2V8VA

Crystal structure of mutant r322a of beta-alanine synthase from saccharomyces kluyveri
Total Genus 147
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
147
sequence length
435
structure length
435
Chain Sequence
LNLPAAAPLSIASGRLNQTILETGSQFGGVARWGQESHEFGMRRLAGTALDGAMRDWFTNECESLGCKVKVDKIGNMFAVYPGKNGGKPTATGSHLDTQPEAGKYDGILGVLAGLEVLRTFKDNNYVPNYDVCVVVWFNEEGARFARSCTGSSVWSHDLSLEEAYGLMSVGEDKPESVYDSLKNIGYIGDTPASYKENEIDAHFELHIEQGPILEDENKAIGIVTGVQAYNWQKVTVHGVGAHAGTTPWRLRKDALLMSSKMIVAASEIAQRHNGLFTCGIIDAKPYSVNIIPGEVSFTLDFAHPSDDVLATMLKEAAAEFDRLIKINDGGALSYESETLQVSPAVNFHEVCIECVSRSAFAQFKKDQVRQIWSGAGHDSCQTAPHVPTSMIFIPSKDGLSHNYYEYSSPEEIENGFKVLLQAIINYDNYRVIRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structures of Yeast -Alanine Synthase Complexes Reveal the Mode of Substrate Binding and Large Scale Domain Closure Movements.
pubmed doi rcsb
source organism Saccharomyces kluyveri
molecule tags Hydrolase
molecule keywords BETA-ALANINE SYNTHASE
total genus 147
structure length 435
sequence length 435
chains with identical sequence B, C, D
ec nomenclature ec 3.5.1.6: Beta-ureidopropionase.
pdb deposition date 2007-08-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01546 Peptidase_M20 Peptidase family M20/M25/M40
A PF07687 M20_dimer Peptidase dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.360 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2v8vA02
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 2v8vA01
2C6PA 8CPAA 2EK8A 3CPXA 1TKHA 3K9TA 4OKOA 3GB0A 4ZX9A 4FAIA 2XEFA 4R8FA 4YWYA 2ZOGA 5I4MA 2JEWA 1LAPA 4MHPA 3D7DA 4PXCA 3V7ZA 4X8IA 2JBKA 1ELMP 2RB7A 3MN8A 4G1PA 1F2OA 1BAVA 4P4JA 2ZELA 3L2NA 5LRJA 4P45A 5K8NA 3N5FA 1HDQA 3B3WA 1IGBA 2WYRA 2GLJA 2OR4A 5JGFA 3DLJA 4YU9A 3NA6A 2Q4ZA 3VH9A 4A94A 3H8EA 1BPNA 4RUHA 1ZG8A 2C1CA 1CP6A 3NH4A 3DGVA 2ZEEA 1YSJA 3D67A 2F7VA 3ISZA 2XEJA 3HLPA 5LYFA 4O23A 4ZI6A 3B7IA 1AYEA 4UEFA 1ZLHA 3NH5A 3H8FA 3T8WA 2PJ2A 2Q51A 3B3TA 4P10A 1AMPA 2BO9A 1QQ9A 1FNOA 4MCQA 2QYVA 3D68A 2QJ8A 4FBEA 2CTBA 2IMOA 4ZY2A 4EFDA 2AFWA 3PBEA 3CDXA 5F09A 1TKJA 3SI1A 5JH9A 3WT4A 1ZG9A 2O4HA 1OBRA 1GYTA 1H8LA 3VATA 1JQGA 1HEEA 3IEHA 4OC3A 3IWWA 2XEIA 5THWA 2PCUA 4IHMA 4JZ0A 5JM6A 4DYOA 2RFHA 4EMEA 4WWVA 2XEGA 4NFRA 4NGQA 2GREA 4DJLA 4ZX8A 2GLFA 4MCRA 2O53A 4PPZA 3WC5A 2V8VA 3IC1A 2VL1A 4OIWA 3BXMA 2BCOA 4PXBA 4PXDA 1R3NA 2AFOA 3FEEA 2AFZA 5J1QA 2CF4A 3I1UA 4W9YA 2PJ6A 1PYTB 1ZLIA 4OC4A 3KL9A 3S9LA 2HB6A 3BI1A 4PXEA 4F9UA 3IFEA 2PJ7A 1XBUA 1XJOA 5LYIA 3D7GA 3SJEA 2NSMA 4MRIA 2ZEPA 3FX6A 3K2KA 5CPAA 4UEEA 1F2PA 1M4LA 2CIJA 5LRKA 4OP4A 4MMOA 5LRGA 2PJ1A 1TF8A 3SI2A 1FT7A 1DE4C 3S9MA 3ISXA 1ARMA 1ELLP 2EK9A 4KSIA 3IJ3A 3KI9A 3FMCA 3KQXA 1LOKA 1CP7A 4WJBA 4X3RA 2V8DA 3JRUA 1ARLA 2PJCA 3S9NA 1Y0RA 4Z65A 2IQ6A 3SJXA 2PJAA 3PB9X 2EWBA 3KZWA 3VARA 4A38A 3B35A 3FEDA 1YW4A 4OMEA 4P4BA 2AFUA 3D66A 4P4DA 5K8OA 2PJ0A 2NYQA 5HXDA 4LQGA 1TF9A 3KHZA 4A37A 3BI0A 4K3NA 1XMBA 4F8ZA 3D7FA 2AFXA 1Z8LA 3SJGA 2QVPA 4UEZA 3PFOA 3FJUA 4H2KA 4NGNA 3KHXA 2PVVA 4TWEA 4ZYQA 3IO1A 2AFMA 2PRQA 3FF3A 4UIBA 1LFWA 2V8GA 3IIBA 4OIDA 3V38A 1LANA 1Y0YA 4NGTA 2HC9A 2DEAA 3FH4A 3BHXA 3WABA 3CPAA 4BD9A 2C6CA 2ZENA 3MRUA 3PBBA 2PJ4A 3WC7A 1XFOA 1YLOA 4FWUA 1YW6A 1Z2LA 2JBJA 3PB8X 2ZEFA 2ZEDA 4NJQA 1R43A 2F8HA 1LAMA 4OC2A 4EWTA 4X2TA 5K8PA 4R76A 2GU2A 2WZNA 4MHNA 3SJFA 4UF4A 4CPAA 2V8HA 6CPAA 2ANPA 1BLLE 2PVWA 1UWYA 3B3CA 3D4UA 2I3CA 4OC0A 4FUUA 3PEIA 3B3VA 3PB6X 3RBUA 3B3SA 2J9AA 2ZOFA 3GUXA 3FECA 2BOAA 2ZEOA 2PJBA 1VGYA 4Q7AA 4MHYA 5LYLA 4A39A 1VIXA 3PFEA 2ZEHA 1QMUA 4ZY0A 1VHEA 5D29A 4DUKA 3NFZA 1CX8A 5K8MA 3QNVA 3KASA 1Z5RA 1Q7LA 3PB7X 1KWMA 4ZY1A 2ABZA 3KQZA 3GLJA 3SI0A 2PE3A 4IK2A 4P4FA 3HUVA 3KR5A 4NJRA 4OC1A 3RZAA 4MCPA 2ZEGA 5HVFA 1F57A 5D8NA 3PRTA 4NGMA 2G9DA 4R6TA 1LCPA 4B6ZA 1YMEA 4MHZA 4ONWA 4P6YA 3KR4A 3PB4X 1PCAA 3FVLA 5ELYA 2PJ3A 4F9VA 1DTDA 1CG2A 2FVGA 1Y7EA 3H8GA 4R7MA 4PQAA 1TXRA 4NGPA 4TNUA 1XRYA 1ZG7A 1VHOA 2PIZA 4GM5A 1IY7A 1CBXA 2V77A 1TKFA 2PIYA 2PJ5A 1CPXA 2POKA 3RAMA 3WC6A 3D7HA 4NGSA 5DS0A 2PJ9A 4AXVA 2PJ8A 3B2YA 5IB9A 1CPSA 4NGRA 1EE3P 2IJZA 4OC5A 3CT9A 2OOTA 4MXUA 1NSAA 7CPAA 3KGQA 4IAVA 3TC8A 3LMSA 4JYWA 5CBMA 3NH8A 2CTCA 3TX8A 4P4EA 1BPMA 1RTQA 3LWUA 2C6GA 4UIAA 2Q43A 5HVGA 4MCSA 5LYDA 2ZEMA 2AFSA 5HVHA 4P44A 4P4IA 1HDUA
chains in the Genus database with same CATH superfamily
3MPYA 1X12A 3RAXA 3CPXA 3P45B 1BOBA 1S1WB 2OZUA 4OADA 5I4MA 2HQIA 3PV8A 5CXTA 2VA3A 1NK7A 1F2GA 3GCXP 2UUCF 3OL6A 1ELMP 4ORFA 4JI8F 4A8QA 3M30B 1RTJA 1N56A 2QMLA 2QC3A 5K8NA 2ATRA 1LWCA 3JSRA 2VEZA 4IH7A 4CTAB 1Y9OA 5A8RA 3KLIB 3QO9A 4IH6A 2JEVA 4KO0B 3VVUA 1RDRA 5IQQA 2HVZA 4Y0FA 4DJBA 3H2VE 2DPJA 4UQTA 3N4WA 4EU0A 4NA3A 4RW7A 4CLKA 3HMJG 1HFEL 1IBKJ 2H4WB 4B3TF 4ZI6A 4DF8A 4J9OA 4LBPA 5DQGA 2BEIA 2HZCA 4WKRA 3HSDA 2YKMA 1TUVA 2EKNA 3H8YA 2A3JA 2HZVA 5KOXA 1Q81T 4C98A 3A9LA 5BR8J 1R0AA 3QZ7A 1M90T 3MM8A 3KLEB 1FXLA 5D4LA 4K4WA 4CRZB 2DHGA 2CIMA 2Z3LA 4RW4A 2MXYA 1TKJA 1FX2A 5CAAA 3NCPA 2KT3A 2CQHA 1QE1B 1EP4B 1H8LA 3BSAA 3MFHA 4GKKF 3KG1A 4IG3B 3M2UA 4LFBF 1HMVB 4KORA 2ZW7A 3LGHA 4DYOA 1QSMA 4ATNA 3PDNA 3BBCA 1YQHA 1LWFA 1WSVA 5GAEI 5KT5A 4PXBA 4FD5A 2WPXA 1QSTA 5LJ3Y 1RAFB 1RTHB 2AFZA 5F0UA 5DRKA 2R2UA 3SHPA 3NY0A 2VD3A 4F9UA 1YHQS 1FT8A 1IKXB 1FD2A 3KLHA 3CDUA 2E5LJ 1E6YA 1ON0A 4ETZA 3SFGA 3OVBA 2NZCA 5HSPA 2BDPA 1GMUA 2FL4A 5C2CA 4DWIA 3ISXA 1S6UA 2YQ3A 4R8UB 4UT4A 1U1OA 3NOGA 1FKOA 4L73A 3KQXA 1S6PA 4HT7A 4DV6J 4UCNA 4CNYA 1HNWF 2XYPB 3GIMA 4MFZA 2G1DA 1JXVA 2YWGA 3PB9X 4DX8H 5KFNA 1HIYA 3DHXA 3CJQA 2IA0A 4JLYA 2PMWA 5HXDA 1T9UA 2IIHA 4DR7F 2AZ3A 3H42A 1RT6A 2AFXA 1N4LA 1TMJA 2G2OA 3HHEA 1M5PC 1U49A 4USVA 1WG5A 1NK5A 1KSPA 3OL9A 4IFYA 2CPZA 1RACB 1L3UA 4NX9A 1N33J 4GC7A 3LALA 2HHUA 3V38A 3R1KA 2KU7A 2DGUA 3BHXA 3O5TB 3ZTRA 1RK8A 5GMEA 2R7WA 2ZENA 2I6WA 1IN0A 2GW8A 1Q8BA 3PB8X 3C19A 4K4TA 3TCVA 1HI0P 2HQFA 2CVIA 2QJ3A 2C2OB 3DGPA 3RTVA 4R76A 5F8GA 2WZNA 3Q2SC 1TV6A 2ANPA 2X7BA 2GNKA 1UWYA 3K8VA 4KZTA 5D0GA 3DLEB 3R5GA 2Z56B 4DV2F 1U0HA 3ZTSA 1AZSA 1H38A 2P9GA 2OPRA 1YR0A 1T7PA 4GKJJ 2A4NA 3JTNA 4ID8A 1S6PB 3MMCA 1VIXA 4QIEA 5C42A 1PIEA 4JOUA 4IG3A 2HIQA 4ZY1A 4K2XA 2PE3A 3RB4A 1UA1A 4KAIA 4OC1A 2ZEGA 4FXWA 4N41A 1XK8A 3BGFA 5J2PB 4MKAA 2VDIA 1FTCA 2BBEA 3AD8C 3FVLA 3G6ES 4MYTA 1F9EB 4F9VA 1RA7A 4WE1A 5D4OA 3HX9A 3HXMA 2V4RA 1FJCA 3GYXB 1BY9A 4BC9A 1IY7A 4GXHA 2OB0A 2RMLA 4U9YA 1A2ZA 2W9BA 5BJRA 5DS0A 2UP1A 1KOHA 2PRBA 1HNXJ 1S60A 4B12A 4ZJQA 4NA2A 3VVTA 3W5ZA 2Y8WA 3CT9A 3THTA 1T03A 3QRQA 2COLA 5FJ4A 4PWWA 1T94A 4II9A 2FT0A 3KMSA 1OPZA 3O2IA 5ETKA 1S9EA 1U24A 5AT1B 3UQSA 3U1LA 1HWUA 1MJBA 2HNDB 4FF2A 1XBWA 5E5NA 4QUSA 3H5YA 3G82B 2JVOA 2L3MA 3OQ2A 4CAVA 4R8FA 3L3CA 2ASDA 4TN2A 1X0FA 3DDNA 2KM8C 3LP2B 3V7ZA 1BQXA 1PAUB 2K5TA 4ES1A 3GE9A 3BO2A 5J1PA 3CJ2A 1YJWS 1FDNA 3PRVA 3MOJB 4Y3CA 1RT1B 2KI2A 4O44B 1S7KA 2VFVA 2Z2ZA 3BREA 3TEHB 4ZP6A 3NA6A 1R8AA 1YGHA 3QGPA 1PC5A 3MMCB 1RCOB 3EJMA 3J7Z5 5A6PA 3EY5A 2I8EA 3GWCA 4J9SA 4K4VA 1X4FA 1HBUB 2MJNA 2XEJA 2KN4A 3F56A 4B08A 4P72A 1MROA 3TRGA 4LFCF 3A12A 1BO4A 4BWMA 2R7XA 4QU6A 5CYMB 3TUIC 5C7PA 1JLCA 3DDDA 2GIFA 2H48B 2XEXA 1RT5A 2VPWB 1OQ6A 2N7YA 4MCQA 4W98A 2AGPA 2CTBA 2PC1A 3GY9A 4A30A 1RTDB 4F8RA 1GAOA 5HBMA 2CXAA 1XEBA 3V2UC 2DHHA 5J2NA 5F09A 3H4QA 3EVOA 5JH9A 2NXNA 2X1GA 2MQMA 1BXNA 3K5PA 1FE0A 3IM8A 1UFWA 1DZ5A 2WCXA 2CQ0A 1JQGA 4LF8F 5EX0A 5DDPC 1RZMA 4X4SA 1NKCA 1HWIA 3C8YA 3FBFA 2ACYA 3GQCA 2O53A 4OI6A 2D1CA 4G65A 1SV5A 4C97A 2L9WA 3L7UA 4PXDA 1MWZA 4MFQA 3DI6B 2JH3A 2CNMA 1P9YA 2ASJA 2CF4A 4OJGA 2PJ6A 4UOHA 2PGCA 4OI2A 1KDNA 1N33F 3EXCX 4IYQA 2R8HA 1XQIA 1HKAA 2XGQA 2VXKA 2YVSA 3T90A 2EBGA 1BMQB 3FX6A 3WHIA 2BW2A 3JSYA 1M4LA 3KXDA 1JK9B 3JYTB 1ELLP 2K3KA 5A0YA 4ZCLA 4XPKA 3CMAS 5G22A 4FKYA 4OX6A 5HH1A 2ROPA 3MUTP 2BXJA 4OHWA 2XQCA 4KFBB 2ZH2A 5H9EK 4NLUA 2D69A 1Y5LB 3IWEA 4GVLA 2O01C 5EX3A 2Y3YA 1UPPA 1DTTA 5K8OA 1W25A 3BH6B 1TF9A 3N9UC 3MPWA 1FESA 1OYEA 3KLVA 3HHKA 3G6VA 4NGNA 1LWFB 4OYAA 1F9FA 2MSTA 5D0HA 4RJVA 2F3JA 3FSYA 1LANA 3OFHA 4QIFA 4ZLLA 1Z4EA 1SQHA 3C6UA 2GGPA 3VGVA 3FJ2A 2FZGB 1X4AA 1HQEA 2RT3A 1R43A 2D3ZA 3FQLA 3A8KA 2KXFA 3M6UA 2H5MA 2J0SD 2VG6A 1B0PA 1DLOA 4JI5F 3PEIA 4USUA 5JMNA 4LSNA 2HHHJ 3KKWA 3UE2A 2YWFA 4K4UA 2CZVC 1VGYA 4PG6A 4ZOSA 3LPYA 4X65J 5EC4A 1W2IA 1I21A 1UVMA 4PSXA 3IN5A 4K50A 1YRXA 2VBZA 2IMWP 5D29A 5KFVA 1C2PA 1S57A 3OJSA 1DURA 4WIIA 4A32A 4O4GA 1S7LA 4GMKA 4IFVA 2YNIA 2ABYA 4I6WA 3AOAA 4NLXA 4DEZA 3PVXA 3N0VA 1F3FA 3GV7B 5IM0A 4Y28C 2PJ3A 4HDGA 4WTOB 1X4BA 2GIRA 5LMUJ 1VC0A 3OSPA 2C42A 4E0DA 4FYXB 3PXGa 2BE2B 2W9CA 2ZW5A 4LBHA 2ZH3A 1VRUA 5LXRA 1KR4A 2IM0A 3NCQA 3OXLA 1FNXH 4EGLA 4F3MA 4PG8A 3M8WA 4F50A 4DU7A 1KTVA 3Q8RB 1R0CB 1TAQA 4Q43A 2XS7A 3DYAB 2OOTA 1U8WA 5KFRA 1UVLA 2Z2LA 1UVJA 4IAVA 4OX9F 2HWTA 3Q22A 2F4VF 4DV0J 3G8WA 3KK2B 2Q43A 4ZJLA 4KV8B 3CTRA 4TLRA 5CYMA 3TZWA 2GV1A 1KQFB 2P9EA 4QC6A 1U1RA 3DOMA 3K9TA 3D1HA 1AW0A 5HBMB 2OMLA 2KRRA 3D28A 4PXCA 3MM7A 2CJBA 2R8IA 1VDHA 3HCXA 4KHMA 4AUKA 1AUGA 1IBMF 5HN0A 2HNZA 5EDWA 2UUWA 5KG4A 4CIOA 1XOVA 5IV3A 2CDQA 1GMVA 1T9VA 3DLJA 1K1SA 4J9KA 2C2ZB 3OL7A 1B70B 3H8EA 2LQJA 3W5YA 1CSJA 1U0SA 3D67A 5HLFA 1OQ3A 4FP9A 4NYPA 4Q2LA 3J80U 2FZKB 2MMYA 2QN6B 5D4NA 3M8SA 2FDNA 2PJ2A 4UZCA 3R5DA 2GFFA 5EMIA 4JI3J 1ZZNA 3PR4A 3DDIA 4MFKA 3D4JA 4EYHB 3C16A 2AJ4A 4USMA 2P9CA 2FJAB 2PI5A 1IR0A 1SXLA 3EMTA 2FB0A 2KH9A 1H72C 1Q1KA 1REVB 1VQOS 1SC3B 1S1XB 4ZPVR 1X5TA 2CJKA 1JNRB 3MCOA 3OVAA 3S7RA 3C6UB 4DX5A 1IKYB 4UFVA 2XEIA 4RL1A 4W90B 4F6AA 2XEGA 3MWBA 2E9ZA 5F41A 1CULB 3B4DA 1EARA 5DZ6A 1TL1A 4FDFA 4KS9A 3UD4P 4CH1A 4OIWA 2E29A 2LYVA 2KCWA 3S01A 4DX7A 2WOMA 2EG2A 2H54B 1HHQA 1UP1A 5LMNJ 3NP5A 1C1BB 4J91A 5J2PA 1HNIB 1RHKB 4UW2A 3AA8A 5KG2A 3QRPA 1VBKA 2RS8A 2LEBA 2GANA 2NSMA 5KFLA 5EUHA 4GKJF 3ZZRA 3K2KA 3UN5A 2KHCA 4NASA 3I5AA 3CCMS 1WD6A 2QA4S 1TKTA 1VBYA 4M5KA 1NCLA 4Y6IA 5GVQA 3H5UA 2PDAA 4KR0B 3TVKA 1RISA 2J9DE 2KYXA 2H9ZA 1U26A 2JLMA 3H5XA 2VV5A 2OU2A 5AG4A 1MN9A 1YVFA 2N3OA 2RD5C 4AQYF 3VAHA 4F0YA 5IWAJ 5B7WA 4A38A 2R4FA 3BO4A 4OI3A 2JJ4D 5KTAA 2AU0A 5F9NA 2NYQA 2XBPA 2GZOA 1PJ7A 1U2FA 4DBQA 2O1PA 3D7FA 3HFKA 2QVPA 1SJFA 3IRXB 3P96A 2ADCA 2XLJA 2PRQA 3B4MA 1QSNA 1NJXA 4E2AA 4DR3F 1M4GA 2HBQB 2NPIA 4NGTA 3NS7B 4E8UA 4BD9A 2BJ3A 3HT3A 5HQ8A 4DR7J 4FWUA 3T1HJ 3JXOA 4M3SA 4Y49C 2G2YA 4DSLA 3PTWA 2CUYA 3FUYA 1WC6A 4X2TA 5BXIA 4DPUA 3HP6A 4ES2A 4N77A 1JKHA 4CPAA 2HQYA 4XDCA 1ZAWA 4UY8T 1TK0A 1RKIA 5K14A 3GFHA 4UFWA 4NEYA 5CCMA 3QAYA 3B3SA 3GUXA 2AYMA 4U7UK 3PP9A 2A2DA 2JFDA 4AG7A 4KSFA 5IV0A 3TFYA 2KB2A 3RU0A 3OUYB 3TANA 1URNA 2HVDA 3SI8A 2C3PA 1Q8IA 3I9SA 3D6TB 3TEGA 1D9DA 2CADA 1S1UA 1Q2YA 4MFLA 2FLPA 1O6XA 4DI6A 4PEOA 3TI0A 1S0OA 5LMUF 1WOOA 4FYYB 1M4IA 1JJCB 1N5YA 4FNIA 4ER8A 4PG4A 2BE7D 2B6AA 3H5SA 4NXNF 2XZWA 3LPEA 2B3TB 2G3AA 3JS9A 3M8PA 4OFZA 2MB0B 1ZAXA 4LFCJ 3N6LA 2G3TA 2QE5A 5AG7A 4GM5A 2JWNA 2IVYA 2PIYA 2HKEA 4HACA 5CYQA 3M1VA 3RAMA 3D7HA 1F5CA 4ZP8A 3D2WA 4C0HA 5H86A 4DSEA 5KT4A 3SSQA 4MIAA 1F0XA 3VAJA 1AB8A 3WQPA 2F9JA 4TQSA 3C14A 5E0OA 4CLYA 3AHPA 3J81Y 2QLJB 2ZVSA 3U7JA 3J81U 4ZPAA 3NMRA 1NNDA 3KG0A 4BLGA 1BPMA 4B3TJ 3PCOB 2VODA 2C2KB 2AKWB 2QZ8A 2ZEMA 2D41A 5HVHA 1EP4A 4WP9A 5M2RA 3F0AA 1JXLA 2A10A 2AMCB 3CMES 2JSXA 5EN1A 1U6ZA 1FKOB 2HBZB 1HL6A 3M32B 5L1JA 1R0AB 5T14A 3FMBA 2GAGC 2Y0MA 1IB1E 1M4DA 1JIHA 5D6GA 1MMDA 2LECA 4G1PA 2IAJA 1IKWA 3ZTQA 3UDCA 3DKDA 2Y1JA 2GJFA 4YDDB 4C3LA 2EFNA 3BGUA 4HVZA 1Q95G 2FVCA 1HQUA 3VH9A 3PHEA 4HPSA 3DLBA 4I2QA 2QRRA 2XNQA 4EFAC 4AYBD 4R5PB 1CP6A 2B43A 1SI9A 3HKZD 3HHLD 1GXUA 1ZM9A 4DPYA 2CNTA 2ROEA 2VBYA 5IT4A 3T9ZA 4X4PA 2MQQA 3H8FA 3T8WA 3IWLA 4OV6A 3ZZPA 1HWLA 1XR5A 4TVAB 3ZC4A 2QJ8A 3KYLA 4JV5J 3PZPA 3AJ1A 2IPOB 1D09B 1UWAA 1NB7A 1QM9A 5IXUA 1SJ3P 2O5DA 1GEHA 1OS5A 2A6MA 4J9NA 2Z8QA 3VATA 1J5OB 5CQGA 4KUBA 4JI2F 3AOCA 4JI8J 2PCUA 3IM9A 4CCHA 4G1IA 1H0HB 4A95A 1RB0A 1FRLA 1KTQA 5KOWA 1QDUB 3HHLC 3BXMA 3T9NA 2OPRB 2BM1A 3F5BA 4W4MA 5T7LB 3OSNA 1DTTB 4YGOA 1ZLIA 2HMIA 2VONA 3KL9A 4USKA 3R9GA 4U6PA 2CQGA 1V0CA 2QO3A 3D7GA 2XO6A 2Y0BB 4KFBA 5A28A 3CD7A 4M6IA 2BJDA 3OTBA 1S0NA 1P1TA 2OSQA 4TYBA 2XHCA 5HLFB 4MMOA 3M8YA 1NB2A 3P49B 2B7BB 3PNIA 4KPCA 3O44A 1GNKA 1TMMA 3QFHA 5CYQB 3MM7B 1XIQA 5JXSA 1VOMA 3R96A 4UZBA 4KUAA 4NEXA 3EC4A 2F4FA 4XNHB 3A3NB 4B9NA 1HWKA 3TOAA 2EWBA 2UXDJ 4UQGA 2IJNA 2BANA 1X5PA 2EFGA 2AFUA 3VGTA 2XSFA 3OL8A 1HBNB 3NG8A 2HHSA 4C9DA 4OJ3A 3L09A 1DAXA 4KHPJ 4HNWB 4CDIA 4DS4A 3M9NB 5CYJA 3KHXA 2BVZA 2W7PA 2V34A 2RE1A 5KFHA 2DHXA 1SCJB 4PYAA 4RO0A 1ZS6A 3RGIA 1RUSA 1P8GA 1DQ9A 2J6UA 3CJ0A 3FH4A 1I51B 2VUGA 4DLEA 1YLOA 3AD9C 4YFUA 1HNXF 4F25A 1IBMJ 2F9DA 3TOBA 1RT3A 2IL4A 1B6BA 1FKAF 1KC8T 3V6JA 1G3OA 4KVXA 1VRUB 4NCZA 4EZ9A 3VGSA 1H7XA 1IYKA 3IA0A 3B3VA 3QWPA 2W2MP 2HHPA 1MN7A 3PY8A 4LMZA 1UWBA 3DRSA 3OR1A 2E5IA 3MPVA 4ECZA 4JI5J 2Z30B 3R27A 1U8SA 2CG8A 2BUNA 2NPFA 4LSLB 2OTJS 4WFXA 1Q7LA 5HJXA 2B5JA 1KRPA 5MAOA 2VG7B 1SVDA 3FEZA 4DPOA 4FVMA 4L3KA 3CB4A 4MCPA 3OLBA 2IC3A 3I4PA 4AFFA 3KMQA 1YG0A 1FNMA 3N28A 5D4PA 4R6TA 2LMIA 1WKKA 4ECVA 2VPYB 2ALZA 4Y2IA 2FCKA 1AT1B 4LX9A 4TY9A 2I9SA 4MFBA 2ARHA 3H2UB 3K7RA 2QTWA 1U6FA 5LMNF 1QUVA 2X7IA 3CCVS 3L4BC 1IXKA 3H4BA 1NDCA 4I4BA 2MKIA 3KK1A 3BSOA 3LODA 2R3VA 4JUZA 4ED1A 2I38A 5DJBA 1CS4A 3TNVA 3QIPA 2KT2A 1PYSB 4IOCQ 2HFSA 2DKOB 3RBDA 1FDAA 4O3SA 5D8HB 2C3OA 3BKFA 3I56S 3C14B 4QOTA 4I49A 4MFBB 2H65B 1N5VA 4LF5J 2PMHA 3QJPA 1S76D 1O5JA 3K59A 5HMYA 3GTYX 2XY7A 3NWRA 1S49A 1RTQA 2CY2A 1FCAA 2FVPA 4QVTA 2LFVA 4F04B 2J8MA 2FIUA 4JV5F 3N5BA 2C6PA 1PKUA 1IJEB 2FLOA 4F3OA 4ZP7A 2HFNA 4CP5A 3VV2B 1QAIA 3GB0A 3RAQA 4I1TA 4C0BA 1C1CB 3EZUA 4F0HA 4LSLA 2MDAA 2I0XA 2LA6A 4BS2A 4ECUA 5AE3A 4B9UA 1NBEB 3EO4A 4YP3A 4OL8A 4DV2J 3D3CJ 1TVRB 3KLGB 3MPDA 4DR4F 4OYXA 1F2OA 2IJFA 3D3BJ 4RNOA 3N5FA 2UXCF 3OD2A 2IBKA 2QV6A 2C2DA 2ZBPA 1J2VA 2KYZA 3KUEA 5A0YB 4DV7F 3Q8SB 1EZZB 4J9QA 3LQVA 3OR1B 2HRTA 5KTDA 1EQMA 3DGVA 1S5ZA 5D77A 4DR6J 1ZH5A 3CULA 3N6NA 4ELVA 4ZLJA 3PG9A 3HHDA 2DGSA 2DRAA 1RHJB 2RIJA 4UEFA 3FIXA 1Q7LB 1WHVA 3B3TA 3AXKA 3LAMA 1NSPA 2BO9A 3TA0A 4G6VB 4DR1F 1UAWA 1UZHA 2EXUA 2FZCB 2IMOA 3DRSB 3E0KA 2K8GA 2Q1LA 3D2PA 1GYTA 1QVGR 2DH9A 4QYRA 4X4OA 3V6KA 4Q0BB 4PWDA 3CJSA 4C8ZA 1XNRJ 4OC3A 4FXVA 3EICA 5HP1A 3WIUA 1TQLA 3EGNA 4HACB 2BYCA 1FK9B 1YX0A 4QQBA 3T1HF 4DJLA 4MCRA 3BR8A 2XS5A 5L1KA 1KLMB 1REGX 4CT9A 2V8VA 4A33A 3CDEA 3W5XA 4RI1A 5IC4B 4AL5A 1X60A 1T9XA 1S0MA 1N0VC 5H9FK 2HMIB 3M2RB 2LA4A 2Z0ZA 1UL3A 4RBTA 2VU5A 4QB9A 4KOWA 1VQ5S 1KS2A 1UZDA 4UOCA 2MZSA 4B9LA 2KVQE 3HO1A 3PIPQ 1TP7A 2UUBF 1WDTA 3H5ZA 1SQGA 4KSIA 4MK8A 5F8LA 4OZJA 4X4NA 1CJWA 1FHTA 2VF3A 2F1FA 4EVYA 3W2VA 2VB6A 1IKXA 3PACA 4JV2A 1S6QB 5IC6B 2G2ZA 1F2HA 2JLEA 5K20B 1NK8A 2FUG9 4DUYF 3MM9A 1UEUA 3R95A 2RUSA 3EYZA 1XMQJ 4F8ZA 2BL1A 1Z8LA 4X65F 5GAEU 2PVVA 3I5BA 4C8YA 3H40A 4TWEA 1VFJA 4EBEA 1KUYA 3DR6A 2O67A 3LH2S 3AB2B 2DNOA 3L9ZA 3EGVA 4LJMA 4Q2MA 4R0EA 1FWKA 4U7UD 2DCLA 2ZE2A 3RBEA 2P2CB 3CXSA 1ROFA 5IOLA 3FRMA 2PEHA 1D9AA 4HI2A 1S1VB 1IKWB 7FDRA 4QPXA 2B3UA 1S7FA 2DIVA 1OYDA 2HNYB 2YX1A 3IG1A 2YH1A 3KWMA 1WJ9A 1HQUB 1Y5IB 3W61A 5EWEA 4P52A 2ZEOA 3ZZ0A 4DL7A 2ZH8A 4Q7AA 4C7HA 2DBBA 5LYLA 1SL0A 2FD2A 1AZSB 4X2BA 4C8KA 3CDWA 4DV5J 2FE7A 3QLHA 1NSKL 1CJKB 3W60A 5K8MA 4BHQA 4MK9A 2D7SA 4KRWA 5I42B 3VAFA 1QTNB 1KD1T 4UWIA 2B58A 4OYIA 1IOIA 2M4MA 3VR1A 1KWMA 1RLDA 4C11B 2ABZA 5DDOC 4C8OA 2B4DA 4IK2A 1Y9WA 2ZDPA 4PYDA 3MF5A 2HBRB 3BGLA 5HVFA 2L48A 2AT1B 3MXHP 1CJUB 1LW0A 2UUBJ 4P6YA 2WSEC 2DEIA 1PCAA 4WFYA 2HS0A 1CVJA 2RH3A 2HHVA 1HQEB 1UFHA 3UD5A 2HVIA 2D3UA 4KH1B 2R7HA 3OFEA 2I79A 1VS3A 2YPZA 4KSEB 5GADU 3WX8A 3PRDA 2H5IB 2QSFA 4B3OA 1REVA 2HNZB 1R8PA 4MXUA 3M6XA 5G1ZA 2WSAA 1MLAA 1Q86T 2FGCA 1GQEA 4K2JA 3G87A 3DGPB 5LYDA 4NCBA 1N48A 2HS3A 1U6BA 4P4IA 3L7PA 2UUAF 2EK8A 3QAEA 3KK3A 1N6QA 1PU9A 2ZKTA 2IVFB 4K30A 4P9SA 4NLTA 1ZO0A 4PABA 4ECXA 4EBCA 2DYAA 3ZO7A 1AUDA 4QIWD 1YRUA 1KUVA 2FTRA 2Z2YB 1NK9A 3MN8A 2OJ3A 1NEEA 2UU9F 2NZ4A 2B0GA 1N0UA 3TWZA 1VQSA 3RNZA 4B14A 4OX8A 3FXTA 4G3IA 2YKOA 2GMHA 1ZG8A 1NMTA 3ZZUA 2FVSA 2GFQA 4NMLA 1WK4A 3LO3A 4ECSA 2KT5A 3KKFA 1FVQA 3OPKA 2DGWA 3RB6A 3SFUA 4C0OC 2XSJB 3H98A 4I68A 2K1RB 5DM6Q 3MEDB 3T5JA 1QQ9A 1KOOA 3LP0A 5KT6A 4Z2XA 4HR2A 2RRBA 1S12A 1WWZA 2OD4A 3CXPA 1VCTA 3OTEA 4FYWB 3UW1A 4WFBQ 2AJQA 4NOHA 1ELOA 3OFGA 4KC5A 2UUAJ 4U96A 4USHA 2GIVA 3DLKA 4DN0A 3TJ9A 1YREA 5K14B 3VF0B 3S8SA 3LP2A 1FWLA 2MJUA 2GLFA 3LD2A 1ITPA 2ZVIA 3CCRS 4DCOB 3MMBB 2AFOA 1EAYC 1XN9A 2DJWA 3CCES 5J8FA 3S9LA 1WC1A 2GC8A 1QUPA 3CMQA 1N54B 4IG0A 3IFEA 3JSBA 1ZM3A 1MW7A 2ZZTA 3V6DB 2LXUA 2VBWA 1Z8XA 4MRIA 2LQ5A 4XPDB 2VFTA 7FD1A 2BJ8A 3HSGA 5LRKA 4GS4A 2Z3PA 1TL3B 2ASLA 5LRGA 3EXNA 2C2NA 1DHMA 4Q44A 2LXFA 2F8EX 3FSIA 3BPDA 5F8IA 4H4OB 5L1LA 2BJ9A 2V8DA 2WOMB 5AGEA 1ARLA 1IR1A 1S1XA 2GCFA 3UCGA 2IQ6A 1SIZA 4CLLA 4NLPA 2R7QA 4TY8B 4X4UA 2DITA 3H59A 5E96A 1BD6A 1U0HB 1Q4RA 1BQMB 2AWZA 3EXYA 5A8WB 4P4DA 4JXRA 2ZHAA 6FDRA 5M2PA 4DV1F 1R6YA 1Q8KA 2F5IA 2ZUAA 2HYIB 2KZZA 3TW0A 2VC1A 5KFMA 1W26A 3PFOA 2VG7A 3E2EA 4LR7A 2CPXA 3CJRA 2W4DA 2DO0A 2FHMA 2UUTA 2PMZD 2ZBQA 1IU8A 2V8GA 1HNIA 3G8TA 2A0FB 1HBMA 2XWYA 4CAFA 1YJUA 3CD6S 2DB1A 2EKYA 4FS1A 4M6GA 1YW6A 4DR2J 1SC4B 3R9EA 1LAMA 3RG6A 1FRJA 1FDBA 5CCLA 2VC0A 2DPTA 1KP6A 4MHNA 3P2FA 2MQ8A 2GHPA 3CJ3A 2B6AB 3B3CA 4TKTA 3NGRA 1JLCB 2BJEA 2BRLA 1YJVA 2FIWA 1WI6A 3NGUA 3EUNA 1TFYA 1S77D 2ZNYA 1M5OC 4NA1A 3GILA 3BDEA 4KTQA 3PRBA 4JBCA 4HKQA 1TUGB 4R0JA 4ANCA 3F0NA 2R98A 1G6BA 3AT1B 4MKVA 4PRFA 4K4ZA 4IFYB 3M05A 1I94J 4XAKA 3D0HE 3FCHA 1B4SA 4JP8A 1Z5RA 1RAOA 4OYZA 3NMAA 1B7FA 1RAHB 1TL7A 1ZA1B 3PHTA 3ZTPA 3LA0A 2CRLA 4XPLA 2BM0A 4KPYA 4CO1A 3OHAA 4NGMA 1HBNA 4DR5F 3KR4A 4JI6F 3O1LA 4Q8FA 2I2YA 5AG6A 1Y7PA 3V4MA 4RW8A 1MK4A 1XRYA 2G0JA 1VHOA 4RKUC 3G82A 3W62A 2PJ5A 3MUVP 4D3GA 4ECYA 1U02A 3CIZA 4AVBA 2DRBA 5AXMA 4NCGB 1EE3P 1P1LA 3PYEA 4N7TA 1QLNA 1G1XA 1RHUB 4USWA 3EGWB 2XLIA 3TC8A 2DR5A 3QGGA 1IQTA 1OSCA 5HP1B 2ILZA 3X3UA 1RGVA 4KLWA 3LWUA 4P75A 4OX9J 3GMGA 4YEAA 1XF8A 5KG3A 2KKHA 2BE2A 4CQ1A 5IV4A 3NCRA 1TKHA 2QEXS 4FPIA 4DR2F 3H7HB 4YY3J 2P6EA 2J9EA 2HGLA 4RUCA 3RW7A 4AD6A 2JBKA 3EVMA 4ZJOA 3MEGB 2E7WA 4B3MJ 2PE8A 2FSRA 1FF2A 5JVGQ 4IFVB 1JLGB 4C7QA 3HM9A 1VQ8S 2D9PA 1FXRA 4N76A 3BLNA 1HDQA 3O6QA 4LRDA 1IGBA 1QSSA 3BJ8A 4CO0A 5IM0B 4OHVA 5LT5A 4MY0A 2CJYB 2A1BA 2LCWA 1NDLA 2XNRA 3K8WA 2ZEEA 2CQPA 1XNQJ 3VGUA 2QMUB 3UR3C 4J3GA 3MEEA 1FERA 1R57A 3PW7A 4PPDA 1V5IB 3SSRA 4B17A 1ZETA 4LF7F 4I6YA 4J9LA 2K3IA 4LRBA 2Y1LB 3KTQA 3VAGA 5DZ7A 1XMQF 3CO9A 5FLXU 2V4JB 2R9LA 1NDPA 4WP8A 1LNQA 3AJDA 1P27B 4JV1A 3IP0A 5HAOA 1VQ4S 4NCGA 3IGVA 2REEA 1XTZA 3IAS9 1A6LA 2NYHA 2G0CA 4UCPA 1HYSA 2L41A 2IRUA 3LF0A 3BO3A 1UVIA 5DG9A 4EMEA 5C42B 3KHLA 3CCTA 2FPHX 4F02A 4ZX8A 4CH0S 2PQ8A 1VK8A 4OYOA 4X62J 1L3TA 1WELA 2C28A 3J7AN 1RWXB 1IKVB 3I82A 3MFIA 1R3NA 4A8FA 3W6SA 4M95A 4QW9A 3PX4A 1SJ1A 2M52A 4C3MA 2CQ4A 4RNFA 1IBLJ 4RW6A 3TUPA 3CO0P 1QAYA 2HK3A 1HPZA 4I7FA 5KFYA 2C1EB 1M44A 1TL4A 1N34J 3VWEA 2QG9B 3HZGA 1HR0F 2J0XA 3SJEA 2IBOA 1QAJA 1F5BA 4A8KA 2ZEPA 4H89A 3SV4A 4A8YA 3SYZA 2KZMA 4ZVOB 5J1NA 2CJAA 1S1UB 3BSNA 4LF9F 2PO4A 5KFIA 1PGZA 2YPYA 1IUJA 4ZIVA 2R7RA 1ZAVA 1P9QC 5K9FA 3C6TA 2YWKA 4WYLA 3CDBA 1Y0RA 4ERDA 4DQIA 2DT9A 4NZ7A 1JLGA 4RW9A 3FEDA 1D3WA 2WVEA 1WF1A 1AUSL 4F26A 8ATCB 4DR1J 2IA6A 4IQMA 2E44A 5LJ5Y 1HHSA 2DPIA 1FKPB 3BQ1A 1JKHB 2H1YA 1SUQB 1WF2A 3D0IE 2H4YB 3FEYB 2J0WA 4PWUA 5F8HA 3NRBA 1RYSA 2Q66A 2OPQA 3JQMA 2AFMA 3FF3A 4CO2A 4CT8A 4YUDA 2B4VA 4JI4F 5DLFA 4ELTA 2JLGA 3CPAA 2IYGA 2RS2A 3PBBA 3WDOA 2BEFA 3R5CA 2R2TA 3BH7B 1O0PA 3ENVA 2QA4G 4NJQA 4OC2A 2C27A 4DZDA 1K0VA 4PG7A 4KV8A 2KM8B 5KTCA 2HSEB 2CQCA 5M2UA 2YNEA 4DSFA 6CPAA 2HLUA 3T1AA 4YFJA 2IRXA 2R7TA 3I5CA 3RBUA 3CDAA 4IR9A 4OZ5A 4Q0BA 2AW0A 3NXZA 4PQUB 1P0HA 3NS5A 3T5LA 1K9MT 1WNEA 2L9DA 1NJYA 4A8XA 4CYUB 1T0TV 4RWWA 1JMTA 1NRKA 1N34F 4ELUA 1NKBA 2Z3KA 1APSA 1RWMB 1N5SA 1RXTA 4EO8A 2J8SA 4ZVTB 5DWMA 4RW9B 1LEOA 3KQZA 4ZVSB 5DGBA 4DV6F 3HUVA 3KR5A 4DV5F 1U25A 3GFYA 3MAAB 3KLEA 3DRPB 1B99A 1M1DA 4ZLNA 4PK3A 2W9BB 2YNGB 1KLNA 4D3HA 2HEKA 3FBCA 1B0TA 3US5A 3TUJC 4W92B 1VLOA 4NMXA 2P8IA 4PQAA 3POTA 1K8AT 2B9YA 1O51A 1ZG7A 2XY5A 2GVZB 3V81B 4ZVGA 3WC0A 1TL1B 4CLFA 1CBXA 3BR9A 1CS4B 2HBYB 3DCAA 3BQ0A 2D9OA 1SJ4P 2PJ8A 1T8EA 5KFXA 4Y2MA 3K5NA 2AYEA 4JWPA 3KLFB 2IJZA 4QIGA 1EJ7L 3NGDA 3GSDA 2XMMA 2ERRA 3BJ7A 1FRHA 3V6DA 1YJNS 3ZZZA 3QZ8A 5E3AA 2Y9HA 3D6HB 1BQMA 2HNYA 4ES3A 4UIAA 3F8KA 3V5RA 2YX7A 3DRYA 1NAQA 1Z8WA 2AEMA 1M1KT 2DR8A 4OYWA 5ETLA 2GGPB 2VFUA 2FC9A 2E1PA 5KTQA 1SKSA 2GHVC 1LAPA 4H4KA 4RX6A 4YHHJ 4YR0A 2VA2A 5BR8F 2GX8A 1AFIA 1CJTA 4HHHA 1C4CA 3RRHA 1WC0A 3RRGA 4DU8A 4DFJA 1VKCA 1FRXA 3KJNB 2MQOA 1SQFA 4NLQA 4YU9A 3EX7B 1Q82T 1G4CA 2R7VA 1BPNA 4IH5A 4RR5A 1KVJA 3M1VB 4RUHA 2RU3A 1RT2B 2DNYA 2KXNB 3Q0AA 4HHUA 4J5OA 3DLKB 3HLPA 3D5MA 2WVCA 3TAMB 1H6KX 3TA2A 1KONA 3HVTB 1H2VZ 2DGQA 1UVKA 2RDDA 2QYVA 3ULHA 3R3TA 3NKYA 4KGKA 5JUMA 1E6VA 4DL2A 3S1TA 3P6YC 4ZY2A 1U1NA 4NWBA 4EFDA 1YJTA 1L3VA 1UJ5A 4AE5A 2Y1RI 5B0GA 5DQHA 1KQSR 2EW9A 3DYAA 3PO5A 2REFA 5F0WA 4ZVHA 1IWAA 3IEHA 1HW8A 3M8ZA 3TYTA 1B3TA 3BYRA 2L9NA 2VBQA 5G21A 4KYZA 4IHMA 1PILA 1S3ZA 1CJVA 1WEYA 5CD4A 3R6LB 1RT3B 1UKUA 3TAMA 1JXEA 1T95A 4AL7A 2VL1A 1GHEA 1NJZA 3MTJA 2OZGA 4UCMA 4LR9A 5AXNA 5LOQA 3D0GE 2VOPA 5EWFA 2MGZB 4F0XA 2MKSA 3GJSB 3LP0B 1G2EA 4OC4A 2KO1A 4ZHRA 2J7KA 1NZ8A 1H7WA 1MSWD 4DR6F 4ZN3A 2CQDA 1Z4RA 1U7LA 2OPPB 3OUYA 2ODFA 3IXQA 4PWDB 4X4VA 3AODA 5F47A 4O3PA 2FLNA 4ZGYB 5J2QB 4QJVA 4NI2B 4XPCA 3M8PB 5CHCB 3M2VA 1TVRA 3CJKB 4ED7A 4ILLA 3SI2A 2E5HA 1TK8A 3ZFVA 3UWTA 2YWWA 3A3PB 2AEFA 2U1AA 1RT7B 2HZAA 4I6AA 1L3SA 2F63A 3KNAA 1YITS 2E7XA 2J7UA 1EHWA 2PJCA 4M1KA 3LWLA 3QATA 2VH7A 1RHMB 3SQOP 3HLUA 2R7UA 3CCUS 4DL5A 3GYAA 4IUSA 4ENOA 5C24B 4DV3F 2LEPA 4QWCA 4NRUA 3FJUA 4DN9A 2AX1A 4OHZA 1KNZA 1LFWA 4KGMA 3IIBA 2Y1IA 2LU1A 5AXKA 1FO1A 3AY0A 3KG4A 2IM1A 2FYXA 3UO0A 2HC9A 2DEAA 1S5KA 1M5VC 4EI2A 1LK5A 5D3GA 2DF5A 1OZPA 2IFXA 1S48A 2HUZA 2JBJA 4KLVA 3TO6A 4X64J 2O66A 1GTHA 4EWTA 4OZ3A 1F60B 3LGNA 2AF6A 3HF5A 3MGDA 3G6YA 3RRKA 4TNOA 4O3NA 1QJHA 2HVEA 4BC7A 4FD7A 1VQNS 3CWJA 2YKPA 4WK3A 5E2QA 4FYVB 4N8OA 1Q8LA 2ZOFA 4WP3A 1RWWB 2HG4A 2HFUA 1S6QA 3DN9A 3OTOJ 3CD5A 2GVDA 4MHYA 2DNLA 4P2XA 3CD0A 3RR7A 2CYYA 3VAMA 4L74A 5C88A 5DDQC 1WEZA 1Y9KA 5BYRA 3NFZA 2P0WA 4Y2AA 4IUFA 3CXQA 1Y00A 2X3DA 3KASA 4TY8A 4Y2CA 3PB7X 4X84A 2CZ9A 1DTQB 4NLYA 2XWXA 1WHXA 4F4ZA 5G0RA 4U9RA 2KXHA 3THPA 3CPWR 4NJRA 4AG9A 2BE9B 5KT2A 1LCPA 1YMEA 3B54A 4PSWA 3GJTB 2CKWA 1NMEB 2FVGA 1GMWA 2FHJA 3IU1A 3DOLA 2ZJQQ 3FVYA 4N56A 2KRBA 3QGIA 5B08A 5ETNA 4P74A 1TKFA 1RADB 1CPXA 5L46A 1T3NA 3DHWC 1FK9A 2IRYA 1CLFA 3L95X 4OAEA 5IS2A 3B2YA 1UA0A 2XMVA 1J4JA 2K06A 3PW4A 4ALZA 4PAAA 4IR1A 2UXBJ 5DGAA 3BKTA 3DMJA 7CPAA 3P5BP 1RTDA 2JEJA 1RAJA 2QLWA 3BPSP 3OR2A 4WFNQ 4P44A 4QZVB 4DL0C 1SV5B 5CH7B 2E5LF 1KLMA 4OMFG 2VFRA 1QSRA 3OVSA 4YWYA 2OPPA 3TZZA 3QPIA 4CGOA 4K0KF 3IS9B 4X8IA 3L7OA 2EUIA 3MAAA 3I0SB 3UCUP 4Y34A 1I94F 1Y5NB 1JWQA 1YLEA 3QMQA 1PUAA 4OI0A 3NE7A 3SEOA 4LF9J 1RBLA 1T11A 2L08A 2B9EA 1TU0B 3ICLA 1Z9UA 2FVRA 2V9WA 5AE2A 3VWDA 4LUAA 2W9CB 2F7VA 1U2RA 2QIFA 2B8PA 3NWGA 1EKSA 4OLPA 5B0BA 3M9OB 1LFPA 1N71A 2MKCA 3MCMA 2JL9A 3FBBA 4K7QA 2YWHA 3C2PA 1N8RT 2FGOA 3GZ7A 5CNPA 3G2XA 1NLKL 4NLRA 4E98A 3Q8UA 3OTOF 2PA3A 2W1BA 3PBEA 4NLGA 4RU9A 3MR6A 1D0EA 1KUXA 2RC4A 1G7CB 1RWKB 2FVQA 4ANDA 2PI4A 1FTRA 2B4OA 5LL6d 1V3RA 4I67A 4RW6B 1IBLF 4WWVA 4NFRA 1B87A 2GREA 3VAKA 4F7VA 4O4RA 2I5JB 1ICEB 1A0OB 2DNRA 4URGA 2W8KA 2FXFA 1C0UA 4WWSA 2Z0GA 4KGXB 4O4GB 2QIRA 2BCOA 1X8DA 5F8NA 2BW7A 2XG8A 3D1OA 2DXQA 2LQ9A 5KT7A 3MD3A 4DOZA 1PYTB 1WORA 4N5SA 5BWAB 1F9HA 4JJXA 2ZBCA 2HK2A 3RYLA 5HL7Q 2VQFF 4F2RA 2VDHA 3R7NB 4C4WA 1BQNA 1KQGB 3V8IA 3OT9A 2WAQD 5B0CA 3ISNC 1MU2B 4JYAJ 5DETA 4WZQA 3PW0A 1ULRA 3K17A 3QSIA 3W7BA 1DQAA 4LREA 3CE8A 4FNHA 4QPTA 2PDOA 2PN6A 4EYIB 2AP6A 2ZOMA 2YKMB 4Z65A 2JVRA 3G96A 1FWPA 2UV8A 3KLGA 4N47A 4A48A 1S4EA 4LRAA 4NSQA 1BQNB 3RBZA 2ILYA 1K47A 4F0KA 4HNXB 3VZHA 3KJQB 2OHDA 5GMKa 4A37A 3DRRA 4F67A 3W9IA 2FQQB 4FD4A 4MI4A 4ZDNA 2XGPA 1ZPVA 1N36J 1ZPWX 2UUCJ 2RHQB 1Q7YT 3OFFA 2ZKUA 3KFWX 1YJRA 2DGTA 1K44A 4FZVA 5IQ6A 3BJYA 1F5AA 5FD1A 1SQEA 2CPHA 2PFFB 2DHSA 1VIOA 2HQDA 1FEEA 3JQKA 2XMJA 1HNZF 2F8HA 1BWVA 3BN4A 2I5JA 1ZOTA 5J8CA 3CSKA 2OSRA 4UF4A 2DNZA 2V8HA 1NPPA 2XY6A 2N4DA 2AV5A 1AROP 4ILMA 2A18A 2X51A 4C2YA 2OLWA 3F73A 4NZ6A 1JLFA 4YR3A 2VBXA 2RF2B 2DNPA 1DQ8A 5C25A 1RI7A 1QMUA 4L72B 2CPJA 2DNNA 4ZHRB 4ZY0A 2EO8A 1IVZA 3W9HA 4HYKA 2RVJA 1TL5A 3C15B 2OFGX 2AHOB 4WXWA 3PM9A 4QYZK 3W8GA 3HSJA 1CQMA 3JAMY 3S6EA 1S0VA 2GO8A 1P4NA 1D1UA 3DNSA 4WTYA 5AJ3J 4YN3B 1F57A 4L89A 2NCKL 1AA1B 1RT7A 2JDDA 2M2BA 5T41A 1RTIB 1VQKS 3PB4X 4IRDA 2MLYA 1RTHA 4R3LA 2VZZA 2QX0A 3CC7S 4TNUA 2KDOA 4DFKA 3MTKA 2P5VA 1VQLS 4M5IA 3Q2TC 1M5HA 2W8LA 3K9UA 2EBEA 2V67A 2HNDA 2ZZNA 4UUXA 2MGZA 4HH0A 2NR0A 3KJVB 3HVTA 2MZQA 3QT7A 4UA3A 1NU4A 4QR1A 4USIA 4NCAA 1WACA 1M5KC 4C7IA 1U47A 3QT8A 1RT4A 2V2QA 4DFMA 3ZJ0A 3AH6A 1OY8A 2JNJA 5KFWA 2B5GB 3I9V9 3CJTA 3GR0A 3FQKA 4J7CA 2PEBA 3FYNA 2UVRA 1JLEA 1XR7A 2DISA 3F44A 2W2QP 3JTOA 3ONQA 4CLUA 4DSKA 2YQ0A 3QB8A 4TU8A 1N5QA 1DTQA 1J5EF 3BM7A 4OZNA 2DO4A 5A6WA 3V4IB 2GE3A 4HKFA 4MHPA 2QLFB 2XB2D 2QECA 3OWCA 2CQ3A 3IMQJ 4C8NA 4IKAA 2RQCA 3H20A 1EX8A 4WU2A 4ZS6A 2ROGA 2CNLB 4LBIA 1SIWB 1Y3KA 3TJ8A 4U5YA 3QYYA 2G1HA 4XDDA 5J2MA 1RTJB 2DD8S 2OR4A 3QT6A 3G4SS 2J8RA 4CWBA 1FRKA 2VJVA 2QYCA 3ET6A 3N6MA 3PYGA 1R8BA 5LYFA 2NXCA 1S7NA 1TTHB 3J7YU 1YRTA 4JI2J 3EGZA 3LANA 3C66A 1J27A 5GMDA 3T6JA 3DOKB 2NUUG 4K4XA 1YQEA 1AXQA 2W01A 5HO4A 1HA1A 4TQRA 2V2KA 5KFAA 4UWJA 1LWEB 3VQSA 2QA2A 5DG7A 2OELA 3MAHA 1TKTB 1B0VA 5FLXY 3SI1A 3DXSX 2RJZA 2UXCJ 3WT4A 2AYBA 2O4HA 4WFZA 2NYIA 2ZH9A 2ZPAA 4YMEA 4NEZA 3HT0A 2CVEA 3OHBA 4YRHA 2JX2A 3KHRA 1N32J 2X3GA 3UPFA 4ICLB 4M94A 4N8NA 2WBMA 3CEDA 2V50A 4C8MA 3WC5A 3RUBL 4CAWA 4X4RA 2ZWOA 5IWAF 2V68A 4CRYB 2CDRB 1MG7A 1RT6B 1VQ6S 3I1UA 2Q44A 4RS2A 1HBOB 4IRCA 4DPWA 2G4BA 2HB6A 2QGFB 1EQ0A 4JD6A 2MSSA 3P4UB 3BEGB 1NK6A 2LEAA 1VJQA 1J5EJ 2B7CB 5CPAA 4DPTA 3GIKA 4UEEA 2WVFA 3C16B 1RU1A 1TF8A 1WI8A 4EO6A 3ET6B 2F40A 3CC4S 3PX6A 2OPSB 2JLFA 3IJ3A 3DXBA 3KI9A 4F3QA 4WFAQ 4R57A 2K1RA 3S6FA 3DLLQ 1CP7A 1SC1B 1W2BR 2CG4A 3VZIA 3DI6A 4P7TA 4ZVRB 2EFVA 1H74A 3OXGA 2P6GA 4Q5VA 4CGMA 1T05B 1Q16B 4NPOA 5D0RA 3NEKA 1PG5B 3IR5B 1V6HA 2RUGA 1PYTA 3FKBA 4Y49B 3PW5A 1HWJA 2PIIA 1HD1A 5A27A 5DM7Q 4UOFA 4LQGA 2YKNB 3BYPA 2Q6CA 2Z3OA 4PZVA 4K3NA 2YH0A 4EMDA 5A8KA 3HFZB 1ZBTA 3AA9A 4ITSA 5J2QA 3EE3A 3UY5A 4C3KA 5L9NA 1V5VA 1U2CA 2RKIB 3I55S 1FFWB 3B8HA 3WX4A 2W25A 2VHGA 1Y0YA 5DDRC 1RA6A 1LWXA 2RQMA 3R5BA 5ITHA 2C6CA 3WC7A 3W6XA 1N88A 3SQGA 4NI2A 4KVME 2CPEA 3MMJA 1ZYQA 2ZEFA 3GFZA 4AXIA 4AB7A 1FEHA 3D54A 3W2WB 1VRQC 4OZ0A 3DC2A 2PA8D 2ZC4A 3SJFA 4CAEA 2EK1A 4A2ZA 1BLLE 2SXLA 1YZ6A 4PG5A 4R9MA 2M88A 4H4KC 3PYDA 3NLCA 1LXJA 2YNIB 3Q23A 3Q83A 1R89A 4BWJA 3A8JA 4NZ0A 2Q4YA 4L3NA 5AJ3F 4A39A 3RJMB 2KG0A 2W7OA 2PR1A 3EVWA 1CX8A 2HFOA 3N01A 1X5SA 2HHWA 4LIRA 4HDHA 3W65A 2CQIA 3HVRA 2V4QA 1WWHA 2MTLA 2OH1A 4PK2A 4RW4B 1EIYB 2DEJA 2V6AA 2M0GB 5KFZA 2IM3A 3NL0A 4IOAQ 3DM2A 1H2UX 2XMKA 2DXEA 1W7WA 5IT9U 3BB5A 2WHOA 2RQ4A 3SDEA 2HWIA 1URRA 3ELHA 5CZXA 1Q2CA 2XULA 2WUUA 1XJWB 1T9TA 1E6YB 1UW4A 3E51A 3DDKA 1OSDA 4YHHF 5JJBA 2QLXA 1JLBB 1YVOA 1NHKL 3SCKE 2Z58B 2POKA 2E1MC 4NGSA 5D0EA 2PJ9A 3MCNA 2QMXA 5IB9A 4WZMA 2ZZMA 1CPSA 1O8BA 5L1IA 5ETRA 1VYAA 2CZ4A 2BR0A 4XIUA 4OC5A 4NXYA 1K0TA 1R8HA 1RSCA 1NSQA 3MMAA 3NH8A 2XI3A 1KFSA 2OTLS 4CO4A 3TX8A 2CPYA 1LV5A 4QWDA 3TA1A 1NH8A 2DY9A 5E33A 2D3OR 2UXBF 5EBVA 8CPAA 2OEJA 2GJ2A 3OTCA 1DRZA 1NH7A 1HLWA 3EZOA 5F48A 2W24A 2B4UA 1UVNA 2OZHA 1IICA 1M0SA 3LUYA 2VPZB 1JLQA 2HRYA 4DCPB 3DU6A 2M9KA 1BAVA 1R27B 1WOPA 5L9XA 4C11A 4RW7B 1U1MA 3PZJA 2NXEA 5KFTA 2ZHOA 2NSBA 4H4OA 2ZFHA 4BINA 3M8QA 4PUOA 3G9CA 3KOAA 3PX0A 2XZDB 1PC4A 5KG6A 2JEFA 5CABA 3GV5B 1JLBA 3ISZA 1YDLA 4IDKA 2DPSA 4M85A 2BOPA 2QYGA 2CXEA 2ACMA 1CULA 2R2RA 4QU7A 4IG0B 2Q51A 4P10A 3J7YI 3DLGB 2B51A 3QAUA 1U1QA 4DUYJ 3K0JA 2AJFE 3AD7C 4HL9A 4ZCKA 2B5GA 2FJBB 3BKUA 2AFWA 5D15A 3NBPA 2OGUA 2V0NA 4ECWA 3G8SA 2NSCA 1ZTWA 2LDIA 1WDDA 3FEXB 4RW8B 2AJ6A 2WZ1A 3BDPA 1RU2A 2J8AA 3RB0A 3T41A 2Y0SD 3M2RA 4WYWA 4CO3A 2Q3PA 4M8LA 1WHYA 2YWEA 2XMUA 4B3SJ 4URQU 3UDVA 3NGSA 3FDSA 4I69A 3PKYA 2WB1D 1YBAA 3HPOA 1TKZA 4PPZA 4YQWA 3EZ5A 2AX0A 2ZW6A 4CS0B 3AJ2A 4TYAA 3SDEB 1RYRA 2VFSA 5H9FJ 4DR3J 3CC2S 1GXLA 1EB0A 1LOUA 2MY8A 2ZH7A 5IX3A 4A8WA 4DG1B 1JJ2R 2AYGA 2RRAA 3B78A 1Q78A 1XBUA 3DFEA 3ZZYA 1IJFB 3GSIA 2HHTA 4GRSA 2B4PA 2DHAA 5KFBA 4DV3J 1WC3A 1DY3A 4PR6A 3SQGB 4ANEA 4B9MA 1SUQA 4M5DB 2QT7A 5KT3A 4YY3F 2Q6BA 2J6SA 4JI7F 1ARMA 3I4HX 4PKDB 1S7IA 2Z10A 4OLLA 2MHNA 3SCJE 2W4PA 2X1AA 4LT6A 4C6AA 3TJAA 1SC6A 3GIRA 3S9NA 3TO8A 3R9LA 3U27A 4LF6F 1K4JA 2PJAA 2F4VJ 4F4AA 3NBPB 3LOUA 4DQQA 2BA9A 2YNHB 2XYHB 5HMWA 1MWQA 3RBXA 4P4BA 3EDQB 2O28A 5ETVA 4F2SA 3FB3A 2MLXA 1KKHA 2PJ0A 4DR4J 4HT5A 3E01A 2J9DA 1FA0A 1XMBA 1NHUA 2E9TA 3TR5A 2QSWA 3BGRA 1VQMS 3TVZA 4KHRA 3C46A 1RTZA 2ZBRA 1P6TA 2IVMA 3IO1A 2FY1A 2BUEA 1NSLA 3T6BA 3HHLA 1KFDA 4QR2A 3G3SA 1RWNB 1YK3A 1QD1A 4DQSA 3CCLS 4JV0A 2GMJA 3AOBA 5LSLA 1Z2LA 1JLFB 4KGZB 3EWGA 2GO9A 4OHXA 1IIDA 2ZW4A 2HLTA 2MKHA 2IY5B 2PVWA 1FE4A 4F0MA 2WSCC 3D4UA 3PB6X 2W2PP 3DOLB 5E3QA 3SXOA 1Z2ZA 3SCLE 1UEKA 1PJ6A 2Q79A 3ZTOA 1VHEA 4JI0F 4B9SA 3M8QB 1NPKA 4DUKA 1XIXA 1PO6A 1SB6A 3M32A 2GIQA 5KAKA 1OY6A 5LSRA 4UOGA 2AJ1A 4OI1A 1XWLA 3BS9A 4IQXA 2FJXA 5F9LA 1S97A 3HHNB 1T3OA 3KLFA 4DXLA 3R2CJ 4R5PA 2LU2A 3ENWA 1U1LA 1X5OA 4DV1J 5D8NA 3PRTA 3FRYA 5AXLA 4BDPA 2G9DA 3EFAA 3GG1A 2JDCA 2HURA 1QSYA 1N32F 5I3PA 1IBCB 2RILA 1N52B 1DTDA 4RNHA 1TXRA 5JPHA 4CO5A 4ONUA 1X7VA 5H1SV 4UUWA 1YIJS 3TAQA 3M30A 3MUMP 2OUGA 1FJ7A 4AXVA 3I96A 4NGRA 2DH8A 3KJFB 3MZIA 4B3RJ 2DY1A 3RO0A 1LQ9A 4A8SA 3QSYB 4JI1F 3NE8A 2AIRB 2XZTB 3JQJA 4O0NA 2JC0A 4K5RA 2AZ1A 4MHDA 3I31A 2NLWA 3BQ2A 1C0TB 4R25A 2WB4A 3FNNA 4NE9C 5IB0A 4NYZA 2J7WA 2UV8G 1U4BA 2GVZA 1HDUA 1TAUA 3M6WA 2CJXB 2H3EB 2MLZA 3J81j 2XEFA 4FAIA 3MR5A 2KG1A 1V3ZA 1DFDA 2RAQA 3FNCA 3TARA 4Q38A 4RUBA 2Q7SA 2ZHBA 4KE5A 2R1IA 1IOFA 2YX4A 1X4DA 2Z3NA 2MKJA 1GMWD 2FHJD 4P4JA 2N4CA 2XS2A 4X4TA 1TKZB 3B3WA 1HNVB 4K8RA 5E3CA 4OZ1A 2WYRA 3PO4A 4JI3F 3WBZA 4QR0A 2CQ2A 2JEGA 3QAHA 3A13A 5BYQA 2YNHA 2FHOB 4OYMA 2QLBB 1KN6A 3WIVA 1GX6A 2DNGA 1HNWJ 3LP1B 3CW2C 4O0IA 1I5OB 4CNZA 2F65A 2Q4VA 4KH0B 9ATCB 1F3VA 3MURP 1UW9A 1CC8A 4ZKAA 2IHR1 5I3UB 1YJ7A 1ZM4A 3EDRB 2VZ9A 2ZH6A 2B3VA 2DH7A 2E1AA 3CDXA 5HI7A 3R97A 4FXDA 1ZG9A 1V3SA 3GFXA 4B11A 1XR6A 5ETOA 4ZN1A 4LRCA 3MR2A 1CJVB 4GO5X 2GQCA 5A2QY 3M7VA 3CIMA 5THWA 3NOCA 3WR7A 4NLDA 5KFOA 3HFVA 2AJ0A 3W1YC 1WUUA 1RWUA 3I6PA 2Z3MA 1LW2B 5EHHA 5T7LA 1OY9A 2IDLA 2CNOB 2EWHA 2P6TA 4CGLA 5IT9Y 2HIYA 4MJ8A 1WOSA 3NNCA 1NM2A 4RNNA 1R6VA 4F4XA 3P3DA 5I42A 5CA5A 3QIDA 2V8PA 4OLOA 2MKKA 2WW8A 1GFWB 4ZPDA 1TZ0A 1FX4A 3BI1A 3UCZP 3AB4B 5LYIA 4DZ6A 4PV6A 1T05A 1MROB 2NQPA 1KBRA 2O3DA 1N36F 1RAGB 2ASYA 3IAM9 1U45A 4M5NA 2FIAA 2PJ1A 2IAJB 1F6TA 3CCWA 1X9WA 1LW0B 3S9MA 1H2TZ 5A8WA 1OWXA 3T9YA 1FXDA 4X62F 2G0IA 4CGPA 2CWKA 2B4DB 1Q53A 1FFGB 3LW5C 3QGHA 4LFBJ 4YB1P 4E8OA 4URSA 5FIIA 4FF4A 2LDYA 4EZ6A 3H2LA 1RHRB 4OZLA 1RAAB 3JB9k 2CQBA 1NJWA 1B7YB 3BI0A 3IBWA 1CPZA 3SXNA 2H51B 3SJGA 1L5UA 3MMBA 4ZBGA 2P6FA 4J9RA 3MI7X 5D3GB 3NGKA 1LW2A 4E2FB 2D3O1 2DR9A 4A31A 2W4CA 1Q2DA 1XFOA 4KOTA 4F36A 2GVDB 2OI2A 2BKNA 2C3MA 3FZ2A 5D78A 1FRIA 3LGMA 2A2CA 5F8MA 2R7SA 2XCPA 2GU2A 3KDNA 2Y8YA 3B6BA 2M8DB 4X5KA 2I3CA 4OC0A 2WK4A 2ZJRQ 1S6OA 4FUUA 4ZITA 3VALA 1EKRA 2HAFA 2DRDA 3X1LB 2XSJA 3I9ZA 2EVZA 3LTOA 2CFXA 3I0RA 4OHYA 3U1MA 3G8QA 4KY3A 4KOXA 3HI9A 4C2XA 1YK9A 1T9WA 2JDJA 1Q79A 2HGMA 3H4DA 4H4MA 3CUNA 2HHHF 3Q86A 1YX2A 3ZZTA 2CJ9A 9RUBA 1S7HA 1JJHA 5MLCV 2VQEJ 1MJAA 1MNEA 3SI0A 3VAIA 2MPUA 2J9CA 4NLWA 1R0BG 1Y0HA 1X0PA 4ZA1A 4CZCA 3RZAA 4J9UE 3QFWA 3TQ1A 2H5EA 4GVBB 4ONWA 2DNKA 1A9NB 5ETMA 4YS2A 2RRNA 3CXCR 1VC5A 1UFLA 3IWNC 4FD6A 1KQKA 4K4SA 1S9GB 3ZZOA 2ZEJA 3HKWA 1OO0B 3MDFA 4P71A 3PEHA 3UDLA 2OP5A 4KOVA 4JB8B 1Y3JA 4BBYA 2QL9B 2HRUA 3JUWA 3DU5A 3N7ZA 3PW2A 2DNHA 3TVYA 2YNFA 3M2VB 3P8BB 1LKZA 8AT1B 2E5JA 3LACA 4U7CA 4BMHA 2C3UA 2VKRA 1NK4A 2XC9A 1TR0A 2F5GA 1RWOB 3JVNA 4Y2KA 5K5MA 3CCZA 3LMSA 4JYWA 1B64A 4K4YA 1RQ0A 2YKNA 4B3SF 4DLGA 4P4EA 4LFAF 3OJUA 1S79A 1KZFA 5HVGA 4XTTA 3JTPA 3GKRA 3FC9A 4CYQA 2IYIA 1XMOF 4OI4A 1RBAA 1UCNA 3ENAA 1T9YA 3D7DA 3S6GA 3GU0A 3KNGA 1HPZB 4I7FB 1Z1ZA 4KHPF 4ECRA 2FS5A 2CQ1A 3R7SB 2ZITA 3A4TA 5I0CA 3TP2A 3SZ2A 4AVAA 2WVDA 4CLWA 4B9TA 2AJ2A 1MJ9A 2DR7A 1XC9A 2OEMA 2FJVA 3IRWP 4OYPA 1TK5A 4RN7A 4YDXA 5KFDA 2CNSA 2Q4ZA 1DJ0A 2XI2A 4ICLA 3MEKA 4NXMF 1PAEX 3MCSA 1R7IA 5DQIA 3FBEA 1KVIA 3NH4A 2BQUA 3FMWA 5GAGI 3GV8B 4O23A 4LQ9A 3B7IA 2VQEF 1YBUA 1BLUA 1S10A 4K0KJ 1FY7A 1JX4A 5A2QU 2LVWA 3DRRB 4OV1A 1HW9A 1X9SA 1VRTB 5HATA 2VKZG 4GC6A 5HMZA 2ZH4A 1JNZB 2Q04A 1IKYA 5KFFA 1H98A 4UTGA 5HJYA 4KT0C 3ETMA 4V19J 4IO1A 5ETPA 5KFPA 2YKAA 3D6MB 4DX6A 3W66A 4FVCA 4J37A 1HEEA 1R8CA 1LWEA 1YVKA 3P5TL 5JM6A 3K58A 2RFHA 2EFQA 2Z2MA 2IC3B 4AXJA 2J0QD 4FBUA 4MH8A 2C3YA 3TZXA 2YXLA 2W2OP 4YB5A 1IM6A 5FDLA 2ADBA 3FEEA 2EEYA 1SKUB 1FJGJ 3FGVA 5J1QA 2ZH1A 2MY7A 1OJ4A 1JWWA 2MZRA 4M5LA 2MZ1A 4Q8EA 2DR6A 3E3XA 4BBHA 2DGOA 1RP5A 3DRPA 1VHSA 4DHVA 1U1KA 1S1VA 1XMOJ 2OD6A 2V9KA 3VQTA 4PQUA 1KEKA 1F2PA 2N3LA 1IQZA 1RAEB 2ZC3A 4LQ3A 5ISVA 2R42A 2WW4A 3CVKA 8RUCA 3FMCA 3KHHA 2K2PA 4CTAA 1Z4UA 2H5JB 3UVJB 4WU3A 1K1QA 1A7GE 3BGRB 4ED0A 3ETOA 4ED4A 2BSWA 3VARA 1GH8A 2K7KA 2HV2A 2ZM6J 1X4EA 4OIXA 3KJVA 4WIQA 5E7OB 2QL5B 4C2MA 1WKJA 4MFJA 3M4XA 4JI4J 4CAXA 3EM1A 2B4BA 1ACMB 1QVFR 1WF0A 4LF1A 4Q45A 5KFUA 2WTFA 4BCAA 1X4CA 4J9PA 2PT0A 3C3LA 1VI7A 4B10A 4QBUA 4RZRA 3O3LA 1OMSA 3R8YA 3A8IA 4KKOA 4ECQA 3UNGC 1JB0C 4ZMMA 3FCVA 2V5HG 1BE4A 1PYOB 1SL2A 5DWNA 3SCIE 3UR0A 3BN7A 1UEVA 4B5PB 4CYOA 3R7BB 3MECB 1KHWA 1TFWA 2HWHA 1HHTP 3R5AA 3SSSA 5ETTA 3SBMA 5GCNA 3C15A 2U2FA 4F4WA 1QAXA 2WVBA 4DNCA 2XYGB 3ITHB 1HD0A 2MEWA 1RHQB 4WKYA 1KVKA 4G1QB 4P2SA 4IF5A 3FECA 1RT4B 1RT1A 1X4GA 2PJBA 2VJUA 1H73A 3PEJA 1FI4A 4P73A 1HR0J 4MJKA 4H54A 5F49A 2GQ2A 1VR6A 3KK2A 4NYOA 4LFAJ 3AQPA 4Y00A 2BANB 2JRSA 4FS2A 1RKJA 2WRMA 1VQ9S 4LR8A 2RKIA 4ED6A 1TL7B 3FRZA 3A1YG 3FFIA 2JEIA 1IKVA 2XMWA 3LWMA 4CLZA 1UMJA 2FY8A 4I2PA 4WF9Q 1HBMB 3D7SB 5CZVA 4NL5A 3AQOA 2OKQA 3MM6B 5GAHU 4M5GA 4KSAA 3QQCD 5ELYA 2YBVA 4I64A 4UY85 1CG2A 2KJWA 2B8QA 4OYBA 1Y7EA 3H8GA 4K5SA 3UFCX 3EPGA 4NGPA 1U6MA 3TUZC 4B5PA 2HQGA 2AQ4A 4DDFA 3WC6A 3H90A 3GCWP 2GS8A 4C2ZA 1C1CA 2EI5A 4CGNA 1MMLA 1D8YA 2AGQA 3MMAB 2C22A 1MWYA 4IO9Q 1C4AA 4MKBA 2GQQA 1NSAA 2R8GA 4J90A 2XTJP 4CLTA 2FHKA 2IDEA 1D9FA 2E66A 3QLHB 3M9MB 3QO9B 1TKXA 3GONA 3HVAA 2AFSA 3QBCA 1VJWA 1BWEA 3NAHA 4M63A 4QWBA 1U48A 2HVHA 4E0AA 2ZOGA 4LSNB 4FF1A 2JEWA 4YR2A 2NREA 4KOUA 2XMAA 1WKLA 1WTFA 3IWGA 1I12A 2RB7A 3GG0A 2KFYA 4FBTA 4R3KA 2BX6A 3PR5B 5KG7A 3OXFA 4P2MA 2BV3A 1CM0A 5LRJA 2MQPA 3IGNA 3OBIA 5KG5A 3KDOA 1FD8A 1OPIA 4U8VA 1ZZFA 2J76E 2ZE2B 3A3OB 4J9VA 1TKXB 3JAMU 4M5JA 5B0EA 1SPBP 4RBVA 3PJWA 3K5LA 3THVA 2AD9A 2JOQA 4CYNA 1VRTA 1MMNA 3ISND 4LRFA 1TIQA 1WC5A 1M1HA 4B3MF 1YSJA 3V81A 2GAHC 4ED8A 1RABB 3D8PA 1RBOB 5B0AA 1AYEA 2HS4A 2B5JB 2B9XA 4O3RA 4XPEA 2ZDOA 4A46A 1C0UB 5HANA 2LLZA 1CBKA 3PGPA 2CNNB 4H6UA 2R7OA 1AMPA 5JVHQ 1FNOA 3K89A 1GX5A 3K2YA 5B09A 2FJWA 1RJJA 2DXFA 3AFGA 1SL1A 4M6HA 2MZJA 3K57A 5H84A 3MHYA 3W2WA 2YQ1A 5A76A 1PSDA 3U02A 1OBRA 2R8KA 2CA9A 4LF7J 4ZK7M 2I00A 3VWSA 5J2NB 3J7A1 3W63A 3IWWA 4LSZB 3W91A 4A8OA 4JI7J 3DOKA 5KFGA 2DGXA 4NGQA 2YY3A 3FSXA 4WCEQ 4MAKA 2CAJA 3HZEA 3NNAA 2BMBA 2C2MB 3IC1A 2ZWPA 2KHDA 3EPIA 4RNMA 4ZVEA 3W3SA 2DCUB 4NF1A 4G1QA 3JSMA 5AE1A 3IGRA 4DG1A 3M6VA 4KJIA 1Y10A 3KUHA 2PJ7A 2D4PA 1XJOA 1YWXA 2RSQA 4O44A 2QA1A 3BZQA 4M5HA 5DLGA 4CRJA 5EWGA 2CIJA 4HH1A 4OP4A 2CJQA 2KTQA 4YOEA 2MQNA 2ZM6F 2RU9A 1DE4C 2EK9A 4LVOP 4KKOB 4WJBA 3W64A 4RPFA 3GYNA 3DMJB 3OLAA 1YLXA 3WZ0A 3MECA 4P2FA 1VK3A 1TUWA 3B35A 3PYFA 1F1BB 1FKPA 4ID5B 4HEA9 3D66A 4A4JA 4GVBA 2W2NP 2JFKA 3ENQA 2BZ2A 1UTAA 5DG8A 3BSCA 3KHZA 4QYZJ 2EC0A 1RWVB 1HNVA 4ILRA 3W9JA 2ZXVA 2M3DA 3HJFA 2EVNA 5C5JA 2RHSB 3R1LA 1HBUA 4I0WA 2DIUA 2V2ZA 1HARA 1U09A 3GPAA 3DSBA 1I6JA 3TE4A 3T1YJ 1VMBA 2PSWA 3CNQP 3B8GA 2QMWA 1YGYA 4ED3A 2PJ4A 4KVOE 4B3RF 4O3QA 2KL8A 4DQRA 6FD1A 3T3FA 1RAIB 2HQCA 4ZVFA 3GIUA 1YJ9S 1FDDA 1S59A 4WE1B 3UVJA 2E9RX 1E6VB 1JLQB 1CJTB 3CZXA 1YI2S 4I2QB 5L39A 2DNQA 1S9FA 3G71S 1HMVA 4H6ZA 4V19X 4KO0A 3FK4A 4AT1B 3MR7A 2ZD1A 2BOAA 3G6XA 4KOSA 5G0RB 3KUGA 5L8RC 2YKQA 2LQBA 1FJEB 3RB3A 1SKWA 4HTJA 3NNHA 4AQYJ 2A6OA 3PFEA 4USJC 1BUXA 5F3ZA 4ED5A 5LXYA 3HD1A 2RF2A 4CI0B 1SH2A 3VHQA 3K5OA 2KFNA 1PJ5A 4Z7CA 1NHVA 3QJJA 1S1TA 4P4FA 4A47A 1XNQF 3OTDA 4LF4F 4FN5A 1YKWA 3HJVA 4U67Q 3DR8A 4B6ZA 4B9VA 2V2VA 4MHZA 4DSIA 5GAGU 3KLIA 2J5AA 3D9BA 2PD1A 2EBJA 4LUBA 4R7MA 3POTB 2WONA 2E1CA 3Q8PB 2R2SA 2GJIA 2C2EA 4R87A 2VICA 2YNGA 3CGIA 3MM9B 4RLEA 2PC6A 4FKXA 1S1WA 1VQYA 4F4YA 4C48A 3SIPB 4RUAA 1SKRA 4DV0F 2ZD1B 2V4JA 5KFSA 3MR3A 3T1YF 3S6HA 2KVIA 1RCXB 3E01B 3OW2R 3MEGA 2OIHA 3NAIA 4U95A 2CTCA 2ZNZA 2WSFC 1Z8TA 1WG4A 1TV6B 2CPFA 4ED2A 1FRMA 2HHXA 4MCSA 1N5TA 3M8RA 3KHGA 4HI1A 2UU9J 4OKOA 1JLEB 4TU7A 2X1BA 3GJRB 4LF4J 3BF4A 4DL4A 3J80Y 3CCQS 4B02A 3MM5B 5EGYA 1TKDA 3CCSS 3RW6A 1M5SA 3ZNUA 1YTYA 3VCDA 4NXMJ 4I56A 4X64F 1MU2A 2ZELA 3L2NA 4P45A 3ILIA 2HHQA 4MIBA 3TX0A 2HAIA 4CM0A 4EUVA 2ZJPQ 1YZ7A 4DL6A 1JJ4A 2NUHA 4DPXA 2AEJA 3AAWB 2ATCB 1V9OA 3HD2A 3MEDA 3TAPA 3R6GB 3SMZA 1X9MA 3IS9A 2C1CA 3MM5A 4OJ1A 3Q8YA 4O3OA 2V69A 2PR8A 3JSMB 4CM2A 1M1GA 4MTPA 5LM7E 5E41A 2FLLA 4CLPA 3KK3B 1N6QB 1ZLHA 3I3GA 4U8YA 3ZXWA 3NH5A 2PFDA 2YNCA 2UZAA 2HPUA 4JI6J 2MQLA 4V1Ak 4DR5J 3D68A 2EG1A 3P2HA 4ZVQB 2BJ7A 3IR6B 4FPRA 2XO7A 1PBUA 2APOA 3QJLA 4UBRA 1RLCL 2G13A 3ADAC 4RU2A 4MT1A 4Z37A 1QY7A 1RT2A 5I3UA 3CJ8A 4HLBA 2VOOA 4DUTA 1X10A 1SJQA 2KJVA 3LP1A 1NUEA 1XE4A 1GTEA 1TELA 4CH7A 5IFMA 1WTBA 3V6HA 4OX7A 3BBBA 3AXMA 1GK8A 4MFPA 3I32A 4B3OB 2HGNA 1XNRF 2R8JA 4W9YA 4QWAA 1HBOA 3A8EA 2OPSA 4PUOB 4PXEA 1JLAA 1I1GA 4X4QA 1LWCB 2WPWA 2OH2A 2EFPA 4JI1J 5JQ4A 3DLHA 2EK6A 2JHEA 2DGVA 4J9MA 4Y65A 1FJGF 3WC2A 1XEZA 1FT7A 1IWGA 4TU9A 1CJKA 1HQ2A 1S9EB 2ZUGA 2R8VA 3T19A 1CEZA 4EEYA 4X3RA 4AVCA 1WSRA 3IRXA 1QE1A 4L6V3 3MOZA 5E3PA 4ZP9A 1T03B 2NXUA 3KLHB 5F8JA 3IWXA 2DK2A 2OO4A 3KZWA 4OZ2A 1LRZA 4OMEA 3CJ4A 4H4MB 1XMTA 2CPDA 2OEKA 1RWPB 4X66J 4XPDC 1FVSA 1CJUA 2G9OA 4B5OA 5C2GA 1Y4ZB 2GHWA 2JZ5A 2Z11A 3HSZA 4KOYA 4K59A 4UEZA 2IM2A 4H2KA 1YBTA 2W7AA 5F3TA 2UVWA 1VQ7S 4M5MA 4ZYQA 2WBRA 2KFZA 3LAKA 4UIBA 1DARA 3PJXA 4ZPWR 2UVVA 1IR2A 1SBRA 3QWUA 3WABA 1J5OA 4KGVB 5H9EJ 5ETSA 3W8PA 4ECTA 2N7CA 4LVNP 5HMNA 5HK4A 1VHIA 1WC4A 1K73T 3MM8B 4ETXA 3ZNJ1 4ZPTR 5KG1A 2NXJA 4L76A 5KG0A 5L38A 4CYUA 3BV8A 3JTKA 2N82B 2LKZA 2Q7BA 3UNYA 2OMOA 3TTHA 4KQZA 3H0PA 2ZBIA 2DTJA 5HMXA 4QCLA 2YNDA 4ZCMA 3MAQA 3ILLA 5B0FA 3UN2A 2C2RA 3V4IA 4TXSA 3CJKA 1LXNA 1R31A 2FJDB 4DL3A 2B9WA 2E5GA 1EETB 3GLJA 1S1TB 5DO2A 5G4DA 2QFIA 3G86A 3S6KA 4F4KA 1CQNA 2MZTA 4KBIA 4OJHA 1NKEA 3ILOA 3R2DJ 3TO9A 1I3OB 3BBFA 3VTIA 3RR8A 2VI7A 3RYOA 2UVUA 3ITHA 2NMTA 3T5KA 1VBZA 3Q24A 3TZYA 5CD4H 2XCAA 2XLKA 1NO8A 3GP9A 5KFQA 1WEXA 2PIZA 1JLAB 4NLOA 1Q5YA 2V77A 2YNFB 1UETA 4RWXA 4FYDA 4KIAA 3U1NA 1Y7RA 4DUZF 5HQLA 3ZZIA 3H25A 1NXIA 4DV4F 1RT5B 3IU2A 1NZAA 3MPUB 1ZA2B 2FC8A 1VC6A 1S9GA 3HULA 1QSLA 1RO5A 4MK7A 4ZPCA 5A8KB 2UXDF 4LF8J 4UFXA 2OAUA 4EBDA 1SJRA 3GR1A 4L8AA 3J7ZT 4ZVUB 1IM4A 5KFEA 2K7JA 5DS7A 4DV7J 3Q8VA 3D6FB 5FVJA 4QW8A 2VG5B 3W2VB 1CC7A 1BHNA 4JXQA 4IRKA 2Q0YA 3PIOQ 4A8MP 2AE6A 3MD1A 2BACA 4ZCIA 4ZX9A 2M8HA 5KFCA 3R1HA 5HROA 1SH0A 5U47A 2EFOA 1AFJA 2GMLA 4HTIA 2HFVA 3GJQB 4ID5A 1C0TA 4XK8C 2MKYA 2CWXA 4HHJA 2E7VA 4M5DA 2Z4PA 2OPQB 1L3KA 3GIJA 1VBXA 3DRXA 3I0RB 2PSZA 1HNZJ 4ZIWA 3C6TB 2LXIA 2E1RA 2GLJA 5BYSA 4DSJA 1Q5VA 5JGFA 3NS6A 1WG1A 3TOQA 4XO0A 4EK2A 4R8UA 4WK1A 4A94A 3K5MA 4DUZJ 4KB7A 2ATLA 2D74B 4DFPA 1NPRA 2JC1A 2RNEA 1Q0NA 1UJ4A 4NLSA 2ZH5A 3QT5A 1FFSB 5I3QA 2EPIA 3SV3A 2M70A 1S72S 5F46A 1VHFA 4LF2A 3OV7A 1GT8A 3IG1B 1DLOB 2D4OA 2XHWA 4FBEA 1HYSB 3UDEA 2VPXB 5IZHA 2M7SA 2HW3A 3PKMA 4JYAF 5SUHA 2Z57B 3IBFB 1OIAA 2HQ3A 4USTA 1NDKA 5AG5A 3QIPB 7AT1B 4B13A 4DQPA 4DMZA 4LQ6A 3KK1B 3QNWB 5GAHI 3R5JB 4JI0J 4JZ0A 4U9ZA 2W9AA 5ADZA 2BABA 3HDSA 4MBUA 1HI8A 4DF4A 3FZBA 5A8RB 4CYPA 4MKYA 2BJ1A 2BRKA 2F8MA 3MEEB 1X4HA 2CPIA 2VIHA 4PCQA 3IR7B 3NGTA 4GKKJ 2YTCA 3IBCB 4NLVA 2V94A 3UI3A 4XNHC 1ZM2A 5IT0A 1U1PA 4Q36A 5ETQA 3MGJA 3E8OA 5J2MB 3R9FA 2WONB 3I87A 1LK7A 5SZTA 1QSOA 2B56A 4FF3A 4QIVA 3ILJA 3PJ9A 2DNMA 3DLEA 4YB6A 4X66F 4NRTA 4OQJA 2XMTA 3D1QA 5LSOA 3HVWA 1LOKA 3F41A 2VQFJ 3JRUA 1UWBB 3DNCA 3SJXA 2AGOA 3BGOP 1S4FA 2CNKB 2RDIA 2X1FA 1VLYA 1YW4A 3FBUA 1I1DA 2VG6B 5E3RA 3DM2B 1C1BA 1NE9A 2OFHX 2VASA 4QBJA 3JYTA 2GA7A 3HHLB 1S99A 2HFZA 3N79A 5HQMA 1NJIT 3CF5Q 2P6SA 3O8WA 4MY3A 1RXOB 2BKOA 5C82A 2IJRA 3GIIA 4OIDA 4NXNJ 3CJ5A 1L0CA 1DBDA 4L75A 2EC2A 3MRUA 1NK0A 4P7VA 4ZVPB 1N5YB 4I2PB 2G0BA 2LP4A 4LIWA 2BQ3A 1RE1B 4P6QA 3D3SA 4YB7A 4CLSA 2ZEDA 4S0MA 5C24A 1UJ6A 5KFKA 4C68A 3MM6A 5K8PA 2J8NA 3D2MA 3C26A 4QWEA 2VQYA 3FCWA 1RTIA 2YNCC 2BKPA 3SXLA 1X31C 2J9AA 1KHVA 4DS5A 4TLQA 4GO7X 3DOMB 1GXTA 1BC6A 4HNYB 2XM3A 1EETA 3Q8QB 3HK2A 3OR2B 2QL7B 2V63A 3T5HA 5J1EB 4MIWA 2ZEHA 1XERA 2ALYB 3UN3A 2M5YA 1VISA 5KFJA 3QRRA 2QFJA 1IBKF 2I1RA 4Z7YA 3QNVA 4RBUA 1UPMB 3UD3P 3FFIB 3TO7A 4LF6J 2VZYA 5RUBA 4ZPBA 3I0SA 1SH3A 2MYFA 2NS1B 4C8LA 2YGWA 5HROB 2RQKA 1IYLA 5J1EA 4DV4J 2BQRA 2FJEB 5G20A 3B82A 2VG5A 6AT1B 1H3DA 1QTMA 2DXDA 1T02A 1D8ZA 3TQEA 1ZTTA 4WPAA 4AL6A 5B0DA 5C25B 4WXOA 1Y11A 2LQ8A 4ZLPA 4IDKB 2J6TA 3GYGA 1VQPS 3CCJS 4WBFA 3Q89A