2FIWA

Crystal structure of the gcn5-related n-acetyltransferase: aminotransferase, class-ii from rhodopseudomonas palustris
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
160
structure length
160
Chain Sequence
GHMVMSTPALRPYLPEDAAVTAAIFVASIEQLTADDYSEEQQEAWASAADDEAKFAARLSGQLTLIATLQGVPVGFASLKGPDHIDMLYVHPDYVGRDVGTTLIDALEKLAGARGALILTVDASDNAAEFFAKRGYVAKQRNTVSINGEWLANTTMTKSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords GCN5-related N-acetyltransferase:Aminotransferase, class-II
publication title Crystal Structure of the GCN5-Related N-acetyltransferase: Aminotransferase, Class-II from Rhodopseudomonas palustris
rcsb
source organism Rhodopseudomonas palustris
total genus 46
structure length 160
sequence length 160
ec nomenclature
pdb deposition date 2005-12-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13673 Acetyltransf_10 Acetyltransferase (GNAT) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 2fiwA00
1LRZA 2J8MA 1PU9A 4CRYB 4XNHC 2C27A 1M1DA 1S3ZA 2CY2A 3D2PA 3OWCA 1S7LA 2Q4YA 3JUWA 3TTHA 3EC4A 5KTDA 2G3TA 4XPDB 3DR6A 4HNWB 4PK3A 1R57A 3CXSA 4L8AA 3S6KA 4U9ZA 2RC4A 2F5IA 1M4GA 4IUSA 2Z0ZA 4M3SA 3SXOA 4AG9A 4IF5A 3FYNA 4B5PB 3FRMA 3JVNA 2WPWA 5F49A 3EO4A 1MJ9A 2GANA 1U6MA 2PC1A 1MK4A 4CAWA 4E2AA 5C88A 1IICA 1KZFA 1Z4EA 3TOAA 1RO5A 4KLVA 2REEA 2ZW7A 5CNPA 4XPKA 2PSWA 3BLNA 3IGRA 4JJXA 2PR1A 1NMTA 4FD6A 1YLEA 4GS4A 2JDDA 3TO7A 1Q2CA 2Q04A 1Z9UA 1VKCA 4KOWA 2BL1A 4BMHA 4AG7A 3TCVA 2B4DB 2VEZA 3R9GA 5F46A 4CRZB 2PR8A 2FE7A 4UA3A 4Y49C 2Q4VA 2ZXVA 3GY9A 4MJ8A 4YRHA 4B5PA 4R9MA 1GHEA 3PP9A 2PDOA 1IYLA 1QSOA 4ORFA 2JLMA 2Q44A 4KOVA 2FXFA 4DNCA 1NSLA 4KOUA 4MBUA 2CNMA 1KUYA 2B5GB 4EVYA 5DWMA 5H86A 2CNTA 4H6ZA 4KVXA 1I1DA 3DR8A 1QSRA 4KVME 3P2FA 1MJBA 1Y9WA 2FT0A 4FD7A 5IV0A 5JQ4A 3R9FA 5HH1A 4E0AA 4MI4A 3TO6A 2ZW4A 4NCZA 1WK4A 1Y7RA 4QC6A 2HV2A 3R1KA 2I79A 2QMLA 2R8VA 4NXYA 2J8RA 4LUAA 1BOBA 4B5OA 5C82A 2FS5A 1Q2YA 1Q2DA 3W6SA 5H84A 4QBJA 3BJ8A 3EXNA 4PSWA 2B4DA 5E96A 2KCWA 3KKWA 4R3KA 3ZZIA 4XPDC 3S6FA 2G3AA 3QB8A 2B4BA 4UWJA 2R7HA 3P2HA 2P0WA 2X7BA 2BSWA 2ZW5A 4HNXB 4R87A 3DSBA 2A4NA 2VBQA 2FSRA 4PV6A 1XIXA 4XNHB 4II9A 1M4IA 5HMNA 2OU2A 1M4DA 1S5KA 2QIRA 1YGHA 4X5KA 2B5GA 4M85A 2DXQA 1YVOA 4AVAA 4HKFA 1I12A 4L89A 4UWIA 1CJWA 5JPHA 3I9SA 3MGDA 1YK3A 4FD5A 4F6AA 2FL4A 4KUAA 1P4NA 2O28A 3DNSA 2GE3A 2VQYA 3B8GA 3IWGA 4OLLA 2VI7A 5GCNA 1YX0A 2ATRA 4JLYA 3TE4A 1PUAA 2G0BA 4K30A 4H6UA 1FY7A 1B6BA 1B87A 3VWDA 3C26A 3FB3A 4XPLA 2ZW6A 2BEIA 5FVJA 1ON0A 2OH1A 2EVNA 4RS2A 1UFHA 3EY5A 2CNSA 3VWEA 1XE4A 2Q0YA 2FIWA 5F48A 4ONUA 3LD2A 3FBUA 4H89A 2OB0A 2FCKA 4CAXA 4JD6A 1KUVA 2Z10A 2B3UA 1WWZA 2PQ8A 4KOSA 2AJ6A 3I3GA 3WR7A 1QSTA 4HNYB 1QSNA 4AVCA 3GYAA 2HUZA 4R3LA 3G8WA 4NSQA 1YVKA 3E0KA 4Y49B 4AVBA 4NF1A 3R9EA 2D4PA 4OAEA 3F8KA 3D3SA 5I0CA 2GIVA 3CXPA 4QB9A 4ZBGA 5EC4A 1SQHA 4R57A 3T90A 5DWNA 2BUEA 1BO4A 1I21A 3D8PA 5KTAA 4JXQA 5J8FA 2PRBA 3DDDA 4RI1A 3R95A 4U9YA 4OADA 1S7KA 2P6FA 3TT2A 2JDCA 4YGOA 1XF8A 5IB0A 3K9UA 3S6HA 3GKRA 2B58A 2P6EA 3ZJ0A 4KUBA 4MY0A 2ARHA 1M44A 2R98A 1S7FA 4CS0B 3F5BA 2Q7BA 5KTCA 2FIAA 1VHSA 2P6GA 1IB1E 3SXNA 2WPXA 5IX3A 2Y0MA 3N7ZA 3FNCA 2H5MA 3EFAA 1S60A 2J8NA 3TO9A 4I49A 1L0CA 3QAHA 1IIDA 2HQYA 1IYKA 4KLWA 3FXTA 4CAVA 4JXRA 5F47A 3FIXA 4JWPA 2I00A 4QVTA 4U5YA 4J3GA 1NE9A 2JEVA 4AB7A 4QUSA 2ZPAA 1YR0A 2VZZA 3D2MA 3CXQA 5J8CA 1OZPA 3TFYA 2B3VA 3G3SA 3PGPA 2AE6A 3W91A 2Z11A 4KOXA 4PK2A 3RYOA 2QECA 4KVOE 2VXKA 3V8IA 3T9YA 3UY5A 1KUXA 1N71A 2NMTA 3PZJA 1XEBA 3H4QA 1K4JA 1S7NA 3R96A 4MY3A 4NEXA 4FD4A 1Y9KA 1QSMA 2OZGA 1YREA 4E8OA 1Z4RA 4F0YA 4KORA 5EBVA 4LX9A 2VZYA 3F0AA 1TIQA 1XMTA 3LODA 3TOBA 4PSXA 1P0HA 4UBRA 4MHDA 3W6XA 2IL4A 4KOYA 1MJAA 1V0CA 4KOTA 3BJ7A 1J4JA 2R1IA 4YFJA 2REFA 1CM0A 5ISVA 4KZTA 2D4OA 2K5TA 2OZUA 3SHPA 1RXTA 3NE7A 3S6GA 2EUIA 2OZHA
chains in the Genus database with same CATH superfamily
4MHPA 1LRZA 2J8MA 4B6ZA 1PU9A 4BD9A 2J9AA 4P45A 2DPTA 4CAFA 3KI9A 1ZG9A 4CRYB 4XNHC 2WYRA 4P4BA 2C27A 2DEAA 1M1DA 2DPSA 3HLPA 1S3ZA 2CY2A 3D2PA 2Z3OA 3OWCA 4W9YA 3RZAA 1S7LA 3SJGA 2Q4YA 2V8HA 2HC9A 1AMPA 4UEFA 3CT9A 3JUWA 3TTHA 3EC4A 3BXMA 4B11A 5KTDA 2G3TA 2RB7A 4XPDB 3DR6A 3FVLA 4HNWB 4PK3A 3DLJA 1R57A 3CXSA 4L8AA 4TNUA 3S6KA 1LAPA 1PYTB 4U9ZA 2DF5A 4JYWA 2RC4A 2F5IA 1M4GA 4IUSA 2Z0ZA 1Z8TA 4M3SA 4Z65A 4NGRA 5AG5A 3SXOA 1OBRA 4MFQA 2ZEHA 5G1ZA 4AG9A 2EK8A 3H8EA 4IF5A 3FYNA 3WC7A 4B5PB 4ZI6A 3FRMA 3JVNA 4ZY2A 1R3NA 2WPWA 4HPSA 4CYOA 7CPAA 2BCOA 1YMEA 5F49A 3EO4A 1MJ9A 2GANA 5HXDA 1U6MA 2PC1A 1MK4A 2ZEEA 1JWQA 4UCPA 4NFRA 4CAWA 1IICA 2YNDA 3B3TA 4E2AA 1KZFA 1Z4EA 3TOAA 4MHZA 1TKHA 1RO5A 1DE4C 4KLVA 2REEA 5LYDA 3H5ZA 1FNOA 2CF4A 2EWBA 1ZLIA 2ZW7A 1Z5RA 1DTDA 3N5FA 4Q38A 5CNPA 4OC2A 2PSWA 4JZ0A 4XPKA 3L2NA 4IHMA 1VHOA 3BLNA 3IGRA 4JJXA 2PR1A 1NMTA 4B14A 1CPSA 4FD6A 1YLEA 4GS4A 4CGLA 4OC4A 4P4EA 2Z3KA 2JDDA 1HEEA 5CPAA 3TO7A 1ARLA 4NJQA 6CPAA 3IJ3A 2AFZA 1Q2CA 2PJ8A 2PIYA 2Q04A 1YW4A 1Z9UA 2AFOA 1VKCA 4KOWA 2BL1A 3KHXA 3MN8A 4OC1A 4AG7A 4BMHA 4C2ZA 4ZGYB 3TCVA 2B4DB 1ZG8A 2VEZA 3R9GA 4OC5A 5F46A 3S9LA 4CRZB 4DUKA 2PR8A 1XOVA 2FE7A 1CPXA 2Z3LA 1ZO0A 2XEGA 2BOAA 4UA3A 4NGQA 4Y49C 3DGVA 4R6TA 2Q4VA 2ZXVA 2NYQA 3GY9A 3VATA 5K8OA 4MJ8A 4YRHA 4F0XA 4B5PA 3FEEA 3D68A 1GHEA 4R9MA 3PP9A 5DS0A 2PDOA 4UFWA 3PB8X 1CP6A 1IYLA 4CGPA 4UCMA 3JTKA 1A2ZA 2PJ1A 5G22A 5LYIA 3IIBA 3D7HA 4DJLA 4IAVA 1QSOA 4ORFA 2JLMA 2FXFA 1QQ9A 2Q44A 4KOVA 4DNCA 1NSLA 4P10A 5JGFA 2ZEMA 1JQGA 4KOUA 3IWEA 3D4UA 4MBUA 2CNMA 3RNZA 1KUYA 2B5GB 4EVYA 5DWMA 5H86A 2CNTA 4H6ZA 5A28A 4KVXA 1I1DA 2ZOGA 2XEIA 3DR8A 4CPAA 3VARA 1QSRA 4KVME 3P2FA 1MJBA 1Y9WA 2FT0A 3D67A 4FD7A 3FJUA 4C68A 5IV0A 1IOFA 2PJ4A 3IWWA 3SJXA 5JQ4A 3R9FA 5HH1A 4E0AA 4MI4A 3TO6A 2ZW4A 5C88A 2O4HA 4MRIA 4PXDA 4NCZA 1WK4A 1PCAA 1Y7RA 1Z2LA 4QC6A 3SJEA 2HV2A 1F57A 3HUVA 2I79A 3R1KA 2QMLA 4P4DA 4P4FA 1BPMA 2R8VA 4NXYA 1KWMA 2J8RA 1BOBA 4LUAA 4B5OA 2V8DA 3KZWA 5C82A 2FS5A 2GLJA 1Q2YA 2WZNA 3NH4A 1Q2DA 2ABZA 3W6SA 1YQEA 3IU2A 5H84A 4QBJA 1YLOA 5J1QA 3BJ8A 3EXNA 4A2ZA 2VL1A 2PJ2A 2JBKA 2B4DA 4PSWA 2IQ6A 5E96A 3NH8A 5D29A 3PBEA 2KCWA 3KKWA 4C7IA 4R3KA 4UEZA 4XPDC 3ZZIA 3S6FA 5IB9A 2G3AA 3QB8A 2B4BA 2Q4ZA 2R7HA 4UWJA 4ZY0A 3P2HA 2P0WA 3QAYA 5HVFA 2PJ0A 4MFLA 5JH9A 2X7BA 4MHYA 1CBXA 2BSWA 1FT7A 1EE3P 5D8NA 3CPAA 4LQGA 2ZW5A 4HNXB 1M4LA 1AUGA 2BO9A 2PJ6A 4R87A 3V38A 4F9VA 1F2OA 3DSBA 2PCUA 3FH4A 2A4NA 2C6GA 4ZYQA 2VBQA 4M6GA 2ANPA 5CBMA 2FSRA 2NSMA 1Z8XA 1YW6A 4MCSA 4PV6A 1F2PA 1XIXA 3KHZA 4B10A 4XNHB 1YSJA 2OOTA 4II9A 1M4IA 4C2YA 3RAMA 3B3SA 4MXUA 5HMNA 1Y0RA 3B3WA 2OU2A 1M4DA 1S5KA 2QIRA 3GB0A 4PXCA 4A94A 1CX8A 3FECA 5I4MA 2G9DA 1YGHA 2ZELA 3NA6A 2AFUA 4X5KA 2B5GA 4M85A 1TF9A 2DXQA 2FVGA 1YVOA 1ELMP 2EO8A 4AVAA 4MMOA 4HKFA 1I12A 4L89A 4UWIA 3KR5A 1CJWA 5JPHA 3MRUA 3I9SA 2PJ3A 3D7GA 3MGDA 1YK3A 4FD5A 4F6AA 2FL4A 4GM5A 1ZG7A 4KUAA 3WC5A 2ZEGA 3KQZA 3NFZA 2Q7SA 3BHXA 1P4NA 2O28A 3DNSA 2GE3A 4OIWA 2EBJA 2VQYA 4MFJA 4O23A 1H8LA 4OIDA 3B8GA 1TKJA 4P4JA 2QYVA 5LRKA 2PJCA 3IWGA 1CG2A 4OLLA 2VI7A 5GCNA 4A38A 1YX0A 3D7FA 3ISXA 2ATRA 4JLYA 5HVGA 3TE4A 1VGYA 1IY7A 1PUAA 2G0BA 4MFPA 4PXEA 4K30A 4H6UA 1FY7A 1B6BA 2Q43A 5BWAB 5LYLA 1B87A 3VWDA 3C26A 3FB3A 4XPLA 2ZW6A 2BEIA 1Z8WA 4NGTA 5FVJA 1ON0A 2OH1A 4NGMA 2Q51A 4FAIA 2EVNA 4RS2A 5AG6A 4KSFA 1UFHA 3EY5A 1TKFA 4WJBA 2ZEDA 2CNSA 4OC0A 2IMOA 3VWEA 2WUUA 3NE8A 2C6PA 4M6IA 2CTCA 1LFWA 1XE4A 2PIZA 2Q0YA 2FIWA 3BI1A 5F48A 4ONUA 4EFDA 3LD2A 4NJRA 4UCNA 3SJFA 2PVVA 2PJ9A 3FBUA 3B2YA 4UFXA 4H89A 3V7ZA 2OB0A 2FCKA 2AFMA 4P4IA 2QJ8A 4A95A 1Y7EA 4CAXA 4JD6A 2CXAA 1KUVA 2Z10A 1XJOA 4MCQA 1ZLHA 2B3UA 1WWZA 2PQ8A 3K2KA 5K8MA 4KOSA 2PJBA 2AJ6A 3I3GA 3WR7A 1QSTA 4HNYB 1QSNA 2GFQA 3TC8A 4PPZA 4R7MA 5LYFA 3SI2A 3LWUA 3TX8A 3RO0A 4AVCA 3GYAA 2HUZA 4R3LA 3G8WA 4NSQA 4H2KA 1YVKA 3E0KA 1XMBA 4Y49B 4AVBA 5K8PA 4X2TA 2WSAA 4NF1A 4KSAA 3R9EA 4EMEA 2Z3NA 3I1UA 2D4PA 1AYEA 3IC1A 4OAEA 1HDUA 3F8KA 3D3SA 5I0CA 1TXRA 2GIVA 3CXPA 3IO1A 1BLLE 2V8VA 4QB9A 4ZBGA 2I3CA 5EC4A 3IEHA 3WC6A 1SQHA 1X12A 5K8NA 2JBJA 4R57A 4YWYA 2AFSA 1LAMA 4IK2A 1BPNA 3T90A 5DWNA 2BUEA 3PEIA 4WWVA 1BO4A 2YNCA 4B13A 4OP4A 1I21A 5EMIA 1RTQA 3D8PA 5KTAA 4JXQA 5J8FA 2PRBA 2HB6A 3DDDA 3BI0A 4RI1A 3R95A 3NH5A 4K3NA 3SI1A 3ISZA 4U9YA 1IGBA 4OADA 3WABA 1S7KA 2P6FA 3TT2A 2JDCA 4YGOA 3PB9X 1XF8A 5IB0A 4F8ZA 5AG4A 1CP7A 1XFOA 3K9UA 3LMSA 3PB6X 4NGPA 5AG7A 3S6HA 3GKRA 4DYOA 1BAVA 2GLFA 2B58A 2P6EA 3ZJ0A 3PRTA 4KUBA 4MCPA 4MY0A 2ARHA 2Z3PA 1VHEA 3KL9A 3FF3A 3KGQA 1M44A 4LQ6A 4NGNA 2ZEOA 5HVHA 2RFHA 4MFKA 2R98A 2XEJA 3LACA 4A33A 4UIAA 1S7FA 3B35A 2F8HA 3F5BA 5AGEA 2Q7BA 4CS0B 4EWTA 4BBHA 2FIAA 5KTCA 1VHSA 2P6GA 3B3CA 1IB1E 2V8GA 3SXNA 2WPXA 4FWUA 5IX3A 2Y0MA 3N7ZA 2JEWA 4Q7AA 3FNCA 2H5MA 4P6YA 1XBUA 3EFAA 2YNEA 1S60A 2J8NA 3CPXA 1R43A 3PB7X 2GU2A 4BINA 3TO9A 4RN7A 2GREA 3T8WA 4UF4A 4I49A 3FMCA 3WT4A 4A32A 1L0CA 4P44A 1XRYA 4ZX8A 3QAHA 1IIDA 5F09A 2HQYA 1IYKA 4KLWA 3FXTA 2QVPA 3H8GA 4CAVA 2XEFA 5LRGA 4PQAA 3PFEA 4JXRA 4KSIA 5F47A 4R8FA 3FIXA 4JWPA 2I00A 2YNCC 3PFOA 4QVTA 4U5YA 4J3GA 3IU1A 1UWYA 4UFVA 4CYNA 1NE9A 2JEVA 4AB7A 3GIUA 3B3VA 4QUSA 2AFWA 4A37A 1TF8A 1NSAA 2ZPAA 3FEDA 1Q7LA 4FUUA 4M6HA 4X8IA 1YR0A 3A9LA 4C2XA 4CYPA 2PJAA 2VZZA 3D2MA 4RUHA 4CGMA 4CYQA 1VIXA 3CXQA 1LCPA 5J8CA 2O53A 4ZY1A 1LANA 1OZPA 4MCRA 4UIBA 2OR4A 3TFYA 2ZEPA 2B3VA 3G3SA 3PGPA 3SI0A 2AE6A 3W91A 4A30A 2Z11A 4GXHA 4ONWA 1Y0YA 4KOXA 4PK2A 4CAEA 4PXBA 3GLJA 3RYOA 2PRQA 2EK9A 2QECA 4KVOE 2VXKA 4Q36A 3KASA 3V8IA 3T9YA 4UEEA 3UY5A 4OC3A 2Z3MA 3S9MA 1KUXA 1N71A 2NMTA 3PZJA 3PB4X 4MFZA 3D66A 4OKOA 1XEBA 5A27A 2AFXA 3H4QA 5G20A 1K4JA 1S7NA 4CGNA 4X3RA 2PJ7A 3R96A 4MY3A 2POKA 1ELLP 2V77A 4NEXA 4A31A 4C7HA 1IU8A 4FD4A 1Y9KA 1QSMA 2OZGA 4KS9A 3RBUA 3CDXA 4TWEA 1YREA 4E8OA 1Z4RA 4F0YA 3JRUA 4KORA 5EBVA 4MHNA 5G21A 3KQXA 5LRJA 4A39A 2PVWA 1HDQA 2C1CA 2ZEFA 4LX9A 2IJZA 2CIJA 2VZYA 3F0AA 1TIQA 1XMTA 3GUXA 4ZX9A 3LODA 5JM6A 3PBBA 1X10A 4PSXA 3TOBA 1P0HA 4G1PA 4UBRA 2PJ5A 3KR4A 1IOIA 4MHDA 4F9UA 2PE3A 2IL4A 3D7DA 3VH9A 3W6XA 5THWA 3IFEA 3QNVA 3S9NA 2ZENA 3FX6A 4B12A 2F7VA 4KOYA 4YU9A 1MJAA 1V0CA 3CZXA 4KOTA 3BJ7A 1J4JA 1QMUA 2R1IA 4YFJA 8CPAA 2REFA 1CM0A 4OMEA 5ISVA 3H8FA 3K9TA 1Z8LA 2ZOFA 2CTBA 4KZTA 2C6CA 4R76A 4FBEA 2D4OA 1ARMA 2K5TA 1GYTA 2OZUA 5ELYA 3SHPA 1RXTA 4NGSA 2YGWA 3NE7A 4CGOA 3S6GA 2EUIA 4AXVA 1LOKA 2ODFA 3B7IA 2OZHA
chains in the Genus database with same CATH topology
1LRZA 2J8MA 4CAFA 1PU9A 2DPTA 4CRYB 4XNHC 2C27A 1M1DA 2DPSA 1S3ZA 2CY2A 3D2PA 2Z3OA 3OWCA 1S7LA 2Q4YA 3JUWA 3TTHA 3EC4A 4B11A 5KTDA 2G3TA 4XPDB 3DR6A 4HNWB 4PK3A 1R57A 3CXSA 4L8AA 3S6KA 4U9ZA 2RC4A 2F5IA 1M4GA 4IUSA 2Z0ZA 4M3SA 5AG5A 3SXOA 4MFQA 5G1ZA 4AG9A 4IF5A 3FYNA 4B5PB 3FRMA 3JVNA 2WPWA 4CYOA 5F49A 3EO4A 1MJ9A 2GANA 1U6MA 2PC1A 1MK4A 4UCPA 4CAWA 4E2AA 5C88A 1IICA 2YNDA 1KZFA 1Z4EA 3TOAA 1RO5A 4KLVA 2REEA 3H5ZA 2ZW7A 4Q38A 5CNPA 4XPKA 2PSWA 3BLNA 3IGRA 4JJXA 2PR1A 1NMTA 4B14A 4FD6A 1YLEA 4GS4A 4CGLA 2Z3KA 2JDDA 3TO7A 1Q2CA 2Q04A 1Z9UA 1VKCA 4KOWA 2BL1A 4BMHA 4C2ZA 4AG7A 4ZGYB 3TCVA 2B4DB 2VEZA 3R9GA 5F46A 4CRZB 2PR8A 2FE7A 2Z3LA 1ZO0A 4UA3A 4Y49C 2Q4VA 2ZXVA 3GY9A 4MJ8A 4YRHA 4F0XA 4B5PA 4R9MA 1GHEA 3PP9A 2PDOA 4UFWA 1IYLA 4CGPA 4UCMA 3JTKA 5G22A 1QSOA 4ORFA 2JLMA 2Q44A 2FXFA 4KOVA 4DNCA 1NSLA 4KOUA 3IWEA 4MBUA 2CNMA 5A28A 1KUYA 2B5GB 4EVYA 5DWMA 5H86A 2CNTA 4H6ZA 4KVXA 1I1DA 3DR8A 1QSRA 4KVME 3P2FA 1MJBA 1Y9WA 2FT0A 4FD7A 4C68A 5IV0A 5JQ4A 3R9FA 5HH1A 4E0AA 4MI4A 3TO6A 2ZW4A 4NCZA 1WK4A 1Y7RA 4QC6A 2HV2A 3R1KA 2I79A 2QMLA 2R8VA 4NXYA 2J8RA 4LUAA 1BOBA 4B5OA 5C82A 2FS5A 1Q2YA 1Q2DA 3W6SA 3IU2A 5H84A 4QBJA 3BJ8A 3EXNA 4A2ZA 4PSWA 2B4DA 5E96A 2KCWA 3KKWA 4C7IA 4R3KA 3ZZIA 4XPDC 3S6FA 2G3AA 3QB8A 2B4BA 4UWJA 2R7HA 3P2HA 2P0WA 4MFLA 2X7BA 2BSWA 2ZW5A 4HNXB 4R87A 3DSBA 2A4NA 2VBQA 2FSRA 4PV6A 1XIXA 4B10A 4XNHB 4II9A 1M4IA 4C2YA 5HMNA 2OU2A 1M4DA 1S5KA 2QIRA 1YGHA 4X5KA 2B5GA 4M85A 2DXQA 1YVOA 4AVAA 4HKFA 1I12A 4L89A 4UWIA 1CJWA 5JPHA 3I9SA 3MGDA 1YK3A 4FD5A 4F6AA 2FL4A 4KUAA 1P4NA 2O28A 3DNSA 2GE3A 2VQYA 4MFJA 3B8GA 3IWGA 4OLLA 2VI7A 5GCNA 1YX0A 2ATRA 4JLYA 3TE4A 1PUAA 2G0BA 4MFPA 4K30A 4H6UA 1FY7A 1B6BA 5BWAB 1B87A 3VWDA 3C26A 3FB3A 4XPLA 2ZW6A 2BEIA 5FVJA 1ON0A 2OH1A 2EVNA 4RS2A 5AG6A 4KSFA 1UFHA 3EY5A 2CNSA 3VWEA 2WUUA 1XE4A 2Q0YA 2FIWA 5F48A 4ONUA 3LD2A 4UCNA 3FBUA 4UFXA 4H89A 2OB0A 2FCKA 4A95A 4CAXA 4JD6A 2CXAA 1KUVA 2Z10A 2B3UA 1WWZA 2PQ8A 4KOSA 2AJ6A 3I3GA 3WR7A 1QSTA 4HNYB 1QSNA 4AVCA 3GYAA 2HUZA 4R3LA 3G8WA 4NSQA 1YVKA 3E0KA 4Y49B 4AVBA 2WSAA 4NF1A 4KSAA 3R9EA 2Z3NA 2D4PA 4OAEA 3F8KA 3D3SA 5I0CA 2GIVA 3CXPA 4QB9A 4ZBGA 5EC4A 1SQHA 4R57A 3T90A 5DWNA 2BUEA 1BO4A 2YNCA 4B13A 1I21A 3D8PA 5KTAA 4JXQA 5J8FA 2PRBA 3DDDA 4RI1A 3R95A 4U9YA 4OADA 1S7KA 2P6FA 3TT2A 2JDCA 4YGOA 1XF8A 5IB0A 5AG4A 3K9UA 5AG7A 3S6HA 3GKRA 2B58A 2P6EA 3ZJ0A 4KUBA 4MY0A 2ARHA 2Z3PA 1M44A 4MFKA 2R98A 4A33A 1S7FA 4CS0B 3F5BA 5AGEA 2Q7BA 5KTCA 4BBHA 2FIAA 1VHSA 2P6GA 1IB1E 3SXNA 2WPXA 5IX3A 2Y0MA 3N7ZA 3FNCA 2H5MA 3EFAA 2YNEA 1S60A 2J8NA 3TO9A 4I49A 4A32A 1L0CA 3QAHA 1IIDA 2HQYA 1IYKA 4KLWA 3FXTA 4CAVA 4JXRA 5F47A 3FIXA 4JWPA 2I00A 2YNCC 4UFVA 4QVTA 4U5YA 4J3GA 3IU1A 4CYNA 1NE9A 2JEVA 4AB7A 4QUSA 2ZPAA 4CYPA 1YR0A 3A9LA 4C2XA 2VZZA 3D2MA 4CGMA 4CYQA 3CXQA 5J8CA 1OZPA 3TFYA 2B3VA 3G3SA 3PGPA 2AE6A 3W91A 4A30A 2Z11A 4KOXA 4PK2A 4CAEA 3RYOA 2QECA 4KVOE 2VXKA 4Q36A 3V8IA 3T9YA 3UY5A 2Z3MA 1KUXA 1N71A 2NMTA 3PZJA 4MFZA 1XEBA 5A27A 3H4QA 5G20A 1K4JA 1S7NA 4CGNA 3R96A 4MY3A 4NEXA 4A31A 4C7HA 4FD4A 1Y9KA 1QSMA 2OZGA 4KS9A 1YREA 4E8OA 1Z4RA 4F0YA 4KORA 5EBVA 5G21A 4LX9A 2VZYA 3F0AA 1TIQA 1XMTA 3LODA 3TOBA 4PSXA 1P0HA 4UBRA 4MHDA 3W6XA 2IL4A 4B12A 4KOYA 1MJAA 1V0CA 4KOTA 3BJ7A 1J4JA 2R1IA 4YFJA 2REFA 1CM0A 5ISVA 4KZTA 2D4OA 2K5TA 2OZUA 3SHPA 1RXTA 2YGWA 3NE7A 4CGOA 3S6GA 2EUIA 2OZHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LRZ A;  2J8M A;  1PU9 A;  4CRY B;  4XNH C;  2C27 A;  1M1D A;  1S3Z A;  2CY2 A;  3D2P A;  3OWC A;  1S7L A;  2Q4Y A;  3JUW A;  3TTH A;  3EC4 A;  5KTD A;  2G3T A;  4XPD B;  3DR6 A;  4HNW B;  4PK3 A;  1R57 A;  3CXS A;  4L8A A;  3S6K A;  4U9Z A;  2RC4 A;  2F5I A;  1M4G A;  4IUS A;  2Z0Z A;  4M3S A;  3SXO A;  4AG9 A;  4IF5 A;  3FYN A;  4B5P B;  3FRM A;  3JVN A;  2WPW A;  5F49 A;  3EO4 A;  1MJ9 A;  2GAN A;  1U6M A;  2PC1 A;  1MK4 A;  4CAW A;  4E2A A;  5C88 A;  1IIC A;  1KZF A;  1Z4E A;  3TOA A;  1RO5 A;  4KLV A;  2REE A;  2ZW7 A;  5CNP A;  4XPK A;  2PSW A;  3BLN A;  3IGR A;  4JJX A;  2PR1 A;  1NMT A;  4FD6 A;  1YLE A;  4GS4 A;  2JDD A;  3TO7 A;  1Q2C A;  2Q04 A;  1Z9U A;  1VKC A;  4KOW A;  2BL1 A;  4BMH A;  4AG7 A;  3TCV A;  2B4D B;  2VEZ A;  3R9G A;  5F46 A;  4CRZ B;  2PR8 A;  2FE7 A;  4UA3 A;  4Y49 C;  2Q4V A;  2ZXV A;  3GY9 A;  4MJ8 A;  4YRH A;  4B5P A;  4R9M A;  1GHE A;  3PP9 A;  2PDO A;  1IYL A;  1QSO A;  4ORF A;  2JLM A;  2Q44 A;  4KOV A;  2FXF A;  4DNC A;  1NSL A;  4KOU A;  4MBU A;  2CNM A;  1KUY A;  2B5G B;  4EVY A;  5DWM A;  5H86 A;  2CNT A;  4H6Z A;  4KVX A;  1I1D A;  3DR8 A;  1QSR A;  4KVM E;  3P2F A;  1MJB A;  1Y9W A;  2FT0 A;  4FD7 A;  5IV0 A;  5JQ4 A;  3R9F A;  5HH1 A;  4E0A A;  4MI4 A;  3TO6 A;  2ZW4 A;  4NCZ A;  1WK4 A;  1Y7R A;  4QC6 A;  2HV2 A;  3R1K A;  2I79 A;  2QML A;  2R8V A;  4NXY A;  2J8R A;  4LUA A;  1BOB A;  4B5O A;  5C82 A;  2FS5 A;  1Q2Y A;  1Q2D A;  3W6S A;  5H84 A;  4QBJ A;  3BJ8 A;  3EXN A;  4PSW A;  2B4D A;  5E96 A;  2KCW A;  3KKW A;  4R3K A;  3ZZI A;  4XPD C;  3S6F A;  2G3A A;  3QB8 A;  2B4B A;  4UWJ A;  2R7H A;  3P2H A;  2P0W A;  2X7B A;  2BSW A;  2ZW5 A;  4HNX B;  4R87 A;  3DSB A;  2A4N A;  2VBQ A;  2FSR A;  4PV6 A;  1XIX A;  4XNH B;  4II9 A;  1M4I A;  5HMN A;  2OU2 A;  1M4D A;  1S5K A;  2QIR A;  1YGH A;  4X5K A;  2B5G A;  4M85 A;  2DXQ A;  1YVO A;  4AVA A;  4HKF A;  1I12 A;  4L89 A;  4UWI A;  1CJW A;  5JPH A;  3I9S A;  3MGD A;  1YK3 A;  4FD5 A;  4F6A A;  2FL4 A;  4KUA A;  1P4N A;  2O28 A;  3DNS A;  2GE3 A;  2VQY A;  3B8G A;  3IWG A;  4OLL A;  2VI7 A;  5GCN A;  1YX0 A;  2ATR A;  4JLY A;  3TE4 A;  1PUA A;  2G0B A;  4K30 A;  4H6U A;  1FY7 A;  1B6B A;  1B87 A;  3VWD A;  3C26 A;  3FB3 A;  4XPL A;  2ZW6 A;  2BEI A;  5FVJ A;  1ON0 A;  2OH1 A;  2EVN A;  4RS2 A;  1UFH A;  3EY5 A;  2CNS A;  3VWE A;  1XE4 A;  2Q0Y A;  2FIW A;  5F48 A;  4ONU A;  3LD2 A;  3FBU A;  4H89 A;  2OB0 A;  2FCK A;  4CAX A;  4JD6 A;  1KUV A;  2Z10 A;  2B3U A;  1WWZ A;  2PQ8 A;  4KOS A;  2AJ6 A;  3I3G A;  3WR7 A;  1QST A;  4HNY B;  1QSN A;  4AVC A;  3GYA A;  2HUZ A;  4R3L A;  3G8W A;  4NSQ A;  1YVK A;  3E0K A;  4Y49 B;  4AVB A;  4NF1 A;  3R9E A;  2D4P A;  4OAE A;  3F8K A;  3D3S A;  5I0C A;  2GIV A;  3CXP A;  4QB9 A;  4ZBG A;  5EC4 A;  1SQH A;  4R57 A;  3T90 A;  5DWN A;  2BUE A;  1BO4 A;  1I21 A;  3D8P A;  5KTA A;  4JXQ A;  5J8F A;  2PRB A;  3DDD A;  4RI1 A;  3R95 A;  4U9Y A;  4OAD A;  1S7K A;  2P6F A;  3TT2 A;  2JDC A;  4YGO A;  1XF8 A;  5IB0 A;  3K9U A;  3S6H A;  3GKR A;  2B58 A;  2P6E A;  3ZJ0 A;  4KUB A;  4MY0 A;  2ARH A;  1M44 A;  2R98 A;  1S7F A;  4CS0 B;  3F5B A;  2Q7B A;  5KTC A;  2FIA A;  1VHS A;  2P6G A;  1IB1 E;  3SXN A;  2WPX A;  5IX3 A;  2Y0M A;  3N7Z A;  3FNC A;  2H5M A;  3EFA A;  1S60 A;  2J8N A;  3TO9 A;  4I49 A;  1L0C A;  3QAH A;  1IID A;  2HQY A;  1IYK A;  4KLW A;  3FXT A;  4CAV A;  4JXR A;  5F47 A;  3FIX A;  4JWP A;  2I00 A;  4QVT A;  4U5Y A;  4J3G A;  1NE9 A;  2JEV A;  4AB7 A;  4QUS A;  2ZPA A;  1YR0 A;  2VZZ A;  3D2M A;  3CXQ A;  5J8C A;  1OZP A;  3TFY A;  2B3V A;  3G3S A;  3PGP A;  2AE6 A;  3W91 A;  2Z11 A;  4KOX A;  4PK2 A;  3RYO A;  2QEC A;  4KVO E;  2VXK A;  3V8I A;  3T9Y A;  3UY5 A;  1KUX A;  1N71 A;  2NMT A;  3PZJ A;  1XEB A;  3H4Q A;  1K4J A;  1S7N A;  3R96 A;  4MY3 A;  4NEX A;  4FD4 A;  1Y9K A;  1QSM A;  2OZG A;  1YRE A;  4E8O A;  1Z4R A;  4F0Y A;  4KOR A;  5EBV A;  4LX9 A;  2VZY A;  3F0A A;  1TIQ A;  1XMT A;  3LOD A;  3TOB A;  4PSX A;  1P0H A;  4UBR A;  4MHD A;  3W6X A;  2IL4 A;  4KOY A;  1MJA A;  1V0C A;  4KOT A;  3BJ7 A;  1J4J A;  2R1I A;  4YFJ A;  2REF A;  1CM0 A;  5ISV A;  4KZT A;  2D4O A;  2K5T A;  2OZU A;  3SHP A;  1RXT A;  3NE7 A;  3S6G A;  2EUI A;  2OZH A; 
#chains in the Genus database with same CATH topology
 4MHP A;  1LRZ A;  2J8M A;  4B6Z A;  1PU9 A;  4BD9 A;  2J9A A;  4P45 A;  2DPT A;  4CAF A;  3KI9 A;  1ZG9 A;  4CRY B;  4XNH C;  2WYR A;  4P4B A;  2C27 A;  2DEA A;  1M1D A;  2DPS A;  3HLP A;  1S3Z A;  2CY2 A;  3D2P A;  2Z3O A;  3OWC A;  4W9Y A;  3RZA A;  1S7L A;  3SJG A;  2Q4Y A;  2V8H A;  2HC9 A;  1AMP A;  4UEF A;  3CT9 A;  3JUW A;  3TTH A;  3EC4 A;  3BXM A;  4B11 A;  5KTD A;  2G3T A;  2RB7 A;  4XPD B;  3DR6 A;  3FVL A;  4HNW B;  4PK3 A;  3DLJ A;  1R57 A;  3CXS A;  4L8A A;  4TNU A;  3S6K A;  1LAP A;  1PYT B;  4U9Z A;  2DF5 A;  4JYW A;  2RC4 A;  2F5I A;  1M4G A;  4IUS A;  2Z0Z A;  1Z8T A;  4M3S A;  4Z65 A;  4NGR A;  5AG5 A;  3SXO A;  1OBR A;  4MFQ A;  2ZEH A;  5G1Z A;  4AG9 A;  2EK8 A;  3H8E A;  4IF5 A;  3FYN A;  3WC7 A;  4B5P B;  4ZI6 A;  3FRM A;  3JVN A;  4ZY2 A;  1R3N A;  2WPW A;  4HPS A;  4CYO A;  7CPA A;  2BCO A;  1YME A;  5F49 A;  3EO4 A;  1MJ9 A;  2GAN A;  5HXD A;  1U6M A;  2PC1 A;  1MK4 A;  2ZEE A;  1JWQ A;  4UCP A;  4NFR A;  4CAW A;  1IIC A;  2YND A;  3B3T A;  4E2A A;  1KZF A;  1Z4E A;  3TOA A;  4MHZ A;  1TKH A;  1RO5 A;  1DE4 C;  4KLV A;  2REE A;  5LYD A;  3H5Z A;  1FNO A;  2CF4 A;  2EWB A;  1ZLI A;  2ZW7 A;  1Z5R A;  1DTD A;  3N5F A;  4Q38 A;  5CNP A;  4OC2 A;  2PSW A;  4JZ0 A;  4XPK A;  3L2N A;  4IHM A;  1VHO A;  3BLN A;  3IGR A;  4JJX A;  2PR1 A;  1NMT A;  4B14 A;  1CPS A;  4FD6 A;  1YLE A;  4GS4 A;  4CGL A;  4OC4 A;  4P4E A;  2Z3K A;  2JDD A;  1HEE A;  5CPA A;  3TO7 A;  1ARL A;  4NJQ A;  6CPA A;  3IJ3 A;  2AFZ A;  1Q2C A;  2PJ8 A;  2PIY A;  2Q04 A;  1YW4 A;  1Z9U A;  2AFO A;  1VKC A;  4KOW A;  2BL1 A;  3KHX A;  3MN8 A;  4OC1 A;  4AG7 A;  4BMH A;  4C2Z A;  4ZGY B;  3TCV A;  2B4D B;  1ZG8 A;  2VEZ A;  3R9G A;  4OC5 A;  5F46 A;  3S9L A;  4CRZ B;  4DUK A;  2PR8 A;  1XOV A;  2FE7 A;  1CPX A;  2Z3L A;  1ZO0 A;  2XEG A;  2BOA A;  4UA3 A;  4NGQ A;  4Y49 C;  3DGV A;  4R6T A;  2Q4V A;  2ZXV A;  2NYQ A;  3GY9 A;  3VAT A;  5K8O A;  4MJ8 A;  4YRH A;  4F0X A;  4B5P A;  3FEE A;  3D68 A;  1GHE A;  4R9M A;  3PP9 A;  5DS0 A;  2PDO A;  4UFW A;  3PB8 X;  1CP6 A;  1IYL A;  4CGP A;  4UCM A;  3JTK A;  1A2Z A;  2PJ1 A;  5G22 A;  5LYI A;  3IIB A;  3D7H A;  4DJL A;  4IAV A;  1QSO A;  4ORF A;  2JLM A;  2FXF A;  1QQ9 A;  2Q44 A;  4KOV A;  4DNC A;  1NSL A;  4P10 A;  5JGF A;  2ZEM A;  1JQG A;  4KOU A;  3IWE A;  3D4U A;  4MBU A;  2CNM A;  3RNZ A;  1KUY A;  2B5G B;  4EVY A;  5DWM A;  5H86 A;  2CNT A;  4H6Z A;  5A28 A;  4KVX A;  1I1D A;  2ZOG A;  2XEI A;  3DR8 A;  4CPA A;  3VAR A;  1QSR A;  4KVM E;  3P2F A;  1MJB A;  1Y9W A;  2FT0 A;  3D67 A;  4FD7 A;  3FJU A;  4C68 A;  5IV0 A;  1IOF A;  2PJ4 A;  3IWW A;  3SJX A;  5JQ4 A;  3R9F A;  5HH1 A;  4E0A A;  4MI4 A;  3TO6 A;  2ZW4 A;  5C88 A;  2O4H A;  4MRI A;  4PXD A;  4NCZ A;  1WK4 A;  1PCA A;  1Y7R A;  1Z2L A;  4QC6 A;  3SJE A;  2HV2 A;  1F57 A;  3HUV A;  2I79 A;  3R1K A;  2QML A;  4P4D A;  4P4F A;  1BPM A;  2R8V A;  4NXY A;  1KWM A;  2J8R A;  1BOB A;  4LUA A;  4B5O A;  2V8D A;  3KZW A;  5C82 A;  2FS5 A;  2GLJ A;  1Q2Y A;  2WZN A;  3NH4 A;  1Q2D A;  2ABZ A;  3W6S A;  1YQE A;  3IU2 A;  5H84 A;  4QBJ A;  1YLO A;  5J1Q A;  3BJ8 A;  3EXN A;  4A2Z A;  2VL1 A;  2PJ2 A;  2JBK A;  2B4D A;  4PSW A;  2IQ6 A;  5E96 A;  3NH8 A;  5D29 A;  3PBE A;  2KCW A;  3KKW A;  4C7I A;  4R3K A;  4UEZ A;  4XPD C;  3ZZI A;  3S6F A;  5IB9 A;  2G3A A;  3QB8 A;  2B4B A;  2Q4Z A;  2R7H A;  4UWJ A;  4ZY0 A;  3P2H A;  2P0W A;  3QAY A;  5HVF A;  2PJ0 A;  4MFL A;  5JH9 A;  2X7B A;  4MHY A;  1CBX A;  2BSW A;  1FT7 A;  1EE3 P;  5D8N A;  3CPA A;  4LQG A;  2ZW5 A;  4HNX B;  1M4L A;  1AUG A;  2BO9 A;  2PJ6 A;  4R87 A;  3V38 A;  4F9V A;  1F2O A;  3DSB A;  2PCU A;  3FH4 A;  2A4N A;  2C6G A;  4ZYQ A;  2VBQ A;  4M6G A;  2ANP A;  5CBM A;  2FSR A;  2NSM A;  1Z8X A;  1YW6 A;  4MCS A;  4PV6 A;  1F2P A;  1XIX A;  3KHZ A;  4B10 A;  4XNH B;  1YSJ A;  2OOT A;  4II9 A;  1M4I A;  4C2Y A;  3RAM A;  3B3S A;  4MXU A;  5HMN A;  1Y0R A;  3B3W A;  2OU2 A;  1M4D A;  1S5K A;  2QIR A;  3GB0 A;  4PXC A;  4A94 A;  1CX8 A;  3FEC A;  5I4M A;  2G9D A;  1YGH A;  2ZEL A;  3NA6 A;  2AFU A;  4X5K A;  2B5G A;  4M85 A;  1TF9 A;  2DXQ A;  2FVG A;  1YVO A;  1ELM P;  2EO8 A;  4AVA A;  4MMO A;  4HKF A;  1I12 A;  4L89 A;  4UWI A;  3KR5 A;  1CJW A;  5JPH A;  3MRU A;  3I9S A;  2PJ3 A;  3D7G A;  3MGD A;  1YK3 A;  4FD5 A;  4F6A A;  2FL4 A;  4GM5 A;  1ZG7 A;  4KUA A;  3WC5 A;  2ZEG A;  3KQZ A;  3NFZ A;  2Q7S A;  3BHX A;  1P4N A;  2O28 A;  3DNS A;  2GE3 A;  4OIW A;  2EBJ A;  2VQY A;  4MFJ A;  4O23 A;  1H8L A;  4OID A;  3B8G A;  1TKJ A;  4P4J A;  2QYV A;  5LRK A;  2PJC A;  3IWG A;  1CG2 A;  4OLL A;  2VI7 A;  5GCN A;  4A38 A;  1YX0 A;  3D7F A;  3ISX A;  2ATR A;  4JLY A;  5HVG A;  3TE4 A;  1VGY A;  1IY7 A;  1PUA A;  2G0B A;  4MFP A;  4PXE A;  4K30 A;  4H6U A;  1FY7 A;  1B6B A;  2Q43 A;  5BWA B;  5LYL A;  1B87 A;  3VWD A;  3C26 A;  3FB3 A;  4XPL A;  2ZW6 A;  2BEI A;  1Z8W A;  4NGT A;  5FVJ A;  1ON0 A;  2OH1 A;  4NGM A;  2Q51 A;  4FAI A;  2EVN A;  4RS2 A;  5AG6 A;  4KSF A;  1UFH A;  3EY5 A;  1TKF A;  4WJB A;  2ZED A;  2CNS A;  4OC0 A;  2IMO A;  3VWE A;  2WUU A;  3NE8 A;  2C6P A;  4M6I A;  2CTC A;  1LFW A;  1XE4 A;  2PIZ A;  2Q0Y A;  2FIW A;  3BI1 A;  5F48 A;  4ONU A;  4EFD A;  3LD2 A;  4NJR A;  4UCN A;  3SJF A;  2PVV A;  2PJ9 A;  3FBU A;  3B2Y A;  4UFX A;  4H89 A;  3V7Z A;  2OB0 A;  2FCK A;  2AFM A;  4P4I A;  2QJ8 A;  4A95 A;  1Y7E A;  4CAX A;  4JD6 A;  2CXA A;  1KUV A;  2Z10 A;  1XJO A;  4MCQ A;  1ZLH A;  2B3U A;  1WWZ A;  2PQ8 A;  3K2K A;  5K8M A;  4KOS A;  2PJB A;  2AJ6 A;  3I3G A;  3WR7 A;  1QST A;  4HNY B;  1QSN A;  2GFQ A;  3TC8 A;  4PPZ A;  4R7M A;  5LYF A;  3SI2 A;  3LWU A;  3TX8 A;  3RO0 A;  4AVC A;  3GYA A;  2HUZ A;  4R3L A;  3G8W A;  4NSQ A;  4H2K A;  1YVK A;  3E0K A;  1XMB A;  4Y49 B;  4AVB A;  5K8P A;  4X2T A;  2WSA A;  4NF1 A;  4KSA A;  3R9E A;  4EME A;  2Z3N A;  3I1U A;  2D4P A;  1AYE A;  3IC1 A;  4OAE A;  1HDU A;  3F8K A;  3D3S A;  5I0C A;  1TXR A;  2GIV A;  3CXP A;  3IO1 A;  1BLL E;  2V8V A;  4QB9 A;  4ZBG A;  2I3C A;  5EC4 A;  3IEH A;  3WC6 A;  1SQH A;  1X12 A;  5K8N A;  2JBJ A;  4R57 A;  4YWY A;  2AFS A;  1LAM A;  4IK2 A;  1BPN A;  3T90 A;  5DWN A;  2BUE A;  3PEI A;  4WWV A;  1BO4 A;  2YNC A;  4B13 A;  4OP4 A;  1I21 A;  5EMI A;  1RTQ A;  3D8P A;  5KTA A;  4JXQ A;  5J8F A;  2PRB A;  2HB6 A;  3DDD A;  3BI0 A;  4RI1 A;  3R95 A;  3NH5 A;  4K3N A;  3SI1 A;  3ISZ A;  4U9Y A;  1IGB A;  4OAD A;  3WAB A;  1S7K A;  2P6F A;  3TT2 A;  2JDC A;  4YGO A;  3PB9 X;  1XF8 A;  5IB0 A;  4F8Z A;  5AG4 A;  1CP7 A;  1XFO A;  3K9U A;  3LMS A;  3PB6 X;  4NGP A;  5AG7 A;  3S6H A;  3GKR A;  4DYO A;  1BAV A;  2GLF A;  2B58 A;  2P6E A;  3ZJ0 A;  3PRT A;  4KUB A;  4MCP A;  4MY0 A;  2ARH A;  2Z3P A;  1VHE A;  3KL9 A;  3FF3 A;  3KGQ A;  1M44 A;  4LQ6 A;  4NGN A;  2ZEO A;  5HVH A;  2RFH A;  4MFK A;  2R98 A;  2XEJ A;  3LAC A;  4A33 A;  4UIA A;  1S7F A;  3B35 A;  2F8H A;  3F5B A;  5AGE A;  2Q7B A;  4CS0 B;  4EWT A;  4BBH A;  2FIA A;  5KTC A;  1VHS A;  2P6G A;  3B3C A;  1IB1 E;  2V8G A;  3SXN A;  2WPX A;  4FWU A;  5IX3 A;  2Y0M A;  3N7Z A;  2JEW A;  4Q7A A;  3FNC A;  2H5M A;  4P6Y A;  1XBU A;  3EFA A;  2YNE A;  1S60 A;  2J8N A;  3CPX A;  1R43 A;  3PB7 X;  2GU2 A;  4BIN A;  3TO9 A;  4RN7 A;  2GRE A;  3T8W A;  4UF4 A;  4I49 A;  3FMC A;  3WT4 A;  4A32 A;  1L0C A;  4P44 A;  1XRY A;  4ZX8 A;  3QAH A;  1IID A;  5F09 A;  2HQY A;  1IYK A;  4KLW A;  3FXT A;  2QVP A;  3H8G A;  4CAV A;  2XEF A;  5LRG A;  4PQA A;  3PFE A;  4JXR A;  4KSI A;  5F47 A;  4R8F A;  3FIX A;  4JWP A;  2I00 A;  2YNC C;  3PFO A;  4QVT A;  4U5Y A;  4J3G A;  3IU1 A;  1UWY A;  4UFV A;  4CYN A;  1NE9 A;  2JEV A;  4AB7 A;  3GIU A;  3B3V A;  4QUS A;  2AFW A;  4A37 A;  1TF8 A;  1NSA A;  2ZPA A;  3FED A;  1Q7L A;  4FUU A;  4M6H A;  4X8I A;  1YR0 A;  3A9L A;  4C2X A;  4CYP A;  2PJA A;  2VZZ A;  3D2M A;  4RUH A;  4CGM A;  4CYQ A;  1VIX A;  3CXQ A;  1LCP A;  5J8C A;  2O53 A;  4ZY1 A;  1LAN A;  1OZP A;  4MCR A;  4UIB A;  2OR4 A;  3TFY A;  2ZEP A;  2B3V A;  3G3S A;  3PGP A;  3SI0 A;  2AE6 A;  3W91 A;  4A30 A;  2Z11 A;  4GXH A;  4ONW A;  1Y0Y A;  4KOX A;  4PK2 A;  4CAE A;  4PXB A;  3GLJ A;  3RYO A;  2PRQ A;  2EK9 A;  2QEC A;  4KVO E;  2VXK A;  4Q36 A;  3KAS A;  3V8I A;  3T9Y A;  4UEE A;  3UY5 A;  4OC3 A;  2Z3M A;  3S9M A;  1KUX A;  1N71 A;  2NMT A;  3PZJ A;  3PB4 X;  4MFZ A;  3D66 A;  4OKO A;  1XEB A;  5A27 A;  2AFX A;  3H4Q A;  5G20 A;  1K4J A;  1S7N A;  4CGN A;  4X3R A;  2PJ7 A;  3R96 A;  4MY3 A;  2POK A;  1ELL P;  2V77 A;  4NEX A;  4A31 A;  4C7H A;  1IU8 A;  4FD4 A;  1Y9K A;  1QSM A;  2OZG A;  4KS9 A;  3RBU A;  3CDX A;  4TWE A;  1YRE A;  4E8O A;  1Z4R A;  4F0Y A;  3JRU A;  4KOR A;  5EBV A;  4MHN A;  5G21 A;  3KQX A;  5LRJ A;  4A39 A;  2PVW A;  1HDQ A;  2C1C A;  2ZEF A;  4LX9 A;  2IJZ A;  2CIJ A;  2VZY A;  3F0A A;  1TIQ A;  1XMT A;  3GUX A;  4ZX9 A;  3LOD A;  5JM6 A;  3PBB A;  1X10 A;  4PSX A;  3TOB A;  1P0H A;  4G1P A;  4UBR A;  2PJ5 A;  3KR4 A;  1IOI A;  4MHD A;  4F9U A;  2PE3 A;  2IL4 A;  3D7D A;  3VH9 A;  3W6X A;  5THW A;  3IFE A;  3QNV A;  3S9N A;  2ZEN A;  3FX6 A;  4B12 A;  2F7V A;  4KOY A;  4YU9 A;  1MJA A;  1V0C A;  3CZX A;  4KOT A;  3BJ7 A;  1J4J A;  1QMU A;  2R1I A;  4YFJ A;  8CPA A;  2REF A;  1CM0 A;  4OME A;  5ISV A;  3H8F A;  3K9T A;  1Z8L A;  2ZOF A;  2CTB A;  4KZT A;  2C6C A;  4R76 A;  4FBE A;  2D4O A;  1ARM A;  2K5T A;  1GYT A;  2OZU A;  5ELY A;  3SHP A;  1RXT A;  4NGS A;  2YGW A;  3NE7 A;  4CGO A;  3S6G A;  2EUI A;  4AXV A;  1LOK A;  2ODF A;  3B7I A;  2OZH A; 
#chains in the Genus database with same CATH homology
 1LRZ A;  2J8M A;  4CAF A;  1PU9 A;  2DPT A;  4CRY B;  4XNH C;  2C27 A;  1M1D A;  2DPS A;  1S3Z A;  2CY2 A;  3D2P A;  2Z3O A;  3OWC A;  1S7L A;  2Q4Y A;  3JUW A;  3TTH A;  3EC4 A;  4B11 A;  5KTD A;  2G3T A;  4XPD B;  3DR6 A;  4HNW B;  4PK3 A;  1R57 A;  3CXS A;  4L8A A;  3S6K A;  4U9Z A;  2RC4 A;  2F5I A;  1M4G A;  4IUS A;  2Z0Z A;  4M3S A;  5AG5 A;  3SXO A;  4MFQ A;  5G1Z A;  4AG9 A;  4IF5 A;  3FYN A;  4B5P B;  3FRM A;  3JVN A;  2WPW A;  4CYO A;  5F49 A;  3EO4 A;  1MJ9 A;  2GAN A;  1U6M A;  2PC1 A;  1MK4 A;  4UCP A;  4CAW A;  4E2A A;  5C88 A;  1IIC A;  2YND A;  1KZF A;  1Z4E A;  3TOA A;  1RO5 A;  4KLV A;  2REE A;  3H5Z A;  2ZW7 A;  4Q38 A;  5CNP A;  4XPK A;  2PSW A;  3BLN A;  3IGR A;  4JJX A;  2PR1 A;  1NMT A;  4B14 A;  4FD6 A;  1YLE A;  4GS4 A;  4CGL A;  2Z3K A;  2JDD A;  3TO7 A;  1Q2C A;  2Q04 A;  1Z9U A;  1VKC A;  4KOW A;  2BL1 A;  4BMH A;  4C2Z A;  4AG7 A;  4ZGY B;  3TCV A;  2B4D B;  2VEZ A;  3R9G A;  5F46 A;  4CRZ B;  2PR8 A;  2FE7 A;  2Z3L A;  1ZO0 A;  4UA3 A;  4Y49 C;  2Q4V A;  2ZXV A;  3GY9 A;  4MJ8 A;  4YRH A;  4F0X A;  4B5P A;  4R9M A;  1GHE A;  3PP9 A;  2PDO A;  4UFW A;  1IYL A;  4CGP A;  4UCM A;  3JTK A;  5G22 A;  1QSO A;  4ORF A;  2JLM A;  2Q44 A;  2FXF A;  4KOV A;  4DNC A;  1NSL A;  4KOU A;  3IWE A;  4MBU A;  2CNM A;  5A28 A;  1KUY A;  2B5G B;  4EVY A;  5DWM A;  5H86 A;  2CNT A;  4H6Z A;  4KVX A;  1I1D A;  3DR8 A;  1QSR A;  4KVM E;  3P2F A;  1MJB A;  1Y9W A;  2FT0 A;  4FD7 A;  4C68 A;  5IV0 A;  5JQ4 A;  3R9F A;  5HH1 A;  4E0A A;  4MI4 A;  3TO6 A;  2ZW4 A;  4NCZ A;  1WK4 A;  1Y7R A;  4QC6 A;  2HV2 A;  3R1K A;  2I79 A;  2QML A;  2R8V A;  4NXY A;  2J8R A;  4LUA A;  1BOB A;  4B5O A;  5C82 A;  2FS5 A;  1Q2Y A;  1Q2D A;  3W6S A;  3IU2 A;  5H84 A;  4QBJ A;  3BJ8 A;  3EXN A;  4A2Z A;  4PSW A;  2B4D A;  5E96 A;  2KCW A;  3KKW A;  4C7I A;  4R3K A;  3ZZI A;  4XPD C;  3S6F A;  2G3A A;  3QB8 A;  2B4B A;  4UWJ A;  2R7H A;  3P2H A;  2P0W A;  4MFL A;  2X7B A;  2BSW A;  2ZW5 A;  4HNX B;  4R87 A;  3DSB A;  2A4N A;  2VBQ A;  2FSR A;  4PV6 A;  1XIX A;  4B10 A;  4XNH B;  4II9 A;  1M4I A;  4C2Y A;  5HMN A;  2OU2 A;  1M4D A;  1S5K A;  2QIR A;  1YGH A;  4X5K A;  2B5G A;  4M85 A;  2DXQ A;  1YVO A;  4AVA A;  4HKF A;  1I12 A;  4L89 A;  4UWI A;  1CJW A;  5JPH A;  3I9S A;  3MGD A;  1YK3 A;  4FD5 A;  4F6A A;  2FL4 A;  4KUA A;  1P4N A;  2O28 A;  3DNS A;  2GE3 A;  2VQY A;  4MFJ A;  3B8G A;  3IWG A;  4OLL A;  2VI7 A;  5GCN A;  1YX0 A;  2ATR A;  4JLY A;  3TE4 A;  1PUA A;  2G0B A;  4MFP A;  4K30 A;  4H6U A;  1FY7 A;  1B6B A;  5BWA B;  1B87 A;  3VWD A;  3C26 A;  3FB3 A;  4XPL A;  2ZW6 A;  2BEI A;  5FVJ A;  1ON0 A;  2OH1 A;  2EVN A;  4RS2 A;  5AG6 A;  4KSF A;  1UFH A;  3EY5 A;  2CNS A;  3VWE A;  2WUU A;  1XE4 A;  2Q0Y A;  2FIW A;  5F48 A;  4ONU A;  3LD2 A;  4UCN A;  3FBU A;  4UFX A;  4H89 A;  2OB0 A;  2FCK A;  4A95 A;  4CAX A;  4JD6 A;  2CXA A;  1KUV A;  2Z10 A;  2B3U A;  1WWZ A;  2PQ8 A;  4KOS A;  2AJ6 A;  3I3G A;  3WR7 A;  1QST A;  4HNY B;  1QSN A;  4AVC A;  3GYA A;  2HUZ A;  4R3L A;  3G8W A;  4NSQ A;  1YVK A;  3E0K A;  4Y49 B;  4AVB A;  2WSA A;  4NF1 A;  4KSA A;  3R9E A;  2Z3N A;  2D4P A;  4OAE A;  3F8K A;  3D3S A;  5I0C A;  2GIV A;  3CXP A;  4QB9 A;  4ZBG A;  5EC4 A;  1SQH A;  4R57 A;  3T90 A;  5DWN A;  2BUE A;  1BO4 A;  2YNC A;  4B13 A;  1I21 A;  3D8P A;  5KTA A;  4JXQ A;  5J8F A;  2PRB A;  3DDD A;  4RI1 A;  3R95 A;  4U9Y A;  4OAD A;  1S7K A;  2P6F A;  3TT2 A;  2JDC A;  4YGO A;  1XF8 A;  5IB0 A;  5AG4 A;  3K9U A;  5AG7 A;  3S6H A;  3GKR A;  2B58 A;  2P6E A;  3ZJ0 A;  4KUB A;  4MY0 A;  2ARH A;  2Z3P A;  1M44 A;  4MFK A;  2R98 A;  4A33 A;  1S7F A;  4CS0 B;  3F5B A;  5AGE A;  2Q7B A;  5KTC A;  4BBH A;  2FIA A;  1VHS A;  2P6G A;  1IB1 E;  3SXN A;  2WPX A;  5IX3 A;  2Y0M A;  3N7Z A;  3FNC A;  2H5M A;  3EFA A;  2YNE A;  1S60 A;  2J8N A;  3TO9 A;  4I49 A;  4A32 A;  1L0C A;  3QAH A;  1IID A;  2HQY A;  1IYK A;  4KLW A;  3FXT A;  4CAV A;  4JXR A;  5F47 A;  3FIX A;  4JWP A;  2I00 A;  2YNC C;  4UFV A;  4QVT A;  4U5Y A;  4J3G A;  3IU1 A;  4CYN A;  1NE9 A;  2JEV A;  4AB7 A;  4QUS A;  2ZPA A;  4CYP A;  1YR0 A;  3A9L A;  4C2X A;  2VZZ A;  3D2M A;  4CGM A;  4CYQ A;  3CXQ A;  5J8C A;  1OZP A;  3TFY A;  2B3V A;  3G3S A;  3PGP A;  2AE6 A;  3W91 A;  4A30 A;  2Z11 A;  4KOX A;  4PK2 A;  4CAE A;  3RYO A;  2QEC A;  4KVO E;  2VXK A;  4Q36 A;  3V8I A;  3T9Y A;  3UY5 A;  2Z3M A;  1KUX A;  1N71 A;  2NMT A;  3PZJ A;  4MFZ A;  1XEB A;  5A27 A;  3H4Q A;  5G20 A;  1K4J A;  1S7N A;  4CGN A;  3R96 A;  4MY3 A;  4NEX A;  4A31 A;  4C7H A;  4FD4 A;  1Y9K A;  1QSM A;  2OZG A;  4KS9 A;  1YRE A;  4E8O A;  1Z4R A;  4F0Y A;  4KOR A;  5EBV A;  5G21 A;  4LX9 A;  2VZY A;  3F0A A;  1TIQ A;  1XMT A;  3LOD A;  3TOB A;  4PSX A;  1P0H A;  4UBR A;  4MHD A;  3W6X A;  2IL4 A;  4B12 A;  4KOY A;  1MJA A;  1V0C A;  4KOT A;  3BJ7 A;  1J4J A;  2R1I A;  4YFJ A;  2REF A;  1CM0 A;  5ISV A;  4KZT A;  2D4O A;  2K5T A;  2OZU A;  3SHP A;  1RXT A;  2YGW A;  3NE7 A;  4CGO A;  3S6G A;  2EUI A;  2OZH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...