2V8VA

Crystal structure of mutant r322a of beta-alanine synthase from saccharomyces kluyveri
Total Genus 147
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
147
sequence length
435
structure length
435
Chain Sequence
LNLPAAAPLSIASGRLNQTILETGSQFGGVARWGQESHEFGMRRLAGTALDGAMRDWFTNECESLGCKVKVDKIGNMFAVYPGKNGGKPTATGSHLDTQPEAGKYDGILGVLAGLEVLRTFKDNNYVPNYDVCVVVWFNEEGARFARSCTGSSVWSHDLSLEEAYGLMSVGEDKPESVYDSLKNIGYIGDTPASYKENEIDAHFELHIEQGPILEDENKAIGIVTGVQAYNWQKVTVHGVGAHAGTTPWRLRKDALLMSSKMIVAASEIAQRHNGLFTCGIIDAKPYSVNIIPGEVSFTLDFAHPSDDVLATMLKEAAAEFDRLIKINDGGALSYESETLQVSPAVNFHEVCIECVSRSAFAQFKKDQVRQIWSGAGHDSCQTAPHVPTSMIFIPSKDGLSHNYYEYSSPEEIENGFKVLLQAIINYDNYRVIRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords BETA-ALANINE SYNTHASE
publication title Crystal Structures of Yeast -Alanine Synthase Complexes Reveal the Mode of Substrate Binding and Large Scale Domain Closure Movements.
pubmed doi rcsb
source organism Saccharomyces kluyveri
total genus 147
structure length 435
sequence length 435
chains with identical sequence B, C, D
ec nomenclature ec 3.5.1.6: Beta-ureidopropionase.
pdb deposition date 2007-08-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01546 Peptidase_M20 Peptidase family M20/M25/M40
A PF07687 M20_dimer Peptidase dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.360 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2v8vA02
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 2v8vA01
3MRUA 2EK8A 3PFOA 3KGQA 1R3NA 2GREA 2EWBA 1F2OA 1TXRA 1XFOA 4TNUA 2VL1A 3NA6A 4NGTA 3LMSA 8CPAA 5LRGA 5J1QA 4EWTA 1YW6A 2HB6A 4MHNA 1VHOA 5IB9A 4P4DA 3SJEA 1XJOA 1F57A 4X8IA 2AFSA 2V8HA 5K8NA 4A39A 1TKHA 4DYOA 3T8WA 4DUKA 1Y0RA 3KHZA 1CPSA 2PJ5A 2ANPA 3FMCA 2IQ6A 1TKJA 4K3NA 2AFMA 3GLJA 1ARLA 2QVPA 1YLOA 4P4IA 5LYFA 3PEIA 3WABA 3B3CA 2RB7A 3FX6A 4NGRA 1LAMA 2Q4ZA 1Z2LA 4OP4A 3KR4A 4NJRA 4MHZA 4R6TA 1ZLIA 3KHXA 4OC5A 1TF9A 4R8FA 3PB8X 3NH8A 2WYRA 3CPXA 3PB9X 4UEEA 4FAIA 4PXCA 3NH4A 3D68A 4NGMA 3B3WA 5ELYA 3PB7X 4YU9A 2AFOA 3D7DA 3ISXA 4MCRA 2JBKA 3B7IA 2PVVA 5D29A 5LRKA 1QQ9A 1YMEA 1JQGA 4EMEA 3SJFA 1CBXA 1YW4A 4PXBA 3NFZA 4P4FA 1PYTB 2BCOA 1PCAA 3KL9A 1RTQA 1VHEA 2V77A 4O23A 3B2YA 2DEAA 4NGNA 3WC7A 5HXDA 5CPAA 2ZOFA 3IWWA 3DGVA 3QNVA 3LWUA 4OC4A 4A37A 2QYVA 4IK2A 4F9VA 3FEDA 3H8GA 4FUUA 4P4BA 2ABZA 2PJ1A 4FWUA 4ZX9A 3D7GA 3D66A 4X2TA 3KQZA 2HC9A 4W9YA 4ZI6A 2IJZA 2RFHA 5HVFA 3KR5A 2PE3A 2EK9A 1CP6A 2QJ8A 4F9UA 1BLLE 1TF8A 2POKA 1UWYA 4FBEA 4MCPA 1BAVA 3IEHA 4MCQA 2JEWA 3CDXA 1CPXA 4UIAA 2C6CA 3KQXA 2PJ4A 4ZX8A 4PQAA 3FJUA 2PJ9A 2OR4A 1ZG7A 2ZEMA 4R7MA 5LYLA 2AFWA 3SI1A 5HVHA 1AMPA 4P4JA 1F2PA 2PJ2A 3VH9A 4OC0A 3FH4A 2F8HA 2ZEGA 4OIDA 2NSMA 4RUHA 2ZEFA 3IJ3A 2PJBA 2JBJA 5LYIA 2CTBA 3S9NA 3H8FA 3IC1A 3PBEA 4PPZA 4MMOA 4MXUA 4UEZA 4WJBA 4OIWA 1ELMP 1KWMA 4IAVA 3K2KA 4X3RA 1DE4C 2XEGA 1Z8LA 3GUXA 4ZY2A 4JYWA 3GB0A 1H8LA 3S9LA 3CPAA 5LYDA 2O53A 4P45A 3D7FA 2I3CA 4OC1A 4F8ZA 2ZOGA 2PJ0A 4UIBA 4NGPA 4A94A 5JH9A 5K8MA 4GM5A 1FNOA 4IHMA 2C1CA 3NH5A 1OBRA 2Q51A 3S9MA 4OC2A 3TC8A 1Z5RA 3HLPA 1M4LA 5JM6A 2ZELA 4LQGA 1Q7LA 4NGSA 5F09A 1R43A 1LFWA 3V38A 1ZG8A 2G9DA 3PB4X 4B6ZA 3PRTA 2PJCA 1TKFA 1XMBA 2PVWA 2O4HA 1ZLHA 5HVGA 4NJQA 1BPNA 4MHPA 2PRQA 4PXEA 4NFRA 2Q43A 1Y0YA 3D67A 4JZ0A 3RBUA 2V8GA 3JRUA 4P44A 1IGBA 2PIYA 2PCUA 2XEFA 4UEFA 2OOTA 2V8VA 1XRYA 5LRJA 2PJAA 3MN8A 2XEJA 4EFDA 2WZNA 3RZAA 4MHYA 3DLJA 3SI0A 3H8EA 2PJ6A 3KZWA 1ELLP 4ZY1A 1DTDA 3HUVA 2ZEPA 6CPAA 1Y7EA 3B3VA 2V8DA 1EE3P 4NGQA 2PJ7A 3WC6A 2GU2A 4P10A 2J9AA 4OC3A 3B3TA 4ZYQA 3B3SA 2C6PA 2CF4A 1ZG9A 2F7VA 1BPMA 3BI0A 3BI1A 1QMUA 3VARA 1LOKA 3PB6X 3BXMA 5I4MA 1YSJA 4AXVA 2ZEHA 3SI2A 2BO9A 1CX8A 1HDUA 5JGFA 2PJ8A 3IIBA 4R76A 3FEEA 4CPAA 2FVGA 2AFUA 5CBMA 1VIXA 1FT7A 3WC5A 2NYQA 2XEIA 3IFEA 3L2NA 1CG2A 7CPAA 2PJ3A 4TWEA 3PBBA 3ISZA 3KI9A 2C6GA 5D8NA 4KSIA 1LAPA 3V7ZA 2BOAA 2PIZA 3TX8A 3SJXA 3IO1A 4A38A 1CP7A 1NSAA 4H2KA 4ZY0A 3N5FA 2GLFA 3SJGA 1HEEA 4G1PA 4MRIA 3FF3A 3D7HA 4WWVA 1XBUA 3BHXA 4BD9A 2GLJA 4PXDA 5K8PA 1AYEA 2AFXA 4P4EA 5K8OA 4DJLA 1LCPA 2CIJA 3FECA 2AFZA 5DS0A 3I1UA 3VATA 2CTCA 4OKOA 4OMEA 5THWA 1IY7A 3FVLA 2ZEOA 4Q7AA 4YWYA 2ZENA 3PFEA 1ARMA 3CT9A 4MCSA 4P6YA 4Z65A 3WT4A 3D4UA 1VGYA 2IMOA 1HDQA 2ZEEA 1LANA 3KASA 1GYTA 3B35A 4ONWA 3K9TA 4UF4A 3RAMA 2ZEDA
chains in the Genus database with same CATH superfamily
4KOSA 2R7OA 2HS4A 5HN0A 1YGHA 2HZVA 1V6HA 3LGMA 2B7CB 3MHYA 5KTDA 1IJFB 5IFMA 2IA0A 4E8OA 3HI9A 1QM9A 3E51A 2ALYB 1U47A 4DV0F 3MPDA 4CQ1A 4A39A 4NZ6A 4IOCQ 3R1KA 1MJAA 2HNZA 1C0UB 1K8AT 2HIYA 2E9RX 1QSTA 4NYPA 3M8PA 2EVNA 1VQMS 1R27B 3PM9A 4KO0A 4AVBA 4NGRA 1SV5A 1Y3KA 5IC6B 1BHNA 1CJKA 1ZLIA 4DV7J 3JQJA 5IT9U 2KH9A 2XMTA 1EKRA 2W7AA 4RX6A 5BXIA 1RHRB 4LF2A 2YH1A 3GV5B 2KG0A 2OD4A 3RRGA 4O3SA 3G96A 1Q2YA 3MFIA 3H98A 2KXNB 2DNNA 2B8QA 1CJVA 3B2YA 1N8RT 4A31A 3WC7A 3NL0A 3CTRA 3G6ES 5GAEI 4DFMA 2H54B 1SBRA 3CC7S 1VRUB 4NLWA 1RT2A 4DPOA 2CY2A 4K4YA 1Y5IB 2Q0YA 1JLCA 1NHUA 2V69A 4QWBA 1RP5A 3PX6A 2YKMB 2XGPA 5C82A 7FDRA 3OTEA 1SJRA 1SH2A 1M5PC 4QOTA 3R5GA 1CPXA 1Y9OA 2AQ4A 2HQFA 5DDQC 5KG5A 1MWQA 1TUGB 2OR4A 3G2XA 3SI1A 4PCQA 4EK2A 3BGLA 1AMPA 1F2PA 3ENWA 1UTAA 1ZETA 4CIOA 1EAYC 3PW5A 3I0SA 4WFXA 2PJBA 2REEA 2OTJS 2A1BA 3KLIB 1N56A 3NG8A 1HWIA 1HQ2A 3DLKB 3GILA 4KOVA 2ZC3A 2KZZA 3RR8A 3GFZA 2HGLA 2E7XA 1BGXT 2G0BA 2PSWA 4MK9A 4DR5F 1AB8A 1MJ9A 3NCQA 4R57A 3EJMA 2ZHAA 4C11B 1T02A 4U9YA 1PUAA 3DN9A 3LODA 2BE2B 5AXMA 4MK8A 4NA2A 3B4MA 1VRTB 4DPWA 2OKQA 5KFNA 3PV8A 1N32J 2WRMA 2XLKA 2C1CA 3K9UA 3I9V9 1HI1A 3SQGA 3W66A 2HYIB 1C0TA 2KM8C 4IG0B 1OQ3A 1T95A 2DTJA 5EC4A 1JLFB 4FKXA 4HDHA 2Q4YA 4YY3F 4UOGA 4QUSA 1EP4B 4GC6A 1L3SA 1LWXA 3FQLA 1S6QB 3DU5A 1WSVA 5ETPA 4J3GA 4XPEA 3PR5B 3SI8A 4QJVA 1KFDA 3ISND 2PI5A 4XO0A 2YKMA 2UUWA 3MD3A 5H84A 4CM2A 5HQ8A 4H6ZA 3UE2A 4ELVA 4WE1B 5CXTA 4Z2XA 4O0NA 2WZNA 5DQIA 2LQBA 1S10A 1KVJA 5L46A 2EVZA 1DFDA 1C4AA 2W2QP 1RT1B 3EVWA 4UWJA 2F7VA 1RI7A 1Q2CA 1BPMA 3ZTSA 1KRPA 3MMCA 3W9HA 1LWCB 1SJFA 3BR9A 2UUCJ 1Z8WA 3K2YA 3AODA 2R1IA 4Y00A 2HEKA 2VA2A 4CT9A 3GWCA 2XLIA 2EG2A 3TOAA 4Q2LA 2AFUA 4CNYA 2X3DA 1FT7A 5DZ7A 3TAPA 1UVKA 4WTYA 3CDUA 4QQBA 3RG6A 1EJ7L 2BE2A 3BDEA 5CNPA 3V7ZA 3H7HB 2RUGA 2WHOA 3TT2A 3HD1A 2K3IA 5ETNA 3Q8SB 1F2HA 1VRTA 2MGZA 4I0WA 2XMUA 1HIYA 1X5PA 4WU3A 1IOIA 3UWTA 4XNHC 3DOMB 2L08A 5L1KA 1GXUA 2IJNA 1HBUB 1AYEA 3I5CA 1OPIA 3VAGA 2MKKA 2J9DE 2AJ0A 3IGVA 2CPJA 2WONA 4ANDA 2P6TA 1IY7A 1FKPB 3MPVA 3AXMA 2FLLA 3H5SA 4AD6A 2C22A 1DRZA 3TTHA 4RW6B 3FEXB 1FFWB 2DPJA 2HBQB 3CJ4A 1HHTP 3PKMA 1VIOA 4XAKA 3UQSA 3QAUA 1JIHA 3KASA 1QAXA 5JUMA 4DF4A 2ZEDA 1HFEL 5D4PA 1H38A 5FIIA 2UV8A 2WPXA 3R1HA 2OFGX 4YHHJ 3K5MA 4CDIA 3MGJA 1OPZA 4YMEA 1WC5A 1B70B 3BF4A 5ETMA 3VAMA 4YRHA 2ZJQQ 3SJEA 2OPPA 4B5PA 4F2RA 2FJBB 4CGPA 4BWMA 3LH2S 1H72C 3NNCA 1XNQF 4OYOA 2W4CA 4EBCA 1DTTB 3GFXA 5KT2A 3CDEA 2FSRA 1VLYA 1VBKA 3MZIA 1VQPS 2MZTA 5KG1A 4ANEA 2KCWA 3GCXP 4UTGA 1CJTA 2F3JA 3KK1A 3D0HE 3FCWA 2IVYA 5FD1A 2DY9A 3PB8X 4ATNA 2E66A 2AHOB 4CH0S 3MTJA 3P5TL 3PB7X 5B7WA 2RS2A 1EIYB 4K4UA 3M2RB 4A8MP 4JV5F 4DV5F 1KZFA 2I9SA 5C42A 4USJC 3NFZA 1OY9A 3QJLA 3KXDA 4O23A 3W61A 2XO6A 1WF1A 2OHDA 5GMEA 3PW2A 2MJUA 2NPFA 2KHCA 4FWUA 4RW6A 2YKNB 3GSDA 4DSKA 4JI5J 1GTHA 4NI2A 1RT7B 5HMXA 4PK2A 1T9WA 2XBPA 1GNKA 3KR5A 2W9CA 4YB1P 2GIQA 3N5BA 5E0OA 2GFQA 4RWWA 4PAAA 3WC0A 2GVZB 5A2QU 5HMYA 2G4BA 2PJ9A 3TOBA 2WSAA 2A2CA 4F8RA 5AG4A 3CGIA 3CD0A 4C7HA 2D3ZA 2MLZA 5B0GA 4B9MA 1NE9A 1H98A 4KY3A 4OX7A 4N77A 1GTEA 1C1BB 5KFXA 5L38A 4B9SA 1VHFA 3UN5A 4A8FA 3HT3A 2CJXB 5CD4A 1PG5B 4LIRA 3V5RA 4AG9A 3OD2A 3E8OA 5F3TA 1J27A 3ILIA 4DQIA 4JYWA 3ZTOA 3R5CA 3QNWB 5LMNF 3TAQA 4ECZA 4GO7X 4UY85 1XOVA 5D4OA 1Z4EA 1RKIA 4C8LA 4A94A 3M2RA 4B9TA 4ECWA 4C2YA 5EDWA 1RBLA 4IHMA 3BSCA 4RBUA 2RJZA 2I8EA 3BGRA 2JX2A 3LD2A 4DV1F 4AQYF 3BEGB 4ELTA 4OL8A 4OC2A 1Z5RA 1TL5A 1EZZB 2DPTA 4ZJQA 3CCTA 5LSOA 2VU5A 4NE9C 2DD8S 4QWEA 5GADU 2AYEA 4ZN1A 1U2FA 2M9KA 4RU9A 4H89A 2J6TA 2P9EA 1IOFA 4EZ6A 2YKNA 3HCXA 4NXNF 1KLMB 2GANA 1RT7A 2CNSA 4QWDA 4N76A 2M8DB 1JMTA 5HJYA 4ES2A 3VCDA 2AYMA 2Z11A 3JRUA 4P44A 2XEFA 1KUVA 2V8VA 2F65A 4P2SA 2OZUA 4FD4A 2JEVA 5LRJA 1IU8A 2Q7SA 2D4PA 4C3MA 4Z37A 3J7Z5 2E1RA 3SYZA 4UWIA 1NH8A 4F2SA 1NZAA 3BBFA 3NGSA 1T11A 3WC6A 1KTVA 2XQCA 4NLPA 1IKVB 3TZYA 3DFEA 3BI0A 4IFYA 2CDRB 4RPFA 1KOOA 1FT8A 1FRKA 1BD6A 1RZMA 1NJIT 4ZLPA 2P9GA 5I4MA 2FJDB 1FDNA 3KMQA 4M94A 3D2WA 1TVRB 1FVSA 3PW4A 2Q04A 2YQ0A 4GO5X 2J9CA 2XM3A 4DQQA 1F1BB 3WC5A 3IM8A 3FBEA 2GA7A 1LNQA 4NXMF 1ELOA 1JKHB 3QLHB 5J2QA 4IRDA 3HHLD 4KSIA 5K5MA 3MAAA 4I2PB 3J81Y 3CMES 1NK4A 2R8IA 3JSYA 2BXJA 1VQOS 4M5KA 2F5IA 3VAKA 2Z3OA 1K4JA 1PYTA 2QIRA 3GZ7A 4PK3A 1O0PA 2GLJA 4L73A 4YR2A 2E5LF 1CC7A 2GMJA 1KLMA 3LALA 4FNIA 5LL6d 3T1HF 3W5YA 4USUA 1LCPA 4LF7J 1FA0A 2LQJA 2WB4A 3SFGA 2G0IA 3CC4S 4KOXA 4FYYB 4N56A 2OZHA 3S6FA 4LVNP 2KG1A 5KTQA 4NL5A 2IRYA 5IZHA 2WVFA 3DLGB 4X4UA 3W2VB 2I79A 1PU9A 3SCJE 3PYGA 4ED5A 4YQWA 5K14B 1K1QA 3Q22A 2A4NA 2H51B 1JNZB 4NWBA 3D4JA 3LWLA 2ZH1A 4RI1A 2R7VA 3FK4A 2GV1A 3UDCA 1JWWA 2K06A 1V3RA 1BQNA 4QZVB 2A2DA 2PDOA 2X7BA 4DSLA 3M30A 3R5DA 2LLZA 5LMUF 1KEKA 3X1LB 2DXEA 4BLGA 2ZFHA 5ITHA 4CI0B 3A8KA 2Q44A 2BVZA 1J4JA 1X0PA 4M5GA 2J8NA 1EARA 3QLHA 3VF0B 5EMIA 3HO1A 2QVPA 2DH8A 2BUEA 4I2PA 3WABA 1RUSA 2N3LA 1PJ6A 2OPQB 3I96A 2H5MA 4E8UA 4HACB 4NJRA 1I5OB 1WOOA 5D15A 1WDDA 4J9NA 1K0VA 3C16B 4YS2A 3TJ8A 2F4FA 4QIVA 4ZMMA 2CPFA 1UJ4A 9ATCB 2E5HA 1T05A 1YW4A 2RT3A 2AF6A 3AQPA 1B87A 4ZS6A 1RTQA 1VHEA 1OY6A 1R8BA 4OMFG 1QVGR 1TL7B 3NAHA 4KVXA 4YFUA 3G8QA 4EVYA 4CRJA 3TANA 3O3LA 3K5NA 3M2UB 4Z7YA 4FF1A 4XK8C 3T6JA 3MMAB 4ZI6A 3DLGA 2HVHA 3KHGA 3W2VA 2Z4PA 2HHXA 3V2UC 3IEHA 2PD1A 1MW7A 3CDXA 1S4FA 2WVDA 5A6WA 1EETB 3IM9A 5CHCB 3PACA 2R7HA 4IO1A 3KK2B 3KKFA 5HVHA 3JYTA 2OEKA 2BJEA 2H5JB 3Q8QB 1RDRA 2IDEA 2ZEFA 1AUDA 4DV0J 4PUOB 4ZCMA 4HH0A 2ZDPA 1SKRA 5GADI 2X3GA 1BC6A 3IA0A 3HSGA 4J9VA 2I38A 1KP6A 3LPEA 2ZWOA 3AB4B 4PG5A 1LWFB 4B9VA 4L72B 1I1DA 1MSWD 3FZBA 1RT5B 2CRLA 2B0GA 2GHWA 1NK0A 1JLEA 2V9WA 2R8GA 3H20A 2HHTA 2FGOA 1R31A 3FMBA 2GFFA 1WHVA 3RB0A 2HHHJ 3LTOA 3OSPA 4UIBA 3O6QA 3O5TB 4A32A 1QSLA 1TV6A 2QLWA 5D0GA 2ZDOA 3KMSA 2I5JA 4RW4A 2FJWA 1QY7A 1S79A 4X4NA 4DFKA 1VYAA 4OJ3A 2CQ4A 2ZELA 1EB0A 3H2LA 1FKAF 2LXUA 2OSQA 2VI7A 2JEGA 4FKYA 4MKBA 4WWSA 1CSJA 1HNWF 3NGKA 1YREA 3M2UA 3EXCX 4A47A 3HVAA 2O4HA 4IOAQ 4LF5J 3FC9A 4WCEQ 1S0MA 1Y0YA 1U6FA 4OZ0A 4C8KA 1Q78A 1Z1ZA 5DG9A 3D1OA 1FXLA 5C24A 2Y0BB 3VALA 3KNAA 4LRFA 1YTYA 3IBCB 1EETA 2KI2A 2B5JA 4QVTA 1HNZJ 3N4WA 3DLJA 4ZPWR 3DDKA 2GAGC 5AE2A 1G7CB 2Z3MA 2XWYA 4P2FA 1TAUA 1SC3B 1HA1A 4PUOA 3DI6B 2M3DA 4ZCIA 2CWKA 1B4SA 5CYQA 3VTIA 1TKXA 3BXMA 2DNMA 2B4PA 4OIXA 4NA1A 3MEGB 1GMVA 5JGFA 2ARHA 1LWFA 3NS6A 2P2CB 7AT1B 2FT0A 4DR5J 1RT5A 5A0YA 1U1QA 4DU7A 4RNMA 5KFYA 1NK9A 3Q8UA 3MEEB 1YBUA 3BQ0A 2NLWA 4FVCA 1QSMA 4K2XA 1YG0A 2HQIA 2F1FA 1RAGB 3JSMA 1KN6A 4W90B 1DQ8A 5H9EK 3G71S 1TIQA 4LQ9A 4WYLA 1A6LA 3HJVA 4OV1A 5AJ3F 2VPYB 4DN9A 2ILYA 1YK9A 3OTCA 2KFYA 2GE3A 1WG4A 2CIJA 3CJ0A 2K7JA 3BREA 2VOOA 2D9OA 4NXYA 4Q7AA 5HK4A 2NXNA 3US5A 2IYIA 4MT1A 1DQ9A 1WC3A 5CABA 3MAQA 2MTLA 5IXUA 3CJ5A 3FUYA 1Z8XA 3DLEA 1CC8A 2D3UA 5GAHU 2GREA 5GAGU 4CLFA 2J8AA 2VL1A 4CAXA 5CZXA 1KUXA 4ANCA 2RHQB 4HHUA 3DI6A 2IMWP 3K57A 5J1QA 1NEEA 2I0XA 1VHOA 1RWUA 4NLTA 5F46A 2OU2A 3DLHA 2F8MA 1QUVA 4FYXB 5GMDA 5BYSA 1QAJA 5L1LA 4CYUA 1HLWA 3V6HA 2MMYA 4X62F 1Y0RA 2D41A 4FYVB 1M1DA 3TZZA 4CGLA 3DMJB 4LFCJ 2JVOA 2VFSA 1JK9B 4LBHA 3FJ2A 3OBIA 2CNNB 3AXKA 2QIFA 3FBUA 3JVNA 4P72A 3T1AA 2QEXS 1RAOA 5EWFA 5C88A 2ZXVA 2XY5A 2B3VA 2DKOB 5BYRA 4J90A 3JS9A 3SJFA 1U0SA 1PCAA 3CJKB 5CPAA 5HXDA 4GKJJ 2DR5A 2FZGB 3C6UA 4MJKA 3WX4A 1XNRF 3C14A 4Y3CA 5FDLB 4L8AA 1X4FA 2G3TA 4HHHA 2PGCA 5M2PA 2CJQA 5JPHA 4OHZA 4DL6A 1PJ5A 4F02A 3MM9B 1C2PA 2HNYB 4DCPB 2VEZA 1S1VA 4P6QA 3D2PA 2ZE2B 2IY5B 4V19J 4KZTA 1P6TA 4ED2A 4P75A 3DOKA 5IWAJ 3SFUA 1XBWA 3MGDA 1W26A 4OIDA 1RT3A 1HKAA 2JDCA 2RQKA 3ONQA 3BBCA 3ILOA 1WC6A 2C2KB 3VAJA 2Z30B 4ZLJA 4PV6A 3MOZA 1OMSA 2A10A 2DRDA 5DWMA 1Q79A 3J80Y 3QWPA 4QU6A 3GUXA 4I6WA 3H42A 1FD8A 3QQCD 1R7IA 3NBPB 1Q2DA 2W9AA 3PO4A 2YKPA 2P6SA 3EY5A 4LFAF 4RUAA 1W2BR 4CCHA 3H4DA 3IWEA 2XGQA 4DV5J 2MSSA 5D3GA 4KHMA 4O3RA 2CQ0A 2HVEA 4WFNQ 2FVPA 4HNYB 4DFPA 3KLEB 2VH7A 2WOMB 3AHPA 2YNCA 3R27A 2ZD1B 4LFBF 3CJKA 3EYZA 4BINA 4B17A 3IGRA 2IAJA 1LFWA 4F0XA 2MZ1A 2LECA 3CCWA 3CUNA 1MU2B 4DQPA 2G3AA 2E9TA 3D9BA 4GMKA 1D1UA 2D3OR 3M8QA 3R97A 2BBEA 3MM9A 2E5GA 4FBTA 5E3QA 2K8GA 4HT5A 2V4JA 3I87A 2YX7A 2ZE2A 3PW7A 3TRGA 2VA3A 5KFBA 2LXIA 5FLXY 3BJ8A 3G4SS 3AT1B 4ZVTB 4NCAA 4I56A 5FVJA 3HUVA 1HWKA 2RRBA 3W2WB 4ECUA 2GJFA 5HROB 1RHMB 3IR6B 2J9AA 2DISA 5KG4A 4A4JA 1PC4A 2UXCF 4JI2F 2CZ9A 5IV4A 2PMWA 1UPPA 2DR9A 1JLAB 2NYIA 5KOWA 4DHVA 4KQZA 4OYAA 3IIBA 3TZXA 4UZBA 1ROFA 5LMNJ 2BJ8A 4P2MA 3NBPA 7CPAA 2CQ3A 2K3KA 1NHVA 4AT1B 1N88A 2Q3PA 1BQMB 5KFCA 3I4PA 2EFQA 2P0WA 4TQRA 2V5HG 1B0PA 1QSNA 3ETMA 5GAHI 1QE1B 1UAWA 2JSXA 3IO1A 2JWNA 3Q24A 4H2KA 3NS5A 4DV1J 5GAGI 4AQYJ 4NYOA 1RCOB 5E3PA 4O0IA 4G1PA 2QT7A 3CO9A 4NMLA 2KHDA 2ZD1A 3D7HA 3R2DJ 1URRA 1AZSB 1L3UA 2HLUA 1D9FA 4PXDA 1L5UA 3T90A 1XR6A 1J5EF 5K20B 2J6SA 4U6PA 2BQUA 4EYHB 1Z8TA 1P8GA 3T1YJ 4WFAQ 1ARMA 2LXFA 3J7AN 3MCOA 1OSCA 4K7QA 2GJIA 5AGEA 4C3KA 3CXCR 2QLBB 1FKOB 1YBTA 4PSWA 2G9OA 5F49A 4UF4A 3B35A 2OPSB 2NZ4A 3TJ9A 4DCJB 1HD1A 3W2WA 2YKOA 5HROA 2KM8B 1T7PA 3SSSA 2HK3A 4B08A 1RADB 1DY3A 3KLGB 4M5IA 3RO0A 4Y2CA 2H1YA 3NGUA 4MHNA 4D3HA 2AX1A 3E01B 5KG6A 1ZTWA 3M4XA 2DK2A 3CCLS 1A9NB 1NDCA 4DR1J 2EFPA 2RU9A 4DPUA 2Z57B 1LK5A 4IDKA 2FHOB 4NXMJ 5KT4A 4ZK7M 4QW8A 4H4OA 2XSFA 2BZ2A 1AT1B 2YGWA 1H6KX 3MM6A 4J91A 1UWAA 4II9A 1D8YA 2HGNA 1YVOA 2BJ3A 5HO4A 1HBNB 3ELHA 2R2RA 2DNOA 2O3DA 2YTCA 2D7SA 3L09A 3H8YA 5LRKA 5BWAB 1QQ9A 1AZSA 2VOPA 2AYBA 2IJFA 3NY0A 1JQGA 1IIDA 1NPKA 3KG0A 3Q2TC 2IVFB 1Q5VA 3BH7B 3IWWA 1QD1A 1KS2A 3DLBA 2EEYA 3FEDA 3VWEA 4G1IA 3M8RA 4JV2A 1TL3B 4W9YA 3OVBA 3HK2A 4DOZA 5E33A 5HVFA 3LW5C 4Y2IA 1BLLE 4HNXB 2ATLA 4UZCA 1R8HA 3R8YA 3QGGA 1IKXB 1WWHA 1KQKA 4PWDA 1ZG7A 1Q1KA 1FJGF 1VDHA 2R3VA 4ONUA 5LMUJ 2ABYA 2F8HA 3KK3A 2DH7A 3I31A 2OPRA 1N6QA 3DCAA 4LF1A 5KFOA 1PC5A 3N0VA 4RUHA 2QFIA 4A46A 2WSEC 3GFHA 1UJ5A 2RF2A 1S7IA 3JXOA 2EWHA 4JXQA 2LFVA 4QYZJ 8ATCB 1T9TA 1VFJA 1M0SA 1ELMP 1KWMA 2JDJA 4O4RA 5KFSA 1CPZA 4HR2A 2KDOA 2F4VF 1FXDA 4UCMA 2OI2A 3SHPA 5JMNA 2ILZA 2VG7A 2CVIA 2GZOA 4Q2MA 2APOA 4CS0B 5K8MA 1UCNA 5IX3A 5EGYA 1FNOA 2DNZA 5J8CA 1NDLA 3I4HX 5J1NA 4J9QA 2OMLA 3TC8A 1HNVA 3PGPA 4ZVHA 1BOBA 5F8JA 5JJBA 2J7KA 4I68A 4ZITA 5HMWA 3IU2A 3VV2B 2AX0A 4L3NA 1TZ0A 4DXLA 2B9WA 3PB4X 3B6BA 2E5JA 2XHCA 1JB0C 1OYEA 4B13A 2EFOA 1IM6A 3KOAA 1ZLHA 4I4BA 2EBEA 3QGPA 3T5HA 4J9PA 3RW7A 1S48A 5DM6Q 3CJSA 4XDCA 2FVSA 2CYYA 4KJIA 1KDNA 1NU4A 2HV2A 1NSQA 1IKXA 2GHPA 1N34F 3NWGA 2O67A 3PX0A 1DTDA 4JI4J 4ZPDA 2PJ7A 3ZTQA 4ZP9A 4LSNA 2WW8A 5EX0A 3B3SA 4CH7A 1S1TB 4ZPAA 2DRAA 2CXAA 1LOKA 1U25A 2V68A 4GVBB 3I56S 2CNOB 2YBVA 4NCGB 1K73T 1QAIA 1AA1B 4BBYA 2O5DA 3K89A 4F04B 5E41A 5JVGQ 3FEEA 3HZGA 3TEHB 2RIJA 4I49A 2NYQA 1H2VZ 1QJHA 4IUSA 1ZZNA 2B4OA 3PBBA 4EBDA 4ZCKA 3Q0AA 1P1LA 2IC3A 2MJNA 3BB5A 1WDTA 2BJ9A 4F0KA 4DR6J 3TX8A 4MFJA 3TQ1A 4Y2KA 2Y8WA 1IB1E 1HEEA 4DMZA 2UVWA 4MRIA 3WQPA 1NBEB 3QGIA 3MAHA 3S7RA 3BLNA 3P4UB 2ASJA 4OI3A 4BD9A 2Z3KA 3T41A 5H9FJ 3W64A 3TI0A 1HNWJ 3Q8PB 1NUEA 1TKZB 3TX0A 2ADBA 2CJAA 3MUMP 1R0CB 4DSFA 1BWEA 2BW7A 4CO2A 3EDQB 1RAIB 2W2OP 3MUTP 3RJMB 1HQEA 1FE0A 1HWUA 2LEAA 3EGZA 4ICLB 2VBZA 1LWEB 1MJBA 4A8OA 1XE4A 3D4UA 1N33J 1UEUA 4R25A 1ZTTA 1HDQA 2GQ2A 3OSNA 3H4QA 2NS1B 1GYTA 3KWMA 5A8WA 1K44A 2ACMA 3PFOA 6FDRA 1N36F 2Z3PA 4KGZB 1TMJA 4DF8A 2VJUA 2FS5A 4OI1A 3DXSX 3LMSA 1KKHA 1NSKL 3G8TA 4LBIA 4X64J 4DR3F 3PZJA 2CXEA 4HYKA 2CUYA 4GVBA 1KTQA 3LUYA 1WORA 5C25B 3DYAB 3DGPB 4GVLA 4MH8A 1LKZA 1RT6B 2MB0B 2JC1A 3HFKA 4DV6J 3K59A 4DYOA 4DUKA 2GVDB 3FYNA 1G6BA 1YGYA 3C6TA 2PJ5A 5CH7B 3HM9A 5DDPC 3R3TA 2DGOA 1WKJA 3S8SA 2UUBF 5J1EA 4ZPVR 2HW3A 1XTZA 5KFTA 2DGSA 3C26A 1TF9A 2Y8YA 1SUQB 3DHWC 3J7YU 2QGFB 4A48A 3KLHA 4MKAA 3VWSA 3QRQA 1UPMB 2IHR1 3B7IA 4JD6A 3TUJC 3LP2A 5KFZA 1NK7A 3OWCA 1BUXA 1RBOB 3IR5B 1VKCA 4TU9A 5HLFB 3UO0A 4YDDB 2J6UA 1XWLA 3DM2A 3GJQB 3VQSA 1RAEB 4F9VA 3EX7B 4P4BA 3KLFA 3H4BA 1SC4B 2M8HA 4WZQA 1LWEA 1C1CB 1DTQA 1TL4A 4ZA1A 4Y65A 4LSLB 2CQHA 2OLWA 4R3LA 3I5AA 3RYOA 4NYZA 2EI5A 2ZHOA 1UA1A 1UWYA 2KVQE 2E29A 3PJWA 2J5AA 4CYOA 4GKKJ 4X65F 2IM3A 1IR2A 2MKJA 5DO2A 3UDVA 4JBCA 1B0TA 1RABB 4P4JA 3DRRA 2WSFC 1KUYA 3GPAA 5KT6A 2ZW4A 5C25A 3L7OA 2ZEGA 3DGPA 4MFKA 3KHLA 2M70A 4QYRA 1IXKA 4O4GB 4X62J 4PPZA 2YNFB 2GVDA 5D0RA 2V50A 1BMQB 4F67A 1S5ZA 2DR7A 4H4MB 3GIIA 3UDLA 4KGXB 2CQGA 2ASLA 2DITA 1YKWA 3R5AA 2VKRA 1OWXA 2CPDA 3IAM9 1NK6A 2A3JA 5D0HA 2N7YA 5JXSA 2FL4A 2MHNA 4ZIVA 4NLRA 1VBXA 2PJ0A 2HWTA 2MYFA 4NGPA 5JH9A 4F4WA 4CO0A 1PBAA 3BPSP 1CULA 2GCFA 1YVFA 4GXHA 3C3LA 1Q86T 3TWZA 3G82B 3K0JA 4CAFA 1UW9A 2PO4A 2R7UA 2BYCA 3UR3C 4OI2A 3RBZA 1M4LA 1AXQA 5F09A 5HLFA 1FX2A 3F0NA 3NGDA 1S77D 3P49B 3NNAA 1VHSA 4A30A 4HI1A 1RJJA 3FNNA 2HQDA 3HKZD 1XMBA 4OI4A 2XNQA 3P3DA 5CCLA 4NJQA 4OZ1A 2J7UA 1GK8A 2ZJPQ 2PRQA 5D4LA 4RL1A 3QO9B 1Z4RA 2F40A 1RA6A 2OFHX 2V63A 4JLYA 2Y1JA 3EZ5A 1PBUA 4ZVQB 4EFDA 2PR8A 2B4BA 2E9ZA 4YR3A 2VG5A 2PFDA 4FS1A 6CPAA 2CIMA 3FVYA 1QSRA 1GT8A 4YR0A 4QIFA 4PZVA 4QIEA 2NZCA 2UUAF 1K1SA 2IIHA 1VOMA 1RU2A 1GXTA 3D54A 3CD7A 2W1BA 3HZEA 1HNIA 2X51A 2FVCA 1F60B 2QL7B 1Y3JA 1OJ4A 4O4GA 2QMXA 3ILLA 3KKWA 2YNFA 4Y28C 4RR5A 1XIXA 2ZEHA 3SI2A 1WEZA 4DX5A 4C68A 1TKDA 4OHVA 1IN0A 4R76A 4Q43A 1VK3A 3QBCA 2RKIB 4WK3A 4OYBA 2E1AA 3A4TA 2WW4A 2BACA 2DCUB 3JAMY 1N5VA 4PR6A 1CG2A 4R87A 3Q8YA 2IJRA 3ISZA 3IRWP 5CCMA 1KSPA 4Y34A 1JLQB 2MKYA 3ENQA 2V4QA 2MQOA 3DRPB 2ZH9A 3F8KA 4ZY0A 3G82A 3ET6B 1F3FA 2ASDA 5U47A 4LFBJ 3VR1A 5HAOA 3HPOA 3GV8B 2UU9J 4B9UA 1Q95G 3CDBA 3C46A 3CCQS 2O1PA 4PG6A 2LQ9A 1H73A 1REVB 5KFGA 3NOGA 4FXDA 2B4VA 1RTZA 2JL9A 4CLWA 2NPIA 3MM5A 3M6XA 4RU2A 1P4NA 4B3OB 1OS5A 3CZXA 2XC9A 1VQSA 4TU7A 4WIIA 3TCVA 2EG1A 1K9MT 1FJ7A 2CPHA 1F9HA 5KFHA 2YNGB 3J7YI 1RTJB 4O3QA 4Q8FA 2FC9A 4OJGA 4X4PA 1DAXA 4JI2J 4WYWA 2CNMA 3TAMA 1WACA 5IT9Y 3IS9A 1FXRA 3UDEA 2I1RA 3MOJB 1W7WA 2JRSA 5AXNA 4I69A 3F73A 1F5CA 1F6TA 3EZUA 2V34A 3D5MA 1U4BA 2PN6A 3PYEA 1X9WA 5AG6A 4DR4J 5HMNA 2VG6B 1LRZA 5IT0A 4QW9A 2XMAA 4C0BA 2HMIB 1B6BA 2FY8A 2XLJA 3GLJA 3PRDA 2J9EA 2XZTB 4NLVA 4DZ6A 3CWJA 2B56A 4WIQA 5F8MA 3U1NA 1HMVB 1JLQA 1FNXH 4ECTA 1UVMA 1HYSB 1S12A 2FDNA 3PXGa 3R7SB 3ET6A 2HQYA 2RSQA 1F5BA 1X8DA 2ATCB 3CXPA 2EFGA 2CNLB 2VZYA 2E1MC 1CBXA 1O5JA 2DEIA 1J5EJ 3GIRA 4TYBA 2GQQA 2M2BA 3UVJB 4NGNA 4L89A 3OJUA 4IUFA 1JNRB 4J9LA 4A37A 1UWBB 2MKIA 3R9EA 4FUUA 2AKWB 2IYGA 3QWUA 1QDUB 3NLCA 3K7RA 4B3OA 1A2ZA 2ZH2A 1V9OA 2R7SA 3H25A 5CYMB 1WNEA 3G3SA 3BO3A 1YZ6A 2HBRB 2YNGA 3G8SA 2EBGA 5DZ6A 3AOBA 3OHAA 2HHWA 1EKSA 4R8UA 1K47A 1LV5A 1I94J 1UJ6A 4DCOB 4PRFA 1SKSA 2Y0MA 5K9FA 4DDFA 2Q6CA 3JTKA 5AT1B 3OR2A 3R9LA 3FH4A 2RNEA 4ID5A 3V4MA 2NSMA 3TA1A 3DOLA 3M2VA 1UZDA 3T5LA 4FP9A 4N7TA 4CO5A 2HMIA 4OZ2A 2XI2A 1ZYQA 1U1KA 1WKKA 1M5KC 2C28A 4M3SA 2VC0A 3W9JA 2XEGA 4QBJA 2HLTA 1WD6A 1GXLA 3K58A 1H8LA 2Q66A 2YNCC 3S9LA 3V6KA 1HYSA 2AP6A 4RKUC 2GS8A 3M8PB 1KQGB 3S6GA 3LACA 5KFFA 4JI1J 4KFBA 3W5XA 1IJEB 1FRXA 1YZ7A 3N6MA 4C8MA 3B54A 1YJUA 3VGUA 1YJWS 5BJRA 3LP0A 2UVRA 4RNNA 4YFJA 1X7VA 1XIQA 2GAHC 3M05A 3VAHA 3DU6A 2PI4A 5AG5A 1J2VA 1HBMA 3J7A1 1CJVB 4Z7CA 4O3PA 4F3QA 4ZKAA 5B0EA 4OYWA 2OZGA 2NUUG 2C27A 2X1BA 3W9IA 2H5IB 2V2VA 4JZ0A 1U1MA 3H5ZA 3QIDA 1YI2S 5A28A 4OHWA 1RT2B 2YY3A 2CPIA 3CF5Q 1N5TA 3CNQP 4B3RF 2LU2A 1RTHA 1M1HA 3TARA 4CTAA 3EDRB 1S9EA 3SI0A 5AE1A 3OTOF 2W01A 1EE3P 4O44B 2RDIA 4N8OA 2JFKA 4OC3A 3PRVA 5EWEA 2C6PA 3D7SB 1S4EA 3QJPA 3G6XA 2PMZD 3PEHA 1NH7A 4QWCA 2JFDA 3LAKA 4QIGA 1MN7A 4YN3B 4RW9A 3CMQA 1N0VC 4LMZA 5KAKA 3BQ2A 1HARA 2Y0SD 3I0SB 5T7LA 2FVGA 5CBMA 1ZA2B 1S7HA 3PZPA 5L9NA 1R0BG 4JYAF 2XCPA 2CWXA 4PYAA 4RUBA 1R8AA 2AGQA 3V8IA 2YH0A 3SXLA 1CP7A 1N0UA 4DPTA 2ZZTA 4WFZA 1XF8A 2PDAA 3BQ1A 2ZHBA 3T5KA 3LOUA 3N01A 3SXNA 3MPWA 4DV2F 2UV8G 4ZOSA 4U9ZA 3SV4A 2MZJA 3IBFB 4Y6IA 1TP7A 3SQGB 1M5OC 4B3MF 4ED7A 4K5RA 1S6PA 1C0TB 1P1TA 3VATA 3HXMA 2VD3A 1N5QA 4QPXA 1FE4A 1T9UA 4OX9F 2HHPA 2C2OB 4USIA 4Z65A 5SUHA 2G0JA 4NLQA 3PTWA 3J81j 3W91A 3AH6A 4C2MA 2VQFF 2R7QA 1M1GA 3PDNA 2EK8A 4O44A 2AJ1A 5HANA 5DG7A 4DV4F 2BMBA 3B8HA 2BM1A 2LP4A 1URNA 1TFYA 3GYAA 2F9DA 1YW6A 3EMTA 4KH0B 3M8SA 2ODFA 2B5GA 1FWPA 2CVEA 2MY7A 5HP1B 3FSXA 1SQFA 3ZTRA 2RDDA 1UEKA 2FUG9 4NEXA 2R98A 5K8NA 3MMCB 3JQKA 2HURA 5J2PA 1ZBTA 5G20A 4DSJA 1VMBA 1Q5YA 3UPFA 3MPYA 4DQSA 3KHZA 3ZZ0A 1RISA 1V0CA 4RUCA 2AFMA 2EW9A 2HUZA 2UVVA 3HHKA 4FF3A 2RB7A 4ZPCA 3PY8A 4C8OA 2MZQA 4MHZA 5I3PA 3H90A 2F63A 3GIMA 3PW0A 3PB9X 5I42A 2E44A 2UXDF 3RB3A 4IFVB 2CQ2A 4YU9A 4OYXA 5LXRA 4MCRA 4ES1A 3C8YA 3OW2R 3IRXA 2VICA 2JZ5A 2MGZB 4CLYA 5A2QY 4FD5A 4YB5A 1J5OB 3QIPB 4X4QA 2KFNA 3GIUA 5E96A 3D3CJ 1OIAA 5E2QA 1BQXA 3KUHA 1S7NA 3THPA 1NMTA 3M1VB 3PEJA 4MKVA 3T5JA 3SSRA 1UL3A 4FD6A 3D66A 1FD2A 4G1QA 1Q16B 3CB4A 2WONB 4LIWA 4AUKA 5DRKA 3HX9A 5KFPA 3T9YA 4F26A 1JLBB 2VIHA 4KOTA 5E5NA 1N36J 2G0CA 2B43A 2VUGA 1RE1B 1S72S 1QUPA 1E6YA 3FJUA 5D8HB 1S9FA 3CE8A 3RB4A 4DR3J 4QBUA 3N6NA 3VGTA 5I3QA 1IM4A 3RUBL 4NOHA 5HP1A 3M6VA 4OV6A 3T9NA 1YK3A 3CJ2A 4IH6A 3MR7A 3IC1A 2B9XA 3JB9k 4AG7A 2OPPB 5H1SV 1QTMA 4B5PB 3UN2A 1L3TA 1FY7A 2IBKA 4K2JA 4J9UE 3NCPA 1PIEA 2RHSB 3NNHA 2VBQA 4FXVA 2OP5A 3AB2B 3NXZA 2G1DA 2O53A 3JUWA 1IQTA 2L9DA 4C0HA 4K4TA 1QAYA 4F8ZA 1GEHA 4ID8A 4IFVA 2VASA 3ZC4A 1CJTB 3CD6S 3KK1B 4L3KA 2GHVC 2MSTA 5F0UA 5F8IA 1F2GA 2YWHA 3UFCX 1J5OA 2EBJA 3QIPA 3UNGC 3T19A 2GGPA 3PVXA 5CAAA 3AD7C 1LFPA 2BM0A 3M1VA 5C42B 2LKZA 3FFIA 3MMBB 3MECA 1KR4A 5AXLA 2NSBA 4Q36A 2Y1IA 4MHPA 3QT7A 2MLYA 5DGAA 4NFRA 1QSSA 1XR7A 3SZ2A 2Z0ZA 4TLQA 3D28A 2R7XA 1JLBA 4QIWD 2AU0A 4Q0BA 4B12A 1SC6A 5A8RB 1TFWA 2O01C 4UEFA 1ZM4A 4NI2B 2WK4A 2J8MA 4RBTA 1SJQA 5LSRA 2W9CB 1RGVA 5J2NA 2NSCA 4U7CA 4ZHRA 2DGQA 3QFHA 2XEXA 1B3TA 2B4DA 4OAEA 1HW8A 2XHWA 4I67A 1UZHA 3R5JB 2UUCF 1XEBA 3M6WA 3LPYA 2BO9A 5KT5A 1CX8A 4I2QA 1IICA 1HDUA 2PSZA 1XR5A 2ZWPA 2BKNA 3OR1A 2OJ3A 5C5JA 2B3UA 2EUIA 2W9BA 2ZUGA 4ED6A 2RVJA 5KFDA 3M9OB 3KI9A 1I3OB 2ATRA 1FFSB 3NEKA 2BA9A 1FRIA 1QSOA 5CQGA 2J0WA 1RLDA 4TY8B 2ZH8A 2QE5A 4A8KA 4YP3A 2YQ3A 1ZM3A 4OYIA 2AJQA 3CJRA 2EKNA 3BGRB 1DZ5A 2ZVSA 4G65A 1Q8KA 3MMBA 1CEZA 2P9CA 1T8EA 5CZVA 2AFXA 3NGTA 1RO5A 4HDGA 2CKWA 3C15B 2QC3A 4KUBA 2R8JA 3I1UA 3EVMA 4X66F 3FVLA 4M5HA 4OI0A 4KSFA 2DRBA 1P9QC 5A8RA 3W65A 3UD4P 2NR0A 3WT4A 2B51A 1P9YA 1MMLA 3S01A 3W1YC 2NYHA 1ZOTA 3RAMA 1VQ8S 2KKHA 1RBAA 3TA2A 1FNMA 3H5YA 3MRUA 3BBBA 2R7RA 2EWBA 1IBKF 1F2OA 3A8EA 2QA4G 4I6AA 4NLSA 2QA1A 2UVUA 3BR8A 5JQ4A 2AMCB 2LVWA 3RBDA 5ETVA 2MLXA 4PG4A 4QYZK 3PYDA 1NB2A 1KQSR 4WP9A 3N28A 1QSYA 3GONA 1HPZA 2XY7A 2BJDA 2F8EX 4IFYB 3ICLA 4DV3F 2VQYA 4A95A 2U1AA 2ZBQA 4RW8A 2XYPB 4ETXA 4KYZA 4QR2A 1RTIA 2ZM6F 1SJ1A 1TKJA 3KNGA 3IWXA 2XYHB 5LYFA 4IR1A 4LBPA 3PHTA 1EQ0A 4K4XA 2IRUA 4KC5A 3A8JA 4Y49C 1PAUB 1Z2LA 4WTOB 4OP4A 3G87A 4F36A 4WU2A 2BL1A 2YKAA 4JI0J 4TY8A 3L4BC 5J2QB 1Y0HA 3MAAB 1DHMA 2LU1A 3EXYA 5ELYA 1X4EA 3Q86A 2AFOA 2JBKA 2QSFA 3MM7A 3RBEA 1T9XA 2UUTA 1FTCA 3G6VA 4M6GA 4P4FA 4DUYJ 1PYTB 5B0CA 4IF5A 3RTVA 5LJ5Y 1SL0A 3C15A 5L9XA 3KUGA 2HS3A 3HHLB 2EPIA 2HPUA 1OSDA 2A6MA 1U1OA 4DPXA 3FRZA 4B3SF 1B64A 5CA5A 4BDPA 1FTRA 4OX6A 2ROEA 3D7GA 4USWA 4LR9A 2N4DA 3K5OA 2KFZA 5DLGA 2B6AB 5T14A 1D9DA 1FRMA 2K1RA 5F9LA 3RAXA 2C3YA 4E2FB 2P5VA 1BAVA 1HHQA 4MCQA 2C6CA 3THVA 1MN9A 3QFWA 4FD7A 1NM2A 1GX6A 1UVJA 1S57A 2MPUA 1YRTA 1VBZA 1DJ0A 5F3ZA 1MMNA 3V81B 3OV7A 2W7OA 5F0WA 4J9OA 3BDPA 4P9SA 4P7TA 1UEVA 1ZPWX 3KG4A 2MHEA 1BQNB 4J9MA 4TLRA 4R5PB 3Q8VA 2XY6A 1TK5A 4MY0A 3M30B 5L1JA 2DCLA 2FJEB 2JC0A 2MQPA 3OTBA 4XPDC 2OO4A 5E3AA 4WKYA 1T03B 1S76D 4FBUA 3DC2A 4MJ8A 4CGMA 4CRZB 2LYVA 5LYDA 3IBWA 4X5KA 1RWMB 2GC8A 3D7FA 4U5YA 2I3CA 2P6GA 4C9DA 1CVJA 3V4IA 2ZKUA 2ZOGA 1UA0A 4GM5A 5GMKa 3OL6A 5H9FK 3QMQA 3W6XA 3AD8C 2ALZA 4ZVOB 2EO8A 3TVKA 2Q51A 3N79A 1NKBA 1RT4A 3TVYA 1GMWD 2E1PA 5B0AA 4A8XA 1HI8A 4LQGA 3KUEA 3HHLA 5H9EJ 4LF9J 3QSYB 2GJ2A 2OH2A 3PHEA 1T05B 4EEYA 2VFUA 3KYLA 4U8VA 1S1WA 2GIFA 3POTA 4OX8A 2B6AA 4P7VA 1BPNA 5B0BA 4KT0C 4C3LA 1IBMF 2FY1A 3BSOA 1YRUA 2V2KA 4YEAA 2BANB 2XTJP 4M5JA 4F3MA 4TY9A 5HBMB 3GIKA 2VXKA 2PJAA 1FFGB 5B09A 2J0QD 3BS9A 1JWQA 4DZDA 5EN1A 1XEZA 4DR2F 1CJUB 3V81A 2V8DA 2LCWA 3AQOA 4JI7F 2QMLA 1NJXA 3TO6A 4CO3A 3B3TA 2ERRA 2FGCA 4EO8A 3ENVA 3SV3A 4IG3A 4YUDA 2Y3YA 3M7VA 4KGVB 4AYBD 1TQLA 5HMZA 3JYTB 4R5PA 2OIHA 4RLEA 4RNHA 2EKYA 4ED0A 5FJ4A 2PJ8A 1WOPA 3FQKA 3VGVA 4DG1B 1H0HB 2DO4A 1T03A 3OXFA 2FHJD 1UMJA 2XMJA 3O44A 2W8KA 2HNDB 1X12A 3HSDA 3JQMA 3LANA 3I55S 4OQJA 4EUVA 1PILA 2KN4A 2HAFA 1U09A 2RU3A 3GR0A 4DX8H 1RWXB 4LQ6A 3DRSB 3CXQA 1Q81T 1FK9A 1JLEB 3I0RA 4JV1A 2XMMA 2OAUA 2FHJA 2FJAB 4DL0C 1SCJB 3TOQA 2X1AA 2KYZA 2Z2ZA 1M1KT 1NKCA 4M85A 2ZPAA 1XBUA 1TV6B 5LM7E 3ZO7A 4KRWA 1FHTA 4J7CA 4ZLNA 1S9GB 4DX7A 1Q8LA 3OL8A 4M95A 2I5JB 4RW4B 4NASA 1U26A 1HWJA 2FJVA 1S0VA 1MWYA 3D2MA 2IPOB 4JI6F 4YWYA 3JSRA 3WR7A 4CH1A 2BANA 3EWGA 1OZPA 5HBMA 1WC1A 4DSEA 4PQUB 3K5LA 4K4WA 3TZWA 4EO6A 3BO2A 4G6VB 5C24B 1CJUA 3QZ8A 1R3NA 1TAQA 4WXWA 4DS4A 4KS9A 3NA6A 1X4BA 2B5JB 3MEDA 3IG1A 2OH1A 3LO3A 4DLEA 4KKOA 4P71A 2HFOA 4I7FA 3S6KA 4CYPA 3HJFA 4LR7A 1KQFB 1FRJA 4LX9A 2BJ1A 2V8HA 1NAQA 2RRAA 2QLFB 4DG1A 1TKHA 2YWEA 3HKWA 3VAFA 3Q89A 3VHQA 5CYQB 4OLLA 1MLAA 1W25A 1TKXB 3DDDA 2HNDA 4ECSA 1U2RA 4F0HA 2FVRA 4A2ZA 2VHGA 2Q7BA 2W8LA 1YLOA 4JYAJ 3FRYA 2EXUA 3IWGA 1VQLS 3ZZIA 2ZW5A 1NCLA 1LAMA 5A0YB 1TL1A 3DRSA 4OC5A 1I51B 4U7UD 1EQMA 3GJRB 5F48A 1YLXA 2FHMA 4NZ7A 3R2CJ 4RO0A 4E0AA 3W3SA 5KFRA 1N4LA 2OMOA 4ZP8A 4DV2J 4HEA9 3VAIA 1U0HA 1H2UX 4P2XA 1S9GA 3AAWB 2QL5B 2RH3A 1LW0A 4XTTA 1TELA 5KG3A 1VI7A 3KL9A 1V5VA 1YX0A 3JTPA 4KHRA 3JSMB 2G1HA 3F44A 4LREA 2L3MA 5KFAA 1VLOA 1S59A 4OC4A 5G0RA 3RRHA 3BGOP 1NJYA 3SCIE 2HHUA 2ABZA 4S0MA 4ZX9A 1EX8A 2IM0A 4IH7A 4P73A 4ZP6A 2HC9A 4QC6A 1H7WA 3QYYA 4PQUA 2PE3A 2VQFJ 4F9UA 3QRPA 2POKA 4N47A 4DV4J 1CJWA 4LJMA 3H0PA 4F25A 4LF8F 2H9ZA 4ZX8A 4CO1A 3DLEB 2ZEMA 5KFKA 3GSIA 2WTFA 4ZP7A 4DWIA 2V2ZA 1U8SA 2PJ2A 1LXJA 1IBLF 3VH9A 3DLLQ 2AD9A 4WP8A 2OTLS 4GC7A 1F5AA 1VQYA 1GH8A 2HBYB 4AXJA 1U8WA 4ZPTR 4WJBA 1UFHA 3RR7A 1Y4ZB 3OUYA 3K2KA 4WKRA 2HFUA 2LQ5A 2HVDA 4ZGYB 2DGTA 2C3PA 4CYUB 2RILA 5DLFA 4DEZA 4WBFA 5BYQA 4ZJOA 4LQ3A 1VJQA 3A3PB 2UXDJ 4MFBB 2WZ1A 2DNYA 3KDNA 4OZ3A 2HHHF 1HBOA 4UBRA 1T0TV 1FDBA 1YJNS 1OBRA 4A8QA 5EWGA 3BJ7A 4H4KA 4KPYA 2V94A 2AGPA 1Q7LA 3T9ZA 1DLOA 4LRBA 4CLLA 3R6GB 2NREA 4YY3J 1IR1A 4JWPA 3HVTB 4I64A 4AL7A 2ZH5A 4CLTA 1TUVA 2LEPA 4LF5F 1VRQC 1Y5LB 4A33A 1U49A 4PXEA 3C6UB 4UFXA 2YWGA 3C14B 2C2MB 1X0FA 2B8PA 3NMAA 1KHWA 2YX1A 4PSXA 3MN8A 1D8ZA 1ZM2A 3I9ZA 3EE3A 4ER8A 1H2TZ 2DBBA 3B4DA 1HNZF 3WC2A 3CC2S 1S1VB 2JLGA 4DFJA 1MMDA 2C2DA 2ZH6A 3KDOA 1RB0A 1N48A 3DOKB 1UVIA 2IL4A 2R42A 2HHQA 2J8RA 5LOQA 4N5SA 2RD5C 1C0UA 2I6WA 1XQIA 1SH3A 4NEYA 1RT3B 2B7BB 4UUWA 5E3CA 3HHDA 3PJ9A 5DWNA 4NZ0A 4QR0A 2WBMA 2VV5A 2ASYA 2FZCB 2XI3A 2PJ3A 2Z3LA 2G2ZA 2M52A 2JDDA 4HNWB 2D1CA 4MFBA 4UOFA 2CPXA 1LAPA 1WKLA 2DNGA 3FZ2A 3KHHA 2C3OA 1IUJA 2BKOA 4A38A 3ZJ0A 3TA0A 1FEEA 1HL6A 4CGOA 1YRXA 3HFZB 1YIJS 2WSCC 1U6MA 2BR0A 5RUBA 1NB7A 4B14A 3MR5A 5D3GB 4AL5A 1TUWA 1G3OA 1VRUA 4FF4A 3HVRA 2BEIA 3HVTA 5LSLA 1NK5A 2XMWA 5BR8F 2DB1A 2CTCA 2IAJB 4KAIA 4KB7A 3T6BA 3MR3A 1VQNS 1WI8A 3M8QB 2V67A 2FLOA 2U2FA 2FXFA 2Q4VA 2WUUA 5SZTA 2R7WA 3FSYA 4M1KA 2YWKA 4TN2A 2V4JB 4F0MA 3K17A 3A3NB 3SEOA 1YWXA 3THTA 2KT3A 3UI3A 2PR1A 4KV8B 1C4CA 1CQMA 3UD3P 2NQPA 4C8ZA 4AVCA 2DHXA 3KLIA 3U7JA 2OUGA 1N5YB 2JH3A 5A27A 4GS4A 3CVKA 4URSA 1X4HA 3DLKA 1F57A 4JOUA 4NRTA 2Z8QA 4RJVA 4G3IA 1NPPA 1XNQJ 3LQVA 4M8LA 1BE4A 3HSJA 2FC8A 5G21A 4C11A 2IQ6A 4P74A 1ACMB 3PIOQ 5L8RC 1REGX 1BWVA 4HH1A 2P8IA 4LFCF 3NS7B 1VK8A 4EFAC 4R8FA 3GYGA 2CAJA 3D68A 3CCSS 3FEZA 2KXFA 4IG0A 1O51A 4JV5J 1UFLA 2JVRA 1PAEX 2NUHA 3PJXA 1UVNA 1WJ9A 4DI6A 1YJTA 1OY8A 2XYGB 1JLFA 1XERA 2J76E 2DHSA 3OFEA 1EP4A 2H5EA 4JI8F 1S6QA 1NPRA 4GKJF 2DNLA 4X66J 4HKFA 2DXDA 1M4GA 3HT0A 1VCTA 4WF9Q 2DNHA 1T3NA 3HMJG 4X2TA 4X84A 1RAJA 4WE1A 1DARA 5AE3A 2RFHA 3ISNC 2EK9A 2ZZMA 1RHQB 2QX0A 1RAFB 1WF2A 2FYXA 3U1LA 2MQQA 1GFWB 2XG8A 2BKPA 1IBKJ 2BE7D 4MK7A 4RN7A 4KV8A 1FF2A 1RT1A 3GG1A 2F5GA 1GHEA 3WIUA 5IWAF 1LWCA 1GAOA 5IV0A 2EK6A 4B10A 1H74A 4YGOA 1N5YA 2H48B 3EGNA 4FZVA 5D77A 4YB6A 1JLGB 3TVZA 3QAHA 1Z4UA 4DV3J 4KR0B 5LYIA 3S9NA 1E6VB 5EX3A 2FLNA 1TR0A 4NPOA 3PBEA 4KSEB 2RRNA 2XS7A 2ZM6J 3EVOA 3SDEB 3ZNUA 1VR6A 2WBRA 3CXSA 3OFGA 2E1CA 4CLKA 4MTPA 4IDKB 4QPTA 2REFA 2R7TA 4H4OB 2BOPA 4P45A 4UUXA 1A7GE 4MHDA 4F6AA 3MM6B 3P96A 5ETQA 3BKUA 3DOMA 1S49A 2CJ9A 1FDDA 1RXOB 3ULHA 3Q8RB 1B7FA 4DL3A 1HBUA 5HJXA 3CDWA 1V3ZA 3MI7X 4BHQA 5HSPA 1R43A 2H4WB 4CGNA 1WC4A 2ZBRA 1FKPA 4B3SJ 1F9EB 3R5BA 3GJSB 4NXNJ 4Q5VA 3BV8A 5HVGA 3QRRA 4B9NA 1ZZFA 1Q4RA 8AT1B 4J9KA 2DIUA 4IQMA 2DGWA 1N52B 3OFFA 2AGOA 1X9MA 1NO8A 2HHVA 3BN7A 3P2HA 3CCJS 2PIYA 2Q79A 4B9LA 3KJFB 2XEJA 2ZKTA 2VBYA 3QATA 3LAMA 4MHYA 4BMHA 4V1Ak 2FZKB 4EBEA 2HQ3A 4DU8A 3KG1A 1JLGA 1ZG9A 1VQ9S 4PWDB 2QN6B 2ZH4A 3BSNA 3GMGA 1E6VA 2LQ8A 3FCVA 2I2YA 5HH1A 2FE7A 4K0KF 1DTTA 1YSJA 4CM0A 2DXQA 1XN9A 3KK3B 1N6QB 2OPRB 2DGVA 3BM7A 5LXYA 3SDEA 2RF2B 2NMTA 1VIXA 3EFAA 4C7QA 1TTHB 3PP9A 3MCMA 4F7VA 4Y0FA 3FCHA 4ZPBA 2CQCA 1V3SA 3FIXA 3MR6A 2OEMA 2FLPA 2PIZA 3FKBA 2F9JA 5EUHA 4X4VA 2W24A 2HFNA 3GJTB 3NOCA 3D1QA 3I9SA 2H4YB 1IBCB 1KC8T 4KUAA 2VG7B 1U1PA 4LRDA 3KHRA 4FNHA 4WWVA 1U1LA 4OLOA 1V5IB 1YX2A 1X4GA 1RU1A 2B9YA 2C2ZB 3CSKA 2AJ4A 1HNVB 2E5LJ 3FRMA 3T1HJ 4ZCLA 2N82B 2AFZA 3HF5A 2LEBA 5ISVA 4ZBGA 5EHHA 5LJ3Y 1IBMJ 3MM8B 3T1YF 5H86A 4ZN3A 2ADCA 3H5UA 3QB8A 2V9KA 1A0OB 2ZUAA 2VZ9A 3OL7A 2VDIA 2EC2A 2GVZA 3A8IA 4DR2J 1W2IA 3BN4A 3AOCA 3R95A 1RCXB 4JI7J 4QU7A 2HWHA 3RGIA 3NP5A 2BQRA 3UW1A 4IH5A 3S1TA 1NDKA 1C1BA 2KVIA 2WVBA 5LRGA 4EWTA 1ZAWA 1HW9A 4ZLLA 4LSNB 3FEYB 2X1FA 3RAQA 1JXVA 3W8PA 3KJQB 2R8KA 3D3BJ 4CYNA 1NMEB 2O28A 3T8WA 3A12A 5T41A 4DR1F 2YKQA 2BABA 1D09B 2AZ3A 2VBWA 1ARLA 2MY8A 4J37A 1QTNB 4WK1A 3IAS9 1S0NA 4BS2A 3RYLA 3KHXA 2C42A 4CAWA 4PWWA 4MIWA 4J9RA 3NH8A 3CPXA 4RBVA 5KFMA 4LF4F 1Z9UA 2HRUA 6FD1A 2IC3B 5MLCV 4M5DB 1YQEA 1LQ9A 1IVZA 4DJBA 4MIAA 2LA4A 2JLEA 5DGBA 2V77A 2HZAA 1PYSB 4LSZB 4JI6J 3D8PA 1WHWA 4LF6F 5IQQA 3MM8A 3NWRA 3H8GA 2JNJA 4EI2A 2PJ1A 2BUNA 1GMUA 2VB6A 2ZW6A 3DSBA 2YPYA 2B58A 1SKWA 2JLFA 2DPSA 1HQEB 1VQKS 1IKYB 2JEWA 3ZZOA 3CCES 3KQXA 1IKVA 1ZA1B 4F4YA 2BW2A 4MFZA 4ZVRB 3UCUP 3SCKE 1U2CA 3LF0A 3FSIA 4ZVGA 5A8WB 1RAAB 4LRAA 1RKJA 1X31C 3BSAA 2DGUA 2DHAA 1TVRA 4CLUA 2HKEA 4IRCA 3QT8A 2JBJA 5F9NA 5DM7Q 1HR0F 1RACB 4M6HA 3ZZZA 3ZZUA 1KOHA 4K4ZA 1JKHA 3NGRA 2MZRA 3JTOA 4IOBA 1Z8LA 3EXNA 3B78A 2CQPA 3CPAA 1S6OA 3C6TB 2Z2YB 1GQEA 3HHLC 4LUBA 3W63A 1JX4A 3BJYA 3W5ZA 5D4NA 3OFHA 5J1EB 2MQNA 3HFVA 4M5DA 1JJ4A 2CNTA 4ZIWA 3HSZA 3M32B 5AXKA 3KLHB 1JJHA 3HLPA 1SQGA 4XPKA 3S6HA 4NSQA 3OVAA 3WX8A 2IA6A 3RB6A 1ZG8A 3LP2B 4OYPA 2ROGA 4NA3A 4B6ZA 5B0DA 5IS2A 4TU8A 4Y49B 5KFWA 2ZITA 2PVWA 3EZOA 3GR1A 1PGZA 4CWBA 3DM2B 4WPAA 2G2YA 5ETRA 4IQXA 4JV0A 2DR6A 5K14A 3KLFB 1IKYA 1DTQB 3OL9A 3LP1B 3VGSA 4TVAB 4LF8J 3HDSA 1Y10A 3H59A 2DO0A 4OHXA 1ELLP 1RWPB 1WELA 4XPLA 3B3VA 4JI4F 1IBLJ 5KFLA 1SPBP 1U45A 1SI9A 1SQEA 4H54A 2RE1A 1RHJB 3MR2A 2CF4A 3JSBA 1CS4B 1FWLA 2A18A 1WI6A 4IYQA 1YBAA 3VARA 4ECYA 2DGXA 3TUIC 4Q44A 1RK8A 3DRRB 3N6LA 1FEHA 3TUPA 3Q2SC 5IB0A 1IWAA 1L0CA 2RQMA 3FGVA 3R6LB 2N7CA 3EUNA 1UP1A 2OELA 4RS2A 4NLGA 2OPQA 2R2SA 2DYAA 3B8GA 4HACA 1M90T 2AW0A 1XC9A 2UXBF 3UN3A 3C16A 4AXIA 1JXLA 3EGWB 4W92B 2YWFA 5J8FA 3GIJA 5ETTA 4DR6F 3PO5A 2MKHA 3M32A 4HI2A 3D6HB 4A8WA 1FI4A 4USKA 2QFJA 4Q45A 1L3KA 1RSCA 4ED1A 3EGVA 2X1GA 4KE5A 1TL7A 4XPDB 2QSWA 2HSEB 3D0GE 1CULB 2GO8A 2MQLA 3I32A 5AJ3J 1XMQF 1FO1A 5ETOA 5KG0A 4QCLA 5KTCA 3FXTA 4M6IA 3MMAA 3FBBA 1X9SA 3PX4A 3MPUB 3VZIA 4URQU 4OMEA 3W7BA 3F41A 4DX6A 3J81U 2Z0GA 3I6PA 3F56A 1TU0B 4P6YA 3PCOB 3LP1A 4U9RA 1APSA 4HL9A 1N33F 1RWNB 1OYDA 4C8YA 1N71A 2ZEEA 2YNDA 3KK2A 2CZVC 3QT6A 2PC1A 1U6BA 4OI6A 2EK1A 2W4PA 1ZO0A 1UFKA 3GYXB 3TNVA 3EO4A 4NGTA 1CS4A 7FD1A 4KGMA 2VG5B 8CPAA 4X64F 1LK7A 1G2EA 3CPWR 2HB6A 4L74A 2Y1LB 3I82A 4ECRA 2AFSA 2KZMA 1HNIB 2IM2A 4DV6F 5HL7Q 2WAQD 4U7UK 1AUGA 4J5OA 4QB9A 4KIAA 3FMCA 2PMHA 4PG8A 4P4IA 1YQHA 2AYGA 3IWLA 5F8HA 2HHSA 3V6JA 2MEWA 2GNKA 2D74B 4OLPA 3BKTA 2WYRA 3CCMS 4PXCA 3NH4A 1ZM9A 4NGMA 5ADZA 3DKDA 1SIZA 3UR0A 3CULA 2GO9A 3EM1A 4UOCA 3U1MA 3ISXA 3BO4A 3B82A 3DR6A 1PYOB 1Y7RA 4PXBA 1AUSL 1ON0A 1HQUB 4M5MA 5BR8J 3I5BA 3C19A 4PG7A 3LWUA 1XMOF 1XNRJ 2YWWA 2R4FA 3O1LA 5F8NA 5JVHQ 4NEZA 1RTDB 4V19X 3KQZA 1RWOB 2HIQA 2CJKA 3MM5B 2RDJA 5KG2A 4MCPA 3AA9A 4TXSA 1T94A 4NLXA 4GKKF 4AE5A 1F3VA 2UP1A 3TJAA 2PJ4A 4PQAA 4X4OA 2Z10A 3LGNA 4XPCA 3SXOA 1X5TA 2VBXA 1MNEA 2XSJB 4KOUA 2J7WA 1I6JA 3GQCA 1FJEB 2Z58B 4MYTA 1PO6A 1KLNA 5CYJA 3GP9A 3MEGA 3TAMB 2VQEF 3MDFA 3IS9B 4R0EA 3VQTA 2GW8A 4DR7F 2KRRA 3H8FA 3ZZYA 2C2RA 4HPSA 2RQ4A 4HTIA 4AFFA 3KFWX 1FERA 2KJWA 4LT6A 4MXUA 4UEZA 1VISA 3S6EA 1G4CA 2KXHA 4KHPF 1VHIA 2LDYA 4J9SA 2IDLA 3MEEA 1HNXF 5ETSA 4JI3F 4I1TA 3RNZA 4PABA 1Q8IA 4ZVFA 5EBVA 1VJWA 2NXJA 2VF3A 4JUZA 4H4KC 4L75A 3M8WA 2HRYA 4LFAJ 4ELUA 4JXRA 1YITS 3CCZA 1U48A 2VODA 3LA0A 4ZVUB 3SMZA 4ALZA 2PQ8A 3AJ2A 1SJ3P 1S60A 1WF0A 1YJVA 3NMRA 3HHNB 3H2VE 1HQUA 4PWUA 4WZMA 3AD9C 3PIPQ 4JI8J 4K4SA 3P45B 1ITPA 1S7KA 1FCAA 3V38A 3GKRA 2Y1RI 3TR5A 5D0EA 1WEXA 2BRKA 2DXFA 1X10A 2YNHB 4K30A 1RTDA 5ETLA 1SB6A 2C2EA 4JJXA 1UVLA 1S1XB 3IR7B 4C7IA 3EPGA 4OYZA 2JEIA 3D67A 1F9FA 2OOTA 2HWIA 1VS3A 1JXEA 5DETA 1WK4A 3V6DB 3F5BA 2C3UA 4K59A 1D0EA 3H8EA 1TKTB 2ZEPA 2XSJA 3ZFVA 3G6YA 4P10A 4TYAA 4R8UB 4DSIA 2UXCJ 2G13A 4HVZA 1N5SA 1P0HA 3GV7B 4WFBQ 1SIWB 3OPKA 1ZPVA 3HVWA 3OR2B 2G2OA 3BYRA 3A3OB 4ID5B 1SKUB 3TO7A 3FDSA 3DOLB 3M2VB 2DHHA 3TEGA 1EHWA 3DMJA 2XNRA 4CPAA 2CG4A 3F0AA 2BSWA 1BO4A 5L39A 4IR9A 2DIVA 3X3UA 1L3VA 2FPHX 2V0NA 1KBRA 4DL5A 5M2UA 2M88A 5D8NA 4CRYB 1VC6A 2BOAA 3OVSA 1LW2B 3DRXA 3N9UC 1M4IA 2ZZNA 4MAKA 4NX9A 4HTJA 4RW7B 4O3OA 4KFBB 2QV6A 2P6FA 3D6TB 2M4MA 4UW2A 5C7PA 2DVIA 3DR8A 2H3EB 3LP0B 4PPDA 5FDLA 2UU9F 1KONA 2Q1LA 5F8LA 2BEFA 1FVQA 4P4EA 2GIRA 2YNHA 1S3ZA 2PEHA 1WTFA 2EC0A 3TO8A 5DS0A 2CADA 1S1XA 4OKOA 2HNYA 3MEKA 3CJ8A 1WOSA 3R7NB 4DN0A 2ZH7A 3CIZA 4TKTA 3GCWP 4MCSA 1HBMB 1K0TA 3OT9A 3L3CA 1S99A 2CNKB 3AJ1A 2MKSA 4DL7A 2V4RA 4UA3A 1QVFR 5B08A 3DDNA 1LANA 3V6DA 4CAEA 2AJ6A 1YJRA 5KFJA 2D4OA 3ZZRA 4ONWA 3K9TA 1TKTA 3L7UA 1BY9A 4KLWA 3CJQA 2DNQA 3IMQJ 2VZZA 4E98A 1DBDA 1RTHB 2VPZB 4CTAB 1S9EB 2HAIA 2L9WA 5IB9A 4K0KJ 2ZJRQ 3EICA 4M5LA 4OZNA 3C2PA 2J9DA 2CQBA 3SQOP 4DR4F 2E7WA 4JB8B 1RWKB 3VVTA 2V2QA 2GQCA 4DUZF 1FRHA 4NRUA 5IQ6A 1CPSA 1JJCB 2HQCA 4RW9B 2BQ3A 4CO4A 3KLVA 4K3NA 2COLA 4CP5A 2FB0A 1UKUA 5T7LB 4WXOA 1U24A 1LW2A 2C1EB 2RS8A 1JJ2R 3KR4A 2RQCA 3NKYA 4ECXA 2KTQA 2YXLA 2M5YA 3KLEA 2WOMA 4NLUA 1Y9WA 4RW7A 2XZWA 2KRBA 5C2GA 1KHVA 3D7DA 4MI4A 5D29A 3BYPA 2OSRA 4UQGA 1TK0A 5DQGA 3PR4A 4FPRA 4EMEA 2YPZA 3AA8A 1ZAXA 2M0GB 4LUAA 1MU2A 2BCOA 5L1IA 3O2IA 3G8WA 4DNCA 2HK2A 2OGUA 4O3NA 4BC9A 2MZSA 3N7ZA 3A9LA 4LVOP 2EFNA 1I12A 2N4CA 2CQIA 5IC4B 4QWAA 4DBQA 1S6PB 4C98A 4IRKA 1VQ7S 1Y5NB 1YJ9S 1SVDA 2IJZA 3GE9A 4NLDA 5KT7A 1ULRA 3DHXA 4ILLA 2X7IA 1TF8A 4K8RA 5IT4A 4HHJA 3BGUA 2CQ1A 4UFWA 1I94F 1Y00A 1X4DA 2MQ8A 1LEOA 4ZJLA 1R6VA 2JOQA 3R7BB 5LYLA 1NSLA 2AFWA 4ECQA 1JLAA 4ENOA 1FJGJ 2LDIA 4CLPA 3SCLE 1D9AA 4USHA 2VFTA 3IJ3A 2WCXA 5KFEA 2CTBA 2NXCA 1WSRA 4ED3A 5G22A 2LA6A 2R8VA 2CDQA 2FTRA 4MMOA 2B5GB 3ZZPA 1OQ6A 3IWNC 4MBUA 5J2MB 3P5BP 5GCNA 1NJWA 4F4XA 1BQMA 4IAVA 4ILRA 3PKYA 1PSDA 3SIPB 5J2PB 1WHYA 4B3TF 1QE1A 1IKWB 2F4VJ 1OO0B 3Q83A 1H3DA 3W62A 4LF4J 4JI1F 4TQSA 2VONA 3BPDA 4NCZA 2CJYB 2YQ1A 5GVQA 2RC4A 3TYTA 2CPZA 1YR0A 4B11A 3K8WA 5I42B 2DNRA 3QT5A 4F4ZA 5JM6A 4HKQA 2ROPA 1RYRA 3QGHA 1AFJA 3IRXB 1D3WA 4LF6J 4B5OA 5KFQA 2JEJA 5HI7A 4C4WA 4FF2A 2G9DA 5E7OB 3J80U 1TKFA 3I3GA 1I21A 4EYIB 1KNZA 4H6UA 1S0OA 1B99A 4Q8EA 2YVSA 2PT0A 1FDAA 1FKOA 5KG7A 1ZAVA 1R8CA 3NE7A 1X4AA 4NMXA 2HBZB 2AZ1A 2MQMA 2NXEA 3OLBA 2HFZA 1LOUA 4XNHB 2OPSA 1CBKA 3RU0A 2PCUA 4L6V3 3VZHA 2V6AA 4G1QB 2CZ4A 1XRYA 5A8KB 1RXTA 4C0OC 3OJSA 2FCKA 1M5VC 3HLUA 3KLGA 3D0IE 1XK8A 1N34J 3GY9A 1NZ8A 3JTNA 2GMLA 3CCVS 2KL8A 1UETA 1Y7EA 2HZCA 2Q6BA 3E01A 3OQ2A 2XULA 3LGHA 4I6YA 4N41A 1E6YB 2DT9A 1QMUA 3NRBA 4KORA 3H2UB 2DY1A 1HR0J 1VBYA 5ETKA 2QL9B 3GG0A 5J2MA 2UZAA 2E7VA 1WG5A 1RA7A 3ITHB 2CJBA 5MAOA 1X5SA 3KJNB 4CAVA 4K5SA 3P8BB 2IFXA 1WTBA 1SH0A 1U1RA 4F4KA 3VWDA 2W2MP 3AY0A 1IKWA 5FLXU 2XEIA 3L2NA 4A8SA 4EMDA 1NXIA 1HBNA 4OZ5A 1O6XA 5D6GA 1R8PA 4QR1A 4X4TA 2HS0A 5A76A 2PC6A 2QECA 4X4RA 5G1ZA 3RRKA 2ZVIA 4FDFA 4OYMA 4U96A 2ZBIA 3GYNA 3VVUA 1Q8BA 1WC0A 4WFYA 3QPIA 1T9YA 4DV7F 1FX4A 1CLFA 2A6OA 3SJGA 2W7PA 1KVKA 5KFIA 5E3RA 2N3OA 2QLJB 3E3XA 2VC1A 3H5XA 3BHXA 1TMMA 4GRSA 2PIIA 3CCUS 2XS2A 4K50A 4KH1B 3CDAA 3D6FB 2FIAA 5IV3A 2QYCA 3MUVP 4N8NA 4U95A 2EFVA 2GGPB 5K8OA 1TL3A 4E2AA 1YVKA 4OZJA 2HFSA 1NLKL 2KT2A 2AJFE 4ZVSB 1NRKA 3FFIB 3CT9A 3QAYA 3TFYA 3MECB 4EZ9A 5A8KA 1Y9KA 4AVAA 2ZBPA 1FESA 3ZZTA 2P6EA 4Q0BB 4BC7A 3KGQA 1FWKA 4FVMA 4EU0A 1T3OA 1TXRA 2KYXA 1XFOA 4TNUA 1SC1B 4Y2MA 2D69A 2HVIA 1XJWB 5J2NB 3EC4A 4ZHRB 4P4DA 4USVA 5J1PA 4MKYA 1XJOA 4X8IA 2QRRA 2B4DB 2XMKA 2QMWA 3ITHA 3OLAA 1WUUA 3TO9A 3ZXWA 2DF5A 2DH9A 2HG4A 3BKFA 3U27A 2UXBJ 2DR8A 2ANPA 4K4VA 1Q53A 1PJ7A 4I2QB 3WDOA 1PKUA 3IU1A 3OR1B 2UUBJ 3M8YA 3B3CA 2NXUA 3R96A 2WVEA 2WVCA 2B4UA 3DXBA 1CM0A 2W9BB 4R6TA 4KOWA 2K7KA 4BWJA 4UEEA 1FRLA 2H65B 8RUCA 2FJXA 3B3WA 4LRCA 1IWGA 4OFZA 1RAHB 2R8HA 2Y9HA 3A1YG 2PVVA 3CW2C 1YMEA 5M2RA 1M4DA 1N32F 4UOHA 4RZRA 2JEFA 3TW0A 1XMQJ 2YX4A 4URGA 2QA2A 1Q0NA 4OADA 3A13A 2DEAA 1U02A 1X4CA 2ZOFA 3DGVA 3QNVA 2RMLA 4IK2A 4CZCA 5IM0B 3TP2A 4R9MA 2PFFB 3CD5A 2DEJA 2HRTA 2VJVA 2RUSA 2ZOMA 1RQ0A 4MIBA 2O66A 4FBEA 3M6UA 3D6MB 4X65J 2QG9B 2E5IA 1S1TA 4CYQA 2CA9A 2LMIA 1FJCA 4R7MA 4Q38A 4M5NA 4F50A 4RNOA 4R0JA 5F8GA 2ZBCA 2QA4S 3OHBA 2IBOA 2AWZA 4NCGA 2AEMA 4R3KA 6AT1B 1AROP 3R1LA 3TE4A 1N54B 1VQ4S 3OXGA 1HPZB 3H40A 5KOXA 1NKEA 2Z2MA 1ZH5A 4F4AA 1DE4C 1BXNA 4RW8B 3UCZP 5KFUA 4EGLA 1X5OA 3ZTPA 1RTIB 3SSQA 3DNCA 1GX5A 4TNOA 4HLBA 4DS5A 3M9NB 1CQNA 2ZNZA 3D3SA 1P27B 1S1UB 1X60A 3DNSA 1XMTA 3NH5A 1NNDA 3S9MA 1TKZA 3R9FA 4KBIA 4JP8A 4NGSA 3MM7B 1UFWA 2ZC4A 3MXHP 1XMOJ 1AW0A 4C2ZA 3PRTA 5IM0A 3CMAS 2PJCA 1G1XA 4ICLA 1YDLA 2V8PA 1HD0A 4XDDA 2B9EA 4C48A 2YNIB 2FVQA 3BH6B 3RBUA 2MDAA 2V8GA 4MY3A 2HGMA 1IGBA 2OB0A 1MG7A 2Z56B 3CJ3A 2AT1B 1Z2ZA 4ZVPB 1S7LA 2BE9B 3T3FA 4DL2A 1SQHA 3RZAA 1YLEA 2K1RB 2GIVA 4HT7A 2ZNYA 2PJ6A 3KZWA 4ZY1A 3L9ZA 1TK8A 2VFRA 4NGQA 3W60A 1M44A 2ACYA 3DYAA 4D3GA 4ZYQA 2BX6A 2CPEA 2UUAJ 1QLNA 3M9MB 4USMA 3MURP 2VQEJ 4YHHF 1VQ5S 5KT3A 1RT6A 4DR7J 4OJHA 2W4DA 3FBFA 3E0KA 3PB6X 2NCKL 2QTWA 2DPIA 2QJ3A 3QSIA 4RNFA 2BRLA 4AXVA 2BDPA 5I0CA 3IGNA 2XB2D 1SL2A 4OHYA 4NCBA 4KHPJ 1R6YA 1HNXJ 4JI3J 5KTAA 4UQTA 3GTYX 3ENAA 4LR8A 1R89A 4TWEA 1SUQA 3GU0A 2C6GA 4FN5A 1HWLA 2HVZA 4RWXA 2JLMA 3Q23A 1U6ZA 4DLGA 2PEBA 2K2PA 1NJZA 3HP6A 4CLZA 1S1UA 1HI0P 4F0YA 2ZEJA 3V4IB 3FF3A 2AE6A 4UCNA 2MXYA 3PYFA 2WB1D 3PRBA 4MFQA 2KU7A 3FNCA 1IYLA 4ERDA 1SJ4P 1LXNA 2JJ4D 1RT4B 1C1CA 4DJLA 2VDHA 4X2BA 2VFVA 4LSLA 5THWA 1KFSA 4KLVA 2YNIA 2XO7A 5B0FA 5F47A 3HHEA 2ZENA 3PFEA 1BLUA 5DG8A 4A8YA 4JI5F 1S1WB 3WZ0A 3POTB 9RUBA 1VGYA 5DQHA 3CO0P 4ES3A 2DJWA 2R2UA 4KTQA 2XWXA 5G4DA 2HFVA 3NE8A 4CNZA 3C66A 2D9PA 4KSAA 4ETZA 4DQRA 1U7LA 2DHGA 2AEFA 2KJVA 3QJJA 3UD5A 3MCNA 2D3O1 3AFGA 1IR0A 2AV5A 3QAEA 4W98A 4H4MA 4L76A 3UNYA 4IG3B 3NCRA 3UCGA 2I00A 5F41A 1YJ7A 3MMJA 4OZLA 2FQQB 3IP0A 2FHKA 2R2TA 5AG7A 1S7FA 5DS7A 4ED4A 3PEIA 3FX6A 2PA8D 4DL4A 4OJ1A 2Q4ZA 4E0DA 3AJDA 1UW4A 3EPIA 3ILJA 3P2FA 4U67Q 2CQDA 2AJ2A 4JI0F 1B7YB 4AB7A 4FAIA 1U1NA 4C2XA 4FXWA 3HULA 1YHQS 4X4SA 3OXLA 2OD6A 1FK9B 4PKDB 3I0RB 2FIWA 2SXLA 2XZDB 4C97A 4DUYF 4YDXA 3KJVB 4FYWB 4IO9Q 1R0AB 4UT4A 3L95X 1RYSA 2QYVA 4DPYA 4F3OA 3QO9A 1KVIA 2KO1A 2QMUB 4MYUA 4FYDA 3ADAC 2JHEA 2C3MA 4BCAA 2PRBA 1CP6A 1GMWA 2QJ8A 1MROB 1RHUB 3AOAA 4BBHA 4IKAA 4UIAA 1IQZA 3PNIA 1WWZA 2HQGA 1RWVB 2XMVA 4MFPA 1B0VA 1WEYA 1IYKA 1MWZA 1RLCL 2DNPA 4W4MA 4OC0A 4AL6A 1NSPA 4ED8A 3OTDA 3CEDA 3MEDB 3NAIA 3IG1B 5HQLA 1H7XA 3ETOA 3TQEA 4KKOB 2RKIA 4DUZJ 5GAEU 1MK4A 4I7FB 1S6UA 4PEOA 4KOYA 2XCAA 5D78A 2OEJA 4UCPA 4OIWA 1Y11A 3M8ZA 3U02A 3WBZA 4X3RA 4CT8A 4ITSA 1M5HA 3MFHA 3CIMA 3WHIA 1O8BA 4ZY2A 3GB0A 3QZ7A 4USTA 4ECVA 3DRPA 2IM1A 2ZW7A 5HQMA 1ICEB 2W2NP 2J0XA 2RAQA 1I1GA 4OC1A 4B02A 1F0XA 4NLOA 4FPIA 4C8NA 2QO3A 1RWWB 1NK8A 5DDRC 4YOEA 2VKZG 5LT5A 1TL1B 2VPWB 3FMWA 4NLYA 2A0FB 1Q82T 3SBMA 3E2EA 3KJVA 3FBCA 1ZS6A 1REVA 2IRXA 2QZ8A 3G86A 1R0AA 2Z2LA 4CLSA 2YNEA 5DJBA 3MCSA 1NDPA 1U0HB 3PG9A 4LF9F 4WP3A 2CPYA 3GFYA 1LW0B 2XS5A 3W6SA 1AFIA 4NF1A 4LF7F 3D1HA 3BZQA 1S5KA 4KPCA 5G0RB 2Q43A 4C6AA 1MROA 2IVMA 4KVOE 2FIUA 5I3UB 1Q7YT 1RTJA 4B3RJ 3MD1A 2KB2A 3UY5A 4ILMA 3FB3A 3OTOJ 2VPXB 4DUTA 4UFVA 3IXQA 3RW6A 3KTQA 3ZNJ1 2GU2A 1WG1A 3O8WA 3R9GA 3BI1A 3MWBA 1RHKB 2VG6A 2GMHA 4MFLA 2GX8A 4Y2AA 4PYDA 4U8YA 1M5SA 1R57A 3IN5A 4UY8T 2MKCA 2C2NA 1DQAA 2DNKA 5A6PA 4FS2A 1HMVA 4B3TJ 1VQ6S 2HNZB 3K8VA 3IFEA 1WHXA 3W8GA 2AIRB 1T9VA 2W2PP 2CFXA 4ZDNA 3WIVA 4YB7A 4XIUA 3OUYB 2BJ7A 2PE8A 1VC0A 3TUZC 1KD1T 2FD2A 4KO0B 2BV3A 4KGKA 5CD4H 1SV5B 3DRYA 3DDIA 3K5PA 3SJXA 1CJKB 2L48A 5DDOC 1NSAA 1SXLA 1NHKL 3N5FA 2GLFA 3G9CA 3UVJA 1Y7PA 2L9NA 1VC5A 4P52A 2R9LA 2KT5A 1HBOB 4KVME 1UWBA 2M7SA 5C2CA 3P6YC 2WPWA 5K8PA 3LWMA 3MTKA 2AEJA 3MF5A 2PA3A 3L7PA 4B3MJ 3RBXA 2QLXA 2Z3NA 3JAMU 2L41A 3FECA 1Q7LB 3HD2A 1DLOB 4OX9J 2ZEOA 5CYMA 1HHSA 1DURA 5KFVA 2J0SD