4R87A

Crystal structure of spermidine n-acetyltransferase from vibrio cholerae in complex with coa and spermine
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
170
structure length
170
Chain Sequence
NSQLTLRALERGDLRFIHNLNNNRNIMSYWFEEPYESFDELEELYNKHIHDNAERRFVVEDAQKNLIGLVELIEINYIHRSAEFQIIIAPEHQGKGFARTLINRALDYSFTILNLHKIYLHVAVENPKAVHLYEECGFVEEGHLVEEFFINGRYQDVKRMYILQSKYLNR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Spermidine n1-acetyltransferase
publication title A Novel Polyamine Allosteric Site of SpeG from Vibrio cholerae Is Revealed by Its Dodecameric Structure.
pubmed doi rcsb
source organism Vibrio cholerae o1
molecule tags Transferase
total genus 41
structure length 170
sequence length 170
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature ec 2.3.1.57: Diamine N-acetyltransferase.
pdb deposition date 2014-08-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13302 Acetyltransf_3 Acetyltransferase (GNAT) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4r87A00
1Y9WA 3TTHA 1Z4EA 5FVJA 3E0KA 1BO4A 1LRZA 4KOTA 2B4BA 4FD7A 1S7FA 2OZUA 2QIRA 4XNHB 4KVOE 4YGOA 3TO7A 3LD2A 1YGHA 2FSRA 5JQ4A 3TO6A 5ISVA 4XPLA 1QSMA 2R1IA 2H5MA 3H4QA 3R1KA 1Q2CA 4B5PB 4QUSA 2JLMA 3PP9A 4R57A 3BLNA 3JUWA 2PR8A 4HNXB 3TO9A 4H6UA 1GHEA 4J3GA 1M4GA 2WPXA 2OH1A 2VBQA 2Z10A 3EFAA 4JJXA 3ZZIA 1P0HA 2B5GA 3P2FA 4AB7A 3TFYA 1XEBA 2BL1A 3N7ZA 2P6FA 4ONUA 3EO4A 4PV6A 4KUBA 5IX3A 2A4NA 4KORA 1B6BA 3ZJ0A 3S6GA 2J8NA 2G3AA 2PRBA 3EC4A 4MBUA 2IL4A 4UWJA 1CJWA 2P0WA 2Q0YA 3F5BA 1YX0A 3FXTA 2ARHA 4R3LA 4NEXA 2Q4VA 1KUYA 3QAHA 1YREA 5EC4A 1VHSA 4KOWA 4AVCA 2Q7BA 4M3SA 4GS4A 2ZW5A 5C82A 5C88A 3D3SA 4CRZB 2D4PA 3T90A 5DWNA 4XPDC 3V8IA 2B58A 4JXQA 1M1DA 2JEVA 2REFA 4II9A 2OZGA 3S6KA 2FIAA 5E96A 1FY7A 4HNYB 2NMTA 4FD6A 5I0CA 3D2PA 4CRYB 4XPDB 5F46A 3IWGA 2B5GB 1QSOA 2REEA 3S6FA 2P6EA 4PSWA 1Z9UA 3I9SA 4AG9A 2FE7A 2FL4A 2VZYA 1MJAA 3LODA 1XE4A 1M44A 2BSWA 2K5TA 4ORFA 3R9EA 2Z11A 2RC4A 3FIXA 3TOAA 2I79A 2F5IA 4F0YA 5HMNA 3CXPA 3QB8A 3DR8A 1QSRA 1YVOA 4AVAA 4R87A 1RXTA 2Z0ZA 1I12A 3GYAA 3DR6A 3TCVA 3TE4A 1YLEA 3I3GA 3IGRA 2EUIA 3B8GA 3VWDA 3RYOA 2PSWA 4Y49C 4QBJA 2J8RA 4CAVA 3W6SA 2ZPAA 2CNMA 3G3SA 4DNCA 5F49A 2KCWA 3FB3A 4HNWB 3FNCA 4MI4A 1CM0A 4Y49B 1ON0A 2R8VA 4BMHA 3DNSA 1S7NA 3JVNA 4RI1A 5IB0A 4U9ZA 2BEIA 1Y7RA 4X5KA 2B3VA 4MY3A 1QSNA 3PGPA 4QC6A 1S7KA 2ZW6A 2HUZA 2OZHA 2C27A 4LX9A 1KUVA 4EVYA 4HKFA 2FCKA 2GANA 3EY5A 1SQHA 5H86A 2Q4YA 3FRMA 1S5KA 2CNSA 2PR1A 2O28A 2OB0A 1YVKA 4OLLA 5F48A 2VZZA 1RO5A 4E2AA 4OADA 3BJ8A 3NE7A 3D2MA 2ATRA 2R98A 2ZW4A 4MJ8A 4NSQA 4KOXA 3WR7A 1IIDA 1BOBA 3EXNA 4F6AA 1Q2YA 2B3UA 2BUEA 4AG7A 1UFHA 2CNTA 1VKCA 4AVBA 1Z4RA 2VQYA 3TOBA 1NE9A 4ZBGA 1K4JA 4L8AA 2B4DA 4JXRA 2FT0A 1Q2DA 2ZXVA 3F0AA 4YRHA 3DSBA 5J8FA 3OWCA 4R9MA 3P2HA 4NF1A 2QECA 1U6MA 2PQ8A 4KOVA 2PC1A 4JD6A 3F8KA 1XIXA 1WWZA 4IF5A 4UWIA 4CAXA 4KLWA 2D4OA 3CXSA 1M4IA 2FS5A 1MJ9A 1OZPA 4E8OA 5CNPA 3UY5A 3PZJA 3R96A 3FYNA 4L89A 5KTCA 2P6GA 1NMTA 1WK4A 1XF8A 1Y9KA 1IYKA 1S3ZA 4RS2A 2FIWA 3SHPA 1V0CA 4FD5A 3VWEA 3FBUA 4KLVA 4PK2A 4QB9A 4H6ZA 5EBVA 5HH1A 4KOUA 5IV0A 1IB1E 3T9YA 4OAEA 2PDOA 3TT2A 3W6XA 1IICA 4JLYA 4YFJA 2B4DB 4U5YA 5F47A 1M4DA 4PK3A 2WPWA 4KOYA 4LUAA 4JWPA 3MGDA 4M85A 4FD4A 1S60A 1I21A 2AJ6A 1P4NA 4UA3A 1TIQA 4KVME 2G0BA 3KKWA 1KZFA 5DWMA 4KOSA 4CS0B 1KUXA 2CY2A 1B87A 4PSXA 1IYLA 4XPKA 2Y0MA 2OU2A 2VI7A 1QSTA 4IUSA 3D8PA 1XMTA 4MY0A 2GIVA 3C26A 2VXKA 1YK3A 4K30A 4KUAA 1YR0A 1PUAA 4E0AA 4B5OA 5KTAA 3GKRA 1I1DA 3R95A 2GE3A 2Q44A 4NXYA 1S7LA 3R9FA 2R7HA 2JDCA 3BJ7A 1PU9A 2Q04A 3W91A 1R57A 4KZTA 2G3TA 4H89A 2J8MA 4R3KA 2AE6A 3K9UA 3SXOA 3GY9A 2HQYA 1J4JA 1N71A 4B5PA 3SXNA 2I00A 4QVTA 3CXQA 2DXQA 4UBRA 2VEZA 1L0CA 5KTDA 5J8CA 2JDDA 2ZW7A 5H84A 2FXFA 3DDDA 4U9YA 1NSLA 5JPHA 4MHDA 3S6HA 5GCNA 2EVNA 4I49A 1MJBA 3G8WA 4CAWA 2X7BA 1MK4A 2HV2A 2QMLA 4NCZA 3R9GA 4KVXA 4XNHC
chains in the Genus database with same CATH superfamily
4O23A 1CP6A 3KI9A 1IU8A 1Y9WA 4UEZA 3TTHA 1Z4EA 2CIJA 3FJUA 4OIDA 5FVJA 3PFEA 3PB6X 4OMEA 3IU1A 1ZG7A 3E0KA 1BO4A 3SI0A 1LRZA 1YMEA 3PEIA 2ZEDA 4KOTA 2B4BA 4MCPA 4FD7A 2EBJA 3PB8X 1S7FA 2OZUA 2QIRA 4XNHB 4KVOE 4YGOA 4OP4A 3TO7A 3LD2A 1YGHA 2FSRA 5JQ4A 1IGBA 5HVFA 1ZG9A 3TO6A 5ISVA 4XPLA 3QNVA 1QSMA 1TKHA 1IOFA 1XRYA 2R1IA 2H5MA 4KS9A 2ZEMA 3H4QA 2PCUA 3RZAA 1NSAA 4GXHA 4NGQA 2PIYA 3R1KA 1Q2CA 1VIXA 2PVWA 4B5PB 4QUSA 2JLMA 3PP9A 2IMOA 2PJ3A 3BLNA 3GB0A 3JUWA 4R57A 6CPAA 2PR8A 2YNDA 5LRGA 4HNXB 3TO9A 3T8WA 3GLJA 4H6UA 1GHEA 4J3GA 4NFRA 1KWMA 2PVVA 3WC7A 1YLOA 4P10A 1M4GA 2WPXA 2OH1A 2VBQA 2Z10A 3EFAA 4JJXA 4LQ6A 5DS0A 2OOTA 3ZZIA 1P0HA 2B5GA 2CXAA 1VHEA 3P2FA 4UFXA 4AB7A 4UFVA 4R7MA 3TFYA 3LACA 3JTKA 4KSIA 1XEBA 4PXDA 2POKA 2BL1A 3N7ZA 2P6FA 4ONUA 1FNOA 3EO4A 2DEAA 1CP7A 2ODFA 4PV6A 4ZY2A 1R3NA 4KUBA 4DYOA 5IX3A 3ISXA 2A4NA 4KORA 2GFQA 1B6BA 3ZJ0A 2NYQA 4MHPA 2J8NA 3S6GA 2F8HA 2G3AA 2PRBA 3NE8A 3EC4A 2AFXA 4UCMA 1YW4A 4MBUA 4A38A 3GUXA 2PJ6A 2IL4A 1DE4C 1FT7A 4UWJA 1CJWA 4EWTA 4MHNA 2P0WA 2Q0YA 3F5BA 1YX0A 3FXTA 3NH8A 2ARHA 4R3LA 4NGMA 2PJ1A 3PBEA 4NEXA 2EK8A 2F7VA 4UF4A 4MFPA 2Q4VA 1Z8WA 1KUYA 3QAHA 1UWYA 3WC5A 1YREA 4JZ0A 2Z3OA 5EC4A 4OC0A 1VHSA 4KOWA 4AVCA 2Q7BA 4M3SA 4GS4A 5CBMA 2PJ2A 2ZW5A 3HUVA 1AYEA 4C7HA 5C88A 2YNCA 5C82A 3D3SA 3MRUA 4CRZB 2D4PA 3B7IA 4KSFA 7CPAA 3T90A 5DWNA 4XPDC 3V8IA 3KL9A 4ZY0A 2PIZA 3KQXA 2B58A 2AFWA 2Q43A 4JXQA 1M1DA 2JEVA 4FWUA 2REFA 3B3SA 2RFHA 3I1UA 2OZGA 4BD9A 4II9A 5LYIA 3JRUA 4UEEA 3V7ZA 1A2ZA 3S6KA 2FIAA 4MHYA 5E96A 1FY7A 4HNYB 2NMTA 4NJQA 4NGPA 4FD6A 1Z8TA 3KR5A 5I0CA 3D2PA 2G9DA 4R6TA 3H5ZA 4XPDB 4CRYB 5F46A 4ONWA 3IWGA 2DPTA 4P45A 2B5GB 5EMIA 1QSOA 2PJCA 4ZYQA 2YNEA 4A95A 3D7HA 3BI1A 1JWQA 2REEA 3S6FA 1F2OA 2P6EA 3QAYA 4PSWA 1Z9UA 3I9SA 4B13A 4AG9A 5F09A 1ELMP 2RB7A 2FE7A 3D68A 4C2XA 5JGFA 3PFOA 4P4JA 3D4UA 2FL4A 3B2YA 3KASA 3TX8A 2VZYA 5AG6A 2BCOA 2WUUA 4CGMA 2IQ6A 2PRQA 1MJAA 2ZEEA 4B14A 4F0XA 3LODA 1XE4A 1M44A 2BSWA 2K5TA 4ORFA 3R9EA 4RUHA 2Z3NA 2Z11A 1F57A 2RC4A 3FIXA 3TOAA 2I79A 4EMEA 4PQAA 5LYDA 4A39A 2F5IA 3BHXA 4F0YA 5HMNA 2EWBA 3B3VA 3CXPA 3QB8A 3DR8A 2YNCC 4ZX9A 4F9UA 2EO8A 1QSRA 3KQZA 3IWWA 4CGNA 4EFDA 1YVOA 1TF8A 5HVGA 4AVAA 5K8PA 4R87A 2ANPA 1RXTA 2Z0ZA 4TNUA 1I12A 3GYAA 2J9AA 3FEEA 1Y0RA 3DR6A 3TCVA 3TE4A 1YLEA 1CPSA 3I3GA 5ELYA 3IGRA 2XEJA 3CZXA 4NGRA 8CPAA 2EUIA 2HB6A 4JYWA 3B8GA 4CGPA 3VWDA 1PYTB 3RYOA 2PSWA 4Y49C 4MCSA 4NGNA 5LRJA 4QBJA 3CPAA 2J8RA 4A2ZA 3W6SA 4CAVA 2ZPAA 2EK9A 1F2PA 2CNMA 3G3SA 4DNCA 5F49A 2KCWA 3FB3A 1CBXA 4X3RA 4HNWB 5LRKA 2AFSA 3FNCA 4PPZA 5LYLA 1IOIA 2PJBA 4MI4A 1CM0A 4CYQA 4Y49B 1ON0A 2R8VA 4ZX8A 3KZWA 4BMHA 3DNSA 1QQ9A 1S7NA 2ABZA 1OBRA 3JVNA 4RI1A 2ZEPA 5IB0A 4RN7A 2GLJA 2PJ0A 4U9ZA 1BLLE 1TXRA 2BEIA 1Y7RA 4X5KA 2B3VA 4MY3A 1QSNA 1Z8LA 3LMSA 3PGPA 5K8NA 4IHMA 4QC6A 3FVLA 1S7KA 2ZW6A 3D7GA 5THWA 4CPAA 4TWEA 5LYFA 4B12A 2HUZA 2OZHA 2C27A 4B6ZA 2NSMA 4LX9A 1KUVA 5K8OA 4EVYA 3TC8A 4HKFA 2FCKA 2GANA 3EY5A 5D8NA 1SQHA 5H86A 3SI1A 2Q4YA 3FRMA 1S5KA 3D7DA 2CNSA 3CT9A 4B11A 2PR1A 2O28A 2OB0A 1PCAA 1YVKA 4MRIA 4OLLA 5F48A 3FEDA 2DPSA 2VZZA 1RO5A 4E2AA 4OADA 4C2ZA 3BJ8A 2BO9A 4MFLA 5G21A 1ELLP 3D2MA 3NE7A 2ATRA 2R98A 3PBBA 2ZW4A 3IC1A 4C7IA 2WSAA 4MJ8A 4NSQA 4KOXA 3WR7A 1EE3P 2QYVA 2YGWA 3NH4A 1IIDA 1BOBA 3EXNA 4W9YA 4F6AA 1Q2YA 1CG2A 2B3UA 2BUEA 4UIAA 4AG7A 4ZGYB 1UFHA 2JBJA 4BBHA 2CNTA 1AUGA 2ZOFA 1VKCA 4MFZA 4AVBA 1TF9A 4A33A 2GLFA 1Z4RA 1Y7EA 1Z5RA 2V8HA 4A30A 2VQYA 3TOBA 1XFOA 1NE9A 3KR4A 3IO1A 4ZBGA 3NA6A 4MFKA 1K4JA 1ZLHA 5BWAB 4ZY1A 1R43A 3IEHA 4L8AA 2CTBA 4ZI6A 2B4DA 4JXRA 4P4IA 2FT0A 1Q2DA 4P4BA 2ZXVA 4MFJA 3F0AA 4YRHA 3GIUA 3DSBA 3SJGA 5J8FA 3OWCA 4R9MA 5G20A 3P2HA 4PXBA 4CAFA 1HDUA 4A32A 4NF1A 1ARLA 2QECA 4MFQA 1YSJA 4CYNA 4FBEA 1U6MA 4NGSA 2PQ8A 3N5FA 2C1CA 4KOVA 3A9LA 2PC1A 4IK2A 1HEEA 5CPAA 4CGOA 2PJAA 3PB4X 2V8GA 4JD6A 1LFWA 3F8KA 1Q7LA 1WWZA 1XIXA 4IF5A 4UWIA 4B10A 2JBKA 3FMCA 4CAXA 3IIBA 2AFMA 2ZEOA 4KLWA 5J1QA 2D4OA 3CXSA 1M4IA 3IFEA 2FS5A 3FH4A 4PXCA 3IWEA 2GU2A 1MJ9A 1OZPA 4E8OA 5CNPA 4NGTA 2FVGA 3FX6A 3UY5A 5AG5A 3B3TA 1ARMA 3PZJA 3R96A 5AG4A 4NJRA 5I4MA 3FYNA 5HVHA 4L89A 5KTCA 2P6GA 1NMTA 1WK4A 4UIBA 5G22A 3S9MA 1XF8A 2XEFA 2WZNA 1Y9KA 1IYKA 1S3ZA 4Q38A 4RS2A 2V8DA 2FIWA 3SHPA 4CGLA 1V0CA 4FD5A 3VWEA 3KGQA 3SJEA 3FBUA 4KLVA 4MHZA 1BPMA 2HC9A 3K9TA 4PK2A 4H6ZA 4QB9A 5EBVA 4Q36A 5HH1A 4H2KA 4KOUA 5IV0A 2C6GA 1IB1E 4WWVA 3T9YA 2Z3LA 4OAEA 4OIWA 2DF5A 5AGEA 3WT4A 2PDOA 3D67A 4CYPA 1Z8XA 4R76A 5A27A 4UEFA 3TT2A 3W6XA 2PJ7A 4OKOA 1IICA 3V38A 4YU9A 1XJOA 1XBUA 4JLYA 4F9VA 1LANA 4YFJA 2Z3MA 2B4DB 4K3NA 4U5YA 4UCNA 5F47A 1M4DA 4F8ZA 1BAVA 4PK3A 2WPWA 3PB9X 4KOYA 4LUAA 4JWPA 1X10A 4KSAA 3MGDA 3KHZA 4M85A 1ZLIA 3H8FA 1S60A 2AFUA 4FD4A 1I21A 5A28A 5HXDA 3BI0A 2AJ6A 1P4NA 4GM5A 1Y0YA 4UA3A 1TIQA 1YW6A 2Z3KA 3FECA 3IJ3A 4KVME 2G0BA 3KKWA 2ZEGA 1TKJA 1KZFA 3L2NA 4UCPA 5DWMA 4OC1A 4KOSA 4C2YA 1XMBA 4A94A 4CS0B 1KUXA 2CY2A 1B87A 4OC4A 4PSXA 4X2TA 1IYLA 4XPKA 2BOAA 2Y0MA 2CF4A 2OU2A 4P44A 3WC6A 1XOVA 1ZO0A 2IJZA 2VI7A 4P4FA 1QSTA 3D66A 3SI2A 1LOKA 4IUSA 2Q7SA 3D8PA 1XMTA 4DJLA 4MY0A 3MN8A 2GIVA 3B3CA 3C26A 2XEIA 3K2KA 3CPXA 2ZOGA 3NH5A 3S9NA 4R8FA 5D29A 3VH9A 2VXKA 1YK3A 2ZENA 1VGYA 3B35A 2I3CA 4FAIA 4K30A 3LWUA 4PXEA 4KUAA 1YR0A 1PUAA 1JQGA 4E0AA 1HDQA 5AG7A 4MCQA 4B5OA 1DTDA 5KTAA 1CX8A 3DGVA 2V8VA 3GKRA 1RTQA 1I1DA 3ISZA 2Z3PA 3CDXA 3R95A 2CTCA 3HLPA 3RAMA 4LQGA 2GE3A 2Q44A 2O53A 3BXMA 3IU2A 4NXYA 4OC5A 2AFOA 1ZG8A 1S7LA 2WYRA 2JEWA 2AFZA 3KHXA 4UFWA 1X12A 3H8EA 4A37A 2VL1A 1CPXA 4MMOA 3R9FA 1BPNA 2JDCA 2R7HA 3BJ7A 3DLJA 1PU9A 2QVPA 2Q04A 3W91A 4P6YA 1R57A 1M4LA 4WJBA 2OR4A 1Z2LA 4C68A 2PE3A 2V77A 2ZEFA 4OC2A 2ZELA 4KZTA 2G3TA 1LAMA 4H89A 2J8MA 4M6HA 2AE6A 4R3KA 3K9UA 4OC3A 3SXOA 4Z65A 4YWYA 3GY9A 1H8LA 2HQYA 1J4JA 4P4DA 3VATA 4CYOA 3FF3A 1N71A 2C6CA 4MXUA 3WABA 2PJ5A 4B5PA 3H8GA 5G1ZA 2I00A 2Q51A 3SXNA 5JM6A 1YQEA 2Q4ZA 1TKFA 3CXQA 4QVTA 2DXQA 4UBRA 1VHOA 3RO0A 2VEZA 1L0CA 5KTDA 1IY7A 4Q7AA 4M6GA 5J8CA 1LAPA 2PJ4A 2JDDA 2PJ8A 3D7FA 4HPSA 1LCPA 2ZW7A 3SJFA 4AXVA 5H84A 2FXFA 3RBUA 4A31A 5IB9A 3DDDA 5JH9A 4U9YA 4BINA 3B3WA 1NSLA 1QMUA 2O4HA 3PRTA 5JPHA 4MHDA 2GREA 1GYTA 3S6HA 2QJ8A 3SJXA 5GCNA 3VARA 4CAEA 2EVNA 4I49A 1MJBA 4IAVA 4P4EA 3G8WA 4M6IA 4CAWA 3S9LA 5K8MA 2X7BA 1AMPA 3NFZA 3RNZA 1MK4A 2HV2A 2QMLA 4MCRA 2C6PA 2XEGA 4DUKA 4NCZA 3PB7X 2PJ9A 4FUUA 3R9GA 4X8IA 2ZEHA 4KVXA 4G1PA 4XNHC
chains in the Genus database with same CATH topology
1Y9WA 3TTHA 1Z4EA 5FVJA 3IU1A 3E0KA 1BO4A 1LRZA 4KOTA 2B4BA 4FD7A 1S7FA 2OZUA 2QIRA 4XNHB 4KVOE 4YGOA 3TO7A 3LD2A 1YGHA 2FSRA 5JQ4A 3TO6A 5ISVA 4XPLA 1QSMA 2R1IA 2H5MA 4KS9A 3H4QA 3R1KA 1Q2CA 4B5PB 4QUSA 2JLMA 3PP9A 4R57A 3BLNA 3JUWA 2PR8A 2YNDA 4HNXB 3TO9A 4H6UA 1GHEA 4J3GA 1M4GA 2WPXA 2OH1A 2VBQA 2Z10A 3EFAA 4JJXA 3ZZIA 1P0HA 2B5GA 2CXAA 3P2FA 4UFXA 4AB7A 4UFVA 3TFYA 3JTKA 1XEBA 2BL1A 3N7ZA 2P6FA 4ONUA 3EO4A 4PV6A 4KUBA 5IX3A 2A4NA 4KORA 1B6BA 3ZJ0A 3S6GA 2J8NA 2G3AA 2PRBA 3EC4A 4UCMA 4MBUA 2IL4A 4UWJA 1CJWA 2P0WA 2Q0YA 3F5BA 1YX0A 3FXTA 2ARHA 4R3LA 4NEXA 4MFPA 2Q4VA 1KUYA 3QAHA 1YREA 2Z3OA 5EC4A 1VHSA 4KOWA 4AVCA 2Q7BA 4M3SA 4GS4A 2ZW5A 4C7HA 5C88A 2YNCA 5C82A 3D3SA 4CRZB 2D4PA 4KSFA 3T90A 5DWNA 4XPDC 3V8IA 2B58A 4JXQA 1M1DA 2JEVA 2REFA 4II9A 2OZGA 3S6KA 2FIAA 5E96A 1FY7A 4HNYB 2NMTA 4FD6A 5I0CA 3D2PA 4CRYB 4XPDB 3H5ZA 5F46A 3IWGA 2DPTA 2B5GB 1QSOA 2YNEA 4A95A 2REEA 3S6FA 2P6EA 4B13A 4PSWA 1Z9UA 3I9SA 4AG9A 2FE7A 4C2XA 2FL4A 2VZYA 5AG6A 4CGMA 2WUUA 1MJAA 4B14A 4F0XA 3LODA 1XE4A 1M44A 2BSWA 2K5TA 4ORFA 3R9EA 2Z3NA 2Z11A 2RC4A 3FIXA 3TOAA 2I79A 2F5IA 4F0YA 5HMNA 3CXPA 3QB8A 3DR8A 2YNCC 1QSRA 4CGNA 1YVOA 4AVAA 4R87A 1RXTA 2Z0ZA 1I12A 3GYAA 3DR6A 3TCVA 3TE4A 1YLEA 3I3GA 3IGRA 2EUIA 3B8GA 4CGPA 3VWDA 3RYOA 2PSWA 4Y49C 4QBJA 2J8RA 4A2ZA 3W6SA 4CAVA 2ZPAA 2CNMA 3G3SA 4DNCA 5F49A 2KCWA 3FB3A 4HNWB 3FNCA 4MI4A 1CM0A 4CYQA 4Y49B 1ON0A 2R8VA 4BMHA 3DNSA 1S7NA 3JVNA 4RI1A 5IB0A 4U9ZA 2BEIA 1Y7RA 4X5KA 2B3VA 4MY3A 1QSNA 3PGPA 4QC6A 1S7KA 2ZW6A 4B12A 2HUZA 2OZHA 2C27A 4LX9A 1KUVA 4EVYA 4HKFA 2FCKA 2GANA 3EY5A 1SQHA 5H86A 2Q4YA 3FRMA 1S5KA 2CNSA 4B11A 2PR1A 2O28A 2OB0A 1YVKA 4OLLA 5F48A 2DPSA 2VZZA 1RO5A 4E2AA 4OADA 4C2ZA 3BJ8A 4MFLA 5G21A 3NE7A 3D2MA 2ATRA 2R98A 2ZW4A 4C7IA 2WSAA 4MJ8A 4NSQA 4KOXA 3WR7A 2YGWA 1IIDA 1BOBA 3EXNA 4F6AA 1Q2YA 2B3UA 2BUEA 4AG7A 4ZGYB 1UFHA 4BBHA 2CNTA 1VKCA 4MFZA 4AVBA 4A33A 1Z4RA 4A30A 2VQYA 3TOBA 1NE9A 4ZBGA 4MFKA 1K4JA 5BWAB 4L8AA 2B4DA 4JXRA 2FT0A 1Q2DA 2ZXVA 4MFJA 3F0AA 4YRHA 3DSBA 5J8FA 3OWCA 4R9MA 5G20A 3P2HA 4CAFA 4A32A 4NF1A 2QECA 4MFQA 4CYNA 1U6MA 2PQ8A 4KOVA 3A9LA 2PC1A 4CGOA 4JD6A 3F8KA 1XIXA 1WWZA 4IF5A 4UWIA 4B10A 4CAXA 4KLWA 2D4OA 3CXSA 1M4IA 2FS5A 3IWEA 1MJ9A 1OZPA 4E8OA 5CNPA 3UY5A 5AG5A 3PZJA 3R96A 5AG4A 3FYNA 4L89A 5KTCA 2P6GA 1NMTA 1WK4A 5G22A 1XF8A 1Y9KA 1IYKA 1S3ZA 4Q38A 4RS2A 2FIWA 3SHPA 4CGLA 1V0CA 4FD5A 3VWEA 3FBUA 4KLVA 4PK2A 4QB9A 4H6ZA 5EBVA 4Q36A 5HH1A 4KOUA 5IV0A 1IB1E 3T9YA 2Z3LA 4OAEA 5AGEA 2PDOA 4CYPA 5A27A 3TT2A 3W6XA 1IICA 4JLYA 4YFJA 2Z3MA 2B4DB 4U5YA 4UCNA 5F47A 1M4DA 4PK3A 2WPWA 4KOYA 4LUAA 4JWPA 4KSAA 3MGDA 4M85A 4FD4A 1S60A 1I21A 5A28A 2AJ6A 1P4NA 4UA3A 1TIQA 2Z3KA 4KVME 2G0BA 3KKWA 4UCPA 1KZFA 5DWMA 4KOSA 4C2YA 4CS0B 1KUXA 2CY2A 1B87A 4PSXA 1IYLA 4XPKA 2Y0MA 2OU2A 1ZO0A 2VI7A 1QSTA 4IUSA 3D8PA 1XMTA 4MY0A 2GIVA 3C26A 2VXKA 1YK3A 4K30A 4KUAA 1YR0A 1PUAA 4E0AA 5AG7A 4B5OA 5KTAA 3GKRA 1I1DA 2Z3PA 3R95A 2GE3A 2Q44A 3IU2A 4NXYA 1S7LA 4UFWA 3R9FA 2R7HA 2JDCA 3BJ7A 1PU9A 2Q04A 3W91A 1R57A 4C68A 4KZTA 2G3TA 4H89A 2J8MA 4R3KA 2AE6A 3K9UA 3SXOA 3GY9A 2HQYA 1J4JA 4CYOA 1N71A 4B5PA 5G1ZA 2I00A 3SXNA 4QVTA 3CXQA 2DXQA 4UBRA 2VEZA 1L0CA 5KTDA 5J8CA 2JDDA 2ZW7A 5H84A 2FXFA 4A31A 3DDDA 4U9YA 1NSLA 5JPHA 4MHDA 3S6HA 5GCNA 4CAEA 2EVNA 4I49A 1MJBA 3G8WA 4CAWA 2X7BA 1MK4A 2HV2A 2QMLA 4NCZA 3R9GA 4KVXA 4XNHC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Y9W A;  3TTH A;  1Z4E A;  5FVJ A;  3E0K A;  1BO4 A;  1LRZ A;  4KOT A;  2B4B A;  4FD7 A;  1S7F A;  2OZU A;  2QIR A;  4XNH B;  4KVO E;  4YGO A;  3TO7 A;  3LD2 A;  1YGH A;  2FSR A;  5JQ4 A;  3TO6 A;  5ISV A;  4XPL A;  1QSM A;  2R1I A;  2H5M A;  3H4Q A;  3R1K A;  1Q2C A;  4B5P B;  4QUS A;  2JLM A;  3PP9 A;  4R57 A;  3BLN A;  3JUW A;  2PR8 A;  4HNX B;  3TO9 A;  4H6U A;  1GHE A;  4J3G A;  1M4G A;  2WPX A;  2OH1 A;  2VBQ A;  2Z10 A;  3EFA A;  4JJX A;  3ZZI A;  1P0H A;  2B5G A;  3P2F A;  4AB7 A;  3TFY A;  1XEB A;  2BL1 A;  3N7Z A;  2P6F A;  4ONU A;  3EO4 A;  4PV6 A;  4KUB A;  5IX3 A;  2A4N A;  4KOR A;  1B6B A;  3ZJ0 A;  3S6G A;  2J8N A;  2G3A A;  2PRB A;  3EC4 A;  4MBU A;  2IL4 A;  4UWJ A;  1CJW A;  2P0W A;  2Q0Y A;  3F5B A;  1YX0 A;  3FXT A;  2ARH A;  4R3L A;  4NEX A;  2Q4V A;  1KUY A;  3QAH A;  1YRE A;  5EC4 A;  1VHS A;  4KOW A;  4AVC A;  2Q7B A;  4M3S A;  4GS4 A;  2ZW5 A;  5C82 A;  5C88 A;  3D3S A;  4CRZ B;  2D4P A;  3T90 A;  5DWN A;  4XPD C;  3V8I A;  2B58 A;  4JXQ A;  1M1D A;  2JEV A;  2REF A;  4II9 A;  2OZG A;  3S6K A;  2FIA A;  5E96 A;  1FY7 A;  4HNY B;  2NMT A;  4FD6 A;  5I0C A;  3D2P A;  4CRY B;  4XPD B;  5F46 A;  3IWG A;  2B5G B;  1QSO A;  2REE A;  3S6F A;  2P6E A;  4PSW A;  1Z9U A;  3I9S A;  4AG9 A;  2FE7 A;  2FL4 A;  2VZY A;  1MJA A;  3LOD A;  1XE4 A;  1M44 A;  2BSW A;  2K5T A;  4ORF A;  3R9E A;  2Z11 A;  2RC4 A;  3FIX A;  3TOA A;  2I79 A;  2F5I A;  4F0Y A;  5HMN A;  3CXP A;  3QB8 A;  3DR8 A;  1QSR A;  1YVO A;  4AVA A;  4R87 A;  1RXT A;  2Z0Z A;  1I12 A;  3GYA A;  3DR6 A;  3TCV A;  3TE4 A;  1YLE A;  3I3G A;  3IGR A;  2EUI A;  3B8G A;  3VWD A;  3RYO A;  2PSW A;  4Y49 C;  4QBJ A;  2J8R A;  4CAV A;  3W6S A;  2ZPA A;  2CNM A;  3G3S A;  4DNC A;  5F49 A;  2KCW A;  3FB3 A;  4HNW B;  3FNC A;  4MI4 A;  1CM0 A;  4Y49 B;  1ON0 A;  2R8V A;  4BMH A;  3DNS A;  1S7N A;  3JVN A;  4RI1 A;  5IB0 A;  4U9Z A;  2BEI A;  1Y7R A;  4X5K A;  2B3V A;  4MY3 A;  1QSN A;  3PGP A;  4QC6 A;  1S7K A;  2ZW6 A;  2HUZ A;  2OZH A;  2C27 A;  4LX9 A;  1KUV A;  4EVY A;  4HKF A;  2FCK A;  2GAN A;  3EY5 A;  1SQH A;  5H86 A;  2Q4Y A;  3FRM A;  1S5K A;  2CNS A;  2PR1 A;  2O28 A;  2OB0 A;  1YVK A;  4OLL A;  5F48 A;  2VZZ A;  1RO5 A;  4E2A A;  4OAD A;  3BJ8 A;  3NE7 A;  3D2M A;  2ATR A;  2R98 A;  2ZW4 A;  4MJ8 A;  4NSQ A;  4KOX A;  3WR7 A;  1IID A;  1BOB A;  3EXN A;  4F6A A;  1Q2Y A;  2B3U A;  2BUE A;  4AG7 A;  1UFH A;  2CNT A;  1VKC A;  4AVB A;  1Z4R A;  2VQY A;  3TOB A;  1NE9 A;  4ZBG A;  1K4J A;  4L8A A;  2B4D A;  4JXR A;  2FT0 A;  1Q2D A;  2ZXV A;  3F0A A;  4YRH A;  3DSB A;  5J8F A;  3OWC A;  4R9M A;  3P2H A;  4NF1 A;  2QEC A;  1U6M A;  2PQ8 A;  4KOV A;  2PC1 A;  4JD6 A;  3F8K A;  1XIX A;  1WWZ A;  4IF5 A;  4UWI A;  4CAX A;  4KLW A;  2D4O A;  3CXS A;  1M4I A;  2FS5 A;  1MJ9 A;  1OZP A;  4E8O A;  5CNP A;  3UY5 A;  3PZJ A;  3R96 A;  3FYN A;  4L89 A;  5KTC A;  2P6G A;  1NMT A;  1WK4 A;  1XF8 A;  1Y9K A;  1IYK A;  1S3Z A;  4RS2 A;  2FIW A;  3SHP A;  1V0C A;  4FD5 A;  3VWE A;  3FBU A;  4KLV A;  4PK2 A;  4QB9 A;  4H6Z A;  5EBV A;  5HH1 A;  4KOU A;  5IV0 A;  1IB1 E;  3T9Y A;  4OAE A;  2PDO A;  3TT2 A;  3W6X A;  1IIC A;  4JLY A;  4YFJ A;  2B4D B;  4U5Y A;  5F47 A;  1M4D A;  4PK3 A;  2WPW A;  4KOY A;  4LUA A;  4JWP A;  3MGD A;  4M85 A;  4FD4 A;  1S60 A;  1I21 A;  2AJ6 A;  1P4N A;  4UA3 A;  1TIQ A;  4KVM E;  2G0B A;  3KKW A;  1KZF A;  5DWM A;  4KOS A;  4CS0 B;  1KUX A;  2CY2 A;  1B87 A;  4PSX A;  1IYL A;  4XPK A;  2Y0M A;  2OU2 A;  2VI7 A;  1QST A;  4IUS A;  3D8P A;  1XMT A;  4MY0 A;  2GIV A;  3C26 A;  2VXK A;  1YK3 A;  4K30 A;  4KUA A;  1YR0 A;  1PUA A;  4E0A A;  4B5O A;  5KTA A;  3GKR A;  1I1D A;  3R95 A;  2GE3 A;  2Q44 A;  4NXY A;  1S7L A;  3R9F A;  2R7H A;  2JDC A;  3BJ7 A;  1PU9 A;  2Q04 A;  3W91 A;  1R57 A;  4KZT A;  2G3T A;  4H89 A;  2J8M A;  4R3K A;  2AE6 A;  3K9U A;  3SXO A;  3GY9 A;  2HQY A;  1J4J A;  1N71 A;  4B5P A;  3SXN A;  2I00 A;  4QVT A;  3CXQ A;  2DXQ A;  4UBR A;  2VEZ A;  1L0C A;  5KTD A;  5J8C A;  2JDD A;  2ZW7 A;  5H84 A;  2FXF A;  3DDD A;  4U9Y A;  1NSL A;  5JPH A;  4MHD A;  3S6H A;  5GCN A;  2EVN A;  4I49 A;  1MJB A;  3G8W A;  4CAW A;  2X7B A;  1MK4 A;  2HV2 A;  2QML A;  4NCZ A;  3R9G A;  4KVX A;  4XNH C; 
#chains in the Genus database with same CATH topology
 4O23 A;  1CP6 A;  3KI9 A;  1IU8 A;  1Y9W A;  4UEZ A;  3TTH A;  1Z4E A;  2CIJ A;  3FJU A;  4OID A;  5FVJ A;  3PFE A;  3PB6 X;  4OME A;  3IU1 A;  1ZG7 A;  3E0K A;  1BO4 A;  3SI0 A;  1LRZ A;  1YME A;  3PEI A;  2ZED A;  4KOT A;  2B4B A;  4MCP A;  4FD7 A;  2EBJ A;  3PB8 X;  1S7F A;  2OZU A;  2QIR A;  4XNH B;  4KVO E;  4YGO A;  4OP4 A;  3TO7 A;  3LD2 A;  1YGH A;  2FSR A;  5JQ4 A;  1IGB A;  5HVF A;  1ZG9 A;  3TO6 A;  5ISV A;  4XPL A;  3QNV A;  1QSM A;  1TKH A;  1IOF A;  1XRY A;  2R1I A;  2H5M A;  4KS9 A;  2ZEM A;  3H4Q A;  2PCU A;  3RZA A;  1NSA A;  4GXH A;  4NGQ A;  2PIY A;  3R1K A;  1Q2C A;  1VIX A;  2PVW A;  4B5P B;  4QUS A;  2JLM A;  3PP9 A;  2IMO A;  2PJ3 A;  3BLN A;  3GB0 A;  3JUW A;  4R57 A;  6CPA A;  2PR8 A;  2YND A;  5LRG A;  4HNX B;  3TO9 A;  3T8W A;  3GLJ A;  4H6U A;  1GHE A;  4J3G A;  4NFR A;  1KWM A;  2PVV A;  3WC7 A;  1YLO A;  4P10 A;  1M4G A;  2WPX A;  2OH1 A;  2VBQ A;  2Z10 A;  3EFA A;  4JJX A;  4LQ6 A;  5DS0 A;  2OOT A;  3ZZI A;  1P0H A;  2B5G A;  2CXA A;  1VHE A;  3P2F A;  4UFX A;  4AB7 A;  4UFV A;  4R7M A;  3TFY A;  3LAC A;  3JTK A;  4KSI A;  1XEB A;  4PXD A;  2POK A;  2BL1 A;  3N7Z A;  2P6F A;  4ONU A;  1FNO A;  3EO4 A;  2DEA A;  1CP7 A;  2ODF A;  4PV6 A;  4ZY2 A;  1R3N A;  4KUB A;  4DYO A;  5IX3 A;  3ISX A;  2A4N A;  4KOR A;  2GFQ A;  1B6B A;  3ZJ0 A;  2NYQ A;  4MHP A;  2J8N A;  3S6G A;  2F8H A;  2G3A A;  2PRB A;  3NE8 A;  3EC4 A;  2AFX A;  4UCM A;  1YW4 A;  4MBU A;  4A38 A;  3GUX A;  2PJ6 A;  2IL4 A;  1DE4 C;  1FT7 A;  4UWJ A;  1CJW A;  4EWT A;  4MHN A;  2P0W A;  2Q0Y A;  3F5B A;  1YX0 A;  3FXT A;  3NH8 A;  2ARH A;  4R3L A;  4NGM A;  2PJ1 A;  3PBE A;  4NEX A;  2EK8 A;  2F7V A;  4UF4 A;  4MFP A;  2Q4V A;  1Z8W A;  1KUY A;  3QAH A;  1UWY A;  3WC5 A;  1YRE A;  4JZ0 A;  2Z3O A;  5EC4 A;  4OC0 A;  1VHS A;  4KOW A;  4AVC A;  2Q7B A;  4M3S A;  4GS4 A;  5CBM A;  2PJ2 A;  2ZW5 A;  3HUV A;  1AYE A;  4C7H A;  5C88 A;  2YNC A;  5C82 A;  3D3S A;  3MRU A;  4CRZ B;  2D4P A;  3B7I A;  4KSF A;  7CPA A;  3T90 A;  5DWN A;  4XPD C;  3V8I A;  3KL9 A;  4ZY0 A;  2PIZ A;  3KQX A;  2B58 A;  2AFW A;  2Q43 A;  4JXQ A;  1M1D A;  2JEV A;  4FWU A;  2REF A;  3B3S A;  2RFH A;  3I1U A;  2OZG A;  4BD9 A;  4II9 A;  5LYI A;  3JRU A;  4UEE A;  3V7Z A;  1A2Z A;  3S6K A;  2FIA A;  4MHY A;  5E96 A;  1FY7 A;  4HNY B;  2NMT A;  4NJQ A;  4NGP A;  4FD6 A;  1Z8T A;  3KR5 A;  5I0C A;  3D2P A;  2G9D A;  4R6T A;  3H5Z A;  4XPD B;  4CRY B;  5F46 A;  4ONW A;  3IWG A;  2DPT A;  4P45 A;  2B5G B;  5EMI A;  1QSO A;  2PJC A;  4ZYQ A;  2YNE A;  4A95 A;  3D7H A;  3BI1 A;  1JWQ A;  2REE A;  3S6F A;  1F2O A;  2P6E A;  3QAY A;  4PSW A;  1Z9U A;  3I9S A;  4B13 A;  4AG9 A;  5F09 A;  1ELM P;  2RB7 A;  2FE7 A;  3D68 A;  4C2X A;  5JGF A;  3PFO A;  4P4J A;  3D4U A;  2FL4 A;  3B2Y A;  3KAS A;  3TX8 A;  2VZY A;  5AG6 A;  2BCO A;  2WUU A;  4CGM A;  2IQ6 A;  2PRQ A;  1MJA A;  2ZEE A;  4B14 A;  4F0X A;  3LOD A;  1XE4 A;  1M44 A;  2BSW A;  2K5T A;  4ORF A;  3R9E A;  4RUH A;  2Z3N A;  2Z11 A;  1F57 A;  2RC4 A;  3FIX A;  3TOA A;  2I79 A;  4EME A;  4PQA A;  5LYD A;  4A39 A;  2F5I A;  3BHX A;  4F0Y A;  5HMN A;  2EWB A;  3B3V A;  3CXP A;  3QB8 A;  3DR8 A;  2YNC C;  4ZX9 A;  4F9U A;  2EO8 A;  1QSR A;  3KQZ A;  3IWW A;  4CGN A;  4EFD A;  1YVO A;  1TF8 A;  5HVG A;  4AVA A;  5K8P A;  4R87 A;  2ANP A;  1RXT A;  2Z0Z A;  4TNU A;  1I12 A;  3GYA A;  2J9A A;  3FEE A;  1Y0R A;  3DR6 A;  3TCV A;  3TE4 A;  1YLE A;  1CPS A;  3I3G A;  5ELY A;  3IGR A;  2XEJ A;  3CZX A;  4NGR A;  8CPA A;  2EUI A;  2HB6 A;  4JYW A;  3B8G A;  4CGP A;  3VWD A;  1PYT B;  3RYO A;  2PSW A;  4Y49 C;  4MCS A;  4NGN A;  5LRJ A;  4QBJ A;  3CPA A;  2J8R A;  4A2Z A;  3W6S A;  4CAV A;  2ZPA A;  2EK9 A;  1F2P A;  2CNM A;  3G3S A;  4DNC A;  5F49 A;  2KCW A;  3FB3 A;  1CBX A;  4X3R A;  4HNW B;  5LRK A;  2AFS A;  3FNC A;  4PPZ A;  5LYL A;  1IOI A;  2PJB A;  4MI4 A;  1CM0 A;  4CYQ A;  4Y49 B;  1ON0 A;  2R8V A;  4ZX8 A;  3KZW A;  4BMH A;  3DNS A;  1QQ9 A;  1S7N A;  2ABZ A;  1OBR A;  3JVN A;  4RI1 A;  2ZEP A;  5IB0 A;  4RN7 A;  2GLJ A;  2PJ0 A;  4U9Z A;  1BLL E;  1TXR A;  2BEI A;  1Y7R A;  4X5K A;  2B3V A;  4MY3 A;  1QSN A;  1Z8L A;  3LMS A;  3PGP A;  5K8N A;  4IHM A;  4QC6 A;  3FVL A;  1S7K A;  2ZW6 A;  3D7G A;  5THW A;  4CPA A;  4TWE A;  5LYF A;  4B12 A;  2HUZ A;  2OZH A;  2C27 A;  4B6Z A;  2NSM A;  4LX9 A;  1KUV A;  5K8O A;  4EVY A;  3TC8 A;  4HKF A;  2FCK A;  2GAN A;  3EY5 A;  5D8N A;  1SQH A;  5H86 A;  3SI1 A;  2Q4Y A;  3FRM A;  1S5K A;  3D7D A;  2CNS A;  3CT9 A;  4B11 A;  2PR1 A;  2O28 A;  2OB0 A;  1PCA A;  1YVK A;  4MRI A;  4OLL A;  5F48 A;  3FED A;  2DPS A;  2VZZ A;  1RO5 A;  4E2A A;  4OAD A;  4C2Z A;  3BJ8 A;  2BO9 A;  4MFL A;  5G21 A;  1ELL P;  3D2M A;  3NE7 A;  2ATR A;  2R98 A;  3PBB A;  2ZW4 A;  3IC1 A;  4C7I A;  2WSA A;  4MJ8 A;  4NSQ A;  4KOX A;  3WR7 A;  1EE3 P;  2QYV A;  2YGW A;  3NH4 A;  1IID A;  1BOB A;  3EXN A;  4W9Y A;  4F6A A;  1Q2Y A;  1CG2 A;  2B3U A;  2BUE A;  4UIA A;  4AG7 A;  4ZGY B;  1UFH A;  2JBJ A;  4BBH A;  2CNT A;  1AUG A;  2ZOF A;  1VKC A;  4MFZ A;  4AVB A;  1TF9 A;  4A33 A;  2GLF A;  1Z4R A;  1Y7E A;  1Z5R A;  2V8H A;  4A30 A;  2VQY A;  3TOB A;  1XFO A;  1NE9 A;  3KR4 A;  3IO1 A;  4ZBG A;  3NA6 A;  4MFK A;  1K4J A;  1ZLH A;  5BWA B;  4ZY1 A;  1R43 A;  3IEH A;  4L8A A;  2CTB A;  4ZI6 A;  2B4D A;  4JXR A;  4P4I A;  2FT0 A;  1Q2D A;  4P4B A;  2ZXV A;  4MFJ A;  3F0A A;  4YRH A;  3GIU A;  3DSB A;  3SJG A;  5J8F A;  3OWC A;  4R9M A;  5G20 A;  3P2H A;  4PXB A;  4CAF A;  1HDU A;  4A32 A;  4NF1 A;  1ARL A;  2QEC A;  4MFQ A;  1YSJ A;  4CYN A;  4FBE A;  1U6M A;  4NGS A;  2PQ8 A;  3N5F A;  2C1C A;  4KOV A;  3A9L A;  2PC1 A;  4IK2 A;  1HEE A;  5CPA A;  4CGO A;  2PJA A;  3PB4 X;  2V8G A;  4JD6 A;  1LFW A;  3F8K A;  1Q7L A;  1WWZ A;  1XIX A;  4IF5 A;  4UWI A;  4B10 A;  2JBK A;  3FMC A;  4CAX A;  3IIB A;  2AFM A;  2ZEO A;  4KLW A;  5J1Q A;  2D4O A;  3CXS A;  1M4I A;  3IFE A;  2FS5 A;  3FH4 A;  4PXC A;  3IWE A;  2GU2 A;  1MJ9 A;  1OZP A;  4E8O A;  5CNP A;  4NGT A;  2FVG A;  3FX6 A;  3UY5 A;  5AG5 A;  3B3T A;  1ARM A;  3PZJ A;  3R96 A;  5AG4 A;  4NJR A;  5I4M A;  3FYN A;  5HVH A;  4L89 A;  5KTC A;  2P6G A;  1NMT A;  1WK4 A;  4UIB A;  5G22 A;  3S9M A;  1XF8 A;  2XEF A;  2WZN A;  1Y9K A;  1IYK A;  1S3Z A;  4Q38 A;  4RS2 A;  2V8D A;  2FIW A;  3SHP A;  4CGL A;  1V0C A;  4FD5 A;  3VWE A;  3KGQ A;  3SJE A;  3FBU A;  4KLV A;  4MHZ A;  1BPM A;  2HC9 A;  3K9T A;  4PK2 A;  4H6Z A;  4QB9 A;  5EBV A;  4Q36 A;  5HH1 A;  4H2K A;  4KOU A;  5IV0 A;  2C6G A;  1IB1 E;  4WWV A;  3T9Y A;  2Z3L A;  4OAE A;  4OIW A;  2DF5 A;  5AGE A;  3WT4 A;  2PDO A;  3D67 A;  4CYP A;  1Z8X A;  4R76 A;  5A27 A;  4UEF A;  3TT2 A;  3W6X A;  2PJ7 A;  4OKO A;  1IIC A;  3V38 A;  4YU9 A;  1XJO A;  1XBU A;  4JLY A;  4F9V A;  1LAN A;  4YFJ A;  2Z3M A;  2B4D B;  4K3N A;  4U5Y A;  4UCN A;  5F47 A;  1M4D A;  4F8Z A;  1BAV A;  4PK3 A;  2WPW A;  3PB9 X;  4KOY A;  4LUA A;  4JWP A;  1X10 A;  4KSA A;  3MGD A;  3KHZ A;  4M85 A;  1ZLI A;  3H8F A;  1S60 A;  2AFU A;  4FD4 A;  1I21 A;  5A28 A;  5HXD A;  3BI0 A;  2AJ6 A;  1P4N A;  4GM5 A;  1Y0Y A;  4UA3 A;  1TIQ A;  1YW6 A;  2Z3K A;  3FEC A;  3IJ3 A;  4KVM E;  2G0B A;  3KKW A;  2ZEG A;  1TKJ A;  1KZF A;  3L2N A;  4UCP A;  5DWM A;  4OC1 A;  4KOS A;  4C2Y A;  1XMB A;  4A94 A;  4CS0 B;  1KUX A;  2CY2 A;  1B87 A;  4OC4 A;  4PSX A;  4X2T A;  1IYL A;  4XPK A;  2BOA A;  2Y0M A;  2CF4 A;  2OU2 A;  4P44 A;  3WC6 A;  1XOV A;  1ZO0 A;  2IJZ A;  2VI7 A;  4P4F A;  1QST A;  3D66 A;  3SI2 A;  1LOK A;  4IUS A;  2Q7S A;  3D8P A;  1XMT A;  4DJL A;  4MY0 A;  3MN8 A;  2GIV A;  3B3C A;  3C26 A;  2XEI A;  3K2K A;  3CPX A;  2ZOG A;  3NH5 A;  3S9N A;  4R8F A;  5D29 A;  3VH9 A;  2VXK A;  1YK3 A;  2ZEN A;  1VGY A;  3B35 A;  2I3C A;  4FAI A;  4K30 A;  3LWU A;  4PXE A;  4KUA A;  1YR0 A;  1PUA A;  1JQG A;  4E0A A;  1HDQ A;  5AG7 A;  4MCQ A;  4B5O A;  1DTD A;  5KTA A;  1CX8 A;  3DGV A;  2V8V A;  3GKR A;  1RTQ A;  1I1D A;  3ISZ A;  2Z3P A;  3CDX A;  3R95 A;  2CTC A;  3HLP A;  3RAM A;  4LQG A;  2GE3 A;  2Q44 A;  2O53 A;  3BXM A;  3IU2 A;  4NXY A;  4OC5 A;  2AFO A;  1ZG8 A;  1S7L A;  2WYR A;  2JEW A;  2AFZ A;  3KHX A;  4UFW A;  1X12 A;  3H8E A;  4A37 A;  2VL1 A;  1CPX A;  4MMO A;  3R9F A;  1BPN A;  2JDC A;  2R7H A;  3BJ7 A;  3DLJ A;  1PU9 A;  2QVP A;  2Q04 A;  3W91 A;  4P6Y A;  1R57 A;  1M4L A;  4WJB A;  2OR4 A;  1Z2L A;  4C68 A;  2PE3 A;  2V77 A;  2ZEF A;  4OC2 A;  2ZEL A;  4KZT A;  2G3T A;  1LAM A;  4H89 A;  2J8M A;  4M6H A;  2AE6 A;  4R3K A;  3K9U A;  4OC3 A;  3SXO A;  4Z65 A;  4YWY A;  3GY9 A;  1H8L A;  2HQY A;  1J4J A;  4P4D A;  3VAT A;  4CYO A;  3FF3 A;  1N71 A;  2C6C A;  4MXU A;  3WAB A;  2PJ5 A;  4B5P A;  3H8G A;  5G1Z A;  2I00 A;  2Q51 A;  3SXN A;  5JM6 A;  1YQE A;  2Q4Z A;  1TKF A;  3CXQ A;  4QVT A;  2DXQ A;  4UBR A;  1VHO A;  3RO0 A;  2VEZ A;  1L0C A;  5KTD A;  1IY7 A;  4Q7A A;  4M6G A;  5J8C A;  1LAP A;  2PJ4 A;  2JDD A;  2PJ8 A;  3D7F A;  4HPS A;  1LCP A;  2ZW7 A;  3SJF A;  4AXV A;  5H84 A;  2FXF A;  3RBU A;  4A31 A;  5IB9 A;  3DDD A;  5JH9 A;  4U9Y A;  4BIN A;  3B3W A;  1NSL A;  1QMU A;  2O4H A;  3PRT A;  5JPH A;  4MHD A;  2GRE A;  1GYT A;  3S6H A;  2QJ8 A;  3SJX A;  5GCN A;  3VAR A;  4CAE A;  2EVN A;  4I49 A;  1MJB A;  4IAV A;  4P4E A;  3G8W A;  4M6I A;  4CAW A;  3S9L A;  5K8M A;  2X7B A;  1AMP A;  3NFZ A;  3RNZ A;  1MK4 A;  2HV2 A;  2QML A;  4MCR A;  2C6P A;  2XEG A;  4DUK A;  4NCZ A;  3PB7 X;  2PJ9 A;  4FUU A;  3R9G A;  4X8I A;  2ZEH A;  4KVX A;  4G1P A;  4XNH C; 
#chains in the Genus database with same CATH homology
 1Y9W A;  3TTH A;  1Z4E A;  5FVJ A;  3IU1 A;  3E0K A;  1BO4 A;  1LRZ A;  4KOT A;  2B4B A;  4FD7 A;  1S7F A;  2OZU A;  2QIR A;  4XNH B;  4KVO E;  4YGO A;  3TO7 A;  3LD2 A;  1YGH A;  2FSR A;  5JQ4 A;  3TO6 A;  5ISV A;  4XPL A;  1QSM A;  2R1I A;  2H5M A;  4KS9 A;  3H4Q A;  3R1K A;  1Q2C A;  4B5P B;  4QUS A;  2JLM A;  3PP9 A;  4R57 A;  3BLN A;  3JUW A;  2PR8 A;  2YND A;  4HNX B;  3TO9 A;  4H6U A;  1GHE A;  4J3G A;  1M4G A;  2WPX A;  2OH1 A;  2VBQ A;  2Z10 A;  3EFA A;  4JJX A;  3ZZI A;  1P0H A;  2B5G A;  2CXA A;  3P2F A;  4UFX A;  4AB7 A;  4UFV A;  3TFY A;  3JTK A;  1XEB A;  2BL1 A;  3N7Z A;  2P6F A;  4ONU A;  3EO4 A;  4PV6 A;  4KUB A;  5IX3 A;  2A4N A;  4KOR A;  1B6B A;  3ZJ0 A;  3S6G A;  2J8N A;  2G3A A;  2PRB A;  3EC4 A;  4UCM A;  4MBU A;  2IL4 A;  4UWJ A;  1CJW A;  2P0W A;  2Q0Y A;  3F5B A;  1YX0 A;  3FXT A;  2ARH A;  4R3L A;  4NEX A;  4MFP A;  2Q4V A;  1KUY A;  3QAH A;  1YRE A;  2Z3O A;  5EC4 A;  1VHS A;  4KOW A;  4AVC A;  2Q7B A;  4M3S A;  4GS4 A;  2ZW5 A;  4C7H A;  5C88 A;  2YNC A;  5C82 A;  3D3S A;  4CRZ B;  2D4P A;  4KSF A;  3T90 A;  5DWN A;  4XPD C;  3V8I A;  2B58 A;  4JXQ A;  1M1D A;  2JEV A;  2REF A;  4II9 A;  2OZG A;  3S6K A;  2FIA A;  5E96 A;  1FY7 A;  4HNY B;  2NMT A;  4FD6 A;  5I0C A;  3D2P A;  4CRY B;  4XPD B;  3H5Z A;  5F46 A;  3IWG A;  2DPT A;  2B5G B;  1QSO A;  2YNE A;  4A95 A;  2REE A;  3S6F A;  2P6E A;  4B13 A;  4PSW A;  1Z9U A;  3I9S A;  4AG9 A;  2FE7 A;  4C2X A;  2FL4 A;  2VZY A;  5AG6 A;  4CGM A;  2WUU A;  1MJA A;  4B14 A;  4F0X A;  3LOD A;  1XE4 A;  1M44 A;  2BSW A;  2K5T A;  4ORF A;  3R9E A;  2Z3N A;  2Z11 A;  2RC4 A;  3FIX A;  3TOA A;  2I79 A;  2F5I A;  4F0Y A;  5HMN A;  3CXP A;  3QB8 A;  3DR8 A;  2YNC C;  1QSR A;  4CGN A;  1YVO A;  4AVA A;  4R87 A;  1RXT A;  2Z0Z A;  1I12 A;  3GYA A;  3DR6 A;  3TCV A;  3TE4 A;  1YLE A;  3I3G A;  3IGR A;  2EUI A;  3B8G A;  4CGP A;  3VWD A;  3RYO A;  2PSW A;  4Y49 C;  4QBJ A;  2J8R A;  4A2Z A;  3W6S A;  4CAV A;  2ZPA A;  2CNM A;  3G3S A;  4DNC A;  5F49 A;  2KCW A;  3FB3 A;  4HNW B;  3FNC A;  4MI4 A;  1CM0 A;  4CYQ A;  4Y49 B;  1ON0 A;  2R8V A;  4BMH A;  3DNS A;  1S7N A;  3JVN A;  4RI1 A;  5IB0 A;  4U9Z A;  2BEI A;  1Y7R A;  4X5K A;  2B3V A;  4MY3 A;  1QSN A;  3PGP A;  4QC6 A;  1S7K A;  2ZW6 A;  4B12 A;  2HUZ A;  2OZH A;  2C27 A;  4LX9 A;  1KUV A;  4EVY A;  4HKF A;  2FCK A;  2GAN A;  3EY5 A;  1SQH A;  5H86 A;  2Q4Y A;  3FRM A;  1S5K A;  2CNS A;  4B11 A;  2PR1 A;  2O28 A;  2OB0 A;  1YVK A;  4OLL A;  5F48 A;  2DPS A;  2VZZ A;  1RO5 A;  4E2A A;  4OAD A;  4C2Z A;  3BJ8 A;  4MFL A;  5G21 A;  3NE7 A;  3D2M A;  2ATR A;  2R98 A;  2ZW4 A;  4C7I A;  2WSA A;  4MJ8 A;  4NSQ A;  4KOX A;  3WR7 A;  2YGW A;  1IID A;  1BOB A;  3EXN A;  4F6A A;  1Q2Y A;  2B3U A;  2BUE A;  4AG7 A;  4ZGY B;  1UFH A;  4BBH A;  2CNT A;  1VKC A;  4MFZ A;  4AVB A;  4A33 A;  1Z4R A;  4A30 A;  2VQY A;  3TOB A;  1NE9 A;  4ZBG A;  4MFK A;  1K4J A;  5BWA B;  4L8A A;  2B4D A;  4JXR A;  2FT0 A;  1Q2D A;  2ZXV A;  4MFJ A;  3F0A A;  4YRH A;  3DSB A;  5J8F A;  3OWC A;  4R9M A;  5G20 A;  3P2H A;  4CAF A;  4A32 A;  4NF1 A;  2QEC A;  4MFQ A;  4CYN A;  1U6M A;  2PQ8 A;  4KOV A;  3A9L A;  2PC1 A;  4CGO A;  4JD6 A;  3F8K A;  1XIX A;  1WWZ A;  4IF5 A;  4UWI A;  4B10 A;  4CAX A;  4KLW A;  2D4O A;  3CXS A;  1M4I A;  2FS5 A;  3IWE A;  1MJ9 A;  1OZP A;  4E8O A;  5CNP A;  3UY5 A;  5AG5 A;  3PZJ A;  3R96 A;  5AG4 A;  3FYN A;  4L89 A;  5KTC A;  2P6G A;  1NMT A;  1WK4 A;  5G22 A;  1XF8 A;  1Y9K A;  1IYK A;  1S3Z A;  4Q38 A;  4RS2 A;  2FIW A;  3SHP A;  4CGL A;  1V0C A;  4FD5 A;  3VWE A;  3FBU A;  4KLV A;  4PK2 A;  4QB9 A;  4H6Z A;  5EBV A;  4Q36 A;  5HH1 A;  4KOU A;  5IV0 A;  1IB1 E;  3T9Y A;  2Z3L A;  4OAE A;  5AGE A;  2PDO A;  4CYP A;  5A27 A;  3TT2 A;  3W6X A;  1IIC A;  4JLY A;  4YFJ A;  2Z3M A;  2B4D B;  4U5Y A;  4UCN A;  5F47 A;  1M4D A;  4PK3 A;  2WPW A;  4KOY A;  4LUA A;  4JWP A;  4KSA A;  3MGD A;  4M85 A;  4FD4 A;  1S60 A;  1I21 A;  5A28 A;  2AJ6 A;  1P4N A;  4UA3 A;  1TIQ A;  2Z3K A;  4KVM E;  2G0B A;  3KKW A;  4UCP A;  1KZF A;  5DWM A;  4KOS A;  4C2Y A;  4CS0 B;  1KUX A;  2CY2 A;  1B87 A;  4PSX A;  1IYL A;  4XPK A;  2Y0M A;  2OU2 A;  1ZO0 A;  2VI7 A;  1QST A;  4IUS A;  3D8P A;  1XMT A;  4MY0 A;  2GIV A;  3C26 A;  2VXK A;  1YK3 A;  4K30 A;  4KUA A;  1YR0 A;  1PUA A;  4E0A A;  5AG7 A;  4B5O A;  5KTA A;  3GKR A;  1I1D A;  2Z3P A;  3R95 A;  2GE3 A;  2Q44 A;  3IU2 A;  4NXY A;  1S7L A;  4UFW A;  3R9F A;  2R7H A;  2JDC A;  3BJ7 A;  1PU9 A;  2Q04 A;  3W91 A;  1R57 A;  4C68 A;  4KZT A;  2G3T A;  4H89 A;  2J8M A;  4R3K A;  2AE6 A;  3K9U A;  3SXO A;  3GY9 A;  2HQY A;  1J4J A;  4CYO A;  1N71 A;  4B5P A;  5G1Z A;  2I00 A;  3SXN A;  4QVT A;  3CXQ A;  2DXQ A;  4UBR A;  2VEZ A;  1L0C A;  5KTD A;  5J8C A;  2JDD A;  2ZW7 A;  5H84 A;  2FXF A;  4A31 A;  3DDD A;  4U9Y A;  1NSL A;  5JPH A;  4MHD A;  3S6H A;  5GCN A;  4CAE A;  2EVN A;  4I49 A;  1MJB A;  3G8W A;  4CAW A;  2X7B A;  1MK4 A;  2HV2 A;  2QML A;  4NCZ A;  3R9G A;  4KVX A;  4XNH C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...