4R87A

Crystal structure of spermidine n-acetyltransferase from vibrio cholerae in complex with coa and spermine
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
170
structure length
170
Chain Sequence
NSQLTLRALERGDLRFIHNLNNNRNIMSYWFEEPYESFDELEELYNKHIHDNAERRFVVEDAQKNLIGLVELIEINYIHRSAEFQIIIAPEHQGKGFARTLINRALDYSFTILNLHKIYLHVAVENPKAVHLYEECGFVEEGHLVEEFFINGRYQDVKRMYILQSKYLNR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Spermidine n1-acetyltransferase
publication title A Novel Polyamine Allosteric Site of SpeG from Vibrio cholerae Is Revealed by Its Dodecameric Structure.
pubmed doi rcsb
source organism Vibrio cholerae o1
total genus 41
structure length 170
sequence length 170
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature ec 2.3.1.57: Diamine N-acetyltransferase.
pdb deposition date 2014-08-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13302 Acetyltransf_3 Acetyltransferase (GNAT) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4r87A00
4ONUA 4FD6A 4MY0A 3ZZIA 3EXNA 1QSTA 4MHDA 4L8AA 2JDDA 2VEZA 3D2MA 1VKCA 2PC1A 4II9A 4R3KA 3R96A 2ZW4A 3R9GA 4Y49B 3TFYA 2Q4VA 2P6GA 2OZHA 2Z0ZA 3BLNA 4NCZA 3G8WA 2FL4A 1I1DA 4EVYA 5I0CA 2H5MA 5H84A 4AVAA 2BL1A 5IV0A 3TO9A 1Q2YA 1B6BA 4PK2A 4JD6A 4CAWA 1YVKA 5H86A 1NE9A 1RO5A 4QB9A 5GCNA 4E0AA 2FIAA 4PSWA 3QB8A 2ZW5A 3JVNA 4XNHB 1U6MA 3R95A 3S6FA 2PRBA 2PDOA 3GY9A 4OAEA 4ORFA 5IB0A 1I12A 3SXNA 4HNWB 4LUAA 1QSRA 2Z11A 1Y9WA 2VZZA 1YR0A 1S3ZA 2ZXVA 4UBRA 1IICA 4CS0B 2J8RA 1YLEA 3C26A 4FD7A 1SQHA 3FXTA 4AVBA 3D3SA 4B5OA 3FIXA 1S7NA 4FD5A 3DSBA 4Y49C 5HMNA 3RYOA 4KOYA 2IL4A 2C27A 1XF8A 3TE4A 3R9EA 1L0CA 2P6EA 2B4DB 4KOUA 1M4GA 3I9SA 3TOAA 4KVOE 3TO6A 1R57A 1S5KA 2B58A 3UY5A 2QIRA 4QBJA 1OZPA 3WR7A 1BOBA 2ATRA 4JWPA 3T9YA 2BUEA 4NF1A 1CJWA 4F0YA 2OB0A 2B3UA 2EVNA 4YRHA 4HNYB 2X7BA 3FRMA 3TOBA 1YGHA 4R87A 2CNSA 4JLYA 4U5YA 4AVCA 2R7HA 2PQ8A 4FD4A 2CNTA 5C88A 2FIWA 3S6HA 1TIQA 3GYAA 3GKRA 3IWGA 3TT2A 1Z9UA 2Y0MA 4XPKA 2REFA 1WWZA 5KTCA 4B5PB 4KLVA 4KVME 2HQYA 3S6KA 4YFJA 4R57A 3D2PA 2VXKA 2D4OA 2PSWA 5KTDA 4E8OA 3D8PA 2REEA 4KOWA 1MJAA 2HUZA 2DXQA 2O28A 4L89A 4IF5A 5F46A 2BEIA 2FXFA 2OH1A 3DDDA 4XPLA 4CRYB 4KOSA 5JQ4A 3BJ7A 4M3SA 2VBQA 2D4PA 3NE7A 1J4JA 2I79A 3BJ8A 1S7FA 3T90A 4JJXA 4E2AA 1QSMA 1KUXA 2OZUA 4X5KA 3G3SA 1GHEA 2J8MA 4MI4A 4AB7A 1MJBA 2OU2A 3JUWA 4KORA 2B4DA 2B5GB 4RS2A 3SXOA 2CNMA 1LRZA 3ZJ0A 4KZTA 2JLMA 2ARHA 2Q04A 2PR8A 1KUYA 2R8VA 2VQYA 4KOVA 4QC6A 2JEVA 5ISVA 4CAXA 2VI7A 4LX9A 2Q7BA 3S6GA 3V8IA 1MK4A 2GE3A 4MJ8A 4H89A 3VWDA 3LD2A 2GANA 4U9ZA 1S7KA 4KLWA 2ZW6A 3TTHA 1CM0A 4K30A 3LODA 4H6UA 2P0WA 1Z4EA 1M1DA 4UWIA 3K9UA 2B3VA 4B5PA 3R9FA 4ZBGA 3EFAA 5F49A 2FCKA 4XNHC 1MJ9A 4CRZB 1XE4A 3MGDA 1IB1E 3B8GA 1P4NA 2WPXA 3P2FA 5C82A 4KOXA 1IYKA 2AJ6A 1PU9A 2R98A 1S60A 1WK4A 2ZW7A 2CY2A 4UWJA 3OWCA 5DWNA 5F48A 1M4IA 2G0BA 3W6SA 1KUVA 3TCVA 4F6AA 4CAVA 2PR1A 5JPHA 5E96A 2G3AA 2FSRA 2FS5A 1Y9KA 4PSXA 3F8KA 5KTAA 3KKWA 1VHSA 1K4JA 3N7ZA 2B5GA 3W91A 2FE7A 4KUAA 4NSQA 3IGRA 4GS4A 1S7LA 3PZJA 2WPWA 4PK3A 2VZYA 4MBUA 4M85A 4XPDB 3TO7A 2P6FA 4JXQA 3W6XA 1YVOA 3P2HA 2RC4A 3PGPA 2GIVA 1NMTA 1NSLA 2QECA 2I00A 5EC4A 1B87A 5EBVA 1Y7RA 1YK3A 4I49A 3I3GA 4UA3A 5HH1A 1IYLA 1XEBA 3FNCA 4OADA 4PV6A 3QAHA 2EUIA 3PP9A 2F5IA 1IIDA 2A4NA 1YX0A 1M44A 1YREA 1XMTA 3FYNA 4QVTA 4JXRA 3EO4A 2JDCA 1QSOA 2Q4YA 1N71A 1Q2CA 1FY7A 1V0CA 1I21A 4XPDC 2BSWA 2K5TA 4OLLA 3F5BA 1BO4A 1Z4RA 4R3LA 3SHPA 4IUSA 4AG7A 4J3GA 5CNPA 5DWMA 3EC4A 3VWEA 3CXPA 3F0AA 4U9YA 4AG9A 4HKFA 1RXTA 4H6ZA 2NMTA 3E0KA 4NEXA 3FBUA 3EY5A 4RI1A 2R1IA 2J8NA 2G3TA 3H4QA 4NXYA 1PUAA 3DR6A 2Q44A 4KOTA 1XIXA 3DNSA 4BMHA 3CXQA 1M4DA 3DR8A 2Z10A 1ON0A 4R9MA 5FVJA 4YGOA 5J8CA 4MY3A 3FB3A 4DNCA 4KVXA 1UFHA 2AE6A 2B4BA 5J8FA 2QMLA 2OZGA 2FT0A 2KCWA 3CXSA 2Q0YA 2HV2A 4KUBA 1QSNA 1KZFA 5IX3A 3R1KA 1Q2DA 1P0HA 2ZPAA 4QUSA 5F47A 4HNXB
chains in the Genus database with same CATH superfamily
3T8WA 5JM6A 4A38A 4ONUA 1HDQA 2WYRA 4A32A 4FD6A 4MCPA 4MY0A 3KL9A 2F7VA 3EXNA 5G22A 3ZZIA 5HVGA 4HPSA 1QSTA 4MHDA 1FT7A 4L8AA 4BBHA 1IOIA 2JDDA 2VEZA 3D2MA 1VKCA 4A94A 2PC1A 4II9A 4R3KA 3R96A 2QVPA 2ZW4A 2PJ7A 2AFZA 2ZOFA 4NGSA 4B10A 2IMOA 1LCPA 2GLJA 3R9GA 4Y49B 3TFYA 2Q4VA 2P6GA 3MRUA 3SJXA 2DEAA 2OZHA 2Z0ZA 1Y0RA 3BLNA 4MHZA 4K3NA 4O23A 4NCZA 3RZAA 3BXMA 1YW4A 2HC9A 3G8WA 3H5ZA 4P44A 2FL4A 2JBKA 4NGQA 1I1DA 4EVYA 4F9UA 5I0CA 3V7ZA 2H5MA 5H84A 1XJOA 4AVAA 2BL1A 4CGPA 1XOVA 5IV0A 2AFOA 4P4BA 3TO9A 2ZEGA 1Q2YA 5BWAB 4IK2A 4F9VA 4UIBA 1A2ZA 1B6BA 3HUVA 4PK2A 4JD6A 5AG6A 4CAWA 1YVKA 4GXHA 1QQ9A 1NE9A 1RO5A 2PE3A 5H86A 2PJ0A 4QB9A 1LAMA 3K2KA 4MHNA 5GCNA 4E0AA 2FIAA 2IQ6A 1F57A 2V8VA 4PSWA 3QB8A 2ZW5A 3JVNA 5D29A 4OP4A 2XEJA 4XNHB 1U6MA 5F09A 2ZEFA 2Z3OA 3R95A 5LRJA 3S6FA 2PRBA 2PDOA 3GY9A 4OAEA 3B7IA 4ORFA 5IB0A 3TC8A 1XRYA 4B12A 1I12A 1M4LA 3SXNA 4HNWB 4UEZA 3D67A 1ZG7A 3IC1A 4LUAA 1QSRA 2Z11A 4P10A 1Y9WA 2VZZA 4BINA 4DUKA 1YR0A 1S3ZA 3ISZA 2ZXVA 4UFWA 4PPZA 4UBRA 2CTBA 7CPAA 1IICA 2GREA 3KI9A 2J8RA 1YLEA 3C26A 4FD7A 4CS0B 1SQHA 2XEIA 3FXTA 4AVBA 1R3NA 4OC5A 2JEWA 3D3SA 1H8LA 3FIXA 4B5OA 1S7NA 4FD5A 3DSBA 4Y49C 5HMNA 3RYOA 4KOYA 4AXVA 2IL4A 1Y0YA 2PVVA 1ARMA 3JTKA 1RTQA 2C27A 1XF8A 1Y7EA 4NJQA 3CT9A 3PEIA 3FX6A 4UEFA 4OKOA 3BHXA 2WZNA 4DJLA 1IGBA 4UFXA 3R9EA 1L0CA 3TE4A 2YNCC 2P6EA 3H8GA 2B4DB 4KOUA 4UEEA 2V77A 1M4GA 3I9SA 3SI1A 3TOAA 1Z2LA 4KVOE 3IWWA 1R57A 1S5KA 1TKJA 2B58A 3CDXA 3IFEA 1VIXA 2HB6A 3B35A 3KZWA 5D8NA 2QIRA 3UY5A 4R76A 5LRKA 4QBJA 1OZPA 2C6CA 3PB4X 3WR7A 1YLOA 4ONWA 5LYIA 1BOBA 1KWMA 2ATRA 2CXAA 2PIZA 4A37A 4JWPA 3D7FA 3T9YA 2BUEA 4NF1A 1CJWA 4F0YA 2OB0A 5AGEA 2ZOGA 3FEEA 3IJ3A 4CPAA 2B3UA 5G21A 2EVNA 5DS0A 1AMPA 1YQEA 2YGWA 4YRHA 4HNYB 2X7BA 3FRMA 3TOBA 3PB6X 1YGHA 1FNOA 4R87A 3S9MA 3SI0A 2CNSA 4JLYA 4U5YA 2WUUA 4AVCA 2R7HA 3CZXA 2PQ8A 4MFZA 4FD4A 2CNTA 5C88A 2FIWA 4RN7A 3S6HA 3GUXA 4OMEA 1TIQA 2Z3LA 3GKRA 3GYAA 4A33A 2FVGA 3IWGA 2CIJA 3TT2A 3B3CA 4G1PA 3WT4A 1Z9UA 2Y0MA 4OC1A 4XPKA 2REFA 1WWZA 2YNCA 5KTCA 2Z3PA 4Z65A 3VARA 1X12A 4C2ZA 2BO9A 4B11A 4B5PB 4KLVA 3KASA 4KVME 3KGQA 2HQYA 3S6KA 3B3TA 4YFJA 4R57A 3TO6A 3D2PA 2VXKA 2D4OA 1LFWA 2PSWA 3IO1A 3D7DA 1X10A 2CTCA 5KTDA 4E8OA 1ELMP 3D8PA 2PRQA 4A39A 2REEA 4KOWA 1MJAA 2HUZA 4R8FA 4NGPA 2DXQA 2O28A 4RUHA 4MFKA 4L89A 4IF5A 3SJFA 5F46A 1HDUA 5CPAA 3D4UA 5I4MA 2BEIA 2FXFA 2OH1A 3DDDA 5LYDA 2Z3NA 2EO8A 2EBJA 4XPLA 5LYLA 4UCMA 4CRYB 3JRUA 4EMEA 2IJZA 3V38A 4KOSA 1PCAA 2Q7SA 4MFJA 5JQ4A 5K8NA 4P4IA 3BJ7A 4M3SA 2VBQA 4NGMA 2GU2A 4P4JA 3B2YA 2D4PA 3NE7A 4MFQA 1J4JA 2I79A 3BJ8A 1BLLE 1S7FA 4CYPA 4ZI6A 5HXDA 3T90A 4JJXA 4E2AA 3WC6A 2PJCA 1ZLIA 3NFZA 3TX8A 1QSMA 1KUXA 1UWYA 2OZUA 2ZEEA 4X5KA 3G3SA 4A2ZA 1GHEA 1Z5RA 1JQGA 2J8MA 4MI4A 4AB7A 2G9DA 1MJBA 4F8ZA 2Q51A 2OU2A 2EWBA 4F0XA 3B3SA 4MFPA 2ZEPA 3JUWA 4KORA 2B4DA 2B5GB 1HEEA 4RS2A 1IY7A 3SXOA 2CNMA 1AUGA 1LRZA 3ZJ0A 2QYVA 4KZTA 2JLMA 4B14A 4IAVA 3GIUA 4P4EA 2ARHA 3KHZA 4FBEA 2Q04A 5CBMA 1QMUA 2PR8A 1R43A 3RBUA 4LQGA 1KUYA 2R8VA 2VQYA 4A30A 4KOVA 4KSAA 4QC6A 4LQ6A 2JEVA 4R6TA 2PJ2A 3MN8A 3FVLA 4MMOA 2V8GA 4OC3A 3N5FA 5ISVA 4CAXA 2VI7A 1PYTB 3KR4A 3SI2A 4PQAA 5EMIA 2JBJA 2PIYA 4LX9A 4TNUA 4JYWA 2Q7BA 4MHPA 5HVHA 3S6GA 2PJBA 3V8IA 4MRIA 1MK4A 2GE3A 4MJ8A 4H89A 1IU8A 3VWDA 3LD2A 1NSAA 2GANA 4U9ZA 4CGMA 1S7KA 4FAIA 1OBRA 4KLWA 2ABZA 2ZW6A 3PB8X 3TTHA 1CM0A 4K30A 3LODA 4H6UA 2P0WA 1Z4EA 2POKA 4P6YA 1M1DA 4UWIA 3K9UA 2B3VA 2PJ4A 4B5PA 2C1CA 4W9YA 3DGVA 3L2NA 2BCOA 4M6IA 3R9FA 3PB9X 3PB7X 4ZBGA 3EFAA 2DPTA 4P4DA 2BOAA 1TF8A 5F49A 5THWA 2ANPA 2FCKA 4XNHC 1MJ9A 4CRZB 1XE4A 2J9AA 3MGDA 4M6HA 1TF9A 4B13A 1IB1E 3KQXA 3B8GA 1P4NA 5G20A 4CGLA 2WPXA 3QAYA 4UF4A 2ZEHA 1CP6A 2PCUA 4PXEA 1VGYA 3P2FA 4C2YA 4KOXA 5C82A 4C7IA 3S9NA 1IYKA 5A28A 2AJ6A 1PU9A 2Q4ZA 2ZEDA 4ZYQA 2R98A 1S60A 1WK4A 4WWVA 2ZW7A 1ZLHA 2CY2A 2V8HA 3PFEA 4CYQA 4UWJA 4YWYA 3BI1A 2O4HA 3OWCA 2ZENA 3I1UA 3PFOA 2Q43A 4MCQA 5K8OA 5AG4A 3GLJA 5DWNA 5F48A 4C7HA 1M4IA 2G0BA 4CAFA 1CPSA 3W6SA 3SJEA 1CPXA 4MXUA 3RO0A 4ZY1A 1KUVA 4PXDA 3D68A 3TCVA 3FECA 4F6AA 3WC7A 4CAVA 1CBXA 4P45A 4EWTA 5AG5A 2PR1A 3D66A 1YW6A 5JPHA 3NE8A 5E96A 3IU2A 2G3AA 2FS5A 2FSRA 4UCNA 1BPMA 1EE3P 1Y9KA 2PVWA 4PSXA 3F8KA 4YU9A 3IIBA 5KTAA 3KKWA 1VHSA 1XFOA 5J1QA 1K4JA 4M6GA 5ELYA 2B5GA 3N7ZA 4NFRA 2AFXA 3W91A 4X2TA 2FE7A 3H8EA 4KUAA 4PXBA 4NGNA 5G1ZA 4NSQA 3IGRA 3ISXA 4GS4A 4A31A 1S7LA 2WPWA 3PZJA 1TKFA 4PK3A 2VZYA 4MBUA 4M85A 1LAPA 3FJUA 2C6PA 1CX8A 2Z3KA 3QNVA 4TWEA 4XPDB 3IWEA 3TO7A 4KS9A 2P6FA 1DTDA 4JXQA 3W6XA 4Q7AA 8CPAA 1GYTA 2V8DA 4KSFA 4PXCA 2OOTA 1YVOA 3A9LA 3D7GA 3S9LA 3FMCA 3P2HA 3PBBA 5LYFA 3NH5A 2RC4A 3PGPA 2GIVA 1NMTA 1NSLA 2ZELA 2QECA 2I00A 4ZY2A 5EC4A 1B87A 3NH8A 5AG7A 4H2KA 4ZGYB 5EBVA 1Y7RA 1YK3A 2NSMA 1XMBA 1BPNA 1AYEA 4I49A 2XEFA 1ZO0A 1CG2A 3I3GA 4OC0A 4UA3A 5HH1A 1IYLA 1Z8XA 1XEBA 3FNCA 4OADA 4PV6A 3QAHA 2EUIA 3PP9A 2F5IA 5HVFA 2AFSA 4Q36A 1IIDA 3RAMA 2A4NA 3D7HA 4KSIA 1YX0A 4MFLA 2DPSA 2AFUA 1YMEA 1YREA 1ELLP 1XMTA 1VHEA 1M44A 2ZEOA 3FYNA 3LMSA 4QVTA 4JXRA 4ZX8A 2C6GA 2PJ3A 3EO4A 5K8MA 4OC4A 4OC2A 2VL1A 5K8PA 1ZG9A 3B3WA 3VH9A 2JDCA 2NYQA 4UFVA 3CPXA 4Q38A 1QSOA 4FWUA 2AFMA 2Q4YA 1N71A 1Q2CA 4EFDA 1FY7A 1V0CA 1I21A 4XPDC 2BSWA 2K5TA 4OLLA 2PJ5A 3GB0A 3F5BA 5LRGA 1BO4A 4CGOA 1JWQA 1Z4RA 2YNEA 1TKHA 4X8IA 4NGTA 4R3LA 3LWUA 6CPAA 1CP7A 3SHPA 2Z3MA 4IHMA 4IUSA 1XBUA 2XEGA 4MCSA 4AG7A 2PJ6A 4J3GA 3HLPA 2RB7A 5CNPA 5DWMA 3EC4A 4JZ0A 3VWEA 4WJBA 3CXPA 4C68A 3H8FA 4FUUA 1ZG8A 3B3VA 3F0AA 4BD9A 2ZEMA 3KHXA 1ARLA 4U9YA 4CYOA 2PJ1A 2YNDA 3CPAA 4AG9A 4NJRA 4NGRA 4HKFA 1Q7LA 3KR5A 3RNZA 1Z8WA 1RXTA 3PBEA 1YSJA 3PRTA 3IU1A 4H6ZA 4CYNA 2NMTA 4GM5A 3E0KA 4NEXA 4UIAA 1Z8LA 3FBUA 3EY5A 3FEDA 2OR4A 4RI1A 3DLJA 2R1IA 2J8NA 3NA6A 2G3TA 3H4QA 4NXYA 3WABA 1F2OA 4OIWA 1PUAA 3DR6A 3LACA 3NH4A 2Q44A 4KOTA 2ODFA 1XIXA 3FH4A 3DNSA 4DYOA 4R7MA 4BMHA 5A27A 2GFQA 3SJGA 3CXQA 1M4DA 3DR8A 2Z10A 1ON0A 4R9MA 2RFHA 4UCPA 4X3RA 1VHOA 5FVJA 2PJ8A 4YGOA 4A95A 4CAEA 2CF4A 5J8CA 4MY3A 3FB3A 2I3CA 4DNCA 2O53A 4KVXA 2AFWA 1UFHA 2EK8A 2AE6A 2EK9A 4MHYA 2B4BA 1IOFA 3BI0A 2WSAA 5J8FA 2QMLA 1BAVA 2OZGA 4P4FA 2PJAA 1F2PA 4ZX9A 4MCRA 5JGFA 2FT0A 2KCWA 4OIDA 1TXRA 3VATA 1LOKA 5IB9A 4ZY0A 3K9TA 3CXSA 1DE4C 2GLFA 2Q0YA 1Z8TA 2HV2A 4KUBA 4C2XA 1QSNA 1LANA 1KZFA 3FF3A 4CGNA 5IX3A 2QJ8A 2DF5A 3IEHA 3R1KA 3WC5A 4B6ZA 2F8HA 5JH9A 1Q2DA 1P0HA 2PJ9A 2ZPAA 3KQZA 4QUSA 5F47A 4HNXB
chains in the Genus database with same CATH topology
4ONUA 4A32A 4FD6A 4MY0A 5G22A 3EXNA 3ZZIA 1QSTA 4MHDA 4L8AA 4BBHA 2JDDA 2VEZA 3D2MA 1VKCA 2PC1A 4II9A 4R3KA 3R96A 2ZW4A 4B10A 3R9GA 4Y49B 3TFYA 2Q4VA 2P6GA 2OZHA 2Z0ZA 3BLNA 4NCZA 3G8WA 3H5ZA 2FL4A 1I1DA 4EVYA 5I0CA 2H5MA 5H84A 4AVAA 2BL1A 4CGPA 5IV0A 3TO9A 1Q2YA 5BWAB 1B6BA 5AG6A 4PK2A 4JD6A 4CAWA 1YVKA 5H86A 1NE9A 1RO5A 4QB9A 5GCNA 4E0AA 2FIAA 4PSWA 3QB8A 2ZW5A 3JVNA 4XNHB 1U6MA 2Z3OA 3R95A 3S6FA 2PRBA 2PDOA 3GY9A 4OAEA 4ORFA 5IB0A 4B12A 1I12A 3SXNA 4HNWB 4LUAA 1QSRA 2Z11A 1Y9WA 2VZZA 1YR0A 1S3ZA 2ZXVA 4UFWA 4UBRA 1IICA 4CS0B 2J8RA 1YLEA 3C26A 4FD7A 1SQHA 3FXTA 4AVBA 3D3SA 4B5OA 3FIXA 1S7NA 4FD5A 3DSBA 4Y49C 5HMNA 3RYOA 4KOYA 2IL4A 3JTKA 2C27A 1XF8A 3TE4A 4UFXA 3R9EA 1L0CA 2YNCC 2P6EA 2B4DB 4KOUA 1M4GA 3I9SA 3TOAA 4KVOE 3TO6A 1R57A 1S5KA 2B58A 3UY5A 2QIRA 4QBJA 1OZPA 3WR7A 1BOBA 2ATRA 2CXAA 4JWPA 3T9YA 2BUEA 4NF1A 1CJWA 4F0YA 2OB0A 5AGEA 2B3UA 5G21A 2EVNA 2YGWA 4YRHA 4HNYB 2X7BA 3FRMA 3TOBA 1YGHA 4R87A 2CNSA 4JLYA 4U5YA 2WUUA 4AVCA 2R7HA 2PQ8A 4MFZA 4FD4A 2CNTA 5C88A 2FIWA 3S6HA 1TIQA 2Z3LA 3GKRA 3GYAA 4A33A 3IWGA 3TT2A 1Z9UA 2Y0MA 4XPKA 2REFA 1WWZA 2YNCA 5KTCA 2Z3PA 4C2ZA 4B11A 4B5PB 4KLVA 4KVME 2HQYA 3S6KA 4YFJA 4R57A 3D2PA 2VXKA 2D4OA 2PSWA 5KTDA 4E8OA 3D8PA 2REEA 4KOWA 1MJAA 2HUZA 2DXQA 2O28A 4MFKA 4L89A 4IF5A 5F46A 2BEIA 2FXFA 2OH1A 3DDDA 2Z3NA 4XPLA 4UCMA 4CRYB 4KOSA 4MFJA 5JQ4A 3BJ7A 4M3SA 2VBQA 2D4PA 3NE7A 4MFQA 1J4JA 2I79A 3BJ8A 4CYPA 1S7FA 3T90A 4JJXA 4E2AA 1QSMA 1KUXA 2OZUA 4X5KA 3G3SA 4A2ZA 1GHEA 2J8MA 4MI4A 4AB7A 1MJBA 2OU2A 4F0XA 4MFPA 3JUWA 4KORA 2B4DA 2B5GB 4RS2A 3SXOA 2CNMA 1LRZA 3ZJ0A 4KZTA 2JLMA 4B14A 2ARHA 2Q04A 2PR8A 1KUYA 2R8VA 2VQYA 4A30A 4KOVA 4KSAA 4QC6A 2JEVA 5ISVA 4CAXA 2VI7A 4LX9A 2Q7BA 3S6GA 3V8IA 1MK4A 2GE3A 4MJ8A 4H89A 3VWDA 3LD2A 2GANA 4U9ZA 4CGMA 1S7KA 4KLWA 2ZW6A 3TTHA 1CM0A 4K30A 3LODA 4H6UA 2P0WA 1Z4EA 1M1DA 4UWIA 3K9UA 2B3VA 4B5PA 3R9FA 4ZBGA 3EFAA 2DPTA 5F49A 2FCKA 4XNHC 1MJ9A 4CRZB 1XE4A 3MGDA 4B13A 1IB1E 3B8GA 1P4NA 5G20A 4CGLA 2WPXA 3P2FA 4C2YA 4KOXA 5C82A 4C7IA 1IYKA 5A28A 2AJ6A 1PU9A 2R98A 1S60A 1WK4A 2ZW7A 2CY2A 4CYQA 4UWJA 3OWCA 5AG4A 5DWNA 5F48A 4C7HA 1M4IA 2G0BA 4CAFA 3W6SA 1KUVA 3TCVA 4F6AA 4CAVA 5AG5A 2PR1A 5JPHA 5E96A 3IU2A 2G3AA 2FSRA 2FS5A 4UCNA 1Y9KA 4PSXA 3F8KA 5KTAA 3KKWA 1VHSA 1K4JA 3N7ZA 2B5GA 3W91A 2FE7A 4KUAA 5G1ZA 4NSQA 3IGRA 4GS4A 4A31A 1S7LA 3PZJA 2WPWA 4PK3A 2VZYA 4MBUA 4M85A 2Z3KA 4XPDB 3IWEA 3TO7A 4KS9A 2P6FA 4JXQA 3W6XA 4KSFA 1YVOA 3A9LA 3P2HA 2RC4A 3PGPA 2GIVA 1NMTA 1NSLA 2QECA 2I00A 5EC4A 1B87A 5AG7A 4ZGYB 5EBVA 1Y7RA 1YK3A 4I49A 1ZO0A 3I3GA 4UA3A 5HH1A 1IYLA 1XEBA 3FNCA 4OADA 4PV6A 3QAHA 2EUIA 3PP9A 2F5IA 4Q36A 1IIDA 2A4NA 1YX0A 4MFLA 2DPSA 1M44A 1YREA 4UFVA 4CYOA 1XMTA 3FYNA 4QVTA 4JXRA 3EO4A 2JDCA 4Q38A 1QSOA 2Q4YA 1N71A 1Q2CA 1FY7A 1V0CA 1I21A 4XPDC 2BSWA 2K5TA 4OLLA 3F5BA 1BO4A 4CGOA 1Z4RA 2YNEA 4R3LA 3SHPA 2Z3MA 4IUSA 4AG7A 4J3GA 5CNPA 5DWMA 3EC4A 3VWEA 3CXPA 4C68A 3F0AA 4U9YA 2YNDA 4AG9A 4HKFA 1RXTA 3IU1A 4H6ZA 4CYNA 2NMTA 3E0KA 4NEXA 3FBUA 3EY5A 4RI1A 2R1IA 2J8NA 2G3TA 3H4QA 4NXYA 1PUAA 3DR6A 2Q44A 4KOTA 1XIXA 3DNSA 4BMHA 5A27A 3CXQA 1M4DA 3DR8A 2Z10A 1ON0A 4R9MA 4UCPA 5FVJA 4YGOA 4A95A 4CAEA 5J8CA 4MY3A 3FB3A 4DNCA 4KVXA 1UFHA 2AE6A 2B4BA 2WSAA 5J8FA 2QMLA 2OZGA 2FT0A 2KCWA 3CXSA 2Q0YA 2HV2A 4KUBA 4C2XA 1QSNA 1KZFA 4CGNA 5IX3A 3R1KA 1Q2DA 1P0HA 2ZPAA 4QUSA 5F47A 4HNXB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ONU A;  4FD6 A;  4MY0 A;  3ZZI A;  3EXN A;  1QST A;  4MHD A;  4L8A A;  2JDD A;  2VEZ A;  3D2M A;  1VKC A;  2PC1 A;  4II9 A;  4R3K A;  3R96 A;  2ZW4 A;  3R9G A;  4Y49 B;  3TFY A;  2Q4V A;  2P6G A;  2OZH A;  2Z0Z A;  3BLN A;  4NCZ A;  3G8W A;  2FL4 A;  1I1D A;  4EVY A;  5I0C A;  2H5M A;  5H84 A;  4AVA A;  2BL1 A;  5IV0 A;  3TO9 A;  1Q2Y A;  1B6B A;  4PK2 A;  4JD6 A;  4CAW A;  1YVK A;  5H86 A;  1NE9 A;  1RO5 A;  4QB9 A;  5GCN A;  4E0A A;  2FIA A;  4PSW A;  3QB8 A;  2ZW5 A;  3JVN A;  4XNH B;  1U6M A;  3R95 A;  3S6F A;  2PRB A;  2PDO A;  3GY9 A;  4OAE A;  4ORF A;  5IB0 A;  1I12 A;  3SXN A;  4HNW B;  4LUA A;  1QSR A;  2Z11 A;  1Y9W A;  2VZZ A;  1YR0 A;  1S3Z A;  2ZXV A;  4UBR A;  1IIC A;  4CS0 B;  2J8R A;  1YLE A;  3C26 A;  4FD7 A;  1SQH A;  3FXT A;  4AVB A;  3D3S A;  4B5O A;  3FIX A;  1S7N A;  4FD5 A;  3DSB A;  4Y49 C;  5HMN A;  3RYO A;  4KOY A;  2IL4 A;  2C27 A;  1XF8 A;  3TE4 A;  3R9E A;  1L0C A;  2P6E A;  2B4D B;  4KOU A;  1M4G A;  3I9S A;  3TOA A;  4KVO E;  3TO6 A;  1R57 A;  1S5K A;  2B58 A;  3UY5 A;  2QIR A;  4QBJ A;  1OZP A;  3WR7 A;  1BOB A;  2ATR A;  4JWP A;  3T9Y A;  2BUE A;  4NF1 A;  1CJW A;  4F0Y A;  2OB0 A;  2B3U A;  2EVN A;  4YRH A;  4HNY B;  2X7B A;  3FRM A;  3TOB A;  1YGH A;  4R87 A;  2CNS A;  4JLY A;  4U5Y A;  4AVC A;  2R7H A;  2PQ8 A;  4FD4 A;  2CNT A;  5C88 A;  2FIW A;  3S6H A;  1TIQ A;  3GYA A;  3GKR A;  3IWG A;  3TT2 A;  1Z9U A;  2Y0M A;  4XPK A;  2REF A;  1WWZ A;  5KTC A;  4B5P B;  4KLV A;  4KVM E;  2HQY A;  3S6K A;  4YFJ A;  4R57 A;  3D2P A;  2VXK A;  2D4O A;  2PSW A;  5KTD A;  4E8O A;  3D8P A;  2REE A;  4KOW A;  1MJA A;  2HUZ A;  2DXQ A;  2O28 A;  4L89 A;  4IF5 A;  5F46 A;  2BEI A;  2FXF A;  2OH1 A;  3DDD A;  4XPL A;  4CRY B;  4KOS A;  5JQ4 A;  3BJ7 A;  4M3S A;  2VBQ A;  2D4P A;  3NE7 A;  1J4J A;  2I79 A;  3BJ8 A;  1S7F A;  3T90 A;  4JJX A;  4E2A A;  1QSM A;  1KUX A;  2OZU A;  4X5K A;  3G3S A;  1GHE A;  2J8M A;  4MI4 A;  4AB7 A;  1MJB A;  2OU2 A;  3JUW A;  4KOR A;  2B4D A;  2B5G B;  4RS2 A;  3SXO A;  2CNM A;  1LRZ A;  3ZJ0 A;  4KZT A;  2JLM A;  2ARH A;  2Q04 A;  2PR8 A;  1KUY A;  2R8V A;  2VQY A;  4KOV A;  4QC6 A;  2JEV A;  5ISV A;  4CAX A;  2VI7 A;  4LX9 A;  2Q7B A;  3S6G A;  3V8I A;  1MK4 A;  2GE3 A;  4MJ8 A;  4H89 A;  3VWD A;  3LD2 A;  2GAN A;  4U9Z A;  1S7K A;  4KLW A;  2ZW6 A;  3TTH A;  1CM0 A;  4K30 A;  3LOD A;  4H6U A;  2P0W A;  1Z4E A;  1M1D A;  4UWI A;  3K9U A;  2B3V A;  4B5P A;  3R9F A;  4ZBG A;  3EFA A;  5F49 A;  2FCK A;  4XNH C;  1MJ9 A;  4CRZ B;  1XE4 A;  3MGD A;  1IB1 E;  3B8G A;  1P4N A;  2WPX A;  3P2F A;  5C82 A;  4KOX A;  1IYK A;  2AJ6 A;  1PU9 A;  2R98 A;  1S60 A;  1WK4 A;  2ZW7 A;  2CY2 A;  4UWJ A;  3OWC A;  5DWN A;  5F48 A;  1M4I A;  2G0B A;  3W6S A;  1KUV A;  3TCV A;  4F6A A;  4CAV A;  2PR1 A;  5JPH A;  5E96 A;  2G3A A;  2FSR A;  2FS5 A;  1Y9K A;  4PSX A;  3F8K A;  5KTA A;  3KKW A;  1VHS A;  1K4J A;  3N7Z A;  2B5G A;  3W91 A;  2FE7 A;  4KUA A;  4NSQ A;  3IGR A;  4GS4 A;  1S7L A;  3PZJ A;  2WPW A;  4PK3 A;  2VZY A;  4MBU A;  4M85 A;  4XPD B;  3TO7 A;  2P6F A;  4JXQ A;  3W6X A;  1YVO A;  3P2H A;  2RC4 A;  3PGP A;  2GIV A;  1NMT A;  1NSL A;  2QEC A;  2I00 A;  5EC4 A;  1B87 A;  5EBV A;  1Y7R A;  1YK3 A;  4I49 A;  3I3G A;  4UA3 A;  5HH1 A;  1IYL A;  1XEB A;  3FNC A;  4OAD A;  4PV6 A;  3QAH A;  2EUI A;  3PP9 A;  2F5I A;  1IID A;  2A4N A;  1YX0 A;  1M44 A;  1YRE A;  1XMT A;  3FYN A;  4QVT A;  4JXR A;  3EO4 A;  2JDC A;  1QSO A;  2Q4Y A;  1N71 A;  1Q2C A;  1FY7 A;  1V0C A;  1I21 A;  4XPD C;  2BSW A;  2K5T A;  4OLL A;  3F5B A;  1BO4 A;  1Z4R A;  4R3L A;  3SHP A;  4IUS A;  4AG7 A;  4J3G A;  5CNP A;  5DWM A;  3EC4 A;  3VWE A;  3CXP A;  3F0A A;  4U9Y A;  4AG9 A;  4HKF A;  1RXT A;  4H6Z A;  2NMT A;  3E0K A;  4NEX A;  3FBU A;  3EY5 A;  4RI1 A;  2R1I A;  2J8N A;  2G3T A;  3H4Q A;  4NXY A;  1PUA A;  3DR6 A;  2Q44 A;  4KOT A;  1XIX A;  3DNS A;  4BMH A;  3CXQ A;  1M4D A;  3DR8 A;  2Z10 A;  1ON0 A;  4R9M A;  5FVJ A;  4YGO A;  5J8C A;  4MY3 A;  3FB3 A;  4DNC A;  4KVX A;  1UFH A;  2AE6 A;  2B4B A;  5J8F A;  2QML A;  2OZG A;  2FT0 A;  2KCW A;  3CXS A;  2Q0Y A;  2HV2 A;  4KUB A;  1QSN A;  1KZF A;  5IX3 A;  3R1K A;  1Q2D A;  1P0H A;  2ZPA A;  4QUS A;  5F47 A;  4HNX B; 
#chains in the Genus database with same CATH topology
 3T8W A;  5JM6 A;  4A38 A;  4ONU A;  1HDQ A;  2WYR A;  4A32 A;  4FD6 A;  4MCP A;  4MY0 A;  3KL9 A;  2F7V A;  3EXN A;  5G22 A;  3ZZI A;  5HVG A;  4HPS A;  1QST A;  4MHD A;  1FT7 A;  4L8A A;  4BBH A;  1IOI A;  2JDD A;  2VEZ A;  3D2M A;  1VKC A;  4A94 A;  2PC1 A;  4II9 A;  4R3K A;  3R96 A;  2QVP A;  2ZW4 A;  2PJ7 A;  2AFZ A;  2ZOF A;  4NGS A;  4B10 A;  2IMO A;  1LCP A;  2GLJ A;  3R9G A;  4Y49 B;  3TFY A;  2Q4V A;  2P6G A;  3MRU A;  3SJX A;  2DEA A;  2OZH A;  2Z0Z A;  1Y0R A;  3BLN A;  4MHZ A;  4K3N A;  4O23 A;  4NCZ A;  3RZA A;  3BXM A;  1YW4 A;  2HC9 A;  3G8W A;  3H5Z A;  4P44 A;  2FL4 A;  2JBK A;  4NGQ A;  1I1D A;  4EVY A;  4F9U A;  5I0C A;  3V7Z A;  2H5M A;  5H84 A;  1XJO A;  4AVA A;  2BL1 A;  4CGP A;  1XOV A;  5IV0 A;  2AFO A;  4P4B A;  3TO9 A;  2ZEG A;  1Q2Y A;  5BWA B;  4IK2 A;  4F9V A;  4UIB A;  1A2Z A;  1B6B A;  3HUV A;  4PK2 A;  4JD6 A;  5AG6 A;  4CAW A;  1YVK A;  4GXH A;  1QQ9 A;  1NE9 A;  1RO5 A;  2PE3 A;  5H86 A;  2PJ0 A;  4QB9 A;  1LAM A;  3K2K A;  4MHN A;  5GCN A;  4E0A A;  2FIA A;  2IQ6 A;  1F57 A;  2V8V A;  4PSW A;  3QB8 A;  2ZW5 A;  3JVN A;  5D29 A;  4OP4 A;  2XEJ A;  4XNH B;  1U6M A;  5F09 A;  2ZEF A;  2Z3O A;  3R95 A;  5LRJ A;  3S6F A;  2PRB A;  2PDO A;  3GY9 A;  4OAE A;  3B7I A;  4ORF A;  5IB0 A;  3TC8 A;  1XRY A;  4B12 A;  1I12 A;  1M4L A;  3SXN A;  4HNW B;  4UEZ A;  3D67 A;  1ZG7 A;  3IC1 A;  4LUA A;  1QSR A;  2Z11 A;  4P10 A;  1Y9W A;  2VZZ A;  4BIN A;  4DUK A;  1YR0 A;  1S3Z A;  3ISZ A;  2ZXV A;  4UFW A;  4PPZ A;  4UBR A;  2CTB A;  7CPA A;  1IIC A;  2GRE A;  3KI9 A;  2J8R A;  1YLE A;  3C26 A;  4FD7 A;  4CS0 B;  1SQH A;  2XEI A;  3FXT A;  4AVB A;  1R3N A;  4OC5 A;  2JEW A;  3D3S A;  1H8L A;  3FIX A;  4B5O A;  1S7N A;  4FD5 A;  3DSB A;  4Y49 C;  5HMN A;  3RYO A;  4KOY A;  4AXV A;  2IL4 A;  1Y0Y A;  2PVV A;  1ARM A;  3JTK A;  1RTQ A;  2C27 A;  1XF8 A;  1Y7E A;  4NJQ A;  3CT9 A;  3PEI A;  3FX6 A;  4UEF A;  4OKO A;  3BHX A;  2WZN A;  4DJL A;  1IGB A;  4UFX A;  3R9E A;  1L0C A;  3TE4 A;  2YNC C;  2P6E A;  3H8G A;  2B4D B;  4KOU A;  4UEE A;  2V77 A;  1M4G A;  3I9S A;  3SI1 A;  3TOA A;  1Z2L A;  4KVO E;  3IWW A;  1R57 A;  1S5K A;  1TKJ A;  2B58 A;  3CDX A;  3IFE A;  1VIX A;  2HB6 A;  3B35 A;  3KZW A;  5D8N A;  2QIR A;  3UY5 A;  4R76 A;  5LRK A;  4QBJ A;  1OZP A;  2C6C A;  3PB4 X;  3WR7 A;  1YLO A;  4ONW A;  5LYI A;  1BOB A;  1KWM A;  2ATR A;  2CXA A;  2PIZ A;  4A37 A;  4JWP A;  3D7F A;  3T9Y A;  2BUE A;  4NF1 A;  1CJW A;  4F0Y A;  2OB0 A;  5AGE A;  2ZOG A;  3FEE A;  3IJ3 A;  4CPA A;  2B3U A;  5G21 A;  2EVN A;  5DS0 A;  1AMP A;  1YQE A;  2YGW A;  4YRH A;  4HNY B;  2X7B A;  3FRM A;  3TOB A;  3PB6 X;  1YGH A;  1FNO A;  4R87 A;  3S9M A;  3SI0 A;  2CNS A;  4JLY A;  4U5Y A;  2WUU A;  4AVC A;  2R7H A;  3CZX A;  2PQ8 A;  4MFZ A;  4FD4 A;  2CNT A;  5C88 A;  2FIW A;  4RN7 A;  3S6H A;  3GUX A;  4OME A;  1TIQ A;  2Z3L A;  3GKR A;  3GYA A;  4A33 A;  2FVG A;  3IWG A;  2CIJ A;  3TT2 A;  3B3C A;  4G1P A;  3WT4 A;  1Z9U A;  2Y0M A;  4OC1 A;  4XPK A;  2REF A;  1WWZ A;  2YNC A;  5KTC A;  2Z3P A;  4Z65 A;  3VAR A;  1X12 A;  4C2Z A;  2BO9 A;  4B11 A;  4B5P B;  4KLV A;  3KAS A;  4KVM E;  3KGQ A;  2HQY A;  3S6K A;  3B3T A;  4YFJ A;  4R57 A;  3TO6 A;  3D2P A;  2VXK A;  2D4O A;  1LFW A;  2PSW A;  3IO1 A;  3D7D A;  1X10 A;  2CTC A;  5KTD A;  4E8O A;  1ELM P;  3D8P A;  2PRQ A;  4A39 A;  2REE A;  4KOW A;  1MJA A;  2HUZ A;  4R8F A;  4NGP A;  2DXQ A;  2O28 A;  4RUH A;  4MFK A;  4L89 A;  4IF5 A;  3SJF A;  5F46 A;  1HDU A;  5CPA A;  3D4U A;  5I4M A;  2BEI A;  2FXF A;  2OH1 A;  3DDD A;  5LYD A;  2Z3N A;  2EO8 A;  2EBJ A;  4XPL A;  5LYL A;  4UCM A;  4CRY B;  3JRU A;  4EME A;  2IJZ A;  3V38 A;  4KOS A;  1PCA A;  2Q7S A;  4MFJ A;  5JQ4 A;  5K8N A;  4P4I A;  3BJ7 A;  4M3S A;  2VBQ A;  4NGM A;  2GU2 A;  4P4J A;  3B2Y A;  2D4P A;  3NE7 A;  4MFQ A;  1J4J A;  2I79 A;  3BJ8 A;  1BLL E;  1S7F A;  4CYP A;  4ZI6 A;  5HXD A;  3T90 A;  4JJX A;  4E2A A;  3WC6 A;  2PJC A;  1ZLI A;  3NFZ A;  3TX8 A;  1QSM A;  1KUX A;  1UWY A;  2OZU A;  2ZEE A;  4X5K A;  3G3S A;  4A2Z A;  1GHE A;  1Z5R A;  1JQG A;  2J8M A;  4MI4 A;  4AB7 A;  2G9D A;  1MJB A;  4F8Z A;  2Q51 A;  2OU2 A;  2EWB A;  4F0X A;  3B3S A;  4MFP A;  2ZEP A;  3JUW A;  4KOR A;  2B4D A;  2B5G B;  1HEE A;  4RS2 A;  1IY7 A;  3SXO A;  2CNM A;  1AUG A;  1LRZ A;  3ZJ0 A;  2QYV A;  4KZT A;  2JLM A;  4B14 A;  4IAV A;  3GIU A;  4P4E A;  2ARH A;  3KHZ A;  4FBE A;  2Q04 A;  5CBM A;  1QMU A;  2PR8 A;  1R43 A;  3RBU A;  4LQG A;  1KUY A;  2R8V A;  2VQY A;  4A30 A;  4KOV A;  4KSA A;  4QC6 A;  4LQ6 A;  2JEV A;  4R6T A;  2PJ2 A;  3MN8 A;  3FVL A;  4MMO A;  2V8G A;  4OC3 A;  3N5F A;  5ISV A;  4CAX A;  2VI7 A;  1PYT B;  3KR4 A;  3SI2 A;  4PQA A;  5EMI A;  2JBJ A;  2PIY A;  4LX9 A;  4TNU A;  4JYW A;  2Q7B A;  4MHP A;  5HVH A;  3S6G A;  2PJB A;  3V8I A;  4MRI A;  1MK4 A;  2GE3 A;  4MJ8 A;  4H89 A;  1IU8 A;  3VWD A;  3LD2 A;  1NSA A;  2GAN A;  4U9Z A;  4CGM A;  1S7K A;  4FAI A;  1OBR A;  4KLW A;  2ABZ A;  2ZW6 A;  3PB8 X;  3TTH A;  1CM0 A;  4K30 A;  3LOD A;  4H6U A;  2P0W A;  1Z4E A;  2POK A;  4P6Y A;  1M1D A;  4UWI A;  3K9U A;  2B3V A;  2PJ4 A;  4B5P A;  2C1C A;  4W9Y A;  3DGV A;  3L2N A;  2BCO A;  4M6I A;  3R9F A;  3PB9 X;  3PB7 X;  4ZBG A;  3EFA A;  2DPT A;  4P4D A;  2BOA A;  1TF8 A;  5F49 A;  5THW A;  2ANP A;  2FCK A;  4XNH C;  1MJ9 A;  4CRZ B;  1XE4 A;  2J9A A;  3MGD A;  4M6H A;  1TF9 A;  4B13 A;  1IB1 E;  3KQX A;  3B8G A;  1P4N A;  5G20 A;  4CGL A;  2WPX A;  3QAY A;  4UF4 A;  2ZEH A;  1CP6 A;  2PCU A;  4PXE A;  1VGY A;  3P2F A;  4C2Y A;  4KOX A;  5C82 A;  4C7I A;  3S9N A;  1IYK A;  5A28 A;  2AJ6 A;  1PU9 A;  2Q4Z A;  2ZED A;  4ZYQ A;  2R98 A;  1S60 A;  1WK4 A;  4WWV A;  2ZW7 A;  1ZLH A;  2CY2 A;  2V8H A;  3PFE A;  4CYQ A;  4UWJ A;  4YWY A;  3BI1 A;  2O4H A;  3OWC A;  2ZEN A;  3I1U A;  3PFO A;  2Q43 A;  4MCQ A;  5K8O A;  5AG4 A;  3GLJ A;  5DWN A;  5F48 A;  4C7H A;  1M4I A;  2G0B A;  4CAF A;  1CPS A;  3W6S A;  3SJE A;  1CPX A;  4MXU A;  3RO0 A;  4ZY1 A;  1KUV A;  4PXD A;  3D68 A;  3TCV A;  3FEC A;  4F6A A;  3WC7 A;  4CAV A;  1CBX A;  4P45 A;  4EWT A;  5AG5 A;  2PR1 A;  3D66 A;  1YW6 A;  5JPH A;  3NE8 A;  5E96 A;  3IU2 A;  2G3A A;  2FS5 A;  2FSR A;  4UCN A;  1BPM A;  1EE3 P;  1Y9K A;  2PVW A;  4PSX A;  3F8K A;  4YU9 A;  3IIB A;  5KTA A;  3KKW A;  1VHS A;  1XFO A;  5J1Q A;  1K4J A;  4M6G A;  5ELY A;  2B5G A;  3N7Z A;  4NFR A;  2AFX A;  3W91 A;  4X2T A;  2FE7 A;  3H8E A;  4KUA A;  4PXB A;  4NGN A;  5G1Z A;  4NSQ A;  3IGR A;  3ISX A;  4GS4 A;  4A31 A;  1S7L A;  2WPW A;  3PZJ A;  1TKF A;  4PK3 A;  2VZY A;  4MBU A;  4M85 A;  1LAP A;  3FJU A;  2C6P A;  1CX8 A;  2Z3K A;  3QNV A;  4TWE A;  4XPD B;  3IWE A;  3TO7 A;  4KS9 A;  2P6F A;  1DTD A;  4JXQ A;  3W6X A;  4Q7A A;  8CPA A;  1GYT A;  2V8D A;  4KSF A;  4PXC A;  2OOT A;  1YVO A;  3A9L A;  3D7G A;  3S9L A;  3FMC A;  3P2H A;  3PBB A;  5LYF A;  3NH5 A;  2RC4 A;  3PGP A;  2GIV A;  1NMT A;  1NSL A;  2ZEL A;  2QEC A;  2I00 A;  4ZY2 A;  5EC4 A;  1B87 A;  3NH8 A;  5AG7 A;  4H2K A;  4ZGY B;  5EBV A;  1Y7R A;  1YK3 A;  2NSM A;  1XMB A;  1BPN A;  1AYE A;  4I49 A;  2XEF A;  1ZO0 A;  1CG2 A;  3I3G A;  4OC0 A;  4UA3 A;  5HH1 A;  1IYL A;  1Z8X A;  1XEB A;  3FNC A;  4OAD A;  4PV6 A;  3QAH A;  2EUI A;  3PP9 A;  2F5I A;  5HVF A;  2AFS A;  4Q36 A;  1IID A;  3RAM A;  2A4N A;  3D7H A;  4KSI A;  1YX0 A;  4MFL A;  2DPS A;  2AFU A;  1YME A;  1YRE A;  1ELL P;  1XMT A;  1VHE A;  1M44 A;  2ZEO A;  3FYN A;  3LMS A;  4QVT A;  4JXR A;  4ZX8 A;  2C6G A;  2PJ3 A;  3EO4 A;  5K8M A;  4OC4 A;  4OC2 A;  2VL1 A;  5K8P A;  1ZG9 A;  3B3W A;  3VH9 A;  2JDC A;  2NYQ A;  4UFV A;  3CPX A;  4Q38 A;  1QSO A;  4FWU A;  2AFM A;  2Q4Y A;  1N71 A;  1Q2C A;  4EFD A;  1FY7 A;  1V0C A;  1I21 A;  4XPD C;  2BSW A;  2K5T A;  4OLL A;  2PJ5 A;  3GB0 A;  3F5B A;  5LRG A;  1BO4 A;  4CGO A;  1JWQ A;  1Z4R A;  2YNE A;  1TKH A;  4X8I A;  4NGT A;  4R3L A;  3LWU A;  6CPA A;  1CP7 A;  3SHP A;  2Z3M A;  4IHM A;  4IUS A;  1XBU A;  2XEG A;  4MCS A;  4AG7 A;  2PJ6 A;  4J3G A;  3HLP A;  2RB7 A;  5CNP A;  5DWM A;  3EC4 A;  4JZ0 A;  3VWE A;  4WJB A;  3CXP A;  4C68 A;  3H8F A;  4FUU A;  1ZG8 A;  3B3V A;  3F0A A;  4BD9 A;  2ZEM A;  3KHX A;  1ARL A;  4U9Y A;  4CYO A;  2PJ1 A;  2YND A;  3CPA A;  4AG9 A;  4NJR A;  4NGR A;  4HKF A;  1Q7L A;  3KR5 A;  3RNZ A;  1Z8W A;  1RXT A;  3PBE A;  1YSJ A;  3PRT A;  3IU1 A;  4H6Z A;  4CYN A;  2NMT A;  4GM5 A;  3E0K A;  4NEX A;  4UIA A;  1Z8L A;  3FBU A;  3EY5 A;  3FED A;  2OR4 A;  4RI1 A;  3DLJ A;  2R1I A;  2J8N A;  3NA6 A;  2G3T A;  3H4Q A;  4NXY A;  3WAB A;  1F2O A;  4OIW A;  1PUA A;  3DR6 A;  3LAC A;  3NH4 A;  2Q44 A;  4KOT A;  2ODF A;  1XIX A;  3FH4 A;  3DNS A;  4DYO A;  4R7M A;  4BMH A;  5A27 A;  2GFQ A;  3SJG A;  3CXQ A;  1M4D A;  3DR8 A;  2Z10 A;  1ON0 A;  4R9M A;  2RFH A;  4UCP A;  4X3R A;  1VHO A;  5FVJ A;  2PJ8 A;  4YGO A;  4A95 A;  4CAE A;  2CF4 A;  5J8C A;  4MY3 A;  3FB3 A;  2I3C A;  4DNC A;  2O53 A;  4KVX A;  2AFW A;  1UFH A;  2EK8 A;  2AE6 A;  2EK9 A;  4MHY A;  2B4B A;  1IOF A;  3BI0 A;  2WSA A;  5J8F A;  2QML A;  1BAV A;  2OZG A;  4P4F A;  2PJA A;  1F2P A;  4ZX9 A;  4MCR A;  5JGF A;  2FT0 A;  2KCW A;  4OID A;  1TXR A;  3VAT A;  1LOK A;  5IB9 A;  4ZY0 A;  3K9T A;  3CXS A;  1DE4 C;  2GLF A;  2Q0Y A;  1Z8T A;  2HV2 A;  4KUB A;  4C2X A;  1QSN A;  1LAN A;  1KZF A;  3FF3 A;  4CGN A;  5IX3 A;  2QJ8 A;  2DF5 A;  3IEH A;  3R1K A;  3WC5 A;  4B6Z A;  2F8H A;  5JH9 A;  1Q2D A;  1P0H A;  2PJ9 A;  2ZPA A;  3KQZ A;  4QUS A;  5F47 A;  4HNX B; 
#chains in the Genus database with same CATH homology
 4ONU A;  4A32 A;  4FD6 A;  4MY0 A;  5G22 A;  3EXN A;  3ZZI A;  1QST A;  4MHD A;  4L8A A;  4BBH A;  2JDD A;  2VEZ A;  3D2M A;  1VKC A;  2PC1 A;  4II9 A;  4R3K A;  3R96 A;  2ZW4 A;  4B10 A;  3R9G A;  4Y49 B;  3TFY A;  2Q4V A;  2P6G A;  2OZH A;  2Z0Z A;  3BLN A;  4NCZ A;  3G8W A;  3H5Z A;  2FL4 A;  1I1D A;  4EVY A;  5I0C A;  2H5M A;  5H84 A;  4AVA A;  2BL1 A;  4CGP A;  5IV0 A;  3TO9 A;  1Q2Y A;  5BWA B;  1B6B A;  5AG6 A;  4PK2 A;  4JD6 A;  4CAW A;  1YVK A;  5H86 A;  1NE9 A;  1RO5 A;  4QB9 A;  5GCN A;  4E0A A;  2FIA A;  4PSW A;  3QB8 A;  2ZW5 A;  3JVN A;  4XNH B;  1U6M A;  2Z3O A;  3R95 A;  3S6F A;  2PRB A;  2PDO A;  3GY9 A;  4OAE A;  4ORF A;  5IB0 A;  4B12 A;  1I12 A;  3SXN A;  4HNW B;  4LUA A;  1QSR A;  2Z11 A;  1Y9W A;  2VZZ A;  1YR0 A;  1S3Z A;  2ZXV A;  4UFW A;  4UBR A;  1IIC A;  4CS0 B;  2J8R A;  1YLE A;  3C26 A;  4FD7 A;  1SQH A;  3FXT A;  4AVB A;  3D3S A;  4B5O A;  3FIX A;  1S7N A;  4FD5 A;  3DSB A;  4Y49 C;  5HMN A;  3RYO A;  4KOY A;  2IL4 A;  3JTK A;  2C27 A;  1XF8 A;  3TE4 A;  4UFX A;  3R9E A;  1L0C A;  2YNC C;  2P6E A;  2B4D B;  4KOU A;  1M4G A;  3I9S A;  3TOA A;  4KVO E;  3TO6 A;  1R57 A;  1S5K A;  2B58 A;  3UY5 A;  2QIR A;  4QBJ A;  1OZP A;  3WR7 A;  1BOB A;  2ATR A;  2CXA A;  4JWP A;  3T9Y A;  2BUE A;  4NF1 A;  1CJW A;  4F0Y A;  2OB0 A;  5AGE A;  2B3U A;  5G21 A;  2EVN A;  2YGW A;  4YRH A;  4HNY B;  2X7B A;  3FRM A;  3TOB A;  1YGH A;  4R87 A;  2CNS A;  4JLY A;  4U5Y A;  2WUU A;  4AVC A;  2R7H A;  2PQ8 A;  4MFZ A;  4FD4 A;  2CNT A;  5C88 A;  2FIW A;  3S6H A;  1TIQ A;  2Z3L A;  3GKR A;  3GYA A;  4A33 A;  3IWG A;  3TT2 A;  1Z9U A;  2Y0M A;  4XPK A;  2REF A;  1WWZ A;  2YNC A;  5KTC A;  2Z3P A;  4C2Z A;  4B11 A;  4B5P B;  4KLV A;  4KVM E;  2HQY A;  3S6K A;  4YFJ A;  4R57 A;  3D2P A;  2VXK A;  2D4O A;  2PSW A;  5KTD A;  4E8O A;  3D8P A;  2REE A;  4KOW A;  1MJA A;  2HUZ A;  2DXQ A;  2O28 A;  4MFK A;  4L89 A;  4IF5 A;  5F46 A;  2BEI A;  2FXF A;  2OH1 A;  3DDD A;  2Z3N A;  4XPL A;  4UCM A;  4CRY B;  4KOS A;  4MFJ A;  5JQ4 A;  3BJ7 A;  4M3S A;  2VBQ A;  2D4P A;  3NE7 A;  4MFQ A;  1J4J A;  2I79 A;  3BJ8 A;  4CYP A;  1S7F A;  3T90 A;  4JJX A;  4E2A A;  1QSM A;  1KUX A;  2OZU A;  4X5K A;  3G3S A;  4A2Z A;  1GHE A;  2J8M A;  4MI4 A;  4AB7 A;  1MJB A;  2OU2 A;  4F0X A;  4MFP A;  3JUW A;  4KOR A;  2B4D A;  2B5G B;  4RS2 A;  3SXO A;  2CNM A;  1LRZ A;  3ZJ0 A;  4KZT A;  2JLM A;  4B14 A;  2ARH A;  2Q04 A;  2PR8 A;  1KUY A;  2R8V A;  2VQY A;  4A30 A;  4KOV A;  4KSA A;  4QC6 A;  2JEV A;  5ISV A;  4CAX A;  2VI7 A;  4LX9 A;  2Q7B A;  3S6G A;  3V8I A;  1MK4 A;  2GE3 A;  4MJ8 A;  4H89 A;  3VWD A;  3LD2 A;  2GAN A;  4U9Z A;  4CGM A;  1S7K A;  4KLW A;  2ZW6 A;  3TTH A;  1CM0 A;  4K30 A;  3LOD A;  4H6U A;  2P0W A;  1Z4E A;  1M1D A;  4UWI A;  3K9U A;  2B3V A;  4B5P A;  3R9F A;  4ZBG A;  3EFA A;  2DPT A;  5F49 A;  2FCK A;  4XNH C;  1MJ9 A;  4CRZ B;  1XE4 A;  3MGD A;  4B13 A;  1IB1 E;  3B8G A;  1P4N A;  5G20 A;  4CGL A;  2WPX A;  3P2F A;  4C2Y A;  4KOX A;  5C82 A;  4C7I A;  1IYK A;  5A28 A;  2AJ6 A;  1PU9 A;  2R98 A;  1S60 A;  1WK4 A;  2ZW7 A;  2CY2 A;  4CYQ A;  4UWJ A;  3OWC A;  5AG4 A;  5DWN A;  5F48 A;  4C7H A;  1M4I A;  2G0B A;  4CAF A;  3W6S A;  1KUV A;  3TCV A;  4F6A A;  4CAV A;  5AG5 A;  2PR1 A;  5JPH A;  5E96 A;  3IU2 A;  2G3A A;  2FSR A;  2FS5 A;  4UCN A;  1Y9K A;  4PSX A;  3F8K A;  5KTA A;  3KKW A;  1VHS A;  1K4J A;  3N7Z A;  2B5G A;  3W91 A;  2FE7 A;  4KUA A;  5G1Z A;  4NSQ A;  3IGR A;  4GS4 A;  4A31 A;  1S7L A;  3PZJ A;  2WPW A;  4PK3 A;  2VZY A;  4MBU A;  4M85 A;  2Z3K A;  4XPD B;  3IWE A;  3TO7 A;  4KS9 A;  2P6F A;  4JXQ A;  3W6X A;  4KSF A;  1YVO A;  3A9L A;  3P2H A;  2RC4 A;  3PGP A;  2GIV A;  1NMT A;  1NSL A;  2QEC A;  2I00 A;  5EC4 A;  1B87 A;  5AG7 A;  4ZGY B;  5EBV A;  1Y7R A;  1YK3 A;  4I49 A;  1ZO0 A;  3I3G A;  4UA3 A;  5HH1 A;  1IYL A;  1XEB A;  3FNC A;  4OAD A;  4PV6 A;  3QAH A;  2EUI A;  3PP9 A;  2F5I A;  4Q36 A;  1IID A;  2A4N A;  1YX0 A;  4MFL A;  2DPS A;  1M44 A;  1YRE A;  4UFV A;  4CYO A;  1XMT A;  3FYN A;  4QVT A;  4JXR A;  3EO4 A;  2JDC A;  4Q38 A;  1QSO A;  2Q4Y A;  1N71 A;  1Q2C A;  1FY7 A;  1V0C A;  1I21 A;  4XPD C;  2BSW A;  2K5T A;  4OLL A;  3F5B A;  1BO4 A;  4CGO A;  1Z4R A;  2YNE A;  4R3L A;  3SHP A;  2Z3M A;  4IUS A;  4AG7 A;  4J3G A;  5CNP A;  5DWM A;  3EC4 A;  3VWE A;  3CXP A;  4C68 A;  3F0A A;  4U9Y A;  2YND A;  4AG9 A;  4HKF A;  1RXT A;  3IU1 A;  4H6Z A;  4CYN A;  2NMT A;  3E0K A;  4NEX A;  3FBU A;  3EY5 A;  4RI1 A;  2R1I A;  2J8N A;  2G3T A;  3H4Q A;  4NXY A;  1PUA A;  3DR6 A;  2Q44 A;  4KOT A;  1XIX A;  3DNS A;  4BMH A;  5A27 A;  3CXQ A;  1M4D A;  3DR8 A;  2Z10 A;  1ON0 A;  4R9M A;  4UCP A;  5FVJ A;  4YGO A;  4A95 A;  4CAE A;  5J8C A;  4MY3 A;  3FB3 A;  4DNC A;  4KVX A;  1UFH A;  2AE6 A;  2B4B A;  2WSA A;  5J8F A;  2QML A;  2OZG A;  2FT0 A;  2KCW A;  3CXS A;  2Q0Y A;  2HV2 A;  4KUB A;  4C2X A;  1QSN A;  1KZF A;  4CGN A;  5IX3 A;  3R1K A;  1Q2D A;  1P0H A;  2ZPA A;  4QUS A;  5F47 A;  4HNX B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...