2FIWA

Crystal structure of the gcn5-related n-acetyltransferase: aminotransferase, class-ii from rhodopseudomonas palustris
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
160
structure length
160
Chain Sequence
GHMVMSTPALRPYLPEDAAVTAAIFVASIEQLTADDYSEEQQEAWASAADDEAKFAARLSGQLTLIATLQGVPVGFASLKGPDHIDMLYVHPDYVGRDVGTTLIDALEKLAGARGALILTVDASDNAAEFFAKRGYVAKQRNTVSINGEWLANTTMTKSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the GCN5-Related N-acetyltransferase: Aminotransferase, Class-II from Rhodopseudomonas palustris
rcsb
source organism Rhodopseudomonas palustris
molecule tags Transferase
molecule keywords GCN5-related N-acetyltransferase:Aminotransferase, class-II
total genus 46
structure length 160
sequence length 160
ec nomenclature
pdb deposition date 2005-12-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13673 Acetyltransf_10 Acetyltransferase (GNAT) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 2fiwA00
2GANA 5HH1A 4KOVA 5EC4A 2HV2A 4R3LA 4KOYA 2R7HA 1U6MA 1MJAA 4MHDA 2JDDA 2B58A 2PDOA 4UWJA 3SHPA 2OU2A 2FIWA 2Q44A 3DDDA 3D3SA 2ZW7A 3E0KA 2A4NA 2VQYA 3H4QA 4MJ8A 3DNSA 1GHEA 4B5OA 2FE7A 4RS2A 2RC4A 3GY9A 2KCWA 5H86A 4PK3A 2JEVA 4KVXA 3QB8A 2R1IA 4KLVA 4CRYB 3DR6A 3KKWA 4Y49C 4NSQA 1L0CA 2ZW4A 1UFHA 3RYOA 1M1DA 2OZGA 4JLYA 5KTCA 2Q4YA 2Q7BA 1MJBA 4IF5A 3I9SA 4KOTA 2BEIA 3R9FA 1PUAA 2K5TA 4I49A 5KTDA 3ZJ0A 1S7LA 3F5BA 4QVTA 1M44A 4CAVA 1KUYA 1I21A 1P4NA 2WPWA 2I00A 1YLEA 4UBRA 2VBQA 1IIDA 4X5KA 2Z0ZA 3FXTA 3S6FA 2DXQA 1N71A 4E8OA 3JUWA 3TOAA 4AB7A 2HQYA 4PV6A 1NE9A 2BSWA 2JDCA 2F5IA 5DWMA 4EVYA 1Z4RA 1BO4A 2PC1A 3BLNA 2Z11A 5F49A 2ATRA 2J8NA 2G3AA 2EUIA 5CNPA 1XEBA 5I0CA 4KOXA 3JVNA 3K9UA 5J8FA 4HNXB 4XNHC 3FYNA 5E96A 4Y49B 1Y9WA 4BMHA 1I1DA 1SQHA 1Q2YA 3MGDA 4K30A 3TO6A 1YK3A 4NEXA 3TTHA 2H5MA 4OADA 3W6XA 3IWGA 3R9GA 4H6ZA 1QSRA 2QIRA 3VWDA 1CJWA 3C26A 1J4JA 2PR1A 2FT0A 1KUVA 1Z9UA 1XIXA 2NMTA 4U9ZA 3T9YA 3D2MA 4L89A 3V8IA 1RXTA 2HUZA 4PSXA 4KLWA 3DR8A 1I12A 4FD6A 4JXRA 1IYLA 2AE6A 4CS0B 4B5PB 4XPLA 3BJ7A 4II9A 1KUXA 1S60A 4OLLA 4KVME 1KZFA 4AG7A 4FD4A 1M4GA 1YR0A 3FNCA 5HMNA 3R96A 2C27A 3FIXA 5FVJA 1YX0A 3FB3A 4LUAA 5IX3A 3N7ZA 4AVAA 2I79A 1WK4A 1Q2CA 1Z4EA 3CXQA 5JPHA 4ONUA 4CAXA 2QECA 3LD2A 4MY3A 4J3GA 4GS4A 2VEZA 3P2HA 3PZJA 4QC6A 3S6KA 1M4IA 1XE4A 4R87A 2Q4VA 4KZTA 4YGOA 3P2FA 2REEA 2D4OA 3W91A 1V0CA 2WPXA 1S7KA 1MK4A 1MJ9A 1P0HA 2ZPAA 2CNSA 2PR8A 1WWZA 1LRZA 2X7BA 3QAHA 2G3TA 2ZW6A 4B5PA 1QSOA 1Y7RA 1IB1E 5C82A 2J8MA 3VWEA 4L8AA 2FIAA 2GE3A 1VKCA 2G0BA 4QUSA 2EVNA 2P0WA 2B5GA 4ZBGA 1QSNA 2B4DA 3TO9A 5JQ4A 5F48A 3R95A 3B8GA 2R8VA 4FD5A 4KOUA 5GCNA 3EC4A 3EY5A 4HKFA 4FD7A 4KVOE 3PGPA 1BOBA 4DNCA 1VHSA 2AJ6A 4OAEA 2FXFA 5EBVA 5KTAA 1QSTA 4YFJA 3CXPA 5ISVA 4IUSA 1S3ZA 2PSWA 4E0AA 2O28A 4NF1A 3FBUA 1FY7A 4ORFA 3S6GA 4M3SA 4KUAA 1R57A 1IICA 2OZHA 2Z10A 2FCKA 5IV0A 3TO7A 3BJ8A 3DSBA 3F0AA 1S7NA 1RO5A 3R9EA 2FSRA 1IYKA 2D4PA 1YGHA 4F6AA 3LODA 3W6SA 1XF8A 3TOBA 2VXKA 4MI4A 3CXSA 3SXNA 3G8WA 2J8RA 2REFA 2ARHA 2CNTA 1Y9KA 1YVOA 3PP9A 4RI1A 4R3KA 4HNYB 5H84A 2Q04A 4NCZA 2Y0MA 2P6FA 3I3GA 4UWIA 2ZW5A 4QBJA 1PU9A 1S5KA 4MBUA 2P6GA 4JWPA 2GIVA 4H6UA 3TE4A 3D2PA 2FS5A 3D8PA 4XPKA 3T90A 4U5YA 3F8KA 4CAWA 2PQ8A 4XNHB 4CRZB 5F46A 2BL1A 1YVKA 3FRMA 4UA3A 2JLMA 3TCVA 3EFAA 4AVBA 3ZZIA 1S7FA 3TFYA 3UY5A 2VZYA 4KOSA 2VI7A 2Q0YA 3OWCA 4JJXA 4AVCA 1NMTA 1QSMA 3EXNA 3NE7A 4KUBA 4R9MA 4MY0A 1TIQA 1NSLA 3SXOA 3G3SA 4KORA 4LX9A 1ON0A 5DWNA 2B5GB 2B3VA 1OZPA 1K4JA 1B87A 2CY2A 2OB0A 5J8CA 2B4BA 4H89A 1YREA 3GKRA 4HNWB 5IB0A 2OH1A 4E2AA 2B3UA 2CNMA 2P6EA 4NXYA 2VZZA 4JD6A 3TT2A 5F47A 3WR7A 2R98A 3S6HA 4R57A 4QB9A 1M4DA 2OZUA 5C88A 4KOWA 2B4DB 1Q2DA 4JXQA 4PSWA 1XMTA 4XPDC 2BUEA 4U9YA 2FL4A 2PRBA 4YRHA 2ZXVA 4XPDB 4M85A 3GYAA 3R1KA 2QMLA 4F0YA 2IL4A 3EO4A 4AG9A 3IGRA 1CM0A 1B6BA 4PK2A
chains in the Genus database with same CATH superfamily
2GANA 5HH1A 3DLJA 3RBUA 2Z3NA 4WJBA 4KOVA 5EC4A 3NH5A 4FAIA 2HC9A 2HV2A 4KOYA 4R3LA 4MHPA 3CDXA 3N5FA 2PJ2A 2V8GA 2V8VA 2R7HA 2XEIA 3D7HA 4GXHA 5K8NA 1U6MA 1MJAA 3PB7X 4MHDA 2JDDA 5LRJA 8CPAA 3ISXA 4A33A 2ZOGA 2B58A 4MFZA 1F2OA 2FVGA 2GLJA 3SJGA 5ELYA 2Q43A 2YNEA 4TNUA 4C2ZA 2PDOA 3H8EA 2EBJA 4UWJA 4NGMA 4OMEA 3SHPA 2OU2A 2FIWA 2JBKA 2Q44A 3DDDA 4MMOA 3PB8X 4CYQA 4OC4A 3D3SA 2ZW7A 1YQEA 2XEJA 3E0KA 2CXAA 2A4NA 5LRGA 2VQYA 4ZGYB 4M6HA 3H4QA 4MJ8A 3DNSA 4C2XA 4Q7AA 4CGPA 1GHEA 2CTCA 1Z8LA 3IFEA 4UEFA 4B5OA 2FE7A 1XFOA 1XJOA 2BO9A 2Z3KA 4MHYA 4RS2A 2RC4A 2J9AA 4BD9A 5HXDA 3GY9A 4UEZA 2KCWA 1Y7EA 4OC5A 5H86A 4PK3A 2JEVA 4KVXA 1XOVA 5D29A 1Z5RA 3D68A 3QB8A 5HVFA 2R1IA 4KLVA 1BAVA 4CRYB 3DR6A 3KKWA 1LAPA 4Y49C 3TX8A 4NSQA 1FT7A 3KHZA 2IMOA 1L0CA 2PVVA 2ZW4A 1UFHA 3RYOA 1M1DA 2OZGA 2YGWA 5AG6A 2YNCA 5JM6A 4UIAA 4JLYA 4DJLA 2QVPA 3SJEA 5KTCA 2Q4YA 1ZG9A 2Q7BA 1MJBA 4M6GA 4FBEA 4IF5A 1IOIA 1CPXA 4X2TA 3KHXA 5THWA 3I9SA 3NA6A 4KOTA 4UIBA 2JEWA 4R76A 2BEIA 4BBHA 4YWYA 4UF4A 3R9FA 4B13A 1PUAA 3IC1A 2K5TA 4I49A 5KTDA 3D67A 3HUVA 2GLFA 4MFKA 4P4IA 3ZJ0A 1S7LA 3F5BA 4QVTA 1M44A 2ZEHA 3IWWA 1YMEA 3S9MA 3WT4A 3QAYA 4C7IA 4CAVA 4ZY0A 1I21A 1KUYA 1P4NA 1H8LA 2I00A 2WPWA 3B3CA 3BHXA 3BXMA 4NGPA 1YLEA 4R6TA 2PJBA 4UBRA 2QYVA 3SJFA 3IO1A 2OOTA 1VGYA 4CPAA 4GM5A 4C2YA 2VBQA 1IIDA 4X5KA 1X10A 2Z0ZA 3FXTA 2EK8A 1ZG8A 3S6FA 2DXQA 3FVLA 1N71A 4PPZA 5I4MA 4E8OA 3JUWA 4UEEA 4W9YA 4ZX8A 3TOAA 2HQYA 4KSAA 4PV6A 4AB7A 2IQ6A 1NE9A 4MFLA 3I1UA 2BSWA 2F7VA 2JDCA 2F5IA 4MHZA 3GIUA 5DWMA 2EO8A 4DYOA 4EVYA 4OKOA 1Z4RA 1BO4A 1CPSA 2PC1A 1HDUA 2Z11A 1X12A 2DEAA 3BLNA 1TF8A 3CPAA 2ATRA 3CPXA 3D4UA 4OC2A 4O23A 4NFRA 2J8NA 2G3AA 4R8FA 4CYOA 4OC0A 1VHOA 4PQAA 3KQZA 2EUIA 3JRUA 5CNPA 1R43A 1XEBA 5I0CA 1QQ9A 4KOXA 4Q38A 3JVNA 3K9UA 2ZELA 3FF3A 3B3VA 2WYRA 5J8FA 2ZEFA 5F49A 4HNXB 4XNHC 2ZEGA 1IGBA 4X3RA 3FX6A 3FYNA 3L2NA 4Q36A 5E96A 1Y0RA 1BLLE 4Y49B 1Y9WA 2O4HA 2EWBA 4BMHA 3NH8A 1I1DA 2PJ8A 1SQHA 1CBXA 1Q2YA 3WC6A 3MGDA 4K30A 5AG5A 2G9DA 1YK3A 3TO6A 4P10A 2I3CA 4B12A 4NEXA 3TTHA 1ARMA 2O53A 2H5MA 3SJXA 1IU8A 1FNOA 5A27A 4OADA 2VL1A 3FECA 3IWGA 3R9GA 4H6ZA 3W6XA 1YW6A 1OBRA 1QSRA 2QIRA 3SI0A 3VWDA 2ABZA 1CJWA 1Z8XA 3BI1A 3C26A 1J4JA 3LWUA 2PR1A 4HPSA 2FT0A 1KUVA 1Z9UA 3VH9A 3GB0A 1XIXA 2PJ1A 3K2KA 5G20A 4MCQA 1Q7LA 4CYNA 2NMTA 4U9ZA 2C6PA 4YU9A 3T9YA 4OC3A 3B3TA 3D2MA 4L89A 2YNDA 3V8IA 5JH9A 2NSMA 1IY7A 3S9LA 2AFSA 1RXTA 2HUZA 1Z2LA 2EK9A 4PSXA 4KLWA 2ZEOA 5LYFA 3DR8A 1I12A 4F0XA 4FD6A 4MFPA 4JXRA 1IYLA 3PFEA 2AE6A 4CS0B 4B5PB 5K8OA 4XPLA 2PCUA 1LANA 3BJ7A 4B6ZA 2PJAA 4MCRA 4II9A 1KUXA 1S60A 5K8PA 1F57A 2Z3OA 4OLLA 4KVME 3FH4A 4NGRA 1YW4A 3D7GA 3B3WA 5LYIA 3CT9A 3NE8A 1KZFA 4H2KA 4AG7A 2CTBA 4A2ZA 3JTKA 5K8MA 5IB9A 4PXCA 1PYTB 4FD4A 2BCOA 1M4GA 1YR0A 3FNCA 5HMNA 2PJ3A 4G1PA 3R96A 2C27A 3FIXA 4KS9A 1M4LA 5FVJA 1ZLIA 2WZNA 1YX0A 1YSJA 4ZI6A 2WSAA 3FB3A 3FEEA 4MXUA 4LUAA 5IX3A 4C7HA 3N7ZA 4AVAA 2I79A 1WK4A 2JBJA 3GUXA 1Q2CA 1JQGA 4ZX9A 3WC7A 1Z4EA 3CXQA 5JPHA 1A2ZA 4ONUA 4CAXA 2QECA 3LD2A 4MY3A 4J3GA 4NJRA 4GS4A 1ELMP 2VEZA 1TKFA 3P2HA 3PZJA 5DS0A 3LMSA 4QC6A 3S6KA 1R3NA 1M4IA 1XE4A 4R87A 2Q4VA 4KZTA 4YGOA 3P2FA 3A9LA 2REEA 4P4JA 4EWTA 2D4OA 5EMIA 3W91A 1V0CA 1ZLHA 2WPXA 2PIYA 3D7FA 1S7KA 4ZY2A 3B35A 1MK4A 1MJ9A 1P0HA 2QJ8A 2ZPAA 3H8FA 3PFOA 2CNSA 4LQGA 4Z65A 4M6IA 5JGFA 2PR8A 1WWZA 1LRZA 2X7BA 3QAHA 2G3TA 2ZW6A 4B5PA 3RO0A 5HVHA 1QSOA 1Y7RA 2AFZA 5HVGA 1IB1E 5C82A 1HDQA 4F9UA 2J8MA 3KR5A 3VWEA 4MFJA 4P4FA 2XEGA 4L8AA 1QMUA 2FIAA 2GE3A 3PRTA 3FMCA 3RZAA 1VKCA 2G0BA 2EVNA 2P0WA 4QUSA 2B5GA 4ZBGA 2PJ6A 1VHEA 4P4EA 1QSNA 1TKHA 4BINA 1TF9A 2B4DA 3TO9A 5JQ4A 2AFMA 5F48A 3R95A 1BPNA 1ELLP 2AFOA 5G1ZA 2GFQA 1VIXA 1IOFA 1Z8WA 5J1QA 5CPAA 3B8GA 2R8VA 4CGNA 2CF4A 2Z3PA 4FD5A 2HB6A 4KOUA 5GCNA 2YNCC 3DGVA 3K9TA 3EC4A 4X8IA 3WABA 2ZEDA 6CPAA 4NGTA 3IIBA 3EY5A 4JZ0A 5AGEA 3VATA 1DE4C 4A37A 4HKFA 4FD7A 4KVOE 4EMEA 3PGPA 1BOBA 4UCNA 2BOAA 4F8ZA 4DNCA 1VHSA 2AJ6A 3FJUA 1JWQA 4IAVA 2FXFA 4OAEA 2ODFA 5EBVA 5KTAA 3NFZA 4OP4A 1QSTA 7CPAA 4YFJA 3CXPA 5ISVA 1HEEA 4IUSA 1S3ZA 2PSWA 3T8WA 2RFHA 4E0AA 2PRQA 2O28A 4AXVA 5F09A 2OR4A 3FBUA 1FY7A 2PJCA 4NF1A 4ORFA 3S6GA 3KL9A 5G21A 4M3SA 4KUAA 5G22A 1R57A 4NGSA 1DTDA 1IICA 4PXDA 4FWUA 2DF5A 3GLJA 2OZHA 4CGLA 2Z10A 2FCKA 3PB9X 5IV0A 1Z8TA 5CBMA 3TO7A 2Q7SA 3KI9A 3BJ8A 3DSBA 4MFQA 3F0AA 1S7NA 1RO5A 2ANPA 3R9EA 4A30A 4K3NA 2FSRA 1IYKA 2D4PA 4OIWA 4A95A 2PJ5A 3B7IA 5LYLA 1YGHA 4F6AA 3QNVA 4P6YA 3LODA 3W6SA 1XF8A 1CP7A 2AFXA 3V7ZA 3TOBA 4NJQA 2VXKA 1XRYA 5LYDA 4MI4A 3CXSA 3NH4A 3SXNA 3IEHA 4JYWA 3G8WA 4RN7A 2J8RA 4IHMA 2REFA 2ARHA 3MN8A 3HLPA 2CNTA 2PIZA 2PJ0A 3WC5A 1Y9KA 3KQXA 1YVOA 4CAEA 3PP9A 4RI1A 4A32A 2C1CA 3H8GA 4R3KA 4R7MA 4KSFA 2GU2A 4UCMA 4CAFA 4NGQA 2GREA 3B2YA 3V38A 1ARLA 4HNYB 5H84A 2AFWA 2Q04A 4C68A 3BI0A 2WUUA 4NCZA 2Y0MA 2P6FA 3I3GA 4UWIA 2F8HA 4ZY1A 2ZEMA 1TXRA 2ZW5A 2NYQA 3KZWA 1PU9A 1PCAA 4B11A 4QBJA 3KASA 4UCPA 2V77A 1ZO0A 5LRKA 1S5KA 4MBUA 5AG4A 4MCPA 2IJZA 3KR4A 4B14A 2P6GA 4JWPA 4ONWA 2GIVA 4A31A 2ZEPA 3D66A 1BPMA 3IJ3A 4H6UA 3D2PA 2FS5A 4RUHA 3D8PA 4XPKA 3T90A 3TE4A 4U5YA 4CGMA 2CIJA 2Z3LA 1AUGA 3F8KA 2PQ8A 2PE3A 4TWEA 4XNHB 3IU1A 4CAWA 4CRZB 5F46A 2BL1A 4KSIA 1YVKA 4MRIA 4UFWA 1LFWA 3FRMA 4UA3A 2JLMA 3MRUA 1CX8A 2V8HA 1ZG7A 3D7DA 4EFDA 4P4DA 2XEFA 3B3SA 3ISZA 3TCVA 3LACA 3EFAA 4AVBA 4B10A 3ZZIA 1CP6A 1S7FA 1NSAA 3RNZA 3TFYA 3UY5A 2VZYA 4PXBA 4KOSA 3KGQA 2VI7A 2Z3MA 3H5ZA 1KWMA 3PB4X 2Q0YA 3OWCA 1Y0YA 3IWEA 3PB6X 1UWYA 4JJXA 4AVCA 1NMTA 1QSMA 3EXNA 3NE7A 4KUBA 4R9MA 4MY0A 2ZOFA 1TIQA 2PVWA 1NSLA 3SXOA 3G3SA 1YLOA 4KORA 4LX9A 1ON0A 4OIDA 2AFUA 5D8NA 5DWNA 1XBUA 2B5GB 2PJ4A 5A28A 3SI2A 1LOKA 2B3VA 4ZYQA 4F9VA 1OZPA 1LCPA 1K4JA 1B87A 2CY2A 2OB0A 4P4BA 5J8CA 4MHNA 4UFVA 4WWVA 2B4BA 4H89A 4IK2A 2ZEEA 2Q51A 1YREA 3GKRA 1F2PA 2RB7A 4HNWB 3SI1A 5IB0A 2OH1A 3RAMA 3TC8A 4E2AA 2B3UA 4DUKA 2CNMA 2P6EA 2C6CA 3IU2A 2VZZA 4JD6A 4NXYA 3TT2A 2DPTA 3VARA 2PJ9A 5F47A 3WR7A 2R98A 3PBBA 3S6HA 4R57A 4QB9A 1M4DA 2OZUA 4OC1A 4KOWA 5C88A 2B4DB 4UFXA 1TKJA 2DPSA 1Q2DA 4JXQA 4CGOA 4A38A 4PSWA 1XMTA 4CYPA 4XPDC 4LQ6A 3S9NA 1AYEA 4P44A 1AMPA 2V8DA 4NGNA 4P45A 1EE3P 2PJ7A 2BUEA 4U9YA 4PXEA 4FUUA 1XMBA 5AG7A 2FL4A 2PRBA 3PBEA 3FEDA 4YRHA 2ZXVA 1RTQA 4M85A 4XPDB 3GYAA 4MCSA 3R1KA 3PEIA 2QMLA 4F0YA 2IL4A 2C6GA 4A39A 4A94A 1GYTA 3EO4A 2ZENA 4AG9A 1CG2A 2Q4ZA 3CZXA 3IGRA 5BWAB 1CM0A 2POKA 1LAMA 1B6BA 4PK2A
chains in the Genus database with same CATH topology
2GANA 5HH1A 2Z3NA 4KOVA 5EC4A 2HV2A 4R3LA 4KOYA 2R7HA 1U6MA 1MJAA 4MHDA 2JDDA 4A33A 2B58A 4MFZA 2YNEA 4C2ZA 2PDOA 4UWJA 3SHPA 2OU2A 2FIWA 2Q44A 3DDDA 4CYQA 3D3SA 2ZW7A 3E0KA 2CXAA 2A4NA 2VQYA 4ZGYB 3H4QA 4MJ8A 3DNSA 4C2XA 4CGPA 1GHEA 4B5OA 2FE7A 2Z3KA 4RS2A 2RC4A 3GY9A 2KCWA 5H86A 4PK3A 2JEVA 4KVXA 3QB8A 2R1IA 4KLVA 4CRYB 3DR6A 3KKWA 4Y49C 4NSQA 1L0CA 2ZW4A 1UFHA 3RYOA 1M1DA 2OZGA 2YGWA 5AG6A 2YNCA 4JLYA 5KTCA 2Q4YA 2Q7BA 1MJBA 4IF5A 3I9SA 4KOTA 2BEIA 4BBHA 3R9FA 4B13A 1PUAA 2K5TA 4I49A 5KTDA 4MFKA 3ZJ0A 1S7LA 3F5BA 4QVTA 1M44A 4C7IA 4CAVA 1KUYA 1I21A 1P4NA 2WPWA 2I00A 1YLEA 4UBRA 4C2YA 2VBQA 1IIDA 4X5KA 2Z0ZA 3FXTA 3S6FA 2DXQA 1N71A 4E8OA 3JUWA 3TOAA 4AB7A 2HQYA 4KSAA 4PV6A 1NE9A 4MFLA 2BSWA 2JDCA 2F5IA 5DWMA 4EVYA 1Z4RA 1BO4A 2PC1A 3BLNA 2Z11A 4KSFA 5F49A 2ATRA 4CYOA 2J8NA 2G3AA 2EUIA 5CNPA 1XEBA 5I0CA 4KOXA 4Q38A 3JVNA 3K9UA 5J8FA 4HNXB 4XNHC 3FYNA 5E96A 4Q36A 4Y49B 1Y9WA 4BMHA 1I1DA 1SQHA 1Q2YA 3MGDA 4K30A 5AG5A 3TO6A 1YK3A 4B12A 4NEXA 3TTHA 2H5MA 5A27A 4OADA 3W6XA 3IWGA 3R9GA 4H6ZA 1QSRA 2QIRA 3VWDA 1CJWA 3C26A 1J4JA 2PR1A 2FT0A 1KUVA 1Z9UA 1XIXA 5G20A 4CYNA 2NMTA 4U9ZA 3T9YA 3D2MA 4L89A 2YNDA 3V8IA 1RXTA 2HUZA 4PSXA 4KLWA 3DR8A 1I12A 4F0XA 4FD6A 4MFPA 4JXRA 1IYLA 2AE6A 4CS0B 4B5PB 4XPLA 3BJ7A 4II9A 1KUXA 1S60A 2Z3OA 4OLLA 4KVME 1KZFA 4AG7A 4A2ZA 3JTKA 4FD4A 1M4GA 1YR0A 3FNCA 5HMNA 3R96A 2C27A 3FIXA 4KS9A 5FVJA 1YX0A 2WSAA 3FB3A 4LUAA 5IX3A 4C7HA 3N7ZA 4AVAA 2I79A 1WK4A 1Q2CA 1Z4EA 3CXQA 5JPHA 4ONUA 4CAXA 2QECA 3LD2A 4MY3A 4J3GA 4GS4A 2VEZA 3P2HA 3PZJA 4QC6A 3S6KA 1M4IA 1XE4A 4R87A 2Q4VA 4KZTA 4YGOA 3P2FA 3A9LA 2REEA 2D4OA 3W91A 1V0CA 2WPXA 1S7KA 1MK4A 1MJ9A 1P0HA 2ZPAA 2CNSA 2PR8A 1WWZA 1LRZA 2X7BA 3QAHA 2G3TA 2ZW6A 4B5PA 1QSOA 1Y7RA 1IB1E 5C82A 2J8MA 3VWEA 4MFJA 4L8AA 2FIAA 2GE3A 1VKCA 2G0BA 2EVNA 2P0WA 4QUSA 2B5GA 4ZBGA 1QSNA 2B4DA 3TO9A 5JQ4A 5F48A 3R95A 5G1ZA 3B8GA 2R8VA 4CGNA 2Z3PA 4FD5A 4KOUA 5GCNA 2YNCC 3EC4A 3EY5A 5AGEA 4HKFA 4FD7A 4KVOE 3PGPA 1BOBA 4UCNA 4DNCA 1VHSA 2AJ6A 4OAEA 2FXFA 5EBVA 5KTAA 1QSTA 4YFJA 3CXPA 5ISVA 4IUSA 1S3ZA 2PSWA 4E0AA 2O28A 4NF1A 3FBUA 1FY7A 4ORFA 3S6GA 5G21A 4M3SA 4KUAA 5G22A 1R57A 1IICA 2OZHA 4CGLA 2Z10A 2FCKA 5IV0A 3TO7A 3BJ8A 3DSBA 4MFQA 3F0AA 1S7NA 1RO5A 4A30A 3R9EA 2FSRA 1IYKA 2D4PA 4A95A 1YGHA 4F6AA 3LODA 3W6SA 1XF8A 3TOBA 2VXKA 4MI4A 3CXSA 3SXNA 3G8WA 2J8RA 2REFA 2ARHA 2CNTA 1Y9KA 1YVOA 4CAEA 3PP9A 4RI1A 4A32A 4R3KA 4UCMA 4CAFA 4HNYB 5H84A 2Q04A 4C68A 2WUUA 4NCZA 2Y0MA 2P6FA 3I3GA 4UWIA 2ZW5A 4B11A 4QBJA 1PU9A 4UCPA 1ZO0A 1S5KA 4MBUA 5AG4A 4B14A 2P6GA 4JWPA 2GIVA 4A31A 4H6UA 3TE4A 3D2PA 2FS5A 3D8PA 4XPKA 3T90A 4U5YA 4CGMA 2Z3LA 3F8KA 4CAWA 2PQ8A 4XNHB 4CRZB 5F46A 3IU1A 2BL1A 1YVKA 4UFWA 3FRMA 4UA3A 2JLMA 3TCVA 3EFAA 4AVBA 4B10A 3ZZIA 1S7FA 3TFYA 3UY5A 2VZYA 4KOSA 2VI7A 2Z3MA 3H5ZA 2Q0YA 3OWCA 3IWEA 4JJXA 4AVCA 1NMTA 1QSMA 3EXNA 3NE7A 4KUBA 4R9MA 4MY0A 1TIQA 1NSLA 3SXOA 3G3SA 4KORA 4LX9A 1ON0A 5DWNA 2B5GB 5A28A 2B3VA 1OZPA 1K4JA 1B87A 2CY2A 2OB0A 5J8CA 4UFVA 2B4BA 4H89A 1YREA 3GKRA 4HNWB 5IB0A 2OH1A 4E2AA 2B3UA 2CNMA 2P6EA 4NXYA 3IU2A 2VZZA 4JD6A 3TT2A 2DPTA 5F47A 3WR7A 2R98A 3S6HA 4R57A 4QB9A 1M4DA 2OZUA 5C88A 4KOWA 2B4DB 4UFXA 1Q2DA 2DPSA 4JXQA 4CGOA 4PSWA 1XMTA 4CYPA 4XPDC 2BUEA 4U9YA 5AG7A 2FL4A 2PRBA 4YRHA 2ZXVA 4XPDB 4M85A 3GYAA 3R1KA 2QMLA 4F0YA 2IL4A 3EO4A 4AG9A 3IGRA 5BWAB 1CM0A 1B6BA 4PK2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GAN A;  5HH1 A;  4KOV A;  5EC4 A;  2HV2 A;  4R3L A;  4KOY A;  2R7H A;  1U6M A;  1MJA A;  4MHD A;  2JDD A;  2B58 A;  2PDO A;  4UWJ A;  3SHP A;  2OU2 A;  2FIW A;  2Q44 A;  3DDD A;  3D3S A;  2ZW7 A;  3E0K A;  2A4N A;  2VQY A;  3H4Q A;  4MJ8 A;  3DNS A;  1GHE A;  4B5O A;  2FE7 A;  4RS2 A;  2RC4 A;  3GY9 A;  2KCW A;  5H86 A;  4PK3 A;  2JEV A;  4KVX A;  3QB8 A;  2R1I A;  4KLV A;  4CRY B;  3DR6 A;  3KKW A;  4Y49 C;  4NSQ A;  1L0C A;  2ZW4 A;  1UFH A;  3RYO A;  1M1D A;  2OZG A;  4JLY A;  5KTC A;  2Q4Y A;  2Q7B A;  1MJB A;  4IF5 A;  3I9S A;  4KOT A;  2BEI A;  3R9F A;  1PUA A;  2K5T A;  4I49 A;  5KTD A;  3ZJ0 A;  1S7L A;  3F5B A;  4QVT A;  1M44 A;  4CAV A;  1KUY A;  1I21 A;  1P4N A;  2WPW A;  2I00 A;  1YLE A;  4UBR A;  2VBQ A;  1IID A;  4X5K A;  2Z0Z A;  3FXT A;  3S6F A;  2DXQ A;  1N71 A;  4E8O A;  3JUW A;  3TOA A;  4AB7 A;  2HQY A;  4PV6 A;  1NE9 A;  2BSW A;  2JDC A;  2F5I A;  5DWM A;  4EVY A;  1Z4R A;  1BO4 A;  2PC1 A;  3BLN A;  2Z11 A;  5F49 A;  2ATR A;  2J8N A;  2G3A A;  2EUI A;  5CNP A;  1XEB A;  5I0C A;  4KOX A;  3JVN A;  3K9U A;  5J8F A;  4HNX B;  4XNH C;  3FYN A;  5E96 A;  4Y49 B;  1Y9W A;  4BMH A;  1I1D A;  1SQH A;  1Q2Y A;  3MGD A;  4K30 A;  3TO6 A;  1YK3 A;  4NEX A;  3TTH A;  2H5M A;  4OAD A;  3W6X A;  3IWG A;  3R9G A;  4H6Z A;  1QSR A;  2QIR A;  3VWD A;  1CJW A;  3C26 A;  1J4J A;  2PR1 A;  2FT0 A;  1KUV A;  1Z9U A;  1XIX A;  2NMT A;  4U9Z A;  3T9Y A;  3D2M A;  4L89 A;  3V8I A;  1RXT A;  2HUZ A;  4PSX A;  4KLW A;  3DR8 A;  1I12 A;  4FD6 A;  4JXR A;  1IYL A;  2AE6 A;  4CS0 B;  4B5P B;  4XPL A;  3BJ7 A;  4II9 A;  1KUX A;  1S60 A;  4OLL A;  4KVM E;  1KZF A;  4AG7 A;  4FD4 A;  1M4G A;  1YR0 A;  3FNC A;  5HMN A;  3R96 A;  2C27 A;  3FIX A;  5FVJ A;  1YX0 A;  3FB3 A;  4LUA A;  5IX3 A;  3N7Z A;  4AVA A;  2I79 A;  1WK4 A;  1Q2C A;  1Z4E A;  3CXQ A;  5JPH A;  4ONU A;  4CAX A;  2QEC A;  3LD2 A;  4MY3 A;  4J3G A;  4GS4 A;  2VEZ A;  3P2H A;  3PZJ A;  4QC6 A;  3S6K A;  1M4I A;  1XE4 A;  4R87 A;  2Q4V A;  4KZT A;  4YGO A;  3P2F A;  2REE A;  2D4O A;  3W91 A;  1V0C A;  2WPX A;  1S7K A;  1MK4 A;  1MJ9 A;  1P0H A;  2ZPA A;  2CNS A;  2PR8 A;  1WWZ A;  1LRZ A;  2X7B A;  3QAH A;  2G3T A;  2ZW6 A;  4B5P A;  1QSO A;  1Y7R A;  1IB1 E;  5C82 A;  2J8M A;  3VWE A;  4L8A A;  2FIA A;  2GE3 A;  1VKC A;  2G0B A;  4QUS A;  2EVN A;  2P0W A;  2B5G A;  4ZBG A;  1QSN A;  2B4D A;  3TO9 A;  5JQ4 A;  5F48 A;  3R95 A;  3B8G A;  2R8V A;  4FD5 A;  4KOU A;  5GCN A;  3EC4 A;  3EY5 A;  4HKF A;  4FD7 A;  4KVO E;  3PGP A;  1BOB A;  4DNC A;  1VHS A;  2AJ6 A;  4OAE A;  2FXF A;  5EBV A;  5KTA A;  1QST A;  4YFJ A;  3CXP A;  5ISV A;  4IUS A;  1S3Z A;  2PSW A;  4E0A A;  2O28 A;  4NF1 A;  3FBU A;  1FY7 A;  4ORF A;  3S6G A;  4M3S A;  4KUA A;  1R57 A;  1IIC A;  2OZH A;  2Z10 A;  2FCK A;  5IV0 A;  3TO7 A;  3BJ8 A;  3DSB A;  3F0A A;  1S7N A;  1RO5 A;  3R9E A;  2FSR A;  1IYK A;  2D4P A;  1YGH A;  4F6A A;  3LOD A;  3W6S A;  1XF8 A;  3TOB A;  2VXK A;  4MI4 A;  3CXS A;  3SXN A;  3G8W A;  2J8R A;  2REF A;  2ARH A;  2CNT A;  1Y9K A;  1YVO A;  3PP9 A;  4RI1 A;  4R3K A;  4HNY B;  5H84 A;  2Q04 A;  4NCZ A;  2Y0M A;  2P6F A;  3I3G A;  4UWI A;  2ZW5 A;  4QBJ A;  1PU9 A;  1S5K A;  4MBU A;  2P6G A;  4JWP A;  2GIV A;  4H6U A;  3TE4 A;  3D2P A;  2FS5 A;  3D8P A;  4XPK A;  3T90 A;  4U5Y A;  3F8K A;  4CAW A;  2PQ8 A;  4XNH B;  4CRZ B;  5F46 A;  2BL1 A;  1YVK A;  3FRM A;  4UA3 A;  2JLM A;  3TCV A;  3EFA A;  4AVB A;  3ZZI A;  1S7F A;  3TFY A;  3UY5 A;  2VZY A;  4KOS A;  2VI7 A;  2Q0Y A;  3OWC A;  4JJX A;  4AVC A;  1NMT A;  1QSM A;  3EXN A;  3NE7 A;  4KUB A;  4R9M A;  4MY0 A;  1TIQ A;  1NSL A;  3SXO A;  3G3S A;  4KOR A;  4LX9 A;  1ON0 A;  5DWN A;  2B5G B;  2B3V A;  1OZP A;  1K4J A;  1B87 A;  2CY2 A;  2OB0 A;  5J8C A;  2B4B A;  4H89 A;  1YRE A;  3GKR A;  4HNW B;  5IB0 A;  2OH1 A;  4E2A A;  2B3U A;  2CNM A;  2P6E A;  4NXY A;  2VZZ A;  4JD6 A;  3TT2 A;  5F47 A;  3WR7 A;  2R98 A;  3S6H A;  4R57 A;  4QB9 A;  1M4D A;  2OZU A;  5C88 A;  4KOW A;  2B4D B;  1Q2D A;  4JXQ A;  4PSW A;  1XMT A;  4XPD C;  2BUE A;  4U9Y A;  2FL4 A;  2PRB A;  4YRH A;  2ZXV A;  4XPD B;  4M85 A;  3GYA A;  3R1K A;  2QML A;  4F0Y A;  2IL4 A;  3EO4 A;  4AG9 A;  3IGR A;  1CM0 A;  1B6B A;  4PK2 A; 
#chains in the Genus database with same CATH topology
 2GAN A;  5HH1 A;  3DLJ A;  3RBU A;  2Z3N A;  4WJB A;  4KOV A;  5EC4 A;  3NH5 A;  4FAI A;  2HC9 A;  2HV2 A;  4KOY A;  4R3L A;  4MHP A;  3CDX A;  3N5F A;  2PJ2 A;  2V8G A;  2V8V A;  2R7H A;  2XEI A;  3D7H A;  4GXH A;  5K8N A;  1U6M A;  1MJA A;  3PB7 X;  4MHD A;  2JDD A;  5LRJ A;  8CPA A;  3ISX A;  4A33 A;  2ZOG A;  2B58 A;  4MFZ A;  1F2O A;  2FVG A;  2GLJ A;  3SJG A;  5ELY A;  2Q43 A;  2YNE A;  4TNU A;  4C2Z A;  2PDO A;  3H8E A;  2EBJ A;  4UWJ A;  4NGM A;  4OME A;  3SHP A;  2OU2 A;  2FIW A;  2JBK A;  2Q44 A;  3DDD A;  4MMO A;  3PB8 X;  4CYQ A;  4OC4 A;  3D3S A;  2ZW7 A;  1YQE A;  2XEJ A;  3E0K A;  2CXA A;  2A4N A;  5LRG A;  2VQY A;  4ZGY B;  4M6H A;  3H4Q A;  4MJ8 A;  3DNS A;  4C2X A;  4Q7A A;  4CGP A;  1GHE A;  2CTC A;  1Z8L A;  3IFE A;  4UEF A;  4B5O A;  2FE7 A;  1XFO A;  1XJO A;  2BO9 A;  2Z3K A;  4MHY A;  4RS2 A;  2RC4 A;  2J9A A;  4BD9 A;  5HXD A;  3GY9 A;  4UEZ A;  2KCW A;  1Y7E A;  4OC5 A;  5H86 A;  4PK3 A;  2JEV A;  4KVX A;  1XOV A;  5D29 A;  1Z5R A;  3D68 A;  3QB8 A;  5HVF A;  2R1I A;  4KLV A;  1BAV A;  4CRY B;  3DR6 A;  3KKW A;  1LAP A;  4Y49 C;  3TX8 A;  4NSQ A;  1FT7 A;  3KHZ A;  2IMO A;  1L0C A;  2PVV A;  2ZW4 A;  1UFH A;  3RYO A;  1M1D A;  2OZG A;  2YGW A;  5AG6 A;  2YNC A;  5JM6 A;  4UIA A;  4JLY A;  4DJL A;  2QVP A;  3SJE A;  5KTC A;  2Q4Y A;  1ZG9 A;  2Q7B A;  1MJB A;  4M6G A;  4FBE A;  4IF5 A;  1IOI A;  1CPX A;  4X2T A;  3KHX A;  5THW A;  3I9S A;  3NA6 A;  4KOT A;  4UIB A;  2JEW A;  4R76 A;  2BEI A;  4BBH A;  4YWY A;  4UF4 A;  3R9F A;  4B13 A;  1PUA A;  3IC1 A;  2K5T A;  4I49 A;  5KTD A;  3D67 A;  3HUV A;  2GLF A;  4MFK A;  4P4I A;  3ZJ0 A;  1S7L A;  3F5B A;  4QVT A;  1M44 A;  2ZEH A;  3IWW A;  1YME A;  3S9M A;  3WT4 A;  3QAY A;  4C7I A;  4CAV A;  4ZY0 A;  1I21 A;  1KUY A;  1P4N A;  1H8L A;  2I00 A;  2WPW A;  3B3C A;  3BHX A;  3BXM A;  4NGP A;  1YLE A;  4R6T A;  2PJB A;  4UBR A;  2QYV A;  3SJF A;  3IO1 A;  2OOT A;  1VGY A;  4CPA A;  4GM5 A;  4C2Y A;  2VBQ A;  1IID A;  4X5K A;  1X10 A;  2Z0Z A;  3FXT A;  2EK8 A;  1ZG8 A;  3S6F A;  2DXQ A;  3FVL A;  1N71 A;  4PPZ A;  5I4M A;  4E8O A;  3JUW A;  4UEE A;  4W9Y A;  4ZX8 A;  3TOA A;  2HQY A;  4KSA A;  4PV6 A;  4AB7 A;  2IQ6 A;  1NE9 A;  4MFL A;  3I1U A;  2BSW A;  2F7V A;  2JDC A;  2F5I A;  4MHZ A;  3GIU A;  5DWM A;  2EO8 A;  4DYO A;  4EVY A;  4OKO A;  1Z4R A;  1BO4 A;  1CPS A;  2PC1 A;  1HDU A;  2Z11 A;  1X12 A;  2DEA A;  3BLN A;  1TF8 A;  3CPA A;  2ATR A;  3CPX A;  3D4U A;  4OC2 A;  4O23 A;  4NFR A;  2J8N A;  2G3A A;  4R8F A;  4CYO A;  4OC0 A;  1VHO A;  4PQA A;  3KQZ A;  2EUI A;  3JRU A;  5CNP A;  1R43 A;  1XEB A;  5I0C A;  1QQ9 A;  4KOX A;  4Q38 A;  3JVN A;  3K9U A;  2ZEL A;  3FF3 A;  3B3V A;  2WYR A;  5J8F A;  2ZEF A;  5F49 A;  4HNX B;  4XNH C;  2ZEG A;  1IGB A;  4X3R A;  3FX6 A;  3FYN A;  3L2N A;  4Q36 A;  5E96 A;  1Y0R A;  1BLL E;  4Y49 B;  1Y9W A;  2O4H A;  2EWB A;  4BMH A;  3NH8 A;  1I1D A;  2PJ8 A;  1SQH A;  1CBX A;  1Q2Y A;  3WC6 A;  3MGD A;  4K30 A;  5AG5 A;  2G9D A;  1YK3 A;  3TO6 A;  4P10 A;  2I3C A;  4B12 A;  4NEX A;  3TTH A;  1ARM A;  2O53 A;  2H5M A;  3SJX A;  1IU8 A;  1FNO A;  5A27 A;  4OAD A;  2VL1 A;  3FEC A;  3IWG A;  3R9G A;  4H6Z A;  3W6X A;  1YW6 A;  1OBR A;  1QSR A;  2QIR A;  3SI0 A;  3VWD A;  2ABZ A;  1CJW A;  1Z8X A;  3BI1 A;  3C26 A;  1J4J A;  3LWU A;  2PR1 A;  4HPS A;  2FT0 A;  1KUV A;  1Z9U A;  3VH9 A;  3GB0 A;  1XIX A;  2PJ1 A;  3K2K A;  5G20 A;  4MCQ A;  1Q7L A;  4CYN A;  2NMT A;  4U9Z A;  2C6P A;  4YU9 A;  3T9Y A;  4OC3 A;  3B3T A;  3D2M A;  4L89 A;  2YND A;  3V8I A;  5JH9 A;  2NSM A;  1IY7 A;  3S9L A;  2AFS A;  1RXT A;  2HUZ A;  1Z2L A;  2EK9 A;  4PSX A;  4KLW A;  2ZEO A;  5LYF A;  3DR8 A;  1I12 A;  4F0X A;  4FD6 A;  4MFP A;  4JXR A;  1IYL A;  3PFE A;  2AE6 A;  4CS0 B;  4B5P B;  5K8O A;  4XPL A;  2PCU A;  1LAN A;  3BJ7 A;  4B6Z A;  2PJA A;  4MCR A;  4II9 A;  1KUX A;  1S60 A;  5K8P A;  1F57 A;  2Z3O A;  4OLL A;  4KVM E;  3FH4 A;  4NGR A;  1YW4 A;  3D7G A;  3B3W A;  5LYI A;  3CT9 A;  3NE8 A;  1KZF A;  4H2K A;  4AG7 A;  2CTB A;  4A2Z A;  3JTK A;  5K8M A;  5IB9 A;  4PXC A;  1PYT B;  4FD4 A;  2BCO A;  1M4G A;  1YR0 A;  3FNC A;  5HMN A;  2PJ3 A;  4G1P A;  3R96 A;  2C27 A;  3FIX A;  4KS9 A;  1M4L A;  5FVJ A;  1ZLI A;  2WZN A;  1YX0 A;  1YSJ A;  4ZI6 A;  2WSA A;  3FB3 A;  3FEE A;  4MXU A;  4LUA A;  5IX3 A;  4C7H A;  3N7Z A;  4AVA A;  2I79 A;  1WK4 A;  2JBJ A;  3GUX A;  1Q2C A;  1JQG A;  4ZX9 A;  3WC7 A;  1Z4E A;  3CXQ A;  5JPH A;  1A2Z A;  4ONU A;  4CAX A;  2QEC A;  3LD2 A;  4MY3 A;  4J3G A;  4NJR A;  4GS4 A;  1ELM P;  2VEZ A;  1TKF A;  3P2H A;  3PZJ A;  5DS0 A;  3LMS A;  4QC6 A;  3S6K A;  1R3N A;  1M4I A;  1XE4 A;  4R87 A;  2Q4V A;  4KZT A;  4YGO A;  3P2F A;  3A9L A;  2REE A;  4P4J A;  4EWT A;  2D4O A;  5EMI A;  3W91 A;  1V0C A;  1ZLH A;  2WPX A;  2PIY A;  3D7F A;  1S7K A;  4ZY2 A;  3B35 A;  1MK4 A;  1MJ9 A;  1P0H A;  2QJ8 A;  2ZPA A;  3H8F A;  3PFO A;  2CNS A;  4LQG A;  4Z65 A;  4M6I A;  5JGF A;  2PR8 A;  1WWZ A;  1LRZ A;  2X7B A;  3QAH A;  2G3T A;  2ZW6 A;  4B5P A;  3RO0 A;  5HVH A;  1QSO A;  1Y7R A;  2AFZ A;  5HVG A;  1IB1 E;  5C82 A;  1HDQ A;  4F9U A;  2J8M A;  3KR5 A;  3VWE A;  4MFJ A;  4P4F A;  2XEG A;  4L8A A;  1QMU A;  2FIA A;  2GE3 A;  3PRT A;  3FMC A;  3RZA A;  1VKC A;  2G0B A;  2EVN A;  2P0W A;  4QUS A;  2B5G A;  4ZBG A;  2PJ6 A;  1VHE A;  4P4E A;  1QSN A;  1TKH A;  4BIN A;  1TF9 A;  2B4D A;  3TO9 A;  5JQ4 A;  2AFM A;  5F48 A;  3R95 A;  1BPN A;  1ELL P;  2AFO A;  5G1Z A;  2GFQ A;  1VIX A;  1IOF A;  1Z8W A;  5J1Q A;  5CPA A;  3B8G A;  2R8V A;  4CGN A;  2CF4 A;  2Z3P A;  4FD5 A;  2HB6 A;  4KOU A;  5GCN A;  2YNC C;  3DGV A;  3K9T A;  3EC4 A;  4X8I A;  3WAB A;  2ZED A;  6CPA A;  4NGT A;  3IIB A;  3EY5 A;  4JZ0 A;  5AGE A;  3VAT A;  1DE4 C;  4A37 A;  4HKF A;  4FD7 A;  4KVO E;  4EME A;  3PGP A;  1BOB A;  4UCN A;  2BOA A;  4F8Z A;  4DNC A;  1VHS A;  2AJ6 A;  3FJU A;  1JWQ A;  4IAV A;  2FXF A;  4OAE A;  2ODF A;  5EBV A;  5KTA A;  3NFZ A;  4OP4 A;  1QST A;  7CPA A;  4YFJ A;  3CXP A;  5ISV A;  1HEE A;  4IUS A;  1S3Z A;  2PSW A;  3T8W A;  2RFH A;  4E0A A;  2PRQ A;  2O28 A;  4AXV A;  5F09 A;  2OR4 A;  3FBU A;  1FY7 A;  2PJC A;  4NF1 A;  4ORF A;  3S6G A;  3KL9 A;  5G21 A;  4M3S A;  4KUA A;  5G22 A;  1R57 A;  4NGS A;  1DTD A;  1IIC A;  4PXD A;  4FWU A;  2DF5 A;  3GLJ A;  2OZH A;  4CGL A;  2Z10 A;  2FCK A;  3PB9 X;  5IV0 A;  1Z8T A;  5CBM A;  3TO7 A;  2Q7S A;  3KI9 A;  3BJ8 A;  3DSB A;  4MFQ A;  3F0A A;  1S7N A;  1RO5 A;  2ANP A;  3R9E A;  4A30 A;  4K3N A;  2FSR A;  1IYK A;  2D4P A;  4OIW A;  4A95 A;  2PJ5 A;  3B7I A;  5LYL A;  1YGH A;  4F6A A;  3QNV A;  4P6Y A;  3LOD A;  3W6S A;  1XF8 A;  1CP7 A;  2AFX A;  3V7Z A;  3TOB A;  4NJQ A;  2VXK A;  1XRY A;  5LYD A;  4MI4 A;  3CXS A;  3NH4 A;  3SXN A;  3IEH A;  4JYW A;  3G8W A;  4RN7 A;  2J8R A;  4IHM A;  2REF A;  2ARH A;  3MN8 A;  3HLP A;  2CNT A;  2PIZ A;  2PJ0 A;  3WC5 A;  1Y9K A;  3KQX A;  1YVO A;  4CAE A;  3PP9 A;  4RI1 A;  4A32 A;  2C1C A;  3H8G A;  4R3K A;  4R7M A;  4KSF A;  2GU2 A;  4UCM A;  4CAF A;  4NGQ A;  2GRE A;  3B2Y A;  3V38 A;  1ARL A;  4HNY B;  5H84 A;  2AFW A;  2Q04 A;  4C68 A;  3BI0 A;  2WUU A;  4NCZ A;  2Y0M A;  2P6F A;  3I3G A;  4UWI A;  2F8H A;  4ZY1 A;  2ZEM A;  1TXR A;  2ZW5 A;  2NYQ A;  3KZW A;  1PU9 A;  1PCA A;  4B11 A;  4QBJ A;  3KAS A;  4UCP A;  2V77 A;  1ZO0 A;  5LRK A;  1S5K A;  4MBU A;  5AG4 A;  4MCP A;  2IJZ A;  3KR4 A;  4B14 A;  2P6G A;  4JWP A;  4ONW A;  2GIV A;  4A31 A;  2ZEP A;  3D66 A;  1BPM A;  3IJ3 A;  4H6U A;  3D2P A;  2FS5 A;  4RUH A;  3D8P A;  4XPK A;  3T90 A;  3TE4 A;  4U5Y A;  4CGM A;  2CIJ A;  2Z3L A;  1AUG A;  3F8K A;  2PQ8 A;  2PE3 A;  4TWE A;  4XNH B;  3IU1 A;  4CAW A;  4CRZ B;  5F46 A;  2BL1 A;  4KSI A;  1YVK A;  4MRI A;  4UFW A;  1LFW A;  3FRM A;  4UA3 A;  2JLM A;  3MRU A;  1CX8 A;  2V8H A;  1ZG7 A;  3D7D A;  4EFD A;  4P4D A;  2XEF A;  3B3S A;  3ISZ A;  3TCV A;  3LAC A;  3EFA A;  4AVB A;  4B10 A;  3ZZI A;  1CP6 A;  1S7F A;  1NSA A;  3RNZ A;  3TFY A;  3UY5 A;  2VZY A;  4PXB A;  4KOS A;  3KGQ A;  2VI7 A;  2Z3M A;  3H5Z A;  1KWM A;  3PB4 X;  2Q0Y A;  3OWC A;  1Y0Y A;  3IWE A;  3PB6 X;  1UWY A;  4JJX A;  4AVC A;  1NMT A;  1QSM A;  3EXN A;  3NE7 A;  4KUB A;  4R9M A;  4MY0 A;  2ZOF A;  1TIQ A;  2PVW A;  1NSL A;  3SXO A;  3G3S A;  1YLO A;  4KOR A;  4LX9 A;  1ON0 A;  4OID A;  2AFU A;  5D8N A;  5DWN A;  1XBU A;  2B5G B;  2PJ4 A;  5A28 A;  3SI2 A;  1LOK A;  2B3V A;  4ZYQ A;  4F9V A;  1OZP A;  1LCP A;  1K4J A;  1B87 A;  2CY2 A;  2OB0 A;  4P4B A;  5J8C A;  4MHN A;  4UFV A;  4WWV A;  2B4B A;  4H89 A;  4IK2 A;  2ZEE A;  2Q51 A;  1YRE A;  3GKR A;  1F2P A;  2RB7 A;  4HNW B;  3SI1 A;  5IB0 A;  2OH1 A;  3RAM A;  3TC8 A;  4E2A A;  2B3U A;  4DUK A;  2CNM A;  2P6E A;  2C6C A;  3IU2 A;  2VZZ A;  4JD6 A;  4NXY A;  3TT2 A;  2DPT A;  3VAR A;  2PJ9 A;  5F47 A;  3WR7 A;  2R98 A;  3PBB A;  3S6H A;  4R57 A;  4QB9 A;  1M4D A;  2OZU A;  4OC1 A;  4KOW A;  5C88 A;  2B4D B;  4UFX A;  1TKJ A;  2DPS A;  1Q2D A;  4JXQ A;  4CGO A;  4A38 A;  4PSW A;  1XMT A;  4CYP A;  4XPD C;  4LQ6 A;  3S9N A;  1AYE A;  4P44 A;  1AMP A;  2V8D A;  4NGN A;  4P45 A;  1EE3 P;  2PJ7 A;  2BUE A;  4U9Y A;  4PXE A;  4FUU A;  1XMB A;  5AG7 A;  2FL4 A;  2PRB A;  3PBE A;  3FED A;  4YRH A;  2ZXV A;  1RTQ A;  4M85 A;  4XPD B;  3GYA A;  4MCS A;  3R1K A;  3PEI A;  2QML A;  4F0Y A;  2IL4 A;  2C6G A;  4A39 A;  4A94 A;  1GYT A;  3EO4 A;  2ZEN A;  4AG9 A;  1CG2 A;  2Q4Z A;  3CZX A;  3IGR A;  5BWA B;  1CM0 A;  2POK A;  1LAM A;  1B6B A;  4PK2 A; 
#chains in the Genus database with same CATH homology
 2GAN A;  5HH1 A;  2Z3N A;  4KOV A;  5EC4 A;  2HV2 A;  4R3L A;  4KOY A;  2R7H A;  1U6M A;  1MJA A;  4MHD A;  2JDD A;  4A33 A;  2B58 A;  4MFZ A;  2YNE A;  4C2Z A;  2PDO A;  4UWJ A;  3SHP A;  2OU2 A;  2FIW A;  2Q44 A;  3DDD A;  4CYQ A;  3D3S A;  2ZW7 A;  3E0K A;  2CXA A;  2A4N A;  2VQY A;  4ZGY B;  3H4Q A;  4MJ8 A;  3DNS A;  4C2X A;  4CGP A;  1GHE A;  4B5O A;  2FE7 A;  2Z3K A;  4RS2 A;  2RC4 A;  3GY9 A;  2KCW A;  5H86 A;  4PK3 A;  2JEV A;  4KVX A;  3QB8 A;  2R1I A;  4KLV A;  4CRY B;  3DR6 A;  3KKW A;  4Y49 C;  4NSQ A;  1L0C A;  2ZW4 A;  1UFH A;  3RYO A;  1M1D A;  2OZG A;  2YGW A;  5AG6 A;  2YNC A;  4JLY A;  5KTC A;  2Q4Y A;  2Q7B A;  1MJB A;  4IF5 A;  3I9S A;  4KOT A;  2BEI A;  4BBH A;  3R9F A;  4B13 A;  1PUA A;  2K5T A;  4I49 A;  5KTD A;  4MFK A;  3ZJ0 A;  1S7L A;  3F5B A;  4QVT A;  1M44 A;  4C7I A;  4CAV A;  1KUY A;  1I21 A;  1P4N A;  2WPW A;  2I00 A;  1YLE A;  4UBR A;  4C2Y A;  2VBQ A;  1IID A;  4X5K A;  2Z0Z A;  3FXT A;  3S6F A;  2DXQ A;  1N71 A;  4E8O A;  3JUW A;  3TOA A;  4AB7 A;  2HQY A;  4KSA A;  4PV6 A;  1NE9 A;  4MFL A;  2BSW A;  2JDC A;  2F5I A;  5DWM A;  4EVY A;  1Z4R A;  1BO4 A;  2PC1 A;  3BLN A;  2Z11 A;  4KSF A;  5F49 A;  2ATR A;  4CYO A;  2J8N A;  2G3A A;  2EUI A;  5CNP A;  1XEB A;  5I0C A;  4KOX A;  4Q38 A;  3JVN A;  3K9U A;  5J8F A;  4HNX B;  4XNH C;  3FYN A;  5E96 A;  4Q36 A;  4Y49 B;  1Y9W A;  4BMH A;  1I1D A;  1SQH A;  1Q2Y A;  3MGD A;  4K30 A;  5AG5 A;  3TO6 A;  1YK3 A;  4B12 A;  4NEX A;  3TTH A;  2H5M A;  5A27 A;  4OAD A;  3W6X A;  3IWG A;  3R9G A;  4H6Z A;  1QSR A;  2QIR A;  3VWD A;  1CJW A;  3C26 A;  1J4J A;  2PR1 A;  2FT0 A;  1KUV A;  1Z9U A;  1XIX A;  5G20 A;  4CYN A;  2NMT A;  4U9Z A;  3T9Y A;  3D2M A;  4L89 A;  2YND A;  3V8I A;  1RXT A;  2HUZ A;  4PSX A;  4KLW A;  3DR8 A;  1I12 A;  4F0X A;  4FD6 A;  4MFP A;  4JXR A;  1IYL A;  2AE6 A;  4CS0 B;  4B5P B;  4XPL A;  3BJ7 A;  4II9 A;  1KUX A;  1S60 A;  2Z3O A;  4OLL A;  4KVM E;  1KZF A;  4AG7 A;  4A2Z A;  3JTK A;  4FD4 A;  1M4G A;  1YR0 A;  3FNC A;  5HMN A;  3R96 A;  2C27 A;  3FIX A;  4KS9 A;  5FVJ A;  1YX0 A;  2WSA A;  3FB3 A;  4LUA A;  5IX3 A;  4C7H A;  3N7Z A;  4AVA A;  2I79 A;  1WK4 A;  1Q2C A;  1Z4E A;  3CXQ A;  5JPH A;  4ONU A;  4CAX A;  2QEC A;  3LD2 A;  4MY3 A;  4J3G A;  4GS4 A;  2VEZ A;  3P2H A;  3PZJ A;  4QC6 A;  3S6K A;  1M4I A;  1XE4 A;  4R87 A;  2Q4V A;  4KZT A;  4YGO A;  3P2F A;  3A9L A;  2REE A;  2D4O A;  3W91 A;  1V0C A;  2WPX A;  1S7K A;  1MK4 A;  1MJ9 A;  1P0H A;  2ZPA A;  2CNS A;  2PR8 A;  1WWZ A;  1LRZ A;  2X7B A;  3QAH A;  2G3T A;  2ZW6 A;  4B5P A;  1QSO A;  1Y7R A;  1IB1 E;  5C82 A;  2J8M A;  3VWE A;  4MFJ A;  4L8A A;  2FIA A;  2GE3 A;  1VKC A;  2G0B A;  2EVN A;  2P0W A;  4QUS A;  2B5G A;  4ZBG A;  1QSN A;  2B4D A;  3TO9 A;  5JQ4 A;  5F48 A;  3R95 A;  5G1Z A;  3B8G A;  2R8V A;  4CGN A;  2Z3P A;  4FD5 A;  4KOU A;  5GCN A;  2YNC C;  3EC4 A;  3EY5 A;  5AGE A;  4HKF A;  4FD7 A;  4KVO E;  3PGP A;  1BOB A;  4UCN A;  4DNC A;  1VHS A;  2AJ6 A;  4OAE A;  2FXF A;  5EBV A;  5KTA A;  1QST A;  4YFJ A;  3CXP A;  5ISV A;  4IUS A;  1S3Z A;  2PSW A;  4E0A A;  2O28 A;  4NF1 A;  3FBU A;  1FY7 A;  4ORF A;  3S6G A;  5G21 A;  4M3S A;  4KUA A;  5G22 A;  1R57 A;  1IIC A;  2OZH A;  4CGL A;  2Z10 A;  2FCK A;  5IV0 A;  3TO7 A;  3BJ8 A;  3DSB A;  4MFQ A;  3F0A A;  1S7N A;  1RO5 A;  4A30 A;  3R9E A;  2FSR A;  1IYK A;  2D4P A;  4A95 A;  1YGH A;  4F6A A;  3LOD A;  3W6S A;  1XF8 A;  3TOB A;  2VXK A;  4MI4 A;  3CXS A;  3SXN A;  3G8W A;  2J8R A;  2REF A;  2ARH A;  2CNT A;  1Y9K A;  1YVO A;  4CAE A;  3PP9 A;  4RI1 A;  4A32 A;  4R3K A;  4UCM A;  4CAF A;  4HNY B;  5H84 A;  2Q04 A;  4C68 A;  2WUU A;  4NCZ A;  2Y0M A;  2P6F A;  3I3G A;  4UWI A;  2ZW5 A;  4B11 A;  4QBJ A;  1PU9 A;  4UCP A;  1ZO0 A;  1S5K A;  4MBU A;  5AG4 A;  4B14 A;  2P6G A;  4JWP A;  2GIV A;  4A31 A;  4H6U A;  3TE4 A;  3D2P A;  2FS5 A;  3D8P A;  4XPK A;  3T90 A;  4U5Y A;  4CGM A;  2Z3L A;  3F8K A;  4CAW A;  2PQ8 A;  4XNH B;  4CRZ B;  5F46 A;  3IU1 A;  2BL1 A;  1YVK A;  4UFW A;  3FRM A;  4UA3 A;  2JLM A;  3TCV A;  3EFA A;  4AVB A;  4B10 A;  3ZZI A;  1S7F A;  3TFY A;  3UY5 A;  2VZY A;  4KOS A;  2VI7 A;  2Z3M A;  3H5Z A;  2Q0Y A;  3OWC A;  3IWE A;  4JJX A;  4AVC A;  1NMT A;  1QSM A;  3EXN A;  3NE7 A;  4KUB A;  4R9M A;  4MY0 A;  1TIQ A;  1NSL A;  3SXO A;  3G3S A;  4KOR A;  4LX9 A;  1ON0 A;  5DWN A;  2B5G B;  5A28 A;  2B3V A;  1OZP A;  1K4J A;  1B87 A;  2CY2 A;  2OB0 A;  5J8C A;  4UFV A;  2B4B A;  4H89 A;  1YRE A;  3GKR A;  4HNW B;  5IB0 A;  2OH1 A;  4E2A A;  2B3U A;  2CNM A;  2P6E A;  4NXY A;  3IU2 A;  2VZZ A;  4JD6 A;  3TT2 A;  2DPT A;  5F47 A;  3WR7 A;  2R98 A;  3S6H A;  4R57 A;  4QB9 A;  1M4D A;  2OZU A;  5C88 A;  4KOW A;  2B4D B;  4UFX A;  1Q2D A;  2DPS A;  4JXQ A;  4CGO A;  4PSW A;  1XMT A;  4CYP A;  4XPD C;  2BUE A;  4U9Y A;  5AG7 A;  2FL4 A;  2PRB A;  4YRH A;  2ZXV A;  4XPD B;  4M85 A;  3GYA A;  3R1K A;  2QML A;  4F0Y A;  2IL4 A;  3EO4 A;  4AG9 A;  3IGR A;  5BWA B;  1CM0 A;  1B6B A;  4PK2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...