2V8VA

Crystal structure of mutant r322a of beta-alanine synthase from saccharomyces kluyveri
Total Genus 147
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
147
sequence length
435
structure length
435
Chain Sequence
LNLPAAAPLSIASGRLNQTILETGSQFGGVARWGQESHEFGMRRLAGTALDGAMRDWFTNECESLGCKVKVDKIGNMFAVYPGKNGGKPTATGSHLDTQPEAGKYDGILGVLAGLEVLRTFKDNNYVPNYDVCVVVWFNEEGARFARSCTGSSVWSHDLSLEEAYGLMSVGEDKPESVYDSLKNIGYIGDTPASYKENEIDAHFELHIEQGPILEDENKAIGIVTGVQAYNWQKVTVHGVGAHAGTTPWRLRKDALLMSSKMIVAASEIAQRHNGLFTCGIIDAKPYSVNIIPGEVSFTLDFAHPSDDVLATMLKEAAAEFDRLIKINDGGALSYESETLQVSPAVNFHEVCIECVSRSAFAQFKKDQVRQIWSGAGHDSCQTAPHVPTSMIFIPSKDGLSHNYYEYSSPEEIENGFKVLLQAIINYDNYRVIRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structures of Yeast -Alanine Synthase Complexes Reveal the Mode of Substrate Binding and Large Scale Domain Closure Movements.
pubmed doi rcsb
source organism Saccharomyces kluyveri
molecule tags Hydrolase
molecule keywords BETA-ALANINE SYNTHASE
total genus 147
structure length 435
sequence length 435
chains with identical sequence B, C, D
ec nomenclature ec 3.5.1.6: Beta-ureidopropionase.
pdb deposition date 2007-08-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01546 Peptidase_M20 Peptidase family M20/M25/M40
A PF07687 M20_dimer Peptidase dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.360 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2v8vA02
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 2v8vA01
4P45A 5DS0A 2HC9A 4ONWA 4UEFA 2ANPA 2CF4A 4P44A 3SJGA 3GLJA 3MN8A 1LFWA 4ZY1A 3PFEA 1ZG8A 4R7MA 4A94A 3D67A 1XFOA 4MMOA 5LYIA 3PRTA 2PJCA 2XEGA 5LYDA 5CBMA 1CG2A 3I1UA 4A39A 3IC1A 4MHNA 3PB6X 2PJ6A 3KR5A 1VIXA 1BLLE 3KI9A 1F2PA 4X8IA 1NSAA 4IHMA 3FEDA 3PFOA 2CTBA 4MCPA 2C6GA 4X2TA 4MHYA 2O53A 4UEZA 2ZEMA 3WC5A 3N5FA 2AFOA 3B3CA 3VATA 4NGRA 4Z65A 2POKA 4Q7AA 3FECA 4NGQA 1F2OA 7CPAA 1AYEA 4UF4A 3ISXA 3PBEA 2PE3A 3NH8A 4K3NA 3PB8X 2PVWA 1XJOA 1AMPA 4DJLA 3B7IA 1XRYA 5D29A 4FAIA 2ZEEA 4IAVA 3KR4A 3KZWA 2GLJA 4F9VA 3KQZA 3T8WA 4FUUA 1CPSA 1H8LA 5ELYA 3DLJA 3GB0A 1CP7A 5LRGA 4MHZA 3RZAA 3QNVA 1ARLA 1GYTA 4GM5A 4ZY2A 2PJ7A 3NFZA 1R43A 2V8HA 2O4HA 4OMEA 3WT4A 1CP6A 2WYRA 3B3WA 1YMEA 4MXUA 1HDUA 3D7HA 3H8FA 1F57A 2PJ1A 3JRUA 2Q51A 2ABZA 3KHXA 3V7ZA 1IY7A 3VARA 4MRIA 3GUXA 3V38A 2XEFA 4OP4A 1BPMA 1YSJA 1PCAA 2CIJA 1ZG9A 3D7FA 2HB6A 1CX8A 4CPAA 3CPXA 2NSMA 2JEWA 1ELMP 3RAMA 3IFEA 2ZOFA 1IGBA 3IIBA 5LYFA 4FBEA 2GU2A 2GLFA 4JYWA 4DUKA 5LRJA 4TNUA 4PPZA 5K8MA 3S9NA 4EMEA 4MHPA 4BD9A 3KHZA 1BAVA 2IJZA 2PJAA 2V77A 5I4MA 3B2YA 4PXDA 2EK9A 4UEEA 5LRKA 2ZEHA 3TC8A 2DEAA 2PJ8A 4P4JA 2AFMA 5IB9A 4F9UA 5J1QA 1QQ9A 4YU9A 3MRUA 1EE3P 1TKHA 1M4LA 1CBXA 3FF3A 4G1PA 4P10A 4PXCA 5JGFA 3FMCA 2J9AA 2AFXA 3SJFA 5K8NA 4OC4A 3PEIA 4O23A 4F8ZA 2CTCA 3D66A 1VGYA 3H8EA 4NJQA 4DYOA 2ZEPA 1LANA 4AXVA 3WC6A 3S9LA 3VH9A 1Y0RA 3H8GA 4R76A 4ZX9A 1VHEA 2PIYA 5THWA 3SI1A 1LAPA 2ZENA 3KGQA 2ZEGA 2QYVA 1FNOA 3SI0A 2EK8A 2EWBA 3IWWA 2RFHA 4MCSA 4W9YA 4YWYA 2AFZA 3K9TA 2C1CA 1Q7LA 4OIDA 4X3RA 4R8FA 3B3VA 3FEEA 4P4IA 5HVHA 2IMOA 2PJ4A 5F09A 2C6PA 2PRQA 2PJ5A 5D8NA 2V8DA 3PBBA 3DGVA 1HEEA 4EFDA 2PVVA 2FVGA 3PB4X 4ZI6A 2VL1A 4OC1A 2V8GA 2RB7A 8CPAA 2NYQA 5CPAA 2Q43A 2F8HA 3PB9X 4OC2A 3ISZA 2ZELA 3BHXA 5LYLA 4NGPA 2AFWA 1YW4A 1JQGA 1Z2LA 4MCQA 4P6YA 4ZX8A 1Y7EA 2AFUA 1UWYA 4LQGA 3B3TA 5JH9A 3RBUA 1DE4C 2C6CA 3BXMA 1Y0YA 2JBJA 3HUVA 3WC7A 1TF8A 3LWUA 4JZ0A 2G9DA 4P4DA 3FVLA 3KASA 1ZLHA 4NJRA 1XMBA 3FX6A 4NGMA 3WABA 2XEJA 1BPNA 3CT9A 1LAMA 4UIAA 1LOKA 2QJ8A 4OKOA 2PJ2A 3FJUA 4B6ZA 1Z5RA 4NGTA 2PJBA 4UIBA 4ZY0A 3SI2A 5HXDA 3D4UA 2V8VA 4OC3A 3TX8A 3HLPA 1RTQA 2BOAA 2GREA 3BI0A 3D68A 2ZEFA 3IO1A 2IQ6A 2ZEOA 3K2KA 3SJEA 2I3CA 2ZOGA 2ZEDA 4IK2A 3D7DA 1TXRA 2AFSA 4MCRA 2PJ0A 3IEHA 4WWVA 1Z8LA 4NGNA 4OC0A 4ZYQA 4NGSA 3B3SA 5K8OA 1LCPA 4NFRA 2OOTA 3KL9A 4P4EA 3PB7X 4FWUA 2OR4A 1TKJA 3NH5A 1OBRA 2PIZA 5JM6A 1ZG7A 2XEIA 3NA6A 3KQXA 3LMSA 4OC5A 4A38A 4PXBA 2WZNA 3BI1A 4WJBA 1KWMA 3B35A 5HVGA 3FH4A 2JBKA 1VHOA 4P4BA 1PYTB 3IJ3A 4P4FA 3NH4A 2Q4ZA 3L2NA 1XBUA 1CPXA 1HDQA 2QVPA 4R6TA 3D7GA 4A37A 4PXEA 1YLOA 2PCUA 3CDXA 4TWEA 4KSIA 1FT7A 1ARMA 2BO9A 3SJXA 2PJ9A 1ZLIA 4H2KA 3S9MA 2PJ3A 4RUHA 4OIWA 6CPAA 4PQAA 1QMUA 1TKFA 5HVFA 4EWTA 2F7VA 5K8PA 3CPAA 1YW6A 1DTDA 1ELLP 1R3NA 1TF9A 2BCOA
chains in the Genus database with same CATH superfamily
3H5SA 3ZTQA 3P5BP 2HZAA 4DUYF 2EFQA 3RBXA 2KM8C 3PYFA 2C2DA 1PG5B 1RZMA 3L7OA 2HFNA 5DM7Q 1HMVA 1IKYA 1X5OA 5LYIA 1PAUB 3A4TA 4DV6F 4OZ2A 3R97A 2R7OA 2PI5A 1RT3A 1VIXA 3NBPA 2AJ0A 5EWGA 2FHJD 3I55S 2DNZA 3HHLD 3HZEA 3BGFA 5I42B 4CLTA 4NI2B 1FTCA 2CPYA 4K59A 3KLIB 2Z11A 1D9DA 2IFXA 2HFVA 4ZLJA 2PGCA 5KAKA 1RWXB 1HD0A 2F65A 3UCZP 1S57A 1RSCA 2BM0A 3TUJC 4QPXA 2BQRA 1GQEA 1TKXB 1M5VC 3KMSA 3ET6A 3CCMS 4DV7F 4DV1J 1SJ3P 4JI1F 5KOWA 2VFRA 4CH1A 2CY2A 4XTTA 3QAHA 1BQNB 3DRPB 3KLEB 1VLOA 1L3UA 4BBYA 1N32J 2HHVA 4ZY2A 2OELA 2ZJQQ 2XB2D 5G0RA 1X9MA 2RKIB 3V5RA 1PILA 1UW4A 4ED6A 4DCPB 1NKCA 3KWMA 2MQOA 3QO9A 4QUSA 2B5GB 1YRXA 3H8FA 5B0BA 2MMYA 5C42B 2DNGA 5FDLA 4E0DA 3C16A 4F0HA 1I51B 5JQ4A 3OSNA 3BEGB 3EICA 2IYIA 4JWPA 2LU1A 3DM2A 3RRKA 1Y5LB 2BR0A 3HFVA 1BPMA 5D3GA 3H98A 3HPOA 4I2PB 2JEGA 3T5JA 1T05A 4ZVGA 5B0EA 1Y4ZB 1H73A 3SSQA 1FWLA 5KFYA 2CAJA 5IC4B 1VQLS 3ZZZA 2DNOA 1Q4RA 2XSJB 2J8MA 3VAGA 2I9SA 2R7XA 2XSJA 2EPIA 3OD2A 4DMZA 3C14B 3DOKA 2G3AA 2LP4A 2ATLA 1RTHB 4GKKJ 2HFSA 3MM7A 1IKXB 2KYZA 2DEAA 3JAMU 1YRUA 1IBMF 2E5LJ 4PWDA 5IC6B 1IKXA 3FSYA 1RTHA 2HK3A 2FZCB 1OY6A 2HS3A 5J1NA 4U6PA 2VA3A 1YJUA 4LF9F 5E2QA 1TV6B 3I87A 1FFSB 3JQMA 2QYVA 4DBQA 2EXUA 3ZTOA 1UFWA 2MY8A 2OGUA 5KFKA 1GMWA 3CNQP 2M52A 4OADA 1M5OC 3EGZA 4NZ0A 5F09A 1IM4A 1KKHA 4QOTA 4DG1A 1LK7A 2FVCA 1YBUA 2KKHA 4G1IA 4AFFA 4OC1A 1RT6B 1X5TA 4OC2A 2EC0A 4C2ZA 1REVA 1N48A 1AUGA 4YRHA 4JI7F 2YWWA 2OSRA 4A95A 3C14A 4Y2CA 1S77D 2C3OA 2JBJA 4TLQA 1SKUB 3ITHB 4I4BA 3NBPB 1TKXA 2E44A 1TL7B 2GE3A 2L08A 2HHUA 3CSKA 1VRTB 4L3NA 3HJFA 4R0JA 4PEOA 2ZH2A 2F9JA 1HR0F 3CD7A 4EBEA 1UWBA 2PJBA 2YNFB 4PG7A 1W2IA 3Q0AA 2D9PA 3Q83A 3IM8A 1B3TA 3HHLA 2XLKA 3H42A 2M0GB 4U95A 2I6WA 1UVJA 3K2KA 2X1FA 3SDEB 2ZEDA 2ZNZA 4OV6A 4ETZA 2E66A 2PJ0A 2B43A 3QT6A 4CYUA 4WWVA 4KSFA 1FXLA 4ONUA 1F9HA 2ZHOA 1UWAA 1KC8T 2ZDOA 1FDAA 4HNYB 4OYWA 3V2UC 4ECWA 1KLNA 5HO4A 1Z2ZA 2B4VA 3HVAA 2ZW5A 3KLHA 3VF0B 5IV4A 3NAIA 1OPZA 2G0JA 3K9UA 5E7OB 4NEXA 1FRLA 3D4JA 4LSNB 4RNMA 3NMRA 4MBUA 2YQ3A 3QO9B 4JJXA 4NLPA 2JDCA 2VG5B 3L2NA 1JKHB 1ZAXA 2MEWA 2RKIA 2NPIA 4ZOSA 2HQ3A 4MFZA 3QSYB 3KK1B 1JNRB 3M2RA 3S9MA 1DBDA 5D0GA 1Y9KA 2P6SA 1S5KA 4CZCA 3H4BA 3OR2B 3A9LA 3GR0A 3TAPA 3ZNUA 1J5OB 4WK3A 1TF9A 4I49A 4LSZB 1SBRA 4FPRA 4ONWA 5FLXY 1OSCA 4M94A 1L3TA 5KG0A 1MNEA 4MFBB 3PACA 3FQKA 5I3UB 2R7VA 2ZHAA 3AOAA 1VIOA 1WTBA 2CQBA 3RG6A 1MWQA 3TRGA 2V69A 2CJQA 1DARA 1DTTB 1Q2YA 2FHMA 4B9VA 1IBMJ 3J81U 3DLBA 4ECYA 3VATA 2XSFA 1YVOA 2ZWPA 3POTA 2XC9A 2YWEA 5CHCB 1FK9B 3PZJA 4CS0B 2REEA 4DQSA 3R5CA 3FBBA 1BLUA 3C26A 3CJ2A 1TKTA 1O6XA 3UD3P 2PVWA 1AMPA 2I2YA 1TK8A 1W2BR 3CZXA 2HNDB 2E1RA 4ZKAA 4EZ6A 2HAIA 1OYEA 4U8YA 4F9VA 1B7FA 2BE9B 3T8WA 3AXMA 1WHYA 4GVBB 3VGUA 2PQ8A 5E3CA 3AJDA 4Q43A 1YX2A 2O67A 3QRPA 4WKRA 4MYUA 3GFXA 2EG1A 7AT1B 3M8QB 4J9SA 2PJ7A 1S1VB 1S1UA 1IKWB 3MDFA 1QE1B 1KSPA 3E8OA 2OEJA 1TELA 2LDIA 4LF5F 4ANCA 3MEEA 3FFIA 3OHAA 3Q8UA 3DNSA 3V7ZA 2I5JA 4LF6F 2CJKA 3SZ2A 5JVHQ 4OP4A 5BYRA 1WACA 3DI6A 2XS2A 2UVWA 2XLJA 4LF2A 1QSSA 2AJ6A 1BQXA 3IFEA 4AQYF 1IGBA 3E51A 2FVSA 2GGPB 3HX9A 1Y0HA 2YKQA 3MR5A 1YZ6A 3LA0A 4ATNA 2JX2A 4K5RA 4UY8T 1UVIA 4TN2A 2YNDA 4DV3J 4CO2A 4PXDA 4ZVEA 5IB9A 3CCTA 4A8SA 4UCMA 1QQ9A 2JLFA 3QSIA 2GFQA 5H86A 1S4FA 2MKYA 1RT3B 4OX8A 4NCZA 2MKSA 4DYOA 1FRJA 2ZVSA 2ZEPA 2VG7A 1Y0RA 4FF1A 2J7KA 3QFHA 4ZX9A 4MFBA 2Z3KA 3MEDA 1S9GA 3QAEA 5HMYA 2FJBB 1X60A 3R5GA 3M30A 2B51A 5AG5A 4C0HA 4MYTA 4DFPA 3Q8VA 4X3RA 1RT4A 2DGQA 2EBEA 5T14A 3SQGA 4AUKA 1ZH5A 3D8PA 1GH8A 3G4SS 4K4SA 1QSRA 3W6SA 1BQMA 1J2VA 2ZKTA 1EQMA 5IWAJ 5JXSA 2J0WA 3CJTA 2M3DA 5KT3A 4M5NA 1WNEA 2R7HA 3TE4A 1GTHA 1U6FA 2RIJA 2VBQA 3V8IA 1T94A 2J7UA 2MQLA 2MLZA 1GTEA 2QA4G 4P75A 4NF1A 1DAXA 2RQMA 3KFWX 1HNIB 4ZJLA 4KY3A 2CA9A 3PIPQ 3GIJA 2IL4A 1Q8BA 4UIBA 1YIJS 1YBTA 1T9YA 1FX2A 1CULA 2V8VA 2FLPA 1YI2S 5KTQA 3TEGA 1YJNS 1IKWA 2UUWA 3MWBA 4ER8A 2GIRA 4M5DB 4WP8A 1S1VA 2ZH1A 3O6QA 4PZVA 5DGAA 4OYPA 1Z8LA 1ZM2A 4DR4J 2CZVC 3MCOA 5K8OA 2J0QD 1ROFA 4N8NA 4J9OA 3JS9A 3DLEB 2YKOA 5DZ7A 2I1RA 4O3QA 4NEZA 3KJVA 4LFBJ 2NYHA 4M63A 4M3SA 2CQ2A 3NA6A 4ILRA 4YMEA 2FVQA 3KDNA 2VFTA 4CLZA 3RB3A 3CDBA 2KG0A 1IUJA 3W6XA 4KZTA 3ZZOA 4TY9A 4P4FA 2IIHA 2E5HA 3ZZTA 1S9FA 3PW0A 4ZPBA 1OPIA 3D7GA 4EYIB 2DHSA 2XHCA 1RYSA 2JSXA 4XPKA 3TAMB 2ZFHA 2RC4A 5EHHA 2BO9A 2PJ9A 4ID5B 4DS4A 4OX9F 1GMWD 2H65B 1UL3A 1PSDA 1QTNB 1HNWF 4M6IA 3CPAA 1HBOA 4ED4A 4DEZA 4RU9A 3D3CJ 2Q4YA 3MPYA 4RJVA 4I7FB 2QL5B 3IBFB 3PKMA 3N6LA 4OJ3A 2PMWA 1B99A 1F5AA 4QQBA 3C15A 1Z8TA 1WDTA 1MJ9A 1FRKA 2CJAA 1TUGB 4S0MA 3PRTA 1Y10A 2XEGA 4IG3A 2DHXA 2GFFA 3UPFA 3I1UA 3PB6X 2Q04A 3TJ9A 1N6QB 2B9EA 4OX7A 5AE2A 3M9NB 5KFDA 4CAXA 2YH0A 4X5KA 2V5HG 3S6GA 4OZJA 1SL0A 3HK2A 2Z3OA 4IFYB 2DR9A 4TQSA 2L41A 2ZZNA 1D09B 3TZWA 3B3CA 3OJSA 1TAQA 3RU0A 2L3MA 1U6MA 4AVAA 1K73T 3CCVS 1PBUA 4NYPA 3LALA 1AYEA 5A8WA 4MKBA 3VZIA 3H5YA 3E01B 4USHA 4QR2A 4NWBA 2MZQA 1J4JA 1W7WA 2F5IA 2Z56B 2M7SA 2ZEEA 3B82A 4CTAA 3AQOA 3JSMA 2WB1D 5ELYA 1I94F 4YY3F 4N56A 1YBAA 1PC5A 3RBZA 1WG1A 4UW2A 2COLA 1XF8A 3FYNA 3M2VB 2BW7A 3MECB 3D6MB 1WJ9A 3W9HA 1XIXA 2KN4A 2AWZA 1LEOA 1XE4A 1S79A 2PD1A 2VASA 3B3WA 3GIIA 2X1GA 3DHWC 5GAHU 2UUAJ 3MPUB 3Q2TC 3C15B 3M8RA 1NSKL 1FDBA 1R0AB 3O8WA 4V19J 5E96A 2MY7A 3Q22A 1OO0B 2QLJB 5ITHA 1FCAA 1KN6A 1FKOA 4WCEQ 2VG6A 2CQ1A 1O0PA 3EXYA 2YKNB 2E5LF 3JSBA 2FS5A 4A8WA 4G1QA 3TR5A 1H0HB 2RHQB 2N3LA 5F0UA 4OHVA 4B10A 2WOMA 2ZOFA 1FWPA 4LJMA 4ECRA 4XDCA 4F3OA 1RDRA 1B4SA 1WOSA 4LFAJ 2QTWA 5CD4H 4URSA 4YS2A 1HD1A 3MAAB 1SVDA 1NHUA 2BUNA 2DCUB 1BC6A 1OZPA 3UWTA 4R0EA 1JLCA 4EBDA 1RISA 3OPKA 4OYIA 1L3SA 1M4LA 1Q5YA 4DSIA 4K2JA 4C11A 3MMAA 2B6AB 3NAHA 2R9LA 2UUAF 2RS8A 1QM9A 2AFXA 4TY8A 4O23A 4WFYA 4M5HA 2M9KA 4X62F 4CLKA 3LW5C 3J80Y 3MD3A 3SCLE 4E0AA 1FERA 3MMBA 2RHSB 3UR3C 3CIMA 3FKBA 4HACA 2DRDA 4WYWA 2RFHA 5AT1B 2FT0A 2QJ3A 2YKPA 4CLFA 2DXEA 4UA3A 2KM8B 4W9YA 4R5PA 3EO4A 3NGTA 4R8FA 4Y6IA 3FEEA 3N79A 5HVHA 2IMOA 5BXIA 2G2ZA 3DLKA 3QRRA 1GXUA 3DGVA 4UUWA 1V3ZA 1DFDA 4CM0A 3F73A 4ZI6A 2VL1A 1HBUA 1XMQJ 8CPAA 4ZPTR 2Q43A 2F8HA 3R8YA 5AE3A 2HQYA 1K0TA 1R8HA 2NCKL 2UU9J 4K30A 2Q4VA 3J7AN 1PJ6A 3T9ZA 1GMVA 1FJ7A 2RRNA 3IMQJ 1FX4A 2C6CA 3HUVA 2XMVA 1N34F 2EUIA 4KOUA 3AOBA 3D28A 2EVZA 3FMWA 2NLWA 3G8QA 3G8SA 3M30B 1FA0A 2NMTA 4FBUA 2E5IA 1NB7A 2UXDF 3MXHP 1KVIA 3GJRB 2FJAB 5F46A 1UP1A 1A7GE 3D2WA 2IQ6A 1AT1B 4CYOA 3BM7A 2BEFA 5G0RB 1ZAWA 2VJVA 3V6KA 4ZDNA 2VPXB 2FJEB 4OYMA 4NCGA 3D1QA 3G3SA 2LVWA 4FBTA 5E3QA 1TTHB 4R57A 1BXNA 2DJWA 3CJ8A 3S8SA 3IP0A 3NGRA 2E7XA 4XO0A 1H2TZ 1PYTB 3HMJG 4I67A 4ZN3A 4UQTA 1DY3A 3UCGA 1NZAA 4X62J 4KSIA 1HBNA 3MM5A 4JP8A 4DUZF 5DDQC 5EUHA 5K8PA 4KPCA 1YW6A 2VFVA 1R3NA 1WSVA 4U7CA 5HATA 4MJKA 1NUEA 2F8MA 4UEFA 2QA1A 3IRWP 1VHFA 3I5CA 3PFEA 3D3SA 4WU2A 2V2KA 4ZHRB 3UE2A 3Q8SB 1XTZA 5DLFA 2DNQA 4B14A 5KFNA 2P6EA 1V0CA 4MHNA 4C3MA 1TVRA 3W62A 4KV8B 1VRUB 3KI9A 4RW6A 3HZGA 2AU0A 1F2PA 1M5PC 1N0UA 1B70B 1R0AA 3SXNA 5KTAA 1K4JA 1OY9A 5JPHA 2QFJA 3LAKA 2HYIB 5GVQA 2DVIA 2O01C 2FGCA 3HSGA 2YNCA 2HHHJ 3ISXA 5D6GA 3NWGA 3TQEA 1LNQA 3GYNA 1WDDA 5KTCA 2UZAA 5A0YB 4ZJQA 4IAVA 3D3BJ 3VWEA 5HP1B 1JMTA 2JLGA 3DLJA 3GYAA 3FNNA 2B6AA 1CP7A 3ZFVA 4GVLA 1RTJA 3RNZA 4IDKB 1XQIA 3ENAA 5K14A 2MHEA 2HFZA 2B4DB 3KK3B 4Y2AA 4OYAA 1VQNS 4NPOA 5IT4A 5ETVA 2ZJPQ 2ZH6A 2HQGA 2D3UA 3NNHA 3TT2A 4KIAA 1FVSA 1F57A 2D74B 1EB0A 2NSCA 1XC9A 3CXPA 2IM3A 4MT1A 4KH1B 5AG7A 1RT5B 4PSWA 4DV4J 1FESA 4RU2A 1YK3A 2X51A 5DQIA 2LEBA 1SC6A 4Y65A 4DCOB 3FZ2A 1Z4RA 2Z3NA 4CO0A 2FLLA 2YVSA 4ECTA 4UBRA 4U9RA 3H8YA 1CQNA 4IH7A 2BACA 2AHOB 3GYXB 5KG6A 1VDHA 2IVMA 4MHDA 2BDPA 3SCJE 4M85A 3K8VA 1HWUA 4DZDA 2GZOA 5G21A 1SQEA 3CWJA 4H89A 3U1MA 2NUHA 2VIHA 4MI4A 3KKFA 2MXYA 4DV5J 5A8KB 3LO3A 2OPPB 4BWJA 4Z7CA 4FYDA 2FLOA 2ZH9A 2MLYA 4OZ3A 3RB6A 3CB4A 3DDNA 4DL4A 1SUQB 2SXLA 2CPZA 5J2QA 1NJWA 3CDEA 4QWEA 2JDJA 5DDPC 4KE5A 3FRZA 3W1YC 4DZ6A 1NEEA 4LQ9A 2F5GA 5HROB 4U96A 4P7TA 3HSZA 3HI9A 4JI5J 1HFEL 4P6QA 2A2DA 1S1XB 4MCSA 1VQ8S 2YWKA 4QVTA 1LWEA 1L3KA 2CPFA 5A76A 3O2IA 1Q7LA 4OIDA 3CDWA 4YHHJ 1I1GA 3UDLA 2PRQA 2R98A 3W91A 3HD2A 1LXNA 3PB4X 3MMCB 3J81Y 4P74A 5CPAA 2QMLA 1HKAA 2VZZA 4ZPWR 4Y28C 5F3TA 4OHYA 4ECSA 3VAFA 3BHXA 3NOGA 1GX6A 1JLEB 1N5YA 4QZVB 1QTMA 5J1EA 1DRZA 5AXMA 2B9YA 2HK2A 3I0SB 3BH7B 4E8OA 5HK4A 1F60B 2HURA 1ITPA 1C0UA 4UIAA 2DHGA 2ASYA 1KVJA 4CAWA 1ZZFA 1NKEA 1RK8A 4AYBD 2LQBA 1XNQF 2K1RB 1HA1A 1UVMA 1VC6A 4Q45A 2LDYA 3M8SA 2IC3A 1RQ0A 1H7XA 5K20B 3KNGA 2V2VA 1FTRA 3SV3A 1M1KT 1T3OA 3UVJB 1TXRA 2AFSA 3S6HA 5A2QY 2Q6BA 5A2QU 1VRQC 5KFHA 2GIQA 2B4UA 1HI0P 4Q36A 2ZH7A 2OOTA 4IUFA 2VG6B 5DLGA 3NH5A 2DD8S 2GIVA 4DLGA 2GJIA 2JNJA 4RWWA 1WWHA 3VZHA 2D41A 4K4VA 2ZH4A 3W3SA 2AX0A 4RUBA 2IC3B 2HBRB 3QRQA 5M2RA 3TW0A 3G86A 3M32B 4KAIA 3OSPA 2E1CA 1IXKA 1IJFB 3C6TB 1U0HB 1SIWB 2H5MA 1E6YB 2ZW4A 1TP7A 1KUXA 2GV1A 4ES1A 2DR5A 2D7SA 2ILYA 3Q24A 1Q7LB 5KFSA 1UVLA 4PQAA 5I3QA 2QRRA 3KTQA 1U24A 4F2RA 4H4OB 3SBMA 3AAWB 1FRMA 3R1HA 3THPA 2O1PA 1UW9A 2OZGA 2FIWA 5GMKa 2RNEA 1LFWA 3SIPB 2ABYA 3KHHA 4N5SA 4N8OA 2R8HA 1S4EA 4R7MA 3K8WA 2LEPA 3CC4S 2RQ4A 3GYGA 1S7LA 1JLQA 3AOCA 5F9LA 4R8UB 1HHTP 2CQPA 2K06A 1V6HA 4H4MA 1NAQA 3L7UA 2NPFA 5LMNF 2ADBA 1LWEB 4C2YA 4KOYA 1TVRB 2H1YA 1FJCA 2O53A 3ZZ0A 1RP5A 3DN9A 1X4GA 4DL0C 1CBKA 4LQ3A 1GXTA 3PY8A 3BREA 3FK4A 4LBIA 4BC9A 4WTOB 5IQQA 1WEXA 1YITS 1S9GB 3MUTP 4UF4A 4DR6F 1SUQA 1V9OA 4CGOA 9ATCB 3KLIA 2PE3A 4ZP6A 2OEKA 3VVUA 2VPYB 2WVFA 2PEHA 5IM0A 4ALZA 3K89A 1PJ7A 3EZOA 5LSRA 1VKCA 1SH2A 4K4TA 3GJTB 2MKIA 3SMZA 4X4VA 5E5NA 4QYZK 4HNXB 4DV6J 1RWNB 1SH3A 3M8ZA 2B9XA 4GM5A 2NYIA 1WKLA 4MFJA 5F8HA 3TO7A 2BXJA 1N88A 3P45B 4K4YA 3HVWA 3JSRA 1UKUA 2LMIA 1WF0A 5CZXA 2UXCJ 1U48A 4MXUA 4I68A 4I2QB 2F4VJ 3UDVA 1HDUA 5H84A 4O44A 2LCWA 3W60A 4C8NA 4ECUA 2BJ3A 1O5JA 2FJWA 4MIWA 4MK9A 3LACA 4CLYA 1MMNA 1JB0C 1KLMB 4TKTA 2A4NA 4KVME 3V38A 5ETSA 5LXRA 1O51A 3T1YF 3I32A 4NLOA 3CCLS 3OV7A 3D7FA 2GJFA 2HB6A 1D8ZA 4LFAF 2KXHA 2E9RX 5FIIA 1IWGA 1K9MT 2C3MA 3JTOA 2NSMA 4L76A 1EHWA 5KOXA 1YJ7A 2FIAA 5ETOA 1N34J 4IRCA 5A6WA 4IFVA 2E9ZA 1X8DA 3KHZA 2LEAA 1T11A 1Q81T 5LL6d 1WF1A 3HSJA 2HUZA 4F50A 3QBCA 4I69A 4UEEA 5C88A 2AYBA 2GVZA 4USJC 2ZEHA 4AXIA 1SC4B 3LGMA 4I7FA 4LR7A 3MRUA 5D77A 4DR3F 3NWRA 1N36F 2C2ZB 4YOEA 4ZLPA 4KBIA 5HP1A 1Q53A 1RT7A 4KT0C 1PYOB 5JJBA 1YX0A 3MEEB 4MK8A 2DNHA 3MAQA 2AZ1A 1U8SA 2HBZB 3R1KA 2ASLA 4LRCA 3TOAA 2FIUA 3MPWA 1AXQA 3QGGA 4JXQA 2AV5A 3QLHA 3R1LA 4YWYA 3G87A 5FJ4A 3GTYX 4YUDA 2REFA 4E2FB 1S9EB 2R8JA 3AT1B 2A2CA 4PUOA 3PBBA 2K7JA 3FEZA 4EFDA 2HVEA 4KUAA 1LWXA 3EGVA 3R95A 2KL8A 4OX9J 5I0CA 2NYQA 3U02A 3TOBA 1ZETA 3ISND 1J5EJ 1X5SA 1Z2LA 4P6YA 2PI4A 4ZX8A 3RBUA 5AXKA 4PRFA 2P9EA 4EO8A 4UFVA 4M6GA 3MAHA 3W8PA 1XMOJ 1XMBA 2HEKA 2C2MB 3T1HJ 1WORA 3TTHA 2VJUA 3QZ8A 3H2LA 3MPVA 2CNOB 2BSWA 5B0DA 2JFKA 2HSEB 1UA1A 4LFCF 2UVRA 2CZ9A 3R9FA 3VGTA 1U4BA 3BGRB 2NQPA 2WSEC 2BOAA 2IBKA 4I2QA 4DPYA 4OJ1A 2JOQA 2PMHA 2HMIB 1LKZA 3QJPA 3CD5A 3RW7A 2IPOB 2W9BB 4NX9A 3VAMA 3LANA 3LF0A 3WR7A 3L3CA 3KK1A 3BYRA 3BS9A 3OJUA 2J9CA 1T02A 3AD7C 3BPSP 2C2KB 2XEIA 2GHWA 3VVTA 2ZPAA 5HVGA 5HLFB 2HQCA 4HI1A 4A2ZA 5BYQA 2CPJA 4DFMA 4IOCQ 3B8HA 1SKRA 3T90A 3ILOA 4LF4F 3PDNA 1NDKA 1HDQA 2QVPA 1LWCB 4DV0F 3PCOB 2MQQA 2HBQB 5F8JA 3V4IB 1FT7A 3MECA 3SCIE 3W61A 5IS2A 2PSWA 2EKNA 3DRRB 3S6KA 2CUYA 4OI4A 4OIWA 2G0BA 3F8KA 3THTA 3QGIA 1QAXA 4JI2J 3BZQA 5HVFA 4EWTA 2V68A 1KNZA 2OPSB 3OT9A 1NPKA 1Y9WA 1CVJA 4CYQA 3OUYB 4A8FA 5DS0A 3OVAA 1N54B 2XQCA 4ZVQB 4GKKF 3QAYA 3QNWB 1RWKB 1R8PA 2ASDA 3GP9A 3CE8A 4C8KA 4F4KA 4KR0B 3D67A 3FBUA 3DU5A 4H4OA 2VQFJ 3TUPA 2I8EA 5LYDA 3W63A 1YRTA 1VR6A 2CDQA 2KHCA 5J2NB 1HWKA 3DYAA 3EDQB 2KFZA 3L95X 5ISVA 5D0RA 2DNKA 1KHWA 4HACB 1SJFA 4Z65A 3BYPA 3AXKA 4QU7A 4KKOB 2QLXA 1WK4A 3N28A 3OTOF 2Y8WA 1REVB 4K3NA 2OZHA 2LXFA 1FDNA 1A0OB 2DO4A 1HNXF 5KFRA 2CPHA 1JLBA 3KR4A 3PNIA 3MTKA 2ZD1A 3JB9k 1IB1E 5MAOA 1NSPA 3I9SA 1SPBP 1D0EA 3CXSA 1Q7YT 4GRSA 4U5YA 3MFIA 4OZ0A 5G1ZA 3NS5A 3WT4A 2RUSA 5KFVA 5BR8J 2ZBQA 5HQLA 4BWMA 3NL0A 3KNAA 1XMQF 5M2UA 2B3TB 5LJ5Y 3ETMA 4ED1A 1X4AA 4OFZA 1XNQJ 5D4NA 3SQGB 2F4FA 2HVHA 4LF1A 3M2VA 3EPIA 3GFZA 2IVYA 3DRRA 3ICLA 2RJZA 1N33F 4DR1J 4DSEA 5D3GB 2MSSA 5EDWA 5LT5A 1IWAA 1BE4A 4JI0F 2IRYA 4CGLA 1QVFR 2G2OA 1LXJA 4J7CA 3E01A 3HHLB 2VODA 1LW0B 4OI6A 2KYXA 1U8WA 2ZBPA 4OIXA 1PKUA 3UDCA 3EGWB 3DHXA 2B5GA 2DGWA 4PG4A 2DGOA 4RPFA 2GQ2A 4KOTA 5D15A 2QECA 2OPRB 3MMCA 4Z2XA 3CULA 4K4XA 2QSFA 1YZ7A 2R4FA 4PWWA 1U2RA 4F9UA 1EE3P 2YKMA 3MURP 4TYBA 1VOMA 4NYOA 2YX4A 3FMCA 4DDFA 1N0VC 2DITA 2W2NP 3GMGA 3M2RB 4NJQA 4CNYA 4QIEA 2Z3PA 1JXVA 3B78A 1CEZA 3UNYA 2Z10A 4R76A 1TR0A 2J9DE 4LF8F 2MGZA 5M2PA 2DRAA 3N0VA 2KFYA 3P96A 2BJDA 2YNIA 2MGZB 1FNOA 2VBWA 3V6DA 2DBBA 3M8WA 4HDHA 1XERA 3BR8A 4FXVA 2OAUA 2DNNA 2WOMB 8RUCA 2PJ4A 4J5OA 4ED0A 4B3MJ 2A18A 4USWA 4I0WA 1HIYA 3HT0A 4F3MA 5DWNA 1BY9A 5C7PA 1F1BB 4IF5A 2JJ4D 2DCLA 4URGA 4C6AA 3KUHA 3UW1A 3PO4A 2CPIA 2K8GA 2XZDB 3GE9A 1S59A 3ENVA 3JVNA 1HHSA 1UWYA 2XS7A 1QSMA 1HYSB 2GIFA 1JLAA 3FSIA 1HBMB 1KDNA 5CYMA 1WWZA 4CAVA 3U27A 4C8MA 2DPJA 3QLHB 4NGTA 1ACMB 3AA9A 2WRMA 3DOKB 4V1Ak 4N47A 3TA1A 2YWGA 3I0RA 1EZZB 3GSDA 5GMEA 3C3LA 1VQ7S 1RAHB 4O3OA 1F2HA 3PM9A 4F3QA 2CQCA 1TKZB 4FYWB 2B4DA 1FO1A 4GKJF 1XNRF 3ETOA 3P5TL 4LF4J 2WTFA 3DSBA 2KO1A 1CJKB 2ROEA 3FNCA 4QBUA 4L75A 3S1TA 2PIZA 4HTJA 5JM6A 3B54A 3I5BA 5ADZA 2XMKA 1A6LA 1QD1A 2WZNA 3BI1A 1NK4A 5AJ3J 5C25B 2Y1IA 3CCWA 2B8PA 2YGWA 3BSNA 4LR8A 5B08A 6FDRA 1RT2A 4CP5A 1H7WA 1WC5A 1J5OA 3SYZA 5LMUJ 3R2CJ 4AE5A 5L46A 2I79A 1QE1A 3A1YG 3N4WA 2AYMA 1VBKA 3F41A 2W9CB 1RAAB 4ZVTB 2KZMA 4E2AA 4C48A 1WC1A 1JJ2R 4LUBA 4CO4A 2AQ4A 3LP1A 4GO7X 4O4RA 1NH8A 2N4DA 2GVDA 2PJ3A 4NOHA 3T9NA 2RE1A 2VI7A 3SSSA 4M5KA 4O3PA 1TUWA 3K5LA 1NK6A 1RA6A 5J2NA 2CNTA 5C2CA 5B0CA 4ELTA 3CD0A 3CUNA 4ZHRA 2Y1LB 2HKEA 3W9JA 4YHHF 2KFNA 3BO4A 4C0OC 3R5AA 2LFVA 4P44A 4CH0S 2F9DA 1XR6A 2Y0SD 4DV2J 5I42A 3CGIA 2VKRA 4QIWD 1XFOA 4B3RF 2XNQA 2AP6A 2EI5A 1IBKJ 1FFWB 4JI8J 3QT7A 2MDAA 4PK3A 1ZA2B 4NXMJ 4ZVUB 4Y2KA 5DWMA 4Q2MA 1GHEA 1IVZA 3Q89A 1ZTWA 1J5EF 1N4LA 4CNZA 3OTOJ 4MHYA 2B4PA 2ZEJA 2VFUA 2AFOA 2ZBCA 4NGRA 1XOVA 4A31A 3H5XA 3TARA 1T9TA 4HI2A 2YNFA 7CPAA 4DPXA 2VKZG 5HMNA 3EVWA 2MLXA 4ZVHA 3TEHB 1M4DA 4M5DA 2ROPA 4K4ZA 2XS5A 4RBTA 2MZJA 3DRSB 2OD4A 3L09A 1HQEB 3R5DA 3W2VA 3ITHA 4FUUA 1CPSA 3BF4A 3HD1A 3EPGA 4KHPF 2WONA 4LSLA 4WKYA 2DPIA 3RAQA 3K5NA 1GXLA 4K7QA 3MM9A 3NXZA 4UWIA 3HJVA 3W66A 4DLEA 4FYXB 2L9WA 2VUGA 3RRGA 1NDCA 3MM8B 1DTQB 3LGHA 4HPSA 2X7IA 2YPYA 3EJMA 2HFUA 1RWOB 1CS4A 4PV6A 2R7TA 4NCBA 3BSOA 3N6NA 2Q51A 1XJWB 4ZVPB 3HFKA 4M95A 2MZRA 4TLRA 4JI6J 3KHXA 2PR8A 3MCSA 2WVCA 1IY7A 2V4JA 3EUNA 2XEFA 3LP2A 2PE8A 4J9QA 1YSJA 2OPQB 4ZITA 2VOOA 2DNPA 2WPWA 5KG3A 4AL7A 4NSQA 1RT4B 4N76A 4FBEA 2HGNA 4Y3CA 3I0RB 3KUEA 3K57A 4TNUA 1R8AA 2XLIA 4EMEA 3T9YA 3FIXA 2Y1RI 2R8VA 2PJAA 2KXNB 1XIQA 4I6WA 5DG8A 3EZ5A 4WP9A 1WHVA 4FKXA 3H2VE 3X3UA 3LPEA 4CH7A 1X4DA 1CBXA 2J9EA 4ERDA 3BBFA 2FYXA 2B4BA 3QJLA 4B13A 2APOA 1L3VA 4OC4A 3IGNA 3PEIA 4RX6A 4NMXA 5KFLA 4AXVA 1SH0A 4JUZA 8ATCB 2IJRA 3GZ7A 2PDOA 1HQ2A 1LAPA 1F9EB 2FDNA 4ZVOB 3DU6A 1T05B 1XEBA 2EBGA 2QLBB 5DETA 4F25A 1BWEA 4RW8B 4QIVA 2J9DA 3MMAB 2IBOA 3PHEA 1YDLA 1HYSA 3CVKA 2AEJA 4AL5A 2PJ5A 2V8DA 4ZK7M 1GX5A 4KPYA 4QR1A 2YNIB 3Q86A 1ULRA 2MZSA 1TKDA 1QVGR 3SCKE 4PKDB 3GFYA 1ON0A 4NGPA 2AFWA 1BQNA 4LQGA 5JH9A 3PRBA 4UWJA 1FVQA 4HHUA 1DZ5A 3R6LB 4ECXA 3ET6B 1VC5A 5LXYA 2UXBF 4NJRA 2P9CA 4NGMA 3IWNC 3DLGB 4MKAA 4CLLA 1LAMA 1URNA 4CI0B 1NO8A 3UDEA 3G82A 3FCWA 4ZY0A 4YR0A 4JV1A 3MM7B 2YX1A 3JAMY 1EX8A 1S12A 1B64A 2ZH3A 1S7KA 3T1YJ 3R6GB 1IICA 3WHIA 3FEXB 2GREA 4ZP8A 2ZEFA 3I96A 2ZJRQ 3SJEA 3LUYA 2HLTA 2OPSA 3BR9A 1MWZA 4MCRA 5HMXA 1P4NA 1UZDA 2A0FB 2WHOA 2UP1A 2DGTA 4NL5A 3BJYA 1EIYB 5HQMA 1NBEB 2JEVA 3F0AA 3K0JA 1RABB 3M32A 5I3PA 2CJXB 1U1LA 3MMJA 3LMSA 4CTAB 4PXBA 4A38A 2FHJA 1WEZA 4QWBA 4USMA 2DNYA 1RGVA 2GCFA 4C8ZA 2JH3A 3LGNA 1HPZA 1Q8IA 3G8WA 4EBCA 3CCJS 4B5PB 1UWBB 3RR8A 4LF7F 3CMAS 3D6TB 4B9LA 5E3RA 4KFBA 2A10A 4A37A 4B08A 2PCUA 1Q95G 5JMNA 3RR7A 1ZS6A 2MPUA 4O4GA 1S1TA 1FHTA 2BE7D 1H3DA 2K7KA 2YNGA 1IOFA 2Z3LA 1DTDA 1T9VA 2VQFF 2G4BA 2Z2ZA 4B3RJ 2DH8A 1N8RT 2FGOA 3H40A 4UOHA 4KFBB 1R89A 2MKHA 3H7HB 4ZPCA 2HQDA 4QIGA 3PG9A 3DGPB 4MAKA 1HQUB 1RE1B 1WHXA 4II9A 3AB2B 5AG4A 4ECZA 3MR7A 1N33J 3KR5A 2HRYA 4NXYA 4Y49B 4X2BA 1M5SA 3FEDA 4B17A 3CCES 3TAQA 4KLWA 1UVKA 2BW2A 4X65F 2CWXA 4Q7AA 4EZ9A 3FECA 1U49A 1IKYB 3S6FA 1WUUA 2YWHA 4LR9A 3V81A 4CDIA 3PBEA 3UY5A 4F7VA 2LYVA 5ETLA 4M8LA 3MOJB 4O0NA 2GLJA 4RL1A 4K4WA 4KHMA 2ERRA 2F3JA 3G82B 4KORA 2OLWA 1LWCA 3IR5B 4G3IA 3QT5A 3QNVA 3B6BA 4C9DA 3DNCA 2G3TA 4JI3J 4GKJJ 1R43A 1TL7A 2YNHB 2Z2MA 5L39A 2BRLA 3UQSA 4DF8A 2PA3A 1JLBB 1RKIA 2RAQA 1YTYA 2JRSA 4EUVA 4X4OA 1S0MA 2GAGC 4UOGA 4IO1A 2GQQA 2QL9B 1CJWA 4DL2A 4ED8A 5GAGI 3Q23A 1G2EA 1FNXH 1Q2CA 1NDPA 5LM7E 4ETXA 2DGSA 4KUBA 1NMEB 3HHEA 2JFDA 4I2PA 1XR7A 1YVKA 1VC0A 2ILZA 4JLYA 2VBYA 4ILMA 2DY9A 2VBZA 4IQMA 1C0UB 3MR6A 1ZM9A 2BBEA 1C1CB 2HMIA 4CPAA 2DYAA 3VHQA 2RU9A 2ZD1B 3RAMA 3O1LA 3CCZA 3IIBA 5EMIA 2OH2A 1SQGA 3D2MA 2W2OP 2GLFA 3I9ZA 4DUKA 5J1EB 4LVNP 1RO5A 4L8AA 1K1SA 4BD9A 1JLEA 2B9WA 1N5YB 1FKAF 1NM2A 4C3KA 1YGHA 1M90T 4WTYA 3DRPA 3KLEA 3TC8A 3IGRA 3FGVA 4LBPA 1WG5A 2OZUA 2XHWA 3MOZA 3P6YC 5J1QA 2ADCA 3OUYA 1RT5A 1D9AA 4OLOA 4JBCA 4YDXA 1C4CA 2BANA 1IR2A 2Y1JA 2ZNYA 4NXMF 2CTCA 1NU4A 3KJFB 1G7CB 1IR0A 4WBFA 2PN6A 3H8GA 1S1XA 2L9NA 4U7UK 2VFSA 4NA2A 1MMDA 4X4SA 3AH6A 5DM6Q 1R57A 3KHGA 1Z1ZA 3MM6B 4OZLA 5J2QB 4U7UD 2EG2A 3OL9A 2BJEA 4F0YA 4CO1A 4DUTA 3MGDA 4WFAQ 3IA0A 2GA7A 1FD8A 1WD6A 4ORFA 1B7YB 5D8NA 2AW0A 2IRXA 2H48B 3EYZA 2CJBA 4PYDA 2PVVA 2MQNA 2K3KA 3H0PA 3M1VA 2CWKA 2IY5B 1KFDA 2XGQA 1VQ6S 3CCSS 3TA0A 4X4QA 4F4YA 2WUUA 4OHXA 3M8PA 3ZXWA 5F48A 3BKTA 1K0VA 5LYLA 2RSQA 3M6WA 1YW4A 4YN3B 1Y7EA 1RTDB 3BKFA 1MJBA 4C8LA 1JK9B 3WC7A 1Z8WA 4K50A 3FVLA 3OVSA 4OYXA 4WFNQ 1YQHA 4ILLA 1T9XA 4C3LA 4NA3A 1NLKL 1WTFA 1R6VA 1GK8A 2HRUA 2PR1A 4NXNJ 1YLEA 5CAAA 3DMJB 3PXGa 2DEJA 4K0KJ 1U1RA 2XY7A 5KFEA 4R9MA 1MN7A 4NA1A 4A48A 2ZVIA 1WI8A 2E1AA 3LP0B 4NMLA 3EVMA 3NNAA 4CGPA 3A8KA 4W98A 1JLFB 3IR7B 1T03A 4OC0A 3IM9A 3QATA 2D9OA 1NJIT 4JI4J 3KL9A 2OR4A 1X0FA 1VQYA 4RNHA 2DGXA 1T8EA 3PW2A 3QIPA 2AGOA 1DJ0A 5J2PB 3KQXA 2ZE2A 3MUMP 4F0KA 1BO4A 4ZMMA 1QAYA 4F4XA 1QDUB 2XMAA 3IAM9 3NEKA 4A8KA 3WBZA 4KHPJ 2VC0A 4JYAJ 2QGFB 5F8NA 8AT1B 3LP0A 4ECQA 1B6BA 3IBWA 4LUAA 2IAJB 3JSYA 4P72A 1Z9UA 1OYDA 4R3LA 2DHAA 2W1BA 4PXEA 3T19A 1FRIA 4BBHA 4ZIWA 1V5VA 5D78A 5L9XA 3EE3A 4H2KA 3DLLQ 5HAOA 3HVTA 1S48A 2QFIA 4GMKA 1T95A 2VF3A 1QMUA 4H6ZA 1RI7A 5I3UA 4ZPAA 2XYHB 3W5YA 4NZ6A 1N5QA 3WC0A 4DFKA 3QIDA 3KHLA 3PP9A 2JEFA 4JI8F 2VQEJ 1YJVA 1MLAA 2UV8G 4TU9A 4IFVB 3IWXA 3OTCA 4ZVSB 4DR1F 3IC1A 3SFUA 4LF9J 5CCLA 5C25A 1IBLF 2NXEA 1RT7B 1NSAA 4Z7YA 2CQ3A 4QWDA 1P9QC 1NJXA 3ONQA 2QYGA 2ZC3A 9RUBA 2UUCJ 3VQTA 2Y3YA 2HNZA 1JWQA 3IRXA 2LA6A 3W2WA 4QPTA 1SKWA 2R2SA 1LW2B 3PYGA 3PB8X 1Q79A 4KGMA 3CJ0A 3KZWA 3N5BA 1EETB 1H8LA 4NLSA 3GB0A 4NXNF 3I9V9 4CLPA 3FCVA 4B9UA 2I00A 2G1HA 4IG3B 1YJTA 3A3OB 1NKBA 5DJBA 1RHMB 3I31A 5CYMB 2LECA 2O4HA 1S0VA 3QB8A 4P52A 1LW0A 2ZW6A 1YMEA 1QSTA 1F5BA 5IM0B 2JLMA 4EU0A 3SV4A 1IKVB 4FN5A 1ZOTA 4DJBA 5GADI 2ABZA 1M4IA 4ED2A 4PG5A 4K0KF 1GFWB 4MRIA 1ZA1B 4Q5VA 2H5JB 4ZN1A 1EARA 4BMHA 3GKRA 3MZIA 2FXFA 3PRVA 4YB1P 1RBOB 2I0XA 2V2ZA 5D4LA 2JEWA 1I5OB 5LYFA 3KLFB 3I6PA 2GU2A 3SXOA 5L8RC 3PIOQ 2WW8A 4DV7J 4AB7A 2K1RA 3S9NA 4MFQA 1H74A 3TZXA 2M8DB 2VU5A 4IH6A 3TYTA 2IJZA 2FLNA 3ZO7A 4DXLA 1Y9OA 3ZTPA 1SB6A 3ENQA 2AEMA 2IM1A 4P4JA 3C2PA 4DR6J 5ETPA 1HBUB 1IU8A 5L1KA 3KJVB 3SQOP 2GJ2A 5DRKA 4C2XA 4RKUC 3CF5Q 2G2YA 3WIVA 5JGFA 1VBZA 3UVJA 1C0TB 1YGYA 4J37A 5EWFA 3C6UA 2RF2A 4F8ZA 1H2UX 3BPDA 1IYLA 1LWFA 2LXIA 2V0NA 3BDEA 3CDUA 1RLDA 2VONA 4F04B 2Y0MA 4XIUA 2FE7A 1U1OA 3F56A 4C2MA 4YY3J 4RBUA 1UEVA 2VV5A 3PJ9A 4DPTA 1U1NA 2HVIA 4UUXA 3ZNJ1 1PU9A 2C1CA 1F9FA 5EC4A 4P4IA 4OYBA 1KQGB 3CJQA 5A0YA 2FVGA 2DH7A 2MQ8A 1AZSB 4F67A 1UVNA 1K47A 3DDKA 2ZELA 3NGSA 4NLGA 1BMQB 4L3KA 1MU2B 1NMTA 4DX7A 3JYTB 3P8BB 1TK0A 4JZ0A 1CJVA 4LIWA 5KG1A 2YQ0A 1S7HA 1HNVA 3GG1A 3DXBA 3K5MA 1ZBTA 4CT9A 2V2QA 3J80U 1ZLHA 1N5TA 2R7UA 1WKKA 2J7WA 2CNMA 1LOKA 1NK5A 4TU7A 1IBKF 4JI0J 1B0VA 1JLGB 2QE5A 3BGUA 4IOBA 3I5AA 1XNRJ 2EW9A 1CJTB 4K2XA 4AXJA 4WK1A 3CCQS 4USVA 1ELOA 2GC8A 1RTQA 3D2PA 3BI0A 2YXLA 4KYZA 2ZEOA 1S76D 3GU0A 2VA2A 3D7DA 2H4WB 2QZ8A 2DR8A 3FEYB 1E6VA 4KVXA 2R7QA 1AW0A 2JVOA 5BR8F 2W9BA 2RS2A 1PUAA 3D6HB 1Q5VA 4FDFA 4Q44A 2PA8D 2Q66A 3MCNA 3B8GA 1S1WB 5B09A 2BQUA 3LPYA 1SC1B 3EXCX 2EKYA 4ECVA 1I6JA 1MMLA 5EGYA 1FKPB 2KG1A 4CCHA 4M5LA 2CZ4A 1QUPA 4ZIVA 1VYAA 3BQ0A 2ZE2B 4QR0A 4ELUA 2CIMA 4R6TA 3EVOA 1OY8A 4IDKA 4QW9A 2J8NA 3R9LA 4CRYB 2GO9A 3K7RA 2OU2A 2XWYA 6CPAA 5KFCA 4AL6A 2IAJA 2HWTA 2HHWA 2R7WA 4CYNA 3LOUA 4QWAA 1X4HA 4UCPA 3DDIA 3R3TA 3HO1A 2HC9A 2CADA 4DR5F 5HBMA 1S1UB 1UCNA 5F41A 1HI1A 3MN8A 2BX6A 4DQRA 3VCDA 2HNZB 3VV2B 1OQ3A 4MMOA 2QMUB 3TO9A 1TMMA 1MSWD 3GJQB 5E0OA 5CBMA 4ZS6A 1CG2A 2RDDA 1VI7A 2BJ1A 4RW7A 3J7A1 3QWPA 4WZMA 2R8IA 3U7JA 4IO9Q 4WFXA 2C6GA 4OQJA 5A8RA 2KRBA 3EMTA 3P2HA 5A8KA 5ETTA 5L1IA 4DL5A 2G9OA 1UJ6A 3MM8A 4I56A 3WX4A 3CC7S 5HMWA 2CXEA 1DLOB 4FD6A 3C19A 4D3HA 2BKOA 1XBWA 2PFFB 3VAHA 1FNMA 3MM9B 5JVGQ 5KG4A 2D4OA 3K5OA 3DOLB 4ITSA 1Z4EA 1S60A 3OWCA 1BD6A 4LX9A 3IGVA 1QUVA 1U1MA 1CC8A 1RTZA 2OB0A 3DCAA 3BBCA 4CRJA 5KG2A 3TANA 3DRXA 4OJHA 1U0SA 3ILIA 2UV8A 2EK6A 2XY5A 5FVJA 3X1LB 2CQ0A 1N36J 2LXUA 1D3WA 4F4WA 2HQFA 2B5JB 2YX7A 4B3MF 4NCGB 4C8OA 2FSRA 2UUCF 4B02A 3GCXP 2Q79A 1Q0NA 3QT8A 2QA2A 1X9SA 1PCAA 5L9NA 3UN5A 2D3OR 2DNLA 4U9YA 3ZZPA 3UN3A 2Z8QA 4UZBA 4RW6B 3MCMA 5U47A 3ULHA 4JB8B 3MEKA 2C2OB 4NLWA 2HIQA 1TMJA 5F47A 1Q82T 5C24B 7FDRA 2MKKA 2R42A 2GMLA 2V77A 5I4MA 2DT9A 3ZZIA 2W8KA 4N77A 2GVDB 4USTA 2XTJP 2HHHF 2FJXA 2KH9A 4X64J 3OVBA 3OL6A 3KHRA 4ENOA 3W8GA 3TFYA 4KO0B 2BOPA 4B3TJ 4LVOP 3SJFA 5KT5A 2WSAA 2FQQB 2UXDJ 2V94A 3UN2A 4J91A 3TI0A 3PW4A 1RBAA 2NSBA 4GS4A 4PPDA 2MZ1A 4IRDA 2P8IA 5LOQA 5KFQA 3NCQA 3A8EA 2ZEGA 2BA9A 2BEIA 2EK8A 2AX1A 2OI2A 5IOLA 5IT9U 3RBEA 4NRTA 1FJGJ 1VBYA 2R1IA 3FBCA 2ZM6J 4KJIA 3TWZA 4OX6A 4X84A 3IBCB 4LMZA 4DV4F 4DI6A 4OHWA 4U67Q 3ZTSA 3W64A 4USKA 4DR2F 1NSQA 5GAEI 4L6V3 4J9VA 1APSA 4J9NA 1HW8A 5LMNJ 5KFOA 3BV8A 1VQMS 4QBJA 2H54B 3HFZB 3TO6A 1TL1A 2DPTA 1C1CA 2BANB 3FX6A 2XEJA 2CDRB 4FS1A 5AJ3F 3C6TA 1WELA 2QJ8A 4RNFA 2PJ2A 2OTLS 4B9SA 4B6ZA 1Z5RA 1T03B 3J81j 2OTJS 5ETNA 2WVBA 4Q0BA 3N01A 3OTDA 1TFYA 1X12A 3DRYA 1HW9A 1RU2A 4NCAA 5IFMA 1RA7A 3D1OA 3D4UA 3QGHA 2IM2A 3FFIB 2EFVA 1U09A 4XPDC 1P27B 2VOPA 4FS2A 1KOOA 3NE7A 3I3GA 2GNKA 4LFCJ 1S1TB 1HWIA 3A13A 3DMJA 5BYSA 2ZWOA 4DN9A 5KT2A 5K9FA 2OIHA 1VQKS 2FPHX 4ES3A 2HW3A 2MKCA 2W2MP 3W5ZA 4LF7J 2JVRA 1S5ZA 3PB7X 2VXKA 4FKYA 3J7YI 3RJMB 3DKDA 2DR7A 3W7BA 4DS5A 1RHJB 3DOLA 4QYZJ 2XMMA 2O3DA 1FDDA 2C2NA 4NE9C 3B35A 2ZZTA 3KLFA 4P4BA 4A4JA 2QLFB 3BQ2A 4UY85 1DLOA 1TKTB 2YH1A 4DV2F 2RD5C 4JV2A 1RACB 1NJYA 2EK1A 2XI3A 1XBUA 1TL5A 3G2XA 1CPXA 4G1QB 1S0NA 2DXFA 3I82A 3POTB 4IUSA 2D3ZA 5CYQA 5DDRC 4IR9A 4CAEA 3MR3A 1U2FA 4WP3A 1V5IB 4A8MP 2Y8YA 1ARMA 4YDDB 1ZLIA 3KDOA 4LF5J 2OPRA 2ALYB 2CNLB 2QC3A 1NE9A 4CYUB 3FSXA 2CQGA 4DR3J 3SDEA 2GHVC 4P2FA 4XAKA 3H5ZA 2B3VA 4XPEA 3K2YA 5EX0A 1SQFA 5DO2A 1FJGF 1FXRA 1PJ5A 5C2GA 2ZHBA 2AJ4A 2HS0A 3PX0A 2CF4A 3IN5A 3DGPA 5FLXU 3R9GA 2DNRA 3DC2A 2R7RA 1ZG8A 1W25A 4KOVA 4Y00A 3BN7A 1YVFA 4CM2A 2L9DA 3G71S 4DL3A 1KTVA 5AXLA 3T1HF 4HKFA 4YR2A 4IR1A 3SXLA 4K8RA 1Y3JA 3E2EA 4ELVA 1CM0A 4O3SA 4UFXA 2CTBA 4PG6A 3ADAC 3IXQA 3OXGA 2HZCA 4UEZA 2OFHX 1RLCL 1VMBA 5A8WB 1NPRA 4NGQA 1P9YA 1TAUA 3A3NB 4LIRA 4DHVA 1NK7A 4B9NA 3DLGA 4AD6A 3KK2B 2O28A 5EN1A 2O5DA 4RW8A 2W25A 3M9OB 1WOOA 4CGNA 5IT0A 2YKMB 1NNDA 5CA5A 5F8MA 5J8FA 4ANEA 5KFTA 1Q86T 2VZYA 3NFZA 4KKOA 2C1EB 5D4PA 4OHZA 2FCKA 5J1PA 1KHVA 4A30A 2MYFA 4UT4A 3M2UB 3MF5A 2FC8A 5H1SV 1CJTA 2KI2A 2JC1A 2P5VA 2ARHA 4J3GA 1UEUA 5IB0A 1RKJA 5KFGA 2Z57B 2VB6A 2IA6A 5F49A 2ZM6F 4NLYA 2C27A 2YTCA 1ZTTA 4FP9A 4LBHA 4TNOA 1EETA 2HV2A 4M6HA 2E9TA 2VEZA 1IOIA 3L4BC 1S7FA 4N7TA 1QJHA 2UVVA 2BV3A 3RBDA 5HROA 1SKSA 4P73A 1AZSA 2B58A 3GY9A 2HHXA 2PT0A 2H51B 1RTJB 1K44A 5ETMA 1RT6A 2AFMA 3RRHA 3LP2B 4X4PA 1R6YA 4EEYA 1RJJA 2A6MA 4PXCA 5KFUA 1PIEA 4GO5X 5DG7A 3TA2A 4IH5A 3GPAA 2GMHA 5C42A 3EC4A 3DOMB 5AXNA 1RAIB 4YB7A 1NRKA 4PABA 1RHKB 4DCJB 3WC6A 3BJ7A 3QQCD 4WE1B 2U2FA 1MN9A 3PJXA 5F8GA 4FVMA 1SIZA 4U8VA 2J0SD 4MFKA 1PAEX 1R8BA 4FD5A 3M6UA 5A27A 2PIYA 4ZP7A 1FD2A 4W92B 1LRZA 3CJ5A 2O66A 1Y5NB 2YPZA 2G13A 3C6UB 4J9KA 1UJ4A 4LSLB 3M8YA 3WZ0A 2HPUA 1C0TA 4DWIA 3K9TA 3R2DJ 5AE1A 2QIFA 1VRUA 1IM6A 2HLUA 3ILLA 1U26A 2ZBRA 2P0WA 3V6HA 1RWPB 2N3OA 2OFGX 4ID5A 4CT8A 1NB2A 2FHOB 1NXIA 4PWDB 1S6OA 1NK9A 4FNIA 3NP5A 3DLHA 4HDGA 4J90A 3PB9X 3NKYA 3BO3A 1NK0A 1SJ1A 1NPPA 2HHTA 4RWXA 1JQGA 3VAKA 4C98A 2ZBIA 3BXMA 2DTJA 2BQ3A 1Y0YA 1F5CA 2JWNA 3MM5B 2DGVA 1RXTA 1M4GA 3CT9A 2V9WA 2AZ3A 2W9AA 5F0WA 4DR7J 4M1KA 3C46A 4DQPA 3FJUA 1RWMB 3DLEA 4R25A 3NY0A 4L73A 5GAEU 2BZ2A 1UMJA 1RBLA 7FD1A 2JL9A 3EM1A 1IKVA 2FTRA 3PTWA 2P6FA 2QLWA 2J6SA 1S72S 3IO1A 3GSIA 3CXQA 3HHLC 2H5EA 4PUOB 4IK2A 2HS4A 5MLCV 4RW9B 2H9ZA 2JC0A 2W2PP 3Q2SC 3T5KA 1LCPA 4J9LA 1WC3A 4P4EA 3FBEA 1QSYA 4DV3F 3IWEA 4PCQA 4MKVA 2GO8A 5HANA 4A32A 3N7ZA 2C42A 2WONB 3KG0A 1G3OA 4UCNA 2LQ8A 1KQFB 3THVA 1YJWS 1N5VA 5T7LB 3HHNB 4ZLNA 4C0BA 2WVDA 1M1HA 2GGPA 2HGMA 2IMWP 2EFOA 5E33A 1XN9A 3IJ3A 2FC9A 4EGLA 3I4HX 3PGPA 1SJ4P 3D0IE 1YJRA 4X4UA 3WC2A 4XNHB 1TL4A 2HWIA 2AJQA 4NLVA 2ZH5A 1YLOA 3CDXA 3KJQB 1QLNA 4YR3A 1VK8A 1CJKA 2BE2A 3R96A 3SJXA 2E1PA 1VJQA 3R7NB 2UUBF 4RUHA 1G4CA 2HNDA 1P1LA 4X66F 4Y2MA 1FEEA 4XPDB 5HH1A 1EQ0A 1EP4A 4OAEA 2H5IB 4H54A 3NGDA 3GJSB 2ANPA 1HARA 1HMVB 3SJGA 3WQPA 2MHNA 3BGLA 4AQYJ 3KKWA 4ZLLA 2VPWB 4FYYB 1VFJA 4WIQA 5JUMA 5A28A 3BSCA 4A46A 2BUEA 4G65A 5CYJA 4TQRA 2XI2A 4DSFA 3R9EA 2PJ6A 1KBRA 1DQAA 4QJVA 3BH6B 3QAUA 4DUYJ 3IU1A 1TKZA 2XZTB 2LKZA 4IHMA 1S6PB 4B3OB 1CPZA 3AJ2A 1NH7A 4ZPVR 1RAEB 4DQIA 3NE8A 4O44B 4X2TA 4HH0A 2ZITA 4G6VB 4GC6A 2XZWA 4XPLA 4OMFG 3LWMA 2POKA 2H4YB 1T0TV 3HHKA 1VQPS 2PSZA 1HI8A 1F2OA 2HWHA 4CIOA 1KP6A 4WYLA 2CJ9A 3NH8A 2F40A 1REGX 2F63A 4TYAA 3A12A 3VWDA 3G6XA 3OR2A 1DTTA 1G1XA 1R0CB 3J7Z5 1SL2A 3QMQA 2AF6A 3ZTRA 4I1TA 3D7SB 5SUHA 2XMUA 3V6DB 1HNXJ 3IAS9 3GFHA 1LK5A 2DRBA 4LSNA 4OMEA 2I5JB 5DG9A 3TZZA 3BGOP 3VR1A 3EY5A 1YLXA 3VQSA 3P2FA 4D3GA 2VICA 2RDJA 2Q1LA 3V6JA 2HHQA 5KT4A 4JI2F 1FK9A 2CQIA 2OHDA 5G4DA 1PYSB 2J5AA 2M88A 4LREA 2FB0A 3UD5A 1T7PA 2D1CA 4B11A 5LJ3Y 4LRAA 4CQ1A 3H5UA 2B3UA 3T3FA 1ZZNA 1ZM4A 3BKUA 1HQEA 2DNMA 4PQUA 1OS5A 2Z30B 3TUZC 2BMBA 4V19X 4GVBA 4RS2A 2ZZMA 3GV7B 4WZQA 2PFDA 4F4AA 5A6PA 3CMES 3FDSA 2B8QA 2EC2A 4ID8A 2VH7A 3NLCA 3VWSA 5H9EK 2IRUA 2WBRA 3MD1A 1R7IA 1S3ZA 2DXDA 4DNCA 4JXRA 1N5SA 2FL4A 2KU7A 2ZKUA 4QYRA 2AE6A 1Z4UA 3FF3A 2V50A 4DV5F 3IG1A 4MIBA 1UFKA 3ZJ0A 2VDIA 4QU6A 1VGYA 1JLAB 4KB7A 2J8SA 1RUSA 2OEMA 3MM6A 2IJFA 4A8YA 1RWWB 4YEAA 1S10A 3D1HA 2KVQE 2DIUA 2Z2LA 2XY6A 1IQZA 2FY1A 4JI3F 2ZENA 1I12A 3EFAA 5HJXA 4IFYA 4URQU 3N6MA 3ZZRA 2PEBA 3B3VA 2NXUA 1MROB 3T5HA 2ATCB 4DSJA 3CJKB 3TP2A 3HHDA 4RBVA 1NJZA 1KUVA 1N56A 3KK2A 4QW8A 1Q1KA 4UFWA 1TL3A 2Z4PA 1TV6A 3ISZA 2VG5A 4WPAA 1ZPVA 4OL8A 4B5PA 2QL7B 3ENWA 3MUVP 2HFOA 4KGXB 4F8RA 2XMTA 1U25A 1HPZB 2CQDA 1U6ZA 4UQGA 4FF3A 2W4DA 3DYAB 3CXCR 2ACYA 4W90B 2WPXA 3TVKA 3D5MA 3W9IA 4JYAF 1X4FA 4XNHC 3WABA 2JEIA 3IG1B 2Y9HA 3OR1A 4X4NA 1RAOA 1URRA 4HL9A 5IX3A 1RHUB 4C7IA 6FD1A 1S7IA 2CG4A 5CYQB 4LF6J 5HXDA 1FEHA 3LQVA 1QSLA 3K17A 4FXWA 1IN0A 5HN0A 5KG7A 3QJJA 1NHVA 5ETQA 2HVDA 4OZNA 1BOBA 2RF2B 3RYOA 1RAGB 4GC7A 2V9KA 3MEGB 5G20A 4WXOA 2IYGA 3MEGA 4OI3A 1TKJA 1U47A 3QYYA 1HBMA 4WWSA 2CNKB 4OC5A 1Y11A 4NLTA 4EFAC 5IT9Y 4F6AA 2E29A 2Q7BA 3OLAA 1D9FA 1VHOA 2MQMA 4DQQA 1GT8A 2UU9F 2QO3A 3NH4A 3D0HE 2NREA 2Q4ZA 2DY1A 1UZHA 4HYKA 1Q16B 4OI2A 4BINA 3I56S 4FPIA 5HL7Q 2RDIA 3CD6S 3DM2B 3GG0A 3M6XA 4DF4A 2KJVA 3E3XA 4B9TA 2OUGA 2KT3A 4MY3A 3P49B 2I38A 3T6JA 2B4OA 2KHDA 3TZYA 2N7CA 3SI8A 1UPPA 1JJCB 4XDDA 2MZTA 2V34A 4QWCA 3NS7B 3H2UB 5T7LA 3VALA 1M0SA 3TAMA 1RHRB 5AG6A 3GV5B 4I64A 4YFUA 2C3YA 1NSLA 4EK2A 2MQPA 4ZY1A 4NI2A 1RWVB 2MJUA 2E5JA 3TCVA 4Q38A 1KONA 1BQMB 3H4DA 1C1BA 3E0KA 2YNGB 2N4CA 1B0PA 3SHPA 3L7PA 4HNWB 3IS9A 4A39A 4FXDA 2NUUG 4ES2A 5GAGU 4HKQA 4RW9A 1BLLE 2WB4A 2HHSA 4X8IA 5H9FK 1QSNA 4FD7A 1B87A 3HP6A 3CTRA 2Q44A 2ZEMA 3R27A 3ZC4A 3MEDB 3PZPA 2A3JA 5KG5A 2DF5A 3PV8A 3FRYA 2Q6CA 2PC6A 3H90A 4Y2IA 5DDOC 3B7IA 2OKQA 4OJGA 3KQZA 2HG4A 1Y3KA 3OXFA 4DPWA 4PR6A 3HLUA 4KOXA 2KJWA 2OPPA 1ARLA 1I21A 2W4CA 2ZOMA 4Q8FA 1JWWA 3FUYA 1KFSA 3PR5B 4DFJA 2C2RA 3FBFA 1SCJB 5KFFA 2P6TA 5C24A 1EJ7L 2XMJA 5CABA 3CJSA 3BSAA 4ANDA 2V8PA 3JRUA 4FVCA 4IG0B 3JTKA 5IV0A 2E5GA 2AYEA 1KS2A 1NDLA 1OSDA 3O5TB 1FRXA 1K8AT 4LRFA 2AEFA 3F44A 2XULA 4KHRA 4UTGA 2ZW7A 4BS2A 3S7RA 4KTQA 2CIJA 4OLLA 5B7WA 2VD3A 3M6VA 3OFHA 4Q2LA 5H9FJ 1ELMP 2PC1A 1R8CA 1JJ4A 5AGEA 1RT2B 4PK2A 2KB2A 5HQ8A 1KRPA 4PPZA 3GCWP 3RUBL 4MHPA 1HWLA 4RN7A 3R5BA 4M5IA 1VHIA 1YK9A 2CKWA 2ATRA 2OO4A 2Y0BB 2KVIA 3M8QA 2J6TA 1TFWA 3HDSA 1H98A 1WC4A 3HKWA 2ZDPA 2CQ4A 4Z37A 2F8EX 2B0GA 2J9AA 1I3OB 3O3LA 5K8NA 4RUAA 2MJNA 2QSWA 3D66A 2C3UA 2EFGA 3CJ4A 3LODA 4IQXA 2KRRA 2J6UA 3F5BA 3H59A 2B56A 2FZKB 1VHEA 1T9UA 1O8BA 1S6QA 4CAFA 1KQKA 4CLUA 1AFJA 5F3ZA 3UO0A 2V63A 3CMQA 1HR0J 2HBYB 2Q0YA 2HVZA 2V4RA 4JOUA 2KZZA 2F1FA 5EWEA 3EWGA 1R27B 4HT5A 2UVUA 4RI1A 4A8QA 2W2QP 2ALZA 3B4MA 5B0FA 2YNEA 1TU0B 3V4IA 2BE2B 5L38A 4CLSA 4ZVFA 2WZ1A 4AVBA 2V8GA 2X1AA 4KVOE 2RB7A 1KOHA 4HLBA 2J76E 2K3IA 1CSJA 1F3FA 1FE0A 1W26A 3NS6A 2GX8A 3FC9A 3VAJA 4BLGA 3TQ1A 2CFXA 4WE1A 3UR0A 3EGNA 5A8RB 2RVJA 3DOMA 3OHBA 4KSAA 5B0AA 3LTOA 4Q0BB 2WVEA 4C7HA 4NRUA 3JYTA 1TUVA 3G9CA 5ETRA 1HBNB 2FHKA 2R2UA 3OW2R 4OKOA 1ZAVA 4YB6A 3PYDA 1FXDA 1RYRA 2Z0GA 4PG8A 4FZVA 2BM1A 2D69A 1KUYA 3HLPA 1IBCB 4WU3A 3MR2A 1AB8A 1J27A 5C82A 1P0HA 1G6BA 2OMOA 2HRTA 4HH1A 3AY0A 3DFEA 2LQ9A 3NNCA 4NLXA 3K5PA 2XCPA 4NGNA 3RO0A 4DOZA 4MFLA 4R8UA 1N32F 2G1DA 2UXCF 3UCUP 4O3NA 1JLQB 1OBRA 3BJ8A 2XYPB 3IR6B 2NXNA 1E6VB 2KCWA 1JX4A 4P71A 4WJBA 3GV8B 4RUCA 1FWKA 3TJ8A 4WFZA 3FH4A 1UFLA 1U1PA 4BC7A 2JBKA 5CZVA 4NLQA 2VZ9A 1S49A 2FVPA 2AT1B 2BJ9A 5CXTA 2R7SA 1Y00A 3CPWR 1HNWJ 4JI4F 3GWCA 3EX7B 3KLGA 4A33A 2UUBJ 5HI7A 1EP4B 3BQ1A 3JTNA 3VGSA 1S97A 5BWAB 2A6OA 2ASJA 4HHJA 3EZUA 1HWJA 3D9BA 3IS9B 1TKFA 1ZM3A 5E41A 4GXHA 2F7VA 1VLYA 2BCOA 3VTIA 4MJ8A 3OTEA 4P45A 3V4MA 4QC6A 3AD8C 1L0CA 3CJRA 2EO8A 3GLJA 1LQ9A 4P7VA 1X4CA 1GAOA 2XM3A 1U6BA 1XK8A 2PJCA 2DB1A 1ICEB 2R2RA 4AT1B 1VBXA 1VHSA 1I1DA 3A8IA 3NGKA 1PGZA 1YJ9S 1YG0A 2GANA 2DEIA 1CQMA 3PFOA 2IDLA 2Z0ZA 4OZ5A 2HHPA 3TNVA 3N5FA 3A3PB 1FT8A 4RW4B 2RQCA 3W5XA 1RT1A 1U02A 5KFXA 4KC5A 2QIRA 1P1TA 3TVZA 4X65J 1KVKA 2ZH8A 1RT1B 2FD2A 4DJLA 4L72B 3AA8A 3JQKA 5D0EA 3D54A 4PSXA 1ZPWX 2RU3A 4JI5F 2WW4A 4DN0A 3JTPA 4H4KC 2J8RA 3RAXA 3PEHA 1VCTA 1VQOS 3TO8A 1DURA 1E6YA 1LW2A 2D4PA 1GYTA 4ED7A 2OMLA 3RB4A 1RCOB 3GONA 3KUGA 1HQUA 2V8HA 1MK4A 1CJUA 1RAJA 1LFPA 4Y34A 1XR5A 4QIFA 2ZUAA 3G6VA 1CC7A 4EI2A 2KDOA 2PJ1A 1XMTA 1MW7A 2MB0B 3IWGA 1IJEB 3ILJA 3KJNB 4RNNA 3VARA 3GUXA 4XK8C 2JEJA 4L74A 1UEKA 3RB0A 2XEXA 2R8KA 1F3VA 3HCXA 2HNYA 4TVAB 2QYCA 1IYKA 2EWHA 3FJ2A 2YNCC 3JXOA 2FUG9 4MIAA 3KOAA 1IBLJ 2PMZD 4JV0A 4X4TA 2DKOB 5FDLB 1EKSA 3I0SA 1R0BG 2J0XA 2LA4A 4B12A 4HR2A 4JYWA 2LLZA 1Q2DA 5T41A 5KFWA 2VDHA 2XG8A 3ZZYA 1BAVA 3B2YA 1A9NB 2RT3A 1TL3B 2A1BA 2EK9A 4F36A 1SXLA 1M44A 2Z58B 4MKYA 5LRKA 2PJ8A 2CPXA 4YB5A 1WEYA 4YU9A 3LD2A 3AFGA 3MI7X 1TKHA 4R3KA 1HNVB 3KYLA 4DR2J 4H4MB 3GIMA 2EVNA 3PX4A 2XWXA 3DR6A 3H20A 4OI0A 5LSOA 3H8EA 1LOUA 3RTVA 3G8TA 4RNOA 3OL7A 3MHYA 3F0NA 3S9LA 3BGRA 2RRAA 1Q8LA 1KQSR 1CJUB 1X5PA 3KK3A 2NXCA 3KGQA 4JI1J 5GMDA 3C66A 2HQIA 1UAWA 3Q8PB 1YKWA 2DIVA 6AT1B 3WIUA 2V67A 3OLBA 2VBXA 1H2VZ 4M5GA 4AVCA 2W8LA 2GAHC 3ISNC 4F2SA 1U0HA 4KLVA 2B7BB 1WKJA 1Y7RA 2XBPA 2E7WA 1GMUA 2RQKA 4NEYA 1M1GA 3PYEA 1U1QA 3FZBA 4RR5A 1V3RA 2JHEA 5K14B 3R7BB 4CLWA 2AFUA 3M2UA 1MWYA 3US5A 2EEYA 2DHHA 1S7NA 2IHR1 1FRHA 3LWUA 2G9DA 1S9EA 4O3RA 2XO6A 2KT2A 4UOFA 4KO0A 3RGIA 4F02A 4J9UE 5L1JA 1Y7PA 5IV3A 2VHGA 4USUA 3FVYA 2U1AA 3VGVA 5F8IA 4ZBGA 1Q8KA 4AG7A 4OC3A 2JZ5A 3K59A 4ZCKA 1U2CA 4DL6A 5KFBA 3FMBA 1H38A 3T41A 4E8UA 1VQ5S 2Q7SA 1VJWA 1YWXA 1AUDA 1RTIA 1KR4A 1SL1A 4KSEB 2N7YA 2R2TA 4EMDA 3L9ZA 3B3SA 1ZYQA 4NFRA 2AMCB 3OBIA 4OI1A 2ZXVA 4FWUA 3T5LA 2WAQD 4FNHA 4DV0J 3M7VA 4MFPA 1F6TA 5RUBA 1I94J 3PW5A 4ZVRB 3IU2A 2GMJA 3B4DA 4ZA1A 4LT6A 2IM0A 5DZ6A 2MTLA 1RWUA 4KRWA 2PDAA 5F9NA 4DX5A 2RILA 5KFIA 3HULA 2AJ2A 3UD4P 1QAIA 5J2PA 4ZGYB 2ODFA 4I6AA 3SSRA 4RZRA 1KZFA 1S6PA 2WSFC 1HNIA 1KLMA 1TK5A 3IWLA 1K1QA 1TL1B 3FCHA 4KOSA 2MKJA 3C8YA 3MPDA 3LWLA 2CYYA 5SZTA 3OXLA 1ELLP 2WSCC 1JLFA 2WCXA 1WF2A 2FY8A 1CS4B 1YHQS 2EFPA 1EKRA 1SV5B 4ZJOA 1U7LA 1JNZB 2IDEA 4I6YA 1KD1T 5LSLA 1QSOA 2BRKA 1QAJA 2OD6A 2UXBJ 4MTPA 4LQ6A 2J8AA 4FYVB 3OL8A 1RADB 1X31C 3M1VB 2CJYB 4RO0A 4YFJA 3JQJA 2B7CB 1FF2A 1JXEA 1WSRA 2NS1B 5FD1A 4EO6A 2BYCA 3PO5A 4F0XA 1WG4A 2AYGA 3PR4A 3P4UB 2YQ1A 4TXSA 3J7YU 1ZO0A 4O0IA 1TZ0A 2CXAA 5HBMB 1BGXT 5HLFA 5KFZA 1PO6A 2F4VF 3PEJA 2HIYA 1XJOA 4KQZA 5D29A 4FAIA 4OYOA 1NK8A 4F0MA 3KLVA 2V6AA 4J9RA 2R3VA 4HVZA 4R5PB 4DSLA 5LRGA 2QA4S 2G0IA 1JJHA 2CPEA 3QWUA 2V4QA 4DV1F 1C1BB 2XNRA 3V81B 2W7PA 3PHTA 4IOAQ 1TIQA 1CP6A 2CVIA 3DXSX 3G6YA 3D7HA 3K58A 3BDPA 4J9MA 2QT7A 1FI4A 1S1WA 4KGKA 4DUZJ 3GILA 3QGPA 4H4KA 1SI9A 1RHQB 4DU8A 2B5JA 1H72C 2IVFB 2W7AA 3HF5A 3CPXA 2AGPA 4XPCA 2NXJA 3TJAA 4TU8A 5LMUF 4WFBQ 2YY3A 4ZCIA 3Q8YA 2W4PA 5K8MA 3OFFA 2QG9B 1QY7A 2XMWA 4X66J 2FJVA 2DR6A 1NHKL 4C11B 2CPDA 1M5KC 5KFMA 4LFBF 5HJYA 2XO7A 4MH8A 1JLCB 4CO3A 2FVRA 2M5YA 4KV8A 1AUSL 2KTQA 3DLKB 4G1PA 4P10A 5DQHA 4PWUA 2ROGA 3EXNA 3Q8QB 3R5JB 5D4OA 1RCXB 5KFJA 1OMSA 1RTDA 1CJVB 2GS8A 2X3GA 3KLHB 3KG1A 3M8PB 1YQEA 1WHWA 4RLEA 3NGUA 3SI1A 1FE4A 3SI0A 1SV5A 2EWBA 3U1LA 4JD6A 4ED5A 5GCNA 3WX8A 4P2SA 2AFZA 3JSMB 1FJEB 4TY8B 4KH0B 3CJ3A 3KG4A 2DGUA 1S0OA 1DHMA 3CW2C 2EFNA 2ACMA 1HEEA 3CIZA 2GVZB 3CC2S 1WC0A 1T3NA 2QV6A 4P2MA 4Q8EA 5J2MA 1VISA 2M70A 1X10A 4IKAA 2NZ4A 3M05A 4KOWA 2QMWA 2CVEA 4N41A 3MMBB 1D1UA 3TVYA 5CQGA 1DQ8A 4MCQA 1WI6A 1IQTA 3MAAA 1RXOB 3PKYA 3N9UC 2E7VA 3B3TA 1NCLA 1Q78A 4RW4A 3R7SB 2KXFA 2RUGA 4DR7F 1DE4C 2L48A 2BKPA 4M5JA 3HKZD 1JIHA 5F8LA 1UPMB 1VQ4S 1VQ9S 1YREA 4YP3A 1X4EA 1SC3B 2DO0A 4O4GB 2P2CB 5DS7A 3MTJA 5EX3A 2BJ8A 2HGLA 4KGVB 5IQ6A 4NLRA 3SI2A 3D6FB 1SJQA 3OQ2A 3KMQA 4W4MA 2ZUGA 2YKAA 3CO0P 4IG0A 1PC4A 3TX8A 4BHQA 1GEHA 1N52B 1OJ4A 3D68A 1MG7A 4QCLA 4JI6F 2VPZB 5CNPA 4DG1B 4JV5F 3IEHA 3NCPA 4HHHA 1N6QA 4ZYQA 1A2ZA 4NGSA 4ZCLA 1HNZJ 4DX8H 4HT7A 4OV1A 4R87A 2RRBA 5D0HA 2YKNA 3FQLA 3RYLA 2PO4A 1FKOB 1C4AA 2X1BA 4UZCA 3KLGB 3GR1A 1YR0A 5KFPA 2QEXS 3GQCA 2WK4A 2PRBA 3CCUS 1KWMA 3T6BA 4WXWA 1B0TA 3MFHA 4DR5J 1MU2A 2FZGB 1XMOF 3M9MB 4K5SA 2AKWB 2M2BA 2Z3MA 2ZC4A 1UFHA 2LQJA 3NRBA 4ICLA 3BN4A 4NYZA 3RW6A 1JLGA 4DR4F 4CWBA 1F2GA 2CNSA 1KTQA 3S01A 4TWEA 4B3SF 1UTAA 1VRTA 4B5OA 2OSQA 3NOCA 1M1DA 3PW7A 3BLNA 4MY0A 2W24A 2IJNA 4DX6A 3BBBA 4NLDA 3AJ1A 3HXMA 4NLUA 1DQ9A 2C28A 4K4UA 1S99A 2OJ3A 2OH1A 4FF4A 4C8YA 4CO5A 1CLFA 3AODA 4KS9A 2XCAA 4ICLB 4C7QA 2M4MA 4A94A 2KT5A 4IRKA 4NZ7A 5DQGA 4U9ZA 3SFGA 1L5UA 2CNNB 1U1KA 4J9PA 4A8OA 3OFGA 3GIUA 1FKPA 2AIRB 4IYQA 3J7ZT 3U1NA 2HZVA 1IIDA 3TOQA 2G0CA 3AQPA 1AFIA 2BJ7A 3TX0A 1AA1B 5G22A 3BB5A 4MCPA 2W7OA 3NCRA 2DISA 3FXTA 2HNYB 3JUWA 2MSTA 3WC5A 4EVYA 2VQYA 3CO9A 2W01A 2AJFE 3HSDA 3P3DA 2Q3PA 3KXDA 2FJDB 2IA0A 2DK2A 5IXUA 1UJ5A 1XRYA 3CJKA 3LH2S 3I4PA 1JXLA 1MROA 4PAAA 4DL7A 5EBVA 1HLWA 3DRSA 3EDRB 5DGBA 2YWFA 1X9WA 2GHPA 5BJRA 4B3OA 1SJRA 5KFAA 2OP5A 3VAIA 3HVTB 4L89A 4MHZA 3RZAA 1X4BA 4LF8J 3PX6A 3Q8RB 5C5JA 2DH9A 3LAMA 2E1MC 2WYRA 2GW8A 4M5MA 1R31A 2VG7B 1BUXA 4C68A 2QMXA 2CG8A 3D0GE 4YGOA 2CRLA 1GNKA 1XWLA 2K2PA 5J8CA 5J2MB 2K5TA 3M4XA 4A8XA 3GIRA 5KT7A 1SQHA 3CCRS 3FRMA 3QFWA 5IZHA 2C3PA 3AD9C 3OR1B 1LV5A 1ZG9A 5K5MA 5HMZA 1TQLA 2V4JB 1CX8A 5E3PA 1VK3A 4DU7A 2HAFA 3C16B 3UNGC 2NR0A 4CRZB 5LRJA 3OTBA 4JI7J 4LRBA 3IRXB 2WBMA 1S6UA 3O44A 4KGZB 3T1AA 4X4RA 4C97A 1UETA 1CULB 1P6TA 4P2XA 1EAYC 1X0PA 1AROP 3UFCX 4EYHB 4MK7A 2OPQA 1BWVA 2VC1A 2R8GA 1LWFB 1PBAA 1XEZA 4HEA9 1N71A 4PYAA 2W9CA 1OIAA 2CQHA 3HT3A 1NZ8A 1LANA 2GQCA 3W65A 4ED3A 3G96A 3VH9A 3W2WB 1HL6A 1RAFB 4DPUA 2Z2YB 5THWA 4QB9A 4H6UA 4DSKA 2X3DA 1DTQA 2JLEA 1OQ6A 1MJAA 3FB3A 2P9GA 3IWWA 3PRDA 1HBOB 3A8JA 1BHNA 3ZZUA 3WDOA 2AD9A 3MGJA 2C6PA 1U45A 2BKNA 2AGQA 4CYPA 1VS3A 4B3SJ 1F0XA 1HNZF 3NMAA 1X7VA 3PJWA 4F4ZA 1S6QB 4WIIA 3G6ES 2YBVA 2XYGB 2YNHA 4FD4A 2UUTA 1HHQA 2C22A 1M5HA 4DPOA 2LQ5A 2RH3A 1PYTA 5H9EJ 3GIKA 5IWAF 4ZPDA 4OYZA 5CCMA 3S6EA 5D8HB 1D8YA 3H4QA 1TF8A 4E98A 4P4DA 2EBJA 5GADU 3KASA 1WOPA 2DPSA 4PQUB 1BPNA 2VQEF 2PIIA 5ETKA 2XGPA 3HVRA 3OFEA 4F26A 5GAHI 2BL1A 3LP1B 5B0GA 4BDPA 4FF2A 4C4WA 4ZP9A 1FY7A 3AB4B 5HSPA 4JV5J 4LRDA 1H6KX 3NG8A 2QX0A 5CH7B 4HTIA 4UOCA 4BCAA 1RU1A 4OZ1A 1OWXA 2I3CA 2ZOGA 5E3AA 4OLPA 3TUIC 1RB0A 3H25A 3DDDA 3AHPA 3QIPB 3CDAA 3QZ7A 2JDDA 2RMLA 4ZCMA 3DI6B 2P6GA 4AG9A 1JKHA 1ZG7A 5L1LA 1KEKA 1C2PA 4USIA 1RTIB 4Y0FA 3UI3A 3PVXA 4A47A 5KT6A 1FFGB 4WF9Q 2DXQA 1UA0A 2LU2A 2NZCA 4P9SA 1P8GA 3DR8A 2BABA 1Z8XA 2D3O1 3HM9A 3BO2A 1VQSA 5CD4A 3ELHA 3SEOA 4YQWA 2AJ1A 4NASA 4B3TF