2V8VA

Crystal structure of mutant r322a of beta-alanine synthase from saccharomyces kluyveri
Total Genus 147
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
147
sequence length
435
structure length
435
Chain Sequence
b'LNLPAAAPLSIASGRLNQTILETGSQFGGVARWGQESHEFGMRRLAGTALDGAMRDWFTNECESLGCKVKVDKIGNMFAVYPGKNGGKPTATGSHLDTQPEAGKYDGILGVLAGLEVLRTFKDNNYVPNYDVCVVVWFNEEGARFARSCTGSSVWSHDLSLEEAYGLMSVGEDKPESVYDSLKNIGYIGDTPASYKENEIDAHFELHIEQGPILEDENKAIGIVTGVQAYNWQKVTVHGVGAHAGTTPWRLRKDALLMSSKMIVAASEIAQRHNGLFTCGIIDAKPYSVNIIPGEVSFTLDFAHPSDDVLATMLKEAAAEFDRLIKINDGGALSYESETLQVSPAVNFHEVCIECVSRSAFAQFKKDQVRQIWSGAGHDSCQTAPHVPTSMIFIPSKDGLSHNYYEYSSPEEIENGFKVLLQAIINYDNYRVIRG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BETA-ALANINE SYNTHASE
publication title Crystal Structures of Yeast -Alanine Synthase Complexes Reveal the Mode of Substrate Binding and Large Scale Domain Closure Movements.
pubmed doi rcsb
source organism Saccharomyces kluyveri
molecule tags Hydrolase
total genus 147
structure length 435
sequence length 435
chains with identical sequence B, C, D
ec nomenclature ec 3.5.1.6: Beta-ureidopropionase.
pdb deposition date 2007-08-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01546 Peptidase_M20 Peptidase family M20/M25/M40
A PF07687 M20_dimer Peptidase dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.360 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2v8vA02
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 2v8vA01
1VIXA 3B3SA 4P4FA 4F9UA 2V8HA 4MMOA 2JBKA 7CPAA 1LAMA 1AYEA 4NJRA 5K8MA 4P45A 1BPNA 2ZOGA 4F9VA 4ZYQA 2AFXA 4W9YA 1KWMA 2C1CA 3NH8A 4MCRA 5LYIA 4YWYA 2PIYA 1R43A 4UEEA 4Z65A 4G1PA 5K8NA 3PFEA 2ZEPA 4CPAA 4B6ZA 6CPAA 1XBUA 1YLOA 1Q7LA 1TKJA 1M4LA 5HVHA 2NYQA 4UIBA 4R8FA 1ELLP 1IGBA 5K8OA 5HVFA 2XEFA 3BI1A 2IMOA 2AFZA 3CPAA 2I3CA 5LYLA 3FF3A 3KHZA 4PXDA 3L2NA 1ZG9A 3D68A 2PJCA 2ZENA 4A37A 4FBEA 1FNOA 3SJFA 4FUUA 4PXBA 4P10A 4OKOA 1XJOA 3D66A 2ZOFA 3HLPA 1TXRA 4AXVA 1ARMA 3WT4A 4NGNA 3H8FA 1RTQA 4ZX8A 5J1QA 1FT7A 3PBEA 3S9LA 5CBMA 3KL9A 1ZLIA 4WWVA 3WABA 1PCAA 5ELYA 3CPXA 1HDUA 2ZEHA 3NFZA 3PB4X 4OC0A 3K2KA 4ZX9A 4FWUA 2F8HA 4OIWA 3KQZA 4ZI6A 4IK2A 3KR5A 2DEAA 4MXUA 3SI0A 3VARA 2EK8A 2V8DA 4DJLA 3NH5A 4PQAA 2OOTA 1JQGA 1Z8LA 3IFEA 4MHZA 4MCPA 4UIAA 4OC5A 3IC1A 3N5FA 3RBUA 5LYDA 1OBRA 1QQ9A 1LCPA 1CP7A 2GU2A 4FAIA 2POKA 4OC4A 1ZLHA 5LRGA 3PB9X 3NH4A 4P4JA 1ARLA 4MCSA 2Q51A 4IAVA 2ZEOA 1F57A 1Y0YA 2PJ6A 4P4BA 1TF9A 8CPAA 3IJ3A 2ZELA 2C6CA 1CBXA 2C6GA 4ZY0A 3BHXA 3SJXA 2EWBA 2ABZA 1VHEA 2BO9A 2CIJA 4WJBA 4MRIA 4PPZA 4P4EA 2PJ7A 3IWWA 3FJUA 3TX8A 4R6TA 4P6YA 3B3CA 3PRTA 4MHYA 1CPXA 3B2YA 3VH9A 2F7VA 1XFOA 3D7GA 1Y7EA 3B3TA 2AFOA 3B3VA 2WZNA 3WC7A 2VL1A 3PFOA 4DUKA 4OC2A 3SJEA 5K8PA 1BAVA 2IQ6A 5LRKA 4DYOA 3CDXA 3KHXA 3DLJA 3GB0A 3H8EA 3D7HA 4TWEA 4RUHA 3H8GA 5HVGA 4NJQA 3FX6A 4ONWA 3D67A 5D8NA 3LWUA 3JRUA 1R3NA 2ZEFA 3I1UA 4X3RA 2AFWA 3KR4A 4OP4A 3KGQA 2RFHA 3S9NA 1NSAA 1CX8A 2NSMA 2HB6A 3KASA 1CP6A 2V8GA 4NFRA 4EFDA 1Z2LA 2ZEDA 2ZEEA 1TF8A 2WYRA 4NGMA 4PXEA 2XEGA 3B35A 3BXMA 5D29A 3KI9A 4YU9A 5F09A 2QJ8A 2GREA 3IO1A 5JM6A 4A94A 2PJ5A 4P4DA 1ELMP 2PIZA 1TKFA 4OC3A 3IIBA 1GYTA 4GM5A 1AMPA 2PCUA 3LMSA 3DGVA 3KQXA 3WC6A 5HXDA 4NGRA 3B3WA 2J9AA 2ZEGA 3WC5A 4ZY1A 3PEIA 4PXCA 3GUXA 2OR4A 1TKHA 4UEZA 5THWA 5JGFA 4JZ0A 2ZEMA 3FH4A 1DE4C 1QMUA 5LRJA 4K3NA 2HC9A 2V77A 1PYTB 3D7FA 1YW4A 3SI1A 2ANPA 3RZAA 2AFUA 2PJ9A 1HDQA 1HEEA 2G9DA 3KZWA 1YW6A 3PB8X 4X2TA 4JYWA 4Q7AA 1YMEA 1Z5RA 2PJAA 1BLLE 4R76A 4OC1A 4OIDA 2PJ1A 2CF4A 1ZG7A 4UEFA 5DS0A 4NGSA 3CT9A 2GLFA 2CTBA 3PB6X 1ZG8A 1VHOA 2PJ2A 3ISZA 2PVWA 3D4UA 1H8LA 4EWTA 1CPSA 5JH9A 2PJ3A 3FVLA 1YSJA 2JBJA 3FEEA 3MN8A 1EE3P 4LQGA 3SI2A 2EK9A 2BOAA 2Q4ZA 3FEDA 2FVGA 4F8ZA 2JEWA 4A39A 1DTDA 4NGTA 4A38A 2O4HA 3MRUA 2PJ4A 4MHPA 2QYVA 3FMCA 3K9TA 4P4IA 1XRYA 4ZY2A 2PE3A 3GLJA 2V8VA 3RAMA 3B7IA 4EMEA 2CTCA 5IB9A 3V7ZA 3IEHA 2AFMA 1IY7A 4MCQA 4NGPA 2BCOA 3S9MA 3PB7X 3D7DA 4UF4A 1LOKA 1LANA 1UWYA 4IHMA 4TNUA 2PRQA 3NA6A 4BD9A 1XMBA 3T8WA 2PVVA 4OMEA 4P44A 1LAPA 3V38A 2AFSA 2O53A 1BPMA 3TC8A 1F2OA 3VATA 2PJ0A 5I4MA 1F2PA 3HUVA 4NGQA 2PJ8A 1LFWA 4KSIA 3ISXA 3PBBA 2XEIA 3BI0A 2RB7A 1Y0RA 2IJZA 4X8IA 2QVPA 2C6PA 4H2KA 3QNVA 4R7MA 3SJGA 1VGYA 2Q43A 4O23A 5LYFA 5CPAA 2GLJA 2XEJA 1CG2A 2PJBA 3FECA 4MHNA
chains in the Genus database with same CATH superfamily
4X84A 3V6DA 1K9MT 2ZH5A 4OLPA 3MOJB 3M2RA 1LAMA 5K8MA 1NK4A 4TQRA 4C48A 3HFKA 1LXJA 2CNTA 1WF0A 5MLCV 3UCUP 4WF9Q 1RU2A 3ZTPA 2Z10A 4HNYB 2V2QA 3W3SA 3PYEA 4G1PA 5I3QA 4IFVB 1ZM2A 4WYLA 3VCDA 2NUHA 3M8SA 2QN6B 2UUCJ 4NSQA 3BPDA 5ETNA 4CLWA 2PSWA 1Q82T 3EVMA 5HSPA 2VF3A 2UU9F 1RABB 1RT4B 4NASA 1TZ0A 3DOMA 1HNWF 2N7CA 2YWFA 3J81j 2B9EA 4OI6A 1NK5A 1NO8A 4FZVA 4P10A 3PYFA 3D66A 4ZN1A 4QC6A 2BL1A 5ETSA 2AZ3A 4ZPCA 4Y2KA 5HATA 4UFXA 5D15A 1VBKA 4QWDA 3BGUA 1OQ3A 2KYXA 4LF5F 4C97A 4U5YA 2Z4PA 1FRLA 1DTTB 1B4SA 2UVUA 3KNAA 2B7CB 2V4JA 1CJWA 4J9QA 3Q83A 5LOQA 1A0OB 3FRZA 4DZ6A 3HXMA 2R7QA 1YQEA 4KOXA 4DJLA 1FXRA 3KKFA 1U1LA 4WK1A 5T7LA 2GQQA 4MCPA 3VZIA 4DL5A 1MSWD 4I4BA 4DMZA 2J7KA 2RVJA 2LKZA 2BZ2A 4DL6A 3DSBA 3LALA 3HT3A 2POKA 4O4GA 2B4BA 1ZLHA 5GAHU 2ATLA 4HH0A 3K5NA 1PYSB 2AHOB 5B0AA 2QX0A 4L8AA 2ZNYA 2DY9A 4DF8A 1VHEA 3CDEA 1KEKA 2BXJA 3FFIB 1F5AA 1MWYA 2V50A 2ZFHA 4WFXA 2FE7A 1BLUA 5F0WA 3BBBA 1Y00A 4Y0FA 5AG5A 3CMQA 4CO3A 2XCAA 3B3TA 3BPSP 1KBRA 4RBTA 4UUWA 5KT6A 1A6LA 4JB8B 3CNQP 4L6V3 3RAQA 5BR8F 3EPIA 1IXKA 3PP9A 4CT8A 2AGQA 4OJ3A 3IRXB 2I38A 1X5TA 3DLJA 3CCZA 2FS5A 1DAXA 3U1LA 3GPAA 4Q2MA 3D7HA 5M2UA 1IR1A 1MU2A 1W25A 2RD5C 3HI9A 1WUUA 3GG0A 5IC4B 5KG7A 4DR4F 4Y49C 1HHSA 1ZYQA 4JWPA 1XEZA 3WC0A 3V6HA 1S1XB 2RQMA 5KFLA 1R8BA 5M2RA 3SV3A 1VC0A 1CQMA 3KR4A 3KHLA 3CD7A 3GSIA 4Y49B 5EHHA 4NXMF 3UE2A 3VZHA 5DG8A 1KKHA 2WW4A 1SKRA 4HT5A 2MJUA 4NLYA 2X1BA 3MGJA 1D9AA 3EUNA 5E7OB 2QYCA 8RUCA 4QWEA 3SEOA 1CJKB 1VC5A 4NGMA 2OH1A 1L5UA 2HVDA 3ILIA 5F47A 3ITHA 2GREA 3LP1B 2HVEA 2PJ5A 2JFDA 2KRBA 5A6PA 2AYGA 2PIZA 1DURA 1FKOB 3MEEA 1SH2A 2Z3MA 2FVPA 4B9LA 1WEXA 4NZ0A 1S99A 4ICLB 3RYOA 3N9UC 1Q2YA 3MEDB 2J76E 4B02A 4E8OA 1NU4A 2VD3A 2RRAA 4PG5A 4P71A 5KT7A 1DE4C 2QA2A 4Q8FA 1NLKL 1YZ7A 5IOLA 3D5MA 4I2QB 3EGZA 2YNDA 1K0VA 3TAQA 1PG5B 4BINA 3CCTA 2VZYA 4K7QA 2ALYB 2BJEA 1S57A 2H1YA 1LW2B 3CT9A 2Z0GA 1D0EA 4TN2A 4B13A 1UPMB 2MZQA 3ISND 2CVIA 5J1NA 1I94F 2AYMA 2XS7A 2Q66A 2YTCA 1P9QC 3DI6A 4Q5VA 4F8ZA 3ET6B 3JQKA 2JEWA 5KFUA 2BM0A 1NAQA 4U7CA 2VIHA 3T9ZA 2MDAA 2PJ4A 1PIEA 2ZUGA 4KLWA 4K0KF 3JQJA 1SKWA 3NMRA 2FZGB 5AG4A 2RDJA 3BGLA 2CTCA 2UVWA 2NXEA 2RDIA 4X4UA 4YDXA 1I5OB 4ECWA 3OLAA 3N0VA 1TUWA 4WXOA 3I0SB 3HD2A 3HP6A 4BD9A 1PKUA 2L48A 2RMLA 3O3LA 1RT6A 3AFGA 1X12A 2LDYA 5GAEI 4B9MA 1BPMA 1M4GA 5KAKA 1TL1A 1F2PA 1PAUB 1Y3KA 2CAJA 1HWJA 2ALZA 1Y0RA 1RGVA 4E0AA 3D54A 5KT2A 1IICA 4Y2IA 2GLJA 1N32F 2HQGA 2G1DA 1JLBA 4OYAA 2MKYA 2PDOA 1U09A 2Y8YA 4MMOA 2Z8QA 1AYEA 4C11B 5G21A 4KHPF 3MAHA 2CJAA 4R3LA 3JTPA 4KLVA 2E66A 5FLXY 1GX6A 2YWWA 4CIOA 5HH1A 1V0CA 5FLXU 4P7VA 3KKWA 5LYIA 4Q0BA 3QSYB 4LVNP 4N5SA 5CZVA 2ZWPA 2DD8S 3P8BB 1WG1A 1HQEB 1HPZA 6CPAA 1EETB 1Q7LA 4XPLA 1U6ZA 3TYTA 2XEFA 4CYQA 1P27B 2UV8A 2WRMA 2JC1A 2PI4A 2I3CA 4BMHA 2CQHA 1TR0A 5ETTA 1P6TA 5EBVA 1XMQF 2EUIA 4LQ3A 4PXBA 1S97A 2LLZA 3CO9A 3G87A 4F67A 4MFKA 2VA3A 3NCPA 4IUFA 1SL0A 3HLPA 1O8BA 3QFHA 4F4YA 4OADA 3R9GA 4EU0A 3HHLA 2VHGA 2A2CA 3KFWX 4NLVA 4O4RA 2WB4A 3W2VA 2J0XA 4DR6F 2QEXS 2J0SD 3PB4X 1QLNA 1J5OA 4ED8A 2R7OA 2BA9A 4KTQA 4ZVQB 3W1YC 3B82A 4LF4J 2V8DA 3DYAB 4NZ7A 3TOAA 2OELA 3M8QA 2OPRB 3C15A 3POTB 3BGOP 5C5JA 4MYUA 3HPOA 4YMEA 1S6OA 3K59A 3OXGA 4F2SA 1U45A 4ILRA 5IQQA 1IOFA 1OPZA 5GAEU 1Y0YA 4P4BA 4NXNF 1TF9A 2HFOA 2LQ8A 2Z3LA 3L95X 2HWTA 3K5PA 2HWHA 2XM3A 3PZJA 2ASLA 1S0OA 3IR5B 2VH7A 3BLNA 1XIQA 2G4BA 3VGVA 3C16B 1IWAA 3P49B 4JI6F 2QIFA 5KOWA 2N82B 2EVZA 2LXIA 5C7PA 3V4MA 2VL1A 1FK9B 4CRJA 3ISNC 3Q8QB 2IQ6A 3ZC4A 1FD2A 1K1SA 3VAMA 3ZZIA 3JS9A 1CULB 4Z2XA 3R27A 1KUXA 4LRDA 3PGPA 3TUZC 4FD7A 3GB0A 4P75A 1K0TA 3H7HB 5LMNJ 2G0CA 3CXPA 3U7JA 5CCMA 5KFTA 4DLGA 4YGOA 1L3KA 4KSEB 2QLBB 3DOKA 4G3IA 2CPXA 2IAJB 3UR0A 3SFUA 2K06A 2XY6A 2UUAF 5SUHA 2NXUA 2DNYA 4LQ9A 4CYOA 5HQMA 1F9HA 6AT1B 1UP1A 4P2SA 4XK8C 2KM8C 1N36J 3G4SS 1XNRJ 4MH8A 5KG4A 3W9HA 1NPRA 2MY7A 3MTKA 3DRPB 5D6GA 1HMVA 3P45B 1UFWA 3O6QA 4CLZA 3HULA 5A8RA 2KM8B 1SJ1A 2OGUA 5JM6A 5HQ8A 1NKEA 2I0XA 3EPGA 1GMVA 1TK0A 4D3HA 4NGRA 2LQJA 3OL8A 1U1OA 1RTJB 3FB3A 2F40A 1PBUA 4AFFA 1RTDA 4OAEA 3M05A 4YOEA 1F5BA 3L3CA 4HR2A 2ZH8A 3QO9B 2DR7A 4F0YA 1BHNA 4DR1J 3K2YA 4DU7A 2ANPA 3A8EA 5C42B 1WTFA 2KU7A 2JRSA 1UEKA 2LEBA 4B5OA 5KG0A 2H5JB 1URNA 2IM1A 2RU9A 4K2JA 2MGZA 2R7VA 3FCVA 4RS2A 3UNYA 1KVIA 3GIMA 1F2HA 2YBVA 2J5AA 2DBBA 3PHEA 5KFNA 4YR3A 4TQSA 2JBJA 1RU1A 4DR2J 2B5JA 5L1JA 3N6MA 1F3VA 2BOAA 1Q1KA 3FEDA 3PO4A 3KTQA 4KQZA 3AHPA 3HVAA 4DFPA 3F41A 5J8FA 4XDDA 4IH7A 4I0WA 3CE8A 3MRUA 5GMEA 3TOQA 4K4SA 2G2YA 3UDVA 3H4QA 1NRKA 1ZTWA 4PK3A 4MCQA 1S9GB 1ZZFA 2DKOB 2BCOA 4GO5X 4EI2A 2NSBA 1QVGR 1HBOB 3AH6A 3MUTP 1UWYA 4B3TF 2UXCJ 2BE2A 1NJIT 1RJJA 1R89A 4LSZB 1NK8A 1LAPA 4KGXB 2B9XA 4NYPA 5A8KA 5I4MA 2ZW7A 1NPPA 4NI2A 2ZDOA 4A4JA 3CCRS 4Y28C 4LF9J 1IBKF 2VDHA 1NJZA 3V81B 1F60B 4G6VB 3SXOA 5IB0A 2OFGX 3N5BA 4R7MA 2VONA 1NJYA 2XEJA 2M5YA 2OEJA 3IS9B 3OTEA 2GIRA 4IRDA 2HRUA 3BV8A 5JVHQ 4P6QA 4RW4B 1S9EA 4P45A 2AEJA 5IM0A 1JLEA 3G6YA 3OR1B 1YJWS 3DNSA 3AQPA 1XQIA 2AFXA 4MCRA 3MF5A 3I4PA 3AAWB 1CJTB 2F65A 5HLFA 1C1BB 3W64A 2KZMA 2YKMB 2KFZA 2QECA 5J2PB 4ZJOA 3GFHA 1RTIB 2ZEPA 3GIRA 4PWDA 3H59A 3NMAA 3OHAA 4PWUA 4NA3A 1IGBA 3V6DB 5F8LA 2E5LF 4DV6J 3TNVA 3M2RB 5LYLA 1S7LA 1DLOA 4HL9A 5L1KA 1KD1T 4EBDA 4ZPDA 4ECQA 4FYXB 4LF8J 2H5IB 1N33F 3CCVS 2AJ0A 3TARA 1D3WA 4PWWA 4QR1A 5CYJA 2DR8A 3TI0A 4M6GA 3CPXA 4UOFA 3EC4A 3TA1A 3LH2S 5A6WA 3W66A 3H98A 2F8HA 1HD1A 2OO4A 3DOMB 1FERA 2B43A 3I87A 4C0HA 1OZPA 2DEAA 5L38A 3EM1A 3J7Z5 2V8PA 3VARA 1BQNA 2H4YB 1Z8LA 3RBUA 4NLRA 3M9NB 4J9RA 3OSNA 4YRHA 3TJ8A 4QCLA 5IQ6A 2V9WA 2CQ4A 4Y6IA 4JI0F 2HRTA 2N3LA 2E44A 2NLWA 4X4OA 4CRYB 3R96A 7FD1A 2V4JB 2V67A 2BO9A 1XTZA 3US5A 3TX8A 4R6TA 2X1FA 3IGVA 3PW0A 5T7LB 2R2SA 2DNPA 2J7WA 1Y7EA 4AVAA 4ZMMA 1TKZA 3QWPA 4O4GB 2MKKA 2N3OA 2OUGA 1L3TA 4WXWA 2WVEA 4WP9A 3JTOA 4DYOA 3I96A 1IKXA 1VHFA 1X4CA 1YJUA 2C2ZB 4CLLA 2DY1A 1VQPS 1VK8A 4FPIA 2BANA 4MK7A 2ATRA 4DSLA 1WKLA 4O3NA 1YX2A 1TIQA 2M3DA 2GCFA 2KJVA 3I1UA 2X7BA 1KSPA 2NMTA 5JMNA 2RE1A 1TL5A 3NCRA 1IB1E 2JFKA 4C98A 2J8AA 4KIAA 1KUVA 1VQ8S 3BZQA 1LKZA 3HHLD 2HQIA 2Z2YB 4L75A 2E5JA 2I8EA 1I12A 4CNZA 3QZ8A 4C3MA 5F09A 2PDAA 1HW8A 4PV6A 1MU2B 2GQCA 4LMZA 1GT8A 3D2MA 1S5KA 5DETA 1SQFA 2YGWA 3E8OA 4C8MA 1FVSA 2K2PA 1OMSA 2ZW4A 3THPA 3GV7B 3GR0A 2DXFA 2W9BA 4PZVA 2KDOA 2C2DA 2WBRA 2ZH4A 4NLSA 1SV5A 2HHPA 1UEUA 3BQ1A 1PJ5A 4QZVB 3GUXA 3K5MA 2Q7SA 1UCNA 5CYMA 2CNNB 4R57A 4U67Q 3BGRA 4MY0A 1LK7A 4N8OA 3SI1A 4C4WA 1WDDA 1FD8A 2PJ9A 3PR5B 3KG0A 4NZ6A 3ITHB 2HHVA 3QJPA 3FJ2A 3GIKA 4OIDA 2DJWA 2Y1LB 3AJ1A 1HYSA 1M5PC 5C2GA 2CNSA 4ZPWR 1VHOA 1P8GA 4PPDA 3MEEB 3FEXB 3R97A 2IC3A 2XYGB 4M95A 1SCJB 3SI2A 1TAQA 4C8ZA 1C0UA 1YK3A 3NNHA 4X62J 1EQ0A 3HVWA 1LOUA 1ZM3A 4OJHA 2FDNA 4KS9A 3C26A 4ZY2A 2NPIA 3QGGA 1NPKA 1WOSA 2ZUAA 3SYZA 2CPDA 1Y9OA 2X51A 3V7ZA 3C6TA 2BKNA 2GO9A 3FQKA 5HQLA 2O5DA 4JBCA 2MJNA 1W7WA 4K8RA 4UF4A 3ZZRA 4PQUA 3NA6A 2E9RX 2DR5A 5B0BA 4P44A 1QAIA 2HZVA 1M1HA 3DI6B 4K5SA 3UDCA 2XYPB 3SDEA 3NCQA 1YJVA 2R8GA 2ACMA 4DV5F 1LFWA 1VRTA 1B3TA 2GVDA 3I9ZA 4DR3J 3A3NB 3UI3A 2I1RA 2HHHF 4RW9A 3C19A 2CVEA 1O5JA 1FEHA 4OX9J 1F1BB 1Y9KA 1NKBA 3FECA 3A8JA 1T9WA 5B08A 2XMAA 4LFBJ 4JI2F 2GMHA 1RKIA 2VI7A 4DL0C 2HEKA 1RT6B 4FF2A 1WF1A 1R6YA 2BE9B 3UWTA 2V5HG 4RNHA 4YQWA 1TL1B 3OXLA 3NE7A 4IRCA 4OHWA 2WVBA 4JV0A 3MXHP 3D0IE 3BSNA 1MWZA 1YLOA 2ZBIA 3CVKA 4QIGA 4OHZA 1JLBB 4UOGA 1T7PA 4QB9A 4DR7F 2G3TA 4CAVA 3CXCR 3LGMA 3FMWA 2CYYA 4C7IA 3D68A 2AD9A 4KZTA 3I5CA 4FBEA 1MK4A 4KFBA 4BC9A 1FRHA 4PG8A 1JKHA 4Q0BB 2VKZG 5F46A 2KHDA 3GILA 1IOIA 1RTQA 2DPJA 3QAUA 2JEGA 3HT0A 2WZ1A 2VXKA 1LFPA 4M5NA 3RB4A 4JI3F 1HPZB 2VPYB 3MR3A 3DFEA 4ZVGA 1Q7LB 2X3DA 2XB2D 2PFFB 3GWCA 5F48A 4YN3B 4UY8T 1HNIA 4ZVHA 1FEEA 1HI0P 3HHLC 1WKJA 2AJ1A 2UU9J 3CD5A 1NSKL 3IC1A 1HNWJ 3R6LB 1CJUA 3HHLB 1NZAA 1RADB 1BC6A 4Y00A 2MZ1A 2UUTA 3HDSA 4JXQA 5C82A 3TVYA 3W2VB 5JJBA 2P6SA 3LF0A 4OYIA 3PX4A 4N77A 1ZPWX 1JXEA 2PJ6A 4M5LA 2AE6A 1J5OB 2MLZA 1URRA 4LF5J 3FC9A 4WJBA 1U8SA 4BWMA 3OBIA 3BGFA 2J8MA 4A33A 5B0GA 4USIA 2X7IA 4CH0S 4Y65A 3BJ7A 3M8QB 1PJ7A 3SZ2A 3C15B 4RZRA 3DNCA 2PMZD 2MQ8A 3AQOA 4H4OA 3QRRA 2E7XA 4LF2A 1QVFR 1VLOA 2XLKA 4U95A 3F8KA 3OD2A 4OC2A 4TYAA 3MECA 5KFWA 1U6FA 3NXZA 1SI9A 1Q8LA 5KFDA 3KHXA 3TEHB 2FJVA 3TVKA 4FVCA 2CQPA 3MM7A 3FKBA 1RT7A 2KVIA 5KG2A 4A8OA 4M85A 1NSQA 2CG4A 1TP7A 2FCKA 4DS5A 1M5OC 1WKKA 2DGXA 1SUQA 2F8EX 2BJDA 1AB8A 3I55S 2BUEA 2BKOA 3KGQA 5JPHA 1YJ9S 4DL3A 1MJAA 2HB6A 2B58A 2DNNA 1H38A 1APSA 4OYOA 4JI1F 4CZCA 3AXKA 2PQ8A 2Q4YA 5BR8J 5F8NA 2XEGA 2HQCA 1MNEA 5H86A 4UZBA 4F0XA 3R2DJ 2FVQA 1JIHA 2VBXA 4JYAF 2D69A 3QFWA 4P2XA 3IIBA 3DOKB 3GCXP 1H7WA 1XWLA 4B17A 4O3PA 2D3O1 1QUPA 1YI2S 3HKZD 4ZY1A 3DRXA 3VAFA 2HNZA 1KQKA 3E2EA 2Z3KA 2X1GA 5THWA 4RLEA 5JGFA 3G96A 3FH4A 4FD5A 5LRJA 2QG9B 4ZIWA 4CO4A 2YH1A 2OP5A 1CJVA 1KTQA 1HMVB 1ZM9A 4NXMJ 1KHWA 4DPYA 5A8RB 2JDJA 1S59A 3W60A 4E2FB 1Y0HA 2A0FB 1JX4A 2CTBA 1F3FA 4XTTA 5JH9A 2OZGA 4WFBQ 2DO4A 2XMTA 2XI3A 1VDHA 4JV2A 3NAHA 1LNQA 4IH5A 3R9EA 4USJC 2D74B 2DRDA 4KVOE 1RTDB 2EK9A 5IV0A 2Y9HA 2Q4ZA 3RRKA 3HD1A 1SJ4P 2JZ5A 3N79A 2MQMA 3L7PA 3A8IA 2DISA 1XJWB 4LF1A 3NG8A 5CQGA 1S1WA 3IEHA 2YKQA 2MGZB 4GC6A 2CPZA 4GC7A 4M5MA 5EDWA 2EC2A 1UVIA 4MHDA 2ACYA 3QSIA 4OMEA 1EIYB 2Z3NA 3HHKA 2JHEA 2H3EB 1DQ9A 4YFUA 1SJ3P 1HA1A 3TJAA 2FVRA 2PJ8A 1EZZB 1I94J 1Y7RA 1QAXA 2CPJA 4KOYA 1F9EB 4LRFA 1ZBTA 2XGQA 4ANEA 1Z8TA 1Y3JA 4RUBA 1RDRA 2OPPA 1CPZA 2GZOA 2NZ4A 4RR5A 1TK5A 4KB7A 2DHGA 4K0KJ 4RL1A 2DXDA 4LQ6A 4YP3A 3W7BA 2BE2B 3PW2A 3M4XA 4W9YA 2C1CA 1WG5A 2YKOA 2OD6A 5A8KB 3HZGA 3BO2A 4NI2B 1VIOA 4ZK7M 3FVYA 4DX8H 5I0CA 2WSEC 1J2VA 4DV3F 3EX7B 3RAXA 1JNRB 2BW2A 1FRJA 3MPYA 3MOZA 4DFJA 3S8SA 1YVOA 4NLXA 3KK2A 3HM9A 4CPAA 4RI1A 7AT1B 1YVKA 5K8OA 2RSQA 3KHZA 2BJ1A 4DV2J 4X4NA 3MCNA 1VQ6S 1S9EB 2ZENA 1N32J 4A37A 2PEHA 5IM0B 3CPWR 1JLEB 3NLCA 4CO1A 1JMTA 4O3SA 4DU8A 4NGNA 4KHPJ 3FNCA 2WTFA 2XY7A 3O5TB 4IUSA 2DHSA 3S9LA 3GONA 4OYPA 5CBMA 5MAOA 2ZITA 2C27A 2A3JA 3D28A 4QW9A 4PWDB 2EKYA 3OJUA 3K2KA 4YB5A 4XDCA 4WFAQ 1VQ7S 2AV5A 3OVBA 2BRLA 4E2AA 2VJVA 4HEA9 4N47A 2CPEA 4ZI6A 3ENQA 1IQZA 2FGOA 4NLUA 1DLOB 2AT1B 4OIXA 2QZ8A 2QL7B 4EGLA 2ILYA 4U7UK 5F9NA 4UWIA 1X8DA 2ZJQQ 1GMWA 2RRBA 5LYDA 2HS0A 2B7BB 1XMQJ 2XMJA 2A6MA 4CCHA 1IKWA 2HK3A 1BOBA 1HLWA 2EPIA 8AT1B 1FDNA 1GXLA 2PIIA 4Y2CA 2C6GA 2CWKA 2HSEB 2Y0MA 2L08A 4MFLA 3SXNA 4ZY0A 4P9SA 4DR6J 1NDKA 4KUAA 2GV1A 4EK2A 3M6XA 4P4EA 3IWWA 3TEGA 1BQNB 2CNKB 1XK8A 3WIUA 4B11A 3VH9A 1SC1B 4ZVEA 4EYIB 3D4JA 4B9UA 4A2ZA 1DQAA 1QSMA 1MLAA 2MHNA 1R0CB 1FE0A 4J9LA 3UN2A 5F3TA 5K8PA 2YNEA 1ON0A 3I9V9 1H74A 2WK4A 1VQLS 3CULA 1IVZA 1X0FA 4GXHA 2VV5A 3MFHA 1SXLA 3CWJA 2R42A 2XMUA 3D67A 4NXNJ 3LWUA 5LXRA 3NGTA 3VWDA 3P3DA 4OYXA 2H4WB 4CYPA 1U7LA 2CJQA 2EBEA 1C4AA 5DQGA 5KFSA 3L9ZA 3R8YA 3PR4A 3N7ZA 3SBMA 3W65A 2NSMA 2Q4VA 2PR1A 1TKZB 2B4UA 3UNGC 3TW0A 3VAHA 1CP6A 1GK8A 1YR0A 3KUGA 4JI6J 5KTCA 3OQ2A 1X10A 1SC6A 5CCLA 1Y10A 1IKXB 4PXEA 4KT0C 3B35A 3MAAA 2OI2A 1YRTA 4TU7A 2YKAA 3Q8PB 2K7JA 3T1YF 2G2OA 4KBIA 1UVNA 1TKFA 2LXFA 2BANB 4A8QA 1GYTA 1WC3A 2IYIA 2FC8A 2RNEA 4K4YA 1JLQA 5B0FA 3R7NB 1YK9A 3PKMA 4WPAA 3MUMP 2Y8WA 4M5HA 3GYGA 3BREA 3MDFA 3OR2A 4DN9A 1B64A 4PXCA 4ZS6A 2C28A 5HMZA 2EC0A 2UUAJ 3ZZOA 5IWAF 2AJ2A 1X60A 2CPFA 2UP1A 4WIQA 3VALA 4DG1A 1NJXA 3WR7A 2AQ4A 5KFIA 4H6UA 1PJ6A 1FX4A 2PJ1A 2AU0A 1RHUB 3M8ZA 1TU0B 1WACA 3VGSA 3ISZA 2PVWA 3ETOA 3MM9A 2M52A 4DN0A 2GA7A 2W9BB 3TQ1A 1RWUA 4DNCA 1SV5B 1AUGA 2UUBF 3G8QA 5U47A 3GFXA 4X4TA 4UWJA 2XZWA 4V19X 2IMWP 3T5JA 1NB7A 1P4NA 2C22A 1XR6A 1FKAF 5CAAA 3CDAA 5KTDA 3OTBA 5CYMB 3BGRB 3RB3A 2ZHOA 4CH1A 4MHPA 3GV8B 2WOMA 4YB6A 1JJCB 5E3RA 1HYSB 1U1MA 1LANA 1NE9A 2XQCA 1U26A 2IC3B 2V34A 3OTCA 2OJ3A 1FI4A 1C0UB 2C2RA 4L76A 4Y34A 1JLCA 2G0BA 3LPYA 4UCPA 3CD6S 3K5LA 1HR0F 4WTOB 1OY9A 4MFZA 2OMLA 3QT8A 2BABA 2AJ4A 5CA5A 2Z3PA 4F4KA 1RAAB 2Q43A 2H9ZA 3DM2A 1VQ9S 2R8KA 3C6TB 3TO8A 3RBXA 3IGNA 3JSYA 3DC2A 2JDDA 1EKRA 2XTJP 2FUG9 3BYRA 4PQUB 3U27A 5J2QA 2IM3A 3Q8UA 1T9TA 2ZOGA 4RBUA 1NM2A 3RB0A 1XBWA 4U96A 3SDEB 4A32A 4B3TJ 3JAMY 1VRTB 4URSA 1UFLA 2GVDB 5D0HA 2HFNA 5K8NA 4RW9B 2HUZA 2YH0A 4FYYB 4X65J 2OEMA 1X7VA 2GFFA 1SH0A 5GADI 3AD7C 5K14A 1JK9B 1Q4RA 3SSSA 3ZZPA 3MZIA 2P9CA 1IBKJ 2VU5A 2AFZA 4PK2A 2WVCA 4O3RA 3P2FA 4WIIA 4WKYA 4A30A 4TKTA 2D3UA 1UVKA 3ZZYA 1X5OA 4A8KA 4AL5A 3RRHA 2K1RA 2YWEA 3FEZA 3OFFA 3J81U 4CYUA 4NCBA 3LOUA 2WSFC 5IV3A 4ZBGA 5ETLA 3IN5A 1IYKA 1S4EA 3P4UB 1W2IA 4IOAQ 3K8VA 4ZVPB 2OAUA 2E1CA 2CJ9A 5E3AA 4DR1F 2CPYA 2IA0A 2J9DA 5H9FJ 4DF4A 3AT1B 4CRZB 1Y5NB 4QUSA 1SC4B 4CO2A 3OTDA 4WCEQ 1SL2A 1Z2ZA 2E5LJ 2Q6BA 4KFBB 4CLKA 2NQPA 2DF5A 1JKHB 3T1HF 1EKSA 1Y4ZB 4MFQA 2KT5A 1LCPA 5AGEA 4B3MF 2DXQA 2VBZA 3PB9X 5J2MA 1N33J 3KLIB 3UW1A 4J3GA 2WPXA 2GHWA 3W5XA 1F57A 4K4XA 3T19A 2E7VA 4Z37A 3OV7A 3M6WA 1HNIB 3FJUA 5LMUF 3RBZA 2CADA 3PRTA 4MHYA 1OS5A 1RE1B 2MZRA 1XFOA 1T94A 2DGQA 1KC8T 2FPHX 1CJUB 4BHQA 4UFWA 2R2UA 9ATCB 3CO0P 1TKDA 1RBAA 3PFOA 5A28A 2E29A 1YKWA 2RILA 4DSKA 3WZ0A 3DRRA 2RKIA 3B8GA 5KG6A 4J9OA 4J9PA 2VPWB 2QT7A 2MKHA 2MQLA 5B0CA 4DSJA 4JI0J 4RN7A 5HMWA 3FX6A 5GADU 4YY3F 4DQPA 4ZN3A 4J91A 3G82A 4NLGA 2ZZNA 4X3RA 3LW5C 3DLKA 4H4OB 2HVIA 3S9NA 1CX8A 5EWEA 5A27A 3IU1A 2BJ8A 3NGKA 5G1ZA 4ID8A 2ZVSA 3MECB 2NREA 3IRWP 4X4VA 3EJMA 5F3ZA 2DEIA 3MMBA 3MPVA 5CH7B 1K1QA 2B3TB 3MM7B 1YDLA 3Q24A 2DITA 3NOCA 3LP2A 1FY7A 1TV6A 2PCUA 5HO4A 4NE9C 1GXUA 2RQCA 3B3WA 2K8GA 1NH8A 3ZFVA 1SUQB 4QIVA 4MAKA 5H9EK 2AKWB 3FSYA 2DRBA 4QR0A 3W6XA 5BWAB 3JB9k 1VLYA 1XMOF 3AOBA 1QTMA 1MN9A 2FVCA 4EEYA 3KLGA 3LTOA 2LCWA 1W2BR 3MPUB 1FHTA 5HMXA 2VZ9A 3J7A1 1IYLA 3K8WA 4JJXA 2V69A 4R76A 4OC1A 2IDEA 1EAYC 2D7SA 4X64F 3H90A 4NGSA 5GCNA 2G0IA 5KTQA 1WHVA 3SXLA 4DV7F 4ZCIA 3S7RA 3WX8A 1S49A 5DLGA 4CLSA 3VHQA 3PVXA 2HNZB 4AXIA 3BN7A 1S5ZA 4R0JA 2AZ1A 3K58A 3B4DA 4RWXA 4G1IA 2JLGA 2RS8A 3H25A 4G1QA 4HHJA 1CJVB 2YNFA 4UUXA 3MAQA 1N8RT 4ZVOB 1VQOS 4A8WA 3SFGA 3NP5A 1HI8A 1I1GA 2Z57B 5D0RA 4F2RA 4MIAA 1AFJA 2H5MA 2DPTA 4KR0B 1HW9A 3EGVA 3K17A 2MKSA 2R7TA 2MZJA 3UO0A 5IX3A 4CAFA 2AFSA 2MSSA 5AJ3F 4JI8F 3Q8RB 1U0HA 1RCXB 1Y5IB 3VQSA 5CD4A 3OSPA 2HVHA 3QNVA 1S1WB 2HPUA 3T1AA 4ZLNA 2ZHAA 1KNZA 4QQBA 5KFXA 1WSRA 3VWEA 4MHNA 1FDAA 1LRZA 2C2KB 4P4FA 4NA1A 4ZLJA 2XO7A 3PYDA 4QVTA 2QFJA 4IYQA 1VQSA 1KWMA 4I6YA 5DWNA 3OL7A 4QBUA 4NF1A 4CT9A 1S72S 1KLMA 3QYYA 4ER8A 3HSJA 1UMJA 4IR1A 1FKPA 4UEEA 2VICA 4FF3A 2NYHA 5F0UA 2RHSB 5KFAA 3PFEA 3OVSA 2FD2A 4DV5J 1RWVB 1M4LA 2CRLA 2OPPB 5I42A 2HHHJ 1M1KT 1R8PA 1DARA 1AZSA 2DH8A 3QGPA 3BDPA 3L4BC 4LR8A 4USTA 2HNDA 4O44A 4JI2J 5GMDA 4HDHA 4C8YA 3PY8A 4K2XA 4FF1A 2IPOB 2UXBF 3OFGA 1RLDA 1ARMA 4CH7A 4R3KA 3UQSA 1LWFA 3H8FA 1OY6A 1FT7A 3IBCB 1WTBA 1X9SA 1ZLIA 3CJ3A 4WWVA 1UZDA 3CEDA 3R5AA 2HYIB 4RKUC 3KK2B 2XCPA 2HIYA 2D4OA 2HQDA 2EBJA 3BQ2A 4J9MA 1IUJA 2HFSA 3CJ2A 3O8WA 5IXUA 2RT3A 5HMYA 4NLDA 1Z8WA 3SI0A 4ZLPA 1NSLA 1SBRA 5KFGA 4WK3A 5KT5A 1YRUA 2OOTA 4MHZA 3IFEA 2O3DA 3OFEA 1RSCA 3IA0A 3R9FA 4DR7J 2V2ZA 2AEMA 1D9FA 1RAEB 1H98A 2JSXA 3LWMA 3ILLA 2XGPA 4OC4A 2CZVC 4P2MA 3DRSA 3HLUA 3HSZA 4F4WA 4IAVA 3W61A 2ZEOA 3FQLA 8CPAA 2C6CA 3F5BA 2FJDB 5KFQA 1RQ0A 3HF5A 4KOTA 3KYLA 2CIJA 4JI3J 2EO8A 1NK9A 4MRIA 5L1IA 1PILA 1K47A 1Z1ZA 2NYIA 1SIWB 4RUAA 1PSDA 5H9EJ 2C3OA 2F9JA 2WBMA 1B0VA 4DQRA 3B4MA 1KLNA 3D9BA 4M94A 2MYFA 4M5KA 2F63A 2DGVA 4BLGA 1IKWB 3NAIA 3W62A 1RHKB 2APOA 3QGIA 3TUJC 1BAVA 2MTLA 4DR3F 2YNHA 3G6VA 1T03A 3MCMA 4X4SA 3KLHA 1UTAA 2QA4G 1SQEA 4RW7A 4Q45A 2DXEA 3LGHA 2D4PA 1L3SA 2JC0A 1KR4A 4K4UA 3RYLA 1JNZB 3JRUA 3EGWB 4WKRA 4JLYA 1CM0A 1SJQA 2YKNA 2QJ3A 1JJHA 3PCOB 5J1EA 1NSAA 4Y2AA 1UVJA 1BY9A 2FB0A 4DQSA 1H2TZ 4GMKA 1RAHB 5A8WA 1E6VA 4A8XA 3IWGA 4HVZA 3GP9A 4XAKA 1TVRA 4DBQA 1UJ4A 3SSQA 3TRGA 4I56A 1VHSA 3VF0B 2XC9A 2P8IA 1X4DA 2QSFA 4ZP7A 4A31A 3W91A 4A46A 3GR1A 1VJWA 2MMYA 2G13A 4ETZA 2QYGA 1Y9WA 5BJRA 4B5PA 4UEZA 2ERRA 2B0GA 1T9UA 5DGAA 3GYAA 3KG1A 3UR3C 4HKQA 2YWGA 2AFUA 3TO6A 1CBKA 3RNZA 4ZP8A 3EO4A 4F6AA 3MAAB 1U1QA 1G6BA 4Q7AA 4C3KA 2IFXA 2VC1A 1H3DA 3DXSX 1V3RA 2O66A 2Y0BB 4JI1J 1ZG8A 4YB1P 3JTKA 3DDDA 1JLQB 5LJ3Y 3Q0AA 4CLFA 4NRTA 4JYAJ 3CCJS 1S48A 1U25A 1F2GA 3OR2B 5IT4A 2BE7D 5JUMA 2UUWA 4LR7A 2GVZA 1YBTA 3T3FA 2BR0A 1XR5A 5AXKA 5HI7A 2FHJD 3LPEA 2PGCA 1YG0A 3CJKA 1LV5A 2PE3A 4DG1B 4KE5A 4OX6A 2YX7A 3RGIA 3FXTA 4ID5A 5AE3A 3H2VE 2Q3PA 3BR9A 3S9MA 4UA3A 3MM9B 3M8RA 5SZTA 1YRXA 2VFSA 4OZ0A 1FJEB 2VBYA 3FNNA 3TOBA 3CJTA 1OWXA 3Q22A 1RP5A 1U4BA 3TZXA 1J4JA 4M6HA 1CLFA 3C6UA 3DLHA 2C6PA 2KJWA 2UVRA 1VRQC 4ZVFA 3W2WA 5KFJA 4ZP9A 4CI0B 3ONQA 2QMWA 5KFCA 2WOMB 4FF4A 3QIPA 1CG2A 1NSPA 1VIXA 4TY9A 2AF6A 1UEVA 3TUIC 2KI2A 4N7TA 2PD1A 4KUBA 1VQ5S 3KXDA 4BWJA 2PN6A 1HBNA 2AYEA 2OMOA 3OL6A 1JLCB 5L39A 2YX4A 1M5VC 5KTAA 5LL6d 4Z65A 1WI8A 4QBJA 3NGUA 2HHQA 4LSLA 5M2PA 1M0SA 3S6HA 2ZKUA 3DM2B 3QT6A 3MR7A 3WX4A 1RHMB 2HZAA 3CDWA 5DO2A 3FDSA 2C3MA 3DKDA 2Y1RI 2OFHX 1QAJA 5J2QB 2PJCA 2VPXB 2VQFF 2DCUB 1HHQA 3D6HB 4OKOA 3CCLS 1TKXA 5LSOA 4AXVA 3VAIA 2R7UA 4ZOSA 1RWPB 2Y1JA 3FBCA 4QPXA 4PYAA 3A1YG 1N5TA 2NXCA 1RT2A 5KFVA 3I5AA 1EB0A 3BJYA 5K14B 1XC9A 1AUSL 4IDKA 4DV3J 2HQYA 2E1MC 4JI4F 2B56A 5ETRA 1RUSA 3C8YA 2CNLB 2AJ6A 4DV4F 4CM0A 2FLOA 2K1RB 3MURP 1S3ZA 2PMHA 3TZWA 3J7AN 2C3PA 4CYUB 1VCTA 3B78A 3QAEA 2JNJA 3W5YA 2B8PA 3UD3P 1JLFA 2QLFB 5EWGA 1C1CA 4DCOB 4UTGA 3ETMA 3Q2SC 5ETPA 1B7FA 3M32A 5AG6A 4MI4A 2Q04A 5CXTA 3LACA 3OJSA 1M4IA 2CJYB 4FD6A 1Z4RA 4ANCA 5ADZA 2QSWA 2VA2A 4ECTA 3GG1A 1S1UA 1UA1A 3F0AA 2J0QD 1JXLA 1FDDA 2W8KA 1FWLA 2LXUA 4F4ZA 4NPOA 1UJ6A 3TVZA 3GKRA 1FJGF 5J2MB 3V4IA 4ZJLA 1ZAVA 1H73A 4F36A 3CDXA 2IBOA 4RNMA 4NX9A 2JVRA 2RUSA 4KOUA 3T5KA 2XSFA 1FVQA 1WD6A 3T6JA 1WF2A 2REFA 1DY3A 1R0BG 4AVBA 3VWSA 3KASA 2XMKA 5I3UA 3UFCX 3R9LA 2NXNA 2W01A 2VB6A 4LBHA 1ZO0A 4YR2A 2ZEDA 4X4RA 3DRRB 2RKIB 2DH7A 1S7NA 4L73A 3QRQA 1M4DA 2DPSA 4BBHA 4XPDC 2VKRA 4ZPAA 2VPZB 5F49A 4FYDA 1YX0A 4OZNA 1GXTA 3RR8A 3CZXA 4XPDB 3ELHA 2PO4A 3DGVA 4PRFA 2B4OA 2HWIA 3G82B 3OW2R 4TU8A 4DL2A 5KG3A 1RBLA 2V2KA 2J9AA 1DBDA 4DV2F 1B6BA 4Q2LA 3DLKB 3VAJA 3PG9A 4USKA 5BXIA 1FXDA 1EX8A 5EX0A 1VQ4S 2ADCA 2V77A 4U9ZA 3TAPA 5GMKa 1DFDA 2LA4A 5DG9A 3NS5A 2EI5A 4K5RA 3MMBB 3BO3A 4PUOA 4DV1F 4ELTA 4AXJA 4M5DA 1VISA 2DGSA 3G8WA 3LP2B 4DSIA 4PSWA 3KJQB 1TV6B 1LK5A 2U2FA 3W8GA 2KZZA 3PJXA 2IL4A 3T1YJ 4DPUA 2YQ1A 2O28A 4ELUA 1FWPA 1B0TA 3V6JA 2BX6A 4DUTA 1YTYA 5A0YA 3AY0A 4KRWA 3LUYA 4BC7A 4Q44A 2LEPA 3IXQA 3R5CA 2RQ4A 3K9TA 2IVMA 1FTCA 1RACB 3GLJA 4IO9Q 4JV1A 4W4MA 2R2RA 3B7IA 4EMEA 1YJNS 4DSEA 1TFWA 1FESA 1SQGA 2RS2A 2E1RA 5IWAJ 1C4CA 3JVNA 3E51A 4DX7A 2FHOB 1RWOB 3QMQA 4HPSA 1S1TA 1R7IA 2I2YA 5C24A 1HFEL 3K5OA 4J5OA 4OZ2A 2PRQA 3PX0A 5CHCB 1IKYA 1U24A 2O01C 4LBIA 2WSAA 1HNZF 4LUAA 3NL0A 2UUBJ 2QA1A 4G1QB 2YNFB 2OLWA 2W4CA 1CS4A 1UWBA 4JP8A 4URQU 1RYSA 1P1TA 2HZCA 2RRNA 5F41A 2OSRA 3ET6A 1S6PA 4D3GA 2J9EA 1VS3A 4F25A 3AJDA 3P2HA 4LT6A 2HK2A 1H2UX 5DZ6A 1VQNS 2MEWA 3WC2A 1V3ZA 2ZDPA 2R8VA 1HNVA 3NGRA 4DWIA 2GGPA 2CPHA 4ECSA 5J2NA 4B9NA 4M3SA 1PYOB 1U0HB 3ZNJ1 3TCVA 5DQHA 2BQ3A 1GMUA 4IFYA 4TNOA 1XBUA 1HARA 2KG0A 4USMA 1X0PA 1X4GA 4ZVRB 3GSDA 1HR0J 3FSIA 3IG1A 3CJ8A 3TR5A 4F7VA 2YNCA 2MQQA 1T3OA 4U6PA 3MM6A 4CGPA 1REVA 2HFZA 2ZOFA 2XZTB 3WT4A 1KLMB 3GCWP 4QW8A 2YNGA 4M6IA 1V9OA 1FKPB 2KKHA 4QIFA 4QJVA 4ATNA 2YQ3A 3IGRA 1QJHA 3ZTQA 4OI2A 3QB8A 4MIBA 1NHUA 2N4CA 2GMLA 2FY1A 2V4QA 5I42B 1UETA 3IWNC 1ULRA 2M88A 4U8YA 2OH2A 1AZSB 4MT1A 1RWMB 2V9KA 2VFUA 4MXUA 1HWUA 2HNDB 3UCGA 4O44B 2LA6A 1I51B 4AL7A 1VR6A 1LWFB 4OHXA 2FGCA 2ASDA 2R1IA 3BEGB 5CZXA 2HIQA 3H5YA 4DI6A 3PYGA 2XNRA 1VC6A 2XULA 2PRBA 5ITHA 4Q38A 1NCLA 4TY8A 2BUNA 2Z56B 3LP0A 2IRUA 3D7GA 1DTQA 2YQ0A 5D0GA 4C8KA 3ZTOA 3TTHA 3BQ0A 3BM7A 4PG7A 5LXYA 2KFYA 3DRSB 3FMBA 3T1HJ 3KUEA 3M6VA 3AOAA 4DQQA 3HZEA 1S7HA 3MMJA 2B8QA 4B3MJ 1FJCA 4F50A 3OPKA 3IM9A 2CJXB 1IJEB 2QFIA 5EGYA 2H51B 3BB5A 5AT1B 4UQGA 4DFMA 1Q16B 4JD6A 1RT5A 1S7FA 1TMJA 1UVLA 1LW0A 4QIWD 4KGVB 3G8SA 2F3JA 5LMUJ 1JWWA 2GJFA 2MQNA 3W6SA 9RUBA 4DDFA 4OJGA 2QO3A 3FBBA 2G9OA 4K30A 2AX1A 1IBLF 4ES2A 2W4DA 2VFVA 2YNHB 5E96A 1TL7A 1T03B 1F6TA 2JEIA 2GJIA 4X65F 2MKIA 3KLHB 4QWBA 1AUDA 2QJ8A 4MKVA 5D3GA 4EVYA 4RW7B 4FDFA 4YFJA 2R3VA 4L89A 5EN1A 2F5GA 2Z30B 1NMEB 2YKNB 1MG7A 3PV8A 1F0XA 5J1EB 4QWAA 3BH7B 4YY3J 4YS2A 2V63A 2OTJS 1S76D 1QMUA 4AB7A 1WOOA 2BJ3A 3DOLA 5DQIA 2WVFA 5A8WB 2OB0A 1E6VB 3H20A 4OI1A 3JYTA 2G9DA 1YW6A 2PR8A 1TVRB 1YMEA 2IDLA 3NEKA 1BLLE 2EVNA 2CF4A 2CUYA 2QIRA 3EZOA 3IMQJ 1CPSA 4I2PA 1S4FA 4S0MA 1RAGB 3F0NA 1EE3P 2R98A 3DMJA 2J7UA 4B5PB 3UY5A 4CGNA 4A39A 1JB0C 1DQ8A 3GTYX 2JDCA 1Q0NA 3P5TL 4RJVA 1XMOJ 3HK2A 4EFAC 5LSLA 5IB9A 5L9XA 2R7SA 3CW2C 5C88A 4ILLA 1RWNB 5B7WA 3IWLA 2MLXA 4MTPA 2CWXA 2P9EA 4AUKA 4TNUA 4ZHRA 1RA7A 3ZTRA 2W4PA 4XPKA 2D3ZA 2JOQA 4C68A 4X64J 2VBWA 4LREA 3VAKA 1WNEA 4PCQA 2DEJA 4GVBA 1N0UA 1DRZA 3H5ZA 4KYZA 3EZ5A 3BBFA 2VOOA 4DV7J 3HCXA 2GVZB 2XMMA 4NA2A 5HJXA 3ISXA 1P1LA 1AW0A 4QYRA 3CJKB 1X4AA 5K9FA 2BJ7A 1R27B 4ID5B 1YZ6A 4FS2A 2VG6A 2JBKA 4KOWA 1WC1A 3MCOA 3FZ2A 1TMMA 4NJRA 1GQEA 3T6BA 4TVAB 3OHBA 3R2CJ 2HMIA 2R4FA 2E9ZA 2XHCA 1U48A 1AROP 4KV8A 2DVIA 1WHYA 1U49A 3C6UB 3H2LA 3NS6A 3W2WB 4K4VA 5AJ3J 1T05A 4JI8J 4ECVA 2HHXA 2ABYA 2J6SA 1WEZA 3QIPB 2ZNZA 3CCES 4OV6A 4Q8EA 1ELLP 3CPAA 2ADBA 4HI2A 3D0HE 1JLGA 4B3RF 1HQUA 4NOHA 2CXEA 5F9LA 4QU7A 1UWAA 1J5EF 1HBNB 2VFRA 2CDRB 2HGNA 5J1QA 2BYCA 3PBEA 4JI5F 2CZ4A 5F8JA 5A76A 4IQXA 1HDUA 2ZEHA 2ZH3A 1S6QA 2DYAA 1YIJS 1GAOA 4LSLB 3RUBL 4J9NA 2GS8A 4OIWA 4W98A 4V1Ak 2CQ3A 1SPBP 1NMTA 1UJ5A 2V4RA 2YKMA 3NH5A 1RI7A 1QTNB 2JLEA 1IBCB 4UCNA 3QNWB 2NS1B 3V2UC 2LFVA 1ITPA 4UIAA 1TKXB 4OC5A 1QSLA 2I6WA 3N5FA 4WFYA 3MPDA 1KQFB 1QQ9A 1ACMB 4EMDA 3GIUA 4WZMA 1ZETA 4F0KA 5LRGA 3D6TB 3NH4A 1RT2B 2UXBJ 1VFJA 1IM6A 1NBEB 1R57A 1WC5A 2B6AA 4IDKB 3SJXA 3IBFB 2ABZA 2ROEA 5G22A 4PPZA 3NS7B 4PAAA 5HAOA 4L74A 4P6YA 2KG1A 2FLLA 2ZBRA 1WG4A 3M6UA 3B2YA 2J8RA 2KYZA 4ED5A 3ILJA 3GJQB 2MKCA 2ZM6F 1N56A 3B3VA 3ENAA 2KXHA 1HWKA 4DUKA 1JLFB 1NK6A 4RPFA 3SJEA 1C1CB 2EFVA 4BS2A 2GX8A 3M32B 2GIFA 3R7SB 2J9CA 3PW5A 3S1TA 5E41A 3BKFA 4LVOP 4FXWA 4OLLA 4OQJA 3NOGA 3OXFA 3JSMA 3H8EA 2FJBB 2LP4A 1FCAA 1GEHA 4RUHA 4G65A 1G1XA 1RT1A 4ONWA 3QBCA 2BSWA 1I21A 2CQDA 1KVJA 1S1UB 3CJRA 3KLEA 2RFHA 4IO1A 5KT3A 3ZZUA 2KVQE 3I5BA 4OI4A 5AE2A 2EFNA 4YHHF 3V4IB 3KG4A 4CDIA 5A2QY 5HJYA 5A2QU 2OEKA 5IT0A 1TKTA 4A94A 1HL6A 2HQ3A 2ZW6A 2G0JA 3JSRA 4GM5A 1FRKA 3HJVA 3LMSA 2HKEA 2XHWA 2FZKB 4I6AA 2ZEGA 2ZKTA 4A8SA 5CYQA 2P6TA 2XG8A 3KHGA 1B0PA 2WW8A 4DX5A 4CAEA 4C2XA 5I3UB 2ZEMA 4OV1A 3TZYA 2GO8A 1H72C 5IZHA 3H5UA 3P5BP 5KG1A 2HHSA 3IAS9 1PC4A 3G2XA 2OPSA 4U9YA 2R7HA 2GAHC 4ZJQA 3MMCA 3CGIA 4UEFA 4I7FA 3MFIA 2RH3A 1H2VZ 1RAOA 4F0MA 3MR6A 1KFDA 4DL7A 4EUVA 3HFZB 4F3OA 3MD3A 5KOXA 3DR8A 4XPCA 1CC8A 2P6GA 2VEZA 2EEYA 3PEJA 3DGPA 1H6KX 3N4WA 3L7UA 4X66J 2O4HA 3GYNA 2JEVA 4NYOA 1KP6A 3HSDA 2W7PA 2Q44A 3FMCA 4USUA 4PUOB 2V8VA 2MZSA 1V5IB 4M5DB 4KOVA 4A8MP 1HHTP 3GMGA 1ZZNA 4AL6A 1YLXA 4USWA 1QSNA 5FD1A 3Q86A 3PIPQ 3T8WA 2DGTA 5E2QA 2EXUA 3FGVA 1IBMF 4MYTA 1VOMA 3OTOF 5K5MA 2FJAB 3OUYA 1WC4A 2J0WA 2ZC3A 5A0YB 1U1PA 4NGQA 4K59A 4KSIA 2LECA 3CDUA 1HNXF 4X8IA 1QSYA 2CQ0A 3IP0A 4EYHB 3HO1A 5J1PA 4H89A 1VGYA 1MWQA 2CA9A 1N0VC 3THVA 3HJFA 4AT1B 2ZBCA 4DSFA 4KH0B 4QPTA 3WBZA 7CPAA 1S1TB 2A18A 5C24B 4LUBA 1BD6A 2BDPA 1J27A 2JL9A 1NJWA 2KL8A 3A3OB 1N4LA 2QLWA 2WHOA 1IKYB 4B3SF 1GNKA 3BSOA 2KO1A 1Y5LB 4P2FA 2D9OA 2MB0B 2UXDJ 3CMAS 3B54A 4OZ1A 1RT3A 2GHPA 4RBVA 4C9DA 1VMBA 4H4MA 2FT0A 1CS4B 1UWBB 3KJVA 2WAQD 2PA8D 2AYBA 4UIBA 2CQ2A 2QV6A 2G2ZA 3BI1A 1QM9A 2Z3OA 3PW4A 3M30A 4ED4A 1S6PB 5G0RA 3UDEA 2DGOA 2PFDA 4F04B 1MMLA 1CSJA 2ZH2A 3HHNB 4R8UA 4JI7F 4OYMA 1HNVB 4KO0A 2CIMA 1TK8A 1B99A 3DHXA 2GGPB 4K4TA 5J2NB 3W8PA 1MMNA 2DNZA 3CMES 1YBAA 2HFVA 3KL9A 1ZS6A 1CVJA 1WORA 4IFYB 3B6BA 4MFBA 4ZPVR 1D8YA 1WK4A 2YNCC 4ZX9A 1VYAA 3CIMA 2DHHA 4OJ1A 3K89A 2L9WA 2DPIA 3FK4A 4EBEA 2ASYA 3D3SA 3IG1B 1JLAA 4IK2A 2FTRA 3SCLE 5C2CA 2R8HA 3RG6A 1Z8XA 1S7KA 3MM6B 4LX9A 3M8PA 1REVB 2DR9A 2IM2A 4J9KA 1D1UA 2YNGB 4DPXA 1YQHA 2VQFJ 5DWMA 2AWZA 2HNYA 1HIYA 4KPCA 1U02A 4HNXB 1WHXA 2W9CA 4PYDA 4ED7A 3GFYA 2J8SA 3LANA 2GFQA 2RDDA 2RF2A 1OYEA 2MLYA 2CXAA 3DHWC 2YXLA 3NWRA 2VUGA 1S12A 4LFAF 2QMUB 1TL3A 2FSRA 2GHVC 5JXSA 4MKAA 4O3QA 3GV5B 3M8YA 1FE4A 3QLHA 4JI4J 3PACA 3ZXWA 1S60A 3MCSA 1R31A 1OQ6A 3TA2A 3ICLA 2ZEJA 4CLUA 2COLA 3EXNA 2I79A 3UN3A 4DV4J 1OJ4A 1U2CA 1PGZA 5KFBA 1RTHA 1VRUA 1KZFA 1RKJA 3CJ0A 1L3UA 3P6YC 2AGPA 2NZCA 5GVQA 2GC8A 5J8CA 4CAXA 5ETKA 4TY8B 2OSQA 1OYDA 3LP0B 4P73A 3CCQS 1DTQB 2AFWA 3KOAA 3FBEA 2VQEF 4ITSA 4OFZA 4Z7YA 4ILMA 2VOPA 2DT9A 1Q2DA 1ZA2B 2OU2A 4KORA 2R7RA 1N6QA 2HG4A 4WP3A 2V8GA 3T9YA 3I56S 4EFDA 3CJ4A 3D1HA 2B5JB 2DK2A 1NZ8A 4Q43A 3S6GA 3KI9A 4GRSA 1FJGJ 1HKAA 3IO1A 1H0HB 5DG7A 4AD6A 2CDQA 3HVRA 2CJKA 4DS4A 3I0RA 3KQXA 1RT5B 1LW0B 4I69A 2RQKA 2V6AA 3A3PB 4OX7A 2EG2A 1T9VA 1SKUB 1WHWA 1REGX 3RTVA 2HHTA 4RW6A 2LVWA 5CABA 3HVTA 4K3NA 1BMQB 2HC9A 4C8OA 3EY5A 3PRBA 5JVGQ 2RJZA 1XOVA 5BYSA 4AVCA 2XY5A 2A1BA 1TL7B 3V5RA 4UOHA 1K44A 4PG4A 5D3GB 4RU9A 1KQGB 5DRKA 2DR6A 2WONA 3V6KA 5KG5A 1W26A 2MQOA 2PJ3A 1YSJA 1KQSR 1N34J 4LQGA 3CD0A 2C3YA 4KGMA 1Q79A 3P96A 2MQPA 1WWHA 2N7YA 3LQVA 1SB6A 2KHCA 4OZ3A 4QWCA 3DOLB 4OYWA 2CQCA 3RR7A 1X4BA 4C3LA 3JYTB 2V2VA 2ZJRQ 2YX1A 2W8LA 3RU0A 2JJ4D 4K50A 2M8DB 4NGPA 2QRRA 5HLFB 4HACA 2D41A 3HSGA 4DV1J 3I3GA 1WDTA 4I2PB 4F3MA 3DRYA 2FXFA 3R5JB 2G3AA 4YR0A 4GKKF 4FN5A 2PI5A 1RZMA 3DMJB 2O53A 1U2RA 1SVDA 1K73T 6FDRA 3BH6B 4X4PA 2W24A 4FNIA 1VQKS 2P9GA 3BF4A 5ETVA 2XS5A 1BGXT 3SJGA 3CCSS 2OPQA 2Y0SD 5LM7E 4F9UA 3S6FA 2Q0YA 4U9RA 4ZHRB 4HTJA 4DUZF 1YWXA 3Q8YA 3GU0A 4B9TA 1NEEA 4QU6A 2VASA 2AP6A 1U1RA 4NXYA 1F5CA 3SI8A 4GVBB 2HW3A 3NH8A 5HANA 3VV2B 3FBUA 3IR6B 1EP4A 1A7GE 1VJQA 2QL9B 4J37A 4WFNQ 4NEXA 5BYRA 1NKCA 2E9TA 5B0EA 4WYWA 4ONUA 2LDIA 5E5NA 2Z2MA 2DB1A 1HBMA 1HNZJ 5H1SV 3MUVP 1MROA 3KMSA 3PX6A 2F8MA 5EX3A 5HVFA 2IMOA 2B4DA 1C2PA 2VG6B 4N56A 1ZG9A 1UZHA 4M63A 4H6ZA 4IKAA 3EDRB 1TQLA 5CD4H 3LGNA 5I3PA 3L7OA 1T3NA 2B3UA 1TXRA 2IRXA 3TANA 2HMIB 1WWZA 2C2EA 2HLTA 4ZX8A 4NLWA 2HS4A 3R1KA 1BE4A 4J90A 3EYZA 4KV8B 2MKJA 2C2MB 1T9YA 1YHQS 1MMDA 3D3BJ 1FDBA 5L46A 3DLGA 3G8TA 1PCAA 1G4CA 1T05B 1KRPA 1Q5VA 2HAFA 4FWUA 3ZZTA 3RBEA 3R1LA 1GTEA 1EHWA 2K5TA 1RWWB 1JLGB 4ZCMA 1Q5YA 1HQUB 3RW6A 4LBPA 1Q8BA 1UL3A 4NEZA 2XO6A 4UQTA 2P6FA 1N48A 4USHA 1VI7A 1YJ7A 4C7QA 2Z0ZA 1CP7A 2GU2A 5KFFA 3B8HA 4O0NA 2Q51A 1YGYA 1S6QB 2FC9A 2NPFA 3MR2A 1HQ2A 2EWBA 2D3OR 2XSJA 4LSNA 4NCZA 5D4OA 1PC5A 4F3QA 4FXDA 4ZPBA 3CJ5A 2BEIA 1S10A 1RO5A 3BKTA 3NE8A 2F7VA 4EZ9A 1Q95G 1NUEA 4LF6F 1JJ4A 1N71A 4F0HA 4KHMA 3MTJA 4ZPTR 1SIZA 2LQ5A 1FFGB 2JVOA 2KRRA 2NSCA 4PR6A 1T95A 4BDPA 4CYNA 5HROA 3EDQB 4XIUA 2B6AB 2BVZA 4B08A 1VHIA 3OL9A 3H8GA 1AT1B 3UVJA 3SCKE 3LODA 1RCOB 1R3NA 3UD5A 2QMLA 2H54B 2W2QP 1ZM4A 3RBDA 4ZP6A 3SSRA 3DR6A 2AJQA 4RNFA 2WCXA 3TX0A 2ZHBA 8ATCB 4OP4A 2W7AA 3DLLQ 2UV8G 1VQMS 1Q78A 1BWEA 4DL4A 3M9MB 3K57A 2P5VA 2AW0A 2WYRA 3KK1A 2H5EA 1K8AT 2XBPA 2W25A 3JSMB 1RHQB 2EFQA 4B9VA 1ELMP 1RT1B 3J80Y 4ES1A 4GS4A 1FX2A 4OC3A 3IWXA 4X5KA 3H4DA 3J80U 3CSKA 5HXDA 2DIVA 2X3GA 2CQBA 2AMCB 2W2OP 1T8EA 3CXSA 3NGDA 3I9SA 3BN4A 3QWUA 3KLEB 1U6MA 1JJ2R 4W92B 3PEIA 4R87A 1R6VA 1JXVA 3MI7X 3CF5Q 4ORFA 2D9PA 4ED3A 5KFRA 2JEFA 2FVSA 3TE4A 1UPPA 3N01A 2VBQA 2ODFA 4LF7F 1HDQA 1HEEA 4DR5F 1N5VA 4KC5A 2BEFA 3H2UB 5HBMA 1Z5RA 2LQBA 1TKTB 2P0WA 3U1NA 2LQ9A 1IBLJ 1ZG7A 3JAMU 3QZ7A 1RWKB 4IF5A 3AA8A 3RRGA 3CXQA 3MN8A 3EE3A 1HI1A 2BKPA 2XNQA 5CYQB 3CCMS 3M2UA 2B51A 1OIAA 1NHVA 2HBQB 1DHMA 2M70A 4AQYF 3KJFB 2FVGA 1EJ7L 4XPEA 3FUYA 1FTRA 4HNWB 4UT4A 1D9DA 3QT5A 2C1EB 2QYVA 1ELOA 5D78A 2F5IA 5F8IA 1UW9A 4DUYF 1G7CB 4KVME 3H4BA 3BYPA 1B7YB 3RAMA 2OPSB 3I4HX 3WIVA 1N5QA 3MMCB 4JV5F 2KFNA 2V94A 4I7FB 1OY8A 3BKUA 5DM6Q 2GANA 3TWZA 4AE5A 3KLVA 1KN6A 4ED6A 1RXOB 2HFUA 3ILOA 1G3OA 3H40A 3TC8A 3E01A 1WC6A 4DHVA 4L72B 3GJSB 1V3SA 3DGPB 3BI0A 4RW8A 1Q81T 2C2NA 3KLFA 2PT0A 1MJ9A 3DU6A 5T41A 3ENWA 4CGLA 2ZJPQ 2EFOA 2EBGA 1S6UA 1KVKA 4NCAA 1PU9A 2V8HA 3ZTSA 4UCMA 5EUHA 1XNQF 1BUXA 3D6FB 3JSBA 4GO7X 2DCLA 5IS2A 2VG7A 1FNMA 2HGMA 1WSVA 2NCKL 5DGBA 2BQUA 4FS1A 1ICEB 4FKXA 4OL8A 3OUYB 3QAYA 5ISVA 4NWBA 3UD4P 1UAWA 4ZDNA 4F02A 4KAIA 4WFZA 2F4VF 2IJNA 2QLJB 4X4QA 1SL1A 3GJTB 1VBZA 1Z9UA 2E5HA 5BYQA 1S1VA 1X4FA 1VKCA 2RAQA 2NYQA 4IG3A 1NNDA 1LWEA 3DDKA 3AXMA 3FF3A 1L3VA 3CTRA 2K3IA 2JLFA 1BWVA 2DGUA 1RA6A 3QQCD 2CZ9A 3TA0A 3VR1A 4WU2A 2E5GA 2KH9A 3EFAA 1Z4EA 3L09A 3AB4B 1EQMA 3TQEA 1IR2A 3KMQA 3QGHA 4KH1B 2DNQA 1IQTA 2PA3A 3Q2TC 4KVXA 1RT3B 4KJIA 3UCZP 2DNMA 2KXFA 3PDNA 3NFZA 4H4MB 2HV2A 4OC0A 1ZTTA 3KJVB 3G71S 4DFKA 2FJXA 3FCWA 4NCGA 4ES3A 1A2ZA 2A2DA 3QJLA 2OZUA 4MK8A 5DDQC 3KQZA 3M30B 3FYNA 5G0RB 1O51A 1HBUA 4ZKAA 4PQAA 1N5YA 5HN0A 4R8UB 3T9NA 4KO0B 3GQCA 2XMVA 1RT7B 4B3RJ 1OBRA 3DXBA 2FHKA 4DPOA 2HVZA 1IN0A 1V5VA 4JXRA 3EWGA 4FYWB 1FJ7A 2C2OB 1J5EJ 3W63A 3EXCX 3I82A 1LWCA 1ARLA 5EC4A 4MCSA 4DPTA 3SCJE 1BQMA 3BO4A 3GYXB 4MFBB 4EO6A 1R0AA 3WHIA 3FCHA 5DJBA 2W2MP 1Q2CA 2L41A 2XI2A 4ZIVA 3AD9C 4JI5J 2ASJA 1X9MA 2IRYA 1JLAB 1U6BA 4ZGYB 1GMWD 3AOCA 1CPXA 3WDOA 3SQGA 1XE4A 3M8PB 3Q23A 4NEYA 5KFMA 1UVMA 2GNKA 2AFOA 4CTAA 4U7UD 4LJMA 4KKOA 2WZNA 2FJWA 3NBPA 2DGWA 3V8IA 2HNYB 1O6XA 3JTNA 4TLRA 2W9CB 5E3PA 1UA0A 3GJRB 2RF2B 2XYHB 2K3KA 2ZD1A 5KFOA 4C6AA 1TL3B 2I5JA 1ZAXA 2BW7A 3LWLA 4C0BA 1I1DA 4LFCF 2MZTA 3MM8A 3OFHA 3QPIA 3KLIA 3EMTA 2ZEFA 3THTA 5LSRA 3PTWA 3QLHB 4O0IA 1NB2A 5KT4A 2HURA 4MKYA 1Y7PA 1SH3A 2R9LA 3PKYA 3O2IA 2XS2A 2ZH1A 1N52B 3RB6A 3X1LB 4DEZA 3R7BB 3LAMA 5ETQA 1RTHB 1VRUB 2YKPA 1FF2A 1PYTA 4HHUA 1Z2LA 4QIEA 2RC4A 6FD1A 2Z11A 2ZM6J 1KFSA 1IKVA 1S0VA 2JX2A 3VAGA 3R6GB 4ZVUB 4B10A 4ECZA 1Q7YT 4CLPA 4K4WA 4P4DA 2UZAA 5KFKA 3MM5A 4CP5A 1S0MA 5GAGI 4I1TA 3EZUA 4CNYA 2HAIA 1PAEX 4CO5A 3M1VA 3O1LA 3D2WA 3VQTA 3W9IA 2MXYA 4GKJF 4TYBA 1N6QB 1FFWB 5D4LA 2ZE2A 2DNGA 5D77A 1O0PA 1YW4A 4OI3A 4NMXA 2JH3A 3ZZZA 4JYWA 4W90B 4YHHJ 1UFHA 2GLFA 2XWYA 3I0RB 4EWTA 2IBKA 2J6UA 4DCPB 5L9NA 4E98A 2QA4S 1MW7A 1SQHA 3CDBA 5AXNA 2VQYA 3FIXA 1YJRA 2OD4A 2XZDB 4DX6A 4RW6B 2PC6A 3OLBA 4DV0F 3HVTB 4NGTA 2ROGA 4R5PA 4ANDA 5G4DA 2ZC4A 2VZZA 2O67A 4OLOA 3HHDA 2IM0A 2MPUA 5FDLA 3VVUA 3WQPA 1FWKA 2WONB 1AA1B 3PB7X 3G3SA 3D7DA 5IT9Y 4ECYA 2CQ1A 3KDOA 1QUVA 5IT9U 4L3NA 3MGDA 4M1KA 1YGHA 2PVVA 3DLEA 4MIWA 2R8IA 2J8NA 4X2BA 5E3QA 3U1MA 2IA6A 3CJSA 1V6HA 2UUCF 3HUVA 2MSTA 1U1KA 3MMAA 2DTJA 5CNPA 3S6KA 3KDNA 3HX9A 4UY85 4ZA1A 1T9XA 2OZHA 4IRKA 2DNOA 2ZOMA 1U8WA 4K4ZA 4H2KA 3H5XA 5HL7Q 3KJNB 2QC3A 1U0SA 1PUAA 4O23A 2I9SA 3BBCA 4RNNA 1KDNA 1LEOA 1FRMA 4DR4J 4RNOA 1XMTA 4HACB 3KUHA 3NNCA 5DZ7A 1BO4A 4JUZA 2BQRA 4MJ8A 2C3UA 3M2VA 1I6JA 4PSXA 1F9FA 1C0TA 3TO7A 2CNMA 3T90A 5GAGU 5C25A 1ZA1B 2A6OA 3K9UA 2HLUA 4H54A 3VGTA 1IBMJ 3OTOJ 4B6ZA 4E8UA 1TKJA 5HVHA 1E6YA 2AJFE 4Q36A 2OPQB 2HGLA 1HNXJ 1GFWB 3GIIA 4NLOA 5HP1A 4HH1A 2H65B 3MPWA 1Y11A 1FNOA 2LU1A 3UPFA 4DQIA 1U47A 3QAHA 4OYBA 1XJOA 2DHAA 3SHPA 4Y3CA 4C7HA 1EP4B 1XN9A 4F26A 2MHEA 4A47A 2R2TA 4ALZA 2NXJA 4HHHA 4HT7A 1RAFB 4B3SJ 5B09A 1B87A 2WPWA 3GE9A 1HBMB 4M8LA 1X4EA 1MROB 4KPYA 3BS9A 1TL4A 4WE1A 4PABA 2B4DB 3KK3A 2Q7BA 3FSXA 4HI1A 3KR5A 2FJEB 3F56A 4CM2A 2Q6CA 2FLNA 3R5BA 4C8LA 3KNGA 2BV3A 1KONA 3IM8A 4UOCA 1OSDA 4UW2A 3EVOA 4O3OA 1UFKA 1SKSA 3CC4S 4JI7J 4XO0A 2XMWA 1QAYA 4ZITA 3DLGB 4E0DA 3OVAA 4ECUA 4X66F 3FRMA 1FXLA 4F4XA 5KFEA 3BHXA 4ZCLA 4WZQA 4OZ5A 2FL4A 2IIHA 4HYKA 2FIWA 4NYZA 3B3CA 4I6WA 5IFMA 3C14A 5G20A 4QYZK 2KT3A 3EXYA 2OKQA 2DNLA 3R5DA 3NNAA 4RWWA 4NLQA 3DDIA 4DXLA 2W7OA 4IOBA 2QE5A 2X1AA 4DPWA 4R25A 4ECRA 2Y3YA 4J7CA 4I68A 3TT2A 5AXMA 3PHTA 3FBFA 1YREA 1XIXA 4TWEA 4TU9A 3S01A 2XSJB 1WI6A 5RUBA 2CQIA 4FD4A 2PE8A 5ETMA 3G6ES 4LSNB 1RB0A 4MBUA 1QDUB 4ZLLA 2YNIA 4LFAJ 3R95A 3GY9A 5AXLA 4DLEA 1RHRB 2LEAA 4HLBA 4RX6A 4NRUA 5KFYA 5DM7Q 2HBYB 3M8WA 3MD1A 4QR2A 2XLIA 4I67A 2UXDF 2KN4A 5HROB 2P6EA 4YU9A 3R1HA 4ED2A 3H0PA 3UVJB 2I00A 1NDLA 4H4KA 3T5HA 3AD8C 3DLBA 5LJ5Y 4YB7A 3EGNA 2QMXA 3QATA 2HBRB 2HRYA 3A9LA 4ZVSB 5K20B 3WC5A 3D6MB 3MHYA 4A48A 2REEA 4AG9A 2OR4A 3LO3A 3IU2A 4USVA 3JXOA 2GQ2A 4FYVB 3D7FA 2C42A 2VQEJ 3KWMA 3RZAA 4Y2MA 3KK1B 3KZWA 2AIRB 2G1HA 3VTIA 1H7XA 1WELA 2FIUA 2YWHA 2DHXA 1BQXA 4KOSA 1N5SA 4UFVA 1H8LA 1UW4A 2NUUG 3EVWA 1QE1A 4WU3A 1B70B 5AG7A 2B5GA 2HQFA 4FBUA 3AJ2A 1N54B 4CWBA 2OTLS 2RHQB 2EFGA 3KHRA 4ED1A 4FKYA 4IG0A 1DTDA 3SV4A 3MEGA 2Y1IA 1FRXA 2FQQB 5IC6B 4IR9A 3M9OB 3D7SB 1XRYA 2B3VA 3TAMA 4I49A 1U1NA 3OWCA 5H9FK 4WP8A 2ZZTA 2VG5A 5E33A 2RU3A 4B3OA 5HBMB 1T11A 1IY7A 3QRPA 4C2MA 1FT8A 3CUNA 3I31A 4IHMA 3G9CA 3PIOQ 2EKNA 3CCWA 1KOHA 3M2UB 4CO0A 4KSFA 2M4MA 4URGA 3VATA 1PO6A 4ZCKA 4RU2A 3OT9A 4PEOA 1KHVA 3CB4A 3TUPA 2DRAA 2IJZA 2P2CB 4ENOA 4IFVA 2L9NA 4F8RA 3ADAC 5DS7A 3HFVA 4GVLA 5CPAA 1F2OA 4EBCA 2EG1A 3JQMA 1RT4A 4OMFG 4A8FA 3A8KA 1XERA 5FJ4A 2DNHA 4OHVA 5DDPC 1EARA 1GHEA 1BPNA 3S6EA 1R8CA 2DNRA 3CC2S 1RBOB 4TLQA 4LRBA 4YWYA 4CGOA 2RUGA 3E01B 3E0KA 2PIYA 5ETOA 4ELVA 2EK1A 3UDLA 4GKKJ 2HBZB 1IR0A 4RW8B 3KLFB 2CY2A 3RW7A 1DTTA 1R8AA 4Z7CA 1RLCL 2FY8A 1QSOA 4LF4F 3ULHA 4R8FA 4NLPA 4QYZJ 2IJFA 1L0CA 1ZH5A 1X4HA 1X31C 4FXVA 3ENVA 1NH7A 2WVDA 3Q8VA 2ZH9A 3CCUS 2VG7B 2BOPA 4FVMA 4J9SA 4A95A 2QGFB 4DOZA 4DUZJ 2BMBA 1NXIA 4CLTA 2A10A 3A4TA 3PNIA 3CC7S 2EFPA 3I32A 2XEXA 1QY7A 1S1VB 4M5IA 1K4JA 3ZZ0A 4IG3B 1LWEB 3SQOP 3FFIA 1CQNA 2H48B 3BJ8A 3LA0A 3N6NA 1RTZA 2DNKA 2EK8A 1Q8IA 4LRAA 2ZWOA 2B4PA 5F8GA 3QT7A 1DJ0A 3TP2A 1N34F 4OZJA 1G2EA 3KHHA 1OO0B 3AODA 5LMNF 2F4FA 3IRXA 5F8HA 3TZZA 1X9WA 2B9YA 4NCGB 2AEFA 2YY3A 1HBUB 2PJ7A 2VFTA 1S7IA 4QOTA 4JOUA 4MKBA 4B14A 3FZBA 5KFZA 1N5YB 1N36F 1S1XA 3D2PA 1XNRF 1ZOTA 2V68A 4I64A 4YDDB 3BR8A 2FZCB 2Z2ZA 3WC7A 3VVTA 1UKUA 1LWCB 1BQMB 1CJKA 1LXNA 1R0AB 3AA9A 1M90T 2F1FA 3J81Y 2K7KA 2A4NA 4PG6A 5HVGA 2WSCC 3LP1A 1U2FA 5D8NA 2HHUA 1FKOA 4N76A 3KLGB 2Z2LA 1T02A 1ROFA 2GAGC 3SQGB 4ICLA 3CIZA 4HKFA 1RAIB 3MEDA 3F44A 4C0OC 4CTAB 2BRKA 3ZJ0A 4KKOB 3QIDA 5IV4A 4V19J 1M1GA 3NBPB 2IYGA 5DLFA 2B4VA 4NFRA 4LF6J 4I2QA 2CKWA 4WWSA 1DZ5A 5T14A 3W9JA 2JEJA 2ZEEA 2RIJA 2BBEA 3H5SA 1RHJB 2QLXA 4N41A 1X5PA 2ZD1B 1WOPA 4RO0A 4DR2F 2ZH7A 4ECXA 2I5JB 1Q8KA 3AB2B 1LW2A 4L3KA 1AMPA 4TXSA 4NL5A 3MM8B 3WC6A 1M44A 2VDIA 3PRDA 3IAM9 2KXNB 4KGKA 1FFSB 4AYBD 3IWEA 5EWFA 2ZZMA 3BSCA 1S0NA 4BBYA 4MJKA 2N4DA 2HHWA 4ED0A 4OHYA 1TKHA 4RUCA 2GE3A 2AX0A 2WB1D 1Z4UA 1RAJA 3IR7B 1PYTB 5L8RC 3ZO7A 1CEZA 2L9DA 4EZ6A 3SMZA 1TAUA 1IKVB 2BJ9A 4KGZB 2PC1A 2CFXA 2OHDA 2R8JA 4DCJB 2FHJA 1QD1A 2UXCF 3F73A 5DS0A 3FRYA 1WEYA 2W1BA 2GIQA 3MM5B 3PB6X 2ZW5A 2PJ2A 5FVJA 3D4UA 7FDRA 2E7WA 3N6LA 3K7RA 3I0SA 1TTHB 3PW7A 2IHR1 3FEEA 4P52A 4OI0A 3M1VB 2DO0A 3G86A 3PRVA 3D8PA 4LF9F 5EMIA 1SJFA 5H84A 3NRBA 2ZE2B 2WUUA 4A38A 1LQ9A 3A12A 4LR9A 3D1QA 4P4IA 2J6TA 1YBUA 4M5GA 2AFMA 3PZPA 1S77D 1M5SA 4MK9A 4LF7J 3X3UA 4DR5J 2IVFB 1AFIA 1GX5A 3PJ9A 4C11A 1CC7A 5D8HB 4KSAA 1KTVA 4CLYA 1HD0A 3SIPB 2DIUA 2E5IA 4N8NA 1OPIA 2PJ0A 5E3CA 2RB7A 4R5PB 1M1DA 2VJUA 4AQYJ 4DV6F 1HQEA 2LYVA 1EETA 2EWHA 5FDLB 5B0DA 1KUYA 3GIJA 1NK0A 3QJJA 3MR5A 1VBYA 2F9DA 3B3SA 4OYZA 4LF8F 4DUYJ 4KHRA 4C2ZA 1GTHA 1TUVA 3BDEA 2IY5B 2M0GB 4JV5J 4F9VA 4ZYQA 1RISA 3DLEB 5FIIA 3W5ZA 1FA0A 3VGUA 3PO5A 4OX8A 1YITS 5D4PA 4J9UE 1R43A 4HDGA 3TO9A 2YWKA 3MMAB 4M5JA 1HWLA 1P0HA 3EICA 2FYXA 1XEBA 4ERDA 4DZDA 2KB2A 3Q8SB 1FO1A 2W2NP 3Q89A 2M9KA 2JLMA 4PXDA 3L2NA 5JQ4A 1WC0A 2R7WA 3DYAA 1IJFB 3M2VB 2M2BA 3T5LA 3GZ7A 4FUUA 2ZPAA 3SJFA 2OPRA 2KT2A 3POTA 1QSSA 1M5HA 1C0TB 3NKYA 2YPZA 1SJRA 2LU2A 1XF8A 1XNQJ 4LIRA 2XWXA 1RXTA 5LT5A 2ZH6A 1TELA 4MFPA 4OZLA 5C25B 4ZVTB 4YEAA 2Q79A 4MY3A 1D8ZA 3WABA 5ELYA 4LIWA 4NMLA 3T41A 1S9FA 1E6YB 3IBWA 3J7ZT 4F4AA 4NLTA 2F4VJ 3UN5A 3C3LA 5HP1B 4B9SA 2GJ2A 4UZCA 2W2PP 2IJRA 2M7SA 4HTIA 4EO8A 2FLPA 2UVVA 1NDPA 3PEHA 2PEBA 2PSZA 1R8HA 2CG8A 2EW9A 3H42A 1JQGA 1MJBA 3J7YI 3C16A 2ARHA 2CJBA 2VODA 1D09B 2YVSA 3PJWA 4B12A 1YLEA 2BM1A 3O44A 4FAIA 3MWBA 5DDRC 1X5SA 1FK9A 4P4JA 5KFHA 1CULA 2Q1LA 3A13A 3IJ3A 2ZELA 1CBXA 4WE1B 3KK3B 1OSCA 5D0EA 1I3OB 1VQYA 1RWXB 4FPRA 1ZPVA 2IAJA 4U8VA 1FNXH 4P72A 2GMJA 3H8YA 1T0TV 2L3MA 2V0NA 3R5GA 1A9NB 2JWNA 3GFZA 4WBFA 4FBTA 2E1AA 3HHEA 2OIHA 2CQGA 1NHKL 4YUDA 1KS2A 2ZVIA 2ZXVA 1FRIA 5LRKA 1LWXA 3DRPA 2FHMA 4XNHC 3MEKA 2ATCB 2R7XA 1YJTA 5HK4A 4BCAA 1WJ9A 2XLJA 2U1AA 3ZNUA 2KCWA 4NJQA 2AGOA 1ZAWA 4XNHB 2IVYA 3C14B 3E3XA 3G6XA 5E0OA 1RTJA 2PMWA 3HMJG 2BACA 2J9DE 1P9YA 2QL5B 5D4NA 3QO9A 2D1CA 4KY3A 2GIVA 2HS3A 2ZBPA 3DCAA 2NR0A 4IOCQ 1GH8A 4DJBA 5C42A 1XR7A 1TF8A 1MN7A 1VK3A 4R9MA 3BXMA 5D29A 4ETXA 1S79A 3PM9A 4PKDB 3C46A 1Q86T 1YVFA 4X62F 3N28A 3TJ9A 2CNOB 1IIDA 4C8NA 5HMNA 2YNIB 4IH6A 2ILZA 1PBAA 1QSTA 1TUGB 1BXNA 3LD2A 2Z58B 1Q53A 3DN9A 3DDNA 2MY8A 4LFCJ 4C2YA 3I6PA 4JZ0A 2ROPA 3RJMB 2O1PA 3J7YU 4FNHA 4H4KC 3D1OA 3U02A 2E1PA 4A8YA 3PB8X 1QSRA 1IWGA 4X2TA 4P7TA 1JWQA 2PJAA 2GW8A 5F8MA 4MFJA 1IU8A 2YPYA 1S9GA 3HKWA 1HBOA 4R0EA 3FVLA 2LMIA 1IM4A 4AG7A 3PXGa 4P74A 5DDOC 4CS0B 2ZBQA 1SC3B 3C2PA 1RK8A 4OX9F 1NDCA 1TFYA 3M7VA 2CPIA 3DU5A 4LFBF 2SXLA 3V81A 4GKJJ 3D0GE 1NK7A 3IS9A 4WTYA 5L1LA 3BSAA 2VC0A 2W9AA 1LOKA 2M8HA 1AXQA 4FP9A 3NY0A 1RYRA 4RW4A 1QE1B 5KFPA 1XMBA 1M5KC 5GAHI 3K0JA 3NWGA 3OR1A 1KOOA 3R3TA 1N88A 2B5GB 3V38A 4J9VA 3C66A 1VBXA 5AE1A 1CJTA 4IQMA 2QTWA 3CJQA 1HWIA 3LAKA 4LRCA 2FIAA 4II9A 2DH9A 4IG0B 3PBBA 4UBRA 1C1BA 3MEGB 2XEIA 3TFYA