7A 4NGSA 3EFAA 3W6XA 3WC5A 3FF3A 2C27A 3D67A 2POKA 5CNPA 4TNUA 2CNTA 4YGOA 3V7ZA 1ZLIA 2EK8A 1QSNA 2PJCA 4A31A 1YR0A 4NF1A 3ZJ0A 4PXEA 2V77A 2PIZA 2DEAA 2HC9A 4R8FA 2IL4A 4MHDA 3RO0A 3TT2A 4U9ZA 4MCQA 5DWMA 5BWAB 3CXSA 3B7IA 3IFEA 4GS4A 4P4EA 2DPTA 3FECA 3TFYA 4R3KA 2GIVA 3KR5A 5A27A 5KTAA 2G3TA 3PB6X 3R9EA 2HQYA 2FCKA 3S6KA 4MY0A 4KOUA 4MBUA 4KLWA 3PEIA 4H6UA 1YSJA 3D66A 4MXUA 5IV0A 1CM0A 4CAXA 4DNCA 2WYRA 2CXAA 2JLMA 2C6CA 4MY3A 4NGMA 4PV6A 4Y49C 2RB7A 1Z8XA 2ARHA 3VATA 4CGOA 1YK3A 1BPNA 1Y9WA 3VARA 2PSWA 4MJ8A 3F0AA 1S5KA 2Q44A 3FYNA 3JRUA 2F5IA 2K5TA 4F6AA 3H8EA 3LWUA 3FBUA 3CT9A 3N7ZA 2B3VA 1KUXA 3RZAA 3S6FA 4KZTA 2Y0MA 2VEZA 4O23A 2GE3A 2J8NA 3NH8A 3B2YA 4K3NA 2PIYA 3NA6A 2ODFA 1UFHA 2D4PA 8CPAA 3KQZA 5J8FA 2YNDA 4AXVA 2FVGA 1XFOA 3F5BA 2PC1A 3EO4A 4MHNA 1BLLE 3FRMA 1P4NA 3TTHA 3IWEA 1MJBA 4P4FA 2Q4ZA 2ZW4A 2BL1A 3GIUA 4M6GA 2WPXA 3RYOA 4CPAA 2QIRA 2ZOFA 4YRHA 4KS9A 4QB9A 5LRKA 2ZEPA 3TOAA 2H5MA 4P45A 1ARMA 2Z3PA 4IF5A 1CBXA 1IY7A 3FB3A 3DGVA 3S6GA 4CAVA 3D7HA 4CRYB 3HLPA 4KSAA 1VHSA 2PJBA 4OC4A 3SJGA 2VXKA 1TKJA 4P6YA 3RBUA 1ZLHA 2Z3OA 3SJFA 1QQ9A 5LYIA 1K4JA 4C2ZA 5K8OA 2PJ4A 2FXFA 2GLJA 4MFQA 2JBJA 1YMEA 3KL9A 1MJAA 3T9YA 1YREA 2VQYA 1Z4EA 4NJRA 3K2KA 5E96A 2EWBA 5FVJA 1M44A 5GCNA 3V38A 3W6SA 4L89A 1NE9A 1Q7LA 1WK4A 1ZG8A 3FX6A 3ISZA 3R96A 5I0CA 1QSTA 2FE7A 2OH1A 2AFZA 2OOTA 4DJLA 2ZXVA 3SHPA 4XNHC 2CY2A 2ZEMA 3KZWA 4NEXA 4OC3A 4OMEA 4A38A 4JJXA 1S7KA 2P6EA 1N71A 1BOBA 1TIQA 5EMIA 3T90A 2EVNA 2Q04A 4ZI6A 3D7DA 4JD6A 2ANPA 3DLJA 3PB4X 3PRTA 4G1PA 4A33A 3EC4A 3S9NA 4A32A 3RNZA 3SJXA 2ZW5A 4UCMA 1MJ9A 2PJ6A 2CTCA 4PK3A 2OR4A 4R9MA 4UCNA 4CYOA 2PJ9A 2DXQA 4MFPA 4R76A 1VHOA 1S7FA 1I12A 1H8LA 1BO4A 2EO8A 3BI1A 3NE8A 4B14A 4P10A 2ZW7A 3IGRA 2VI7A 2CF4A 5LYLA 3RAMA 3G8WA 2WUUA 3IWWA 2ZPAA 2QJ8A 3WR7A 2JEVA 3FXTA 3WC6A 1X12A 4FAIA 1HDQA 1TXRA 2RFHA 5G20A 2JEWA 2PJ5A 4BD9A 2PRQA 3K9TA 4HNYB 3VWEA 1F2PA 3CXPA 2Q7BA 5HH1A 4CAEA 1NMTA 4R6TA 2OU2A 4FBEA 5ISVA 4M85A 4XPDB 1J4JA 3TO9A 1TKFA 2B58A 3KI9A 3LMSA 4KLVA 1M4GA 1VIXA 4ONUA 4P44A 1M4DA 2CNSA 2AFXA 3DNSA 2AFMA 2KCWA 4OC0A 2A4NA 4ONWA 3PFEA 4P4JA 4UCPA 4A30A 2REFA 3MGDA 4TWEA 4CAFA 2V8GA 4UA3A 2WZNA 4AB7A 4MCSA 4C7IA 5IX3A 3C26A 3TX8A 2FL4A 1Z4RA 1VKCA 3JUWA 5JM6A 3I1UA 4F9VA 2ZEDA 1R57A 2NYQA 2ZELA 2YNCC 1XF8A 1ZG7A 5F46A 2G0BA 4XPLA 4OC5A 4UEEA 1LFWA 3PB7X 5J1QA 1DTDA 2JDDA 3BI0A 2JBKA 3CPAA 1XOVA 2Z3LA 3FJUA 4JXRA 2XEIA 4OAEA 3S6HA 1VGYA 1M1DA 1YLOA 4CGNA 1XJOA 1Q2DA 4OADA 2ZEGA 2RC4A 2PJ0A 3BLNA 3P2HA 4ZY1A 1B6BA 2REEA 2GFQA 5HVGA 4RUHA 3IJ3A 3KR4A 3DDDA 1AMPA 4YFJA 2B4DB 4NGNA 3TO6A 4PXCA 1XBUA 1QMUA 3UY5A 3WT4A 3B8GA 2ZOGA 1GYTA 1TF8A 2ZENA 3GYAA 1XRYA 4UWIA 2HUZA 4KOTA 4MCPA 4UEFA 5C88A 2O4HA 2GANA 2PJ7A 1ZO0A 4PSXA 5A28A 3BJ8A 4W9YA 2QVPA 3D8PA 5EC4A 4A37A 5D29A 4EFDA 3GB0A 3PBBA 4U5YA 1Y0RA 2AFSA 2VL1A 2Z3NA 4LX9A 3R9GA 5KTCA 3I9SA 2F8HA 4FD4A 3WC7A 2G9DA 1YVOA 1U6MA 4ORFA 4UFWA 3KGQA 4NGRA 1IGBA 4KVOE 4PXDA 4C68A 2B5GB 5CBMA 2QMLA 1RXTA 2XEFA 1I21A 4FD6A 2Q43A 4IHMA 5K8PA 2R98A 3IWGA 4KSFA 5HMNA 4UIAA 2ZEEA 4GXHA 4CYPA 3FEEA 2C6PA 4LQ6A 1XEBA 3SI1A 4ZY2A 2O53A 3MN8A 3R1KA 4KOSA 5HVFA 4F9UA 3TE4A 2PE3A 2PRBA 2V8VA 3D2MA 4KOYA 4CYQA 2PVWA 3H8FA 1S7LA 1KZFA 1P0HA 1IYLA 4R87A 4M3SA 3D7GA 4F0YA 5F49A 4BBHA 1JWQA 4IAVA 3KASA 4P4BA 4XPKA 3T8WA 2AFWA 2AJ6A 3R95A 1YX0A 4C7HA 5JPHA 1YLEA 1QSRA 2PCUA 4I49A 4UWJA 4YU9A 1NSLA 4UIBA 2CIJA 3D4UA 2PJ2A 1GHEA 3LD2A 2HB6A 5CPAA 3VWDA 4ZYQA 2YNCA 3D2PA 4RS2A 1Y7EA 1XE4A 4BINA 2PR1A 5K8MA 1FT7A 3FVLA 1TF9A 4Z65A 4ZGYB 4WWVA 1Y7RA 4KOWA 4P4DA 3WABA 2I3CA 1Z5RA 3BJ7A 1WWZA 4B5PA 2PVVA 3H8GA 4X8IA 1AUGA 3D7FA 3S9MA 2JDCA 3KHXA 5ELYA 3IU1A 4NGQA 4KOXA 2GU2A 5H84A 4NCZA 3SXOA 4E0AA 4NXYA 4HNXB 2FIWA 2EBJA 2EUIA 3JTKA 4PPZA 3GY9A 4YWYA 4DYOA 2Q4YA 2VZYA 4MFLA 4OIDA 4II9A 1IU8A 1LAMA 2QYVA 4H89A 4Y49B 2OZUA 4MHZA 2Q0YA 1ELMP 3L2NA 2IQ6A 2XEGA 2IMOA 2WPWA 3IU2A 4MHPA 2C6GA 5KTDA 2I79A 2PQ8A 4GM5A 4JYWA 3B35A 4MHYA 1CG2A 4UEZA 3OWCA 2BCOA 3D3SA 3QAHA 4C2XA 5AG6A 1CX8A 4NJQA 2Z3MA 1MK4A 3IC1A 4NGTA 2DPSA 4QC6A 1A2ZA 1M4LA 2NMTA 5DS0A 3W91A 4JLYA 5IB0A 3CDXA 4OC1A 1Z8WA 2Q4VA 4EWTA 1LCPA 2X7BA 4AVBA 1S3ZA 4QVTA 1XMTA 1CP7A 4A2ZA 4NGPA 1I1DA 3CPXA 4OKOA 1QSMA 4PXBA 1HEEA 1PUAA 3CZXA 4MFJA 5H86A 2V8HA 4HPSA 3SXNA 2D4OA 1CPXA 4IK2A 1QSOA 3SI2A 2R1IA 2EK9A 1F2OA 3PGPA 3ISXA 1AYEA 2IJZA 2R8VA 4FD5A 5C82A 3H5ZA 1Z9UA 2Z0ZA 4KUAA 2PJ1A 2B3UA 4P4IA 2Z10A 2PR8A 4RI1A 5THWA 4KSIA 4U9YA 1B87A 1Y0YA 2BUEA 2P6GA 1IOIA 1EE3P 4OC2A 5EBVA 3B3WA 4CYNA 2BO9A 4ZX8A 4CGMA 1LAPA 3B3CA 4B12A 1ZG9A 2J8MA 2WSAA 4A95A 2B4DA 1Z8LA 5HXDA 1SQHA 4B13A 4XNHB 4X3RA 4NFRA 4E8OA 3FMCA 4QUSA 4FWUA 3VH9A 2ATRA 1XIXA 1S7NA 4MCRA 3DR8A 1XMBA 2ZEFA 4FUUA 4ZX9A 4B11A 4DUKA 5F09A 4CGLA 4KVXA 2CTBA 3FIXA 1RTQA 3FEDA 5JGFA 4X2TA 4C2YA 4CS0B 1Z8TA 5K8NA 4XPDC 4CRZB 4AG7A 4ZY0A 3FNCA 4Q36A 3CXQA 3BHXA 4UFVA 1BPMA 3SJEA 4CAWA 1LOKA 1VHEA 3PP9A 1CPSA 4BMHA 2PJ8A 1PCAA 4A39A 2CNMA 2Z11A 1IOFA 3H4QA 3PFOA 4EVYA 2BOAA 5JH9A 4ZBGA 4MFKA 2BSWA 1YVKA 1BAVA 2PJ3A 3DSBA 3GLJA 4PQAA 1CJWA 5G1ZA 3TC8A 2DF5A 5LYFA 2J8RA 2OZHA 2B5GA 3PBEA 4KVME 4M6IA 5LYDA 1M4IA 3NH5A 1OBRA 2FIAA 3K9UA 3TO7A 3JVNA 5AG7A 1KUVA 2ZW6A 2YNEA 1FNOA 1RO5A 1UWYA 4HKFA 4OIWA 5DWNA 4J3GA 4B5OA 1CP6A 1R43A 3PB9X 1X10A 3KKWA 3D68A 4JZ0A 3MRUA 4M6HA 4X5KA 3B3SA 3I3GA 3EXNA 1YW4A 1L0CA 2Q7SA 2ZEOA 3G3SA 4E2AA 4QBJA 2VZZA 5F47A 3IIBA 4AVCA 3IEHA 6CPAA 1JQGA 4IUSA 2OB0A 2XEJA 5AG4A 1TKHA 1Q2CA 2O28A 2Q51A 2P0WA 4L8AA
chains in the Genus database with same CATH topology
3TCVA 4AVAA 1ON0A 4Q38A 4K30A 4AG9A 1FY7A 3PZJA 4R3LA 5F48A 4PSWA 3QB8A 4R57A 1PU9A 2Z3KA 4B10A 3EY5A 5AG5A 4H6ZA 2QECA 3TOBA 2OZGA 1OZPA 4CGPA 4JXQA 4KOVA 1Q2YA 4B5PB 2P6FA 2AE6A 5G21A 1KUYA 1IB1E 2R7HA 2B4BA 3F8KA 4PK2A 2FT0A 3P2FA 1IYKA 4LUAA 4UBRA 2HV2A 3LODA 4UFXA 1LRZA 1IICA 5G22A 5J8CA 4KUBA 5JQ4A 3A9LA 3E0KA 2FS5A 3GKRA 1IIDA 3NE7A 1Y9KA 3V8IA 4KORA 3R9FA 4F0XA 4NSQA 4MFZA 5AGEA 4MI4A 4JWPA 2PDOA 3DR6A 4HNWB 3ZZIA 2G3AA 2FSRA 2I00A 2BEIA 2YGWA 2VBQA 1V0CA 1S60A 4OLLA 1YGHA 4FD7A 3EFAA 3W6XA 2C27A 5CNPA 2CNTA 4YGOA 1QSNA 4A31A 1YR0A 4NF1A 3ZJ0A 2IL4A 4MHDA 3TT2A 4U9ZA 5BWAB 5DWMA 3CXSA 4GS4A 2DPTA 3TFYA 4R3KA 2GIVA 5A27A 5KTAA 2G3TA 3R9EA 2HQYA 2FCKA 3S6KA 4MY0A 4KOUA 4MBUA 4KLWA 4H6UA 5IV0A 1CM0A 4CAXA 4DNCA 2CXAA 2JLMA 4MY3A 4Y49C 4PV6A 4CGOA 2ARHA 1YK3A 1Y9WA 2PSWA 4MJ8A 3F0AA 1S5KA 2Q44A 3FYNA 2F5IA 2K5TA 4F6AA 3FBUA 3N7ZA 2B3VA 1KUXA 3S6FA 4KZTA 2Y0MA 2VEZA 2GE3A 2J8NA 1UFHA 2D4PA 5J8FA 2YNDA 3F5BA 2PC1A 3EO4A 3FRMA 1P4NA 3TTHA 3IWEA 1MJBA 2ZW4A 2BL1A 2WPXA 3RYOA 2QIRA 4YRHA 4KS9A 4QB9A 3TOAA 2H5MA 2Z3PA 4IF5A 3FB3A 3S6GA 4CAVA 4CRYB 4KSAA 1VHSA 2VXKA 2Z3OA 1K4JA 4C2ZA 4MFQA 2FXFA 1MJAA 3T9YA 1YREA 2VQYA 1Z4EA 5E96A 5FVJA 5GCNA 3W6SA 1M44A 4L89A 1NE9A 3R96A 1WK4A 5I0CA 1QSTA 2FE7A 2OH1A 2ZXVA 3SHPA 4XNHC 2CY2A 4NEXA 4JJXA 1S7KA 2P6EA 1N71A 1BOBA 1TIQA 3T90A 2EVNA 2Q04A 4JD6A 4A33A 3EC4A 4A32A 2ZW5A 4UCMA 1MJ9A 4PK3A 4R9MA 4UCNA 4CYOA 2DXQA 4MFPA 1S7FA 1I12A 1BO4A 4B14A 2ZW7A 3IGRA 2VI7A 3G8WA 2WUUA 2ZPAA 3WR7A 2JEVA 3FXTA 5G20A 4HNYB 3VWEA 3CXPA 2Q7BA 5HH1A 4CAEA 1NMTA 2OU2A 5ISVA 4M85A 4XPDB 1J4JA 3TO9A 2B58A 4KLVA 1M4GA 4ONUA 1M4DA 2CNSA 3DNSA 2KCWA 2A4NA 4A30A 4UCPA 2REFA 3MGDA 4CAFA 4UA3A 4AB7A 4C7IA 5IX3A 3C26A 2FL4A 1Z4RA 1VKCA 3JUWA 1R57A 2YNCC 1XF8A 5F46A 2G0BA 4XPLA 2JDDA 4OAEA 4AVCA 4EVYA 2Z3LA 4JXRA 3S6HA 1M1DA 4CGNA 1Q2DA 4OADA 3BLNA 2RC4A 3P2HA 1B6BA 2REEA 3DDDA 4YFJA 2B4DB 3TO6A 3UY5A 3B8GA 3GYAA 4UWIA 2HUZA 4KOTA 5C88A 2GANA 1ZO0A 4PSXA 5A28A 3BJ8A 5EC4A 3D8PA 4U5YA 2Z3NA 4LX9A 3R9GA 5KTCA 3I9SA 4FD4A 1YVOA 1U6MA 4ORFA 4UFWA 4KVOE 4C68A 2B5GB 2QMLA 1RXTA 1I21A 4FD6A 2R98A 3IWGA 4KSFA 5HMNA 4CYPA 1XEBA 3R1KA 4KOSA 3TE4A 2PRBA 3D2MA 4CYQA 4KOYA 1S7LA 1KZFA 1P0HA 1IYLA 4R87A 4M3SA 4F0YA 5F49A 4BBHA 4XPKA 5JPHA 2AJ6A 3R95A 1YX0A 4C7HA 1YLEA 1QSRA 4I49A 4UWJA 1NSLA 1GHEA 3LD2A 3VWDA 2YNCA 3D2PA 4RS2A 1XE4A 2PR1A 4ZGYB 1Y7RA 4KOWA 3BJ7A 1WWZA 4B5PA 2JDCA 3SXOA 3IU1A 4KOXA 5H84A 4NCZA 4E0AA 4NXYA 4HNXB 2FIWA 2EUIA 3JTKA 3GY9A 2Q4YA 2VZYA 4MFLA 4II9A 4H89A 4Y49B 2OZUA 2Q0YA 3IU2A 2WPWA 5KTDA 2I79A 2PQ8A 3OWCA 3D3SA 3QAHA 4C2XA 5AG6A 2Z3MA 1MK4A 4QC6A 2DPSA 3W91A 2NMTA 4JLYA 5IB0A 2Q4VA 2X7BA 4AVBA 1S3ZA 4QVTA 1XMTA 4A2ZA 1I1DA 1QSMA 1PUAA 5H86A 4MFJA 3SXNA 2D4OA 1QSOA 2R1IA 3PGPA 4FD5A 2R8VA 5C82A 3H5ZA 1Z9UA 2Z0ZA 4KUAA 2B3UA 2Z10A 2PR8A 4RI1A 4U9YA 1B87A 2BUEA 2P6GA 5EBVA 4CYNA 4CGMA 4B12A 2J8MA 2WSAA 4A95A 2B4DA 1SQHA 4B13A 4XNHB 4E8OA 4QUSA 2ATRA 1XIXA 1S7NA 3DR8A 4B11A 4CGLA 4KVXA 3FIXA 4C2YA 4CS0B 4XPDC 4CRZB 4AG7A 3FNCA 4Q36A 3CXQA 4UFVA 4CAWA 3PP9A 4BMHA 2CNMA 2Z11A 3H4QA 4ZBGA 4MFKA 2BSWA 1YVKA 3DSBA 5G1ZA 1CJWA 2J8RA 2OZHA 2B5GA 4KVME 1M4IA 2FIAA 3K9UA 3TO7A 3JVNA 5AG7A 1KUVA 2ZW6A 2YNEA 1RO5A 5DWNA 4HKFA 4J3GA 4B5OA 3KKWA 4X5KA 3I3GA 3EXNA 1L0CA 3G3SA 4E2AA 4QBJA 2VZZA 5F47A 4IUSA 2OB0A 5AG4A 2O28A 1Q2CA 2P0WA 4L8AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TCV A;  4AVA A;  1ON0 A;  4K30 A;  4AG9 A;  1FY7 A;  3PZJ A;  4R3L A;  5F48 A;  4PSW A;  3QB8 A;  4R57 A;  1PU9 A;  3EY5 A;  4H6Z A;  2QEC A;  3TOB A;  2OZG A;  1OZP A;  4JXQ A;  4KOV A;  1Q2Y A;  4B5P B;  2P6F A;  2AE6 A;  1KUY A;  1IB1 E;  2R7H A;  2B4B A;  3F8K A;  4PK2 A;  2FT0 A;  3P2F A;  1IYK A;  4LUA A;  4UBR A;  2HV2 A;  3LOD A;  1LRZ A;  1IIC A;  5J8C A;  5JQ4 A;  4KUB A;  3E0K A;  2FS5 A;  3GKR A;  1IID A;  3NE7 A;  1Y9K A;  3V8I A;  4KOR A;  3R9F A;  4NSQ A;  4MI4 A;  4JWP A;  2PDO A;  3DR6 A;  4HNW B;  3ZZI A;  2G3A A;  2FSR A;  2I00 A;  2BEI A;  2VBQ A;  1V0C A;  1S60 A;  4OLL A;  1YGH A;  4FD7 A;  3EFA A;  3W6X A;  2C27 A;  5CNP A;  2CNT A;  4YGO A;  1QSN A;  1YR0 A;  4NF1 A;  3ZJ0 A;  2IL4 A;  4MHD A;  3TT2 A;  4U9Z A;  5DWM A;  3CXS A;  4GS4 A;  3TFY A;  4R3K A;  2GIV A;  5KTA A;  2G3T A;  3R9E A;  2HQY A;  2FCK A;  3S6K A;  4MY0 A;  4KOU A;  4MBU A;  4KLW A;  4H6U A;  5IV0 A;  1CM0 A;  4CAX A;  4DNC A;  4MY3 A;  2JLM A;  4Y49 C;  4PV6 A;  2ARH A;  1YK3 A;  1Y9W A;  2PSW A;  4MJ8 A;  3F0A A;  1S5K A;  2Q44 A;  3FYN A;  2F5I A;  2K5T A;  4F6A A;  3FBU A;  3N7Z A;  2B3V A;  1KUX A;  3S6F A;  4KZT A;  2Y0M A;  2VEZ A;  2GE3 A;  2J8N A;  1UFH A;  2D4P A;  5J8F A;  3F5B A;  2PC1 A;  3EO4 A;  3FRM A;  1P4N A;  3TTH A;  1MJB A;  2ZW4 A;  2BL1 A;  2WPX A;  3RYO A;  2QIR A;  4YRH A;  4QB9 A;  3TOA A;  2H5M A;  4IF5 A;  3FB3 A;  3S6G A;  4CAV A;  4CRY B;  1VHS A;  2VXK A;  1K4J A;  2FXF A;  1MJA A;  3T9Y A;  1YRE A;  2VQY A;  1Z4E A;  5E96 A;  5FVJ A;  5GCN A;  3W6S A;  1M44 A;  4L89 A;  1NE9 A;  3R96 A;  1WK4 A;  5I0C A;  1QST A;  2FE7 A;  2OH1 A;  2ZXV A;  3SHP A;  4XNH C;  2CY2 A;  4NEX A;  4JJX A;  1S7K A;  2P6E A;  1N71 A;  1BOB A;  1TIQ A;  3T90 A;  2EVN A;  2Q04 A;  4JD6 A;  3EC4 A;  2ZW5 A;  1MJ9 A;  4PK3 A;  4R9M A;  2DXQ A;  1S7F A;  1I12 A;  1BO4 A;  2ZW7 A;  3IGR A;  2VI7 A;  3G8W A;  2ZPA A;  3WR7 A;  2JEV A;  3FXT A;  4HNY B;  3VWE A;  3CXP A;  2Q7B A;  5HH1 A;  1NMT A;  2OU2 A;  5ISV A;  4M85 A;  4XPD B;  1J4J A;  3TO9 A;  2B58 A;  4KLV A;  1M4G A;  4ONU A;  1M4D A;  2CNS A;  3DNS A;  2KCW A;  2A4N A;  2REF A;  3MGD A;  4UA3 A;  4AB7 A;  5IX3 A;  3C26 A;  2FL4 A;  1Z4R A;  1VKC A;  3JUW A;  1R57 A;  1XF8 A;  5F46 A;  2G0B A;  4XPL A;  2JDD A;  4OAE A;  4AVC A;  4EVY A;  4JXR A;  3S6H A;  1M1D A;  1Q2D A;  4OAD A;  3BLN A;  2RC4 A;  3P2H A;  1B6B A;  2REE A;  3DDD A;  4YFJ A;  2B4D B;  3TO6 A;  3UY5 A;  3B8G A;  3GYA A;  4UWI A;  2HUZ A;  4KOT A;  5C88 A;  2GAN A;  4PSX A;  3BJ8 A;  5EC4 A;  3D8P A;  4U5Y A;  4LX9 A;  3R9G A;  5KTC A;  3I9S A;  4FD4 A;  1YVO A;  1U6M A;  4ORF A;  4KVO E;  2B5G B;  2QML A;  1RXT A;  1I21 A;  4FD6 A;  2R98 A;  3IWG A;  5HMN A;  1XEB A;  3R1K A;  4KOS A;  3TE4 A;  2PRB A;  3D2M A;  4KOY A;  1S7L A;  1KZF A;  1P0H A;  1IYL A;  4R87 A;  4M3S A;  4F0Y A;  5F49 A;  4XPK A;  5JPH A;  2AJ6 A;  3R95 A;  1YX0 A;  1YLE A;  1QSR A;  4I49 A;  4UWJ A;  1NSL A;  1GHE A;  3LD2 A;  3VWD A;  3D2P A;  4RS2 A;  1XE4 A;  2PR1 A;  1Y7R A;  4KOW A;  3BJ7 A;  1WWZ A;  4B5P A;  2JDC A;  3SXO A;  4KOX A;  5H84 A;  4NCZ A;  4E0A A;  4NXY A;  4HNX B;  2FIW A;  2EUI A;  3GY9 A;  2Q4Y A;  2VZY A;  4II9 A;  4H89 A;  4Y49 B;  2OZU A;  2Q0Y A;  2WPW A;  5KTD A;  2I79 A;  2PQ8 A;  3OWC A;  3D3S A;  3QAH A;  1MK4 A;  4QC6 A;  3W91 A;  2NMT A;  4JLY A;  5IB0 A;  2Q4V A;  2X7B A;  4AVB A;  1S3Z A;  4QVT A;  1XMT A;  1I1D A;  1QSM A;  1PUA A;  5H86 A;  3SXN A;  2D4O A;  1QSO A;  2R1I A;  3PGP A;  2R8V A;  4FD5 A;  5C82 A;  1Z9U A;  2Z0Z A;  4KUA A;  2B3U A;  2Z10 A;  2PR8 A;  4RI1 A;  4U9Y A;  1B87 A;  2BUE A;  2P6G A;  5EBV A;  2J8M A;  2B4D A;  1SQH A;  4XNH B;  4E8O A;  4QUS A;  2ATR A;  1XIX A;  1S7N A;  3DR8 A;  4KVX A;  3FIX A;  4CS0 B;  4XPD C;  4CRZ B;  4AG7 A;  3FNC A;  3CXQ A;  4CAW A;  3PP9 A;  4BMH A;  2CNM A;  2Z11 A;  3H4Q A;  4ZBG A;  2BSW A;  1YVK A;  3DSB A;  1CJW A;  2J8R A;  2OZH A;  2B5G A;  4KVM E;  1M4I A;  2FIA A;  3K9U A;  3TO7 A;  3JVN A;  1KUV A;  2ZW6 A;  1RO5 A;  5DWN A;  4HKF A;  4J3G A;  4B5O A;  3KKW A;  4X5K A;  3I3G A;  3EXN A;  1L0C A;  3G3S A;  4E2A A;  4QBJ A;  2VZZ A;  5F47 A;  4IUS A;  2OB0 A;  2O28 A;  1Q2C A;  2P0W A;  4L8A A; 
#chains in the Genus database with same CATH topology
 2PJA A;  3TCV A;  3QAY A;  4AVA A;  1ON0 A;  1DE4 C;  3LAC A;  2C1C A;  4Q38 A;  3HUV A;  4K30 A;  4AG9 A;  1FY7 A;  2ZEH A;  4Q7A A;  3PZJ A;  4R3L A;  4A94 A;  5F48 A;  3B3T A;  4PSW A;  3SI0 A;  3QB8 A;  3B3V A;  4MMO A;  4R57 A;  3FH4 A;  1PU9 A;  2Z3K A;  5LRG A;  3EY5 A;  3IO1 A;  4RN7 A;  4H6Z A;  5AG5 A;  4B10 A;  2QEC A;  4OP4 A;  1ELL P;  3BXM A;  2OZG A;  3TOB A;  1OZP A;  1R3N A;  2GRE A;  4JXQ A;  5LRJ A;  4KOV A;  1Q2Y A;  3GUX A;  4CGP A;  1Z2L A;  4B5P B;  2V8D A;  2P6F A;  2AFU A;  2F7V A;  5D8N A;  2AE6 A;  4UF4 A;  1KUY A;  1IB1 E;  2R7H A;  5G21 A;  1YQE A;  1ARL A;  1PYT B;  2B4B A;  4LQG A;  3S9L A;  1KWM A;  2NSM A;  3F8K A;  3PB8 X;  4PK2 A;  2FT0 A;  3P2F A;  1IYK A;  4R7M A;  3NFZ A;  4LUA A;  2HV2 A;  3LOD A;  4UBR A;  1LRZ A;  1IIC A;  4UFX A;  5G22 A;  4KUB A;  5J8C A;  5JQ4 A;  3A9L A;  3E0K A;  3N5F A;  3NH4 A;  7CPA A;  2FS5 A;  2AFO A;  3GKR A;  4F8Z A;  1IID A;  1F57 A;  5IB9 A;  2J9A A;  3NE7 A;  1Y9K A;  2GLF A;  4KOR A;  3V8I A;  3R9F A;  3QNV A;  4B6Z A;  5HVH A;  5I4M A;  1NSA A;  3KHZ A;  4F0X A;  4NSQ A;  4H2K A;  4MFZ A;  5AGE A;  4MI4 A;  4EME A;  4JWP A;  2ABZ A;  2PDO A;  3DR6 A;  4HNW B;  3ZZI A;  2G3A A;  2FSR A;  2I00 A;  2BEI A;  1LAN A;  2YGW A;  1YW6 A;  4WJB A;  1HDU A;  3KQX A;  2VBQ A;  1V0C A;  1S60 A;  4OLL A;  1YGH A;  4MRI A;  4FD7 A;  4NGS A;  3EFA A;  3W6X A;  3WC5 A;  3FF3 A;  2C27 A;  3D67 A;  2POK A;  5CNP A;  4TNU A;  2CNT A;  4YGO A;  3V7Z A;  1ZLI A;  2EK8 A;  1QSN A;  2PJC A;  4A31 A;  1YR0 A;  4NF1 A;  3ZJ0 A;  4PXE A;  2V77 A;  2PIZ A;  2DEA A;  2HC9 A;  4R8F A;  2IL4 A;  4MHD A;  3RO0 A;  3TT2 A;  4U9Z A;  4MCQ A;  5DWM A;  5BWA B;  3CXS A;  3B7I A;  3IFE A;  4GS4 A;  4P4E A;  2DPT A;  3FEC A;  3TFY A;  4R3K A;  2GIV A;  3KR5 A;  5A27 A;  5KTA A;  2G3T A;  3PB6 X;  3R9E A;  2HQY A;  2FCK A;  3S6K A;  4MY0 A;  4KOU A;  4MBU A;  4KLW A;  3PEI A;  4H6U A;  1YSJ A;  3D66 A;  4MXU A;  5IV0 A;  1CM0 A;  4CAX A;  4DNC A;  2WYR A;  2CXA A;  2JLM A;  2C6C A;  4MY3 A;  4NGM A;  4PV6 A;  4Y49 C;  2RB7 A;  1Z8X A;  2ARH A;  3VAT A;  4CGO A;  1YK3 A;  1BPN A;  1Y9W A;  3VAR A;  2PSW A;  4MJ8 A;  3F0A A;  1S5K A;  2Q44 A;  3FYN A;  3JRU A;  2F5I A;  2K5T A;  4F6A A;  3H8E A;  3LWU A;  3FBU A;  3CT9 A;  3N7Z A;  2B3V A;  1KUX A;  3RZA A;  3S6F A;  4KZT A;  2Y0M A;  2VEZ A;  4O23 A;  2GE3 A;  2J8N A;  3NH8 A;  3B2Y A;  4K3N A;  2PIY A;  3NA6 A;  2ODF A;  1UFH A;  2D4P A;  8CPA A;  3KQZ A;  5J8F A;  2YND A;  4AXV A;  2FVG A;  1XFO A;  3F5B A;  2PC1 A;  3EO4 A;  4MHN A;  1BLL E;  3FRM A;  1P4N A;  3TTH A;  3IWE A;  1MJB A;  4P4F A;  2Q4Z A;  2ZW4 A;  2BL1 A;  3GIU A;  4M6G A;  2WPX A;  3RYO A;  4CPA A;  2QIR A;  2ZOF A;  4YRH A;  4KS9 A;  4QB9 A;  5LRK A;  2ZEP A;  3TOA A;  2H5M A;  4P45 A;  1ARM A;  2Z3P A;  4IF5 A;  1CBX A;  1IY7 A;  3FB3 A;  3DGV A;  3S6G A;  4CAV A;  3D7H A;  4CRY B;  3HLP A;  4KSA A;  1VHS A;  2PJB A;  4OC4 A;  3SJG A;  2VXK A;  1TKJ A;  4P6Y A;  3RBU A;  1ZLH A;  2Z3O A;  3SJF A;  1QQ9 A;  5LYI A;  1K4J A;  4C2Z A;  5K8O A;  2PJ4 A;  2FXF A;  2GLJ A;  4MFQ A;  2JBJ A;  1YME A;  3KL9 A;  1MJA A;  3T9Y A;  1YRE A;  2VQY A;  1Z4E A;  4NJR A;  3K2K A;  5E96 A;  2EWB A;  5FVJ A;  1M44 A;  5GCN A;  3V38 A;  3W6S A;  4L89 A;  1NE9 A;  1Q7L A;  1WK4 A;  1ZG8 A;  3FX6 A;  3ISZ A;  3R96 A;  5I0C A;  1QST A;  2FE7 A;  2OH1 A;  2AFZ A;  2OOT A;  4DJL A;  2ZXV A;  3SHP A;  4XNH C;  2CY2 A;  2ZEM A;  3KZW A;  4NEX A;  4OC3 A;  4OME A;  4A38 A;  4JJX A;  1S7K A;  2P6E A;  1N71 A;  1BOB A;  1TIQ A;  5EMI A;  3T90 A;  2EVN A;  2Q04 A;  4ZI6 A;  3D7D A;  4JD6 A;  2ANP A;  3DLJ A;  3PB4 X;  3PRT A;  4G1P A;  4A33 A;  3EC4 A;  3S9N A;  4A32 A;  3RNZ A;  3SJX A;  2ZW5 A;  4UCM A;  1MJ9 A;  2PJ6 A;  2CTC A;  4PK3 A;  2OR4 A;  4R9M A;  4UCN A;  4CYO A;  2PJ9 A;  2DXQ A;  4MFP A;  4R76 A;  1VHO A;  1S7F A;  1I12 A;  1H8L A;  1BO4 A;  2EO8 A;  3BI1 A;  3NE8 A;  4B14 A;  4P10 A;  2ZW7 A;  3IGR A;  2VI7 A;  2CF4 A;  5LYL A;  3RAM A;  3G8W A;  2WUU A;  3IWW A;  2ZPA A;  2QJ8 A;  3WR7 A;  2JEV A;  3FXT A;  3WC6 A;  1X12 A;  4FAI A;  1HDQ A;  1TXR A;  2RFH A;  5G20 A;  2JEW A;  2PJ5 A;  4BD9 A;  2PRQ A;  3K9T A;  4HNY B;  3VWE A;  1F2P A;  3CXP A;  2Q7B A;  5HH1 A;  4CAE A;  1NMT A;  4R6T A;  2OU2 A;  4FBE A;  5ISV A;  4M85 A;  4XPD B;  1J4J A;  3TO9 A;  1TKF A;  2B58 A;  3KI9 A;  3LMS A;  4KLV A;  1M4G A;  1VIX A;  4ONU A;  4P44 A;  1M4D A;  2CNS A;  2AFX A;  3DNS A;  2AFM A;  2KCW A;  4OC0 A;  2A4N A;  4ONW A;  3PFE A;  4P4J A;  4UCP A;  4A30 A;  2REF A;  3MGD A;  4TWE A;  4CAF A;  2V8G A;  4UA3 A;  2WZN A;  4AB7 A;  4MCS A;  4C7I A;  5IX3 A;  3C26 A;  3TX8 A;  2FL4 A;  1Z4R A;  1VKC A;  3JUW A;  5JM6 A;  3I1U A;  4F9V A;  2ZED A;  1R57 A;  2NYQ A;  2ZEL A;  2YNC C;  1XF8 A;  1ZG7 A;  5F46 A;  2G0B A;  4XPL A;  4OC5 A;  4UEE A;  1LFW A;  3PB7 X;  5J1Q A;  1DTD A;  2JDD A;  3BI0 A;  2JBK A;  3CPA A;  1XOV A;  2Z3L A;  3FJU A;  4JXR A;  2XEI A;  4OAE A;  3S6H A;  1VGY A;  1M1D A;  1YLO A;  4CGN A;  1XJO A;  1Q2D A;  4OAD A;  2ZEG A;  2RC4 A;  2PJ0 A;  3BLN A;  3P2H A;  4ZY1 A;  1B6B A;  2REE A;  2GFQ A;  5HVG A;  4RUH A;  3IJ3 A;  3KR4 A;  3DDD A;  1AMP A;  4YFJ A;  2B4D B;  4NGN A;  3TO6 A;  4PXC A;  1XBU A;  1QMU A;  3UY5 A;  3WT4 A;  3B8G A;  2ZOG A;  1GYT A;  1TF8 A;  2ZEN A;  3GYA A;  1XRY A;  4UWI A;  2HUZ A;  4KOT A;  4MCP A;  4UEF A;  5C88 A;  2O4H A;  2GAN A;  2PJ7 A;  1ZO0 A;  4PSX A;  5A28 A;  3BJ8 A;  4W9Y A;  2QVP A;  3D8P A;  5EC4 A;  4A37 A;  5D29 A;  4EFD A;  3GB0 A;  3PBB A;  4U5Y A;  1Y0R A;  2AFS A;  2VL1 A;  2Z3N A;  4LX9 A;  3R9G A;  5KTC A;  3I9S A;  2F8H A;  4FD4 A;  3WC7 A;  2G9D A;  1YVO A;  1U6M A;  4ORF A;  4UFW A;  3KGQ A;  4NGR A;  1IGB A;  4KVO E;  4PXD A;  4C68 A;  2B5G B;  5CBM A;  2QML A;  1RXT A;  2XEF A;  1I21 A;  4FD6 A;  2Q43 A;  4IHM A;  5K8P A;  2R98 A;  3IWG A;  4KSF A;  5HMN A;  4UIA A;  2ZEE A;  4GXH A;  4CYP A;  3FEE A;  2C6P A;  4LQ6 A;  1XEB A;  3SI1 A;  4ZY2 A;  2O53 A;  3MN8 A;  3R1K A;  4KOS A;  5HVF A;  4F9U A;  3TE4 A;  2PE3 A;  2PRB A;  2V8V A;  3D2M A;  4KOY A;  4CYQ A;  2PVW A;  3H8F A;  1S7L A;  1KZF A;  1P0H A;  1IYL A;  4R87 A;  4M3S A;  3D7G A;  4F0Y A;  5F49 A;  4BBH A;  1JWQ A;  4IAV A;  3KAS A;  4P4B A;  4XPK A;  3T8W A;  2AFW A;  2AJ6 A;  3R95 A;  1YX0 A;  4C7H A;  5JPH A;  1YLE A;  1QSR A;  2PCU A;  4I49 A;  4UWJ A;  4YU9 A;  1NSL A;  4UIB A;  2CIJ A;  3D4U A;  2PJ2 A;  1GHE A;  3LD2 A;  2HB6 A;  5CPA A;  3VWD A;  4ZYQ A;  2YNC A;  3D2P A;  4RS2 A;  1Y7E A;  1XE4 A;  4BIN A;  2PR1 A;  5K8M A;  1FT7 A;  3FVL A;  1TF9 A;  4Z65 A;  4ZGY B;  4WWV A;  1Y7R A;  4KOW A;  4P4D A;  3WAB A;  2I3C A;  1Z5R A;  3BJ7 A;  1WWZ A;  4B5P A;  2PVV A;  3H8G A;  4X8I A;  1AUG A;  3D7F A;  3S9M A;  2JDC A;  3KHX A;  5ELY A;  3IU1 A;  4NGQ A;  4KOX A;  2GU2 A;  5H84 A;  4NCZ A;  3SXO A;  4E0A A;  4NXY A;  4HNX B;  2FIW A;  2EBJ A;  2EUI A;  3JTK A;  4PPZ A;  3GY9 A;  4YWY A;  4DYO A;  2Q4Y A;  2VZY A;  4MFL A;  4OID A;  4II9 A;  1IU8 A;  1LAM A;  2QYV A;  4H89 A;  4Y49 B;  2OZU A;  4MHZ A;  2Q0Y A;  1ELM P;  3L2N A;  2IQ6 A;  2XEG A;  2IMO A;  2WPW A;  3IU2 A;  4MHP A;  2C6G A;  5KTD A;  2I79 A;  2PQ8 A;  4GM5 A;  4JYW A;  3B35 A;  4MHY A;  1CG2 A;  4UEZ A;  3OWC A;  2BCO A;  3D3S A;  3QAH A;  4C2X A;  5AG6 A;  1CX8 A;  4NJQ A;  2Z3M A;  1MK4 A;  3IC1 A;  4NGT A;  2DPS A;  4QC6 A;  1A2Z A;  1M4L A;  2NMT A;  5DS0 A;  3W91 A;  4JLY A;  5IB0 A;  3CDX A;  4OC1 A;  1Z8W A;  2Q4V A;  4EWT A;  1LCP A;  2X7B A;  4AVB A;  1S3Z A;  4QVT A;  1XMT A;  1CP7 A;  4A2Z A;  4NGP A;  1I1D A;  3CPX A;  4OKO A;  1QSM A;  4PXB A;  1HEE A;  1PUA A;  3CZX A;  4MFJ A;  5H86 A;  2V8H A;  4HPS A;  3SXN A;  2D4O A;  1CPX A;  4IK2 A;  1QSO A;  3SI2 A;  2R1I A;  2EK9 A;  1F2O A;  3PGP A;  3ISX A;  1AYE A;  2IJZ A;  2R8V A;  4FD5 A;  5C82 A;  3H5Z A;  1Z9U A;  2Z0Z A;  4KUA A;  2PJ1 A;  2B3U A;  4P4I A;  2Z10 A;  2PR8 A;  4RI1 A;  5THW A;  4KSI A;  4U9Y A;  1B87 A;  1Y0Y A;  2BUE A;  2P6G A;  1IOI A;  1EE3 P;  4OC2 A;  5EBV A;  3B3W A;  4CYN A;  2BO9 A;  4ZX8 A;  4CGM A;  1LAP A;  3B3C A;  4B12 A;  1ZG9 A;  2J8M A;  2WSA A;  4A95 A;  2B4D A;  1Z8L A;  5HXD A;  1SQH A;  4B13 A;  4XNH B;  4X3R A;  4NFR A;  4E8O A;  3FMC A;  4QUS A;  4FWU A;  3VH9 A;  2ATR A;  1XIX A;  1S7N A;  4MCR A;  3DR8 A;  1XMB A;  2ZEF A;  4FUU A;  4ZX9 A;  4B11 A;  4DUK A;  5F09 A;  4CGL A;  4KVX A;  2CTB A;  3FIX A;  1RTQ A;  3FED A;  5JGF A;  4X2T A;  4C2Y A;  4CS0 B;  1Z8T A;  5K8N A;  4XPD C;  4CRZ B;  4AG7 A;  4ZY0 A;  3FNC A;  4Q36 A;  3CXQ A;  3BHX A;  4UFV A;  1BPM A;  3SJE A;  4CAW A;  1LOK A;  1VHE A;  3PP9 A;  1CPS A;  4BMH A;  2PJ8 A;  1PCA A;  4A39 A;  2CNM A;  2Z11 A;  1IOF A;  3H4Q A;  3PFO A;  4EVY A;  2BOA A;  5JH9 A;  4ZBG A;  4MFK A;  2BSW A;  1YVK A;  1BAV A;  2PJ3 A;  3DSB A;  3GLJ A;  4PQA A;  1CJW A;  5G1Z A;  3TC8 A;  2DF5 A;  5LYF A;  2J8R A;  2OZH A;  2B5G A;  3PBE A;  4KVM E;  4M6I A;  5LYD A;  1M4I A;  3NH5 A;  1OBR A;  2FIA A;  3K9U A;  3TO7 A;  3JVN A;  5AG7 A;  1KUV A;  2ZW6 A;  2YNE A;  1FNO A;  1RO5 A;  1UWY A;  4HKF A;  4OIW A;  5DWN A;  4J3G A;  4B5O A;  1CP6 A;  1R43 A;  3PB9 X;  1X10 A;  3KKW A;  3D68 A;  4JZ0 A;  3MRU A;  4M6H A;  4X5K A;  3B3S A;  3I3G A;  3EXN A;  1YW4 A;  1L0C A;  2Q7S A;  2ZEO A;  3G3S A;  4E2A A;  4QBJ A;  2VZZ A;  5F47 A;  3IIB A;  4AVC A;  3IEH A;  6CPA A;  1JQG A;  4IUS A;  2OB0 A;  2XEJ A;  5AG4 A;  1TKH A;  1Q2C A;  2O28 A;  2Q51 A;  2P0W A;  4L8A A; 
#chains in the Genus database with same CATH homology
 3TCV A;  4AVA A;  1ON0 A;  4Q38 A;  4K30 A;  4AG9 A;  1FY7 A;  3PZJ A;  4R3L A;  5F48 A;  4PSW A;  3QB8 A;  4R57 A;  1PU9 A;  2Z3K A;  4B10 A;  3EY5 A;  5AG5 A;  4H6Z A;  2QEC A;  3TOB A;  2OZG A;  1OZP A;  4CGP A;  4JXQ A;  4KOV A;  1Q2Y A;  4B5P B;  2P6F A;  2AE6 A;  5G21 A;  1KUY A;  1IB1 E;  2R7H A;  2B4B A;  3F8K A;  4PK2 A;  2FT0 A;  3P2F A;  1IYK A;  4LUA A;  4UBR A;  2HV2 A;  3LOD A;  4UFX A;  1LRZ A;  1IIC A;  5G22 A;  5J8C A;  4KUB A;  5JQ4 A;  3A9L A;  3E0K A;  2FS5 A;  3GKR A;  1IID A;  3NE7 A;  1Y9K A;  3V8I A;  4KOR A;  3R9F A;  4F0X A;  4NSQ A;  4MFZ A;  5AGE A;  4MI4 A;  4JWP A;  2PDO A;  3DR6 A;  4HNW B;  3ZZI A;  2G3A A;  2FSR A;  2I00 A;  2BEI A;  2YGW A;  2VBQ A;  1V0C A;  1S60 A;  4OLL A;  1YGH A;  4FD7 A;  3EFA A;  3W6X A;  2C27 A;  5CNP A;  2CNT A;  4YGO A;  1QSN A;  4A31 A;  1YR0 A;  4NF1 A;  3ZJ0 A;  2IL4 A;  4MHD A;  3TT2 A;  4U9Z A;  5BWA B;  5DWM A;  3CXS A;  4GS4 A;  2DPT A;  3TFY A;  4R3K A;  2GIV A;  5A27 A;  5KTA A;  2G3T A;  3R9E A;  2HQY A;  2FCK A;  3S6K A;  4MY0 A;  4KOU A;  4MBU A;  4KLW A;  4H6U A;  5IV0 A;  1CM0 A;  4CAX A;  4DNC A;  2CXA A;  2JLM A;  4MY3 A;  4Y49 C;  4PV6 A;  4CGO A;  2ARH A;  1YK3 A;  1Y9W A;  2PSW A;  4MJ8 A;  3F0A A;  1S5K A;  2Q44 A;  3FYN A;  2F5I A;  2K5T A;  4F6A A;  3FBU A;  3N7Z A;  2B3V A;  1KUX A;  3S6F A;  4KZT A;  2Y0M A;  2VEZ A;  2GE3 A;  2J8N A;  1UFH A;  2D4P A;  5J8F A;  2YND A;  3F5B A;  2PC1 A;  3EO4 A;  3FRM A;  1P4N A;  3TTH A;  3IWE A;  1MJB A;  2ZW4 A;  2BL1 A;  2WPX A;  3RYO A;  2QIR A;  4YRH A;  4KS9 A;  4QB9 A;  3TOA A;  2H5M A;  2Z3P A;  4IF5 A;  3FB3 A;  3S6G A;  4CAV A;  4CRY B;  4KSA A;  1VHS A;  2VXK A;  2Z3O A;  1K4J A;  4C2Z A;  4MFQ A;  2FXF A;  1MJA A;  3T9Y A;  1YRE A;  2VQY A;  1Z4E A;  5E96 A;  5FVJ A;  5GCN A;  3W6S A;  1M44 A;  4L89 A;  1NE9 A;  3R96 A;  1WK4 A;  5I0C A;  1QST A;  2FE7 A;  2OH1 A;  2ZXV A;  3SHP A;  4XNH C;  2CY2 A;  4NEX A;  4JJX A;  1S7K A;  2P6E A;  1N71 A;  1BOB A;  1TIQ A;  3T90 A;  2EVN A;  2Q04 A;  4JD6 A;  4A33 A;  3EC4 A;  4A32 A;  2ZW5 A;  4UCM A;  1MJ9 A;  4PK3 A;  4R9M A;  4UCN A;  4CYO A;  2DXQ A;  4MFP A;  1S7F A;  1I12 A;  1BO4 A;  4B14 A;  2ZW7 A;  3IGR A;  2VI7 A;  3G8W A;  2WUU A;  2ZPA A;  3WR7 A;  2JEV A;  3FXT A;  5G20 A;  4HNY B;  3VWE A;  3CXP A;  2Q7B A;  5HH1 A;  4CAE A;  1NMT A;  2OU2 A;  5ISV A;  4M85 A;  4XPD B;  1J4J A;  3TO9 A;  2B58 A;  4KLV A;  1M4G A;  4ONU A;  1M4D A;  2CNS A;  3DNS A;  2KCW A;  2A4N A;  4A30 A;  4UCP A;  2REF A;  3MGD A;  4CAF A;  4UA3 A;  4AB7 A;  4C7I A;  5IX3 A;  3C26 A;  2FL4 A;  1Z4R A;  1VKC A;  3JUW A;  1R57 A;  2YNC C;  1XF8 A;  5F46 A;  2G0B A;  4XPL A;  2JDD A;  4OAE A;  4AVC A;  4EVY A;  2Z3L A;  4JXR A;  3S6H A;  1M1D A;  4CGN A;  1Q2D A;  4OAD A;  3BLN A;  2RC4 A;  3P2H A;  1B6B A;  2REE A;  3DDD A;  4YFJ A;  2B4D B;  3TO6 A;  3UY5 A;  3B8G A;  3GYA A;  4UWI A;  2HUZ A;  4KOT A;  5C88 A;  2GAN A;  1ZO0 A;  4PSX A;  5A28 A;  3BJ8 A;  5EC4 A;  3D8P A;  4U5Y A;  2Z3N A;  4LX9 A;  3R9G A;  5KTC A;  3I9S A;  4FD4 A;  1YVO A;  1U6M A;  4ORF A;  4UFW A;  4KVO E;  4C68 A;  2B5G B;  2QML A;  1RXT A;  1I21 A;  4FD6 A;  2R98 A;  3IWG A;  4KSF A;  5HMN A;  4CYP A;  1XEB A;  3R1K A;  4KOS A;  3TE4 A;  2PRB A;  3D2M A;  4CYQ A;  4KOY A;  1S7L A;  1KZF A;  1P0H A;  1IYL A;  4R87 A;  4M3S A;  4F0Y A;  5F49 A;  4BBH A;  4XPK A;  5JPH A;  2AJ6 A;  3R95 A;  1YX0 A;  4C7H A;  1YLE A;  1QSR A;  4I49 A;  4UWJ A;  1NSL A;  1GHE A;  3LD2 A;  3VWD A;  2YNC A;  3D2P A;  4RS2 A;  1XE4 A;  2PR1 A;  4ZGY B;  1Y7R A;  4KOW A;  3BJ7 A;  1WWZ A;  4B5P A;  2JDC A;  3SXO A;  3IU1 A;  4KOX A;  5H84 A;  4NCZ A;  4E0A A;  4NXY A;  4HNX B;  2FIW A;  2EUI A;  3JTK A;  3GY9 A;  2Q4Y A;  2VZY A;  4MFL A;  4II9 A;  4H89 A;  4Y49 B;  2OZU A;  2Q0Y A;  3IU2 A;  2WPW A;  5KTD A;  2I79 A;  2PQ8 A;  3OWC A;  3D3S A;  3QAH A;  4C2X A;  5AG6 A;  2Z3M A;  1MK4 A;  4QC6 A;  2DPS A;  3W91 A;  2NMT A;  4JLY A;  5IB0 A;  2Q4V A;  2X7B A;  4AVB A;  1S3Z A;  4QVT A;  1XMT A;  4A2Z A;  1I1D A;  1QSM A;  1PUA A;  5H86 A;  4MFJ A;  3SXN A;  2D4O A;  1QSO A;  2R1I A;  3PGP A;  4FD5 A;  2R8V A;  5C82 A;  3H5Z A;  1Z9U A;  2Z0Z A;  4KUA A;  2B3U A;  2Z10 A;  2PR8 A;  4RI1 A;  4U9Y A;  1B87 A;  2BUE A;  2P6G A;  5EBV A;  4CYN A;  4CGM A;  4B12 A;  2J8M A;  2WSA A;  4A95 A;  2B4D A;  1SQH A;  4B13 A;  4XNH B;  4E8O A;  4QUS A;  2ATR A;  1XIX A;  1S7N A;  3DR8 A;  4B11 A;  4CGL A;  4KVX A;  3FIX A;  4C2Y A;  4CS0 B;  4XPD C;  4CRZ B;  4AG7 A;  3FNC A;  4Q36 A;  3CXQ A;  4UFV A;  4CAW A;  3PP9 A;  4BMH A;  2CNM A;  2Z11 A;  3H4Q A;  4ZBG A;  4MFK A;  2BSW A;  1YVK A;  3DSB A;  5G1Z A;  1CJW A;  2J8R A;  2OZH A;  2B5G A;  4KVM E;  1M4I A;  2FIA A;  3K9U A;  3TO7 A;  3JVN A;  5AG7 A;  1KUV A;  2ZW6 A;  2YNE A;  1RO5 A;  5DWN A;  4HKF A;  4J3G A;  4B5O A;  3KKW A;  4X5K A;  3I3G A;  3EXN A;  1L0C A;  3G3S A;  4E2A A;  4QBJ A;  2VZZ A;  5F47 A;  4IUS A;  2OB0 A;  5AG4 A;  2O28 A;  1Q2C A;  2P0W A;  4L8A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...