4R87A

Crystal structure of spermidine n-acetyltransferase from vibrio cholerae in complex with coa and spermine
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
170
structure length
170
Chain Sequence
NSQLTLRALERGDLRFIHNLNNNRNIMSYWFEEPYESFDELEELYNKHIHDNAERRFVVEDAQKNLIGLVELIEINYIHRSAEFQIIIAPEHQGKGFARTLINRALDYSFTILNLHKIYLHVAVENPKAVHLYEECGFVEEGHLVEEFFINGRYQDVKRMYILQSKYLNR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Spermidine n1-acetyltransferase
publication title A Novel Polyamine Allosteric Site of SpeG from Vibrio cholerae Is Revealed by Its Dodecameric Structure.
pubmed doi rcsb
source organism Vibrio cholerae o1
molecule tags Transferase
total genus 41
structure length 170
sequence length 170
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature ec 2.3.1.57: Diamine N-acetyltransferase.
pdb deposition date 2014-08-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13302 Acetyltransf_3 Acetyltransferase (GNAT) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4r87A00
5I0CA 2J8MA 4NSQA 2Z0ZA 4KUAA 5JPHA 2Q44A 4NCZA 3OWCA 3KKWA 4JXQA 1KUYA 1YREA 2OZHA 4YRHA 4KOSA 2B58A 2J8RA 2NMTA 1KUVA 1XIXA 2B4DA 1B6BA 2PSWA 2Q04A 2Y0MA 2VXKA 2P6EA 3DNSA 5H84A 2R98A 3FXTA 3TO6A 3GKRA 1KZFA 2O28A 1PUAA 4R3LA 4AVCA 4KOYA 1QSNA 5J8FA 4AG9A 1FY7A 3EC4A 1GHEA 1RO5A 3TO9A 1N71A 4M85A 4R87A 3EXNA 4CAXA 1QSOA 4CRYB 1XE4A 3IWGA 4QC6A 1VKCA 4AVBA 3GY9A 1UFHA 2VQYA 2JDDA 4UA3A 4JD6A 3N7ZA 2JEVA 4XPKA 1M44A 4KORA 4U9YA 1U6MA 3WR7A 4PK2A 1YLEA 1BOBA 3G8WA 1Z9UA 3TO7A 1BO4A 1J4JA 2R8VA 1MJ9A 2A4NA 2OB0A 4QB9A 2G3TA 1Z4RA 4HKFA 1IYLA 3LODA 1MJAA 4CAWA 1S7FA 4ONUA 3CXQA 3FBUA 4KOUA 3S6HA 1QSRA 3TCVA 3JVNA 2FS5A 2FT0A 2DXQA 1M4GA 2CNMA 4IUSA 1CM0A 2ZW6A 4L8AA 4B5PB 2BUEA 2HQYA 3GYAA 4CAVA 4MY3A 2P0WA 4MI4A 3S6GA 1SQHA 3FIXA 2EVNA 1WWZA 4UWIA 5DWMA 3R96A 3RYOA 3D2PA 5E96A 1CJWA 3JUWA 2VEZA 3F5BA 3V8IA 1OZPA 1S7LA 4FD7A 3ZZIA 4KVXA 3DR6A 4JXRA 1Z4EA 4H89A 2R1IA 1S5KA 2OH1A 2K5TA 3QAHA 1MJBA 2WPXA 1P0HA 1Q2CA 3UY5A 3D3SA 3VWDA 4JWPA 3P2HA 4HNXB 5F49A 2OZGA 4GS4A 4BMHA 4E2AA 1NSLA 2ZW7A 3NE7A 4MY0A 2QMLA 2D4OA 3P2FA 3PZJA 3R9FA 3H4QA 5KTDA 3S6FA 4RI1A 2ZXVA 4KVOE 4MHDA 4PSXA 3D8PA 4X5KA 2JLMA 4Y49B 2FL4A 5CNPA 4B5PA 4U9ZA 4E0AA 4AG7A 2Z10A 5F48A 2Z11A 3LD2A 2AJ6A 4Y49C 4HNYB 4B5OA 1VHSA 2BEIA 1B87A 3FRMA 3W91A 1P4NA 1R57A 1WK4A 4EVYA 5IV0A 2FIAA 1XMTA 2PR1A 3BLNA 1Q2YA 4AB7A 4L89A 1Y7RA 4JLYA 4KOTA 4KZTA 2REFA 3ZJ0A 4MJ8A 3R9GA 2H5MA 3G3SA 4DNCA 2OZUA 2FXFA 5FVJA 3I3GA 3SHPA 1YVOA 4JJXA 3EFAA 3CXSA 4NEXA 4UWJA 1I21A 2ARHA 1RXTA 2CNSA 2JDCA 3B8GA 2D4PA 4NXYA 1L0CA 4CS0B 2VI7A 2ZW4A 1YR0A 2Q4YA 1I1DA 3K9UA 2B5GB 5EC4A 2I00A 1XEBA 3IGRA 2EUIA 4M3SA 4II9A 2CY2A 1NMTA 5EBVA 4R57A 4FD6A 3E0KA 1S3ZA 3FYNA 3MGDA 3FB3A 3W6XA 2VBQA 4KOXA 1Q2DA 4U5YA 3BJ7A 3R9EA 3PP9A 2QECA 3R95A 2PC1A 4OAEA 2REEA 4LUAA 3TOBA 2J8NA 5F46A 4FD5A 3TTHA 4F0YA 4IF5A 4QVTA 2GANA 2ZPAA 5C82A 2P6FA 2Q0YA 4OADA 1S7KA 1YK3A 3D2MA 4ORFA 2IL4A 5ISVA 4RS2A 4XPDB 1ON0A 2ATRA 3I9SA 5IB0A 3SXNA 4OLLA 4XPDC 3SXOA 4CRZB 4UBRA 2KCWA 2HV2A 1M4IA 3CXPA 3VWEA 4KOWA 4J3GA 5HH1A 5GCNA 2X7BA 4AVAA 3TT2A 5HMNA 1S60A 3DSBA 3S6KA 3F8KA 1IICA 4LX9A 4KOVA 1NE9A 2B5GA 1YVKA 4QUSA 2OU2A 1K4JA 3T90A 2C27A 1MK4A 2F5IA 2PRBA 5F47A 4XPLA 2GE3A 3BJ8A 2B4BA 2FIWA 4H6UA 4ZBGA 2HUZA 4PV6A 3C26A 1M1DA 1TIQA 4MBUA 2WPWA 3T9YA 2G3AA 2CNTA 5H86A 4PSWA 3R1KA 4R9MA 1QSMA 2B3VA 3TOAA 3W6SA 1YX0A 1YGHA 1QSTA 2VZZA 4XNHB 4H6ZA 4YGOA 4FD4A 4XNHC 1Y9WA 3DR8A 4R3KA 2RC4A 3DDDA 4KLWA 2FSRA 5KTCA 1LRZA 2BL1A 3FNCA 5IX3A 2B4DB 4NF1A 4KLVA 1IYKA 4I49A 4E8OA 5JQ4A 3F0AA 2FE7A 4KVME 2PDOA 2B3UA 4KUBA 2PR8A 4K30A 2P6GA 2FCKA 2Q7BA 1S7NA 3EY5A 2PQ8A 3TE4A 1XF8A 1IB1E 4HNWB 1IIDA 4QBJA 2G0BA 2I79A 5KTAA 4PK3A 2VZYA 3TFYA 1V0CA 1I12A 2BSWA 3PGPA 3QB8A 1PU9A 4YFJA 2AE6A 5J8CA 2ZW5A 1M4DA 5C88A 2GIVA 3EO4A 2QIRA 2R7HA 1Y9KA 2Q4VA 5DWNA 4F6AA 1KUXA
chains in the Genus database with same CATH superfamily
3GLJA 5I0CA 2IQ6A 2J8MA 4NSQA 1YQEA 2Z0ZA 4KUAA 3WT4A 5JPHA 4C7IA 2Q44A 4NCZA 1UWYA 2AFUA 3OWCA 4NGSA 3NE8A 3NH4A 3KQXA 4C68A 4A32A 3NH5A 3KKWA 4JXQA 4KSAA 4OC3A 1KUYA 1YREA 2OZHA 4ZY1A 4YRHA 4MFKA 4RUHA 2F7VA 4KOSA 2B58A 3BHXA 2J8RA 3FMCA 2NMTA 5AG6A 1KUVA 2OR4A 1XIXA 3JTKA 4UEFA 2B4DA 1B6BA 1A2ZA 2PSWA 4E0AA 4ZY2A 8CPAA 3B3CA 1ZG7A 5F09A 4MCRA 2Q04A 2Y0MA 2VXKA 2DEAA 4PQAA 2P6EA 3DNSA 3PEIA 5H84A 1Z5RA 2R98A 3IC1A 1DTDA 3FXTA 4UEZA 3TO6A 3VARA 3FH4A 3GKRA 1KZFA 2O28A 2I3CA 1IGBA 4R8FA 1PUAA 4R3LA 1H8LA 3KQZA 2QJ8A 2PJ3A 4UF4A 4AVCA 1OBRA 1F2OA 4M6HA 4YWYA 4KOYA 1QSNA 2ZEHA 5J8FA 3KZWA 4AG9A 2AFZA 1ARLA 1FY7A 3EC4A 1GHEA 4H2KA 3LWUA 1CBXA 2ODFA 2BCOA 5G20A 1RO5A 1YW6A 4NFRA 3PRTA 3TO9A 4B6ZA 1N71A 4M85A 1ZG8A 4R87A 5AG4A 2EWBA 3EXNA 2WSAA 4CAXA 4NGPA 5JH9A 2ZEEA 4CGNA 1QSOA 4CRYB 4CAEA 3LACA 4UIAA 1TXRA 2GLFA 1XE4A 3IWGA 1XRYA 1AMPA 1VKCA 3D7DA 4FWUA 2PVWA 4QC6A 2PE3A 4P4IA 4AVBA 4F9VA 2JBJA 3CDXA 1TKFA 2CXAA 2C6PA 3GY9A 5K8PA 1UFHA 2VQYA 2JDDA 2WZNA 4UA3A 4JD6A 1R3NA 3N7ZA 2JEVA 4LQ6A 4XPKA 1TKJA 3D7FA 3H8EA 1M44A 4KORA 4OKOA 2PJ7A 1U6MA 4U9YA 3WR7A 3JRUA 4PK2A 1YLEA 1BOBA 1TF8A 3G8WA 1Z9UA 2Z3NA 1BO4A 1J4JA 2R8VA 3TO7A 2OB0A 1MJ9A 2A4NA 2V8GA 2G3TA 3IO1A 1JQGA 4QB9A 1BPNA 4P45A 5D29A 2ZOGA 2RB7A 1Z4RA 3DGVA 3WC6A 1F57A 4A30A 5IB9A 2PJCA 4HKFA 1IYLA 2ZEFA 4MXUA 3LODA 1MJAA 4CAWA 1S7FA 5EMIA 4ONUA 4DJLA 3CXQA 2G9DA 3FBUA 4KOUA 1CP7A 4OC2A 3S6HA 4WWVA 1QSRA 2Z3LA 3SI1A 3TCVA 3JVNA 2V8VA 5HXDA 1QQ9A 3BI0A 4CYPA 4PXCA 3K9TA 4UFVA 4MCSA 2FS5A 2EO8A 3KR4A 3V7ZA 2FT0A 2DXQA 4TWEA 3CPXA 3S9NA 1M4GA 3CZXA 5CBMA 1XMBA 2PJ0A 2CNMA 4IUSA 2Q43A 2XEIA 1CM0A 4PXBA 2ZW6A 5HVGA 4L8AA 2ZEDA 1HDQA 3WC7A 4MHNA 2Z3PA 4R7MA 2CF4A 4B5PB 2BUEA 2HQYA 3GYAA 4P4BA 2WUUA 4CAVA 4MY3A 1LFWA 1CPSA 4A33A 2P0WA 3RNZA 7CPAA 4MI4A 3S6GA 1SQHA 3FIXA 2PCUA 2EVNA 1WWZA 4UWIA 2EK9A 2Q4ZA 5DWMA 3R96A 3V38A 4A2ZA 3B2YA 4CGPA 3RYOA 3D7HA 1XFOA 4MFLA 4ZYQA 2F8HA 1HEEA 3D2PA 2XEFA 5E96A 1CJWA 4ZX9A 3JUWA 2VEZA 3F5BA 4M6IA 3V8IA 4ZX8A 3KI9A 1OZPA 2HB6A 2QYVA 1S7LA 4FD7A 1YW4A 1DE4C 3ZZIA 4DYOA 4KVXA 5I4MA 2OOTA 1KUXA 2RFHA 4MFJA 3DR6A 1FT7A 3KR5A 4JXRA 1Z4EA 4H89A 2R1IA 4IAVA 5LYIA 4CAFA 4Z65A 5K8NA 1S5KA 2OH1A 4OC4A 2K5TA 2PJBA 3QAHA 1MJBA 4EWTA 1LANA 2WPXA 1Y0RA 1P0HA 3NA6A 1Q2CA 3UY5A 4BD9A 2EBJA 3D3SA 3VWDA 5A28A 4JWPA 3P2HA 2AFOA 4PXEA 3N5FA 4HNXB 5F49A 2OZGA 4CGMA 5K8MA 4Q7AA 4GS4A 4BMHA 4NGTA 4E2AA 2PIYA 4GXHA 1QMUA 2PJ4A 4BBHA 2GU2A 4MFPA 1NSLA 2ZW7A 3NE7A 4A31A 4MY0A 1LCPA 3DLJA 2QMLA 4C2XA 1M4LA 2D4OA 3PB8X 5G21A 3P2FA 1ZG9A 3PZJA 1Z8WA 3R9FA 4LQGA 4F9UA 2PJ1A 3H4QA 1YMEA 2DPSA 5KTDA 4X2TA 3S6FA 2ZENA 4RI1A 1RTQA 2ZXVA 4RN7A 4KVOE 4MHDA 3B3TA 3RBUA 5K8OA 1ARMA 4PSXA 3D8PA 4X5KA 2JLMA 4JYWA 2FL4A 4Y49B 5AG7A 4U9ZA 5CNPA 4AG7A 2Z10A 5F48A 3SI2A 4B5PA 2Z11A 3LD2A 2AJ6A 3S9LA 4Y49C 3FECA 4B11A 4HNYB 4WJBA 4B5OA 2O53A 4UIBA 1VHSA 4B14A 2BEIA 1B87A 3FRMA 1IU8A 1NSAA 2PJ2A 4B10A 1JWQA 2YNDA 2V8HA 3W91A 5ELYA 1P4NA 1R57A 1WK4A 2C6CA 2XEGA 4OP4A 1Z8XA 4P6YA 4EVYA 2XEJA 1BAVA 5IV0A 2FIAA 4KSIA 5LRKA 2ZEGA 1XMTA 2PR1A 3T8WA 2CTCA 4C7HA 2GLJA 3BLNA 3FJUA 3GIUA 3K2KA 4MMOA 5A27A 1Q2YA 4AB7A 1Y7RA 4JLYA 4KOTA 4KZTA 2PJ5A 2REFA 4L89A 3D67A 4O23A 3ZJ0A 4MJ8A 1AYEA 2DPTA 3R9GA 2H5MA 2PJ8A 3G3SA 4DNCA 4CPAA 4AXVA 2OZUA 2FXFA 4UCMA 5FVJA 4NGQA 3B3WA 3I3GA 3SHPA 1YVOA 1IOFA 3BXMA 1FNOA 4JJXA 4FAIA 3EFAA 4MHYA 2JEWA 3CXSA 4NEXA 4CYQA 2YNCC 3B7IA 4IHMA 4UWJA 1I21A 2ARHA 2GREA 1RXTA 3H8FA 2CNSA 2JDCA 3B8GA 2D4PA 1XJOA 3CPAA 4MHPA 4OIWA 4NXYA 1L0CA 1YSJA 4CS0B 2VI7A 5JGFA 2PRQA 2ZW4A 3FX6A 1YR0A 5LRJA 3B3SA 2Q4YA 1I1DA 3K9UA 2B5GB 1Q7LA 2ZEMA 5D8NA 5EC4A 2I00A 1XEBA 3IGRA 2EUIA 4K3NA 4M3SA 4II9A 2CY2A 5AGEA 4P4JA 2Q7SA 1NMTA 4MCQA 5EBVA 4R57A 4FD6A 3S9MA 2AFMA 3E0KA 1S3ZA 1Z8LA 5LYDA 1EE3P 3FYNA 3MGDA 2Z3MA 3FB3A 3W6XA 2VBQA 1CX8A 3FVLA 4KOXA 3VH9A 2QVPA 4NGRA 1Q2DA 4U5YA 3BJ7A 3R9EA 3PP9A 2QECA 3R95A 2V77A 2O4HA 4CGLA 5BWAB 2PC1A 3KL9A 4OAEA 4P4FA 3PBBA 3VATA 2REEA 4W9YA 2Q51A 1XOVA 4LUAA 3TOBA 2J8NA 1F2PA 3L2NA 5F46A 3PB9X 4FD5A 1ELLP 1VHEA 3TTHA 4F0YA 3B35A 2POKA 3A9LA 3D66A 5THWA 1YLOA 2PJ9A 3IJ3A 4IF5A 4QVTA 2GANA 3TC8A 2ZPAA 5C82A 2P6FA 4TNUA 2Q0YA 1CG2A 4ONWA 4KS9A 4OADA 4C2YA 4UFXA 1Z2LA 1S7KA 1YK3A 3D2MA 3PB4X 4OMEA 3WABA 5LYLA 2CIJA 3IWEA 4OC1A 4ORFA 3IFEA 3PB7X 3KGQA 4FBEA 2IL4A 2ZEPA 5HVHA 5ISVA 4RS2A 1R43A 2PJ6A 4B13A 4XPDB 1ON0A 2ATRA 2BOAA 3I9SA 4A95A 3SXNA 5IB0A 5JM6A 5G22A 4OLLA 4XPDC 3SXOA 1KWMA 2J9AA 1Y7EA 1TKHA 2KCWA 4UBRA 4CRZB 4P10A 2HV2A 4A94A 2YNCA 5J1QA 4G1PA 1M4IA 3CXPA 6CPAA 3D68A 1PCAA 4KSFA 3VWEA 4KOWA 3BI1A 3IU1A 4J3GA 2ZOFA 5HH1A 5GCNA 2X7BA 3KHZA 4AVAA 2ANPA 4MFZA 3TT2A 4B12A 4EMEA 5HMNA 1S60A 3DSBA 4PPZA 3S6KA 3F8KA 3SJXA 3IEHA 3B3VA 3ISZA 4MHZA 1IICA 4LX9A 4UFWA 4KOVA 4R6TA 2AFWA 4A39A 1ELMP 1Z8TA 1NE9A 2B5GA 1YVKA 2YNEA 2OU2A 4QUSA 4X3RA 1K4JA 3T90A 2C27A 1MK4A 2ABZA 2HC9A 2F5IA 2FVGA 2PRBA 1Y0YA 2WYRA 4OIDA 3PBEA 4IK2A 5F47A 4XPLA 3GUXA 4P4DA 2GE3A 4P4EA 1HDUA 3BJ8A 2PVVA 3NFZA 2B4BA 2FIWA 4CGOA 4H6UA 4ZBGA 4X8IA 2HUZA 4PV6A 4Q36A 3C26A 1M1DA 1TIQA 3MN8A 4MBUA 4ZGYB 4F0XA 3IIBA 1LAMA 2WPWA 3T9YA 4MFQA 2G3AA 2CNTA 4NJRA 3H8GA 5H86A 3FEEA 4PSWA 4CYOA 1XBUA 3D7GA 4OC0A 4F8ZA 3R1KA 4BINA 4R9MA 1QSMA 2B3VA 3TOAA 3W6SA 3NH8A 4NGNA 1YX0A 1IOIA 1YGHA 1QSTA 2AFSA 3SI0A 2VZZA 4XNHB 4P44A 4EFDA 4H6ZA 4M6GA 4YGOA 3RAMA 1BPMA 3QNVA 4FD4A 4XNHC 1VIXA 1X10A 4UEEA 4DUKA 4MCPA 3ISXA 3WC5A 1Y9WA 4PXDA 3DR8A 1CP6A 2Z3OA 3HUVA 2RC4A 4R3KA 3DDDA 5HVFA 4KLWA 2FSRA 5KTCA 1LRZA 4UCNA 3SJEA 2BL1A 3FF3A 3D4UA 4A37A 4A38A 1TF9A 3FNCA 1ZLHA 5IX3A 2B4DB 5LRGA 4NF1A 4KLVA 3KASA 1IYKA 4JZ0A 4CYNA 2V8DA 4I49A 2DF5A 2PJAA 5CPAA 1PYTB 4C2ZA 1BLLE 4E8OA 3TX8A 1GYTA 4YU9A 3PFEA 2JBKA 5JQ4A 1ZO0A 1ZLIA 3F0AA 2FE7A 2VL1A 3CT9A 4KVME 5G1ZA 2PDOA 4ZY0A 1AUGA 4NGMA 2C6GA 3QAYA 1X12A 2B3UA 2ZELA 1IY7A 4KUBA 2PR8A 4UCPA 2CTBA 3RZAA 4K30A 3FEDA 2BO9A 2P6GA 2FCKA 2Z3KA 1S7NA 2Q7BA 3EY5A 3SJGA 4R76A 2PQ8A 2IJZA 3TE4A 1IB1E 1XF8A 2PIZA 5DS0A 4HNWB 1IIDA 4QBJA 1CPXA 3H5ZA 3PFOA 1LOKA 1VHOA 2G0BA 2I79A 5KTAA 4PK3A 4FUUA 2EK8A 3GB0A 4HPSA 2VZYA 4ZI6A 3TFYA 1V0CA 4GM5A 5LYFA 3IWWA 1I12A 3SJFA 2BSWA 4OC5A 4Q38A 3PGPA 3QB8A 3HLPA 1PU9A 2C1CA 3MRUA 3LMSA 4MRIA 5AG5A 3PB6X 1VGYA 2AE6A 4YFJA 2ZW5A 3I1UA 1LAPA 2ZEOA 3KHXA 3RO0A 5J8CA 1M4DA 5C88A 2YGWA 2GIVA 3EO4A 3IU2A 2QIRA 2R7HA 1Y9KA 2AFXA 2Q4VA 5DWNA 4F6AA 2GFQA 2IMOA 2NYQA 4NJQA 2NSMA
chains in the Genus database with same CATH topology
5I0CA 2J8MA 4NSQA 2Z0ZA 4KUAA 5JPHA 4C7IA 2Q44A 4NCZA 4C68A 3OWCA 4A32A 3KKWA 4JXQA 4KSAA 1KUYA 1YREA 2OZHA 4YRHA 4MFKA 4KOSA 2B58A 2J8RA 2NMTA 5AG6A 1KUVA 1XIXA 3JTKA 2B4DA 1B6BA 2PSWA 4E0AA 2Q04A 2Y0MA 2VXKA 2P6EA 3DNSA 5H84A 2R98A 3FXTA 3TO6A 3GKRA 1KZFA 2O28A 1PUAA 4R3LA 4AVCA 4KOYA 1QSNA 5J8FA 4AG9A 1FY7A 3EC4A 1GHEA 5G20A 1RO5A 3TO9A 1N71A 4M85A 4R87A 5AG4A 3EXNA 2WSAA 4CAXA 4CGNA 1QSOA 4CRYB 4CAEA 1XE4A 3IWGA 4QC6A 1VKCA 4AVBA 2CXAA 3GY9A 1UFHA 2VQYA 2JDDA 4UA3A 4JD6A 3N7ZA 2JEVA 4XPKA 1M44A 4KORA 4U9YA 1U6MA 3WR7A 4PK2A 1YLEA 1BOBA 3G8WA 1Z9UA 2Z3NA 1BO4A 1J4JA 2R8VA 3TO7A 1MJ9A 2A4NA 2OB0A 4QB9A 2G3TA 1Z4RA 4A30A 4HKFA 1IYLA 3LODA 1MJAA 4CAWA 1S7FA 4ONUA 3CXQA 3FBUA 4KOUA 3S6HA 1QSRA 2Z3LA 3TCVA 3JVNA 4CYPA 4UFVA 2FS5A 2FT0A 2DXQA 1M4GA 2CNMA 4IUSA 1CM0A 2ZW6A 4L8AA 2Z3PA 4B5PB 2BUEA 2HQYA 3GYAA 2WUUA 4CAVA 4MY3A 4A33A 2P0WA 4MI4A 3S6GA 1SQHA 3FIXA 2EVNA 1WWZA 4UWIA 5DWMA 3R96A 4A2ZA 4CGPA 3RYOA 4MFLA 3D2PA 5E96A 1CJWA 3JUWA 2VEZA 3F5BA 3V8IA 1OZPA 1S7LA 4FD7A 3ZZIA 4KVXA 4MFJA 3DR6A 4JXRA 1Z4EA 4H89A 2R1IA 4CAFA 1S5KA 2OH1A 2K5TA 3QAHA 1MJBA 2WPXA 1P0HA 1Q2CA 3UY5A 3D3SA 3VWDA 5A28A 4JWPA 3P2HA 4HNXB 5F49A 2OZGA 4CGMA 4GS4A 4BMHA 4E2AA 4BBHA 4MFPA 1NSLA 2ZW7A 3NE7A 4A31A 4MY0A 2QMLA 4C2XA 2D4OA 5G21A 3P2FA 3PZJA 3R9FA 3H4QA 5KTDA 2DPSA 3S6FA 4RI1A 2ZXVA 4KVOE 4MHDA 4PSXA 3D8PA 4X5KA 2JLMA 4Y49B 2FL4A 5AG7A 5CNPA 4U9ZA 4B13A 4AG7A 2Z10A 5F48A 4B5PA 2Z11A 3LD2A 2AJ6A 4Y49C 4B11A 4HNYB 4B5OA 1VHSA 4B14A 2BEIA 1B87A 3FRMA 4B10A 2YNDA 3W91A 1P4NA 1R57A 1WK4A 4EVYA 5IV0A 2FIAA 1XMTA 2PR1A 4C7HA 3BLNA 5A27A 1Q2YA 4AB7A 1Y7RA 4JLYA 4KOTA 4KZTA 4L89A 2REFA 3ZJ0A 4MJ8A 2DPTA 3R9GA 2H5MA 3G3SA 4DNCA 2OZUA 2FXFA 4UCMA 5FVJA 3I3GA 3SHPA 1YVOA 4JJXA 3EFAA 3CXSA 4NEXA 4CYQA 2YNCC 4UWJA 1I21A 2ARHA 1RXTA 2CNSA 2JDCA 3B8GA 2D4PA 4NXYA 1L0CA 4CS0B 2VI7A 2ZW4A 1YR0A 2Q4YA 1I1DA 3K9UA 2B5GB 5EC4A 2I00A 1XEBA 3IGRA 2EUIA 4M3SA 4II9A 2CY2A 5AGEA 1NMTA 5EBVA 4R57A 4FD6A 3E0KA 1S3ZA 3FYNA 3MGDA 2Z3MA 3FB3A 3W6XA 2VBQA 4KOXA 1Q2DA 4U5YA 3BJ7A 3R9EA 3PP9A 2QECA 3R95A 4CGLA 5BWAB 2PC1A 4OAEA 2REEA 4LUAA 3TOBA 2J8NA 5F46A 4FD5A 3TTHA 4F0YA 3A9LA 4IF5A 4QVTA 2GANA 2ZPAA 5C82A 2P6FA 2Q0YA 4KS9A 4OADA 4C2YA 4UFXA 1S7KA 1YK3A 3D2MA 3IWEA 4ORFA 2IL4A 5ISVA 4RS2A 4XPDB 1ON0A 2ATRA 3I9SA 4A95A 3SXNA 5IB0A 5G22A 4OLLA 4XPDC 3SXOA 4CRZB 4UBRA 2KCWA 2HV2A 2YNCA 1M4IA 3CXPA 4KSFA 3VWEA 4KOWA 3IU1A 4J3GA 5HH1A 5GCNA 2X7BA 4AVAA 4MFZA 3TT2A 4B12A 5HMNA 1S60A 3DSBA 3S6KA 3F8KA 1IICA 4LX9A 4UFWA 4KOVA 1NE9A 2B5GA 1YVKA 2YNEA 2OU2A 4QUSA 1K4JA 3T90A 2C27A 1MK4A 2F5IA 2PRBA 5F47A 4XPLA 2GE3A 3BJ8A 4CGOA 2B4BA 2FIWA 4H6UA 4ZBGA 2HUZA 4PV6A 4Q36A 3C26A 1M1DA 1TIQA 4MBUA 4ZGYB 4F0XA 2WPWA 3T9YA 4MFQA 2G3AA 2CNTA 5H86A 4PSWA 4CYOA 3R1KA 4R9MA 1QSMA 2B3VA 3TOAA 3W6SA 1YX0A 1YGHA 1QSTA 2VZZA 4XNHB 4H6ZA 4YGOA 4FD4A 4XNHC 1Y9WA 3DR8A 2Z3OA 4R3KA 2RC4A 3DDDA 4KLWA 2FSRA 5KTCA 1LRZA 4UCNA 2BL1A 3FNCA 5IX3A 2B4DB 4NF1A 4KLVA 1IYKA 4CYNA 4I49A 4C2ZA 4E8OA 5JQ4A 1ZO0A 3F0AA 2FE7A 4KVME 5G1ZA 2PDOA 2B3UA 4KUBA 4UCPA 2PR8A 4K30A 2Z3KA 2P6GA 2FCKA 2Q7BA 1S7NA 3EY5A 2PQ8A 3TE4A 1XF8A 1IB1E 4HNWB 1IIDA 4QBJA 3H5ZA 2G0BA 2I79A 5KTAA 4PK3A 2VZYA 3TFYA 1V0CA 1I12A 2BSWA 4Q38A 3PGPA 3QB8A 1PU9A 5AG5A 4YFJA 2AE6A 5J8CA 2ZW5A 1M4DA 5C88A 2YGWA 2GIVA 3EO4A 3IU2A 2QIRA 2R7HA 1Y9KA 2Q4VA 5DWNA 4F6AA 1KUXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5I0C A;  2J8M A;  4NSQ A;  2Z0Z A;  4KUA A;  5JPH A;  2Q44 A;  4NCZ A;  3OWC A;  3KKW A;  4JXQ A;  1KUY A;  1YRE A;  2OZH A;  4YRH A;  4KOS A;  2B58 A;  2J8R A;  2NMT A;  1KUV A;  1XIX A;  2B4D A;  1B6B A;  2PSW A;  2Q04 A;  2Y0M A;  2VXK A;  2P6E A;  3DNS A;  5H84 A;  2R98 A;  3FXT A;  3TO6 A;  3GKR A;  1KZF A;  2O28 A;  1PUA A;  4R3L A;  4AVC A;  4KOY A;  1QSN A;  5J8F A;  4AG9 A;  1FY7 A;  3EC4 A;  1GHE A;  1RO5 A;  3TO9 A;  1N71 A;  4M85 A;  4R87 A;  3EXN A;  4CAX A;  1QSO A;  4CRY B;  1XE4 A;  3IWG A;  4QC6 A;  1VKC A;  4AVB A;  3GY9 A;  1UFH A;  2VQY A;  2JDD A;  4UA3 A;  4JD6 A;  3N7Z A;  2JEV A;  4XPK A;  1M44 A;  4KOR A;  4U9Y A;  1U6M A;  3WR7 A;  4PK2 A;  1YLE A;  1BOB A;  3G8W A;  1Z9U A;  3TO7 A;  1BO4 A;  1J4J A;  2R8V A;  1MJ9 A;  2A4N A;  2OB0 A;  4QB9 A;  2G3T A;  1Z4R A;  4HKF A;  1IYL A;  3LOD A;  1MJA A;  4CAW A;  1S7F A;  4ONU A;  3CXQ A;  3FBU A;  4KOU A;  3S6H A;  1QSR A;  3TCV A;  3JVN A;  2FS5 A;  2FT0 A;  2DXQ A;  1M4G A;  2CNM A;  4IUS A;  1CM0 A;  2ZW6 A;  4L8A A;  4B5P B;  2BUE A;  2HQY A;  3GYA A;  4CAV A;  4MY3 A;  2P0W A;  4MI4 A;  3S6G A;  1SQH A;  3FIX A;  2EVN A;  1WWZ A;  4UWI A;  5DWM A;  3R96 A;  3RYO A;  3D2P A;  5E96 A;  1CJW A;  3JUW A;  2VEZ A;  3F5B A;  3V8I A;  1OZP A;  1S7L A;  4FD7 A;  3ZZI A;  4KVX A;  3DR6 A;  4JXR A;  1Z4E A;  4H89 A;  2R1I A;  1S5K A;  2OH1 A;  2K5T A;  3QAH A;  1MJB A;  2WPX A;  1P0H A;  1Q2C A;  3UY5 A;  3D3S A;  3VWD A;  4JWP A;  3P2H A;  4HNX B;  5F49 A;  2OZG A;  4GS4 A;  4BMH A;  4E2A A;  1NSL A;  2ZW7 A;  3NE7 A;  4MY0 A;  2QML A;  2D4O A;  3P2F A;  3PZJ A;  3R9F A;  3H4Q A;  5KTD A;  3S6F A;  4RI1 A;  2ZXV A;  4KVO E;  4MHD A;  4PSX A;  3D8P A;  4X5K A;  2JLM A;  4Y49 B;  2FL4 A;  5CNP A;  4B5P A;  4U9Z A;  4E0A A;  4AG7 A;  2Z10 A;  5F48 A;  2Z11 A;  3LD2 A;  2AJ6 A;  4Y49 C;  4HNY B;  4B5O A;  1VHS A;  2BEI A;  1B87 A;  3FRM A;  3W91 A;  1P4N A;  1R57 A;  1WK4 A;  4EVY A;  5IV0 A;  2FIA A;  1XMT A;  2PR1 A;  3BLN A;  1Q2Y A;  4AB7 A;  4L89 A;  1Y7R A;  4JLY A;  4KOT A;  4KZT A;  2REF A;  3ZJ0 A;  4MJ8 A;  3R9G A;  2H5M A;  3G3S A;  4DNC A;  2OZU A;  2FXF A;  5FVJ A;  3I3G A;  3SHP A;  1YVO A;  4JJX A;  3EFA A;  3CXS A;  4NEX A;  4UWJ A;  1I21 A;  2ARH A;  1RXT A;  2CNS A;  2JDC A;  3B8G A;  2D4P A;  4NXY A;  1L0C A;  4CS0 B;  2VI7 A;  2ZW4 A;  1YR0 A;  2Q4Y A;  1I1D A;  3K9U A;  2B5G B;  5EC4 A;  2I00 A;  1XEB A;  3IGR A;  2EUI A;  4M3S A;  4II9 A;  2CY2 A;  1NMT A;  5EBV A;  4R57 A;  4FD6 A;  3E0K A;  1S3Z A;  3FYN A;  3MGD A;  3FB3 A;  3W6X A;  2VBQ A;  4KOX A;  1Q2D A;  4U5Y A;  3BJ7 A;  3R9E A;  3PP9 A;  2QEC A;  3R95 A;  2PC1 A;  4OAE A;  2REE A;  4LUA A;  3TOB A;  2J8N A;  5F46 A;  4FD5 A;  3TTH A;  4F0Y A;  4IF5 A;  4QVT A;  2GAN A;  2ZPA A;  5C82 A;  2P6F A;  2Q0Y A;  4OAD A;  1S7K A;  1YK3 A;  3D2M A;  4ORF A;  2IL4 A;  5ISV A;  4RS2 A;  4XPD B;  1ON0 A;  2ATR A;  3I9S A;  5IB0 A;  3SXN A;  4OLL A;  4XPD C;  3SXO A;  4CRZ B;  4UBR A;  2KCW A;  2HV2 A;  1M4I A;  3CXP A;  3VWE A;  4KOW A;  4J3G A;  5HH1 A;  5GCN A;  2X7B A;  4AVA A;  3TT2 A;  5HMN A;  1S60 A;  3DSB A;  3S6K A;  3F8K A;  1IIC A;  4LX9 A;  4KOV A;  1NE9 A;  2B5G A;  1YVK A;  4QUS A;  2OU2 A;  1K4J A;  3T90 A;  2C27 A;  1MK4 A;  2F5I A;  2PRB A;  5F47 A;  4XPL A;  2GE3 A;  3BJ8 A;  2B4B A;  2FIW A;  4H6U A;  4ZBG A;  2HUZ A;  4PV6 A;  3C26 A;  1M1D A;  1TIQ A;  4MBU A;  2WPW A;  3T9Y A;  2G3A A;  2CNT A;  5H86 A;  4PSW A;  3R1K A;  4R9M A;  1QSM A;  2B3V A;  3TOA A;  3W6S A;  1YX0 A;  1YGH A;  1QST A;  2VZZ A;  4XNH B;  4H6Z A;  4YGO A;  4FD4 A;  4XNH C;  1Y9W A;  3DR8 A;  4R3K A;  2RC4 A;  3DDD A;  4KLW A;  2FSR A;  5KTC A;  1LRZ A;  2BL1 A;  3FNC A;  5IX3 A;  2B4D B;  4NF1 A;  4KLV A;  1IYK A;  4I49 A;  4E8O A;  5JQ4 A;  3F0A A;  2FE7 A;  4KVM E;  2PDO A;  2B3U A;  4KUB A;  2PR8 A;  4K30 A;  2P6G A;  2FCK A;  2Q7B A;  1S7N A;  3EY5 A;  2PQ8 A;  3TE4 A;  1XF8 A;  1IB1 E;  4HNW B;  1IID A;  4QBJ A;  2G0B A;  2I79 A;  5KTA A;  4PK3 A;  2VZY A;  3TFY A;  1V0C A;  1I12 A;  2BSW A;  3PGP A;  3QB8 A;  1PU9 A;  4YFJ A;  2AE6 A;  5J8C A;  2ZW5 A;  1M4D A;  5C88 A;  2GIV A;  3EO4 A;  2QIR A;  2R7H A;  1Y9K A;  2Q4V A;  5DWN A;  4F6A A;  1KUX A; 
#chains in the Genus database with same CATH topology
 3GLJ A;  5I0C A;  2IQ6 A;  2J8M A;  4NSQ A;  1YQE A;  2Z0Z A;  4KUA A;  3WT4 A;  5JPH A;  4C7I A;  2Q44 A;  4NCZ A;  1UWY A;  2AFU A;  3OWC A;  4NGS A;  3NE8 A;  3NH4 A;  3KQX A;  4C68 A;  4A32 A;  3NH5 A;  3KKW A;  4JXQ A;  4KSA A;  4OC3 A;  1KUY A;  1YRE A;  2OZH A;  4ZY1 A;  4YRH A;  4MFK A;  4RUH A;  2F7V A;  4KOS A;  2B58 A;  3BHX A;  2J8R A;  3FMC A;  2NMT A;  5AG6 A;  1KUV A;  2OR4 A;  1XIX A;  3JTK A;  4UEF A;  2B4D A;  1B6B A;  1A2Z A;  2PSW A;  4E0A A;  4ZY2 A;  8CPA A;  3B3C A;  1ZG7 A;  5F09 A;  4MCR A;  2Q04 A;  2Y0M A;  2VXK A;  2DEA A;  4PQA A;  2P6E A;  3DNS A;  3PEI A;  5H84 A;  1Z5R A;  2R98 A;  3IC1 A;  1DTD A;  3FXT A;  4UEZ A;  3TO6 A;  3VAR A;  3FH4 A;  3GKR A;  1KZF A;  2O28 A;  2I3C A;  1IGB A;  4R8F A;  1PUA A;  4R3L A;  1H8L A;  3KQZ A;  2QJ8 A;  2PJ3 A;  4UF4 A;  4AVC A;  1OBR A;  1F2O A;  4M6H A;  4YWY A;  4KOY A;  1QSN A;  2ZEH A;  5J8F A;  3KZW A;  4AG9 A;  2AFZ A;  1ARL A;  1FY7 A;  3EC4 A;  1GHE A;  4H2K A;  3LWU A;  1CBX A;  2ODF A;  2BCO A;  5G20 A;  1RO5 A;  1YW6 A;  4NFR A;  3PRT A;  3TO9 A;  4B6Z A;  1N71 A;  4M85 A;  1ZG8 A;  4R87 A;  5AG4 A;  2EWB A;  3EXN A;  2WSA A;  4CAX A;  4NGP A;  5JH9 A;  2ZEE A;  4CGN A;  1QSO A;  4CRY B;  4CAE A;  3LAC A;  4UIA A;  1TXR A;  2GLF A;  1XE4 A;  3IWG A;  1XRY A;  1AMP A;  1VKC A;  3D7D A;  4FWU A;  2PVW A;  4QC6 A;  2PE3 A;  4P4I A;  4AVB A;  4F9V A;  2JBJ A;  3CDX A;  1TKF A;  2CXA A;  2C6P A;  3GY9 A;  5K8P A;  1UFH A;  2VQY A;  2JDD A;  2WZN A;  4UA3 A;  4JD6 A;  1R3N A;  3N7Z A;  2JEV A;  4LQ6 A;  4XPK A;  1TKJ A;  3D7F A;  3H8E A;  1M44 A;  4KOR A;  4OKO A;  2PJ7 A;  1U6M A;  4U9Y A;  3WR7 A;  3JRU A;  4PK2 A;  1YLE A;  1BOB A;  1TF8 A;  3G8W A;  1Z9U A;  2Z3N A;  1BO4 A;  1J4J A;  2R8V A;  3TO7 A;  2OB0 A;  1MJ9 A;  2A4N A;  2V8G A;  2G3T A;  3IO1 A;  1JQG A;  4QB9 A;  1BPN A;  4P45 A;  5D29 A;  2ZOG A;  2RB7 A;  1Z4R A;  3DGV A;  3WC6 A;  1F57 A;  4A30 A;  5IB9 A;  2PJC A;  4HKF A;  1IYL A;  2ZEF A;  4MXU A;  3LOD A;  1MJA A;  4CAW A;  1S7F A;  5EMI A;  4ONU A;  4DJL A;  3CXQ A;  2G9D A;  3FBU A;  4KOU A;  1CP7 A;  4OC2 A;  3S6H A;  4WWV A;  1QSR A;  2Z3L A;  3SI1 A;  3TCV A;  3JVN A;  2V8V A;  5HXD A;  1QQ9 A;  3BI0 A;  4CYP A;  4PXC A;  3K9T A;  4UFV A;  4MCS A;  2FS5 A;  2EO8 A;  3KR4 A;  3V7Z A;  2FT0 A;  2DXQ A;  4TWE A;  3CPX A;  3S9N A;  1M4G A;  3CZX A;  5CBM A;  1XMB A;  2PJ0 A;  2CNM A;  4IUS A;  2Q43 A;  2XEI A;  1CM0 A;  4PXB A;  2ZW6 A;  5HVG A;  4L8A A;  2ZED A;  1HDQ A;  3WC7 A;  4MHN A;  2Z3P A;  4R7M A;  2CF4 A;  4B5P B;  2BUE A;  2HQY A;  3GYA A;  4P4B A;  2WUU A;  4CAV A;  4MY3 A;  1LFW A;  1CPS A;  4A33 A;  2P0W A;  3RNZ A;  7CPA A;  4MI4 A;  3S6G A;  1SQH A;  3FIX A;  2PCU A;  2EVN A;  1WWZ A;  4UWI A;  2EK9 A;  2Q4Z A;  5DWM A;  3R96 A;  3V38 A;  4A2Z A;  3B2Y A;  4CGP A;  3RYO A;  3D7H A;  1XFO A;  4MFL A;  4ZYQ A;  2F8H A;  1HEE A;  3D2P A;  2XEF A;  5E96 A;  1CJW A;  4ZX9 A;  3JUW A;  2VEZ A;  3F5B A;  4M6I A;  3V8I A;  4ZX8 A;  3KI9 A;  1OZP A;  2HB6 A;  2QYV A;  1S7L A;  4FD7 A;  1YW4 A;  1DE4 C;  3ZZI A;  4DYO A;  4KVX A;  5I4M A;  2OOT A;  1KUX A;  2RFH A;  4MFJ A;  3DR6 A;  1FT7 A;  3KR5 A;  4JXR A;  1Z4E A;  4H89 A;  2R1I A;  4IAV A;  5LYI A;  4CAF A;  4Z65 A;  5K8N A;  1S5K A;  2OH1 A;  4OC4 A;  2K5T A;  2PJB A;  3QAH A;  1MJB A;  4EWT A;  1LAN A;  2WPX A;  1Y0R A;  1P0H A;  3NA6 A;  1Q2C A;  3UY5 A;  4BD9 A;  2EBJ A;  3D3S A;  3VWD A;  5A28 A;  4JWP A;  3P2H A;  2AFO A;  4PXE A;  3N5F A;  4HNX B;  5F49 A;  2OZG A;  4CGM A;  5K8M A;  4Q7A A;  4GS4 A;  4BMH A;  4NGT A;  4E2A A;  2PIY A;  4GXH A;  1QMU A;  2PJ4 A;  4BBH A;  2GU2 A;  4MFP A;  1NSL A;  2ZW7 A;  3NE7 A;  4A31 A;  4MY0 A;  1LCP A;  3DLJ A;  2QML A;  4C2X A;  1M4L A;  2D4O A;  3PB8 X;  5G21 A;  3P2F A;  1ZG9 A;  3PZJ A;  1Z8W A;  3R9F A;  4LQG A;  4F9U A;  2PJ1 A;  3H4Q A;  1YME A;  2DPS A;  5KTD A;  4X2T A;  3S6F A;  2ZEN A;  4RI1 A;  1RTQ A;  2ZXV A;  4RN7 A;  4KVO E;  4MHD A;  3B3T A;  3RBU A;  5K8O A;  1ARM A;  4PSX A;  3D8P A;  4X5K A;  2JLM A;  4JYW A;  2FL4 A;  4Y49 B;  5AG7 A;  4U9Z A;  5CNP A;  4AG7 A;  2Z10 A;  5F48 A;  3SI2 A;  4B5P A;  2Z11 A;  3LD2 A;  2AJ6 A;  3S9L A;  4Y49 C;  3FEC A;  4B11 A;  4HNY B;  4WJB A;  4B5O A;  2O53 A;  4UIB A;  1VHS A;  4B14 A;  2BEI A;  1B87 A;  3FRM A;  1IU8 A;  1NSA A;  2PJ2 A;  4B10 A;  1JWQ A;  2YND A;  2V8H A;  3W91 A;  5ELY A;  1P4N A;  1R57 A;  1WK4 A;  2C6C A;  2XEG A;  4OP4 A;  1Z8X A;  4P6Y A;  4EVY A;  2XEJ A;  1BAV A;  5IV0 A;  2FIA A;  4KSI A;  5LRK A;  2ZEG A;  1XMT A;  2PR1 A;  3T8W A;  2CTC A;  4C7H A;  2GLJ A;  3BLN A;  3FJU A;  3GIU A;  3K2K A;  4MMO A;  5A27 A;  1Q2Y A;  4AB7 A;  1Y7R A;  4JLY A;  4KOT A;  4KZT A;  2PJ5 A;  2REF A;  4L89 A;  3D67 A;  4O23 A;  3ZJ0 A;  4MJ8 A;  1AYE A;  2DPT A;  3R9G A;  2H5M A;  2PJ8 A;  3G3S A;  4DNC A;  4CPA A;  4AXV A;  2OZU A;  2FXF A;  4UCM A;  5FVJ A;  4NGQ A;  3B3W A;  3I3G A;  3SHP A;  1YVO A;  1IOF A;  3BXM A;  1FNO A;  4JJX A;  4FAI A;  3EFA A;  4MHY A;  2JEW A;  3CXS A;  4NEX A;  4CYQ A;  2YNC C;  3B7I A;  4IHM A;  4UWJ A;  1I21 A;  2ARH A;  2GRE A;  1RXT A;  3H8F A;  2CNS A;  2JDC A;  3B8G A;  2D4P A;  1XJO A;  3CPA A;  4MHP A;  4OIW A;  4NXY A;  1L0C A;  1YSJ A;  4CS0 B;  2VI7 A;  5JGF A;  2PRQ A;  2ZW4 A;  3FX6 A;  1YR0 A;  5LRJ A;  3B3S A;  2Q4Y A;  1I1D A;  3K9U A;  2B5G B;  1Q7L A;  2ZEM A;  5D8N A;  5EC4 A;  2I00 A;  1XEB A;  3IGR A;  2EUI A;  4K3N A;  4M3S A;  4II9 A;  2CY2 A;  5AGE A;  4P4J A;  2Q7S A;  1NMT A;  4MCQ A;  5EBV A;  4R57 A;  4FD6 A;  3S9M A;  2AFM A;  3E0K A;  1S3Z A;  1Z8L A;  5LYD A;  1EE3 P;  3FYN A;  3MGD A;  2Z3M A;  3FB3 A;  3W6X A;  2VBQ A;  1CX8 A;  3FVL A;  4KOX A;  3VH9 A;  2QVP A;  4NGR A;  1Q2D A;  4U5Y A;  3BJ7 A;  3R9E A;  3PP9 A;  2QEC A;  3R95 A;  2V77 A;  2O4H A;  4CGL A;  5BWA B;  2PC1 A;  3KL9 A;  4OAE A;  4P4F A;  3PBB A;  3VAT A;  2REE A;  4W9Y A;  2Q51 A;  1XOV A;  4LUA A;  3TOB A;  2J8N A;  1F2P A;  3L2N A;  5F46 A;  3PB9 X;  4FD5 A;  1ELL P;  1VHE A;  3TTH A;  4F0Y A;  3B35 A;  2POK A;  3A9L A;  3D66 A;  5THW A;  1YLO A;  2PJ9 A;  3IJ3 A;  4IF5 A;  4QVT A;  2GAN A;  3TC8 A;  2ZPA A;  5C82 A;  2P6F A;  4TNU A;  2Q0Y A;  1CG2 A;  4ONW A;  4KS9 A;  4OAD A;  4C2Y A;  4UFX A;  1Z2L A;  1S7K A;  1YK3 A;  3D2M A;  3PB4 X;  4OME A;  3WAB A;  5LYL A;  2CIJ A;  3IWE A;  4OC1 A;  4ORF A;  3IFE A;  3PB7 X;  3KGQ A;  4FBE A;  2IL4 A;  2ZEP A;  5HVH A;  5ISV A;  4RS2 A;  1R43 A;  2PJ6 A;  4B13 A;  4XPD B;  1ON0 A;  2ATR A;  2BOA A;  3I9S A;  4A95 A;  3SXN A;  5IB0 A;  5JM6 A;  5G22 A;  4OLL A;  4XPD C;  3SXO A;  1KWM A;  2J9A A;  1Y7E A;  1TKH A;  2KCW A;  4UBR A;  4CRZ B;  4P10 A;  2HV2 A;  4A94 A;  2YNC A;  5J1Q A;  4G1P A;  1M4I A;  3CXP A;  6CPA A;  3D68 A;  1PCA A;  4KSF A;  3VWE A;  4KOW A;  3BI1 A;  3IU1 A;  4J3G A;  2ZOF A;  5HH1 A;  5GCN A;  2X7B A;  3KHZ A;  4AVA A;  2ANP A;  4MFZ A;  3TT2 A;  4B12 A;  4EME A;  5HMN A;  1S60 A;  3DSB A;  4PPZ A;  3S6K A;  3F8K A;  3SJX A;  3IEH A;  3B3V A;  3ISZ A;  4MHZ A;  1IIC A;  4LX9 A;  4UFW A;  4KOV A;  4R6T A;  2AFW A;  4A39 A;  1ELM P;  1Z8T A;  1NE9 A;  2B5G A;  1YVK A;  2YNE A;  2OU2 A;  4QUS A;  4X3R A;  1K4J A;  3T90 A;  2C27 A;  1MK4 A;  2ABZ A;  2HC9 A;  2F5I A;  2FVG A;  2PRB A;  1Y0Y A;  2WYR A;  4OID A;  3PBE A;  4IK2 A;  5F47 A;  4XPL A;  3GUX A;  4P4D A;  2GE3 A;  4P4E A;  1HDU A;  3BJ8 A;  2PVV A;  3NFZ A;  2B4B A;  2FIW A;  4CGO A;  4H6U A;  4ZBG A;  4X8I A;  2HUZ A;  4PV6 A;  4Q36 A;  3C26 A;  1M1D A;  1TIQ A;  3MN8 A;  4MBU A;  4ZGY B;  4F0X A;  3IIB A;  1LAM A;  2WPW A;  3T9Y A;  4MFQ A;  2G3A A;  2CNT A;  4NJR A;  3H8G A;  5H86 A;  3FEE A;  4PSW A;  4CYO A;  1XBU A;  3D7G A;  4OC0 A;  4F8Z A;  3R1K A;  4BIN A;  4R9M A;  1QSM A;  2B3V A;  3TOA A;  3W6S A;  3NH8 A;  4NGN A;  1YX0 A;  1IOI A;  1YGH A;  1QST A;  2AFS A;  3SI0 A;  2VZZ A;  4XNH B;  4P44 A;  4EFD A;  4H6Z A;  4M6G A;  4YGO A;  3RAM A;  1BPM A;  3QNV A;  4FD4 A;  4XNH C;  1VIX A;  1X10 A;  4UEE A;  4DUK A;  4MCP A;  3ISX A;  3WC5 A;  1Y9W A;  4PXD A;  3DR8 A;  1CP6 A;  2Z3O A;  3HUV A;  2RC4 A;  4R3K A;  3DDD A;  5HVF A;  4KLW A;  2FSR A;  5KTC A;  1LRZ A;  4UCN A;  3SJE A;  2BL1 A;  3FF3 A;  3D4U A;  4A37 A;  4A38 A;  1TF9 A;  3FNC A;  1ZLH A;  5IX3 A;  2B4D B;  5LRG A;  4NF1 A;  4KLV A;  3KAS A;  1IYK A;  4JZ0 A;  4CYN A;  2V8D A;  4I49 A;  2DF5 A;  2PJA A;  5CPA A;  1PYT B;  4C2Z A;  1BLL E;  4E8O A;  3TX8 A;  1GYT A;  4YU9 A;  3PFE A;  2JBK A;  5JQ4 A;  1ZO0 A;  1ZLI A;  3F0A A;  2FE7 A;  2VL1 A;  3CT9 A;  4KVM E;  5G1Z A;  2PDO A;  4ZY0 A;  1AUG A;  4NGM A;  2C6G A;  3QAY A;  1X12 A;  2B3U A;  2ZEL A;  1IY7 A;  4KUB A;  2PR8 A;  4UCP A;  2CTB A;  3RZA A;  4K30 A;  3FED A;  2BO9 A;  2P6G A;  2FCK A;  2Z3K A;  1S7N A;  2Q7B A;  3EY5 A;  3SJG A;  4R76 A;  2PQ8 A;  2IJZ A;  3TE4 A;  1IB1 E;  1XF8 A;  2PIZ A;  5DS0 A;  4HNW B;  1IID A;  4QBJ A;  1CPX A;  3H5Z A;  3PFO A;  1LOK A;  1VHO A;  2G0B A;  2I79 A;  5KTA A;  4PK3 A;  4FUU A;  2EK8 A;  3GB0 A;  4HPS A;  2VZY A;  4ZI6 A;  3TFY A;  1V0C A;  4GM5 A;  5LYF A;  3IWW A;  1I12 A;  3SJF A;  2BSW A;  4OC5 A;  4Q38 A;  3PGP A;  3QB8 A;  3HLP A;  1PU9 A;  2C1C A;  3MRU A;  3LMS A;  4MRI A;  5AG5 A;  3PB6 X;  1VGY A;  2AE6 A;  4YFJ A;  2ZW5 A;  3I1U A;  1LAP A;  2ZEO A;  3KHX A;  3RO0 A;  5J8C A;  1M4D A;  5C88 A;  2YGW A;  2GIV A;  3EO4 A;  3IU2 A;  2QIR A;  2R7H A;  1Y9K A;  2AFX A;  2Q4V A;  5DWN A;  4F6A A;  2GFQ A;  2IMO A;  2NYQ A;  4NJQ A;  2NSM A; 
#chains in the Genus database with same CATH homology
 5I0C A;  2J8M A;  4NSQ A;  2Z0Z A;  4KUA A;  5JPH A;  4C7I A;  2Q44 A;  4NCZ A;  4C68 A;  3OWC A;  4A32 A;  3KKW A;  4JXQ A;  4KSA A;  1KUY A;  1YRE A;  2OZH A;  4YRH A;  4MFK A;  4KOS A;  2B58 A;  2J8R A;  2NMT A;  5AG6 A;  1KUV A;  1XIX A;  3JTK A;  2B4D A;  1B6B A;  2PSW A;  4E0A A;  2Q04 A;  2Y0M A;  2VXK A;  2P6E A;  3DNS A;  5H84 A;  2R98 A;  3FXT A;  3TO6 A;  3GKR A;  1KZF A;  2O28 A;  1PUA A;  4R3L A;  4AVC A;  4KOY A;  1QSN A;  5J8F A;  4AG9 A;  1FY7 A;  3EC4 A;  1GHE A;  5G20 A;  1RO5 A;  3TO9 A;  1N71 A;  4M85 A;  4R87 A;  5AG4 A;  3EXN A;  2WSA A;  4CAX A;  4CGN A;  1QSO A;  4CRY B;  4CAE A;  1XE4 A;  3IWG A;  4QC6 A;  1VKC A;  4AVB A;  2CXA A;  3GY9 A;  1UFH A;  2VQY A;  2JDD A;  4UA3 A;  4JD6 A;  3N7Z A;  2JEV A;  4XPK A;  1M44 A;  4KOR A;  4U9Y A;  1U6M A;  3WR7 A;  4PK2 A;  1YLE A;  1BOB A;  3G8W A;  1Z9U A;  2Z3N A;  1BO4 A;  1J4J A;  2R8V A;  3TO7 A;  1MJ9 A;  2A4N A;  2OB0 A;  4QB9 A;  2G3T A;  1Z4R A;  4A30 A;  4HKF A;  1IYL A;  3LOD A;  1MJA A;  4CAW A;  1S7F A;  4ONU A;  3CXQ A;  3FBU A;  4KOU A;  3S6H A;  1QSR A;  2Z3L A;  3TCV A;  3JVN A;  4CYP A;  4UFV A;  2FS5 A;  2FT0 A;  2DXQ A;  1M4G A;  2CNM A;  4IUS A;  1CM0 A;  2ZW6 A;  4L8A A;  2Z3P A;  4B5P B;  2BUE A;  2HQY A;  3GYA A;  2WUU A;  4CAV A;  4MY3 A;  4A33 A;  2P0W A;  4MI4 A;  3S6G A;  1SQH A;  3FIX A;  2EVN A;  1WWZ A;  4UWI A;  5DWM A;  3R96 A;  4A2Z A;  4CGP A;  3RYO A;  4MFL A;  3D2P A;  5E96 A;  1CJW A;  3JUW A;  2VEZ A;  3F5B A;  3V8I A;  1OZP A;  1S7L A;  4FD7 A;  3ZZI A;  4KVX A;  4MFJ A;  3DR6 A;  4JXR A;  1Z4E A;  4H89 A;  2R1I A;  4CAF A;  1S5K A;  2OH1 A;  2K5T A;  3QAH A;  1MJB A;  2WPX A;  1P0H A;  1Q2C A;  3UY5 A;  3D3S A;  3VWD A;  5A28 A;  4JWP A;  3P2H A;  4HNX B;  5F49 A;  2OZG A;  4CGM A;  4GS4 A;  4BMH A;  4E2A A;  4BBH A;  4MFP A;  1NSL A;  2ZW7 A;  3NE7 A;  4A31 A;  4MY0 A;  2QML A;  4C2X A;  2D4O A;  5G21 A;  3P2F A;  3PZJ A;  3R9F A;  3H4Q A;  5KTD A;  2DPS A;  3S6F A;  4RI1 A;  2ZXV A;  4KVO E;  4MHD A;  4PSX A;  3D8P A;  4X5K A;  2JLM A;  4Y49 B;  2FL4 A;  5AG7 A;  5CNP A;  4U9Z A;  4B13 A;  4AG7 A;  2Z10 A;  5F48 A;  4B5P A;  2Z11 A;  3LD2 A;  2AJ6 A;  4Y49 C;  4B11 A;  4HNY B;  4B5O A;  1VHS A;  4B14 A;  2BEI A;  1B87 A;  3FRM A;  4B10 A;  2YND A;  3W91 A;  1P4N A;  1R57 A;  1WK4 A;  4EVY A;  5IV0 A;  2FIA A;  1XMT A;  2PR1 A;  4C7H A;  3BLN A;  5A27 A;  1Q2Y A;  4AB7 A;  1Y7R A;  4JLY A;  4KOT A;  4KZT A;  4L89 A;  2REF A;  3ZJ0 A;  4MJ8 A;  2DPT A;  3R9G A;  2H5M A;  3G3S A;  4DNC A;  2OZU A;  2FXF A;  4UCM A;  5FVJ A;  3I3G A;  3SHP A;  1YVO A;  4JJX A;  3EFA A;  3CXS A;  4NEX A;  4CYQ A;  2YNC C;  4UWJ A;  1I21 A;  2ARH A;  1RXT A;  2CNS A;  2JDC A;  3B8G A;  2D4P A;  4NXY A;  1L0C A;  4CS0 B;  2VI7 A;  2ZW4 A;  1YR0 A;  2Q4Y A;  1I1D A;  3K9U A;  2B5G B;  5EC4 A;  2I00 A;  1XEB A;  3IGR A;  2EUI A;  4M3S A;  4II9 A;  2CY2 A;  5AGE A;  1NMT A;  5EBV A;  4R57 A;  4FD6 A;  3E0K A;  1S3Z A;  3FYN A;  3MGD A;  2Z3M A;  3FB3 A;  3W6X A;  2VBQ A;  4KOX A;  1Q2D A;  4U5Y A;  3BJ7 A;  3R9E A;  3PP9 A;  2QEC A;  3R95 A;  4CGL A;  5BWA B;  2PC1 A;  4OAE A;  2REE A;  4LUA A;  3TOB A;  2J8N A;  5F46 A;  4FD5 A;  3TTH A;  4F0Y A;  3A9L A;  4IF5 A;  4QVT A;  2GAN A;  2ZPA A;  5C82 A;  2P6F A;  2Q0Y A;  4KS9 A;  4OAD A;  4C2Y A;  4UFX A;  1S7K A;  1YK3 A;  3D2M A;  3IWE A;  4ORF A;  2IL4 A;  5ISV A;  4RS2 A;  4XPD B;  1ON0 A;  2ATR A;  3I9S A;  4A95 A;  3SXN A;  5IB0 A;  5G22 A;  4OLL A;  4XPD C;  3SXO A;  4CRZ B;  4UBR A;  2KCW A;  2HV2 A;  2YNC A;  1M4I A;  3CXP A;  4KSF A;  3VWE A;  4KOW A;  3IU1 A;  4J3G A;  5HH1 A;  5GCN A;  2X7B A;  4AVA A;  4MFZ A;  3TT2 A;  4B12 A;  5HMN A;  1S60 A;  3DSB A;  3S6K A;  3F8K A;  1IIC A;  4LX9 A;  4UFW A;  4KOV A;  1NE9 A;  2B5G A;  1YVK A;  2YNE A;  2OU2 A;  4QUS A;  1K4J A;  3T90 A;  2C27 A;  1MK4 A;  2F5I A;  2PRB A;  5F47 A;  4XPL A;  2GE3 A;  3BJ8 A;  4CGO A;  2B4B A;  2FIW A;  4H6U A;  4ZBG A;  2HUZ A;  4PV6 A;  4Q36 A;  3C26 A;  1M1D A;  1TIQ A;  4MBU A;  4ZGY B;  4F0X A;  2WPW A;  3T9Y A;  4MFQ A;  2G3A A;  2CNT A;  5H86 A;  4PSW A;  4CYO A;  3R1K A;  4R9M A;  1QSM A;  2B3V A;  3TOA A;  3W6S A;  1YX0 A;  1YGH A;  1QST A;  2VZZ A;  4XNH B;  4H6Z A;  4YGO A;  4FD4 A;  4XNH C;  1Y9W A;  3DR8 A;  2Z3O A;  4R3K A;  2RC4 A;  3DDD A;  4KLW A;  2FSR A;  5KTC A;  1LRZ A;  4UCN A;  2BL1 A;  3FNC A;  5IX3 A;  2B4D B;  4NF1 A;  4KLV A;  1IYK A;  4CYN A;  4I49 A;  4C2Z A;  4E8O A;  5JQ4 A;  1ZO0 A;  3F0A A;  2FE7 A;  4KVM E;  5G1Z A;  2PDO A;  2B3U A;  4KUB A;  4UCP A;  2PR8 A;  4K30 A;  2Z3K A;  2P6G A;  2FCK A;  2Q7B A;  1S7N A;  3EY5 A;  2PQ8 A;  3TE4 A;  1XF8 A;  1IB1 E;  4HNW B;  1IID A;  4QBJ A;  3H5Z A;  2G0B A;  2I79 A;  5KTA A;  4PK3 A;  2VZY A;  3TFY A;  1V0C A;  1I12 A;  2BSW A;  4Q38 A;  3PGP A;  3QB8 A;  1PU9 A;  5AG5 A;  4YFJ A;  2AE6 A;  5J8C A;  2ZW5 A;  1M4D A;  5C88 A;  2YGW A;  2GIV A;  3EO4 A;  3IU2 A;  2QIR A;  2R7H A;  1Y9K A;  2Q4V A;  5DWN A;  4F6A A;  1KUX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...