2PR8A

Crystal structure of aminoglycoside n-acetyltransferase aac(6')-ib11
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
173
structure length
173
Chain Sequence
DSVTLRLMTEHDLAMLYEWLNRSHIVEWWGGEEARPTLADVQEQYLPSVLAQESVTPYIAMLNGEPIGYAQSYVALGSGDGWWEEETDPGVRGIDLSLANASQLGKGLGTKLVRALVELLFNDPEVTKIQTDPSPSNLRAIRCYEKAGFERQGTVTTPDGPAVYMVQTRQAFE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Aminoglycoside 6-N-acetyltransferase type Ib11
publication title Enzyme structural plasticity and the emergence of broad-spectrum antibiotic resistance.
pubmed doi rcsb
source organism Salmonella typhimurium
total genus 44
structure length 173
sequence length 173
chains with identical sequence B
ec nomenclature ec 2.3.1.82: Aminoglycoside 6'-N-acetyltransferase.
pdb deposition date 2007-05-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13523 Acetyltransf_8 Acetyltransferase (GNAT) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 2pr8A00
2B5GA 4QVTA 4KOUA 2X7BA 1IYKA 2A4NA 1YR0A 4AVBA 2WPWA 2J8RA 4XPDB 1IICA 3EO4A 5KTCA 1IYLA 1CM0A 3V8IA 4YGOA 2D4PA 3TTHA 2GIVA 2G0BA 4II9A 1YX0A 4OLLA 3W91A 4PK3A 1P4NA 3QAHA 3PZJA 2FL4A 3EC4A 1XF8A 4NXYA 3KKWA 3SXOA 3DDDA 1S7FA 4KVOE 2D4OA 3GY9A 3T9YA 3TO9A 4F6AA 4EVYA 4FD5A 4HNXB 1XEBA 3FBUA 3I9SA 2PQ8A 3DR8A 2ZPAA 1CJWA 5KTDA 2CNMA 1YVOA 3E0KA 1S60A 5H86A 1M4GA 2VBQA 4FD6A 5IX3A 3FNCA 4I49A 4M3SA 1QSMA 3I3GA 1R57A 4DNCA 2VI7A 4E2AA 2K5TA 5KTAA 2IL4A 3JUWA 5FVJA 4F0YA 3UY5A 3D2PA 4E8OA 3SHPA 3VWEA 2OZHA 3F5BA 2BUEA 4R87A 1S3ZA 1NMTA 2PDOA 4ORFA 4XPLA 2I00A 4UA3A 4CAVA 5DWMA 5IB0A 3F0AA 2JDCA 2OB0A 1IIDA 2BL1A 2P0WA 4H6ZA 3R1KA 2B3UA 4YRHA 1XMTA 4MBUA 1QSRA 1MK4A 5C82A 4Y49C 1NSLA 2KCWA 2F5IA 4KOSA 4L89A 2FE7A 2OU2A 3JVNA 1M4DA 2FS5A 3LD2A 1YGHA 1P0HA 4MJ8A 2REEA 1Z9UA 2FSRA 1S7LA 2WPXA 2R7HA 4LX9A 2Z11A 3GKRA 4R57A 3EFAA 4MY0A 4PV6A 2RC4A 3ZJ0A 4HKFA 4OADA 4KOTA 4KORA 1MJBA 3EXNA 1RXTA 3D8PA 2VZYA 4ZBGA 3OWCA 3S6KA 2P6EA 1U6MA 3G3SA 2BEIA 4KUAA 3S6FA 5C88A 2G3AA 1MJ9A 3BJ8A 4KVXA 3T90A 3W6SA 3TCVA 4JLYA 3PP9A 4M85A 3R9GA 2BSWA 4U5YA 3TT2A 1WK4A 1IB1E 2VEZA 1I12A 2R1IA 4FD4A 1UFHA 5F49A 1PUAA 2Q44A 4PSWA 5EBVA 4ONUA 4J3GA 4AG7A 1SQHA 2Y0MA 1YLEA 4NEXA 4XNHB 4B5PB 1YVKA 2EVNA 3MGDA 2EUIA 2H5MA 1XE4A 2OH1A 4CRZB 4XPKA 2GANA 2FIAA 2ATRA 4KOYA 4L8AA 2P6FA 2R98A 3R96A 4LUAA 2B4DB 4MHDA 3CXQA 4IUSA 1M4IA 3SXNA 4KVME 2FT0A 1KZFA 4XPDC 3TE4A 4BMHA 2B4DA 3GYAA 3FB3A 1WWZA 3D2MA 3G8WA 2PSWA 4PK2A 2CY2A 1J4JA 4U9YA 1RO5A 3DR6A 4RI1A 2Z10A 5IV0A 3WR7A 5H84A 2Q04A 1Y9WA 3CXPA 1S7KA 1V0CA 2JEVA 1YREA 1LRZA 4KUBA 2OZGA 3TFYA 3S6HA 4AB7A 2VXKA 4R9MA 2HUZA 5F46A 4FD7A 1M1DA 3EY5A 1Y9KA 1Z4EA 4E0AA 3NE7A 4HNWB 4MI4A 4NSQA 3R9EA 4KLVA 3FYNA 4CRYB 4RS2A 2PRBA 1KUVA 2ZW7A 1NE9A 4AVCA 5HH1A 2C27A 3PGPA 3LODA 4JXRA 3K9UA 1TIQA 3TOAA 1I1DA 1KUXA 4IF5A 4CS0B 4JXQA 3IGRA 2QMLA 5I0CA 1M44A 4OAEA 4NCZA 3FRMA 3IWGA 5EC4A 1K4JA 2ZW4A 1XIXA 2FIWA 3RYOA 1Q2YA 1FY7A 2JLMA 2Q4VA 4QUSA 1S5KA 2Q4YA 3BJ7A 3N7ZA 4PSXA 2VQYA 3R95A 1KUYA 3P2FA 3QB8A 4QC6A 3TOBA 2R8VA 4U9ZA 1B87A 4KLWA 5CNPA 2ZW5A 4MY3A 4R3LA 5F48A 4JJXA 2QIRA 3FIXA 2Q0YA 2P6GA 1L0CA 2REFA 1Y7RA 2CNTA 4UWIA 4NF1A 3TO6A 3W6XA 2DXQA 2J8MA 5GCNA 1VHSA 5F47A 2G3TA 3DNSA 1VKCA 2JDDA 2QECA 4JD6A 3TO7A 4Y49B 3C26A 4AVAA 4CAWA 4B5PA 2O28A 2OZUA 2Z0ZA 2VZZA 4K30A 3P2HA 4KZTA 2GE3A 1N71A 4UWJA 1Z4RA 2FCKA 2Q7BA 4AG9A 5JQ4A 2NMTA 3ZZIA 1PU9A 4H89A 2HQYA 4B5OA 1QSOA 4GS4A 2PR8A 2B4BA 3H4QA 2AJ6A 2B58A 2ZW6A 5E96A 4YFJA 3D3SA 2I79A 1GHEA 1ON0A 4CAXA 3FXTA 1Q2DA 2AE6A 1B6BA 4JWPA 4QBJA 5HMNA 5J8CA 1S7NA 4QB9A 2B3VA 4HNYB 3BLNA 4KOWA 2HV2A 4R3KA 5J8FA 1BOBA 3VWDA 5JPHA 4KOVA 3R9FA 1OZPA 2PC1A 4XNHC 5ISVA 3S6GA 1I21A 2J8NA 1MJAA 1QSTA 2B5GB 2CNSA 4KOXA 1BO4A 1Q2CA 4H6UA 3B8GA 1QSNA 2FXFA 2ARHA 4X5KA 5DWNA 1YK3A 3F8KA 2ZXVA 3CXSA 2PR1A 4UBRA 3DSBA
chains in the Genus database with same CATH superfamily
2B5GA 4QVTA 4KOUA 1CP7A 2X7BA 1IYKA 2A4NA 4KS9A 4M6GA 1YR0A 4AVBA 1QQ9A 3IJ3A 2WPWA 2XEJA 2J8RA 3PB4X 2NYQA 3RZAA 3QNVA 1TKFA 4CYOA 3KL9A 1JQGA 1HDQA 4XPDB 1IICA 3EO4A 4FUUA 5KTCA 2I3CA 4C7IA 1IYLA 1CM0A 3V8IA 1CPXA 2D4PA 3FEDA 4YGOA 5JM6A 1ZG9A 3TTHA 2GIVA 2GU2A 3HLPA 4OKOA 2G0BA 2PCUA 4II9A 2ANPA 1YX0A 4OLLA 1Y7EA 4MHNA 4PK3A 3W91A 1BPNA 1VIXA 4CYNA 4R7MA 4R6TA 3WC7A 1P4NA 2BCOA 3QAHA 3B3CA 3PZJA 4FBEA 2XEIA 2FL4A 3KHZA 3EC4A 1XF8A 5D29A 4NXYA 5LYFA 2Q43A 1ZO0A 3KKWA 3B2YA 3FF3A 3SXOA 3DDDA 4GM5A 1S7FA 4KVOE 2D4OA 3CPAA 4A94A 4BBHA 1XFOA 3GY9A 4UFXA 2POKA 2Z3OA 1OBRA 3T9YA 3TO9A 3VARA 4F6AA 4EVYA 3IO1A 2Q51A 4FD5A 2EK8A 2CTCA 3BI0A 4PXDA 4HNXB 1XEBA 4NGSA 3FBUA 4B10A 3D66A 4RUHA 2RB7A 3PBBA 3CDXA 3I9SA 2PQ8A 2VL1A 3DR8A 5HVFA 2ZPAA 4FAIA 1CJWA 1IY7A 1FT7A 5KTDA 2CNMA 3SJFA 1YVOA 4GXHA 3E0KA 1S60A 3CZXA 2PIYA 5H86A 1ARMA 1M4GA 2VBQA 3BXMA 4FD6A 5IX3A 3IC1A 2OOTA 2C6CA 1BAVA 3FNCA 2O4HA 4I49A 4YWYA 3WC6A 4LQGA 4M3SA 4OIWA 1QSMA 2ZELA 4B14A 3I3GA 4M6IA 2QVPA 4X2TA 4A95A 1R57A 3GIUA 4ZX9A 4DNCA 3TC8A 4ZX8A 2VI7A 4E2AA 4B11A 2K5TA 4Z65A 5KTAA 2YNDA 2IL4A 2PJ1A 3LMSA 2HB6A 3JUWA 2ZEGA 5FVJA 4C2YA 4F0YA 2Z3LA 3UY5A 4KSIA 1PCAA 3D2PA 4E8OA 3SHPA 2JBKA 3BHXA 3KHXA 4DUKA 4MFPA 3VWEA 2WZNA 4NJQA 2OZHA 3F5BA 2BUEA 3V7ZA 3PB8X 4R87A 3SJEA 1S3ZA 1Z5RA 2Q4ZA 1NMTA 2EBJA 2PDOA 2V77A 2Z3MA 3H8FA 4ORFA 3D7FA 4XPLA 3V38A 5K8MA 2PJ0A 4ZGYB 4CPAA 2I00A 5HXDA 4UA3A 5THWA 1VHEA 4CAVA 3DLJA 4OC2A 4UCMA 5DWMA 5IB0A 3D7DA 3F0AA 2JDCA 3PEIA 2OB0A 4O23A 1IIDA 3HUVA 2AFOA 2BL1A 4M6HA 2P0WA 6CPAA 4MFQA 4H6ZA 3FECA 4UIBA 1CBXA 3R1KA 3VH9A 4DJLA 2B3UA 4MFJA 4YRHA 1XMTA 4OMEA 1CX8A 3KR5A 4MBUA 5HVGA 5JGFA 2DPTA 2J9AA 1QSRA 1MK4A 1BLLE 3SI0A 4MHYA 4ZY1A 5C82A 4Y49C 4A30A 8CPAA 3IU1A 2GFQA 3RO0A 1NSLA 2KCWA 4Q7AA 2V8GA 4RN7A 1Z8WA 4BINA 2F5IA 4KOSA 1YW4A 4L89A 1Y0YA 2FE7A 2OU2A 2PJ7A 1M4DA 2FS5A 3JVNA 2C1CA 3LD2A 4X3RA 1YGHA 1P0HA 2Z3NA 3PB7X 1F2PA 4MJ8A 2REEA 3WT4A 4MCPA 1Z9UA 2FSRA 3PFOA 4OP4A 1S7LA 2WPXA 1JWQA 3K2KA 2R7HA 2YNCC 2PJ2A 3D4UA 2Z11A 3GKRA 4LX9A 4P44A 2OR4A 4P4DA 3KR4A 1CP6A 3N5FA 3D67A 4OIDA 2XEFA 4R57A 2Z3PA 3EFAA 3NH8A 4MY0A 2RC4A 4OC0A 1ZLIA 4PV6A 1X10A 3ZJ0A 4HKFA 5K8OA 4OADA 3S9MA 4KOTA 4KORA 2PJCA 1AUGA 4TWEA 1MJBA 3EXNA 3KGQA 5F09A 1RXTA 3D8PA 2VZYA 4ZBGA 3OWCA 2ZEEA 3S6KA 2P6EA 5AG4A 2F7VA 1U6MA 3D68A 5HVHA 3G3SA 2BEIA 4KUAA 3S6FA 5C88A 1ZLHA 1PYTB 2G3AA 4WWVA 1MJ9A 2WYRA 3BJ8A 5G22A 4KVXA 4P4JA 3T90A 4CGNA 4A33A 1ARLA 3W6SA 3TCVA 1LFWA 4JLYA 3PP9A 5AG6A 4R8FA 4IAVA 4M85A 2O53A 3R9GA 4NGMA 4MFLA 2BSWA 3PB9X 4U5YA 3FX6A 3TT2A 1WK4A 1IB1E 2VEZA 1I12A 2WUUA 5D8NA 2AFUA 3D7HA 2R1IA 2AFMA 4MHZA 2ABZA 4WJBA 4BD9A 4FD4A 1UFHA 3IEHA 5F49A 2BOAA 5ELYA 2CTBA 1PUAA 2Q44A 2AFXA 2XEGA 4PSWA 2DPSA 3KI9A 5EBVA 2PJ4A 4ONUA 5LYLA 4J3GA 4AG7A 1SQHA 2Y0MA 1YLEA 3B7IA 4KSFA 3JTKA 4NEXA 4XNHB 4B5PB 1YVKA 2CIJA 2EUIA 2EVNA 3MGDA 2H5MA 1XE4A 2OH1A 3MN8A 5DS0A 4XPKA 4CRZB 4F9VA 4CGLA 2GANA 4G1PA 2FIAA 2PJ6A 4C2XA 2ATRA 4KOYA 4MFKA 4UCNA 4L8AA 2P6FA 2R98A 3R96A 4NGNA 4LUAA 2B4DB 2PVWA 4MHDA 5G21A 2RFHA 3CXQA 1A2ZA 4A39A 3NH4A 2Z3KA 4IUSA 5K8PA 1M4IA 3B3TA 2PE3A 4LQ6A 4C2ZA 3SXNA 1HEEA 4KVME 1R3NA 5I4MA 1UWYA 3B3SA 2FT0A 1KZFA 3PBEA 1Z2LA 4XPDC 3TE4A 4BMHA 5A27A 4P10A 2DEAA 3ISZA 2B4DA 3GYAA 4IK2A 2CXAA 1WWZA 3D2MA 3FB3A 3G8WA 4B6ZA 4CAEA 2PSWA 4PK2A 3IU2A 4CGOA 2CY2A 1J4JA 4U9YA 1RO5A 3A9LA 3DR6A 3GUXA 4IHMA 4OC1A 4RI1A 2Z10A 5IV0A 4MRIA 3WR7A 4EWTA 3CPXA 3TX8A 4MHPA 5H84A 2Q04A 3H5ZA 1Z8XA 1Y9WA 4C68A 3CXPA 1S7KA 1V0CA 2JEVA 1YREA 4PQAA 2AFSA 1LRZA 4KUBA 2OZGA 3SI1A 3TFYA 3S6HA 4AB7A 2VXKA 5AGEA 2QJ8A 2V8HA 4ONWA 4P4IA 4P4FA 4CGPA 1VGYA 3K9TA 2ZEPA 4R9MA 4ZI6A 2HUZA 4MFZA 5F46A 1F57A 4FD7A 4UF4A 1KWMA 1M1DA 2WSAA 3EY5A 1Y9KA 1Z4EA 1RTQA 4E0AA 2Q7SA 2JBJA 3NE7A 3PB6X 4HNWB 2ZOFA 2JEWA 3GLJA 4MI4A 4NSQA 3BI1A 3IWWA 3R9EA 4KLVA 1NSAA 3FYNA 1VHOA 3GB0A 4NJRA 4CRYB 1Q7LA 1XBUA 2ZEHA 4RS2A 4UIAA 2PRBA 1KUVA 5G20A 4F8ZA 2ZW7A 1NE9A 3PRTA 4AVCA 5HH1A 2C27A 3PGPA 2ZEMA 2GREA 3LODA 4P4EA 4UFVA 2YGWA 3K9UA 4JXRA 5A28A 4ZY0A 3L2NA 5AG5A 4F0XA 1TIQA 5LRGA 3TOAA 1I1DA 3MRUA 1KUXA 3FJUA 4IF5A 4CS0B 3FH4A 2ZEFA 3NA6A 4JXQA 3IGRA 2QMLA 5I0CA 1M44A 7CPAA 1ZG7A 4OAEA 1YQEA 2PJ8A 1YLOA 4CAWA 4NCZA 1M4LA 3FRMA 2PJ3A 3IWGA 5EC4A 1K4JA 5J1QA 2ZW4A 1XIXA 1ZG8A 2FIWA 4EFDA 1Z8TA 2ZOGA 1Q2YA 2YNEA 3RYOA 1FY7A 3RNZA 2G9DA 2JLMA 2Q4VA 4QUSA 1CPSA 1H8LA 1S5KA 1YMEA 1EE3P 2Q4YA 3KASA 4CYQA 3ISXA 3BJ7A 2IJZA 4C7HA 2F8HA 3N7ZA 3H8GA 4PSXA 2VQYA 3R95A 4AXVA 1TXRA 3NE8A 5LYIA 1CG2A 1KUYA 3P2FA 4P45A 3WC5A 1LANA 3QB8A 2V8VA 4QC6A 1YW6A 2R8VA 4U9ZA 3TOBA 1B87A 4KLWA 4ZYQA 4NGQA 5CNPA 1FNOA 2ZW5A 4MY3A 2ZEOA 3JRUA 3KQXA 3LACA 4R3LA 5F48A 3VATA 4JJXA 2QIRA 5LRJA 4KSAA 3FIXA 4A38A 2Q0YA 5G1ZA 2P6GA 1L0CA 4A37A 3IFEA 2REFA 5K8NA 1Y7RA 2CNTA 4UWIA 4NF1A 2QYVA 3TO6A 4B13A 3W6XA 1DE4C 4F9UA 2DXQA 3WABA 2ZENA 3NFZA 2J8MA 5IB9A 4MCQA 2C6PA 5GCNA 2PJ5A 1VHSA 2PJBA 4YU9A 5F47A 2G3TA 2AFZA 3DNSA 1VKCA 2JDDA 2C6GA 2IMOA 2QECA 4JD6A 4X8IA 3TO7A 4TNUA 5CBMA 2PVVA 3SJXA 1X12A 4P4BA 4MXUA 1DTDA 3C26A 4Y49B 3D7GA 1IU8A 1GYTA 3FMCA 5AG7A 4P6YA 5EMIA 4AVAA 2O28A 3CT9A 4B5PA 3S9NA 2OZUA 2Z0ZA 2VZZA 2CF4A 4OC5A 4K30A 4OC4A 2FVGA 3P2HA 4KZTA 2GE3A 3H8EA 5CPAA 3RAMA 1N71A 1LAPA 4UWJA 1Z4RA 4JYWA 4CAFA 2FCKA 2Q7BA 4AG9A 4A31A 1HDUA 5JQ4A 4CGMA 4R76A 1AYEA 2NMTA 4B12A 2AFWA 3ZZIA 5BWAB 1PU9A 4H89A 1TKHA 2HQYA 4JZ0A 4B5OA 1ELLP 1QSOA 3FVLA 4GS4A 1Z8LA 2ZEDA 3NH5A 2PR8A 2B4BA 2GLFA 4PXEA 4DYOA 3H4QA 3LWUA 3FEEA 1F2OA 1R43A 2EO8A 1IOIA 2AJ6A 2B58A 2ZW6A 4Q36A 4PPZA 5E96A 3PFEA 4NGTA 5LYDA 4YFJA 3D3SA 2I79A 2PJ9A 3T8WA 4NFRA 1LAMA 4NGRA 1GHEA 1TF9A 3KZWA 1ON0A 3S9LA 3SI2A 4CAXA 1IOFA 3FXTA 4A32A 1Q2DA 2YNCA 4ZY2A 4H2KA 3IWEA 2AE6A 1B6BA 4JWPA 4K3NA 4QBJA 5HMNA 1ELMP 5J8CA 4UFWA 5JH9A 4Q38A 4PXBA 1S7NA 4QB9A 2B3VA 4HNYB 3RBUA 2GLJA 3BLNA 4KOWA 2HV2A 4R3KA 3B3VA 4FWUA 4CYPA 5J8FA 4UEZA 4UEFA 1BOBA 2PIZA 3B3WA 3VWDA 1XMBA 5JPHA 4KOVA 3R9FA 4MMOA 2V8DA 3KQZA 4HPSA 1XOVA 1XRYA 5LRKA 1OZPA 2PC1A 4XNHC 1LOKA 4A2ZA 1BPMA 4MCRA 4OC3A 5ISVA 1Y0RA 2PRQA 3DGVA 1I21A 3B35A 3S6GA 2BO9A 2J8NA 3QAYA 1XJOA 2IQ6A 3I1UA 2CNSA 1MJAA 1QSTA 2B5GB 1YSJA 4KOXA 1BO4A 1Q2CA 4W9YA 4H6UA 2EWBA 4EMEA 3B8GA 1QSNA 2DF5A 1QMUA 4UCPA 2FXFA 1LCPA 2ARHA 2PJAA 4X5KA 4PXCA 1YK3A 4NGPA 5DWNA 1IGBA 3SJGA 2EK9A 3IIBA 3F8KA 2ZXVA 3CXSA 2PR1A 1TKJA 4UBRA 2HC9A 4MCSA 4UEEA 1AMPA 1TF8A 2ODFA 3DSBA 2NSMA
chains in the Genus database with same CATH topology
2B5GA 4QVTA 4KOUA 2X7BA 1IYKA 2A4NA 4KS9A 1YR0A 4AVBA 2WPWA 2J8RA 4CYOA 4XPDB 1IICA 3EO4A 5KTCA 4C7IA 1IYLA 1CM0A 3V8IA 4YGOA 2D4PA 3TTHA 2GIVA 2G0BA 4II9A 1YX0A 4OLLA 3W91A 4PK3A 4CYNA 1P4NA 3QAHA 3PZJA 2FL4A 3EC4A 1XF8A 4NXYA 1ZO0A 3KKWA 3SXOA 3DDDA 1S7FA 4KVOE 2D4OA 4BBHA 3GY9A 4UFXA 2Z3OA 3T9YA 3TO9A 4F6AA 4EVYA 4FD5A 4HNXB 1XEBA 3FBUA 4B10A 3I9SA 2PQ8A 3DR8A 2ZPAA 1CJWA 5KTDA 2CNMA 1YVOA 3E0KA 1S60A 5H86A 1M4GA 2VBQA 4FD6A 5IX3A 3FNCA 4I49A 4M3SA 1QSMA 4B14A 3I3GA 4A95A 1R57A 4DNCA 2VI7A 4E2AA 4B11A 2K5TA 5KTAA 2YNDA 2IL4A 3JUWA 5FVJA 4C2YA 4F0YA 2Z3LA 3UY5A 3D2PA 4E8OA 3SHPA 4MFPA 3VWEA 2OZHA 3F5BA 2BUEA 4R87A 1S3ZA 1NMTA 2PDOA 2Z3MA 4ORFA 4XPLA 4ZGYB 2I00A 4UA3A 4CAVA 4UCMA 5DWMA 5IB0A 3F0AA 2JDCA 2OB0A 1IIDA 2BL1A 2P0WA 4MFQA 4H6ZA 3R1KA 2B3UA 4MFJA 4YRHA 1XMTA 4MBUA 2DPTA 1QSRA 1MK4A 5C82A 4Y49C 4A30A 3IU1A 1NSLA 2KCWA 2F5IA 4KOSA 4L89A 2FE7A 2OU2A 3JVNA 1M4DA 2FS5A 3LD2A 1YGHA 1P0HA 2Z3NA 4MJ8A 2REEA 1Z9UA 2FSRA 1S7LA 2WPXA 2R7HA 2YNCC 4LX9A 2Z11A 3GKRA 4R57A 2Z3PA 3EFAA 4MY0A 4PV6A 2RC4A 3ZJ0A 4HKFA 4OADA 4KOTA 4KORA 1MJBA 3EXNA 1RXTA 3D8PA 2VZYA 4ZBGA 3OWCA 3S6KA 2P6EA 5AG4A 1U6MA 3G3SA 2BEIA 4KUAA 3S6FA 5C88A 2G3AA 1MJ9A 3BJ8A 5G22A 4KVXA 3T90A 4CGNA 4A33A 3W6SA 3TCVA 4JLYA 3PP9A 5AG6A 4M85A 3R9GA 4MFLA 2BSWA 4U5YA 3TT2A 1WK4A 1IB1E 2VEZA 1I12A 2WUUA 2R1IA 4FD4A 1UFHA 5F49A 1PUAA 2Q44A 4PSWA 2DPSA 5EBVA 4ONUA 4J3GA 4AG7A 1SQHA 2Y0MA 1YLEA 4KSFA 3JTKA 4NEXA 4XNHB 4B5PB 1YVKA 2EVNA 3MGDA 2EUIA 2H5MA 1XE4A 2OH1A 4CRZB 4XPKA 4CGLA 2GANA 2FIAA 4C2XA 2ATRA 4KOYA 4MFKA 4UCNA 4L8AA 2P6FA 2R98A 3R96A 4LUAA 2B4DB 5G21A 4MHDA 3CXQA 2Z3KA 4IUSA 1M4IA 4C2ZA 3SXNA 4KVME 2FT0A 1KZFA 4XPDC 3TE4A 4BMHA 5A27A 2B4DA 3GYAA 2CXAA 1WWZA 3D2MA 3FB3A 3G8WA 4CAEA 2PSWA 4PK2A 3IU2A 4CGOA 2CY2A 1J4JA 4U9YA 1RO5A 3A9LA 3DR6A 4RI1A 2Z10A 5IV0A 3WR7A 5H84A 2Q04A 3H5ZA 1Y9WA 4C68A 3CXPA 1S7KA 1V0CA 2JEVA 1YREA 1LRZA 4KUBA 2OZGA 3TFYA 3S6HA 4AB7A 2VXKA 5AGEA 4CGPA 4R9MA 2HUZA 4MFZA 5F46A 4FD7A 1M1DA 2WSAA 3EY5A 1Y9KA 1Z4EA 4E0AA 3NE7A 4HNWB 4MI4A 4NSQA 3R9EA 4KLVA 3FYNA 4CRYB 4RS2A 2PRBA 1KUVA 5G20A 2ZW7A 1NE9A 4AVCA 5HH1A 2C27A 3PGPA 3LODA 4UFVA 2YGWA 3K9UA 4JXRA 4F0XA 5AG5A 1TIQA 3TOAA 1I1DA 1KUXA 4IF5A 4CS0B 4JXQA 3IGRA 2QMLA 5I0CA 1M44A 4OAEA 4NCZA 3FRMA 3IWGA 5EC4A 1K4JA 2ZW4A 1XIXA 2FIWA 3RYOA 1Q2YA 2YNEA 1FY7A 2JLMA 2Q4VA 4QUSA 1S5KA 2Q4YA 4CYQA 3BJ7A 4C7HA 3N7ZA 4PSXA 2VQYA 3R95A 1KUYA 3P2FA 3QB8A 4QC6A 3TOBA 2R8VA 4U9ZA 1B87A 4KLWA 5CNPA 2ZW5A 4MY3A 4R3LA 5F48A 4JJXA 2QIRA 4KSAA 3FIXA 2Q0YA 5G1ZA 2P6GA 1L0CA 2REFA 1Y7RA 2CNTA 4UWIA 4NF1A 3TO6A 4B13A 3W6XA 2DXQA 2J8MA 5GCNA 1VHSA 5F47A 2G3TA 3DNSA 1VKCA 2JDDA 2QECA 4JD6A 3TO7A 4Y49B 3C26A 4AVAA 4CAWA 5AG7A 4B5PA 2O28A 2OZUA 2Z0ZA 2VZZA 4K30A 3P2HA 4KZTA 2GE3A 1N71A 4UWJA 1Z4RA 4CAFA 2FCKA 2Q7BA 4AG9A 4A31A 5JQ4A 4CGMA 4B12A 2NMTA 3ZZIA 5BWAB 1PU9A 4H89A 2HQYA 4B5OA 1QSOA 4GS4A 2PR8A 2B4BA 3H4QA 2AJ6A 2B58A 2ZW6A 4Q36A 5E96A 5A28A 4YFJA 3D3SA 2I79A 1GHEA 1ON0A 4CAXA 3FXTA 4A32A 1Q2DA 2YNCA 3IWEA 2AE6A 1B6BA 4JWPA 4QBJA 5HMNA 5J8CA 4UFWA 4Q38A 1S7NA 4QB9A 2B3VA 4HNYB 3BLNA 4KOWA 2HV2A 4R3KA 4CYPA 5J8FA 1BOBA 3VWDA 5JPHA 4KOVA 3R9FA 1OZPA 2PC1A 4XNHC 4A2ZA 5ISVA 3S6GA 1I21A 2J8NA 1MJAA 1QSTA 2B5GB 2CNSA 4KOXA 1BO4A 1Q2CA 4H6UA 3B8GA 1QSNA 4UCPA 2FXFA 2ARHA 4X5KA 5DWNA 1YK3A 3F8KA 2ZXVA 3CXSA 2PR1A 4UBRA 3DSBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2B5G A;  4QVT A;  4KOU A;  2X7B A;  1IYK A;  2A4N A;  1YR0 A;  4AVB A;  2WPW A;  2J8R A;  4XPD B;  1IIC A;  3EO4 A;  5KTC A;  1IYL A;  1CM0 A;  3V8I A;  4YGO A;  2D4P A;  3TTH A;  2GIV A;  2G0B A;  4II9 A;  1YX0 A;  4OLL A;  3W91 A;  4PK3 A;  1P4N A;  3QAH A;  3PZJ A;  2FL4 A;  3EC4 A;  1XF8 A;  4NXY A;  3KKW A;  3SXO A;  3DDD A;  1S7F A;  4KVO E;  2D4O A;  3GY9 A;  3T9Y A;  3TO9 A;  4F6A A;  4EVY A;  4FD5 A;  4HNX B;  1XEB A;  3FBU A;  3I9S A;  2PQ8 A;  3DR8 A;  2ZPA A;  1CJW A;  5KTD A;  2CNM A;  1YVO A;  3E0K A;  1S60 A;  5H86 A;  1M4G A;  2VBQ A;  4FD6 A;  5IX3 A;  3FNC A;  4I49 A;  4M3S A;  1QSM A;  3I3G A;  1R57 A;  4DNC A;  2VI7 A;  4E2A A;  2K5T A;  5KTA A;  2IL4 A;  3JUW A;  5FVJ A;  4F0Y A;  3UY5 A;  3D2P A;  4E8O A;  3SHP A;  3VWE A;  2OZH A;  3F5B A;  2BUE A;  4R87 A;  1S3Z A;  1NMT A;  2PDO A;  4ORF A;  4XPL A;  2I00 A;  4UA3 A;  4CAV A;  5DWM A;  5IB0 A;  3F0A A;  2JDC A;  2OB0 A;  1IID A;  2BL1 A;  2P0W A;  4H6Z A;  3R1K A;  2B3U A;  4YRH A;  1XMT A;  4MBU A;  1QSR A;  1MK4 A;  5C82 A;  4Y49 C;  1NSL A;  2KCW A;  2F5I A;  4KOS A;  4L89 A;  2FE7 A;  2OU2 A;  3JVN A;  1M4D A;  2FS5 A;  3LD2 A;  1YGH A;  1P0H A;  4MJ8 A;  2REE A;  1Z9U A;  2FSR A;  1S7L A;  2WPX A;  2R7H A;  4LX9 A;  2Z11 A;  3GKR A;  4R57 A;  3EFA A;  4MY0 A;  4PV6 A;  2RC4 A;  3ZJ0 A;  4HKF A;  4OAD A;  4KOT A;  4KOR A;  1MJB A;  3EXN A;  1RXT A;  3D8P A;  2VZY A;  4ZBG A;  3OWC A;  3S6K A;  2P6E A;  1U6M A;  3G3S A;  2BEI A;  4KUA A;  3S6F A;  5C88 A;  2G3A A;  1MJ9 A;  3BJ8 A;  4KVX A;  3T90 A;  3W6S A;  3TCV A;  4JLY A;  3PP9 A;  4M85 A;  3R9G A;  2BSW A;  4U5Y A;  3TT2 A;  1WK4 A;  1IB1 E;  2VEZ A;  1I12 A;  2R1I A;  4FD4 A;  1UFH A;  5F49 A;  1PUA A;  2Q44 A;  4PSW A;  5EBV A;  4ONU A;  4J3G A;  4AG7 A;  1SQH A;  2Y0M A;  1YLE A;  4NEX A;  4XNH B;  4B5P B;  1YVK A;  2EVN A;  3MGD A;  2EUI A;  2H5M A;  1XE4 A;  2OH1 A;  4CRZ B;  4XPK A;  2GAN A;  2FIA A;  2ATR A;  4KOY A;  4L8A A;  2P6F A;  2R98 A;  3R96 A;  4LUA A;  2B4D B;  4MHD A;  3CXQ A;  4IUS A;  1M4I A;  3SXN A;  4KVM E;  2FT0 A;  1KZF A;  4XPD C;  3TE4 A;  4BMH A;  2B4D A;  3GYA A;  3FB3 A;  1WWZ A;  3D2M A;  3G8W A;  2PSW A;  4PK2 A;  2CY2 A;  1J4J A;  4U9Y A;  1RO5 A;  3DR6 A;  4RI1 A;  2Z10 A;  5IV0 A;  3WR7 A;  5H84 A;  2Q04 A;  1Y9W A;  3CXP A;  1S7K A;  1V0C A;  2JEV A;  1YRE A;  1LRZ A;  4KUB A;  2OZG A;  3TFY A;  3S6H A;  4AB7 A;  2VXK A;  4R9M A;  2HUZ A;  5F46 A;  4FD7 A;  1M1D A;  3EY5 A;  1Y9K A;  1Z4E A;  4E0A A;  3NE7 A;  4HNW B;  4MI4 A;  4NSQ A;  3R9E A;  4KLV A;  3FYN A;  4CRY B;  4RS2 A;  2PRB A;  1KUV A;  2ZW7 A;  1NE9 A;  4AVC A;  5HH1 A;  2C27 A;  3PGP A;  3LOD A;  4JXR A;  3K9U A;  1TIQ A;  3TOA A;  1I1D A;  1KUX A;  4IF5 A;  4CS0 B;  4JXQ A;  3IGR A;  2QML A;  5I0C A;  1M44 A;  4OAE A;  4NCZ A;  3FRM A;  3IWG A;  5EC4 A;  1K4J A;  2ZW4 A;  1XIX A;  2FIW A;  3RYO A;  1Q2Y A;  1FY7 A;  2JLM A;  2Q4V A;  4QUS A;  1S5K A;  2Q4Y A;  3BJ7 A;  3N7Z A;  4PSX A;  2VQY A;  3R95 A;  1KUY A;  3P2F A;  3QB8 A;  4QC6 A;  3TOB A;  2R8V A;  4U9Z A;  1B87 A;  4KLW A;  5CNP A;  2ZW5 A;  4MY3 A;  4R3L A;  5F48 A;  4JJX A;  2QIR A;  3FIX A;  2Q0Y A;  2P6G A;  1L0C A;  2REF A;  1Y7R A;  2CNT A;  4UWI A;  4NF1 A;  3TO6 A;  3W6X A;  2DXQ A;  2J8M A;  5GCN A;  1VHS A;  5F47 A;  2G3T A;  3DNS A;  1VKC A;  2JDD A;  2QEC A;  4JD6 A;  3TO7 A;  4Y49 B;  3C26 A;  4AVA A;  4CAW A;  4B5P A;  2O28 A;  2OZU A;  2Z0Z A;  2VZZ A;  4K30 A;  3P2H A;  4KZT A;  2GE3 A;  1N71 A;  4UWJ A;  1Z4R A;  2FCK A;  2Q7B A;  4AG9 A;  5JQ4 A;  2NMT A;  3ZZI A;  1PU9 A;  4H89 A;  2HQY A;  4B5O A;  1QSO A;  4GS4 A;  2PR8 A;  2B4B A;  3H4Q A;  2AJ6 A;  2B58 A;  2ZW6 A;  5E96 A;  4YFJ A;  3D3S A;  2I79 A;  1GHE A;  1ON0 A;  4CAX A;  3FXT A;  1Q2D A;  2AE6 A;  1B6B A;  4JWP A;  4QBJ A;  5HMN A;  5J8C A;  1S7N A;  4QB9 A;  2B3V A;  4HNY B;  3BLN A;  4KOW A;  2HV2 A;  4R3K A;  5J8F A;  1BOB A;  3VWD A;  5JPH A;  4KOV A;  3R9F A;  1OZP A;  2PC1 A;  4XNH C;  5ISV A;  3S6G A;  1I21 A;  2J8N A;  1MJA A;  1QST A;  2B5G B;  2CNS A;  4KOX A;  1BO4 A;  1Q2C A;  4H6U A;  3B8G A;  1QSN A;  2FXF A;  2ARH A;  4X5K A;  5DWN A;  1YK3 A;  3F8K A;  2ZXV A;  3CXS A;  2PR1 A;  4UBR A;  3DSB A; 
#chains in the Genus database with same CATH topology
 2B5G A;  4QVT A;  4KOU A;  1CP7 A;  2X7B A;  1IYK A;  2A4N A;  4KS9 A;  4M6G A;  1YR0 A;  4AVB A;  1QQ9 A;  3IJ3 A;  2WPW A;  2XEJ A;  2J8R A;  3PB4 X;  2NYQ A;  3RZA A;  3QNV A;  1TKF A;  4CYO A;  3KL9 A;  1JQG A;  1HDQ A;  4XPD B;  1IIC A;  3EO4 A;  4FUU A;  5KTC A;  2I3C A;  4C7I A;  1IYL A;  1CM0 A;  3V8I A;  1CPX A;  2D4P A;  3FED A;  4YGO A;  5JM6 A;  1ZG9 A;  3TTH A;  2GIV A;  2GU2 A;  3HLP A;  4OKO A;  2G0B A;  2PCU A;  4II9 A;  2ANP A;  1YX0 A;  4OLL A;  1Y7E A;  4MHN A;  4PK3 A;  3W91 A;  1BPN A;  1VIX A;  4CYN A;  4R7M A;  4R6T A;  3WC7 A;  1P4N A;  2BCO A;  3QAH A;  3B3C A;  3PZJ A;  4FBE A;  2XEI A;  2FL4 A;  3KHZ A;  3EC4 A;  1XF8 A;  5D29 A;  4NXY A;  5LYF A;  2Q43 A;  1ZO0 A;  3KKW A;  3B2Y A;  3FF3 A;  3SXO A;  3DDD A;  4GM5 A;  1S7F A;  4KVO E;  2D4O A;  3CPA A;  4A94 A;  4BBH A;  1XFO A;  3GY9 A;  4UFX A;  2POK A;  2Z3O A;  1OBR A;  3T9Y A;  3TO9 A;  3VAR A;  4F6A A;  4EVY A;  3IO1 A;  2Q51 A;  4FD5 A;  2EK8 A;  2CTC A;  3BI0 A;  4PXD A;  4HNX B;  1XEB A;  4NGS A;  3FBU A;  4B10 A;  3D66 A;  4RUH A;  2RB7 A;  3PBB A;  3CDX A;  3I9S A;  2PQ8 A;  2VL1 A;  3DR8 A;  5HVF A;  2ZPA A;  4FAI A;  1CJW A;  1IY7 A;  1FT7 A;  5KTD A;  2CNM A;  3SJF A;  1YVO A;  4GXH A;  3E0K A;  1S60 A;  3CZX A;  2PIY A;  5H86 A;  1ARM A;  1M4G A;  2VBQ A;  3BXM A;  4FD6 A;  5IX3 A;  3IC1 A;  2OOT A;  2C6C A;  1BAV A;  3FNC A;  2O4H A;  4I49 A;  4YWY A;  3WC6 A;  4LQG A;  4M3S A;  4OIW A;  1QSM A;  2ZEL A;  4B14 A;  3I3G A;  4M6I A;  2QVP A;  4X2T A;  4A95 A;  1R57 A;  3GIU A;  4ZX9 A;  4DNC A;  3TC8 A;  4ZX8 A;  2VI7 A;  4E2A A;  4B11 A;  2K5T A;  4Z65 A;  5KTA A;  2YND A;  2IL4 A;  2PJ1 A;  3LMS A;  2HB6 A;  3JUW A;  2ZEG A;  5FVJ A;  4C2Y A;  4F0Y A;  2Z3L A;  3UY5 A;  4KSI A;  1PCA A;  3D2P A;  4E8O A;  3SHP A;  2JBK A;  3BHX A;  3KHX A;  4DUK A;  4MFP A;  3VWE A;  2WZN A;  4NJQ A;  2OZH A;  3F5B A;  2BUE A;  3V7Z A;  3PB8 X;  4R87 A;  3SJE A;  1S3Z A;  1Z5R A;  2Q4Z A;  1NMT A;  2EBJ A;  2PDO A;  2V77 A;  2Z3M A;  3H8F A;  4ORF A;  3D7F A;  4XPL A;  3V38 A;  5K8M A;  2PJ0 A;  4ZGY B;  4CPA A;  2I00 A;  5HXD A;  4UA3 A;  5THW A;  1VHE A;  4CAV A;  3DLJ A;  4OC2 A;  4UCM A;  5DWM A;  5IB0 A;  3D7D A;  3F0A A;  2JDC A;  3PEI A;  2OB0 A;  4O23 A;  1IID A;  3HUV A;  2AFO A;  2BL1 A;  4M6H A;  2P0W A;  6CPA A;  4MFQ A;  4H6Z A;  3FEC A;  4UIB A;  1CBX A;  3R1K A;  3VH9 A;  4DJL A;  2B3U A;  4MFJ A;  4YRH A;  1XMT A;  4OME A;  1CX8 A;  3KR5 A;  4MBU A;  5HVG A;  5JGF A;  2DPT A;  2J9A A;  1QSR A;  1MK4 A;  1BLL E;  3SI0 A;  4MHY A;  4ZY1 A;  5C82 A;  4Y49 C;  4A30 A;  8CPA A;  3IU1 A;  2GFQ A;  3RO0 A;  1NSL A;  2KCW A;  4Q7A A;  2V8G A;  4RN7 A;  1Z8W A;  4BIN A;  2F5I A;  4KOS A;  1YW4 A;  4L89 A;  1Y0Y A;  2FE7 A;  2OU2 A;  2PJ7 A;  1M4D A;  2FS5 A;  3JVN A;  2C1C A;  3LD2 A;  4X3R A;  1YGH A;  1P0H A;  2Z3N A;  3PB7 X;  1F2P A;  4MJ8 A;  2REE A;  3WT4 A;  4MCP A;  1Z9U A;  2FSR A;  3PFO A;  4OP4 A;  1S7L A;  2WPX A;  1JWQ A;  3K2K A;  2R7H A;  2YNC C;  2PJ2 A;  3D4U A;  2Z11 A;  3GKR A;  4LX9 A;  4P44 A;  2OR4 A;  4P4D A;  3KR4 A;  1CP6 A;  3N5F A;  3D67 A;  4OID A;  2XEF A;  4R57 A;  2Z3P A;  3EFA A;  3NH8 A;  4MY0 A;  2RC4 A;  4OC0 A;  1ZLI A;  4PV6 A;  1X10 A;  3ZJ0 A;  4HKF A;  5K8O A;  4OAD A;  3S9M A;  4KOT A;  4KOR A;  2PJC A;  1AUG A;  4TWE A;  1MJB A;  3EXN A;  3KGQ A;  5F09 A;  1RXT A;  3D8P A;  2VZY A;  4ZBG A;  3OWC A;  2ZEE A;  3S6K A;  2P6E A;  5AG4 A;  2F7V A;  1U6M A;  3D68 A;  5HVH A;  3G3S A;  2BEI A;  4KUA A;  3S6F A;  5C88 A;  1ZLH A;  1PYT B;  2G3A A;  4WWV A;  1MJ9 A;  2WYR A;  3BJ8 A;  5G22 A;  4KVX A;  4P4J A;  3T90 A;  4CGN A;  4A33 A;  1ARL A;  3W6S A;  3TCV A;  1LFW A;  4JLY A;  3PP9 A;  5AG6 A;  4R8F A;  4IAV A;  4M85 A;  2O53 A;  3R9G A;  4NGM A;  4MFL A;  2BSW A;  3PB9 X;  4U5Y A;  3FX6 A;  3TT2 A;  1WK4 A;  1IB1 E;  2VEZ A;  1I12 A;  2WUU A;  5D8N A;  2AFU A;  3D7H A;  2R1I A;  2AFM A;  4MHZ A;  2ABZ A;  4WJB A;  4BD9 A;  4FD4 A;  1UFH A;  3IEH A;  5F49 A;  2BOA A;  5ELY A;  2CTB A;  1PUA A;  2Q44 A;  2AFX A;  2XEG A;  4PSW A;  2DPS A;  3KI9 A;  5EBV A;  2PJ4 A;  4ONU A;  5LYL A;  4J3G A;  4AG7 A;  1SQH A;  2Y0M A;  1YLE A;  3B7I A;  4KSF A;  3JTK A;  4NEX A;  4XNH B;  4B5P B;  1YVK A;  2CIJ A;  2EUI A;  2EVN A;  3MGD A;  2H5M A;  1XE4 A;  2OH1 A;  3MN8 A;  5DS0 A;  4XPK A;  4CRZ B;  4F9V A;  4CGL A;  2GAN A;  4G1P A;  2FIA A;  2PJ6 A;  4C2X A;  2ATR A;  4KOY A;  4MFK A;  4UCN A;  4L8A A;  2P6F A;  2R98 A;  3R96 A;  4NGN A;  4LUA A;  2B4D B;  2PVW A;  4MHD A;  5G21 A;  2RFH A;  3CXQ A;  1A2Z A;  4A39 A;  3NH4 A;  2Z3K A;  4IUS A;  5K8P A;  1M4I A;  3B3T A;  2PE3 A;  4LQ6 A;  4C2Z A;  3SXN A;  1HEE A;  4KVM E;  1R3N A;  5I4M A;  1UWY A;  3B3S A;  2FT0 A;  1KZF A;  3PBE A;  1Z2L A;  4XPD C;  3TE4 A;  4BMH A;  5A27 A;  4P10 A;  2DEA A;  3ISZ A;  2B4D A;  3GYA A;  4IK2 A;  2CXA A;  1WWZ A;  3D2M A;  3FB3 A;  3G8W A;  4B6Z A;  4CAE A;  2PSW A;  4PK2 A;  3IU2 A;  4CGO A;  2CY2 A;  1J4J A;  4U9Y A;  1RO5 A;  3A9L A;  3DR6 A;  3GUX A;  4IHM A;  4OC1 A;  4RI1 A;  2Z10 A;  5IV0 A;  4MRI A;  3WR7 A;  4EWT A;  3CPX A;  3TX8 A;  4MHP A;  5H84 A;  2Q04 A;  3H5Z A;  1Z8X A;  1Y9W A;  4C68 A;  3CXP A;  1S7K A;  1V0C A;  2JEV A;  1YRE A;  4PQA A;  2AFS A;  1LRZ A;  4KUB A;  2OZG A;  3SI1 A;  3TFY A;  3S6H A;  4AB7 A;  2VXK A;  5AGE A;  2QJ8 A;  2V8H A;  4ONW A;  4P4I A;  4P4F A;  4CGP A;  1VGY A;  3K9T A;  2ZEP A;  4R9M A;  4ZI6 A;  2HUZ A;  4MFZ A;  5F46 A;  1F57 A;  4FD7 A;  4UF4 A;  1KWM A;  1M1D A;  2WSA A;  3EY5 A;  1Y9K A;  1Z4E A;  1RTQ A;  4E0A A;  2Q7S A;  2JBJ A;  3NE7 A;  3PB6 X;  4HNW B;  2ZOF A;  2JEW A;  3GLJ A;  4MI4 A;  4NSQ A;  3BI1 A;  3IWW A;  3R9E A;  4KLV A;  1NSA A;  3FYN A;  1VHO A;  3GB0 A;  4NJR A;  4CRY B;  1Q7L A;  1XBU A;  2ZEH A;  4RS2 A;  4UIA A;  2PRB A;  1KUV A;  5G20 A;  4F8Z A;  2ZW7 A;  1NE9 A;  3PRT A;  4AVC A;  5HH1 A;  2C27 A;  3PGP A;  2ZEM A;  2GRE A;  3LOD A;  4P4E A;  4UFV A;  2YGW A;  3K9U A;  4JXR A;  5A28 A;  4ZY0 A;  3L2N A;  5AG5 A;  4F0X A;  1TIQ A;  5LRG A;  3TOA A;  1I1D A;  3MRU A;  1KUX A;  3FJU A;  4IF5 A;  4CS0 B;  3FH4 A;  2ZEF A;  3NA6 A;  4JXQ A;  3IGR A;  2QML A;  5I0C A;  1M44 A;  7CPA A;  1ZG7 A;  4OAE A;  1YQE A;  2PJ8 A;  1YLO A;  4CAW A;  4NCZ A;  1M4L A;  3FRM A;  2PJ3 A;  3IWG A;  5EC4 A;  1K4J A;  5J1Q A;  2ZW4 A;  1XIX A;  1ZG8 A;  2FIW A;  4EFD A;  1Z8T A;  2ZOG A;  1Q2Y A;  2YNE A;  3RYO A;  1FY7 A;  3RNZ A;  2G9D A;  2JLM A;  2Q4V A;  4QUS A;  1CPS A;  1H8L A;  1S5K A;  1YME A;  1EE3 P;  2Q4Y A;  3KAS A;  4CYQ A;  3ISX A;  3BJ7 A;  2IJZ A;  4C7H A;  2F8H A;  3N7Z A;  3H8G A;  4PSX A;  2VQY A;  3R95 A;  4AXV A;  1TXR A;  3NE8 A;  5LYI A;  1CG2 A;  1KUY A;  3P2F A;  4P45 A;  3WC5 A;  1LAN A;  3QB8 A;  2V8V A;  4QC6 A;  1YW6 A;  2R8V A;  4U9Z A;  3TOB A;  1B87 A;  4KLW A;  4ZYQ A;  4NGQ A;  5CNP A;  1FNO A;  2ZW5 A;  4MY3 A;  2ZEO A;  3JRU A;  3KQX A;  3LAC A;  4R3L A;  5F48 A;  3VAT A;  4JJX A;  2QIR A;  5LRJ A;  4KSA A;  3FIX A;  4A38 A;  2Q0Y A;  5G1Z A;  2P6G A;  1L0C A;  4A37 A;  3IFE A;  2REF A;  5K8N A;  1Y7R A;  2CNT A;  4UWI A;  4NF1 A;  2QYV A;  3TO6 A;  4B13 A;  3W6X A;  1DE4 C;  4F9U A;  2DXQ A;  3WAB A;  2ZEN A;  3NFZ A;  2J8M A;  5IB9 A;  4MCQ A;  2C6P A;  5GCN A;  2PJ5 A;  1VHS A;  2PJB A;  4YU9 A;  5F47 A;  2G3T A;  2AFZ A;  3DNS A;  1VKC A;  2JDD A;  2C6G A;  2IMO A;  2QEC A;  4JD6 A;  4X8I A;  3TO7 A;  4TNU A;  5CBM A;  2PVV A;  3SJX A;  1X12 A;  4P4B A;  4MXU A;  1DTD A;  3C26 A;  4Y49 B;  3D7G A;  1IU8 A;  1GYT A;  3FMC A;  5AG7 A;  4P6Y A;  5EMI A;  4AVA A;  2O28 A;  3CT9 A;  4B5P A;  3S9N A;  2OZU A;  2Z0Z A;  2VZZ A;  2CF4 A;  4OC5 A;  4K30 A;  4OC4 A;  2FVG A;  3P2H A;  4KZT A;  2GE3 A;  3H8E A;  5CPA A;  3RAM A;  1N71 A;  1LAP A;  4UWJ A;  1Z4R A;  4JYW A;  4CAF A;  2FCK A;  2Q7B A;  4AG9 A;  4A31 A;  1HDU A;  5JQ4 A;  4CGM A;  4R76 A;  1AYE A;  2NMT A;  4B12 A;  2AFW A;  3ZZI A;  5BWA B;  1PU9 A;  4H89 A;  1TKH A;  2HQY A;  4JZ0 A;  4B5O A;  1ELL P;  1QSO A;  3FVL A;  4GS4 A;  1Z8L A;  2ZED A;  3NH5 A;  2PR8 A;  2B4B A;  2GLF A;  4PXE A;  4DYO A;  3H4Q A;  3LWU A;  3FEE A;  1F2O A;  1R43 A;  2EO8 A;  1IOI A;  2AJ6 A;  2B58 A;  2ZW6 A;  4Q36 A;  4PPZ A;  5E96 A;  3PFE A;  4NGT A;  5LYD A;  4YFJ A;  3D3S A;  2I79 A;  2PJ9 A;  3T8W A;  4NFR A;  1LAM A;  4NGR A;  1GHE A;  1TF9 A;  3KZW A;  1ON0 A;  3S9L A;  3SI2 A;  4CAX A;  1IOF A;  3FXT A;  4A32 A;  1Q2D A;  2YNC A;  4ZY2 A;  4H2K A;  3IWE A;  2AE6 A;  1B6B A;  4JWP A;  4K3N A;  4QBJ A;  5HMN A;  1ELM P;  5J8C A;  4UFW A;  5JH9 A;  4Q38 A;  4PXB A;  1S7N A;  4QB9 A;  2B3V A;  4HNY B;  3RBU A;  2GLJ A;  3BLN A;  4KOW A;  2HV2 A;  4R3K A;  3B3V A;  4FWU A;  4CYP A;  5J8F A;  4UEZ A;  4UEF A;  1BOB A;  2PIZ A;  3B3W A;  3VWD A;  1XMB A;  5JPH A;  4KOV A;  3R9F A;  4MMO A;  2V8D A;  3KQZ A;  4HPS A;  1XOV A;  1XRY A;  5LRK A;  1OZP A;  2PC1 A;  4XNH C;  1LOK A;  4A2Z A;  1BPM A;  4MCR A;  4OC3 A;  5ISV A;  1Y0R A;  2PRQ A;  3DGV A;  1I21 A;  3B35 A;  3S6G A;  2BO9 A;  2J8N A;  3QAY A;  1XJO A;  2IQ6 A;  3I1U A;  2CNS A;  1MJA A;  1QST A;  2B5G B;  1YSJ A;  4KOX A;  1BO4 A;  1Q2C A;  4W9Y A;  4H6U A;  2EWB A;  4EME A;  3B8G A;  1QSN A;  2DF5 A;  1QMU A;  4UCP A;  2FXF A;  1LCP A;  2ARH A;  2PJA A;  4X5K A;  4PXC A;  1YK3 A;  4NGP A;  5DWN A;  1IGB A;  3SJG A;  2EK9 A;  3IIB A;  3F8K A;  2ZXV A;  3CXS A;  2PR1 A;  1TKJ A;  4UBR A;  2HC9 A;  4MCS A;  4UEE A;  1AMP A;  1TF8 A;  2ODF A;  3DSB A;  2NSM A; 
#chains in the Genus database with same CATH homology
 2B5G A;  4QVT A;  4KOU A;  2X7B A;  1IYK A;  2A4N A;  4KS9 A;  1YR0 A;  4AVB A;  2WPW A;  2J8R A;  4CYO A;  4XPD B;  1IIC A;  3EO4 A;  5KTC A;  4C7I A;  1IYL A;  1CM0 A;  3V8I A;  4YGO A;  2D4P A;  3TTH A;  2GIV A;  2G0B A;  4II9 A;  1YX0 A;  4OLL A;  3W91 A;  4PK3 A;  4CYN A;  1P4N A;  3QAH A;  3PZJ A;  2FL4 A;  3EC4 A;  1XF8 A;  4NXY A;  1ZO0 A;  3KKW A;  3SXO A;  3DDD A;  1S7F A;  4KVO E;  2D4O A;  4BBH A;  3GY9 A;  4UFX A;  2Z3O A;  3T9Y A;  3TO9 A;  4F6A A;  4EVY A;  4FD5 A;  4HNX B;  1XEB A;  3FBU A;  4B10 A;  3I9S A;  2PQ8 A;  3DR8 A;  2ZPA A;  1CJW A;  5KTD A;  2CNM A;  1YVO A;  3E0K A;  1S60 A;  5H86 A;  1M4G A;  2VBQ A;  4FD6 A;  5IX3 A;  3FNC A;  4I49 A;  4M3S A;  1QSM A;  4B14 A;  3I3G A;  4A95 A;  1R57 A;  4DNC A;  2VI7 A;  4E2A A;  4B11 A;  2K5T A;  5KTA A;  2YND A;  2IL4 A;  3JUW A;  5FVJ A;  4C2Y A;  4F0Y A;  2Z3L A;  3UY5 A;  3D2P A;  4E8O A;  3SHP A;  4MFP A;  3VWE A;  2OZH A;  3F5B A;  2BUE A;  4R87 A;  1S3Z A;  1NMT A;  2PDO A;  2Z3M A;  4ORF A;  4XPL A;  4ZGY B;  2I00 A;  4UA3 A;  4CAV A;  4UCM A;  5DWM A;  5IB0 A;  3F0A A;  2JDC A;  2OB0 A;  1IID A;  2BL1 A;  2P0W A;  4MFQ A;  4H6Z A;  3R1K A;  2B3U A;  4MFJ A;  4YRH A;  1XMT A;  4MBU A;  2DPT A;  1QSR A;  1MK4 A;  5C82 A;  4Y49 C;  4A30 A;  3IU1 A;  1NSL A;  2KCW A;  2F5I A;  4KOS A;  4L89 A;  2FE7 A;  2OU2 A;  3JVN A;  1M4D A;  2FS5 A;  3LD2 A;  1YGH A;  1P0H A;  2Z3N A;  4MJ8 A;  2REE A;  1Z9U A;  2FSR A;  1S7L A;  2WPX A;  2R7H A;  2YNC C;  4LX9 A;  2Z11 A;  3GKR A;  4R57 A;  2Z3P A;  3EFA A;  4MY0 A;  4PV6 A;  2RC4 A;  3ZJ0 A;  4HKF A;  4OAD A;  4KOT A;  4KOR A;  1MJB A;  3EXN A;  1RXT A;  3D8P A;  2VZY A;  4ZBG A;  3OWC A;  3S6K A;  2P6E A;  5AG4 A;  1U6M A;  3G3S A;  2BEI A;  4KUA A;  3S6F A;  5C88 A;  2G3A A;  1MJ9 A;  3BJ8 A;  5G22 A;  4KVX A;  3T90 A;  4CGN A;  4A33 A;  3W6S A;  3TCV A;  4JLY A;  3PP9 A;  5AG6 A;  4M85 A;  3R9G A;  4MFL A;  2BSW A;  4U5Y A;  3TT2 A;  1WK4 A;  1IB1 E;  2VEZ A;  1I12 A;  2WUU A;  2R1I A;  4FD4 A;  1UFH A;  5F49 A;  1PUA A;  2Q44 A;  4PSW A;  2DPS A;  5EBV A;  4ONU A;  4J3G A;  4AG7 A;  1SQH A;  2Y0M A;  1YLE A;  4KSF A;  3JTK A;  4NEX A;  4XNH B;  4B5P B;  1YVK A;  2EVN A;  3MGD A;  2EUI A;  2H5M A;  1XE4 A;  2OH1 A;  4CRZ B;  4XPK A;  4CGL A;  2GAN A;  2FIA A;  4C2X A;  2ATR A;  4KOY A;  4MFK A;  4UCN A;  4L8A A;  2P6F A;  2R98 A;  3R96 A;  4LUA A;  2B4D B;  5G21 A;  4MHD A;  3CXQ A;  2Z3K A;  4IUS A;  1M4I A;  4C2Z A;  3SXN A;  4KVM E;  2FT0 A;  1KZF A;  4XPD C;  3TE4 A;  4BMH A;  5A27 A;  2B4D A;  3GYA A;  2CXA A;  1WWZ A;  3D2M A;  3FB3 A;  3G8W A;  4CAE A;  2PSW A;  4PK2 A;  3IU2 A;  4CGO A;  2CY2 A;  1J4J A;  4U9Y A;  1RO5 A;  3A9L A;  3DR6 A;  4RI1 A;  2Z10 A;  5IV0 A;  3WR7 A;  5H84 A;  2Q04 A;  3H5Z A;  1Y9W A;  4C68 A;  3CXP A;  1S7K A;  1V0C A;  2JEV A;  1YRE A;  1LRZ A;  4KUB A;  2OZG A;  3TFY A;  3S6H A;  4AB7 A;  2VXK A;  5AGE A;  4CGP A;  4R9M A;  2HUZ A;  4MFZ A;  5F46 A;  4FD7 A;  1M1D A;  2WSA A;  3EY5 A;  1Y9K A;  1Z4E A;  4E0A A;  3NE7 A;  4HNW B;  4MI4 A;  4NSQ A;  3R9E A;  4KLV A;  3FYN A;  4CRY B;  4RS2 A;  2PRB A;  1KUV A;  5G20 A;  2ZW7 A;  1NE9 A;  4AVC A;  5HH1 A;  2C27 A;  3PGP A;  3LOD A;  4UFV A;  2YGW A;  3K9U A;  4JXR A;  4F0X A;  5AG5 A;  1TIQ A;  3TOA A;  1I1D A;  1KUX A;  4IF5 A;  4CS0 B;  4JXQ A;  3IGR A;  2QML A;  5I0C A;  1M44 A;  4OAE A;  4NCZ A;  3FRM A;  3IWG A;  5EC4 A;  1K4J A;  2ZW4 A;  1XIX A;  2FIW A;  3RYO A;  1Q2Y A;  2YNE A;  1FY7 A;  2JLM A;  2Q4V A;  4QUS A;  1S5K A;  2Q4Y A;  4CYQ A;  3BJ7 A;  4C7H A;  3N7Z A;  4PSX A;  2VQY A;  3R95 A;  1KUY A;  3P2F A;  3QB8 A;  4QC6 A;  3TOB A;  2R8V A;  4U9Z A;  1B87 A;  4KLW A;  5CNP A;  2ZW5 A;  4MY3 A;  4R3L A;  5F48 A;  4JJX A;  2QIR A;  4KSA A;  3FIX A;  2Q0Y A;  5G1Z A;  2P6G A;  1L0C A;  2REF A;  1Y7R A;  2CNT A;  4UWI A;  4NF1 A;  3TO6 A;  4B13 A;  3W6X A;  2DXQ A;  2J8M A;  5GCN A;  1VHS A;  5F47 A;  2G3T A;  3DNS A;  1VKC A;  2JDD A;  2QEC A;  4JD6 A;  3TO7 A;  4Y49 B;  3C26 A;  4AVA A;  4CAW A;  5AG7 A;  4B5P A;  2O28 A;  2OZU A;  2Z0Z A;  2VZZ A;  4K30 A;  3P2H A;  4KZT A;  2GE3 A;  1N71 A;  4UWJ A;  1Z4R A;  4CAF A;  2FCK A;  2Q7B A;  4AG9 A;  4A31 A;  5JQ4 A;  4CGM A;  4B12 A;  2NMT A;  3ZZI A;  5BWA B;  1PU9 A;  4H89 A;  2HQY A;  4B5O A;  1QSO A;  4GS4 A;  2PR8 A;  2B4B A;  3H4Q A;  2AJ6 A;  2B58 A;  2ZW6 A;  4Q36 A;  5E96 A;  5A28 A;  4YFJ A;  3D3S A;  2I79 A;  1GHE A;  1ON0 A;  4CAX A;  3FXT A;  4A32 A;  1Q2D A;  2YNC A;  3IWE A;  2AE6 A;  1B6B A;  4JWP A;  4QBJ A;  5HMN A;  5J8C A;  4UFW A;  4Q38 A;  1S7N A;  4QB9 A;  2B3V A;  4HNY B;  3BLN A;  4KOW A;  2HV2 A;  4R3K A;  4CYP A;  5J8F A;  1BOB A;  3VWD A;  5JPH A;  4KOV A;  3R9F A;  1OZP A;  2PC1 A;  4XNH C;  4A2Z A;  5ISV A;  3S6G A;  1I21 A;  2J8N A;  1MJA A;  1QST A;  2B5G B;  2CNS A;  4KOX A;  1BO4 A;  1Q2C A;  4H6U A;  3B8G A;  1QSN A;  4UCP A;  2FXF A;  2ARH A;  4X5K A;  5DWN A;  1YK3 A;  3F8K A;  2ZXV A;  3CXS A;  2PR1 A;  4UBR A;  3DSB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...