2V8VA

Crystal structure of mutant r322a of beta-alanine synthase from saccharomyces kluyveri
Total Genus 147
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
147
sequence length
435
structure length
435
Chain Sequence
LNLPAAAPLSIASGRLNQTILETGSQFGGVARWGQESHEFGMRRLAGTALDGAMRDWFTNECESLGCKVKVDKIGNMFAVYPGKNGGKPTATGSHLDTQPEAGKYDGILGVLAGLEVLRTFKDNNYVPNYDVCVVVWFNEEGARFARSCTGSSVWSHDLSLEEAYGLMSVGEDKPESVYDSLKNIGYIGDTPASYKENEIDAHFELHIEQGPILEDENKAIGIVTGVQAYNWQKVTVHGVGAHAGTTPWRLRKDALLMSSKMIVAASEIAQRHNGLFTCGIIDAKPYSVNIIPGEVSFTLDFAHPSDDVLATMLKEAAAEFDRLIKINDGGALSYESETLQVSPAVNFHEVCIECVSRSAFAQFKKDQVRQIWSGAGHDSCQTAPHVPTSMIFIPSKDGLSHNYYEYSSPEEIENGFKVLLQAIINYDNYRVIRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BETA-ALANINE SYNTHASE
publication title Crystal Structures of Yeast -Alanine Synthase Complexes Reveal the Mode of Substrate Binding and Large Scale Domain Closure Movements.
pubmed doi rcsb
source organism Saccharomyces kluyveri
molecule tags Hydrolase
total genus 147
structure length 435
sequence length 435
chains with identical sequence B, C, D
ec nomenclature ec 3.5.1.6: Beta-ureidopropionase.
pdb deposition date 2007-08-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01546 Peptidase_M20 Peptidase family M20/M25/M40
A PF07687 M20_dimer Peptidase dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.360 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2v8vA02
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 2v8vA01
1BPNA 2ZEDA 5D8NA 4MHNA 1PYTB 3PFEA 3FEEA 4MRIA 1BLLE 3D7FA 2EWBA 1EE3P 4A38A 4PPZA 5LYFA 3B2YA 3KR4A 1F2OA 4MCRA 5F09A 1XMBA 3VATA 3V38A 5LRJA 1IGBA 2O4HA 3PB7X 3CPXA 3IO1A 2CTCA 3D66A 3JRUA 4NJQA 1CPXA 1TXRA 4Z65A 2C6CA 2IJZA 3PB9X 4Q7AA 3I1UA 2V8HA 3NFZA 3B3WA 2J9AA 3KI9A 1IY7A 3WT4A 1VHOA 4X3RA 4PQAA 2PJ3A 4TWEA 2CIJA 1KWMA 2AFOA 3SI1A 2O53A 3FEDA 1CX8A 2PJ2A 3S9NA 3FVLA 3PRTA 3FECA 4R6TA 3GB0A 1Z5RA 2XEIA 4P4DA 4KSIA 5CPAA 4UIAA 1YLOA 3D67A 4P44A 4MCQA 2Q4ZA 2XEFA 2PVWA 1ZG8A 3KZWA 2GLFA 1GYTA 5HXDA 1HDQA 3B35A 2JEWA 4IK2A 3BXMA 4FWUA 4LQGA 2ZEFA 3N5FA 4OP4A 4DYOA 1VIXA 2AFXA 4NGSA 3KHXA 4OC0A 3IFEA 2V8DA 2PJ9A 1H8LA 1R3NA 3PEIA 4AXVA 2AFWA 3BI1A 1TF8A 3B3CA 2PIYA 5K8MA 1FT7A 4A37A 5LYLA 4GM5A 2RB7A 4PXEA 5JH9A 4DUKA 2PJ7A 3V7ZA 2JBJA 3NH8A 2PJAA 4P4EA 2OOTA 2AFZA 4ZX8A 3FMCA 3WC5A 3B3SA 2ZEGA 3BI0A 1PCAA 5HVFA 1ARMA 4NGMA 2PJ6A 2VL1A 2C1CA 1ZG7A 4ZY2A 3H8FA 1F57A 3FJUA 4MMOA 3H8GA 3D4UA 4OC3A 1HDUA 1R43A 4F9UA 1BAVA 5LYDA 2ANPA 1YW6A 4W9YA 1ARLA 1CG2A 3KR5A 3S9MA 1TKFA 4JZ0A 3T8WA 1LCPA 3KL9A 1F2PA 1M4LA 3HUVA 1LANA 3IEHA 4WWVA 4IAVA 4RUHA 5THWA 4DJLA 4FBEA 1Y7EA 3TC8A 3SI0A 3VARA 1QQ9A 4ZY1A 4TNUA 2GU2A 1UWYA 1VHEA 3PBBA 2ZOFA 2ZEPA 4P6YA 1TF9A 2BOAA 3D7DA 1CP7A 3LMSA 2PJ8A 1Y0RA 1YSJA 4G1PA 3KQZA 3WC6A 1AMPA 3NA6A 6CPAA 4OC2A 8CPAA 2Q43A 4B6ZA 3TX8A 2PRQA 2XEJA 3B3VA 2AFUA 2F8HA 4PXBA 3KGQA 4NGTA 4MHPA 5K8OA 1CPSA 3PB6X 1VGYA 2EK9A 1QMUA 1JQGA 4NGRA 4OIWA 4PXCA 3MN8A 4OC1A 3H8EA 3B3TA 3IJ3A 2ZEMA 3DGVA 2NYQA 4EFDA 4YU9A 3PBEA 4UEEA 2RFHA 1ELLP 3L2NA 4ONWA 1XFOA 3S9LA 2F7VA 2GREA 1DE4C 4R7MA 3SJGA 1YW4A 3CPAA 5HVHA 2HB6A 4F9VA 3KHZA 5J1QA 1XJOA 3SI2A 3IC1A 3SJEA 2ZOGA 1AYEA 2C6GA 3D68A 4FAIA 4O23A 3FX6A 2QJ8A 3GUXA 3KQXA 2V77A 4NJRA 1BPMA 4ZYQA 3ISZA 4CPAA 3WABA 4MXUA 4NGNA 4P4IA 1CP6A 3MRUA 1Y0YA 1XBUA 4BD9A 2Q51A 2ZEOA 3D7HA 2V8GA 3BHXA 5CBMA 2QYVA 4P4FA 4ZY0A 3RBUA 4ZX9A 4UF4A 3GLJA 4UEZA 5JM6A 2ABZA 4NFRA 1ZG9A 1OBRA 2WZNA 4MCSA 3PB8X 3CT9A 2PJBA 3IWWA 2PE3A 1XRYA 3RAMA 4PXDA 3NH5A 2V8VA 2PJ4A 2WYRA 1HEEA 2PVVA 1ELMP 4IHMA 1RTQA 3KASA 7CPAA 3K2KA 4NGPA 1ZLIA 2PJCA 2ZEHA 4P4BA 4X2TA 3SJFA 4UEFA 4X8IA 2OR4A 4P45A 4R76A 3SJXA 2JBKA 2AFMA 5K8NA 4WJBA 4OMEA 5LRKA 2CF4A 1LAPA 2GLJA 2PCUA 5I4MA 4OC5A 3DLJA 2BCOA 3PFOA 2BO9A 1LFWA 3HLPA 4R8FA 5ELYA 3D7GA 4A94A 1LOKA 1Z2LA 4ZI6A 4H2KA 5IB9A 2FVGA 3K9TA 4JYWA 3LWUA 2C6PA 5LYIA 1NSAA 4MHZA 2G9DA 2IQ6A 2ZELA 4MCPA 3PB4X 4MHYA 1Q7LA 2PJ5A 1LAMA 5HVGA 4OIDA 5DS0A 4EMEA 2IMOA 2NSMA 4NGQA 4FUUA 4OC4A 1FNOA 2HC9A 3CDXA 2XEGA 5K8PA 2PIZA 4F8ZA 1DTDA 2PJ1A 2POKA 2DEAA 4P10A 2AFSA 1Z8LA 3VH9A 2I3CA 1TKHA 3WC7A 4P4JA 4EWTA 2QVPA 3FF3A 2ZENA 3NH4A 4UIBA 2ZEEA 3B7IA 1TKJA 3RZAA 1ZLHA 3QNVA 2CTBA 4OKOA 3ISXA 4YWYA 2PJ0A 4K3NA 2EK8A 5LRGA 1CBXA 1YMEA 4A39A 3FH4A 5D29A 3IIBA 5JGFA
chains in the Genus database with same CATH superfamily
4NEYA 3ZZPA 2R7UA 3UD4P 2HFOA 5FVJA 1VFJA 2DEIA 2HQFA 3CJKA 1Z8XA 2EWBA 1XEBA 2ZFHA 5D15A 2ZITA 2R7WA 1UPPA 2IJRA 3IR7B 4Y0FA 3OL9A 4LIRA 1Z4RA 2DGQA 4ZGYB 2C6CA 2VU5A 3KHGA 2IRYA 2AYMA 2E9RX 4Q7AA 3NMRA 3LPEA 5KFSA 3ZZYA 4ES2A 3E01A 3R8YA 2KZZA 3MGDA 4OYXA 2QL7B 4KPCA 2FC8A 2VV5A 3P5BP 5IV0A 2W9CB 1HBOB 3O8WA 3S9NA 4JI0F 1RCXB 4ZPAA 1FEHA 3FCHA 3GB0A 4A31A 3FVYA 2IJNA 4P4DA 3GILA 4UIAA 4C2YA 2Y9HA 3AXKA 4X5KA 2GC8A 4CO3A 2YNDA 3J7YU 5I0CA 3PHEA 3FBBA 3M7VA 1S1TA 4PK3A 3DR6A 1TELA 1Z4UA 4NGSA 2G0JA 3GR0A 2DNYA 4OJHA 4FXVA 2ZW4A 4DL3A 3FRMA 4ED3A 4JLYA 2NSBA 3NBPA 3BSOA 4DUZF 2VPXB 1PIEA 2V2VA 4RNNA 3E01B 4OV1A 2EK6A 4NZ7A 4IF5A 5LYLA 4DCOB 1X4CA 4H54A 5HJXA 4DQPA 1Q82T 1DQ8A 2XO7A 3CC7S 1L3KA 1OSDA 4ELVA 3KKWA 7FD1A 2B7BB 4TQRA 2R8IA 5H9EJ 4TLQA 2O01C 3MM6A 5IXUA 1S1TB 2V9WA 3DC2A 4WYLA 2FGCA 3P3DA 4TU7A 4E8OA 3MCSA 2AF6A 3B4DA 2UZAA 3H8GA 1ZS6A 2DH9A 3BH6B 2JFDA 2ANPA 1PAUB 3CDAA 4W9YA 1ARLA 2VBZA 4LFBJ 2UXCJ 1PYSB 4LF7F 2E7WA 2YVSA 2GVZB 5IV4A 1FO1A 1VDHA 2Y1LB 3AQPA 1WHVA 4I7FB 3QSIA 2FLOA 2Y1IA 4X4NA 3GV5B 4C48A 3CD7A 3EICA 1S0MA 4ZPDA 3CJ8A 4DN9A 2HAFA 3MM6B 2ZEPA 1R8CA 4P6YA 1TF9A 1ICEB 4LBIA 1P27B 1CP7A 2HMIB 2ZUGA 4A8OA 3H5UA 1NO8A 3C6UA 5CYMB 1SKRA 5BR8J 3K5MA 3LGNA 2Q04A 2YWWA 5HQLA 2HQIA 4KS9A 2GQCA 2OH1A 3SCJE 1SJ3P 5IC4B 4OHZA 2LA6A 2EK9A 1QMUA 4X62F 4L6V3 4OIXA 4OIWA 4A2ZA 3N0VA 1S7NA 5J1EA 1WC6A 3Q8QB 2OLWA 3ZTOA 2UXDF 2CXAA 1XWLA 2E5JA 2F7VA 3QWUA 4X4VA 3KK3B 3H5XA 1RTDA 1OJ4A 3KHZA 1XJOA 2IMWP 3D6TB 4CYUB 2OTJS 5HN0A 3JVNA 4JB8B 2ADBA 3G6VA 3KLHA 1SB6A 1EP4A 3PVXA 3ENVA 4C8OA 3AB2B 4FNHA 1H2TZ 1JXLA 3MRUA 4BD9A 4HLBA 4LSLA 3D7HA 3IN5A 1EX8A 3NMAA 4B3MJ 2VZZA 4XK8C 4JUZA 1HMVA 4F26A 4FNIA 1BO4A 4URGA 5IV3A 1RTDB 2ZBRA 2OPPB 2PJBA 3UW1A 2C2MB 4IFYA 2KT2A 3RAMA 1U0SA 5CD4H 3W6SA 1LV5A 3MECA 3V4MA 3KLHB 1RA7A 2E5IA 3RB0A 1BY9A 3SDEA 4NXNF 3BLNA 5B0GA 3KDOA 2EC2A 5FD1A 4A48A 2OZGA 1J5OA 2N4DA 2DPJA 2UUTA 4K7QA 4UZBA 3R6LB 4OHXA 3JSMB 2ROPA 1HWLA 5I4MA 2BL1A 2REEA 1V5VA 1HMVB 3FNNA 4K50A 1BWEA 3K17A 2MGZB 3D1HA 1R0CB 2A6OA 3GV8B 2I8EA 3I6PA 3R1HA 2HRTA 2U2FA 5C5JA 3PV8A 5IT0A 4IFYB 2BA9A 4J9LA 2RC4A 3D5MA 3MECB 2O1PA 3GYNA 2YNFB 4PG8A 2ILYA 3SDEB 4U95A 1LAMA 1WKJA 1XNQJ 3N01A 4FPRA 5JPHA 2M52A 3TVZA 4ED1A 2DNZA 1M1GA 3TAMA 2NXCA 4KOSA 2JEJA 2W2NP 2PIZA 3OTOJ 3ENAA 4MH8A 3AA8A 1RT6A 1UEUA 4IG3A 2BJDA 5LJ5Y 3R96A 2WCXA 4Y2AA 3NGDA 3OL6A 5A6WA 1RXTA 3N5BA 3QNVA 4DWIA 3KWMA 4A4JA 4I69A 3DHWC 4DCPB 5JGFA 4OQJA 4XPEA 1N56A 4KBIA 4PEOA 3D6HB 3DRSA 1IQZA 1X60A 4AVCA 1KOHA 2C27A 4XPDC 3BO3A 1MMLA 2CKWA 2VC1A 3QPIA 5F09A 2BRKA 2LP4A 3MOZA 2E1CA 3EPIA 4ANCA 3D2WA 5D4LA 4IG3B 1RWVB 3B8GA 4A8QA 5A76A 2HZAA 2V68A 5B0EA 4QCLA 1MJ9A 3U7JA 2C2RA 1GTHA 2BE7D 3FEDA 4GMKA 1CX8A 2HHPA 4ZCLA 3OXLA 4R6TA 2HWIA 4AD6A 2DRAA 1OY8A 4AG7A 4P44A 1N5SA 2BACA 4NXYA 2JZ5A 5A8RA 2QA4G 4RUCA 1S1VA 2LKZA 1F5BA 1RI7A 4R0EA 4K0KF 1GMVA 5KT6A 1D1UA 8AT1B 3JTNA 2AW0A 1LW2A 2PJ9A 1GFWB 1SH2A 4CO5A 5A2QU 1S4EA 3B3CA 1IBMF 4ZP6A 4WFBQ 3OJUA 1KLNA 4A37A 3RAQA 5EHHA 3TUZC 3PO5A 2B8QA 4N7TA 4NLYA 5J2MA 1FJGF 4NX9A 4QWDA 3H59A 4IUFA 3MTJA 4P4EA 4NLGA 2MKIA 4KHMA 2EKYA 2ZEGA 1S1VB 2J76E 1CULA 4UW2A 3OFEA 3ELHA 3W2WB 1HNIA 4WU3A 1X0PA 3O5TB 1R27B 3JTKA 1DLOA 3GONA 4OI0A 3FEXB 1KTVA 4H4KC 3VAMA 2GAGC 1VQOS 1S0OA 1F2PA 4HNWB 2KVQE 1FERA 4DPXA 4RUHA 3CCJS 4OLLA 4ED2A 4FBEA 1I1GA 1EQ0A 1KQGB 4HACA 1R0BG 4P2MA 3PX4A 4ZVHA 2FIAA 1T3NA 2HVZA 3I9ZA 4QIEA 1CULB 4CRYB 2DNLA 2NQPA 4DSLA 1N54B 4CP5A 3KQZA 1C1BA 2PC6A 2RUGA 4B6ZA 1UVJA 2XEJA 3WHIA 2LA4A 4QBUA 2NS1B 4IOCQ 2MKSA 1U1LA 3SIPB 4J9OA 4J9VA 4RW6A 4MFPA 3EX7B 1M4DA 1FRXA 2R7HA 3UN5A 3TE4A 3RB3A 3MN8A 3NG8A 1EIYB 1LOUA 4JI3J 4KSFA 5ETNA 3OXGA 4P2XA 3VALA 4AG9A 4A32A 2HHVA 2QYCA 4I64A 1WHYA 4CGOA 1W7WA 2Q6CA 4CM0A 3T3FA 1MROA 4CYNA 2WHOA 4H4MB 2E7VA 3SJEA 1AYEA 4WKYA 1SC6A 1JNZB 2MSTA 5AT1B 3HHLB 5KFEA 5FLXU 2KJWA 4DSIA 3D1OA 2F8EX 1CP6A 3MAAB 3PYFA 4C3MA 1JLFB 1IICA 3OLBA 4C11A 4DBQA 4ZPTR 1Z8WA 4XIUA 3IU1A 4AL5A 4RNOA 3T1YF 5HH1A 1FKPA 1UL3A 3R97A 1OPIA 1RAFB 1RT3A 3ZZIA 5KFXA 2IY5B 1KEKA 4J9KA 3QBCA 4IHMA 1RTQA 2G1DA 1Y7PA 2CQCA 3H2UB 1UA1A 3NS6A 2EFNA 4M1KA 4X2TA 1TK8A 3HVTA 3KJFB 2RQCA 1PO6A 1RT7A 2QX0A 3NEKA 4DOZA 4ZS6A 4C11B 4ZN3A 4RBVA 1YJ9S 3J81j 1ZTTA 1GHEA 5IZHA 3KJNB 2IRXA 3R5AA 4U5YA 1RT3B 4U67Q 2J7UA 2CZ4A 4LSNA 3PX6A 1QTNB 4KT0C 2Y8WA 2AZ1A 1GXTA 4NF1A 1RT2B 4MHZA 1N5VA 2ADCA 1T8EA 3K5PA 4FD6A 2YKNB 5KG6A 1XR7A 3GJTB 4DF4A 3B4MA 4F7VA 3HVTB 1SL0A 5I42A 5LMUJ 2B4BA 3OV7A 2DY1A 4PG6A 5K8PA 4PYAA 1KDNA 2PJ1A 2P9EA 3F0NA 1Q79A 4CGMA 3IBWA 3JQKA 4EWTA 4OJ1A 2X3DA 2ZENA 5F41A 2MQPA 4A95A 4M85A 4G65A 2RHSB 3AA9A 3EGWB 2OSQA 1LRZA 2V63A 1HNVA 4PAAA 4MFBA 3JQJA 1ZBTA 1BQMA 1WHXA 5D8NA 1HR0F 4HI1A 4B9MA 2E5LF 3NGRA 4B3OA 4USWA 1CS4B 4MIWA 3T6BA 1N52B 2OPQA 1DQ9A 3V38A 3KLVA 2ZH4A 3H90A 3M6UA 3TZZA 1TL4A 4DEZA 4Z65A 3HSJA 4RU9A 2CNOB 3MMJA 4JI7J 3P6YC 5LSRA 3TO9A 2JH3A 4NCAA 4CH7A 4KUBA 1S1UA 2K5TA 1E6VB 3A3PB 3MEDB 5KG3A 4DCJB 1QSOA 3D0IE 4MFBB 1NPPA 1NHVA 3DDKA 2AGOA 1ROFA 1BQMB 3FECA 5DG9A 4WKRA 3ZC4A 2L41A 1U47A 4B3OB 2H4WB 4OHVA 2HHQA 2R8VA 3TTHA 4LVOP 3KZWA 4JI5J 3BXMA 3ILIA 1OYDA 4ZHRA 3PYEA 2VXKA 2DIVA 3PZPA 2ZM6J 2DNRA 4USVA 4MJ8A 3IXQA 3LP2B 1R7IA 3RRHA 1TF8A 4F3MA 4PV6A 4UWIA 2JEIA 5GMDA 3I5AA 2R9LA 2M8DB 5L1KA 1Y9OA 1VISA 2AJ1A 4DSKA 2YNEA 2YX7A 2QMXA 4JV5F 3OL8A 1HNZF 2B3UA 4Y49C 4DG1B 4ZX8A 3OW2R 2LDYA 2OGUA 1O6XA 1QSSA 2P6TA 4YGOA 2JWNA 3EO4A 5DGAA 2CNSA 1F60B 1TIQA 3ZZTA 3DYAA 4F4WA 4M5NA 4LF9J 2X1BA 1T7PA 3QAHA 4IR9A 4RZRA 3LD2A 2PT0A 3QFHA 1WNEA 3OHBA 1G1XA 4P72A 1KSPA 2MQQA 2RKIA 4ONUA 4B13A 4MKYA 5GMEA 5F3ZA 1ZAVA 2RU9A 2BJEA 1C4CA 4ECYA 2GVDA 4QR0A 4YFJA 3M4XA 3NNHA 2HYIB 4PSXA 4P2FA 1NSPA 2JHEA 1YSJA 3W62A 4RUAA 1PKUA 3DYAB 4OYMA 4M6IA 1QJHA 2ZHOA 1RZMA 3OR2B 5LMNF 2Z0GA 2KYZA 2VQEF 1BOBA 5B0AA 2YNIA 2HVHA 8ATCB 4QC6A 1RCOB 4L75A 2HGLA 2W24A 2RRBA 1M4IA 4HKQA 2D3O1 1T3OA 4NLDA 5F8HA 1YQHA 1S7FA 3BEGB 3RU0A 1FVSA 2RF2A 2V94A 3IJ3A 2QSWA 3CDWA 1S4FA 4PWDB 3F44A 3QIPA 3VQSA 1IB1E 4R7MA 3PZJA 1FCAA 4JP8A 1QE1A 1B87A 1MN9A 5J1QA 3HSDA 4IDKA 1U4BA 4HTIA 2ATRA 3L7UA 2C2KB 3D68A 4J9PA 1T03A 5B08A 2V77A 1BPMA 1RO5A 5KFRA 1XEZA 2DRBA 2YNIB 1KTQA 4MXUA 1S1XB 3LGHA 1JXEA 2KVIA 1VI7A 4C8MA 3POTA 2RU3A 5CZVA 4ZPCA 4UTGA 3MDFA 1HL6A 2VFTA 1GXUA 4U96A 4P4FA 4IOBA 4CLZA 1DTQA 3RBUA 3MXHP 3S1TA 2KDOA 5L8RC 5KFWA 5C2GA 1M0SA 3RR8A 1HA1A 4NSQA 1T11A 5KT3A 4KOYA 4ZP9A 3TR5A 4B3RF 3C14A 1G4CA 1T03B 1XIXA 2KO1A 1F9HA 2DIUA 2JFKA 4ER8A 4IH6A 5AJ3J 2HS3A 5CH7B 4DMZA 4AXIA 3POTB 2OR4A 2B9YA 1I21A 4DXLA 1R57A 4R87A 1R0AA 3CO9A 1REVA 2XNRA 1DTQB 1NJIT 1J2VA 1M1DA 2XYPB 4WU2A 2WZ1A 1FRLA 1I1DA 3DOKA 5A8KB 3VWDA 2E1AA 3DRXA 5M2PA 4M5DA 2ZH9A 3C2PA 4K4VA 2V8PA 2D4PA 1KLMB 4B3TF 3HFVA 2V4QA 3H40A 1GXLA 2RHQB 5C7PA 3VAGA 3KLIA 5DS0A 3CVKA 1GMWA 1YJNS 1R0AB 1Q1KA 3TJ8A 3CJTA 1UVKA 1NH8A 4RPFA 1Z8LA 4L89A 3D3BJ 1SH0A 2I3CA 2IIHA 3QT7A 3MAHA 3W64A 2ATLA 4M5DB 2RS8A 1UWAA 2X7BA 4H6ZA 4WP9A 2VPYB 1H72C 2AJQA 1YJ7A 1HKAA 5CA5A 1UJ5A 2BSWA 1YIJS 3QZ8A 4G1IA 2ROEA 2JSXA 4LF4F 3E0KA 3PFEA 4O44A 1FF2A 4LBHA 4F8RA 5B0DA 4QVTA 5HP1B 2DXQA 4ZPWR 4CI0B 2MQNA 3S6GA 2BM1A 2CJBA 3QJJA 1EZZB 5RUBA 3IO1A 2DGSA 1CPXA 1TXRA 4Y2CA 2VJVA 2V8HA 3DKDA 3GYAA 3NNCA 2R8KA 4ZVOB 1RBAA 1WI8A 1S60A 3BH7B 2CJKA 1BLUA 4I49A 3T9NA 1TR0A 3DI6A 4EI2A 4OZ5A 5IT9U 5I3UB 3V6HA 3BBFA 4O44B 2FLLA 4J9NA 1OYEA 4WZMA 3NGUA 3RJMB 3MI7X 3N5FA 4EYIB 1PC4A 3HHDA 2R8JA 2VDIA 3X1LB 5GADI 4X2BA 2FGOA 4KSAA 2OTLS 1C2PA 1X4DA 1XR5A 2QMWA 1FRKA 3PXGa 1RKIA 3MMBA 2DBBA 2HFUA 3JAMY 1K73T 4K5RA 1MWQA 1ZH5A 1U6FA 3DI6B 2FVRA 4QR2A 1WHWA 1J5EF 2XSJB 4MAKA 1VQMS 4YOEA 4DX6A 2UU9J 4YP3A 2OMOA 1HNWF 4YDXA 4DUZJ 3C26A 2XMVA 3MM7B 3O3LA 3L4BC 2Y0BB 2PJAA 3A1YG 2OPRA 3SSSA 3PKMA 1X4AA 4ELTA 2KXNB 4Q44A 1VOMA 4NGMA 2CWKA 3R5CA 5D0RA 3GFXA 4ZY2A 2BW2A 4OC3A 3VGSA 4J9SA 4F9UA 1BAVA 4WE1B 3T6JA 5LM7E 3OFHA 1YW6A 1SKSA 1MU2A 3QAEA 3RYLA 3MMBB 2HRUA 3G82A 4ZVTB 3SBMA 4DL2A 1F2GA 3UR0A 3KLFA 3KTQA 4L3KA 2J8AA 2B7CB 3CTRA 2L3MA 1Z2ZA 3M2UB 3VV2B 5KFKA 3GV7B 1FFWB 3CDEA 2YH0A 2OPRB 3D8PA 2EC0A 4LF7J 2ZOFA 3N6MA 2FDNA 1NH7A 2UUAF 5A8WB 2P6GA 2CQDA 3G96A 5EBVA 1D0EA 3UVJB 1L3VA 1G6BA 2Q43A 3ENQA 1JWWA 1LK7A 2J0WA 2GZOA 4B5OA 1VGYA 1GEHA 3G82B 2K8GA 5C42A 1HBMB 4FVMA 3PJWA 3W6XA 2RUSA 3FMWA 5IM0B 2EFOA 2B4UA 4F0YA 4EFDA 1T9UA 4FBTA 2CQGA 2BUEA 1IOFA 4QPTA 1V3ZA 2DT9A 1NJYA 4MK8A 5DZ6A 2XS7A 1UEKA 1FRJA 2WRMA 5F9LA 2CA9A 2ZE2A 2HHTA 1NM2A 4ZLPA 1VK8A 2EBEA 2A1BA 2CPZA 4P4IA 4UFWA 5F48A 1Q2YA 4RW4A 1EETB 4LREA 1AROP 2XI2A 5EWEA 1RHUB 1OZPA 1F5AA 2Z56B 4B08A 1MG7A 1X9SA 4DV3F 1IR0A 1NXIA 4TVAB 2HFSA 4QZVB 1UW4A 3DNCA 5DM7Q 3EVMA 2YQ3A 3SHPA 3PB8X 1T9TA 3HPOA 1S12A 1IKWB 3HMJG 3TAPA 2CPXA 3SEOA 3W65A 1Q2DA 2HNDA 2VPZB 3NGKA 4OZ3A 3MPDA 2K7JA 1G7CB 3QGHA 4ZOSA 2DR5A 4RW4B 3WQPA 4FXWA 3DMJA 1X5SA 2G2OA 4U8YA 4NI2A 3CSKA 4NCBA 3IWNC 2BO9A 4UCMA 4ENOA 1TK5A 2HK3A 3IGRA 1N0VC 4OYWA 1JJ4A 2YKPA 3S6EA 4BMHA 4OHYA 4CRJA 4H2KA 1RGVA 2EUIA 2N3LA 1E6YA 1QDUB 3V5RA 1RWNB 1QAIA 4C8ZA 1DHMA 1TV6B 2K1RB 4FS2A 1NKBA 2P2CB 4KV8B 1ZM2A 2VG7A 4B17A 1H7XA 4QPXA 4K8RA 2B4PA 3QGPA 4RWXA 5KFNA 2LMIA 2LFVA 4DLGA 3PY8A 4KH1B 3M8QA 3RBXA 2GA7A 4OI1A 3KFWX 2QMLA 3HK2A 4OI3A 2ZPAA 3TUPA 4D3GA 1IIDA 2KXHA 1QUVA 4OKOA 2QSFA 5LXYA 3PG9A 3Q2SC 2FJBB 3GIRA 1WOSA 3TWZA 2PE8A 5L1LA 3F0AA 3DR8A 2A0FB 2HBZB 4O3NA 3WIVA 1BLLE 2Z3KA 4BBHA 4N8NA 4MKAA 5HATA 3CPXA 2CTCA 5F8JA 2XCAA 2ASJA 4DR3F 2WSCC 1RWMB 2BR0A 2RRAA 4TKTA 1XBWA 3PJ9A 2DPSA 4UFXA 2M88A 2G4BA 1HQUA 4TWEA 3HF5A 1NJWA 1BQNA 4Q43A 1GT8A 4J37A 3TANA 2M70A 2HLUA 2YX4A 4QWEA 2OI2A 1F2HA 3FIXA 2ABYA 3PHTA 4LMZA 1VQSA 2BKPA 1RWOB 5KG4A 3B35A 2LEAA 4KGVB 3IR6B 3VAKA 3R9EA 4A8MP 2HBYB 4OYAA 3CJRA 3TFYA 5IQQA 1VQLS 4DR7J 1U0HB 4DV7F 3MD3A 2HKEA 4K0KJ 1VK3A 3JXOA 3FEZA 2VF3A 2CVIA 2GIFA 4K59A 1S6QB 5E0OA 4WCEQ 4PXEA 4CLYA 5CYJA 4LRDA 3NH8A 3RB6A 4FKXA 4NYZA 4DUTA 2CQPA 2RAQA 1TKZB 3L7PA 2AFZA 3ET6A 2BM0A 3WDOA 2ZDOA 2C3UA 4OZLA 4Q36A 3OD2A 1RWWB 5ETPA 3FUYA 3M32A 4MFJA 5M2UA 1HDUA 5LYDA 4HT7A 1N36J 4LQ3A 3KK2A 3T5KA 3MF5A 4I2PA 3LGMA 3OVAA 1U45A 1HI8A 3SI0A 2FD2A 1NBEB 3FQLA 3UCGA 3D6MB 1W25A 4ZVUB 2MDAA 4MKVA 5DS7A 3LMSA 4U8VA 5DZ7A 3FXTA 2DHHA 3WC6A 4MT1A 2CNNB 3D4JA 4BWMA 4NGTA 3QZ7A 1FWPA 3KK2B 3HHLC 2ZH7A 5KT5A 3CUNA 1A9NB 2L9DA 3C16B 4NYPA 3Q8VA 5BYSA 2GW8A 3UD5A 5KTQA 4OZ2A 3QT6A 3GCXP 2WUUA 4NRUA 4R5PA 2YNCA 2P9GA 1FNMA 2L48A 3MD1A 3EZ5A 2DITA 2A3JA 4OZ0A 1M1KT 2O67A 1VBKA 1TMJA 3G8WA 3CPAA 1XNRF 5D3GA 2IAJB 3TO7A 3GSIA 4ZLNA 2AU0A 3MR7A 1IJEB 3FX6A 4KORA 4ECXA 4NJRA 4CPAA 1P6TA 4C98A 3MR2A 4JWPA 4R57A 4LFAF 3GWCA 1SV5B 4Y2KA 1EJ7L 3ISNC 1VCTA 4F3QA 1EARA 4R5PB 2YY3A 3HJFA 1SBRA 1XMQF 3W8GA 1PUAA 4CAXA 5LXRA 2YWGA 3FBFA 4TY8A 2CPIA 2YPYA 2JEGA 2WZNA 5JMNA 1S7KA 1HIYA 1LFPA 3CCWA 3NH5A 2FVSA 3LWLA 1NK7A 3BKTA 1Q0NA 2I00A 2DHXA 4HI2A 1AUSL 1RT5A 3PX0A 2IBKA 4WZQA 3EPGA 3WBZA 2MQ8A 1X4GA 2PIIA 2DHSA 5K8NA 4WJBA 4CYOA 4OMEA 5K20B 2AD9A 4R25A 3QRPA 2YKMA 1RAEB 3PFOA 2H65B 1U2RA 3BF4A 4F36A 3FKBA 1I5OB 1Q95G 2J6SA 2HFNA 1LWFB 3UI3A 3H20A 1N8RT 2IC3A 4LR8A 2BUNA 2ZH2A 4K4UA 2B0GA 1QVFR 1R6YA 2DVIA 2EFPA 1WD6A 1B70B 1VQ8S 3HLUA 1OO0B 1JLBA 2C1EB 4MCPA 4MTPA 1URNA 4Y6IA 2IMOA 2J6TA 2E1PA 1WOPA 3MEEB 2XSFA 3IRXA 2J8MA 3JYTA 1EKSA 1RAOA 2YKMB 4U9YA 1FK9B 5CZXA 1IR2A 2AFSA 4TYBA 2W4PA 4ZJQA 4C8NA 1RAGB 3FF3A 3IS9B 3HSGA 4USKA 1LXNA 3DOMB 1X8DA 3RZAA 1TKTB 3CJ3A 2JNJA 3KHRA 1JLBB 4J5OA 3A13A 3HT3A 3IIBA 3BGRA 4L3NA 4YR2A 4DV2F 3EGVA 3ZZZA 1GQEA 1Z1ZA 2BMBA 2CDRB 1ZTWA 1RYSA 2VH7A 1YKWA 3JYTB 1RLCL 2DNPA 1IGBA 2FS5A 1HR0J 2LXUA 5CABA 2BDPA 2KTQA 2E5LJ 2N7CA 1OS5A 2OD6A 4EZ6A 3LACA 4UY85 4O0IA 1CJWA 3WX4A 1S49A 5E96A 3MEGA 1UKUA 2OUGA 2M3DA 1VC5A 2WW4A 3M05A 5HMXA 2NSCA 2AFOA 1K4JA 5DQIA 2ZJPQ 4M5IA 2P0WA 1VHSA 2FZGB 3TO8A 1RTHB 5G0RB 4CDIA 3ZTQA 4ILRA 3LQVA 1FXDA 3PRVA 5HXDA 4FN5A 3FK4A 3BDPA 2I79A 3GR1A 5F46A 4L76A 4DUYF 4ED8A 3T19A 3IR5B 1NCLA 4NMXA 4OYBA 2R98A 1GH8A 1L3SA 1I94J 2SXLA 4G1QB 2NR0A 1S1WA 2ZOMA 3MPUB 3AB4B 5JH9A 3HP6A 4C0BA 1U2FA 1TK0A 4LJMA 1NSQA 2L08A 2NXJA 4NLPA 4I1TA 4X4UA 4M95A 3BKUA 3UFCX 1ARMA 1XERA 1FESA 2VQFF 3OVBA 1ZA1B 5KT2A 1PJ6A 2DGWA 2WVEA 3X3UA 2YQ1A 3FJUA 4MFQA 1HNZJ 3DM2B 3I32A 4F0HA 3B54A 2ZH1A 1WC4A 1TKFA 1YRXA 1KUVA 4PR6A 1YVFA 2A6MA 1NE9A 2DF5A 4X4SA 1R89A 4EO6A 2Z58B 2PRBA 4K30A 2HQGA 1G2EA 1VBZA 4LR7A 1FT8A 1XOVA 4Y34A 2OFGX 3DLEA 4ZIVA 2W25A 2H3EB 5D77A 2I38A 5F49A 4ID5A 3MFHA 1VQ5S 3SFGA 1A6LA 4OC2A 3AAWB 4C0HA 3DDDA 2NXUA 3QMQA 1Y3JA 2DEJA 3FBCA 5BXIA 2E1MC 1WSRA 2IM2A 3ZZUA 2Q1LA 2YTCA 3C6TA 3W9IA 3M8PB 4FPIA 3AJDA 1TL5A 3CXSA 4ZP8A 5LMNJ 3IAM9 2EPIA 1K47A 2HFZA 1VBYA 4UEEA 4IR1A 4AQYF 3TOAA 4NLOA 2EBJA 2VONA 1YW4A 3W63A 2HB6A 2Z2LA 3RUBL 1RWUA 5GAEI 3F41A 2MQOA 4IG0A 4JI1F 3DLGA 2VOPA 1YBTA 3KQXA 2OHDA 3SSQA 1HBNA 3GE9A 3PR4A 1S48A 4PG5A 4ZYQA 2IM3A 2MY7A 1HQEB 1RHRB 3W60A 4MFKA 2J9DE 1TL7B 2J8SA 1NPRA 4LRCA 4ZVGA 4M5LA 4MK7A 2GQ2A 4AYBD 4U7UK 2PEHA 5AG4A 2AYGA 4KUAA 3B8HA 3I0RB 2Z3OA 1V9OA 3E2EA 4C6AA 4XNHB 3GLJA 5AXKA 2ZD1A 1JLEA 1I6JA 4DV4J 3KLGA 1FNXH 5FDLB 1SCJB 2AJFE 2XMAA 4B11A 2EO8A 3BJYA 1RT4A 2Z2MA 1M5HA 2HURA 2PE3A 3H42A 3ILLA 5LL6d 3EZUA 1KHVA 2B56A 3TQ1A 2QA4S 3DLGB 2WYRA 4I2QB 4DFPA 1JLAB 2A4NA 4USJC 3K5NA 2CPDA 4C97A 1FY7A 2JDDA 3NE7A 2PJCA 4NOHA 3M6XA 4CLTA 4R76A 2HWHA 3CE8A 4NZ0A 2M4MA 1YJVA 2DGXA 3CNQP 2PCUA 4ZCKA 1K44A 1NDLA 2LECA 3BQ0A 4NXMF 4XPCA 2GHPA 4EMDA 4OMFG 1JLEB 2C2ZB 4V19X 1B6BA 4QWAA 2F40A 2V5HG 3TUJC 4USMA 3FGVA 1FTRA 3IBFB 3BGLA 3I55S 4ZBGA 3UDVA 1GMWD 1RXOB 3T41A 3Q2TC 2P6SA 2PMWA 1YJWS 4F50A 4XDCA 4ECVA 4OFZA 4KTQA 1YDLA 4B3TJ 3TA1A 1XTZA 1W2BR 2WW8A 1MMDA 1LWCA 3US5A 4F3OA 2XEGA 4N5SA 2HHUA 1DTDA 6FD1A 4W98A 3S6FA 2POKA 1K0TA 1VKCA 1H98A 2CQ1A 1TUWA 4YR0A 4X64F 1TKJA 3H25A 4V19J 4K3NA 5E3CA 2HG4A 2QLJB 3OXFA 1U25A 4ZCIA 3D3SA 4CH0S 1H0HB 2W7PA 3B78A 1JK9B 2B3VA 4GVBB 2HBRB 1HYSA 4KB7A 2XHCA 4NRTA 1WF2A 4LRAA 5LYFA 3K2YA 1U09A 2KYXA 2Z3MA 1SQHA 4DL0C 2V50A 4LF4J 3NY0A 3VAJA 3JRUA 2FJXA 4M8LA 4GC7A 1O8BA 2VFUA 3M9NB 4RUBA 3N6NA 2HZVA 4BLGA 1JLCB 4OV6A 2F4FA 1RDRA 3NRBA 4KPYA 2PJ2A 4HDHA 3OQ2A 2KT3A 3VGVA 3FDSA 3UDCA 3BO2A 1CJUB 1HYSB 3I9SA 2JLGA 1IU8A 4WWSA 2R7TA 2BQUA 3KJVA 2PVWA 3M30A 3E8OA 3CCLS 4ZA1A 2DCUB 4DSJA 1HDQA 3I31A 5KFCA 5JQ4A 3R7BB 2NXNA 1MWZA 4FD7A 1S5ZA 5F3TA 3FQKA 3M2VA 4N77A 3IFEA 2XBPA 2XI3A 3FC9A 2C3MA 2YBVA 3W3SA 1DTTA 3G86A 2FVPA 3QRRA 1Y5LB 3BI1A 1X12A 3VVTA 1FT7A 3V8IA 3K7RA 3FZ2A 4ZPBA 3PW2A 1OY9A 2X1GA 2DRDA 4ECZA 3NS5A 1S9GB 3KJVB 3ONQA 4ZCMA 3M30B 4JI4F 3HFKA 1HNWJ 3RW7A 1SJFA 4YRHA 4MMOA 2V67A 4ZDNA 3O6QA 3A3NB 1DTTB 2RSQA 3PYDA 5IWAF 1B3TA 9RUBA 4QU7A 3O2IA 3TW0A 4Q38A 2DNOA 1DY3A 4X4TA 1RQ0A 1IBCB 2KT5A 3FFIA 3SQGB 2J9CA 3W5XA 1UZHA 3GJQB 3GIIA 5H9FJ 4JI6J 5F8LA 2XS2A 2J8RA 2B9WA 1SJRA 4Y2MA 3EWGA 4EZ9A 4WFZA 3J7YI 4MIBA 1DARA 1VQ9S 5D4NA 4PQUA 2AQ4A 2W4DA 5IQ6A 3J81Y 4CAVA 2KL8A 3O1LA 5HROB 2QT7A 2AFUA 2Y0MA 1YRTA 3NOCA 4LF8F 4H4OB 1TZ0A 2PN6A 2UUAJ 5LSOA 3FFIB 2KFZA 2BE2A 2Q6BA 3OLAA 1NLKL 1I51B 1ZPWX 4QWBA 3GQCA 2QLWA 2HRYA 2HZCA 1NSKL 4HVZA 3DLLQ 3MAQA 2X7IA 3R9GA 2Z8QA 4JI8J 4RBUA 4EU0A 2HQYA 3MMAA 1PILA 2ASDA 3ENWA 4DPOA 2EVNA 2AT1B 3SJGA 3Q8RB 2LQBA 3I0SA 1RB0A 1I3OB 1RHKB 3IBCB 3D2PA 3SI2A 3P96A 3KLEA 3DRPA 4R3KA 1IKXA 3D28A 3GU0A 4RW8A 4LFBF 1VYAA 1YQEA 2CRLA 1F6TA 1WF1A 1Y0YA 1L5UA 2HWTA 2NPIA 3QWPA 4YMEA 3PNIA 5KT7A 5CBMA 2H5IB 4ZY0A 3CB4A 2H4YB 3MMAB 2E1RA 1XMOF 5D6GA 2M9KA 3M2RB 2M2BA 5IC6B 1P8GA 4NFRA 1ZG9A 3GIKA 1XK8A 4MCSA 3U27A 3IWWA 5BR8F 2F63A 2H5MA 3DRPB 5DWNA 5C2CA 2PJ4A 2I1RA 3PW7A 1IKXB 4YDDB 3NKYA 1RTIB 1SJ4P 3CMES 2JC1A 4UEFA 2B4DA 1DAXA 4KGXB 2R2RA 4JOUA 2CF4A 2A10A 1SC4B 2REFA 4XAKA 2BW7A 1VRQC 3D54A 3V6DA 3QAYA 4NLTA 1RYRA 2BEFA 3MM5A 2JDJA 1FDBA 3CJKB 2FJWA 2V6AA 2MQLA 2FVGA 1YK9A 3DLBA 4CLWA 3KUEA 4KH0B 2LQ5A 1IBKF 7AT1B 3UNYA 2IQ6A 3H7HB 2MZJA 5E3QA 3FRZA 3CD5A 3FYNA 2MKJA 4OIDA 3R7SB 1TKDA 1G3OA 3R7NB 1X4FA 2CFXA 3MUTP 3FB3A 5DRKA 2BKOA 2VFVA 3TRGA 3W5ZA 1HQ2A 3V6DB 1AFIA 4H89A 4HL9A 4B9VA 2ZEEA 3B7IA 4KFBA 4FZVA 2XQCA 2Z30B 1HD0A 5LRGA 2W2QP 4DQRA 4L8AA 2F5IA 2OP5A 1WOOA 1KQFB 1TUGB 1FDDA 2WVCA 2YXLA 3SXLA 3NBPB 4ZJOA 2XMWA 1U24A 2EWHA 3P2FA 4NEXA 4LR9A 4FYYB 4MCRA 1KD1T 4NMLA 3VATA 4DN0A 1IYKA 1F0XA 2K3KA 4M6HA 2FHJA 5KFIA 4ELUA 2F9DA 5JXSA 1VC0A 2M8HA 4W90B 1BE4A 2MLYA 4KFBB 2DGUA 1FHTA 4A8SA 3VAIA 1KWMA 3MOJB 3EMTA 2CJQA 1HARA 2AX0A 1JLQA 2DR9A 3FCWA 4DR3J 2BOPA 1Z5RA 4GKJF 3CCZA 1Y00A 4J9RA 2B58A 2PA3A 4USHA 2R7RA 1XNQF 2VJUA 2EG2A 2VZYA 1ZM3A 4EUVA 3OWCA 5L46A 2ZEFA 1S9EA 4MIAA 2CWXA 3KHXA 3HULA 2PSWA 1QTMA 4CLSA 3LWMA 2W4CA 3QGIA 1N6QA 4O4RA 3J7A1 2GO8A 4KHPF 4DU8A 1CJTA 1MSWD 3WC2A 5K8MA 2OU2A 2NYHA 3BS9A 4Q0BA 4CGLA 4ILMA 2Z4PA 1S6UA 2CG4A 1YZ6A 2YQ0A 3Q8PB 1JLQB 4RI1A 2EEYA 4C3KA 2KH9A 3DFEA 1ELOA 1CJVA 3C6UB 5L9NA 4DV7J 1ULRA 2I6WA 1TL3A 4DV1J 2MKCA 1CEZA 4Z2XA 3M8RA 2FT0A 1VR6A 2VQYA 4E98A 2B5JA 1S9EB 5F9NA 3A4TA 4CYPA 5B09A 1NMEB 3GMGA 3ULHA 2JLEA 5J1EB 3AODA 4PK2A 4QYZJ 3BBBA 3KG1A 4B9SA 4Q8EA 4O3SA 4Q0BB 3RGIA 2XY6A 2KFNA 2W1BA 3D2MA 4IAVA 1WTFA 5THWA 1XQIA 3GIMA 4OYPA 2H9ZA 1TL3B 1M44A 1KUXA 2AZ3A 2EW9A 2Z3LA 3R9LA 3VF0B 2KM8B 1EP4B 3UY5A 1Y0RA 2OEJA 4G1PA 2G13A 1WACA 4HNYB 4LSLB 2PC1A 4N8OA 1I12A 1L3TA 5HLFA 1YHQS 4XPDB 3PB6X 4EYHB 3H0PA 2HK2A 3CD0A 2CADA 4XPLA 3DOLA 2XMTA 4IRKA 5A6PA 3IU2A 2XMMA 4ZP7A 2Q4YA 2HAIA 4Y00A 5DJBA 1RAIB 4HH0A 1IUJA 2XMUA 3ZXWA 4ONWA 5HJYA 3E3XA 4YS2A 4U7UD 2OPSA 2FCKA 1CQMA 5AG7A 1YREA 3QRQA 2IM0A 3D6FB 1J5OB 4NLRA 1QSYA 3RR7A 4B5PA 2HHHF 3IC1A 3FBEA 4NCZA 2C6GA 2CZ9A 5HLFB 3HI9A 1RT1A 2BJ7A 2JLFA 5KG7A 4LVNP 1XNRJ 5HQMA 1UFHA 2E5HA 4LFCF 3TX0A 4DLEA 4WK1A 3HD2A 1JXVA 2ZEOA 4ANDA 3DRRA 3O44A 1IXKA 4X4QA 4H4KA 4I56A 2VZ9A 3FSIA 3NCQA 4LFAJ 2CQ0A 2WSEC 2OPSB 5JM6A 3BR8A 4RW9A 1P9QC 4JBCA 1NK8A 1D3WA 1MJBA 2RJZA 3AJ1A 4OLPA 1QSTA 2DD8S 4KKOA 4M5MA 3TAMB 4JD6A 1F3VA 4Y28C 4OZ1A 1RT1B 4G3IA 3KG0A 1RT6B 1P9YA 3EUNA 2VG6A 4CT8A 3V81A 1RBLA 1VHFA 4HHUA 3QB8A 4O0NA 4X8IA 2AFMA 3UDEA 1IR1A 3J80U 4OC5A 2IYGA 3DLJA 2MTLA 1TUVA 4IOAQ 1YR0A 5B0FA 5KTDA 1SPBP 3DRSB 1Q8LA 3PGPA 3I4HX 4C8LA 3UE2A 1RWXB 1K0VA 4LSZB 3K9TA 3LF0A 2B3TB 1Q8KA 4ZK7M 1FD8A 2VDHA 3LWUA 4B9NA 4FXDA 3VZIA 2G9DA 1RJJA 4YUDA 1RHMB 2QL5B 1Q7LA 1SIZA 3CMQA 1RU2A 2VG6B 3V81B 1U6BA 1K9MT 4P7TA 1AA1B 1N5TA 2ACYA 3LTOA 1RWPB 2OMLA 3SV3A 2BYCA 5FJ4A 3K57A 4C7QA 1TFWA 2E7XA 5SUHA 1YTYA 4DR2F 1LKZA 3AOCA 4WFYA 5DG8A 1XF8A 2FTRA 3F5BA 5A8RB 1ZLHA 1EB0A 4KC5A 5KFMA 4K4YA 2OSRA 3GYXB 5D4OA 1NU4A 4PZVA 2HS4A 4E0DA 1UWBA 4KR0B 2GMLA 3M6VA 1GTEA 2CJXB 1LW2B 2ZXVA 2W2MP 5DG7A 3TEHB 1KBRA 3ICLA 3I56S 2DO4A 5J2NA 2WAQD 3D0HE 1YGYA 1M5VC 4TXSA 5C82A 3R6GB 4WTYA 3BSNA 4N47A 5G21A 2QLFB 3FMBA 2UVWA 5J2MB 3NWRA 3OFGA 4CLPA 4DV2J 5KFHA 1OIAA 2ATCB 1U6ZA 3L09A 3KI9A 3F56A 3EY5A 2J0XA 2Z0ZA 2CIJA 3RNZA 2XY5A 1S6PA 4M5GA 1HNIB 2YWHA 4UOGA 2AWZA 1KRPA 1DLOB 2Q4ZA 2XEFA 3OUYA 2DHAA 1R8PA 4DQQA 2GLFA 4FWUA 3PDNA 5E7OB 1O0PA 1SC1B 3OTBA 4DQIA 2V8DA 4HACB 2APOA 1H38A 1UAWA 1KP6A 1TFYA 1Y11A 3OVSA 3I87A 2WBMA 1S6PB 1T9WA 4DUYJ 3V6JA 2VKZG 1FWKA 3OPKA 4D3HA 4DUKA 1C1BB 1H2VZ 5KFZA 3PW0A 2MZSA 3GPAA 4KAIA 2Q44A 1FWLA 1VRTA 2NUHA 1PSDA 5F8GA 3WC5A 3B3SA 4Q8FA 1PCAA 3CXQA 2WK4A 4P52A 3Q23A 2J7KA 5KFVA 3OT9A 4F6AA 4RW6B 4XPKA 1UJ4A 3GFZA 4KRWA 2Q0YA 1KOOA 2ZBCA 1X0FA 4P74A 2MSSA 1PGZA 5E3AA 4BCAA 4E2FB 2CPEA 3GIJA 4JI7F 1WSVA 4DR6F 5DLGA 4X4OA 3L9ZA 4USUA 2FJAB 2QE5A 1LCPA 4FYWB 2VQFJ 2VBQA 1QM9A 5J2QA 4FD4A 2IYIA 3SYZA 3IP0A 2VBYA 4DSFA 2FZCB 4F4AA 3CDBA 1NMTA 1MROB 1IVZA 4UOCA 5JVHQ 3S7RA 1ITPA 3RG6A 3GIUA 1WG4A 3TQEA 1VRTB 1VHEA 2CZVC 1BQXA 5DQGA 2IDLA 4KY3A 4JYAJ 2RIJA 4JI5F 3T9ZA 2HFVA 1XN9A 4DR4F 1N5YA 3KMQA 4RU2A 1ZAWA 2BX6A 3EFAA 3A9LA 3MFIA 1FVQA 5IX3A 4WIQA 2F8HA 1A0OB 2GCFA 4DFMA 5J2QB 1AFJA 3SQOP 3JUWA 4DDFA 2IA0A 1FKPB 1ZZNA 2NCKL 1VC6A 3K89A 4UY8T 2ARHA 3CIZA 4LRBA 3DGVA 4PYDA 1FDAA 2FVQA 1KVJA 4AFFA 4YU9A 1F9EB 3I5CA 3L7OA 3KK1A 4XNHC 2VUGA 2W01A 3EZOA 2A2DA 2QRRA 1OY6A 1NJZA 1N5YB 4OX7A 3GYGA 2UUCJ 3MM8A 2C2EA 1RT7B 3QAUA 2J0SD 5ETKA 4YN3B 2DJWA 3EVWA 2O66A 3D0GE 4F2RA 3TCVA 1EQMA 4IKAA 4JI1J 4LSNB 4LF5F 1IKVA 4F02A 5H86A 3KK1B 3K58A 1T9VA 1T94A 2HV2A 1VLOA 2QMUB 2LEPA 1X9MA 4J3GA 2CNLB 2IRUA 1VQ7S 3I4PA 3MM8B 5I42B 2R8HA 4FBUA 4Y49B 4CLLA 4C68A 3QT5A 2DH8A 4RX6A 4DV0F 5F8IA 4Y2IA 3LW5C 1D8ZA 2HW3A 3ZTRA 4MI4A 4MK9A 1HNVB 1FEEA 1NK4A 2GIVA 1NJXA 4PWWA 2PGCA 1NPKA 3G8SA 1LFWA 1C0TA 5I3QA 5ELYA 2BKNA 2FLPA 2D3ZA 2K3IA 3VVUA 4L73A 2MZ1A 4QWCA 5EWFA 2BEIA 3SXNA 1IKYA 3FSYA 4NXMJ 2OPQB 2H54B 4ID8A 5A2QY 4CNYA 5HL7Q 4MHYA 3PRBA 2GX8A 2PJ5A 5HVGA 4LBPA 4GRSA 4ED6A 1S1UB 4N56A 1YX0A 5KG0A 4BDPA 1S5KA 2QLXA 1U02A 2FJDB 3M8ZA 1IBLF 2AJ0A 4KE5A 4IRDA 4UZCA 1RTJA 1YZ7A 1C0UA 4DU7A 1D8YA 1B0VA 1IKYB 1RTZA 4F4XA 2EK8A 5FIIA 4C4WA 3AFGA 1UA0A 2ZNYA 4ZHRB 1B4SA 4LIWA 4JJXA 2RMLA 4NZ6A 3PM9A 1NRKA 5HMYA 3BYPA 5L39A 3P49B 4X64J 2Q4VA 1GNKA 3M6WA 2CQ3A 4F25A 1NB2A 4DV5F 2X3GA 4TYAA 2BQ3A 5IT4A 1XMBA 1VBXA 1RISA 3OTEA 4PKDB 1SKUB 3PB7X 4CO2A 3IA0A 5AE2A 4DR5F 2JL9A 3EYZA 1RP5A 2RT3A 1TVRA 1IN0A 5DM6Q 3SV4A 3A8KA 2WOMA 5C25A 2PJ3A 3TP2A 3CXPA 3MHYA 1JKHA 1S76D 1WC0A 4C8YA 4YHHF 5GAHU 3R5GA 4ZVSB 1ZA2B 2R4FA 4OLOA 4B10A 4DR1F 5HANA 2IDEA 1UVNA 1HFEL 3GP9A 4FYVB 3ZJ0A 1NZAA 9ATCB 1N33F 2E44A 1Y9KA 1JLGA 3OJSA 1LWEA 2NPFA 1HW8A 4OP4A 2ZJQQ 4RN7A 4QU6A 4B02A 2WB4A 3BSAA 2RKIB 1WUUA 5EUHA 1TP7A 5KFGA 1TVRB 1R3NA 1Q5VA 2WOMB 4X84A 3LP0A 2M0GB 2GVDB 1N34F 5AXLA 5C25B 4C8KA 4C7IA 3R9FA 2GIQA 4PABA 1JKHB 2BABA 1OWXA 2UVRA 3VGTA 1LQ9A 4NLVA 2WB1D 5KT4A 2RILA 4F4KA 2LDIA 2AYEA 1F9FA 2ZUAA 5FLXY 1JLGB 5LOQA 4R8UA 5B7WA 3GJSB 1LWEB 2VL1A 2CY2A 1YJTA 2O28A 2G0BA 3QIDA 5E33A 1RAAB 2Q79A 5EDWA 2RF2B 3LP0B 2E5GA 1W26A 3ADAC 3S9MA 4JZ0A 2QL9B 3KL9A 4JI4J 3HUVA 3R2CJ 4LRFA 3QIPB 3AJ2A 1NAQA 1SL1A 2LQ9A 1U1NA 3A8EA 1DBDA 3OSNA 1QE1B 3LUYA 5IWAJ 4IDKB 1QQ9A 2AGQA 4TNUA 3TJ9A 2FB0A 1Q8IA 4DFJA 1A2ZA 4TNOA 4R8UB 5CNPA 3A8IA 2F4VF 2EI5A 1WG5A 1R31A 2DNKA 1JB0C 4XTTA 2AE6A 1QLNA 2GJ2A 3ZTPA 3HM9A 1X7VA 1NK5A 3CJ2A 3NGSA 3T1HJ 5E41A 1Y10A 4MHPA 2B8PA 3R95A 5HSPA 2N4CA 5KTCA 2XYGB 1W2IA 2MY8A 1YJRA 2UU9F 2HBQB 4PXCA 4ZJLA 4X65F 2MZRA 3VR1A 3MCMA 4LF8J 3C14B 3R5BA 4J9QA 4KOWA 1B99A 4R0JA 1MJAA 5I3PA 3N28A 2GVZA 1QAYA 6FDRA 2OIHA 4I7FA 2R7SA 3K8VA 3DCAA 2NXEA 4P6QA 3FBUA 4C3LA 2VASA 5KFQA 1REVB 2WVFA 3GFHA 3RBDA 2KCWA 2HVDA 2HMIA 2Z2ZA 3DOKB 5CYMA 1UFWA 4DZ6A 2Q51A 2CPFA 1WEXA 4II9A 1RWKB 4WPAA 2E9TA 5E5NA 3P45B 4OX8A 4DL6A 1RLDA 4WXWA 5DLFA 3V6KA 3KLIB 5F8MA 2VPWB 1S79A 1OBRA 2PO4A 3RTVA 1X5PA 4CLKA 4OYOA 4WBFA 2J9EA 3ZTSA 5J2PA 3CIMA 3TZXA 1X4EA 4JXQA 2PVVA 1XMOJ 3G6XA 2GGPA 1P0HA 4OYIA 3K2KA 4K2XA 3KK3A 4UUXA 4FF1A 4KHRA 1X5TA 3VZHA 2OJ3A 2F5GA 1LWXA 4HEA9 2UV8A 2F1FA 2HVIA 4QIFA 4CYUA 2VHGA 4DFKA 3MR6A 1LOKA 2Y3YA 4QJVA 1HNXF 2ZH3A 4X66F 4OJ3A 5J2PB 4HNXB 3LA0A 2QECA 3QFWA 4JI0J 1YK3A 2GGPB 1M1HA 1RADB 3G2XA 5CXTA 4MKBA 5F47A 1NHKL 3DXSX 2XY7A 2OPPA 2AJ4A 4CQ1A 1FNOA 3CDXA 1IBKJ 4J91A 2V4JA 3CWJA 4DQSA 4F8ZA 4CAEA 2OFHX 2LXFA 5KFPA 3AD7C 3DRYA 3VH9A 4P4JA 3MTKA 2R8GA 1AUGA 5T41A 2CNMA 2HVEA 5DETA 4YWYA 3JSMA 2MLXA 2WONA 1IJFB 5KFLA 3IWLA 2CIMA 3DHXA 2MGZA 3RAXA 4TQSA 4B14A 2ZKTA 2ZZNA 2FHJD 1ZM9A 4M63A 4WIIA 4N76A 2IVYA 4CH1A 2C3YA 2COLA 2AX1A 4GO7X 3PRDA 2V4JB 2I2YA 3THPA 1MK4A 2KN4A 2YNFA 5E2QA 2VICA 3MR5A 2CAJA 4XDDA 1H6KX 3PB9X 2KRRA 3CCSS 3CULA 2CQHA 1VMBA 2ROGA 4A8YA 4NYOA 4X3RA 2RE1A 5HAOA 1VRUA 3KUGA 3N79A 2WONB 5KFAA 2D69A 3BN7A 3EDQB 3WX8A 3M8WA 1U6MA 3OL7A 1H74A 1QD1A 1VQ6S 1PJ7A 1YLOA 3C66A 4ES1A 2A18A 3LANA 1MU2B 4PG7A 2H1YA 2VBXA 2CJYB 3FSXA 1FE0A 2MHNA 1WWZA 4IK2A 2JEWA 2DNNA 4TN2A 2V2ZA 2XC9A 2Q7BA 4DYOA 2XZWA 3KLFB 4CNZA 2DR8A 2HS0A 4GKJJ 3K5LA 3TYTA 1H8LA 3N4WA 2GS8A 4HDGA 5LT5A 2AFWA 4QIGA 2PIYA 1BC6A 3TAQA 4BS2A 1VRUB 4IRCA 1R8AA 4QBJA 1HW9A 4UCNA 4X62J 3DLKA 2BANA 2H5JB 2YKOA 2RQMA 5ETQA 3BQ2A 2GJIA 2BJ3A 3HZGA 4KHPJ 2VA2A 4B9LA 4IO9Q 3L95X 2UXDJ 3FMCA 4B3SF 2V69A 2MB0B 2KM8C 5C42B 4ECTA 2V0NA 2C1CA 3D9BA 2OO4A 1K1QA 1Q4RA 3D4UA 1HWUA 1R43A 3HVAA 2FXFA 1JJHA 3R5DA 2BVZA 1Q2CA 3PTWA 5H9FK 1FXLA 3KR5A 5KOXA 1V6HA 2AEMA 2RDDA 1UW9A 4U6PA 3DLKB 2BANB 4DJLA 1Y7EA 3NAIA 1SQEA 4YR3A 2HHWA 1S77D 2ZE2B 4QIWD 4AB7A 1NSLA 1VHIA 3H5YA 1UWYA 1FKOA 5B0CA 4NA1A 1AW0A 1FJEB 4FYDA 5IOLA 6CPAA 2ZZTA 1BXNA 4Z7CA 1U8SA 3IGVA 4DR7F 4Q45A 3DLHA 1FFGB 3Q8SB 1VQKS 4ZVFA 4NXNJ 3W2WA 2B43A 5M2RA 2CYYA 1Y0HA 4F4YA 1S0VA 2J0QD 3RO0A 3UNGC 5A27A 4CIOA 5IFMA 5EN1A 3LOUA 3R27A 2ILZA 1FKOB 2HNDB 3FEYB 4KQZA 1CVJA 3MPVA 4HH1A 3HHEA 4IH7A 2E66A 4AUKA 3RBEA 3DMJB 3R1LA 4ED0A 4NI2B 3QJLA 2QFIA 1N36F 5KFUA 4CGNA 2V9KA 3GUXA 2D74B 3K8WA 4C2ZA 4ZLJA 2W2OP 4UFVA 2GV1A 4PCQA 4USIA 4F04B 2MZQA 1XBUA 2HHHJ 1DURA 1KQKA 4QW8A 1TAUA 2XGQA 2V8GA 4ED4A 2QYVA 5A0YA 1B0TA 4MFLA 3C3LA 2GHVC 1E6YB 5KG2A 4R9MA 2DTJA 5DGBA 4LFCJ 2W7AA 1D9FA 4FYXB 2ABZA 2VG7B 4DPUA 4CO1A 4K4ZA 1PYOB 3PACA 5ETMA 4UQGA 4EBEA 2B5GA 1HEEA 3M8QB 3Q86A 4KOTA 2FSRA 5ETTA 2Z2YB 3DNSA 3BPDA 3LH2S 2FHKA 4NGPA 1ZLIA 3AY0A 4LF6F 4ETXA 3QYYA 1RKJA 3UCZP 4P45A 4H4MA 2JBKA 4ECRA 3NLCA 3FJ2A 2DYAA 5A0YB 1NK0A 2BCOA 5IT9Y 3HHLA 5G1ZA 2MKKA 3W9JA 2GJFA 4CTAA 3MAAA 4JYWA 2ZW7A 1JLFA 3CZXA 2BJ1A 4YY3F 2B5GB 3ETMA 2WTFA 3WR7A 5D0HA 4ZITA 1NUEA 8RUCA 2CNKB 2FIWA 3P2HA 2HC9A 1HQUB 1S6OA 1BQNB 4DL5A 2RH3A 2XMJA 1UVMA 4KVXA 4U9ZA 2XS5A 1TKHA 4CTAB 2LCWA 1IBMJ 2WPWA 1FI4A 2OZUA 4UIBA 4Z7YA 3QT8A 2F8MA 1U1PA 1CBXA 3GSDA 1FJGJ 4WFAQ 4DI6A 3PKYA 3HXMA 5D29A 2JC0A 3A8JA 4DR2J 2BE9B 3OHAA 3H8YA 1Y4ZB 1GK8A 3BB5A 2RS2A 2WBRA 1DRZA 1QAXA 2FJVA 2ZWOA 3FZBA 1RT2A 3H4DA 2O4HA 4F2SA 2YKNA 2VOOA 4HHHA 4GVLA 4GS4A 4OX9F 4U7CA 4UUWA 5DDQC 3NFZA 2J9AA 2FIUA 3R5JB 3HZEA 3ET6B 1WF0A 2V2KA 5MLCV 1YITS 4ZVQB 3CD6S 1WTBA 2J6UA 3NNAA 1WK4A 3FVLA 3PRTA 4A30A 5ISVA 4CZCA 3AOAA 3M32B 5EC4A 4KSIA 4P73A 1UPMB 3PEHA 5G22A 4UOFA 2LLZA 1S0NA 2QC3A 3LALA 1YI2S 2PSZA 4I2PB 4HR2A 3ZZRA 3H98A 3TOQA 1OSCA 3HVWA 2CDQA 4YB5A 1WJ9A 1CS4A 2KB2A 4KGMA 5ETSA 1LEOA 2MQMA 2FC9A 1PBAA 2RB7A 3HHKA 3KJQB 3CCUS 3S6KA 3GJRB 2AJ2A 3NOGA 2MKYA 2JBJA 3GG1A 4KO0A 2CQIA 1E6VA 2DR7A 3FCVA 3MEDA 5ETLA 2DHGA 4CYQA 2PD1A 3HCXA 4QYZK 1VQYA 2P8IA 3D1QA 2EFQA 1U26A 3H8FA 2KJVA 4YB7A 1A7GE 3PJXA 4KSEB 2RRNA 1CC8A 2F9JA 3CMAS 1SQFA 1WEZA 1IQTA 1U1QA 1ZYQA 4URSA 3T8WA 1FA0A 3D3CJ 1M4LA 3R1KA 2PEBA 2BRLA 3A12A 2W7OA 1O51A 1S7HA 5JUMA 1UTAA 2Z57B 4KIAA 3ZFVA 1NB7A 5D3GB 2JEVA 4DR6J 2HGNA 3LP2A 2RVJA 4KO0B 3EDRB 1P4NA 1AZSA 1KN6A 1MWYA 2BOAA 3T1YJ 3G8QA 3D7DA 1SC3B 1ACMB 2L9WA 4QB9A 2HGMA 4QUSA 2UXBF 1DJ0A 5KFDA 1HHSA 3JTOA 3TX8A 2PRQA 3B3VA 4DG1A 5J1PA 1YWXA 2YGWA 1VJWA 3OTCA 3JB9k 3C19A 1VQ4S 4EFAC 1I94F 4WTOB 5MAOA 2PI5A 4DR4J 4P9SA 4TY8B 2G0CA 1Q53A 3C46A 1OQ6A 3MGJA 4K4SA 5CHCB 1S3ZA 4X4PA 2UUWA 2PR8A 2AGPA 4CO0A 4BC9A 4B9UA 4AVBA 2HLTA 2YPZA 4IFVA 4DV6F 1PJ5A 2NYQA 4OADA 1AZSB 1X5OA 2B6AA 3BR9A 1GMUA 3AXMA 3JAMU 1N5QA 2VODA 5KG5A 1RT5B 5KTAA 2DXEA 1U8WA 2YWKA 2LU2A 2PA8D 1TMMA 2MPUA 4AT1B 1SIWB 4E0AA 1VLYA 2EBGA 2LYVA 3SFUA 5KFBA 1Q81T 4I4BA 1UFKA 1HI0P 1NDKA 2Q66A 2IC3B 1X4HA 2QV6A 1U1KA 2MJNA 4IFVB 1J4JA 2JDCA 3BHXA 4KGZB 3HSZA 3OR2A 2B6AB 2VG5A 1VQPS 4ZX9A 4C0OC 3BN4A 3AD9C 4V1Ak 1URRA 3P5TL 2LU1A 1HWKA 5E3PA 3BGUA 4N41A 1UP1A 4LF5J 4KOXA 2ASLA 4ZLLA 4PXDA 2ZH5A 1ZPVA 3IRXB 3H5SA 2ZVIA 1QSLA 4PWDA 2GQQA 1X10A 1WDDA 4F0MA 3EXYA 4XO0A 2UUBF 2BXJA 2L9NA 3MCOA 5EWGA 4EK2A 2AYBA 1LAPA 4ZPVR 1YBUA 3DDIA 4AVAA 2VG5B 4DV0J 3Q89A 3UN2A 2QG9B 3BGRB 2HHSA 1S1XA 2ZKUA 3CJ0A 1FX2A 1YGHA 2XLJA 3FNCA 2FQQB 5AGEA 5K9FA 3MPWA 3PP9A 3HT0A 2QTWA 1FTCA 1N71A 2XYHB 2MYFA 3KKFA 4J9UE 1SKWA 3NAHA 4LF2A 4P2SA 4OX6A 3WZ0A 3SCKE 3MEGB 2NSMA 4NGQA 2EKNA 3S01A 1TL1A 1BUXA 1XMTA 2NUUG 3UDLA 2ZBIA 4EVYA 3JQMA 4RNHA 2X1AA 4RNMA 2XB2D 3TEGA 2HPUA 2BBEA 4I6YA 3K0JA 4FF4A 4BC7A 2FY1A 3G4SS 1NHUA 4RBTA 4DV4F 1UFLA 3NH4A 1UZDA 1D9AA 1NZ8A 1YMEA 1SQGA 1IBLJ 2BV3A 4PPDA 5A8KA 4JV5J 4A33A 4MRIA 5D4PA 4YB6A 1ZZFA 4AL7A 5HBMA 1TL1B 1EE3P 4A38A 1KLMA 1F2OA 2N3OA 2J8NA 1S1WB 3HKWA 3D66A 1AB8A 1CPZA 4FDFA 1YJUA 4PUOA 4KYZA 2CPYA 1S59A 4IYQA 1KZFA 3I9V9 3GG0A 3NWGA 2KFYA 3Q24A 4DV5J 1IY7A 1WEYA 1SL2A 2D9PA 5BJRA 3I3GA 2PMZD 1X9WA 2AEJA 6AT1B 3P8BB 4DR5J 1UETA 2DPIA 2YKAA 4NL5A 4M6GA 2XCPA 1RHJB 2XEIA 1FRMA 1M5SA 4ITSA 2XO6A 3GKRA 1VJQA 4OI6A 2IHR1 2JEFA 1YLEA 5HBMB 2RNEA 2DR6A 2XWYA 1GYTA 4YHHJ 2QJ3A 3J7AN 3BREA 3QO9A 2HQ3A 2FE7A 3G3SA 4JXRA 1UEVA 1Q78A 1TKXA 4PUOB 2K7KA 4DR1J 4UQTA 3T5HA 2FLNA 1C1CA 2H48B 4AXJA 1N33J 5HP1A 2VQEJ 7FDRA 4HPSA 4J9MA 1ZAXA 3E51A 2AEFA 5LJ3Y 1UVIA 3DLEB 1NKCA 2WVBA 3I96A 4GM5A 2HNYA 3AH6A 2LXIA 4ID5B 3V7ZA 2PI4A 4OI4A 3SI8A 1KONA 3IM9A 1N34J 2ASYA 1AT1B 3BJ7A 2R7XA 3NE8A 5HVFA 3AHPA 5SZTA 4B9TA 2PJ6A 2Y1RI 5F0UA 3CJQA 3C6TB 1XE4A 3QO9B 1ZG7A 2ZHBA 2GE3A 1F57A 1TKXB 5I3UA 2DXFA 2ZW5A 1F3FA 1C1CB 1CG2A 3IWGA 4L74A 4LT6A 5ETRA 2G1HA 5KOWA 1CC7A 1NNDA 2HNYB 4P71A 2ZH8A 1RBOB 4WYWA 3EXNA 2GU2A 4EO8A 4K5SA 4FP9A 4IG0B 4LF1A 1MW7A 1HBNB 3UPFA 3ZZOA 2I9SA 3J7Z5 2XSJA 5KG1A 1FKAF 3ITHA 3U1NA 2P9CA 3NA6A 4I6WA 4UWJA 4M5HA 4B3RJ 3MM7A 8CPAA 4G6VB 5GAGI 3K5OA 2P5VA 2ZVSA 2C2OB 2NZCA 2RD5C 1QAJA 3KGQA 2PMHA 2QO3A 4C2XA 2PDAA 3GFYA 4O3PA 2JLMA 5DDRC 1BHNA 2KKHA 3R3TA 2F4VJ 3ILOA 3BDEA 3T90A 2FZKB 1B0PA 2ZD1B 3OR1A 2CJAA 3KLGB 2DPTA 2X51A 1RT4B 2DK2A 3EVOA 4OC1A 2EFGA 4WE1A 3BQ1A 3H8EA 2ZEMA 3GCWP 4JI2F 2IBOA 1ELLP 4J90A 3S9LA 2A2CA 4CAFA 2GREA 4FVCA 3RB4A 3ITHB 1XIQA 3WC0A 2Z3PA 3N6LA 4X65J 2MKHA 2P6FA 3DU5A 4RJVA 5L1JA 3M2UA 3CCMS 1M5OC 5HQ8A 4LQ6A 1PC5A 5DDOC 4O3QA 2X1FA 5D8HB 5A8WA 3OR1B 3UVJA 5JJBA 2C28A 3V2UC 2FHOB 2IVMA 2HNZA 4MFZA 1N32F 4JI6F 3K9UA 4BBYA 1C4AA 1T05A 1KQSR 4HKFA 1KFSA 2QA1A 2GNKA 3M9OB 4ZIWA 3W8PA 1HBMA 1P1LA 2C3OA 3A3OB 4A46A 3M9MB 3KOAA 5BWAB 4IUSA 5DO2A 3PCOB 3SSRA 2Y1JA 5IM0A 1MMNA 2CNTA 1LWCB 5KAKA 4S0MA 2V8VA 1LXJA 3EE3A 3I82A 2BZ2A 1SUQA 4MYUA 5F0WA 5T14A 3KASA 7CPAA 2ZC3A 1YRUA 2Z3NA 1YX2A 2XZDB 4DPTA 4F0XA 1Q5YA 2LVWA 3NCRA 4HYKA 5CAAA 3Q22A 3IMQJ 3T1AA 2HNZB 1IM6A 4I6AA 3LO3A 3T5JA 1WC5A 5LRKA 1T05B 3BM7A 3F73A 1IWGA 4JI8F 1UCNA 3C15A 4R8FA 3QSYB 4DX7A 4A94A 5GCNA 2FY8A 3MM9A 5G20A 2HUZA 5KFTA 2NZ4A 1EETA 5L9XA 2PQ8A 2FVCA 3TA0A 1YLXA 2C6PA 1QSMA 4MYTA 4GKKF 1SUQB 1S72S 3PB4X 4QR1A 5KFJA 1PYTA 4NASA 1Q7YT 1HNXJ 3BSCA 2M7SA 4F4ZA 4M5KA 4X66J 1IKWA 4HHJA 4NLQA 2MEWA 5HI7A 5GADU 2ZBQA 2DEAA 3C15B 4DL7A 2V34A 3MM9B 3NCPA 4EBDA 1DQAA 3CPWR 4JV0A 4K4WA 1CSJA 4K4XA 2R3VA 2CTBA 4OJGA 2PJ0A 1J5EJ 3GZ7A 3VAFA 2GAHC 2C3PA 1KS2A 4RWWA 2N7YA 1BPNA 4CWBA 1X4BA 2V2QA 3M2VB 1PYTB 4Z37A 1PU9A 2ZC4A 1CM0A 5J8FA 3BO4A 4YQWA 2XNQA 4CM2A 3B2YA 2R1IA 1WKLA 2MXYA 5EX0A 1IWAA 3QATA 1FJCA 1TV6A 2K1RA 1IM4A 4KV8A 1H73A 3I1UA 3B3WA 1X31C 2B9EA 5ITHA 4NE9C 3W1YC 2QFJA 1FFSB 3M8YA 3UWTA 2DISA 2O53A 1XC9A 4UCPA 3N7ZA 5D0EA 4X4RA 4CLUA 2JRSA 2AKWB 3D67A 3VAHA 3Q8UA 1NKEA 2XZTB 1ZG8A 1KKHA 2XG8A 5DQHA 5CD4A 4KLWA 1QVGR 4LQGA 3LODA 2HEKA 4H6UA 4OC0A 2K06A 2EFVA 4P75A 3AOBA 4WP8A 4NA3A 1B7YB 1OQ3A 4NCGA 1FD2A 3TI0A 4PQUB 2R7QA 2PJ7A 3OBIA 2B9XA 5D78A 1V3SA 3S6HA 4OZJA 1LK5A 1HHQA 4ECWA 2CVEA 2OOTA 3W61A 2QLBB 3CCTA 2W2PP 1CJKA 4FS1A 1KVKA 3H4QA 1NEEA 1H3DA 2MMYA 3KG4A 2UXCF 2LEBA 2BE2B 3ZNJ1 1HWJA 4KZTA 2DNQA 4UA3A 2B4VA 3HD1A 4B3SJ 1MNEA 5AE3A 3U1MA 2GANA 4FF3A 3U1LA 4DSEA 1N88A 2Y8YA 3MUMP 3IEHA 4NCGB 4LUAA 3KYLA 3TC8A 3I0SB 4ED7A 3VARA 1U0HA 2OAUA 3K59A 3KLEB 3LAMA 2GFFA 1Z4EA 3PBBA 4DV3J 1CJKB 1Q86T 2CXEA 4RW8B 4LUBA 2PJ8A 1S6QA 3LP1A 3N9UC 5AXMA 4PSWA 2IVFB 3VWSA 4UT4A 3W2VA 2D41A 1TKZA 1LNQA 4OHWA 2KI2A 2AJ6A 5K8OA 4IH5A 4RR5A 2ZW6A 4OYZA 4DX8H 1N48A 2DY9A 2Y0SD 1KVIA 3LPYA 5GVQA 1TU0B 2J9DA 1WELA 3VQTA 5B0BA 1R6VA 1DZ5A 3G6YA 3ZNUA 1MN7A 3JSBA 4DV1F 1B7FA 3PBEA 3RYOA 3W91A 3H4BA 5H9EK 4C7HA 2G2YA 2QYGA 4NLUA 3BZQA 2YKQA 3F8KA 3LP1B 4IO1A 5HVHA 3UD3P 2EG1A 4CGPA 3TT2A 2B4DB 2CQ2A 2PFFB 4BINA 3W2VB 3MPYA 3Q8YA 4FAIA 4B3MF 4O23A 3BGFA 2D9OA 5CQGA 3ETOA 3ISZA 3WABA 2DXDA 4AE5A 4Y3CA 2ZJRQ 4NGNA 2PDOA 4DS4A 3IG1A 1B64A 3MM5B 3HKZD 3CC4S 1GX5A 4RNFA 3CCES 3JS9A 2YX1A 3CDUA 3HJVA 1QSRA 1NK9A 2ERRA 5IS2A 4TLRA 4BHQA 3C16A 2R2TA 1Y3KA 5C88A 1HWIA 2W8LA 3HX9A 5HMNA 2VFSA 2WSFC 2QIFA 3DN9A 1XRYA 2H51B 4C9DA 2H5EA 4NEZA 1Y5IB 1ELMP 2KHCA 4C2MA 2ALYB 1WC1A 3HHLD 4P4BA 4MJKA 3IG1B 2DGVA 2IAJA 1FX4A 2XEXA 1YVOA 3SJXA 2DCLA 1Z8TA 5KFOA 1SXLA 3BGOP 1FRIA 5EGYA 4MY0A 1K8AT 4LF6J 3HLPA 4ES3A 3D7GA 5J8CA 5CCMA 2MJUA 2E29A 1S7IA 1JMTA 4W4MA 4P7VA 2UVVA 1SV5A 2VC0A 5IB9A 2DKOB 4U9RA 2NLWA 4RLEA 4ZVPB 4RL1A 1TAQA 1VIOA 3OTOF 2ACMA 2M5YA 4QYRA 4FD5A 3KUHA 4EMEA 2BJ8A 2HHXA 3TO6A 4YY3J 2F65A 1AUDA 2AHOB 3ISND 2C42A 2C22A 4Y65A 3KHLA 4P10A 5AE1A 4ZN1A 5LSLA 3VTIA 4F67A 3THVA 2VKRA 5T7LA 3AT1B 3H2LA 2QVPA 1RACB 5CCLA 2WVDA 5KFFA 3MUVP 2GHWA 1T02A 3IRWP 3ISXA 2G9OA 4KGKA 3B82A 1VQNS 4HT5A 5AG6A 2J5AA 5U47A 3BKFA 3FEEA 1LWFA 1N6QB 1NDPA 3NGTA 1CJTB 4ICLA 1PAEX 4PPZA 4TU9A 1TTHB 3KR4A 2YWEA 2D1CA 1WDTA 1PBUA 3NS7B 5LRJA 3SCIE 3V4IA 3Q0AA 2VIHA 4CCHA 4NJQA 1CJVB 4E8UA 3EGZA 4BWJA 1RHQB 2IJZA 5T7LB 4A47A 3CW2C 3GY9A 5IB0A 5DDPC 2QEXS 3JSYA 3G87A 3MEEA 1U48A 3EM1A 4MHDA 3SI1A 2B5JB 4DJBA 1RA6A 2CPHA 4OX9J 1FK9A 1NDCA 4KOVA 5CPAA 4KJIA 2JJ4D 3IS9A 4Q2MA 1IOIA 3DOMA 4ICLB 2CG8A 5HMZA 1TKTA 4WXOA 2YH1A 1P1TA 1T95A 5HMWA 4NA2A 3V4IB 1VIXA 3CC2S 4W92B 1U49A 2EVZA 1CQNA 3B6BA 3SMZA 1BWVA 5D0GA 3PW5A 2YNCC 1BGXT 2QGFB 4FKYA 1U7LA 1KHWA 1R8HA 4JV1A 1V3RA 1SI9A 4AL6A 1L0CA 4HTJA 3KDNA 3AQOA 3D7SB 2G0IA 3QLHA 2IL4A 2Z11A 1BD6A 3VWEA 1YG0A 4GO5X 4RS2A 1J27A 5CYQA 3BYRA 2FPHX 3I5BA 2HSEB 4NLSA 4GXHA 3HFZB 1ZOTA 3BI0A 3LAKA 4NPOA 3TJAA 2RQKA 3T5LA 3DOLB 3M8SA 3QNWB 1F1BB 4QOTA 4LX9A 1RTHA 1FRHA 5G0RA 4DHVA 2ALZA 2FYXA 1S57A 2QZ8A 5A28A 1RAHB 3QLHB 4WWVA 5K14A 5C24A 1WKKA 3THTA 2ZH6A 4GC6A 2LQ8A 4MBUA 3R2DJ 1GX6A 2VFRA 5CYQB 2XLIA 3KXDA 4B5PB 2D4OA 1XMQJ 1HPZA 4G1QA 3KNGA 4A8XA 1Z9UA 5KFYA 2DH7A 1AMPA 2DO0A 2XWXA 2B51A 4PG4A 1GAOA 3DRRB 4J7CA 4PXBA 3M1VA 4ZVRB 3T9YA 1SH3A 2IPOB 4CAWA 5K14B 5C24B 4JI3F 4RW9B 2UXBJ 2ZZMA 1N0UA 2VB6A 3DM2A 1FDNA 4KKOB 1M4GA 3CCQS 1Y5NB 3B3TA 1AXQA 1JIHA 1HPZB 4URQU 2RFHA 2GO9A 3IGNA 3PYGA 3L2NA 4ECQA 1HI1A 1DE4C 4ZVEA 2P6EA 4KVOE 1KUYA 2YNHA 2CQ4A 4RW7A 4DV6J 2ZOGA 3IWXA 4M5JA 4DZDA 4I68A 3M1VB 1UJ6A 4I0WA 2MZTA 3WIUA 4K4TA 4CRZB 3RRGA 3L3CA 2CQBA 5EMIA 5F8NA 4K2JA 3VHQA 2CUYA 2QA2A 1HBUA 2OEKA 1U1MA 3FRYA 2IM1A 3UCUP 1CBKA 2G3TA 4UBRA 1N4LA 1D9DA 1MLAA 4JYAF 4UEZA 1Q7LB 2UVUA 3M8PA 1YVKA 4TU8A 3CT9A 5AXNA 2YNHB 4RW7B 2HIYA 3ILJA 1F5CA 2XM3A 3CGIA 1ZM4A 2R2SA 4DS5A 4CO4A 2D3UA 1QY7A 2ZWPA 1Q16B 5L1IA 1JJ2R 5JVGQ 2ZEHA 5J1NA 1T9XA 2KHDA 3SJFA 3RRKA 2FUG9 4M94A 3IWEA 2NREA 2O5DA 2YNGA 1RE1B 1HBUB 3J81U 3ZZ0A 2GLJA 1T0TV 3C8YA 1KC8T 1UWBB 4OZNA 3MZIA 2KG1A 2KXFA 1FJ7A 1HQEA 1TL7A 2JOQA 2AV5A 5J2NB 4ETZA 3MURP 4KOUA 2W9BA 1SJ1A 2UUBJ 2KRBA 1SJQA 2UUCF 1WI6A 2J7WA 1Y7RA 4LQ9A 5LMUF 3I0RA 3PIOQ 1HD1A 2QN6B 4QQBA 1M90T 2ZELA 3MEKA 1EAYC 2JVOA 5L38A 5FDLA 3MWBA 1HLWA 1TQLA 2UP1A 4FUUA 4OC4A 2I5JA 4ECUA 2MHEA 2YNGB 1ZETA 2JX2A 4M3SA 4I2QA 4IQXA 1JLAA 1IYLA 5H1SV 2YWFA 3H2VE 4ATNA 4L72B 2XTJP 1QUPA 3WC7A 2JVRA 2W9BB 1KFDA 1JJCB 3OUYB 1RU1A 1REGX 4QW9A 4A39A 3UN3A 4Q2LA 3FH4A 4ZMMA 5HO4A 2ZEDA 4MHNA 3HO1A 4ALZA 3JTPA 2ODFA 4WFNQ 1WWHA 1RSCA 2ZNZA 1S7LA 3RBZA 2N82B 3D7FA 2UV8G 1XJWB 2I5JB 2PFDA 2XULA 4NLWA 4TY9A 3BBCA 2OZHA 2LQJA 1U1RA 2HQDA 1SVDA 4Q5VA 2U1AA 3TNVA 3MCNA 3PIPQ 2R7OA 3DU6A 3WT4A 1VHOA 2ZBPA 1RABB 3VGUA 3GTYX 4PQAA 2D7SA 2IA6A 3NXZA 1Y9WA 4RO0A 2ZHAA 2EXUA 2WSAA 2ZM6F 4MCQA 1CLFA 3OSPA 1QSNA 3OFFA 2ZDPA 4A8FA 3P4UB 4EGLA 2OEMA 4ZKAA 2V4RA 2AFXA 3CJSA 3CXCR 4GVBA 2DNGA 3CF5Q 3PEIA 2KU7A 4AXVA 1R8BA 4R3LA 2C2DA 3EXCX 3QQCD 3KMSA 1JNRB 2VBWA 1Q8BA 4DX5A 2AIRB 3PEJA 2OELA 1NK6A 3ZO7A 1U2CA 3SZ2A 4MY3A 3Q83A 1S10A 2R42A 2ZEJA 3PO4A 3TVYA 4AQYJ 2C2NA 3NP5A 5ETVA 4LF9F 2MLZA 1JLCA 2R7VA 1RAJA 1FE4A 2Q3PA 2RQ4A 2GMJA 3EJMA 5GAEU 2IFXA 2KG0A 3HHNB 4A8KA 1CJUA 4ORFA 5K5MA 4PWUA 4DPWA 4DF8A 2EK1A 1H7WA 1L3UA 2K2PA 2W9AA 3H5ZA 2DGOA 1LANA 3QJPA 1JWQA 2OD4A 5GAHI 3W66A 2DGTA 4ZY1A 2Z10A 5H84A 1ZO0A 2RDIA 4F0KA 1K1SA 5AG5A 3SXOA 2AMCB 3TA2A 4OI2A 3CCRS 1PG5B 2VD3A 3J80Y 2HQCA 2XMKA 1S9GA 5ADZA 1IKVB 2E9ZA 1UMJA 1XR6A 1CPSA 2DNHA 1YBAA 1UVLA 3DXBA 1LW0A 1JQGA 4NGRA 2PR1A 1WORA 3CO0P 3CJ5A 2B4OA 3RW6A 5GAGU 1KR4A 1S99A 1DFDA 1M5PC 2W8KA 5E3RA 3S8SA 5GMKa 3HDSA 3W7BA 1XFOA 3UQSA 3SQGA 4F9VA 2WPXA 2QIRA 2OKQA 5ETOA 2DNMA 1H2UX 1WG1A 4YFUA 4JI2J 3TZYA 2NMTA 1VS3A 2VI7A 4A8WA 2QJ8A 3HVRA 3BV8A 3W5YA 1OPZA 3KHHA 2OB0A 2GMHA 3KNAA 1FXRA 1RUSA 4ED5A 4KVME 4DPYA 1C0TB 1S9FA 1LW0B 2F3JA 1D09B 4IQMA 2BJ9A 3UR3C 3MMCA 3MR3A 4ANEA 4DL4A 3QGGA 5HROA 2O3DA 2KZMA 3VCDA 2CPJA 4H4OA 2HIQA 4USTA 2OH2A 4NLXA 2XLKA 4ERDA 4I67A 3AD8C 4UF4A 5BYQA 3IAS9 5HK4A 3TARA 1WC3A 3CJ4A 4PRFA 1N32J 1V0CA 5AJ3F 1RK8A 3U02A 2FHMA 1EHWA 3BJ8A 3DSBA 1U1OA 1V5IB 1S97A 4OAEA 3T1HF 3UO0A 1ON0A 4CLFA 2XGPA 1JX4A 4JV2A 2FL4A 3MMCB 1RTJB 3G71S 1C0UB 3W9HA 2D3OR 4O4GA 2IJFA 3OTDA 1M5KC 3TOBA 2VEZA 3G8TA 4B12A 1BMQB 4QIVA 4EEYA 3G6ES 4WFXA 5EX3A 4OL8A 3DGPA 2G3AA 2CJ9A 3TZWA 2GIRA 3CCVS 1Z2LA 4E2AA 4ZI6A 3SCLE 3EC4A 1O5JA 2AP6A 2GFQA 4ILLA 2R2UA 2Q7SA 4NWBA 4UOHA 2VA3A 2RDJA 4WK3A 5LYIA 4ECSA 1OMSA 1NSAA 3TVKA 2FJEB 1HHTP 3DDNA 3PW4A 4O3RA 2BQRA 3G9CA 3J7ZT 3PR5B 3M2RA 2I0XA 4RKUC 4CT9A 1APSA 3CEDA 1KNZA 3EGNA 3JSRA 4O4GB 4GKKJ 4YB1P 2XHWA 2DB1A 1RTIA 3DGPB 4YEAA