2V8VA

Crystal structure of mutant r322a of beta-alanine synthase from saccharomyces kluyveri
Total Genus 147
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
147
sequence length
435
structure length
435
Chain Sequence
LNLPAAAPLSIASGRLNQTILETGSQFGGVARWGQESHEFGMRRLAGTALDGAMRDWFTNECESLGCKVKVDKIGNMFAVYPGKNGGKPTATGSHLDTQPEAGKYDGILGVLAGLEVLRTFKDNNYVPNYDVCVVVWFNEEGARFARSCTGSSVWSHDLSLEEAYGLMSVGEDKPESVYDSLKNIGYIGDTPASYKENEIDAHFELHIEQGPILEDENKAIGIVTGVQAYNWQKVTVHGVGAHAGTTPWRLRKDALLMSSKMIVAASEIAQRHNGLFTCGIIDAKPYSVNIIPGEVSFTLDFAHPSDDVLATMLKEAAAEFDRLIKINDGGALSYESETLQVSPAVNFHEVCIECVSRSAFAQFKKDQVRQIWSGAGHDSCQTAPHVPTSMIFIPSKDGLSHNYYEYSSPEEIENGFKVLLQAIINYDNYRVIRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BETA-ALANINE SYNTHASE
publication title Crystal Structures of Yeast -Alanine Synthase Complexes Reveal the Mode of Substrate Binding and Large Scale Domain Closure Movements.
pubmed doi rcsb
source organism Saccharomyces kluyveri
molecule tags Hydrolase
total genus 147
structure length 435
sequence length 435
chains with identical sequence B, C, D
ec nomenclature ec 3.5.1.6: Beta-ureidopropionase.
pdb deposition date 2007-08-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01546 Peptidase_M20 Peptidase family M20/M25/M40
A PF07687 M20_dimer Peptidase dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.360 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2v8vA02
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 2v8vA01
4OC3A 2RB7A 3SI0A 2I3CA 2QYVA 2V8GA 2PJAA 1QQ9A 2BOAA 3S9NA 5HVFA 3HLPA 2VL1A 1ZLHA 1Q7LA 3NH5A 3LWUA 4KSIA 3IWWA 4P4JA 5DS0A 1HEEA 4ZYQA 1ZLIA 2C6GA 4R6TA 3IEHA 4H2KA 3B3TA 3CPXA 2ABZA 4MHNA 1BPMA 3B2YA 1CBXA 4FAIA 3NA6A 4MMOA 1HDUA 3SJXA 3SJGA 3ISXA 2ZOGA 1CPXA 3D7DA 3H8EA 3B3VA 2ZEHA 3K2KA 4MXUA 3GB0A 3KHXA 4R76A 1Z8LA 2XEGA 4F8ZA 2F8HA 4JZ0A 5LYFA 4PXCA 5K8NA 5CBMA 3RAMA 2EK9A 4F9UA 2XEJA 8CPAA 3FEEA 4A38A 2PCUA 2ZEEA 1R3NA 4PXDA 3HUVA 1LAPA 1Z5RA 3PB9X 2PIYA 3JRUA 5ELYA 1OBRA 3CPAA 4NGRA 4MHPA 2V8VA 3KQZA 1FT7A 3TC8A 3FEDA 5THWA 7CPAA 2PIZA 3BI1A 4PXBA 3D67A 1PCAA 2JBKA 3KHZA 4P4BA 2OOTA 3FMCA 4OC2A 3KR4A 4P44A 2PJBA 3WC7A 1QMUA 1XBUA 2PVVA 4X3RA 2ZENA 2CTBA 2F7VA 2PJ2A 4B6ZA 1H8LA 3D7HA 1DE4C 2EK8A 1YSJA 4PXEA 1CP7A 2ZOFA 3CT9A 1AYEA 5JGFA 2AFUA 2ZEFA 1ARMA 3PEIA 3CDXA 1IY7A 1GYTA 1CX8A 3KGQA 3DLJA 4NJQA 2POKA 1HDQA 2C1CA 4P4FA 4UEFA 2BCOA 3PRTA 4O23A 4YU9A 3KASA 5J1QA 2C6CA 4RUHA 2GLFA 5JH9A 3KQXA 3V38A 1ELMP 4A37A 4MHYA 3MRUA 2Q43A 3SI1A 4EWTA 1YLOA 4A39A 3D7GA 2GREA 4UIBA 3K9TA 3SJFA 3DGVA 3IC1A 2ZELA 2PJ6A 4DUKA 4MCQA 3KR5A 2PVWA 4Q7AA 2AFWA 1BPNA 1PYTB 4MRIA 4PPZA 4NFRA 3KL9A 6CPAA 3LMSA 4R8FA 3D66A 2AFOA 1TKFA 2ZEGA 2OR4A 1XJOA 3BI0A 3H8FA 1JQGA 2WZNA 3RBUA 3PB6X 5JM6A 4ZX9A 4P4IA 2CTCA 5LYIA 2PE3A 4ZX8A 3S9LA 4OP4A 4OC0A 3IFEA 3B7IA 1EE3P 4P6YA 1Y0RA 5K8OA 3FECA 4ZY2A 4TWEA 2GU2A 2CIJA 1FNOA 3H8GA 2ZEDA 3D68A 4UEEA 3QNVA 5CPAA 1LOKA 4G1PA 1XMBA 2AFSA 1ARLA 4WWVA 3WC5A 4ONWA 2PJ8A 3RZAA 3WT4A 2V8DA 1TKHA 2ZEPA 5LYDA 3WC6A 4NGPA 3PBBA 1TXRA 4IHMA 4MCSA 1CP6A 1R43A 2CF4A 2C6PA 1BAVA 1CG2A 4X2TA 1Z2LA 3IO1A 1NSAA 4OKOA 4FWUA 2NSMA 1ZG7A 1TF8A 3ISZA 4YWYA 1ELLP 2Q51A 1M4LA 4F9VA 4IK2A 3B3CA 4UF4A 2EWBA 2IJZA 3FJUA 4GM5A 3PB4X 2ZEMA 3PB8X 5D29A 5IB9A 4P45A 5LRGA 2JEWA 2ANPA 4Z65A 4K3NA 2IQ6A 1Y7EA 2NYQA 3GUXA 4LQGA 1VGYA 2JBJA 2G9DA 2WYRA 3B3SA 4R7MA 3L2NA 3PFOA 1ZG8A 2DEAA 2GLJA 2V77A 5HVGA 4BD9A 3PB7X 1LFWA 5D8NA 4NJRA 3WABA 4IAVA 2V8HA 3NFZA 4OC1A 4MCRA 2PJ3A 4P4DA 4OC5A 2PJ4A 1AMPA 2XEFA 3SI2A 2AFMA 2PRQA 1XRYA 2PJ9A 4W9YA 2ZEOA 2QVPA 1F57A 3KZWA 3FF3A 4FUUA 1IGBA 5LRKA 1YW6A 4NGQA 3V7ZA 4X8IA 1RTQA 3IJ3A 2AFXA 1XFOA 1LANA 3FH4A 1DTDA 2O4HA 1BLLE 3NH4A 4NGNA 1TF9A 1YMEA 1VHEA 3I1UA 4CPAA 5K8MA 2IMOA 2PJ1A 3VARA 5HXDA 1UWYA 4NGMA 2O53A 3D7FA 2PJ7A 4UIAA 5I4MA 3NH8A 4A94A 3D4UA 1YW4A 5LYLA 1VIXA 2PJCA 1VHOA 5K8PA 4DYOA 3TX8A 3GLJA 2PJ5A 1LAMA 4P10A 1KWMA 2PJ0A 2FVGA 4JYWA 1ZG9A 3B3WA 4MCPA 4OIDA 3BXMA 4DJLA 2BO9A 4PQAA 3IIBA 3KI9A 4TNUA 2Q4ZA 3FVLA 2QJ8A 4P4EA 4MHZA 1F2PA 2HC9A 3VATA 3PBEA 2J9AA 2XEIA 5HVHA 4EFDA 4EMEA 4OMEA 4UEZA 3T8WA 4OIWA 4AXVA 4ZI6A 4OC4A 5LRJA 3FX6A 4NGTA 3SJEA 1Y0YA 2HB6A 1CPSA 5F09A 1LCPA 3N5FA 3MN8A 1TKJA 2RFHA 4NGSA 3B35A 3PFEA 4ZY1A 3S9MA 3BHXA 4FBEA 2AFZA 1F2OA 4WJBA 4ZY0A 3VH9A
chains in the Genus database with same CATH superfamily
4WZQA 2HQGA 3OFFA 1U4BA 4AVCA 1B0TA 2GVZA 1N5VA 2R7HA 3HT0A 1FDBA 4H4MB 3GJRB 4NLTA 1U6MA 4OYAA 4DFPA 3TJ9A 2PFFB 3WR7A 1RT4B 2CPYA 4ZIWA 3GYXB 2VJVA 2DHSA 3NA6A 3IA0A 2BQ3A 1S9EA 5DZ7A 2DY9A 2G9OA 2DXFA 4K0KF 5ETPA 3M8RA 4TLQA 4ONUA 2C2MB 2O1PA 4AD6A 1VQMS 3DRRB 3FK4A 3AH6A 2C22A 4JV0A 3Q22A 5D77A 3KG1A 4J90A 3NAHA 2UZAA 2XEJA 3PO4A 2CWXA 5IC6B 2B9XA 5BYSA 2DB1A 1QUVA 2HPUA 2DNKA 1BMQB 1S9GA 4PV6A 2YQ3A 4ZK7M 3KNGA 5KAKA 3IAS9 2EBGA 2CAJA 2MPUA 4HACA 3D67A 3PRVA 2JEJA 5MLCV 4P4BA 3FMCA 3HD1A 1V9OA 4CGNA 3WC7A 1GFWB 5E3PA 3VAMA 4WFBQ 1Y9WA 1A7GE 3UD5A 3KTQA 5I3QA 4DXLA 5KG6A 5AXMA 3KYLA 2D7SA 3R6GB 2F8MA 2KM8C 1U48A 1R0BG 2KHCA 1IIDA 1WKLA 2EK6A 1Y5IB 2IHR1 3FZBA 2HHPA 1BWEA 2OPRB 4P2SA 2RDIA 2YNFA 3M6VA 5D0EA 2QLJB 1VHIA 2Z3LA 1ZTWA 4NZ6A 2VDIA 3MUMP 3KASA 1XMOJ 1Q5YA 3SSRA 4DOZA 2WB4A 4MHYA 1S72S 2WOMB 1RK8A 1S4EA 3L95X 3PKMA 1KQFB 1IICA 1RT5A 2F40A 2ZKUA 5I42B 2XO7A 2YWWA 1NMTA 1T9XA 4KHPJ 5F8IA 4FBUA 4ZN3A 1U1RA 1AZSB 4LF5F 1PYTB 4CT8A 4XPCA 3AOCA 5A8KB 2HGMA 2W7AA 2WSEC 5JVGQ 3BI0A 1JQGA 2E29A 4PRFA 3V6DB 3QNWB 2YNIB 3LALA 1HI0P 1U0SA 2OPSA 2FHJD 1SC3B 4TU9A 4L74A 1OY9A 1M1KT 4UEEA 2IYGA 2BRLA 4L75A 2NZCA 2X3DA 2Z3KA 2V0NA 2SXLA 4ONWA 1U1OA 5C88A 5F8JA 3BQ0A 4BHQA 4MI4A 2NXEA 5KT2A 5ETSA 3RB6A 4X5KA 4ZVHA 3PYDA 1QTNB 2ZHOA 2EFNA 1DLOB 3IU2A 1IM4A 3GKRA 3BN4A 4ED4A 3W6XA 2PO4A 1X4DA 2BEIA 1UWAA 3C8YA 3M8QB 1IOFA 1DTQA 2H3EB 4N5SA 4F2SA 4JI7J 4GM5A 2K1RB 5HP1A 1HWLA 3AXMA 4LF4J 3WZ0A 3KG0A 2ZOMA 3SCLE 4BMHA 3QIDA 1IKVB 3DYAB 3FBEA 3NS7B 3I5CA 3T9NA 2VA3A 1FRIA 4DSIA 1XNRJ 1VLOA 5RUBA 3MAHA 2IVFB 3EDRB 1ZG8A 4FYWB 4BD9A 4PR6A 2AJ1A 4EO6A 1ZOTA 3SBMA 5FLXU 2HIQA 4DFJA 4PYAA 1WWHA 2CNLB 1N4LA 3FCHA 3DMJA 4DV6F 2FIAA 2IBOA 3MEGB 2KYZA 4QYRA 1Q86T 4E0DA 2HHWA 4OJ1A 3CCZA 1NJZA 1B7FA 3M8WA 1RWNB 4CT9A 3FSYA 4H4KA 2PFDA 1XFOA 4DL3A 4YB6A 1RUSA 5K8MA 1NJXA 5FLXY 3MPVA 3L7PA 3I4HX 4X4OA 2YKMA 2Z3PA 4NA3A 1P8GA 1NH8A 2LXIA 3OW2R 3BGRA 3KK3B 4K50A 2GAGC 4C8OA 3NBPB 5CCLA 3UPFA 1RT2A 3THPA 5E3CA 4UBRA 4ZLJA 4I4BA 2IA6A 3W63A 1B87A 1MROA 3NKYA 3GP9A 4LQ3A 2Q4ZA 1DRZA 4TYBA 1F9HA 7AT1B 4MK8A 2HYIB 1I3OB 3CTRA 4GC7A 5C25B 3ZTOA 4XPDC 2DNMA 5HVHA 4OHZA 4EZ9A 4ANCA 3FEYB 3AQPA 4RI1A 1FA0A 1NRKA 3KLIA 3KJQB 4LBHA 2OU2A 2HQDA 3MD1A 4C2XA 5E2QA 4OIXA 4IYQA 4NCBA 3MHYA 2ODFA 3D28A 2ZH6A 3SQGB 3DRSA 4K4VA 2P8IA 4CLZA 3HPOA 1Q7YT 1JLCA 4RO0A 4JYAJ 3CNQP 4NLPA 3TRGA 5D4OA 3TFYA 3OFGA 1SJ4P 2D4PA 1QQ9A 5E3AA 1SJRA 3LW5C 3IWEA 3KDNA 2R2UA 5KG5A 2DIUA 3KLEB 5C5JA 1VHSA 3H2VE 1S57A 4CS0B 4Y2AA 4FP9A 3GG0A 3TYTA 3NEKA 3PZJA 2KXFA 3W2WB 2B4DB 4PQUA 2R3VA 5IV4A 1IBLJ 1XMQF 1R0AB 1R8HA 4P71A 1UPPA 1FY7A 4ZLLA 2PQ8A 4NYZA 4A38A 5FD1A 2XY5A 1RTJA 1GMVA 4C3KA 1C1BB 4X62J 2MKHA 2BW7A 1AFJA 2UVUA 2HVHA 1O0PA 1WORA 3BO2A 1B0VA 4P52A 5CD4H 4WK1A 4ICLA 5KTCA 4M95A 2IAJA 1OJ4A 1FTRA 5I3UB 3C14B 4QPTA 4JI4J 2HHUA 1HA1A 4CM0A 4EYIB 2XEXA 3CMAS 5LMUJ 2FD2A 5CHCB 1KC8T 2FJVA 4MFJA 1U7LA 1Q8KA 2IY5B 2PJ2A 3DOKB 3FZ2A 1H8LA 1GT8A 3ZZYA 2PSWA 3EZUA 5E96A 1Q53A 1VBKA 3R96A 3NNCA 3CT9A 1K73T 5JPHA 2AFUA 4NCZA 3QRQA 4PK3A 3H4BA 3S6GA 4DV4F 5A8RB 1VJWA 2XI3A 1PILA 3GCWP 4DS4A 3E01B 4LR8A 1RO5A 1S5KA 2K06A 4Y2KA 4P9SA 1Q16B 2JJ4D 2ZUAA 2NSCA 3AT1B 3M30B 1KQSR 4EWTA 1EKSA 3DLGA 1KTQA 2HFNA 4OI1A 5AJ3J 2MQOA 2P2CB 4EBCA 1T9WA 4KHRA 4ZVEA 1PJ6A 3TEGA 4KFBB 4DUYF 2W9CB 4R3LA 1GK8A 1X4AA 3A1YG 2W4CA 3W60A 3DLHA 1RP5A 3ENAA 3T90A 2DEIA 1SL2A 4DQSA 5DLFA 5IQQA 4KVME 2FLOA 1J4JA 3L7UA 2ASDA 1TP7A 2ZEGA 2OR4A 1XJOA 1NB2A 1OS5A 4OP4A 3FRZA 3Q2SC 4F0MA 2DBBA 4NEZA 3UVJA 3I87A 1CJVA 1YBTA 2KO1A 4CO5A 4ZY2A 1EETA 2CIJA 4M6GA 3KFWX 1VRTB 4WK3A 4G1PA 4M5KA 4O4RA 1HBNA 4GS4A 4KGVB 2PJ8A 3FIXA 5IWAJ 5DLGA 3BDEA 1XERA 2MY8A 2BRKA 4QUSA 2WONB 4HTIA 1WEZA 4AXIA 5C2GA 1HNZF 3ONQA 1IQTA 3D2WA 2QX0A 4FWUA 4J9VA 5JJBA 1ELLP 4DR7F 1HQEA 2ZBCA 3D0IE 4DV7J 3SEOA 2B58A 5CAAA 2YXLA 3F41A 2QV6A 1OSCA 4M5NA 2AYMA 2AF6A 1NSLA 3SXNA 3EGZA 2VEZA 4MFKA 4C3LA 2P6GA 1U8SA 2AP6A 3NE8A 2HRUA 2C2NA 2XYHB 3TUPA 3QGGA 5D8NA 4NJRA 3VALA 3WABA 2GQQA 3CCWA 1FK9A 2N3LA 1B3TA 5F0UA 1JIHA 1WI8A 1RBLA 4DR6F 1H2VZ 3TOQA 4X65F 2B8PA 4KOSA 4FNIA 4KH1B 3ILJA 4ATNA 3KZWA 4YR0A 1P6TA 4MFBB 4LF7J 5GCNA 1XF8A 3HHEA 1YZ6A 1RE1B 4K7QA 2MEWA 2PJ1A 1FKOB 3A8IA 2GIRA 2ASLA 2E7VA 1RTIB 2V4QA 2QL9B 1KRPA 4DYOA 4OYWA 3PCOB 4NOHA 5HN0A 1I6JA 2A2DA 2H51B 2J9DE 1N33J 4I7FA 2AKWB 2AZ1A 3AD8C 4JYWA 4XPLA 4KOTA 1FKAF 3DDKA 2LMIA 3B3WA 4ID5B 2PE8A 3NRBA 3PM9A 3PRBA 4B11A 4NCGB 4KO0A 3BO4A 1FKPA 2HV2A 3ZZRA 4MHZA 4NRTA 4RR5A 2RQ4A 2B9YA 3VVTA 1S9FA 5DQHA 4Z2XA 1LWEA 3IRXB 4ID8A 3D1QA 3VV2B 4J5OA 2MGZB 1NM2A 3Q2TC 4N8OA 4HLBA 1RTHA 3CC7S 2VFUA 5E41A 2ZPAA 4USIA 4DHVA 3PEHA 3NCRA 1RAAB 2AFZA 4DR2F 4EBEA 3J80Y 3POTB 4XIUA 2G1DA 4ZP9A 4GMKA 2NQPA 3MOZA 2OIHA 2VG6A 2XZTB 2C3PA 4I69A 2GHPA 3US5A 2XG8A 3BJYA 1EHWA 2MZTA 1ZLHA 4OZJA 2HURA 2JX2A 3CSKA 3R5DA 1IBKJ 2DGQA 4JI5J 1HQUB 2B5GB 5GMDA 4N56A 1M5VC 2VPXB 3CPXA 1BD6A 3QLHB 3R5CA 4RS2A 3JSBA 4A8OA 2YNGB 1HWUA 1HDUA 2G2ZA 3D7DA 2C3MA 3W65A 4DFMA 2XTJP 5KFNA 3R5GA 4ED0A 3H5XA 3BBCA 1T8EA 5CYJA 3U1LA 4WKRA 3Q0AA 3KLGB 5K8NA 2JFDA 1SH0A 1VQ5S 3MM8B 2B7BB 3BM7A 4ILLA 3M2UA 2LA4A 5D6GA 1TQLA 4RPFA 4JI0F 4I56A 4ZPCA 1WF1A 2ERRA 5HMXA 1RWMB 4ANDA 1N88A 3KQZA 1N6QA 5THWA 5CABA 4ZVOB 1I12A 1UEVA 4ZJLA 1LK5A 1ACMB 4C2MA 5B0CA 5G22A 2GQ2A 5HH1A 2ACYA 2BSWA 4PAAA 2PJBA 2V2ZA 2RHQB 4OJGA 3P4UB 3UN2A 4DV5F 3JQJA 2ATLA 1IKWA 4PWDB 5EMIA 4NLUA 2M7SA 4PABA 1I1DA 2J7UA 1FVQA 5DETA 3GCXP 1AYEA 2YKPA 3TA0A 1WKJA 1K1SA 3MM6A 3F56A 3K2YA 2P9EA 5IQ6A 2ADBA 1Y9KA 2VZ9A 5D0HA 1EX8A 3FNNA 2VONA 2UXCF 1RISA 3CVKA 1NSQA 1HBOA 3MECA 4F3QA 2C6CA 5KFLA 3QAUA 2F9DA 2R2RA 4TY9A 2GGPB 4X66J 2A18A 2ZH1A 1M1DA 2GREA 2EWHA 5B0BA 3WC2A 4JB8B 3GYAA 4W92B 4A8YA 3PJWA 2HNZA 5KTDA 2UU9F 4HDGA 2LFVA 5CYMB 4KV8B 3LP1A 4FD4A 5LSOA 3FVYA 4N47A 1TU0B 2WW8A 2R8VA 2FYXA 1L3TA 2CQDA 2WZNA 2Z56B 3VQTA 2DY1A 4WKYA 3THVA 1WI6A 5G21A 1SXLA 1EE3P 4B02A 3M9OB 2AZ3A 2OPQA 4M5DB 1QSRA 2UUCJ 1Z8TA 2ZBRA 3X3UA 4UFVA 2HZAA 4HT5A 4ZPAA 2IRXA 2XSFA 2P6TA 3VHQA 4L8AA 4AL7A 4KKOA 1UFHA 4GKJJ 2V8DA 1X0PA 4ZS6A 4XTTA 3LUYA 1SH2A 1X5TA 4LSNB 1LW0B 3O6QA 2C1EB 4MCSA 5HROA 3IO1A 1L3VA 3HKZD 4ED2A 1ZG7A 3KWMA 2ROEA 3TO9A 2PD1A 1HD1A 1U0HB 2EWBA 4KGMA 2ZEMA 4F0HA 4ANEA 4B17A 2DGWA 2L9WA 3KJNB 2AEFA 4RW9A 1RT6A 2MSSA 3AXKA 2FE7A 2D1CA 3RBXA 4AG7A 4I2PB 4AL5A 2DXQA 3DNSA 3FCVA 1B70B 3C66A 3PFOA 2XMTA 1NDPA 1D9DA 1SIWB 4EO8A 4IR9A 3GIMA 3NFZA 4IOBA 5FJ4A 3V8IA 4UTGA 1VRUA 2MLZA 3EPGA 4UQGA 3M8ZA 3BSOA 3PG9A 3L7OA 2PJ9A 3T3FA 3OQ2A 3M9NB 4ZP8A 4KORA 4F3MA 3G3SA 4QU7A 4PWWA 3FB3A 2FJWA 2VV5A 3QT7A 4HTJA 5EC4A 1X4HA 3QIPB 3FRYA 1VBYA 3G8TA 1SH3A 5L1KA 1FESA 3G8WA 1O6XA 2MZ1A 1M0SA 2MKIA 3SCIE 3N0VA 3R97A 2Z57B 1T9VA 2RILA 3DLLQ 2ZH2A 2H54B 4K4UA 2XGPA 4UIAA 3IBFB 1S0MA 4YMEA 3CXQA 4B5PA 5C82A 4LF6J 1VC0A 1KWMA 4PEOA 4A8WA 3WX4A 2DHHA 2B8QA 4M8LA 4IG3B 2IRYA 2V9KA 5D3GB 1P9YA 3P3DA 1WD6A 4IH5A 4FYYB 3KMQA 2N3OA 4CO3A 4P4EA 2DGOA 2VBYA 2J76E 3SHPA 1IR1A 4IQMA 3R9EA 5HLFB 3KHLA 3TO7A 2G1HA 4ZHRA 3EVOA 2GFFA 3W7BA 3W9HA 3BSNA 2J6SA 5A0YB 3B4MA 2I00A 4IDKA 2ZM6J 3S9MA 3BHXA 4FVCA 4EZ6A 1YQEA 1ON0A 2F4FA 3CJKA 3I32A 1RU2A 1RB0A 4IG0A 2ZZTA 3QGPA 3EXCX 4Z7CA 3SI0A 3K5NA 3UWTA 3Q24A 3KDOA 4J37A 1RWVB 1RGVA 2ZWPA 4TN2A 3MMCB 1K9MT 4MYTA 3KK2B 3SDEB 4MIAA 4GVBB 4B9SA 3UR0A 1LEOA 1SJQA 3NOGA 1TL1B 2FDNA 2HFZA 3NG8A 4CNZA 1DTTB 2GO8A 4PYDA 3K0JA 3AHPA 2ZOGA 4C8LA 3GONA 2W8KA 3B3VA 4EYHB 1WC5A 2GMLA 1IQZA 5IB0A 4OZ2A 4B3OA 2C3YA 4PWUA 1GMWD 4U8YA 4CGPA 3NP5A 2NXUA 1N36J 1R3NA 5KFCA 4B14A 2GS8A 3GWCA 3PB9X 1V0CA 3TOBA 2RRNA 3T5JA 3W6SA 2P9GA 4N41A 4FPIA 4MHPA 1ZBTA 1FD2A 2DNHA 1V6HA 3LOUA 4YRHA 2IM3A 1KHWA 1DJ0A 2XMKA 4C2ZA 2FY8A 5KFVA 4C8ZA 4JI8F 4CO2A 2CXAA 9RUBA 3ICLA 3LGNA 4ECQA 4DDFA 1QE1B 4F67A 3A8EA 2VH7A 2NYHA 3C16B 6FDRA 3H5UA 4MKYA 4JV1A 4FN5A 4QIVA 4L89A 4MK7A 3JTPA 1ROFA 3DLKB 3TE4A 1PJ5A 3H42A 4P4FA 3PW4A 1TELA 4F8RA 2LU1A 2FLLA 2DHGA 3PIPQ 3RYLA 1LOUA 1Q95G 1V3ZA 1J5EF 4FXWA 4UCNA 3VGTA 2Q43A 3ZZOA 2AJ6A 2FHKA 3R5AA 5B0DA 3W61A 2WBMA 3DGVA 4NLDA 1BE4A 4PG6A 4URQU 4OYPA 1N5QA 1ELOA 5T7LA 2KT5A 4AYBD 1FJ7A 3KHGA 4A33A 4A47A 1JX4A 4PPZA 4X64F 3KL9A 1FFSB 4USTA 1ZM3A 3D66A 2ILZA 5CYQB 5IS2A 1M44A 3DLBA 1NE9A 3PW0A 3W5XA 4P6YA 3T1AA 1TR0A 2J7KA 1M5HA 2NUUG 4DV3F 5KFWA 1S49A 2ZE2B 1Y7PA 3D7SB 1TK5A 1WHYA 3IN5A 3WT4A 3RB0A 2R2SA 4EGLA 4C11B 4RU2A 2YKNB 1DQ8A 4DG1B 3F44A 1SKWA 4IHMA 4YB5A 4WFZA 2CF4A 3W1YC 4OX7A 3VQSA 4EI2A 3C19A 3T1YF 4BWJA 2BE2A 3X1LB 3G96A 2H5JB 1S5ZA 3QT8A 2Q51A 4DR4F 1YJVA 2M5YA 4MKBA 1S1VB 2W8LA 1KUVA 2GC8A 3VGSA 4LUAA 5H9FJ 2DNQA 3PB8X 3AQOA 3TX0A 5LRGA 5F9NA 2B43A 2GMHA 2C2KB 2ALZA 3F0AA 2PEHA 2V63A 2WZ1A 3HI9A 1FRJA 3CD6S 3MM9B 3I3GA 5A76A 1JNRB 4B3RJ 4DV1J 3P8BB 3HULA 3L2NA 3ZTSA 4CNYA 4UCMA 2WVDA 3MMBA 4XNHC 1TKZA 3K5LA 2B4OA 3DN9A 1U2RA 2CPJA 4ER8A 2PRQA 1XRYA 1S1XA 5ADZA 4U7UD 1X8DA 3J81U 3IWXA 4USHA 1YW6A 3J7A1 4KTQA 3HHLB 3FBCA 1DTDA 3NH4A 3NGDA 1TF9A 2KZZA 5AE2A 4U6PA 2XS2A 4UOFA 2J5AA 4KVOE 3W66A 2FVQA 2VOPA 2BW2A 5LYLA 3EWGA 3JXOA 4MKVA 4HHJA 2PMHA 3J81Y 3CIZA 5B0GA 3OL9A 2QTWA 4ENOA 1JLEB 1VR6A 3ITHB 3QO9A 1LAMA 1WHWA 2DR7A 4H89A 4ZITA 1PIEA 5HO4A 2VU5A 3AODA 3IIBA 3NOCA 2FJBB 2F4VJ 3GSIA 4K4XA 2AJ0A 1TK8A 3EDQB 3M8PB 5AXKA 4DX7A 3A3PB 3KG4A 3VATA 3I82A 2B5JB 4UY8T 3MMAA 5EN1A 1WOSA 1YTYA 4YQWA 2HNYA 2NPFA 2J0SD 1LCPA 3MN8A 2FC9A 3M6UA 2ZH8A 2MZJA 3CJQA 4X4SA 3GV8B 1KQKA 1H72C 3QT6A 2EW9A 3ELHA 2B4BA 2CYYA 3S6FA 4QBUA 2ZD1A 5DS0A 2HVIA 1HEEA 2UVRA 3IEHA 1JB0C 4CAWA 2V4JB 2UUAF 4JD6A 3NMAA 5L1JA 1QSOA 4ZVQB 4FAIA 2HQIA 1XEZA 4OX8A 2LQ9A 4Y2MA 2IBKA 2XLJA 2PR8A 4UT4A 2KU7A 4B9UA 3T1HF 4UZBA 3DOLA 4EUVA 3K2KA 2DRDA 3D6HB 4CDIA 4RW8A 1ZPWX 3PYFA 2K5TA 2VKRA 3BSAA 4YN3B 3V4IB 4NXMJ 2ZW7A 5CBMA 5HL7Q 3BDPA 3EVMA 3HHLC 3LWLA 3ZNJ1 2ZEEA 3VWDA 1FDAA 2GFQA 4LF9F 1IUJA 1Z5RA 3TUJC 3C2PA 4RNFA 2UXDF 4ZKAA 3RBZA 2RDJA 1CPZA 4MFPA 3Q23A 1SI9A 5ELYA 2E5JA 4DR5F 1GEHA 4Z37A 5G0RA 1CQNA 2O3DA 4YR3A 4HVZA 1LWCA 4PG8A 5ITHA 1QSLA 4YB1P 1R8PA 4ZP7A 1MJ9A 3JQKA 1RYRA 2KG1A 1XMOF 2Y8YA 1S79A 1IJFB 1Q7LB 2CZ9A 2XSJB 3OXFA 2F7VA 5IFMA 1S1UB 3DM2B 4FKXA 5A8WB 1FJGF 1KBRA 2K3IA 4R0JA 3J7YU 2RQKA 1VLYA 1KLNA 1U26A 2GJ2A 3CO0P 1F9EB 2Z30B 1REVA 4J9SA 1D8YA 1LXNA 5EWEA 3PRTA 2E7WA 1S1TA 1C0UB 4OYXA 3HKWA 4ECXA 2DR6A 3NGKA 4EBDA 5LL6d 3NWGA 4JI6J 1REGX 3KKFA 4O4GA 3UI3A 4TYAA 1M5KC 3MPYA 2J0QD 2QLXA 3D7GA 4DN0A 2ILYA 3GTYX 2C2RA 1TKTA 4ZCLA 4MCQA 2XLKA 4KVXA 2J8SA 2MHEA 3C46A 4NXNJ 5HJYA 4NLWA 2CNKB 3NS6A 1YDLA 2GAHC 1W26A 2HGLA 2NYIA 2WBRA 2VPWB 2V9WA 4NL5A 4USWA 1OY8A 2XNRA 2RQMA 1NH7A 1U1KA 1T94A 1CM0A 2XMJA 3VWSA 3G6XA 1SKSA 2BKPA 1LOKA 4Q44A 2E5LF 3DSBA 4WWVA 1KEKA 5LYDA 3NGUA 2G2YA 3OPKA 4Q36A 6AT1B 1TXRA 3DHWC 3CB4A 4GC6A 3H4DA 1E6YA 4CP5A 2CRLA 4Q38A 3ISZA 2B51A 2M0GB 4A8FA 1VC5A 3S6HA 1VQ9S 3JB9k 4CO4A 5D29A 2YWKA 4J9OA 5KT6A 1XNQJ 3TO8A 1LWFA 5LMNJ 4ILMA 2EC2A 1NHKL 5J2MB 3QRRA 4LQGA 1YLEA 4UWJA 1Q1KA 1R6YA 3JYTA 1Z9UA 4FXDA 2H4YB 2OGUA 5IC4B 1UVKA 3R7BB 4CQ1A 5HVGA 1KLMA 1G1XA 5L46A 1WHXA 1RHQB 2VQFJ 1HL6A 4HT7A 4OC5A 3ISNC 3DXSX 2AFMA 1S0VA 2FJDB 4LF8J 4WE1A 1JKHA 1HBUB 1KVIA 5D0GA 3V7ZA 4X8IA 2UXBJ 1FRMA 4EU0A 2IJNA 1SKRA 1AUDA 3H5ZA 4ED5A 2OTLS 4X4TA 3BH7B 2AW0A 2Z58B 5KOWA 1SJFA 4CPAA 1NK6A 4OI2A 1MW7A 4UWIA 4Q2LA 1U6ZA 4QC6A 3R1LA 1RT7B 4JI2F 5K8PA 3QFWA 2H4WB 1X0FA 2JLEA 2IA0A 1VYAA 3I6PA 2R8KA 4OIDA 3H98A 1QSYA 8ATCB 1K44A 4PQAA 3BREA 1YLXA 3N6MA 1QSSA 1RHKB 2RU9A 3QMQA 2W1BA 3MAQA 3N28A 1RTIA 1RWWB 1MMDA 2EFVA 4DLEA 1RQ0A 2HS3A 2VG5A 4A8QA 2HWHA 3QFHA 4AQYJ 2R1IA 5LRJA 2A6MA 1Q79A 3E8OA 3M2RA 2Q3PA 2R8JA 1QY7A 1RWKB 1UVMA 4M1KA 2BANA 4ZY1A 1IBLF 4DNCA 2EI5A 5KFHA 4QW9A 2QRRA 4C98A 8RUCA 1Q0NA 5HSPA 4LRDA 1BLUA 4B3TJ 3TJAA 3VAIA 4U95A 3DR6A 1S0OA 3NH5A 3D2PA 2LKZA 2MQNA 1UW9A 4KRWA 4TU8A 1S6QA 2F63A 3R2CJ 4L3KA 2LDYA 5KT5A 3SJXA 4F6AA 3O8WA 2E1RA 1FTCA 3DOMA 5DS7A 1HNIB 1RT1A 4OHVA 3ZZPA 2ZBIA 4Q0BB 2UUBF 4G65A 2HK2A 5L1LA 4E2AA 1FDDA 4V19J 2P6SA 4JI3F 4N76A 2Z2LA 2XM3A 3MURP 3VF0B 3NMRA 2DCUB 3O3LA 4ED3A 4HNWB 1FWKA 2Q7SA 1YI2S 4KLVA 2PIZA 3AA9A 2Z8QA 4NLSA 2VC0A 4CTAA 1SJ1A 4KOWA 1PUAA 3SCKE 1DURA 3KLGA 5KT7A 4NRUA 5K20B 5FDLA 4J9UE 1IYLA 1GXUA 3MPWA 3FYNA 3J7AN 3LP0A 4IOCQ 1TL7A 1TKDA 2IPOB 2GIQA 5ETRA 1SC6A 3QJLA 4FNHA 3R5BA 4KSAA 3KGQA 4R8UA 2MZQA 1NBEB 2CQBA 2R9LA 4DQRA 2K7JA 3BH6B 1HWKA 2CWKA 4IQXA 4OZ5A 2HFSA 2JH3A 3V81A 3RTVA 2XB2D 1ELMP 4Q5VA 5CZVA 4ZPVR 1UVIA 3OWCA 5BR8J 3OTOF 2EG2A 3K9TA 3SJFA 4ZCIA 3U1NA 4QIFA 2PJ6A 3PR4A 2B9WA 3MM7B 1PBAA 1PC4A 1IN0A 2RQCA 2BOPA 3I0SB 3DDIA 3V4MA 3I9SA 1RTZA 3PW5A 2B6AB 5U47A 3AB2B 2C2OB 1TKXB 2AX1A 1YX2A 1FE0A 4OZ1A 4R8FA 3MFIA 2A10A 4RNNA 2Y0BB 5DGAA 2QFJA 1T03A 2WVEA 3PB6X 5IV0A 2HVDA 5EX3A 4CLLA 3PEJA 3D6FB 1I51B 4DL0C 4WZMA 4DV7F 1R6VA 4DCOB 3CDEA 3OR1B 3F5BA 1XMBA 9ATCB 4J9RA 1TUWA 3WC5A 4K0KJ 1URNA 3M32B 3WC6A 2JOQA 2ZDOA 5CH7B 3QZ7A 3A3NB 4P75A 1WJ9A 3V6JA 4XDDA 5CZXA 3PO5A 1VQ7S 2EVNA 3QSYB 4JXQA 2R7RA 1SVDA 4DPXA 1JJ2R 1P0HA 1HNVA 1NSAA 1NUEA 2UUWA 2EPIA 3GY9A 4YS2A 1WF0A 1QVFR 2LXFA 3M1VB 4BBHA 3ET6B 3FFIB 5K14B 3CWJA 2WRMA 1CVJA 2HAFA 2D69A 2BMBA 1Q81T 4B13A 1HHTP 4IK2A 2W2PP 3B54A 4DJBA 4DLGA 3FJUA 4P7VA 3KK1B 3CJ8A 2QFIA 2HEKA 2GO9A 1IKYA 1LW2A 2CJQA 2F65A 5B0EA 1S76D 2IQ6A 3KLFB 4M5MA 4DWIA 4UY85 4DFKA 1MU2B 4CAFA 5HI7A 1GX5A 2PSZA 1HI1A 1MN7A 4QR0A 2CPFA 1BQMB 1H7WA 1NEEA 2RS2A 3E0KA 4C8MA 3BN7A 1HBMA 2Q4YA 4AT1B 4DQPA 4ZLPA 2MKCA 3FKBA 2HHTA 3W5YA 2RF2B 4FUUA 2B7CB 3QJJA 2DIVA 1S10A 4ES3A 2IDLA 1RTDA 1HHSA 1NPPA 1HIYA 5ETKA 2I5JA 5CXTA 4TY8B 3MM5B 4B10A 3BF4A 4JV2A 3PIOQ 2DPIA 1W2IA 1DFDA 1KTVA 2CG4A 3I0RB 1Z1ZA 2BL1A 1X31C 4FYDA 2UP1A 2DPTA 3EM1A 4LF5J 1HYSA 4ES2A 2Y1RI 4CYUA 3EZOA 1P9QC 2JEGA 5F46A 3CDWA 3W2VB 3OLBA 1S1WB 4OX6A 4B3MF 3LPEA 4ZMMA 1LNQA 3RBDA 1FRXA 2MHNA 3KMSA 5KT4A 2M4MA 4EMEA 4QW8A 2AEJA 3PYEA 1ZZNA 5DDRC 4OLLA 2E1CA 2RKIA 1Y0YA 4HHUA 4K30A 1KZFA 3BPDA 2PDAA 1D1UA 1TKJA 5ETMA 3EMTA 4QYZK 1N5YA 5M2RA 3LQVA 2FHOB 1BUXA 4CO1A 2CQ3A 5DWNA 4OC3A 2I0XA 1BGXT 1XR7A 4M5JA 1JLAA 5F41A 4OJ3A 2BDPA 3MR2A 3D3CJ 3O1LA 2P6FA 4A2ZA 4QIWD 5KFRA 1UZHA 2XWYA 4ZVSB 4DL6A 4MHNA 2PT0A 2JVOA 2W2OP 1SBRA 2JDJA 1RU1A 4NCAA 3KJVA 2G13A 2DR8A 3TUIC 2ZZNA 1IKXB 4NSQA 4LJMA 4MHDA 3V2UC 2CPDA 2HLTA 4YR2A 2UUTA 3MCNA 1HQ2A 1XN9A 2F8HA 1F2HA 3MEDB 3T5LA 2W2MP 4K4YA 4I2QB 2EC0A 1YKWA 4M63A 2U2FA 1LAPA 2VPYB 4DV6J 2FVRA 3VAJA 3ILIA 4LFCF 4AXJA 3HJVA 5B0AA 4NPOA 1VJQA 2GW8A 2OPPB 3HSJA 5J2PB 3MCMA 3TAMA 1RA7A 4OADA 1PCAA 3QWUA 2GVZB 1AUGA 1VQKS 4KYZA 3H25A 2NLWA 2ZENA 2VIHA 3EE3A 3D7HA 3QPIA 3ZZZA 1SUQA 1MJAA 4NYPA 4U7UK 2DISA 1PYSB 2QGFB 1S9EB 1ARMA 3P5BP 1N52B 4OX9F 1HMVB 4V19X 3OHBA 1HW9A 3BKUA 2HHVA 2QIRA 2HZVA 1YVKA 2Y8WA 4O23A 4DV0J 5IM0A 3RRHA 3CULA 1K0TA 3M8SA 4O3RA 3KLHA 3MD3A 4A37A 1CQMA 2DNYA 4WTYA 2V68A 3RR8A 1TL3A 1S9GB 3B6BA 4GVLA 5KFTA 2ATCB 2X3GA 2HBZB 2QMLA 1Q2DA 2PVWA 2OJ3A 1A6LA 4HACB 2RS8A 2AFWA 2XC9A 4YHHF 4UW2A 4LUBA 3A12A 1HW8A 1OPZA 2AD9A 1AFIA 4RKUC 4RBTA 1Q8BA 5HQLA 1WWZA 5LYIA 3RR7A 4OC0A 4IH7A 2YNHA 4OV6A 5KG4A 3H8GA 5AE1A 3CXCR 2AFSA 2YNFB 1ZM9A 3G87A 3CIMA 2W9BA 2GZOA 1NO8A 4FF1A 1XMQJ 1TKHA 4ZDNA 1R8AA 4ZVGA 1YK3A 3WX8A 1PBUA 4UUWA 3CCTA 2Q44A 1FO1A 3GFYA 4HI2A 1D0EA 3QT5A 4OJHA 2KM8B 2I79A 4RNOA 2GIFA 1RT5B 1SQFA 3OL8A 3RO0A 5G1ZA 3K57A 3N6NA 2H5EA 4BLGA 2M8DB 3HFZB 3NCQA 5CA5A 1G6BA 1TV6A 2VD3A 3ENVA 1U1PA 1Y3JA 2XMMA 1FRLA 3ZXWA 1I1GA 2HFOA 2JC0A 4KBIA 1Z4EA 4CLWA 2EO8A 2EVZA 4LSLA 2OPSB 2HRTA 1QAIA 1SC1B 3G9CA 4E0AA 3EPIA 4P4DA 2DF5A 4ED8A 5KFEA 4DV4J 2QA4G 3BBFA 2LEPA 4F4YA 1ZAXA 1QDUB 4QQBA 4YDDB 3GV5B 2Y0SD 1R0CB 4X4PA 1LANA 3MAAA 5SUHA 4GXHA 5GAHU 3C6TA 1VHEA 2XLIA 3TT2A 3ZTRA 1ZYQA 3PACA 2D9PA 1L5UA 3M2VA 2WPWA 1Y7RA 1F1BB 1DTQB 4ZVFA 3I96A 1FNXH 4H6ZA 2OAUA 1VIXA 1X9MA 5HP1B 1NDKA 3B82A 3DI6A 4LT6A 4X4RA 1EB0A 3GJTB 3G2XA 4IRDA 2OEKA 4M5HA 3FEXB 2C2ZB 2V50A 1KR4A 3CF5Q 1YVFA 2QIFA 1QM9A 1R89A 2VA2A 1FCAA 3MGDA 4CLKA 2KJVA 4W90B 3UW1A 1WG4A 3IXQA 3UN3A 4MTPA 4MJ8A 5IT0A 1Q8IA 1HWIA 2Z3OA 3DMJB 2QMWA 4CAXA 4J9QA 3TO6A 5J2NA 3T8WA 2YH1A 2CZ4A 1JLEA 3QJPA 5F0WA 1AT1B 1K4JA 3CUNA 3B8HA 3PFEA 4DI6A 2EFOA 2GX8A 4FBEA 2DH9A 1RI7A 3RAQA 3BKTA 2VF3A 1M1HA 4ZY0A 1HNZJ 2RB7A 4DL4A 3OVAA 3Q86A 4RW7A 1NMEB 2YKMB 1LWXA 4G1QA 5HVFA 4CLYA 1FEEA 3H2UB 4K59A 4DR7J 3IR5B 3EXNA 3BGRB 3UN5A 2G4BA 4WIQA 4CIOA 2KH9A 1K47A 5HMYA 3S6KA 2ABZA 2ZNYA 1RT2B 4L3NA 1FT8A 3LP2A 1MROB 3EGWB 5KFOA 3FQLA 2VI7A 1RAHB 2XEGA 2AMCB 1IBCB 3WIVA 4CRYB 2WSFC 5EUHA 1KQGB 3T19A 2EKNA 1YGYA 3N7ZA 4OQJA 3OFEA 2OMOA 3R9LA 4XK8C 3K5OA 2WK4A 4DR6J 1HD0A 3NL0A 2Y1IA 3KLIB 4X65J 2ROPA 3WBZA 6FD1A 4S0MA 1WELA 3PVXA 3DRSB 3WQPA 1YRUA 5H9EK 1JLCB 3BI1A 2RVJA 3L3CA 2OOTA 1NSKL 3T9YA 3T6JA 1FJEB 4P6QA 4UA3A 4Y34A 3IP0A 4F4WA 1OMSA 2PC6A 1CS4B 1AROP 3RAXA 2HQCA 2CJ9A 4XPDB 2BJ3A 2LDIA 2OMLA 5J1EA 3NE7A 4B6ZA 1CJKB 2AGPA 4U9RA 2E9RX 4UFWA 3TQEA 3QSIA 3DRXA 1U2FA 2LQJA 4PQUB 3PEIA 2FCKA 2OH2A 5KFUA 5M2PA 2DT9A 2YY3A 2DPSA 1WOOA 4H4KC 3WHIA 2FXFA 3DNCA 1FERA 4KGZB 4FBTA 3UDCA 1RTJB 2N4CA 1UEKA 4ECRA 4JI1F 3MPDA 1UPMB 1XEBA 4LRCA 2C28A 5F49A 3PNIA 4L73A 2DYAA 4DUKA 5LSRA 2QA4S 1JJHA 4J9LA 1B64A 4C8KA 4ICLB 5DM6Q 2HG4A 5B0FA 2IAJB 3RNZA 4RL1A 3C6UA 2MXYA 1HR0F 4KLWA 4U67Q 1XTZA 2FB0A 4J7CA 1YGHA 1T7PA 2RSQA 4KB7A 3HSDA 5JM6A 1RBAA 5HBMA 1X7VA 3HCXA 2ZKTA 3Q8UA 3PDNA 3DXBA 1NKBA 4OI6A 2QJ3A 4DX6A 5GMKa 1B6BA 3TWZA 4ECYA 3QB8A 2MDAA 1CJUA 4NZ7A 5DDOC 2DR5A 1X9WA 5F8HA 3TZXA 1Q8LA 4WXWA 4WBFA 1CP6A 1S6PA 4BWMA 1NKEA 3DLGB 2YH0A 4JI0J 4PUOA 5ETOA 3SXLA 2OZUA 3G6ES 5J2QA 2CPIA 3LAKA 1QJHA 1X5OA 3C26A 4RW4A 1WF2A 2ASYA 2L08A 3OR2A 4AVAA 2PIIA 5BWAB 3D6TB 2EG1A 4LRBA 1XWLA 2NYQA 5C2CA 3GUXA 3Q83A 3H5SA 3EGNA 1WKKA 2J8AA 4DV5J 1DHMA 3QBCA 1TFYA 3G8QA 2DITA 1P27B 2O67A 1RYSA 2C3UA 2R7XA 1XIQA 1W7WA 3UVJB 1CJVB 1DY3A 1PG5B 3N4WA 3SIPB 2A1BA 1EETB 3SXOA 2UV8A 1C1CA 2V2QA 1IBMF 4JV5J 5AE3A 2DHXA 2XYPB 4CI0B 4J91A 3L09A 2KXNB 1HBNB 2DNPA 4DUZJ 3DHXA 4DSEA 2BV3A 2PGCA 2FIUA 1Q82T 2YPZA 2HK3A 3OLAA 1KN6A 2YNEA 3UY5A 2NZ4A 5J2MA 1VQSA 2UXCJ 3LWMA 1MMLA 2DNZA 2VBZA 3PHEA 5J1PA 2F4VF 2CQPA 1BLLE 3I1UA 4B12A 5SZTA 4GRSA 4LFBF 2EFQA 5HATA 1HQEB 5KFSA 2O53A 2NSBA 2XYGB 3RBEA 2ZHAA 2MB0B 2UU9J 4RJVA 4CYQA 1VS3A 3T41A 2KHDA 1YJ7A 4QU6A 2BO9A 2O66A 1WC1A 2DTJA 3GJSB 4IFYA 5HJXA 3UR3C 1H6KX 4B9LA 4ELTA 1FK9B 2AIRB 4NLOA 4R5PA 2XEIA 1U6FA 3PXGa 5KFYA 5DO2A 3D3SA 5DG7A 1EQMA 2DNOA 4OIWA 2G2OA 2LYVA 1N0UA 2LA6A 3CJ5A 5GAHI 2XY7A 3KKWA 4H54A 3HFVA 1BQNA 2AJFE 1QVGR 2VOOA 1T05A 2I38A 1JK9B 2QLWA 3GV7B 2PI4A 1TZ0A 2MKJA 2I3CA 2G0IA 2K2PA 1CJTA 2BJ9A 1RCXB 2ZHBA 2MKYA 2ROGA 3I5BA 2V34A 3M9MB 4G6VB 4FD5A 1Q2YA 1KVKA 4NI2A 4ZYQA 4R6TA 4M6HA 4ZCKA 1V5VA 2RHSB 4I7FB 4XPKA 2W7PA 1QSMA 3BJ8A 1CC8A 4KO0B 2IRUA 2CPZA 2B3UA 4C7QA 3R2DJ 1ULRA 1FKPB 5I0CA 1SV5A 3FNCA 2X1FA 1LWEB 2I2YA 3GIKA 1V5IB 2V2VA 3HUVA 2F1FA 3UFCX 2HFVA 3UDLA 5KFBA 1IWGA 2HIYA 2DGUA 1RTHB 2HHQA 3TTHA 2Y9HA 4F4ZA 4LIRA 4O3QA 1S7HA 3O2IA 3TC8A 5BXIA 4WFYA 4CH1A 3I4PA 7CPAA 3OV7A 3DGPA 1KNZA 3HT3A 1UL3A 4OHWA 1BQXA 2AYEA 2VG6B 1U1MA 4ZVTB 1WSVA 1Y10A 2Z2YB 2PVVA 2Z2MA 2CTBA 5F8MA 4UOHA 1VOMA 2MQPA 5KG2A 2EK8A 2YNCA 1RAJA 1UA1A 2ZOFA 2O01C 1FXDA 1IR2A 4YFUA 3THTA 4O44A 5T14A 3TA2A 3ILOA 4A8SA 2YGWA 2JFKA 1CX8A 1YQHA 4C0OC 4X4UA 2LEAA 4AFFA 2Q66A 3OUYA 1MLAA 1YX0A 3Q8PB 1EP4A 5AGEA 2POKA 4K8RA 4UEFA 4QZVB 1RXOB 3EXYA 2VODA 4YU9A 1HPZA 5C42A 1PSDA 2R4FA 2IC3A 3FJ2A 2VKZG 3M2UB 5IV3A 1YR0A 4FZVA 1BY9A 1NDCA 1PJ7A 1S97A 1SQHA 5BYRA 4KAIA 4FF2A 3J7ZT 5IXUA 1B7YB 4IFVA 2HUZA 2HNDA 1N6QB 1FRKA 3KR5A 2RAQA 4F36A 1YZ7A 2CDQA 1F5BA 1GXTA 3GIJA 1LK7A 3MEEA 1KFSA 3JSMA 1IKWB 3CCMS 3Q8YA 4M85A 1N5SA 1BO4A 1F9FA 3OT9A 4FD7A 1TAUA 1SCJB 4DF4A 3SV4A 3LODA 3QAYA 3TARA 2GIVA 2FLPA 2ZEDA 2VG7A 3MM6B 5CPAA 4KH0B 3Q8RB 4OI4A 4LX9A 2CJXB 5D78A 3PJXA 4Y49B 5C7PA 1NHVA 4NEYA 3MR6A 3AFGA 1HBOB 2BJ8A 3MECB 4U8VA 3OVBA 2DHAA 1SL1A 2VFRA 3AJDA 2HBQB 1P1TA 3FDSA 2MJUA 4QCLA 2VQFF 2RRBA 2X7BA 3D4JA 4O3PA 2HMIA 5KFIA 2CG8A 1VI7A 1WDDA 1A2ZA 2H9ZA 4UUXA 2HNZB 1D8ZA 3RG6A 5KFMA 3ZTPA 2QYCA 3KXDA 2NPIA 3LP1B 1U1NA 4IRCA 3G8SA 3R6LB 3CCSS 4M6IA 1L3UA 2ANPA 4ALZA 3GPAA 2X1GA 1KVJA 1Y4ZB 2CJAA 4B08A 1B99A 3DRPA 4H4OA 4CLSA 4OFZA 5LT5A 4J9PA 4R7MA 4JP8A 5L9XA 4NYOA 2N82B 2OPQB 1UWBA 3WC0A 2Q0YA 5DJBA 4Q8FA 1F60B 4R9MA 2V8HA 1XE4A 3M05A 3V5RA 4MCRA 2WUUA 4WIIA 3MUVP 1AMPA 2PJ4A 4IF5A 3HM9A 1FJCA 2QVPA 1F57A 3FF3A 5GVQA 5DM7Q 3CCUS 4NGQA 1E6VA 1YJ9S 1VQ6S 3OD2A 1J5EJ 3A13A 5HROB 1C0TA 3EX7B 4WYWA 1YMEA 3LH2S 2VPZB 4OYOA 2FY1A 4F4AA 3S1TA 1UWYA 1CULA 2VQEF 1T9YA 1B4SA 4NWBA 3I9V9 4AQYF 1XIXA 2DK2A 3DC2A 1G4CA 2BX6A 1JLBA 4RW6A 4DR1F 4QJVA 3W9JA 5E3QA 4RW9B 2CA9A 4Q43A 1TVRA 1RT6B 4EVYA 4X64J 5L1IA 4MFZA 1Q4RA 1WSRA 1NCLA 2XHWA 4Y49C 5DWMA 4D3HA 4DV3J 1DQAA 3D0GE 2CNMA 1VRUB 1PC5A 1ZAVA 3GE9A 3W91A 3CJ4A 3A4TA 4RUBA 2OB0A 1U09A 1RACB 3HJFA 3CJ3A 5ETNA 3KJFB 3M6XA 2EK1A 1N34F 3Q8VA 2ZITA 3QATA 2XO6A 3HK2A 2HVEA 4K2JA 3T1YJ 1JLGA 1IVZA 1X4BA 2QYVA 3BQ2A 2V8GA 3R7SB 1FWPA 2J0WA 3LWUA 4KSIA 2J6TA 2R7UA 4P4JA 4DR4J 4B5PB 1ZLIA 1X4FA 2Q6CA 1O51A 2L3MA 2LCWA 3GILA 2J9EA 3PX6A 2PI5A 2H65B 4F3OA 5AG4A 1NKCA 3SJGA 4USKA 2KJWA 4V1Ak 4JBCA 2WSAA 4A8XA 4C9DA 3JTNA 1K1QA 4NE9C 2LLZA 3OXLA 2JWNA 3PW2A 4ES1A 3IWLA 1XOVA 2EK9A 4ZHRB 1LXJA 1NDLA 1PAUB 2GVDA 1V3SA 4OZLA 3IGNA 1OBRA 3HLUA 4NGRA 4IDKB 5FVJA 2V8VA 3A8JA 4K5RA 3CJKB 1S77D 4QOTA 4IG0B 4M94A 1HKAA 2APOA 1RT3A 2JBKA 1QLNA 3H8YA 3OTDA 2F5IA 1UP1A 4WFAQ 1QD1A 3SSQA 2CQ2A 2FJAB 4RUCA 4D3GA 3F8KA 3J81j 4DX5A 1VDHA 1LFPA 1TMJA 1D09B 1VQOS 3MI7X 5JGFA 4ETZA 4PCQA 5AXNA 1IY7A 4K4SA 3F0NA 2E1PA 1NZAA 4C6AA 2MQMA 2DEJA 2OZHA 3CC4S 4B3OB 4K5SA 4R57A 1TL5A 5D15A 4HYKA 4F04B 1XMTA 2CXEA 3DU6A 3D2MA 1YLOA 1J5OA 3TQ1A 4WFNQ 2YQ1A 1VK8A 1MWZA 1YJTA 5LOQA 2BUNA 2ZELA 3EYZA 2BR0A 3IAM9 1HMVA 3M7VA 4DL5A 5A27A 2NREA 4ECWA 1M4GA 1S4FA 4MRIA 1WC6A 3S6EA 4Q8EA 1FHTA 1JXEA 3LMSA 5DG8A 4MKAA 2JZ5A 3HO1A 2Z3MA 1YJWS 2DXEA 4IH6A 3U7JA 1KD1T 5KFJA 3VWEA 2UUAJ 3KUHA 1HNWF 4OAEA 1T95A 5C24A 2AEMA 2V94A 4ERDA 2HQ3A 5E3RA 1F3VA 1JLFA 3FMWA 3T1HJ 4ZJOA 2ZEPA 3LGHA 3W64A 1U1QA 2QSFA 3GFHA 1EQ0A 4FVMA 2WB1D 3IS9A 3ILLA 1J2VA 2AU0A 4X2TA 4ORFA 3DLEA 4OZ3A 1SQGA 4OKOA 4HHHA 4E8UA 4LF9J 2NS1B 3IR6B 2NSMA 2UXDJ 4NASA 3DCAA 4NEXA 4YWYA 4EFAC 3C15A 4DR5J 1NXIA 1M4LA 4PK2A 4P72A 2XMUA 4DSJA 1WEYA 4J9KA 5T7LB 1BOBA 3ZO7A 4Z65A 1JLQA 1Y7EA 4A30A 1C4CA 3GIUA 2XS5A 5BJRA 2JBJA 1NU4A 5LXYA 2VZZA 2REEA 3GJQB 4NF1A 3G82A 3BGLA 2IMWP 3BGOP 2QG9B 2ZJRQ 1F2GA 3PB7X 3CD7A 4CH0S 1M1GA 4ECSA 1FJGJ 5KFPA 4IO9Q 1H3DA 2PJ3A 1Y11A 5ETVA 4F25A 1FNMA 3FCWA 2XEFA 4CGOA 1Y3KA 4DZ6A 2Z10A 2M70A 1WTFA 3H7HB 3AJ2A 3HHKA 4YY3F 3PX4A 4LFAF 1M4IA 1RAEB 4MIBA 4DV2F 3JQMA 1FFWB 5KG0A 2BE2B 3IBWA 4DPUA 4NGNA 4KSFA 2A2CA 2MZRA 4KR0B 2ADCA 3CCLS 4HL9A 4DCJB 4NGMA 1C2PA 1JWWA 1N32F 5I4MA 3AY0A 3CDBA 3H59A 3OJUA 2KCWA 4H4MA 1R8CA 2BBEA 4EMDA 1UFKA 2UVWA 1URRA 4C7HA 1GXLA 4K4WA 3LD2A 3OFHA 3CE8A 1RT4A 3BJ7A 3T9ZA 1U45A 2B4UA 2C42A 4MCPA 4ZPBA 3GG1A 5J8CA 2NUHA 4ED7A 2EFGA 1SIZA 1U1LA 2Y1LB 3DRRA 3MMBB 1D9FA 1KSPA 2XZDB 4KOXA 1TKZB 3PBEA 4MFQA 4QWBA 2EFPA 1S1XB 2ASJA 2E5LJ 2VB6A 2FGCA 2HBRB 2HB6A 3N5FA 1KFDA 3VVUA 2FHJA 2RFHA 3B35A 3F73A 2W7OA 1H2TZ 1LRZA 4LMZA 1UJ5A 5D4NA 1PU9A 4WJBA 4J9MA 3I31A 1DZ5A 2Z2ZA 1RABB 3CJ2A 4NLRA 3M4XA 1AUSL 4WTOB 3RJMB 4XNHB 3K7RA 1TUGB 2VZYA 2C6GA 2HHHJ 2G3TA 3EY5A 3QO9B 3HVRA 4WPAA 4N77A 5KG1A 3IMQJ 3NGRA 2IJRA 1IXKA 1HNXF 1RA6A 3ISXA 3E51A 3H8EA 2FSRA 1NK0A 1H7XA 2GMJA 4FDFA 2OPRA 1Z8LA 1OPIA 1S6OA 1NJWA 1B0PA 1X5PA 3J7Z5 2OP5A 3P2HA 2F9JA 2FJXA 2HGNA 1QAYA 3MMAB 2ZH7A 4EEYA 2WOMA 2HNYB 2EXUA 4FPRA 3EC4A 1U25A 2NXJA 1Y5NB 1FT7A 3G6YA 4GO7X 3HVWA 2P5VA 4JXRA 4LQ6A 4B9TA 5CCMA 5I42A 3G71S 2VHGA 1XJWB 3EGVA 2ATRA 3BGFA 5F8GA 4DV0F 3I55S 1AZSA 1PYTA 2Y1JA 5L39A 2ZD1B 1X5SA 2DD8S 5A8KA 1OSDA 4GKKF 3P49B 1EKRA 2WTFA 2DGSA 4JI2J 3V6DA 4FS1A 4DF8A 2YNIA 2DNLA 2HZCA 3BGUA 2IDEA 2WW4A 4J9NA 1T3NA 4B3SF 2D3O1 3RRKA 2KN4A 5E7OB 2KVQE 2R8GA 3DOLB 4TLRA 1L0CA 4NLYA 3IR7B 2EUIA 4RW8B 2ZBPA 2BCOA 5KFDA 3RYOA 2FHMA 2YKAA 1GHEA 4HI1A 1CS4A 3CZXA 4B5OA 3FBUA 1HHQA 3GFXA 3MRUA 4HH0A 1Y9OA 4WWSA 1DLOA 1CJKA 4ZA1A 1ITPA 3K9UA 3S7RA 3SCJE 1KDNA 4RUAA 3MOJB 2FS5A 5IT4A 2GJFA 2FQQB 5G0RB 4OHYA 1LWCB 3M8QA 2QL5B 3H2LA 3MF5A 4Q7AA 1G3OA 1K0VA 2K1RA 2X1AA 1WC0A 1BPNA 5D0RA 2O28A 2W25A 4O3NA 1Z4RA 2K3KA 2FIWA 1IKVA 1MJBA 3DYAA 3RBUA 5F48A 2A0FB 4RU9A 2CFXA 3EVWA 1YG0A 1Z2ZA 3IFEA 3TAQA 2YX7A 4X4NA 5K8OA 4GO5X 4TWEA 2JLFA 4BINA 4F0YA 2OELA 2KVIA 4TVAB 2R98A 1REVB 5IT9U 2W2QP 3MUTP 2W01A 3KLVA 3SFGA 3MEGA 1YJUA 5E0OA 1UFLA 3AOAA 2GV1A 1S1TB 2BUEA 2HBYB 3K5MA 2UUBJ 1I94J 3IWGA 3HVTB 3NNHA 3QAEA 2F5GA 1VC6A 4WP3A 2J8NA 4O4GB 4XPEA 2KFYA 1VQ8S 4JI3J 2E5HA 2ZW6A 2GJIA 1JJCB 1TKTB 3NXZA 4P73A 4C3MA 5IT9Y 1UTAA 3HX9A 4QR1A 3AA8A 4Y2CA 3JAMU 1X4GA 4NZ0A 4Q45A 3KK3A 2WPXA 3NBPA 4QWDA 2JEWA 2P0WA 4ZGYB 1FFGB 2LXUA 1S59A 1KUXA 1H98A 2VDHA 1VGYA 2Z0GA 3GR0A 3TZWA 2H5MA 2HLUA 5DQGA 1OWXA 2G9DA 3B3SA 3AOBA 4OLPA 2DEAA 2NR0A 3JAMY 3CW2C 2KG0A 2FZGB 4OC1A 5C25A 3ETMA 1EJ7L 2Q79A 2QT7A 1ZTTA 3SQGA 3PJ9A 4LF1A 2AFXA 4E8OA 1VHFA 3Q89A 3CO9A 2O5DA 4LBPA 3HHLD 1E6YB 4W4MA 3H90A 2BM1A 5HXDA 1WC3A 3OTOJ 2GHWA 2PJ7A 3D7FA 1LKZA 3QQCD 4FS2A 1FF2A 3CDUA 3KLEA 2CNTA 3UO0A 3SMZA 1Q5VA 2VQYA 1GNKA 3TNVA 1WC4A 1LWFB 2PJ0A 2RUSA 1N8RT 4IO1A 1NPKA 4KC5A 4MK9A 4CAVA 2E44A 3JYTB 4WP9A 2D41A 3W2WA 2B4DA 2H5IB 4AB7A 4I0WA 4JUZA 5ISVA 1R0AA 3VAKA 2MLXA 1LV5A 1KLMB 2BJEA 2HC9A 1NK7A 2E9TA 3I5AA 2ZVSA 4DZDA 4C7IA 2D3ZA 3PX0A 3CJSA 3SJEA 1C1BA 4WE1B 1JKHB 5LJ5Y 2I6WA 2R8HA 2RH3A 2GNKA 3LPYA 4KHPF 5I3UA 3C14A 1F6TA 4RBUA 2KTQA 3S9NA 4DSLA 3BEGB 1I21A 3IWWA 2BE9B 3L9ZA 4OYMA 4R3KA 3DOKA 3B3TA 2QMUB 3GQCA 3Q8SB 2MJNA 2IM2A 4OZNA 1R57A 1WG1A 3D54A 3SQOP 1FD8A 1FX2A 5A8RA 4MXUA 3KNAA 3S01A 4ZPTR 1ZA2B 2V67A 2L9NA 4A8KA 2DO4A 4JZ0A 3E01A 3PW7A 1CSJA 5GAGU 2KDOA 2N7YA 2DGXA 1CC7A 2XULA 2WSCC 2VG5B 4P2XA 2PCUA 2ZH4A 4ED1A 4KUBA 2U1AA 3M30A 2R7OA 3M2RB 1X9SA 4TQSA 2D4OA 2DRAA 2BANB 4U96A 3SFUA 4PG5A 4YGOA 1S48A 2R7WA 4KFBA 4JI7F 2CQIA 2W9CA 1MWQA 4UFXA 3HP6A 5H1SV 3CCJS 4A48A 4LF4F 3GZ7A 2FGOA 3KHZA 3VZIA 3J80U 2R7QA 5AG7A 3VCDA 2YTCA 2RD5C 4R87A 1W25A 2HAIA 2A3JA 5KFZA 3ULHA 4X3RA 3OBIA 1XNRF 1S6QB 4ECVA 3VAHA 1IWAA 2PDOA 4NMXA 4FF4A 3FC9A 3W3SA 3D3BJ 4P74A 4C2YA 3DOMB 2Z11A 1VRTA 1RHUB 2LP4A 1PKUA 2XS7A 3QWPA 1RT1B 2W4DA 3GSDA 4ELVA 2ZXVA 2BE7D 4B3MJ 5B08A 3PR5B 1S7KA 5J1QA 1WG5A 3TCVA 1KONA 1NPRA 2WONA 4M5IA 1YIJS 2Z0ZA 4M5GA 1KOHA 3SI1A 1CEZA 2B9EA 2PN6A 5I3PA 3ISND 1UJ4A 2LQBA 1L3KA 2R7SA 2ZJQQ 2JLGA 1YVOA 2IM0A 2V69A 2ALYB 2V5HG 2L48A 2ZDPA 4CLTA 2J8MA 2QL7B 3TEHB 1N0VC 2WAQD 4TKTA 4DR3J 3BB5A 2MZSA 3ETOA 4CTAB 2AGQA 5FDLB 2H48B 3CCES 2AQ4A 3LP0B 2ZH9A 1TL7B 2CTCA 3MCOA 4ZIVA 1FXRA 3UD3P 2PA8D 1A9NB 2M52A 2W24A 1W2BR 1TFWA 5JXSA 3CD5A 4R8UB 1X12A 3UQSA 1ZO0A 3V6HA 2XI2A 4NX9A 2MQ8A 4O3OA 2OD6A 4NXYA 4PSWA 3NGSA 3PBBA 5J1NA 3BYRA 5LM7E 2KRBA 2YWGA 4MFBA 3V81B 2RU3A 4JYAF 1RHJB 2C6PA 1BAVA 1CG2A 3R8YA 4LRAA 3FBBA 4PZVA 1FKOA 1QAJA 1PGZA 4JV5F 3QYYA 2KXHA 4LFCJ 5KOXA 5H84A 4DUZF 5FIIA 1KOOA 1QTMA 5AG5A 4U7CA 4HNYB 2COLA 4QYZJ 4HEA9 1MSWD 4AG9A 2RC4A 2F8EX 2NXNA 3MTKA 1T03B 3ENWA 3PTWA 5H86A 4ID5A 5ETLA 3OHAA 3D1OA 4NCGA 1VRQC 4C97A 2G3AA 1IU8A 2WVCA 1QUPA 2XY6A 4WXOA 5J8FA 4B9NA 1MK4A 3IRXA 3CMQA 4OX9J 4RN7A 3NLCA 4X62F 4C8NA 2MGZA 4DL2A 5L38A 1FDNA 3RW6A 1HARA 4ECTA 2M2BA 3JTKA 3K5PA 3SSSA 1VQLS 1HNVB 1LQ9A 5KG3A 4I6WA 4OMFG 1FWLA 4JI4F 4F2RA 3POTA 1UKUA 2BA9A 5LMUF 2JRSA 2IIHA 4URSA 4QPXA 3VARA 1FEHA 3PYGA 4I68A 2LEBA 1UVLA 1S60A 3NH8A 1G7CB 2IVYA 2HWTA 4ITSA 4MH8A 1BHNA 1HQUA 1DARA 1YBUA 2MTLA 4N8NA 2B5GA 5F3ZA 1I5OB 5L9NA 1IKYB 1LW2B 3QLHA 4YHHJ 2GA7A 2YNGA 4CLUA 3W9IA 4DJLA 3UNGC 3W5ZA 1UJ6A 2OEMA 5JVHQ 4R25A 3N6LA 3TW0A 4YFJA 4WCEQ 4DSFA 2QJ8A 2B4VA 4Y0FA 3GMGA 2J8RA 4H6UA 4FKYA 4MY0A 1HBMB 4A46A 2BQRA 3CJRA 2J9AA 3H40A 2WHOA 1Y00A 4DU8A 3MM8A 2YBVA 4ZI6A 5AJ3F 3RU0A 2FC8A 4PPDA 2KI2A 2QA2A 2YKOA 1RTDB 4M3SA 2VICA 3VZHA 1RBOB 2AT1B 2I5JB 3DRYA 4MT1A 2V8PA 2KYXA 4BS2A 3ZJ0A 2FT0A 1JNZB 2PJAA 2B3TB 3HLPA 1S99A 3TAPA 5D4LA 4PWDA 1WDTA 2BM0A 5KTQA 3BLNA 5E5NA 3W62A 4HKQA 3QGHA 1U47A 1HYSB 4MMOA 2XBPA 3BSCA 4CYUB 3V6KA 3LACA 1KHVA 1VK3A 4R76A 5IWAF 2C2DA 3LO3A 2W9AA 5DG9A 2YWHA 4RBVA 2JNJA 5LYFA 2CQ0A 2IM1A 4QVTA 1GTEA 1UCNA 3ADAC 1ZAWA 2P6EA 2ZW5A 1MNEA 2RKIB 2GGPA 1A0OB 4ZVUB 2PIYA 4WYLA 5JUMA 4BC9A 1XQIA 1N5YB 3M6WA 3K89A 3FXTA 3FMBA 1S12A 5HMNA 1NK9A 4KT0C 4A4JA 4CCHA 1XR6A 2OH1A 4L6V3 1GQEA 5CYMA 4KV8A 2D3OR 2XMWA 1JLAB 4P44A 2E7XA 5G20A 2ZC3A 3OL7A 2CZVC 1XBUA 2ACMA 4I6AA 4IUFA 4CAEA 2D9OA 2B56A 1H2UX 5DGBA 3KJVB 4M5DA 4LIWA 3PGPA 1VBXA 4MBUA 5LSLA 4F02A 4LRFA 4FXVA 5GAGI 5B7WA 3K8VA 4WP8A 2B3VA 4K4ZA 2OUGA 3MEKA 2MKKA 2GCFA 4LF7F 4LSNA 3CD0A 1LW0A 1EZZB 4KGXB 7FD1A 2ABYA 4HKFA 1YK9A 3AJ1A 2AV5A 3HSGA 4A31A 1XC9A 5A2QU 3SYZA 2CPXA 1R27B 2VUGA 3LGMA 2IJFA 1M4DA 2ZH3A 1U0HA 4CWBA 3W8GA 2HSEB 2R2TA 3TAMB 4CGMA 4DUTA 3H4QA 1N33F 2FPHX 2BEFA 3GYGA 3JTOA 1S0NA 4KZTA 4U9YA 4IKAA 2Q7BA 1U2CA 2E1MC 5K9FA 2DVIA 4LVOP 5L8RC 4I2PA 2DJWA 1SUQB 3BKFA 3UNYA 4P4IA 3HMJG 2HKEA 5A2QY 4I49A 3CXSA 3OTCA 5D4PA 4IUSA 1Y0RA 2YX4A 1OY6A 2XMAA 2PA3A 1RSCA 3N79A 3BYPA 3GIIA 2MMYA 4CO0A 5IM0B 3FGVA 4ZPDA 3LF0A 2CNNB 5HQMA 3IWNC 3KLHB 1PYOB 4G3IA 4K4TA 2XHCA 3QIPA 4B9VA 4ZCMA 4USMA 1TL3B 2CY2A 1S7LA 4AL6A 1VQYA 1GMWA 2R7VA 3JS9A 1GTHA 1TF8A 4KGKA 3RGIA 1XBWA 2QECA 3MMJA 2DRBA 3EICA 5GADU 3T5HA 1IBKF 2JEFA 4JI5F 1TUVA 2G0BA 3B3CA 3TR5A 2IJZA 1MWYA 1SPBP 1RXTA 1SL0A 3AD7C 3TA1A 2KFZA 2V4RA 3CEDA 4ZVRB 1FE4A 1J27A 5F47A 2DXDA 1UETA 4DPWA 2OLWA 4IG3A 1ZM4A 5D3GA 5KFGA 4QR2A 3LANA 2HHXA 1LFWA 5AG6A 2YNHB 1RWUA 4MJKA 2R8IA 4Z7YA 4P2FA 4F0XA 5HLFA 1OO0B 1VBZA 2W9BB 1YRTA 5MAOA 1PO6A 3QRPA 4C8YA 1RKIA 2AYGA 1IGBA 5A0YA 5KT3A 4CYPA 2EKYA 2I8EA 3UDVA 3P96A 1U02A 4BDPA 2C2EA 4C0HA 4JI1J 4MAKA 1M90T 5LJ3Y 1BC6A 4A94A 4ELUA 1YW4A 4OYZA 1JXLA 3IG1B 3PP9A 2CJYB 3MMCA 4CLFA 2PJCA 3KK2A 3SDEA 1N5TA 4GVBA 3AB4B 2KKHA 2PJ5A 1FX4A 1TV6B 5F8LA 1F5AA 4WFXA 1TL1A 1HR0J 4EK2A 3IBCB 4WU3A 5H9EJ 1DTTA 3N9UC 1QAXA 1BWVA 1NHUA 1NZ8A 2VXKA 5AXLA 1R7IA 4OYBA 4LSLB 2CQGA 1F2PA 2LQ8A 2WCXA 4W98A 4F50A 2FVPA 1VKCA 4KS9A 1ZS6A 1YJNS 2FLNA 2J0XA 3A9LA 4EFDA 1H0HB 4DQIA 4X66F 4LR7A 3T6BA 1X4CA 1S3ZA 4RWWA 2RRAA 4K2XA 1CPSA 4ZBGA 4TXSA 3R27A 4KOUA 2EBEA 3ZZTA 3MAAB 2YQ0A 4FD6A 1UVJA 2VASA 3C6TB 1F3FA 3VH9A 1UMJA 1RWXB 3M2VB 2KFNA 2N7CA 3GR1A 4HR2A 2VL1A 2IFXA 1Z8XA 4F0KA 3PY8A 2QC3A 2BVZA 3DI6B 1QE1A 2K7KA 3HD2A 2UUCF 3C16A 2CIMA 4AE5A 3KUEA 4OZ0A 1JWQA 1OYEA 1F5CA 1UFWA 5HQ8A 4GKJF 3KHXA 3KHRA 3DLKA 3OL6A 2X51A 1VFJA 4B9MA 2FUG9 4PXCA 1Z4UA 2WVFA 3NCPA 2PMZD 3RAMA 2FJEB 4USJC 2XQCA 2L9DA 8CPAA 3GU0A 1IBMJ 4YB7A 5J2NB 3EFAA 4PXDA 2DH7A 1WTBA 1FVSA 4URGA 3MPUB 2YWFA 4P7TA 3N5BA 1UW4A 3FEZA 3CPAA 2CUYA 3DDDA 1RAOA 3FEDA 4CLPA 2JDDA 2XZWA 1U49A 2K8GA 2OO4A 1Y0HA 4PXBA 2QZ8A 3B8GA 4RW7B 5CQGA 1UVNA 2R7TA 5G4DA 4XAKA 1HFEL 3KR4A 3SI8A 4G1QB 2H1YA 2MY7A 5GAEU 4LFBJ 4AVBA 2EBJA 2W2NP 3P45B 5CYQA 5IZHA 2HW3A 2OTJS 2GANA 1D9AA 1R8BA 1YSJA 3HSZA 3JSYA 1CP7A 2AHOB 1HLWA 3DKDA 3LP2B 4A32A 3ZZ0A 3NWRA 2JLMA 2ZE2A 3CDXA 5DDQC 1GYTA 2CPEA 3DLJA 4NJQA 1YJRA 4JLYA 1HDQA 2C1CA 2QLBB 3VAFA 4ED6A 3MR3A 5HK4A 4C11A 2QSWA 2YKNA 4DG1A 3G86A 1X10A 4WU2A 3ZC4A 2MYFA 1ZA1B 4OI0A 3UCGA 1ZETA 2DGTA 4II9A 3FSIA 4DEZA 1RWOB 2CQ1A 2BYCA 1S1VA 3AD9C 4PG4A 4LF6F 1YBAA 3EJMA 3TZYA 1EAYC 2VBQA 1S7NA 3KOAA 3G4SS 5ETQA 4ETXA 2BQUA 2HQYA 4YP3A 3WDOA 2JVRA 1TTHB 4C4WA 2ZVIA 3HFKA 4ZPWR 3MM9A 5J1EB 3H8FA 3GYNA 3S9LA 2CQHA 4BC7A 1O5JA 4RLEA 2HHSA 2GU2A 2PR1A 3QNVA 4YEAA 2WVBA 4DUYJ 2REFA 3TVZA 3RZAA 4YUDA 1G2EA 4UOCA 4NLVA 4KIAA 2ZM6F 3ENQA 3ZTQA 2DR9A 1KKHA 3A3OB 1VMBA 3R3TA 4O0IA 2YPYA 5CNPA 1ICEB 3HHLA 3TUZC 1S7FA 2AE6A 4A8MP 3U27A 3PV8A 5B09A 2MSTA 2PRBA 4UF4A 1K8AT 4MIWA 5IB9A 2DNGA 3C6UB 1NSPA 4JWPA 1RDRA 4F26A 3ITHA 1O8BA 4K3NA 2RT3A 2PMWA 5EDWA 1P4NA 3HVTA 3BS9A 2RDDA 4BBYA 2P9CA 3OSNA 1NB7A 3NAIA 2E9ZA 2YKQA 2J6UA 1SJ3P 3CJTA 1VQ4S 4ZJQA 5HBMB 1NNDA 3CGIA 4LVNP 3MFHA 3UCUP 3M8PA 5KTAA 3BV8A 5JQ4A 2OHDA 1DAXA 4DN9A 4R0EA 2BJDA 1WEXA 1VCTA 1N36F 2B5JA 4UCPA 5KFFA 4Y2IA 4UQTA 4OHXA 2QMXA 3SI2A 4NLGA 4W9YA 2ZEOA 3K58A 1CJUB 1U6BA 1U24A 3I9ZA 3CMES 1YRXA 2XGQA 4KJIA 1RTQA 1S6PB 2OEJA 4OL8A 4HPSA 1NJYA 3D6MB 2LECA 5F9LA 3Q8QB 5GADI 1T9TA 2CQCA 3MR7A 4PUOB 5J2QB 2OKQA 3CCQS 4CYOA 4CRJA 2LU2A 2XWXA 2Y3YA 4HDHA 2C27A 4RW4B 3D9BA 2CPHA 1IJEB 4X2BA 3MZIA 4QWAA 3OR2B 1YITS 2XNQA 3QAHA 5ETTA 3TX8A 2V4JA 5JMNA 4IOAQ 1IR0A 8AT1B 3M8YA 4KPYA 1Q2CA 3BXMA 4C68A 3T5KA 1HI8A 2DCLA 4O0NA 2GHVC 2QE5A 3KI9A 2RE1A 2AX0A 2JDCA 4TNUA 1RJJA 3NS5A 5K5MA 1SQEA 2IYIA 1N56A 2ZNZA 3V4IA 1C1CB 4ECUA 2HHHF 2DO0A 3MTJA 4UEZA 4AXVA 2C3OA 1N54B 3FX6A 3SV3A 2ZBQA 5H9FK 2R42A 5LXRA 2L41A 2JSXA 2HQFA 4KQZA 5A6WA 1VQPS 3EO4A 1Y5LB 2X7IA 2B0GA 4KOYA 1SKUB 3TVKA 4Y6IA 1VISA 2JC1A 2OZGA 2CJBA 3UE2A 2KZMA 1JMTA 2VFVA 2AGOA 2BOAA 3U02A 1Q7LA 2XSJA 1WK4A 3A8KA 4DQQA 1S1UA 2Q4VA 4H2KA 2FVSA 3ZFVA 3DM2A 2E5GA 1BPMA 5A8WA 5AT1B 2XMVA 1IB1E 2BKOA 2LQ5A 2BKNA 4ZVPB 2PC1A 4KOVA 3B78A 1WUUA 2J9CA 1H38A 3FBFA 2CDRB 1M5PC 1T02A 1TMMA 4IFYB 2YWEA 3B4DA 4F8ZA 4DR2J 3ZZUA 4DU7A 3VGVA 3IGRA 1OQ6A 2X1BA 4Y3CA 2VBXA 1C0UA 4R5PB 1S7IA 3FEEA 4CH7A 3DR8A 2AJQA 2XCPA 3VGUA 2A6OA 2CVEA 1QSNA 3DDNA 1RCOB 1FI4A 4DPTA 3CC2S 4JJXA 2VFTA 4TU7A 1RZMA 1OZPA 2CKWA 4NA1A 1BQNB 1SC4B 1T05B 2HWIA 3HXMA 1CJTB 2OFHX 1ZPVA 1QMUA 2BZ2A 1NJIT 4B3RF 4DV1F 3GFZA 2VQEJ 1FXLA 2GE3A 4NI2B 1DE4C 2ZW4A 2G0JA 4PXEA 4DR1J 4BCAA 3AAWB 4OYIA 4OV1A 1C4AA 5KG7A 3S8SA 3PKYA 4Y00A 2BJ7A 4I6YA 3L4BC 3LTOA 2MQQA 1SV5B 3OTBA 3EUNA 1NK8A 2JEIA 1HWJA 4RUHA 3RB4A 3KQXA 5IX3A 2DH8A 3O5TB 1MN9A 2ARHA 4UZCA 1VQNS 2RNEA 4RNMA 2KT2A 3BBBA 2VBWA 3HZEA 2HS4A 4X4VA 3R95A 1BXNA 2I1RA 3VAGA 4L76A 2GQCA 3TZZA 3DGPB 1N34J 5GAEI 2CNOB 1I94F 2YVSA 3E3XA 4NFRA 2QA1A 6CPAA 2DPJA 2YX1A 1UA0A 2AFOA 1TKFA 3UDEA 1AXQA 4CYNA 2QEXS 4ZX9A 4ZX8A 4KSEB 1EARA 4DCPB 4NMLA 4DSKA 1RLDA 3R1HA 3FECA 4O44B 3D68A 2RMLA 1NK5A 2BABA 3OUYB 3FSXA 1ARLA 1EP4B 2VFSA 1KUYA 2AJ2A 5HMZA 1HPZB 1HBUA 5C42B 1D3WA 4DMZA 2KB2A 2IC3B 3FRMA 3JSRA 1R43A 1M5OC 3BPSP 4XDCA 4LQ9A 3TJ8A 3GIRA 1IYKA 5EX0A 4E98A 1OIAA 2AWZA 2XCAA 4IFVB 2HNDB 2HS0A 4F4XA 5KFKA 3R1KA 4F9VA 4NLQA 1ZM2A 1RT7A 2AYBA 4ZOSA 3U1MA 2CVIA 4WF9Q 1RHMB 3MEEB 3JSMB 1OYDA 4FYVB 3TVYA 4QWEA 2FVCA 1FRHA 3TANA 3P5TL 3MGJA 4KY3A 2ZEJA 4USUA 3BZQA 4NXMF 4XO0A 2BACA 4IAVA 2ZUGA 2VG7B 4I64A 4U9ZA 1R31A 2KRRA 2OSQA 5KFXA 5A28A 2HFUA 1JJ4A 4QBJA 2QO3A 2G0CA 1DQ9A 4LF2A 5LRKA 3TOAA 2M88A 4M5LA 4FF3A 1S6UA 3J7YI 4O3SA 4IRKA 2IMOA 1M5SA 1XK8A 3R9FA 2HMIB 4PG7A 2IVMA 3TP2A 3D4UA 2M9KA 1WHVA 2PEBA 2ZZMA 3SZ2A 3LAMA 3KHHA 2CNSA 3P6YC 1AW0A 3TI0A 1EIYB 3GLJA 2YNCC 3IM8A 4NLXA 1X60A 1APSA 4PSXA 1QSTA 5DZ6A 3DRPB 4H4OB 2LVWA 3VTIA 4QIEA 1N48A 4YDXA 1RADB 1HNIA 2N4DA 4Q0BA 1RAFB 1UWBB 1GAOA 5HAOA 3FUYA 1HNWJ 2I9SA 4JI6F 2CQ4A 2Y0MA 1V3RA 2MKSA 4TNOA 3R7NB 2OI2A 4NGSA 5DQIA 4Y28C 1GMUA 3MR5A 4NXNF 2IL4A 2UVVA 1E6VB 3HZGA 1SB6A 1NAQA 2QN6B 4C0BA 1CJWA 1C0TB 1P1LA 4DS5A 5A6PA 1WNEA 1UAWA 3BO3A 1MMNA 1AB8A 1CULB 4RZRA 4MY3A 1PAEX 2DNRA 4LR9A 2ZC4A 5E33A 3H20A 1JLBB 4RW6B 4PKDB 4J3GA 2KT3A 2NXCA 2B4PA 3B2YA 2FTRA 1DBDA 1TVRB 1CBXA 3CPWR 2Z3NA 1H74A 1CPXA 4I67A 3MDFA 3RB3A 4QIGA 2ZEHA 3ZZIA 3GB0A 2ZFHA 5M2UA 2OSRA 4LBIA 4F9UA 5D8HB 4Y65A 3PHTA 3P2FA 2VJUA 3JRUA 3W8PA 2DGVA 5KFAA 5F3TA 1X4EA 4DPOA 4NA2A 3HHNB 3E2EA 3MM7A 5IOLA 4YY3J 4LFAJ 3QZ8A 1RAGB 3I0SA 1XNQF 1CLFA 4DV2J 2Q04A 1JLGB 2Q6BA 4KPCA 5LMNF 2B6AA 4OC2A 1TKXA 1N71A 5EWGA 3CCVS 1UEUA 3OTEA 1N32J 5EGYA 4UOGA 4F7VA 1GH8A 2M8HA 3HVAA 4OI3A 2W4PA 4CGLA 1TL4A 4CZCA 2ZEFA 3MCSA 1ZH5A 3WIUA 3MXHP 2CADA 3OR1A 2YNDA 4DR3F 3UD4P 1CBKA 5GMEA 4X4QA 1OQ3A 4LF8F 3HDSA 1T3OA 3K17A 4MFLA 2DKOB 3G6VA 3D8PA 2Q1LA 3R5JB 3RRGA 3M32A 1WACA 2UXBF 4N7TA 2GLFA 5JH9A 2ZWOA 5CD4A 1AA1B 4DBQA 3V38A 4QB9A 4JI8J 4DL7A 5HANA 2GVDB 3NY0A 4A39A 1U8WA 2DNNA 4UIBA 4DPYA 3IC1A 3PRDA 3M1VA 4ZN1A 3ET6A 3FFIA 5K14A 1YWXA 2Z4PA 3QGIA 4LSZB 4USVA 1T11A 3IU1A 4YOEA 4X84A 4KKOB 2D3UA 1RT3B 2AJ4A 2D74B 3KK1A 2RUGA 4KE5A 3KLFA 3NNAA 2JHEA 3JVNA 4F4KA 3OVSA 1TAQA 3PZPA 3K8WA 1MU2A 2PE3A 2UV8G 3B7IA 1NK4A 1BQMA 1H73A 1IM6A 3OJSA 5EHHA 1FNOA 3D1HA 1KP6A 1ZZFA 2EEYA 4P2MA 3ZNUA 1HNXJ 4KUAA 1T9UA 5BYQA 1TK0A 4E2FB 2KL8A 1WOPA 1RKJA 3LA0A 1GX6A 5HMWA 2NCKL 4HH1A 4NGPA 2RF2A 3EZ5A 1XR5A 2J7WA 5T41A 2NMTA 1JXVA 1Z2LA 2FL4A 1J5OB 4TY8A 3MM5A 1VIOA 2QYGA 4B3TF 5KFQA 1TIQA 4C48A 1RAIB 4MYUA 4HNXB 2HRYA 1RLCL 1T0TV 3I0RA 3PB4X 5DRKA 4P45A 3HHDA 4DX8H 2MQLA 3IGVA 4CRZB 2E5IA 3K59A 3CXPA 4CM2A 3W2VA 2WYRA 3H5YA 3CCRS 4GKKJ 4L72B 2QLFB 1S1WA 4ZLNA 4U5YA 2GLJA 2V77A 3HF5A 3BQ1A 2HVZA 3NGTA 2JEVA 4FYXB 4QWCA 2MLYA 5C24B 7FDRA 4B3SJ 4A95A 1YREA 3MWBA 3IRWP 1JLFB 3VR1A 3UCZP 5EBVA 3KUGA 4G1IA 3D0HE 2RJZA 3OSPA 5EWFA 3IS9B 3IJ3A 1F0XA 3FH4A 2V6AA 2O4HA 3DLEB 3OXGA 4ZP6A 1RWPB 3RUBL 5DDPC 3FQKA 4TQRA 4KHMA 4AUKA 2FZCB 3C15B 2BJ1A 3DU5A 3BR8A 4Q2MA 4RWXA 3N01A 1YHQS 2E1AA 1VHOA 1L3SA 4ILRA 4LREA 4RX6A 4P10A 2CJKA 2FVGA 1JLQB 1ZG9A 3CJ0A 4ECZA 3CDAA 1NLKL 1Z8WA 2VC1A 1IKXA 1IOIA 1RHRB 3G82B 2M3DA 3FVLA 4JOUA 2E66A 2OFGX 2ZH5A 3IM9A 3I56S 2V2KA 3MEDA 4I2QA 3R9GA 2OD4A 2FZKB 3C3LA 3IG1A 2F3JA 4OMEA 4I1TA 1Q78A 3RW7A 3JUWA 4OC4A 4OLOA 5BR8F 4NGTA