2FIWA

Crystal structure of the gcn5-related n-acetyltransferase: aminotransferase, class-ii from rhodopseudomonas palustris
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
160
structure length
160
Chain Sequence
GHMVMSTPALRPYLPEDAAVTAAIFVASIEQLTADDYSEEQQEAWASAADDEAKFAARLSGQLTLIATLQGVPVGFASLKGPDHIDMLYVHPDYVGRDVGTTLIDALEKLAGARGALILTVDASDNAAEFFAKRGYVAKQRNTVSINGEWLANTTMTKSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GCN5-related N-acetyltransferase:Aminotransferase, class-II
publication title Crystal Structure of the GCN5-Related N-acetyltransferase: Aminotransferase, Class-II from Rhodopseudomonas palustris
rcsb
source organism Rhodopseudomonas palustris
molecule tags Transferase
total genus 46
structure length 160
sequence length 160
ec nomenclature
pdb deposition date 2005-12-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13673 Acetyltransf_10 Acetyltransferase (GNAT) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 2fiwA00
3CXQA 4RS2A 4NCZA 4F0YA 1Y7RA 2DXQA 4GS4A 4KOWA 4B5PB 3T90A 4QBJA 4KLVA 1M4IA 3CXPA 2REEA 3S6HA 4HNXB 3TTHA 1NE9A 3H4QA 3R9GA 1I12A 5JQ4A 1CM0A 1MJ9A 3D8PA 2B5GB 1MJAA 2J8NA 3FXTA 1IICA 4BMHA 1KUYA 3TOAA 2A4NA 2BL1A 3RYOA 5CNPA 1YVKA 2JDDA 2R7HA 4IUSA 2FXFA 3GKRA 2QIRA 3DR6A 4FD7A 3E0KA 4AVAA 4ONUA 3SHPA 2R1IA 4R3KA 4CAXA 2B3VA 1S7FA 2BSWA 3D3SA 4PV6A 2ZPAA 2HV2A 4LUAA 2VXKA 1YX0A 4KLWA 1QSTA 1R57A 4KORA 3WR7A 2FSRA 2B4DA 4MY3A 4H89A 1RO5A 1CJWA 1YVOA 4JXRA 3S6KA 4R9MA 5EC4A 1P4NA 1M4DA 1IYLA 4XPLA 4RI1A 2G3TA 2CNTA 5JPHA 2HQYA 4HNWB 2PDOA 5F48A 5ISVA 2VEZA 3TOBA 5IX3A 2QMLA 1ON0A 4I49A 2GE3A 1KUXA 1XIXA 2HUZA 3JVNA 5KTAA 3PZJA 2GIVA 2B3UA 2OU2A 4UBRA 2O28A 2EUIA 1PUAA 2ATRA 2B4DB 3S6GA 3FB3A 4MJ8A 5H84A 5J8FA 4AVBA 1U6MA 1I21A 5E96A 4M85A 2FIAA 3NE7A 1QSMA 2G0BA 3TO6A 3OWCA 1QSRA 2R8VA 3R1KA 3PGPA 2QECA 1XMTA 2KCWA 1UFHA 2P6GA 4JD6A 2OZUA 3DNSA 1MK4A 4UWIA 4U5YA 3TCVA 2AJ6A 1SQHA 3V8IA 4HNYB 1B87A 4KVME 5J8CA 4F6AA 4J3GA 3FYNA 2CNSA 1XE4A 2Q4VA 4KOTA 3B8GA 3VWEA 4II9A 4CRYB 2FS5A 3KKWA 4PK2A 2REFA 1S5KA 1BOBA 3GY9A 4JWPA 1IIDA 4NXYA 3F0AA 3W91A 1VHSA 1P0HA 4NF1A 3BJ8A 2FE7A 4PK3A 1IB1E 1S3ZA 2PC1A 4R3LA 3EO4A 4UWJA 5HH1A 4YRHA 4MI4A 3ZJ0A 4U9YA 2G3AA 2ARHA 4FD4A 1B6BA 3CXSA 4XNHC 2P6EA 4KZTA 4ORFA 4PSWA 3G3SA 1KZFA 1RXTA 1S7LA 4KOYA 2CY2A 3BJ7A 1YR0A 1BO4A 2B58A 3D2MA 4AVCA 3IGRA 4NSQA 3IWGA 4QUSA 3G8WA 2K5TA 4OADA 5KTCA 4CRZB 4UA3A 4IF5A 4KVXA 3LODA 4L8AA 4KOVA 4FD6A 5DWMA 4B5OA 1IYKA 3R95A 3TFYA 4MY0A 3K9UA 3VWDA 2FL4A 4KOXA 4QB9A 4QVTA 2NMTA 3LD2A 4E8OA 3D2PA 1XEBA 4K30A 4OAEA 2B4BA 1PU9A 5HMNA 2OB0A 4LX9A 5KTDA 3TO9A 2Y0MA 1S60A 4CS0B 4KVOE 2Q0YA 2I00A 1Z9UA 2I79A 2AE6A 3SXNA 5F47A 2B5GA 1L0CA 4M3SA 3SXOA 2FIWA 3W6SA 4E0AA 2FCKA 3F5BA 4R57A 2PR1A 2VZZA 3BLNA 1Q2DA 1Z4RA 2P0WA 1Q2YA 4JLYA 1S7KA 4CAWA 1MJBA 2ZW7A 2JDCA 2RC4A 2ZW5A 1YK3A 4X5KA 4XNHB 1K4JA 2Q04A 3C26A 3I9SA 2PRBA 2VQYA 5C88A 4XPDC 3FIXA 1V0CA 2PSWA 3DR8A 3JUWA 1OZPA 4H6ZA 1WWZA 2C27A 3P2HA 4AG7A 1I1DA 5DWNA 3T9YA 2EVNA 2PR8A 5I0CA 4MHDA 4DNCA 4PSXA 3F8KA 1XF8A 1Q2CA 2D4OA 3QB8A 2JLMA 1FY7A 3EC4A 4H6UA 4NEXA 2ZW6A 1Z4EA 2Z10A 1LRZA 3R96A 1J4JA 1WK4A 2PQ8A 2VZYA 4JJXA 4FD5A 1QSNA 3DDDA 3R9EA 4KUAA 2JEVA 2OZHA 2Q4YA 2GANA 1M44A 2VI7A 2Z11A 3N7ZA 4QC6A 4AB7A 4Y49C 3PP9A 4HKFA 3FNCA 3S6FA 1YGHA 4R87A 4YGOA 4E2AA 3EY5A 1S7NA 1Y9KA 4AG9A 4OLLA 1NMTA 2ZW4A 3EFAA 3EXNA 3DSBA 2ZXVA 2WPXA 3FRMA 4ZBGA 3I3GA 1QSOA 4KOUA 1Y9WA 3TE4A 1TIQA 1NSLA 4XPDB 2X7BA 3ZZIA 3TT2A 1M1DA 1YLEA 2Q7BA 2P6FA 5H86A 4YFJA 4B5PA 2FT0A 5EBVA 2WPWA 2VBQA 1YREA 2BEIA 2BUEA 2Q44A 1KUVA 2R98A 2F5IA 3QAHA 4JXQA 5F49A 3MGDA 3R9FA 4EVYA 3UY5A 1M4GA 2J8RA 2CNMA 3TO7A 5FVJA 5GCNA 2D4PA 2OZGA 4U9ZA 2IL4A 4KOSA 1N71A 5F46A 2J8MA 4CAVA 4L89A 4MBUA 2OH1A 1VKCA 1GHEA 4KUBA 3W6XA 2Z0ZA 4XPKA 3P2FA 3FBUA 5C82A 5IV0A 5IB0A 4Y49B 3GYAA 2H5MA
chains in the Genus database with same CATH superfamily
4P4BA 1X10A 2PRQA 4PXDA 1VIXA 3CXQA 2EO8A 4NGPA 4RS2A 5G20A 2Q4ZA 3NH4A 4NCZA 4PQAA 4F0YA 4B10A 1Y7RA 2DXQA 3KASA 4GS4A 4KOWA 2IQ6A 2XEGA 4B5PB 3T90A 4QBJA 2ABZA 4A31A 4ZY0A 4KLVA 3T8WA 5LRJA 2V8DA 3CT9A 3NE8A 1CP6A 1M4IA 3CXPA 1UWYA 3QNVA 2REEA 1Z8WA 4UCPA 4NGMA 3PB4X 4LQGA 3S6HA 4HNXB 5F09A 3TTHA 3KHXA 1NE9A 3H4QA 3R9GA 1I12A 2YNCA 2V8HA 1CM0A 1MJ9A 5JQ4A 3D8PA 2B5GB 4MHPA 4OIWA 3SI2A 3S9MA 1XJOA 1MJAA 3CZXA 1CPXA 1IU8A 2J8NA 3B3TA 3FECA 3FX6A 3FXTA 1M4LA 1IICA 4BMHA 5AG6A 1KUYA 2ZEDA 2A4NA 5DS0A 2BL1A 3TOAA 4DUKA 3RYOA 2ZEEA 4BBHA 4FAIA 3IJ3A 5CNPA 3WC6A 1YVKA 5LRGA 2JDDA 2R7HA 4IUSA 2FXFA 3GKRA 2QIRA 3DR6A 4FD7A 1AYEA 3E0KA 3FJUA 4ONUA 3LACA 3SHPA 3VARA 4AVAA 1IOIA 4NJRA 2R1IA 4R3KA 2ZEOA 3WC5A 4CAXA 2B3VA 3FH4A 1S7FA 1Z8XA 4OC5A 2BSWA 1CPSA 4OC3A 3D3SA 1YSJA 2ZPAA 4PV6A 2HV2A 4LUAA 5JM6A 2VXKA 5K8MA 2DPSA 2ZEGA 1YX0A 4KLWA 1QSTA 1R57A 4M6HA 5A27A 4KORA 1ZO0A 2RFHA 2QVPA 2FSRA 2PCUA 3WR7A 2B4DA 2CTBA 4MY3A 5BWAB 1Y0RA 1Z2LA 1RO5A 4H89A 2RB7A 1CJWA 5K8OA 4KSAA 4F9UA 1YVOA 4NGRA 4JXRA 1ZG9A 2GLFA 4R9MA 3S6KA 4KSFA 5EC4A 1P4NA 1M4DA 1IYLA 4JZ0A 2DF5A 4XPLA 5LRKA 4GM5A 4HPSA 4RI1A 2G3TA 2CNTA 5JPHA 2HQYA 5JH9A 2BCOA 4UCNA 4HNWB 2PDOA 3JTKA 5F48A 3S9LA 5ISVA 2VEZA 2ZELA 2AFZA 2JBKA 3TOBA 3MN8A 2EK8A 5HVHA 2CXAA 2IJZA 3FMCA 5IX3A 1VHEA 2JEWA 2QMLA 1ON0A 4FUUA 1DTDA 3B3CA 4I49A 4MFPA 4NGTA 3JRUA 4R7MA 1XBUA 2GE3A 4K3NA 4A94A 4CGMA 4ZY1A 3BXMA 4UIAA 4CGNA 2CF4A 3RZAA 1KUXA 1XIXA 2HUZA 4G1PA 1LAMA 5HVGA 2WSAA 3JVNA 4M6IA 4ZI6A 4R76A 5KTAA 4JYWA 2CTCA 3PZJA 2GIVA 4NGQA 2B3UA 2OU2A 4UBRA 3IC1A 1R43A 2O28A 4MHZA 1Z8LA 2EUIA 1F2PA 1Z5RA 1PUAA 2ATRA 2B4DB 3IFEA 3S6GA 1CBXA 1HDQA 4YU9A 3FB3A 4MJ8A 2PJ2A 5H84A 1ELMP 5J8FA 4AVBA 3WC7A 1BAVA 1U6MA 1I21A 5E96A 4M85A 2FIAA 4LQ6A 2GREA 3NE7A 4P4IA 1PCAA 5LYFA 1QSMA 3H8EA 5AGEA 1LANA 2G0BA 3TO6A 5KTCA 2V77A 3OWCA 2NYQA 5LYLA 1BPMA 1QSRA 2PJAA 2Z3OA 3KQXA 3H5ZA 5D29A 3V7ZA 4A33A 5K8NA 4X3RA 2DPTA 2R8VA 3R1KA 5AG4A 7CPAA 2Z3MA 3PGPA 4MHNA 1TKHA 1ZLHA 2QECA 3D4UA 4C2ZA 1XMTA 2KCWA 2J9AA 3GUXA 3SI0A 2PIYA 1UFHA 4C2XA 1A2ZA 1OBRA 2P6GA 4ZX8A 1YMEA 4JD6A 4OC4A 4CYOA 1YW4A 4ZGYB 2C1CA 3B7IA 2OZUA 3DNSA 2GFQA 1MK4A 4UWIA 4U5YA 3L2NA 3TCVA 3BI1A 3VATA 2AJ6A 2QJ8A 1SQHA 3V8IA 1KWMA 2G9DA 2VL1A 4HNYB 4F0XA 4C7HA 1IY7A 1B87A 2WUUA 4KVME 3PB6X 5AG7A 4J3GA 4F6AA 5J8CA 2EWBA 3FYNA 2CNSA 1XE4A 3SJGA 2Q4VA 4KOTA 3B8GA 3VWEA 2AFUA 3PEIA 4II9A 4CRYB 4R6TA 2FS5A 3KKWA 2EBJA 4PK2A 2AFOA 4EWTA 1Y0YA 2REFA 4B12A 1S5KA 1BOBA 3FEDA 3GY9A 4JWPA 3KGQA 4OC2A 1IIDA 3KZWA 4NXYA 4P4DA 4PXEA 5JGFA 3CPXA 2ZOFA 3SJFA 3F0AA 2QYVA 4RUHA 3W91A 4Z65A 1VHSA 3PBBA 3D7FA 5G21A 1P0HA 3BI0A 2EK9A 4NF1A 3BJ8A 4RN7A 2FE7A 4PK3A 1ARLA 4F8ZA 1X12A 1PYTB 1Z8TA 4A39A 1IB1E 4EMEA 1S3ZA 2PC1A 4R3LA 4MFLA 3EO4A 4UWJA 5HH1A 2PE3A 4YRHA 2FVGA 2PJ5A 4MI4A 4MRIA 3ZJ0A 3H8FA 3HUVA 3PFOA 4U9YA 4UIBA 3TC8A 4A32A 2PJ1A 2G3AA 5IB9A 2ARHA 4FD4A 1B6BA 2O53A 1GYTA 3BHXA 3CXSA 5G1ZA 5THWA 4XNHC 5AG5A 4A30A 2P6EA 3KL9A 4KZTA 4ORFA 3MRUA 4PSWA 3G3SA 1KZFA 1RXTA 1S7LA 1IGBA 5D8NA 1ZG8A 4KOYA 2O4HA 1YQEA 4M6GA 2CY2A 3BJ7A 2PJ7A 1YR0A 1BO4A 3CDXA 2B58A 2PVVA 2PJCA 3D2MA 3GLJA 4AVCA 3IGRA 4NSQA 3IWGA 2ZEHA 4QUSA 5HVFA 3G8WA 4CGLA 4ONWA 4MFJA 2K5TA 3PB8X 1TKJA 4OADA 1CX8A 4TNUA 4P4EA 3RNZA 2F8HA 4KSIA 4IF5A 4KVXA 3K2KA 3LODA 4L8AA 4KOVA 4UA3A 2ZENA 4FD6A 5DWMA 4B5OA 1IYKA 3R95A 3IWEA 4R8FA 4B11A 4C2YA 3TFYA 4MY0A 2AFWA 3K9UA 3IEHA 3VWDA 2F7VA 4ZYQA 2Z3KA 2FL4A 4KOXA 3IU2A 4QB9A 2Q43A 4MCSA 4P44A 4QVTA 2NMTA 3LD2A 4E8OA 3QAYA 3D2PA 1XEBA 3LMSA 5J1QA 4NGSA 3D67A 4MHYA 4K30A 2DEAA 3D7GA 3FF3A 4OAEA 1CG2A 1TXRA 2B4BA 2PJ6A 2ZEFA 3B3WA 4EVYA 4UFWA 5A28A 1PU9A 1JQGA 5HMNA 2I3CA 2YGWA 2OB0A 4LX9A 1HEEA 5KTDA 3TO9A 3IU1A 4OC1A 4MCRA 2Y0MA 1S60A 4CS0B 4BINA 4KVOE 1BLLE 1EE3P 3GB0A 2ODFA 2Q0YA 3PB9X 4CGOA 2AFSA 2I00A 4OKOA 1Z9UA 2AFXA 3IWWA 2I79A 3RO0A 4NGNA 2AE6A 2BOAA 3SXNA 5F47A 2B5GA 1L0CA 3FEEA 4OIDA 4F9VA 2PJ8A 4IK2A 4UEEA 4M3SA 3SXOA 2FIWA 3W6SA 4BD9A 1ZG7A 1CP7A 4E0AA 2FCKA 3F5BA 2IMOA 4R57A 3S9NA 2PR1A 2VZZA 3BLNA 2PJBA 1AUGA 1Q2DA 3B3VA 3KHZA 4UCMA 1Z4RA 2P0WA 1Q2YA 3ISXA 4JLYA 4OMEA 1QQ9A 1S7KA 4FBEA 4CAWA 4C7IA 4ZX9A 1MJBA 2ZW7A 2JDCA 2RC4A 2WYRA 2ZW5A 4P4JA 4EFDA 4UFVA 1YK3A 2ZEMA 4B13A 4X5KA 4XNHB 1K4JA 3SJEA 2Q04A 3I1UA 3C26A 3I9SA 2Z3NA 3A9LA 2PRBA 2VQYA 2YNEA 5C88A 4XPDC 4CAEA 8CPAA 3FIXA 5HXDA 4P4FA 5K8PA 1V0CA 2PSWA 4P10A 3DR8A 3JUWA 1OZPA 4H6ZA 1LFWA 1XOVA 1WWZA 5EMIA 2C27A 4CYPA 3P2HA 4AG7A 1I1DA 3KI9A 4MCPA 5DWNA 1ELLP 2Q7SA 3KR4A 3SI1A 2PJ4A 3T9YA 3TX8A 2EVNA 3NH5A 4A37A 2PR8A 4UF4A 4P6YA 5I0CA 4MHDA 3NA6A 4UFXA 2OOTA 4DNCA 4PSXA 5CPAA 1IOFA 4A2ZA 4C68A 3F8KA 1TKFA 1XF8A 1Q2CA 2D4OA 2BO9A 2V8VA 4PXBA 3QB8A 5ELYA 2JLMA 4YWYA 1FY7A 3EC4A 4H6UA 4DJLA 1XRYA 3V38A 3SJXA 2GU2A 4MCQA 4NEXA 2ZW6A 3D7DA 4IAVA 6CPAA 1Z4EA 2Z10A 5G22A 1LRZA 3R96A 1ZLIA 1VGYA 3K9TA 1J4JA 1NSAA 1WK4A 3B3SA 3PRTA 3DGVA 4FWUA 2XEFA 2PQ8A 1QMUA 2HC9A 3D7HA 1VHOA 2VZYA 4FD5A 4JJXA 4IHMA 4CYNA 1QSNA 1TF9A 3DDDA 4KUAA 3R9EA 2JEVA 1TF8A 2OZHA 2Q4YA 3FVLA 4KS9A 2GANA 1M44A 4A38A 2VI7A 2Z11A 4Q36A 2GLJA 5LYIA 3N7ZA 4QC6A 4AB7A 4UEFA 4Y49C 3PP9A 4OP4A 1H8LA 3PBEA 2NSMA 4HKFA 1LOKA 2POKA 3FNCA 3S6FA 4CGPA 4CYQA 1YGHA 1ARMA 4R87A 4MMOA 4YGOA 4E2AA 3EY5A 2CIJA 3ISZA 3D68A 1S7NA 2JBJA 3KQZA 2YNDA 1Y9KA 3N5FA 4TWEA 3WT4A 4AG9A 5CBMA 4OLLA 3IIBA 4PXCA 1DE4C 1Y7EA 3DLJA 1NMTA 2ZW4A 3EFAA 3EXNA 3DSBA 4GXHA 2ZXVA 3LWUA 2WPXA 1YLOA 3FRMA 4ZBGA 3I3GA 2PJ0A 4MXUA 1QSOA 4KOUA 4NJQA 4PPZA 1Y9WA 3TE4A 4AXVA 2C6GA 2ZEPA 1TIQA 2XEJA 1NSLA 2HB6A 4Q38A 1FNOA 3PB7X 4XPDB 2X7BA 2OR4A 3ZZIA 3TT2A 1M1DA 1YLEA 3D66A 5I4MA 4OC0A 1JWQA 2Q7BA 4P45A 4CAFA 2Z3LA 2P6FA 3H8GA 3KR5A 4MFZA 5H86A 4YFJA 4B5PA 2FT0A 3IO1A 5EBVA 2WPWA 4WWVA 2VBQA 1R3NA 1YREA 2BEIA 2BUEA 1XFOA 2C6CA 2PJ3A 4NFRA 2Q44A 1KUVA 2R98A 3WABA 3GIUA 4WJBA 4X8IA 2PVWA 2XEIA 3B2YA 2F5IA 3QAHA 4JXQA 5F49A 3MGDA 2WZNA 4MFKA 3NFZA 3R9FA 1AMPA 4O23A 1F2OA 2Z3PA 1M4GA 2J8RA 3RBUA 1YW6A 2CNMA 2V8GA 3UY5A 1FT7A 4CRZB 4Q7AA 3RAMA 2AFMA 5LYDA 2ZOGA 3CPAA 3TO7A 5FVJA 4DYOA 5GCNA 2D4PA 2OZGA 4U9ZA 2IL4A 4KOSA 1N71A 4B14A 4UEZA 3B35A 2PJ9A 5F46A 2J8MA 1F57A 2C6PA 3PFEA 1XMBA 4W9YA 4L89A 4CAVA 4MBUA 2OH1A 1Q7LA 1VKCA 1GHEA 4KUBA 3W6XA 1BPNA 2Z0ZA 2YNCC 3HLPA 1LCPA 2PIZA 4XPKA 4CPAA 3P2FA 4H2KA 4X2TA 3FBUA 3NH8A 5C82A 2ANPA 1LAPA 3VH9A 5IV0A 1HDUA 4ZY2A 4B6ZA 4A95A 4MFQA 5IB0A 4Y49B 2Q51A 1RTQA 3GYAA 2H5MA
chains in the Genus database with same CATH topology
3CXQA 4RS2A 5G20A 4NCZA 4F0YA 4B10A 1Y7RA 2DXQA 4GS4A 4KOWA 4B5PB 3T90A 4QBJA 4A31A 4KLVA 1M4IA 3CXPA 2REEA 4UCPA 3S6HA 4HNXB 3TTHA 1NE9A 3H4QA 3R9GA 1I12A 2YNCA 5JQ4A 1CM0A 1MJ9A 3D8PA 2B5GB 1MJAA 2J8NA 3FXTA 1IICA 4BMHA 5AG6A 1KUYA 3TOAA 2A4NA 2BL1A 3RYOA 4BBHA 5CNPA 1YVKA 2JDDA 2R7HA 4IUSA 2FXFA 3GKRA 2QIRA 3DR6A 4FD7A 3E0KA 4AVAA 4ONUA 3SHPA 2R1IA 4R3KA 4CAXA 2B3VA 1S7FA 2BSWA 3D3SA 4PV6A 2ZPAA 2HV2A 4LUAA 2VXKA 2DPSA 1YX0A 4KLWA 1QSTA 1R57A 5A27A 4KORA 1ZO0A 3WR7A 2FSRA 2B4DA 4MY3A 5BWAB 4H89A 1RO5A 1CJWA 4KSAA 1YVOA 4JXRA 3S6KA 4R9MA 4KSFA 5EC4A 1P4NA 1M4DA 1IYLA 4XPLA 4RI1A 2G3TA 2CNTA 5JPHA 2HQYA 4UCNA 4HNWB 2PDOA 3JTKA 5F48A 5ISVA 2VEZA 3TOBA 2CXAA 5IX3A 2QMLA 1ON0A 4I49A 4MFPA 4CGMA 2GE3A 4CGNA 1KUXA 1XIXA 2HUZA 2WSAA 3JVNA 5KTAA 3PZJA 2GIVA 2B3UA 2OU2A 4UBRA 2O28A 2EUIA 1PUAA 2ATRA 2B4DB 3S6GA 3FB3A 4MJ8A 5H84A 5J8FA 4AVBA 1U6MA 1I21A 5E96A 4M85A 2FIAA 3NE7A 1QSMA 5AGEA 2G0BA 3TO6A 3OWCA 2Z3OA 1QSRA 4A33A 3H5ZA 5AG4A 2DPTA 2R8VA 3R1KA 2Z3MA 3PGPA 2QECA 4C2ZA 1XMTA 2KCWA 4C2XA 1UFHA 2P6GA 4JD6A 4CYOA 4ZGYB 2OZUA 3DNSA 1MK4A 4UWIA 4U5YA 3TCVA 2AJ6A 1SQHA 3V8IA 4HNYB 4F0XA 4C7HA 1B87A 2WUUA 4KVME 5AG7A 4F6AA 4J3GA 5J8CA 3FYNA 2CNSA 1XE4A 2Q4VA 4KOTA 3B8GA 3VWEA 4II9A 4CRYB 2FS5A 3KKWA 4PK2A 2REFA 4B12A 1S5KA 1BOBA 3GY9A 4JWPA 1IIDA 4NXYA 3F0AA 3W91A 1VHSA 5G21A 1P0HA 4NF1A 3BJ8A 2FE7A 4PK3A 1IB1E 1S3ZA 2PC1A 4R3LA 4MFLA 3EO4A 4UWJA 5HH1A 4YRHA 4MI4A 3ZJ0A 4U9YA 4A32A 2G3AA 2ARHA 4FD4A 1B6BA 3CXSA 5G1ZA 4XNHC 5AG5A 4A30A 2P6EA 4KZTA 4ORFA 4PSWA 3G3SA 1KZFA 1RXTA 1S7LA 4KOYA 2CY2A 3BJ7A 1YR0A 1BO4A 2B58A 3D2MA 4AVCA 3IGRA 4NSQA 3IWGA 4QUSA 4CGLA 3G8WA 4MFJA 2K5TA 4OADA 5KTCA 4CRZB 4UA3A 4IF5A 4KVXA 3LODA 4L8AA 4KOVA 4FD6A 5DWMA 4B5OA 1IYKA 3R95A 3IWEA 4B11A 4C2YA 3TFYA 4MY0A 3K9UA 3VWDA 2Z3KA 2FL4A 4KOXA 3IU2A 4QB9A 4QVTA 2NMTA 3LD2A 4E8OA 3D2PA 1XEBA 4K30A 4OAEA 2B4BA 4UFWA 5A28A 1PU9A 5HMNA 2YGWA 2OB0A 4LX9A 5KTDA 3TO9A 3IU1A 2Y0MA 1S60A 4CS0B 4KVOE 2Q0YA 4CGOA 2I00A 1Z9UA 2I79A 2AE6A 3SXNA 5F47A 2B5GA 1L0CA 4M3SA 3SXOA 2FIWA 3W6SA 4E0AA 2FCKA 3F5BA 4R57A 2PR1A 2VZZA 3BLNA 1Q2DA 4UCMA 1Z4RA 2P0WA 1Q2YA 4JLYA 1S7KA 4CAWA 4C7IA 1MJBA 2ZW7A 2JDCA 2RC4A 2ZW5A 4UFVA 1YK3A 4B13A 4X5KA 4XNHB 1K4JA 2Q04A 3C26A 3I9SA 2Z3NA 3A9LA 2PRBA 2VQYA 2YNEA 5C88A 4XPDC 4CAEA 3FIXA 1V0CA 2PSWA 3DR8A 3JUWA 1OZPA 4H6ZA 1WWZA 2C27A 4CYPA 3P2HA 4AG7A 1I1DA 5DWNA 3T9YA 2EVNA 2PR8A 5I0CA 4MHDA 4UFXA 4DNCA 4PSXA 4C68A 4A2ZA 3F8KA 1XF8A 1Q2CA 2D4OA 3QB8A 2JLMA 1FY7A 3EC4A 4H6UA 4NEXA 2ZW6A 1Z4EA 2Z10A 5G22A 1LRZA 3R96A 1J4JA 1WK4A 2PQ8A 2VZYA 4JJXA 4FD5A 4CYNA 1QSNA 3DDDA 3R9EA 4KUAA 2JEVA 2OZHA 4KS9A 2Q4YA 2GANA 1M44A 2VI7A 2Z11A 4Q36A 3N7ZA 4QC6A 4AB7A 4Y49C 3PP9A 4HKFA 3FNCA 3S6FA 4CGPA 4CYQA 1YGHA 4R87A 4YGOA 4E2AA 3EY5A 1S7NA 2YNDA 1Y9KA 4AG9A 4OLLA 1NMTA 2ZW4A 3EFAA 3EXNA 3DSBA 2ZXVA 2WPXA 3FRMA 4ZBGA 3I3GA 1QSOA 4KOUA 1Y9WA 3TE4A 1TIQA 1NSLA 4Q38A 4XPDB 2X7BA 3ZZIA 3TT2A 1M1DA 1YLEA 2Q7BA 4CAFA 2Z3LA 2P6FA 4MFZA 5H86A 4YFJA 4B5PA 2FT0A 5EBVA 2WPWA 2VBQA 1YREA 2BEIA 2BUEA 2Q44A 1KUVA 2R98A 2F5IA 3QAHA 4JXQA 5F49A 3MGDA 3R9FA 4MFKA 4EVYA 2Z3PA 3UY5A 1M4GA 2J8RA 2CNMA 3TO7A 5FVJA 5GCNA 2D4PA 2OZGA 4U9ZA 2IL4A 4KOSA 1N71A 4B14A 5F46A 2J8MA 4CAVA 4L89A 4MBUA 2OH1A 1VKCA 1GHEA 4KUBA 3W6XA 2Z0ZA 2YNCC 4XPKA 3P2FA 3FBUA 5C82A 5IV0A 4A95A 4MFQA 5IB0A 4Y49B 3GYAA 2H5MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CXQ A;  4RS2 A;  4NCZ A;  4F0Y A;  1Y7R A;  2DXQ A;  4GS4 A;  4KOW A;  4B5P B;  3T90 A;  4QBJ A;  4KLV A;  1M4I A;  3CXP A;  2REE A;  3S6H A;  4HNX B;  3TTH A;  1NE9 A;  3H4Q A;  3R9G A;  1I12 A;  5JQ4 A;  1CM0 A;  1MJ9 A;  3D8P A;  2B5G B;  1MJA A;  2J8N A;  3FXT A;  1IIC A;  4BMH A;  1KUY A;  3TOA A;  2A4N A;  2BL1 A;  3RYO A;  5CNP A;  1YVK A;  2JDD A;  2R7H A;  4IUS A;  2FXF A;  3GKR A;  2QIR A;  3DR6 A;  4FD7 A;  3E0K A;  4AVA A;  4ONU A;  3SHP A;  2R1I A;  4R3K A;  4CAX A;  2B3V A;  1S7F A;  2BSW A;  3D3S A;  4PV6 A;  2ZPA A;  2HV2 A;  4LUA A;  2VXK A;  1YX0 A;  4KLW A;  1QST A;  1R57 A;  4KOR A;  3WR7 A;  2FSR A;  2B4D A;  4MY3 A;  4H89 A;  1RO5 A;  1CJW A;  1YVO A;  4JXR A;  3S6K A;  4R9M A;  5EC4 A;  1P4N A;  1M4D A;  1IYL A;  4XPL A;  4RI1 A;  2G3T A;  2CNT A;  5JPH A;  2HQY A;  4HNW B;  2PDO A;  5F48 A;  5ISV A;  2VEZ A;  3TOB A;  5IX3 A;  2QML A;  1ON0 A;  4I49 A;  2GE3 A;  1KUX A;  1XIX A;  2HUZ A;  3JVN A;  5KTA A;  3PZJ A;  2GIV A;  2B3U A;  2OU2 A;  4UBR A;  2O28 A;  2EUI A;  1PUA A;  2ATR A;  2B4D B;  3S6G A;  3FB3 A;  4MJ8 A;  5H84 A;  5J8F A;  4AVB A;  1U6M A;  1I21 A;  5E96 A;  4M85 A;  2FIA A;  3NE7 A;  1QSM A;  2G0B A;  3TO6 A;  3OWC A;  1QSR A;  2R8V A;  3R1K A;  3PGP A;  2QEC A;  1XMT A;  2KCW A;  1UFH A;  2P6G A;  4JD6 A;  2OZU A;  3DNS A;  1MK4 A;  4UWI A;  4U5Y A;  3TCV A;  2AJ6 A;  1SQH A;  3V8I A;  4HNY B;  1B87 A;  4KVM E;  5J8C A;  4F6A A;  4J3G A;  3FYN A;  2CNS A;  1XE4 A;  2Q4V A;  4KOT A;  3B8G A;  3VWE A;  4II9 A;  4CRY B;  2FS5 A;  3KKW A;  4PK2 A;  2REF A;  1S5K A;  1BOB A;  3GY9 A;  4JWP A;  1IID A;  4NXY A;  3F0A A;  3W91 A;  1VHS A;  1P0H A;  4NF1 A;  3BJ8 A;  2FE7 A;  4PK3 A;  1IB1 E;  1S3Z A;  2PC1 A;  4R3L A;  3EO4 A;  4UWJ A;  5HH1 A;  4YRH A;  4MI4 A;  3ZJ0 A;  4U9Y A;  2G3A A;  2ARH A;  4FD4 A;  1B6B A;  3CXS A;  4XNH C;  2P6E A;  4KZT A;  4ORF A;  4PSW A;  3G3S A;  1KZF A;  1RXT A;  1S7L A;  4KOY A;  2CY2 A;  3BJ7 A;  1YR0 A;  1BO4 A;  2B58 A;  3D2M A;  4AVC A;  3IGR A;  4NSQ A;  3IWG A;  4QUS A;  3G8W A;  2K5T A;  4OAD A;  5KTC A;  4CRZ B;  4UA3 A;  4IF5 A;  4KVX A;  3LOD A;  4L8A A;  4KOV A;  4FD6 A;  5DWM A;  4B5O A;  1IYK A;  3R95 A;  3TFY A;  4MY0 A;  3K9U A;  3VWD A;  2FL4 A;  4KOX A;  4QB9 A;  4QVT A;  2NMT A;  3LD2 A;  4E8O A;  3D2P A;  1XEB A;  4K30 A;  4OAE A;  2B4B A;  1PU9 A;  5HMN A;  2OB0 A;  4LX9 A;  5KTD A;  3TO9 A;  2Y0M A;  1S60 A;  4CS0 B;  4KVO E;  2Q0Y A;  2I00 A;  1Z9U A;  2I79 A;  2AE6 A;  3SXN A;  5F47 A;  2B5G A;  1L0C A;  4M3S A;  3SXO A;  2FIW A;  3W6S A;  4E0A A;  2FCK A;  3F5B A;  4R57 A;  2PR1 A;  2VZZ A;  3BLN A;  1Q2D A;  1Z4R A;  2P0W A;  1Q2Y A;  4JLY A;  1S7K A;  4CAW A;  1MJB A;  2ZW7 A;  2JDC A;  2RC4 A;  2ZW5 A;  1YK3 A;  4X5K A;  4XNH B;  1K4J A;  2Q04 A;  3C26 A;  3I9S A;  2PRB A;  2VQY A;  5C88 A;  4XPD C;  3FIX A;  1V0C A;  2PSW A;  3DR8 A;  3JUW A;  1OZP A;  4H6Z A;  1WWZ A;  2C27 A;  3P2H A;  4AG7 A;  1I1D A;  5DWN A;  3T9Y A;  2EVN A;  2PR8 A;  5I0C A;  4MHD A;  4DNC A;  4PSX A;  3F8K A;  1XF8 A;  1Q2C A;  2D4O A;  3QB8 A;  2JLM A;  1FY7 A;  3EC4 A;  4H6U A;  4NEX A;  2ZW6 A;  1Z4E A;  2Z10 A;  1LRZ A;  3R96 A;  1J4J A;  1WK4 A;  2PQ8 A;  2VZY A;  4JJX A;  4FD5 A;  1QSN A;  3DDD A;  3R9E A;  4KUA A;  2JEV A;  2OZH A;  2Q4Y A;  2GAN A;  1M44 A;  2VI7 A;  2Z11 A;  3N7Z A;  4QC6 A;  4AB7 A;  4Y49 C;  3PP9 A;  4HKF A;  3FNC A;  3S6F A;  1YGH A;  4R87 A;  4YGO A;  4E2A A;  3EY5 A;  1S7N A;  1Y9K A;  4AG9 A;  4OLL A;  1NMT A;  2ZW4 A;  3EFA A;  3EXN A;  3DSB A;  2ZXV A;  2WPX A;  3FRM A;  4ZBG A;  3I3G A;  1QSO A;  4KOU A;  1Y9W A;  3TE4 A;  1TIQ A;  1NSL A;  4XPD B;  2X7B A;  3ZZI A;  3TT2 A;  1M1D A;  1YLE A;  2Q7B A;  2P6F A;  5H86 A;  4YFJ A;  4B5P A;  2FT0 A;  5EBV A;  2WPW A;  2VBQ A;  1YRE A;  2BEI A;  2BUE A;  2Q44 A;  1KUV A;  2R98 A;  2F5I A;  3QAH A;  4JXQ A;  5F49 A;  3MGD A;  3R9F A;  4EVY A;  3UY5 A;  1M4G A;  2J8R A;  2CNM A;  3TO7 A;  5FVJ A;  5GCN A;  2D4P A;  2OZG A;  4U9Z A;  2IL4 A;  4KOS A;  1N71 A;  5F46 A;  2J8M A;  4CAV A;  4L89 A;  4MBU A;  2OH1 A;  1VKC A;  1GHE A;  4KUB A;  3W6X A;  2Z0Z A;  4XPK A;  3P2F A;  3FBU A;  5C82 A;  5IV0 A;  5IB0 A;  4Y49 B;  3GYA A;  2H5M A; 
#chains in the Genus database with same CATH topology
 4P4B A;  1X10 A;  2PRQ A;  4PXD A;  1VIX A;  3CXQ A;  2EO8 A;  4NGP A;  4RS2 A;  5G20 A;  2Q4Z A;  3NH4 A;  4NCZ A;  4PQA A;  4F0Y A;  4B10 A;  1Y7R A;  2DXQ A;  3KAS A;  4GS4 A;  4KOW A;  2IQ6 A;  2XEG A;  4B5P B;  3T90 A;  4QBJ A;  2ABZ A;  4A31 A;  4ZY0 A;  4KLV A;  3T8W A;  5LRJ A;  2V8D A;  3CT9 A;  3NE8 A;  1CP6 A;  1M4I A;  3CXP A;  1UWY A;  3QNV A;  2REE A;  1Z8W A;  4UCP A;  4NGM A;  3PB4 X;  4LQG A;  3S6H A;  4HNX B;  5F09 A;  3TTH A;  3KHX A;  1NE9 A;  3H4Q A;  3R9G A;  1I12 A;  2YNC A;  2V8H A;  1CM0 A;  1MJ9 A;  5JQ4 A;  3D8P A;  2B5G B;  4MHP A;  4OIW A;  3SI2 A;  3S9M A;  1XJO A;  1MJA A;  3CZX A;  1CPX A;  1IU8 A;  2J8N A;  3B3T A;  3FEC A;  3FX6 A;  3FXT A;  1M4L A;  1IIC A;  4BMH A;  5AG6 A;  1KUY A;  2ZED A;  2A4N A;  5DS0 A;  2BL1 A;  3TOA A;  4DUK A;  3RYO A;  2ZEE A;  4BBH A;  4FAI A;  3IJ3 A;  5CNP A;  3WC6 A;  1YVK A;  5LRG A;  2JDD A;  2R7H A;  4IUS A;  2FXF A;  3GKR A;  2QIR A;  3DR6 A;  4FD7 A;  1AYE A;  3E0K A;  3FJU A;  4ONU A;  3LAC A;  3SHP A;  3VAR A;  4AVA A;  1IOI A;  4NJR A;  2R1I A;  4R3K A;  2ZEO A;  3WC5 A;  4CAX A;  2B3V A;  3FH4 A;  1S7F A;  1Z8X A;  4OC5 A;  2BSW A;  1CPS A;  4OC3 A;  3D3S A;  1YSJ A;  2ZPA A;  4PV6 A;  2HV2 A;  4LUA A;  5JM6 A;  2VXK A;  5K8M A;  2DPS A;  2ZEG A;  1YX0 A;  4KLW A;  1QST A;  1R57 A;  4M6H A;  5A27 A;  4KOR A;  1ZO0 A;  2RFH A;  2QVP A;  2FSR A;  2PCU A;  3WR7 A;  2B4D A;  2CTB A;  4MY3 A;  5BWA B;  1Y0R A;  1Z2L A;  1RO5 A;  4H89 A;  2RB7 A;  1CJW A;  5K8O A;  4KSA A;  4F9U A;  1YVO A;  4NGR A;  4JXR A;  1ZG9 A;  2GLF A;  4R9M A;  3S6K A;  4KSF A;  5EC4 A;  1P4N A;  1M4D A;  1IYL A;  4JZ0 A;  2DF5 A;  4XPL A;  5LRK A;  4GM5 A;  4HPS A;  4RI1 A;  2G3T A;  2CNT A;  5JPH A;  2HQY A;  5JH9 A;  2BCO A;  4UCN A;  4HNW B;  2PDO A;  3JTK A;  5F48 A;  3S9L A;  5ISV A;  2VEZ A;  2ZEL A;  2AFZ A;  2JBK A;  3TOB A;  3MN8 A;  2EK8 A;  5HVH A;  2CXA A;  2IJZ A;  3FMC A;  5IX3 A;  1VHE A;  2JEW A;  2QML A;  1ON0 A;  4FUU A;  1DTD A;  3B3C A;  4I49 A;  4MFP A;  4NGT A;  3JRU A;  4R7M A;  1XBU A;  2GE3 A;  4K3N A;  4A94 A;  4CGM A;  4ZY1 A;  3BXM A;  4UIA A;  4CGN A;  2CF4 A;  3RZA A;  1KUX A;  1XIX A;  2HUZ A;  4G1P A;  1LAM A;  5HVG A;  2WSA A;  3JVN A;  4M6I A;  4ZI6 A;  4R76 A;  5KTA A;  4JYW A;  2CTC A;  3PZJ A;  2GIV A;  4NGQ A;  2B3U A;  2OU2 A;  4UBR A;  3IC1 A;  1R43 A;  2O28 A;  4MHZ A;  1Z8L A;  2EUI A;  1F2P A;  1Z5R A;  1PUA A;  2ATR A;  2B4D B;  3IFE A;  3S6G A;  1CBX A;  1HDQ A;  4YU9 A;  3FB3 A;  4MJ8 A;  2PJ2 A;  5H84 A;  1ELM P;  5J8F A;  4AVB A;  3WC7 A;  1BAV A;  1U6M A;  1I21 A;  5E96 A;  4M85 A;  2FIA A;  4LQ6 A;  2GRE A;  3NE7 A;  4P4I A;  1PCA A;  5LYF A;  1QSM A;  3H8E A;  5AGE A;  1LAN A;  2G0B A;  3TO6 A;  5KTC A;  2V77 A;  3OWC A;  2NYQ A;  5LYL A;  1BPM A;  1QSR A;  2PJA A;  2Z3O A;  3KQX A;  3H5Z A;  5D29 A;  3V7Z A;  4A33 A;  5K8N A;  4X3R A;  2DPT A;  2R8V A;  3R1K A;  5AG4 A;  7CPA A;  2Z3M A;  3PGP A;  4MHN A;  1TKH A;  1ZLH A;  2QEC A;  3D4U A;  4C2Z A;  1XMT A;  2KCW A;  2J9A A;  3GUX A;  3SI0 A;  2PIY A;  1UFH A;  4C2X A;  1A2Z A;  1OBR A;  2P6G A;  4ZX8 A;  1YME A;  4JD6 A;  4OC4 A;  4CYO A;  1YW4 A;  4ZGY B;  2C1C A;  3B7I A;  2OZU A;  3DNS A;  2GFQ A;  1MK4 A;  4UWI A;  4U5Y A;  3L2N A;  3TCV A;  3BI1 A;  3VAT A;  2AJ6 A;  2QJ8 A;  1SQH A;  3V8I A;  1KWM A;  2G9D A;  2VL1 A;  4HNY B;  4F0X A;  4C7H A;  1IY7 A;  1B87 A;  2WUU A;  4KVM E;  3PB6 X;  5AG7 A;  4J3G A;  4F6A A;  5J8C A;  2EWB A;  3FYN A;  2CNS A;  1XE4 A;  3SJG A;  2Q4V A;  4KOT A;  3B8G A;  3VWE A;  2AFU A;  3PEI A;  4II9 A;  4CRY B;  4R6T A;  2FS5 A;  3KKW A;  2EBJ A;  4PK2 A;  2AFO A;  4EWT A;  1Y0Y A;  2REF A;  4B12 A;  1S5K A;  1BOB A;  3FED A;  3GY9 A;  4JWP A;  3KGQ A;  4OC2 A;  1IID A;  3KZW A;  4NXY A;  4P4D A;  4PXE A;  5JGF A;  3CPX A;  2ZOF A;  3SJF A;  3F0A A;  2QYV A;  4RUH A;  3W91 A;  4Z65 A;  1VHS A;  3PBB A;  3D7F A;  5G21 A;  1P0H A;  3BI0 A;  2EK9 A;  4NF1 A;  3BJ8 A;  4RN7 A;  2FE7 A;  4PK3 A;  1ARL A;  4F8Z A;  1X12 A;  1PYT B;  1Z8T A;  4A39 A;  1IB1 E;  4EME A;  1S3Z A;  2PC1 A;  4R3L A;  4MFL A;  3EO4 A;  4UWJ A;  5HH1 A;  2PE3 A;  4YRH A;  2FVG A;  2PJ5 A;  4MI4 A;  4MRI A;  3ZJ0 A;  3H8F A;  3HUV A;  3PFO A;  4U9Y A;  4UIB A;  3TC8 A;  4A32 A;  2PJ1 A;  2G3A A;  5IB9 A;  2ARH A;  4FD4 A;  1B6B A;  2O53 A;  1GYT A;  3BHX A;  3CXS A;  5G1Z A;  5THW A;  4XNH C;  5AG5 A;  4A30 A;  2P6E A;  3KL9 A;  4KZT A;  4ORF A;  3MRU A;  4PSW A;  3G3S A;  1KZF A;  1RXT A;  1S7L A;  1IGB A;  5D8N A;  1ZG8 A;  4KOY A;  2O4H A;  1YQE A;  4M6G A;  2CY2 A;  3BJ7 A;  2PJ7 A;  1YR0 A;  1BO4 A;  3CDX A;  2B58 A;  2PVV A;  2PJC A;  3D2M A;  3GLJ A;  4AVC A;  3IGR A;  4NSQ A;  3IWG A;  2ZEH A;  4QUS A;  5HVF A;  3G8W A;  4CGL A;  4ONW A;  4MFJ A;  2K5T A;  3PB8 X;  1TKJ A;  4OAD A;  1CX8 A;  4TNU A;  4P4E A;  3RNZ A;  2F8H A;  4KSI A;  4IF5 A;  4KVX A;  3K2K A;  3LOD A;  4L8A A;  4KOV A;  4UA3 A;  2ZEN A;  4FD6 A;  5DWM A;  4B5O A;  1IYK A;  3R95 A;  3IWE A;  4R8F A;  4B11 A;  4C2Y A;  3TFY A;  4MY0 A;  2AFW A;  3K9U A;  3IEH A;  3VWD A;  2F7V A;  4ZYQ A;  2Z3K A;  2FL4 A;  4KOX A;  3IU2 A;  4QB9 A;  2Q43 A;  4MCS A;  4P44 A;  4QVT A;  2NMT A;  3LD2 A;  4E8O A;  3QAY A;  3D2P A;  1XEB A;  3LMS A;  5J1Q A;  4NGS A;  3D67 A;  4MHY A;  4K30 A;  2DEA A;  3D7G A;  3FF3 A;  4OAE A;  1CG2 A;  1TXR A;  2B4B A;  2PJ6 A;  2ZEF A;  3B3W A;  4EVY A;  4UFW A;  5A28 A;  1PU9 A;  1JQG A;  5HMN A;  2I3C A;  2YGW A;  2OB0 A;  4LX9 A;  1HEE A;  5KTD A;  3TO9 A;  3IU1 A;  4OC1 A;  4MCR A;  2Y0M A;  1S60 A;  4CS0 B;  4BIN A;  4KVO E;  1BLL E;  1EE3 P;  3GB0 A;  2ODF A;  2Q0Y A;  3PB9 X;  4CGO A;  2AFS A;  2I00 A;  4OKO A;  1Z9U A;  2AFX A;  3IWW A;  2I79 A;  3RO0 A;  4NGN A;  2AE6 A;  2BOA A;  3SXN A;  5F47 A;  2B5G A;  1L0C A;  3FEE A;  4OID A;  4F9V A;  2PJ8 A;  4IK2 A;  4UEE A;  4M3S A;  3SXO A;  2FIW A;  3W6S A;  4BD9 A;  1ZG7 A;  1CP7 A;  4E0A A;  2FCK A;  3F5B A;  2IMO A;  4R57 A;  3S9N A;  2PR1 A;  2VZZ A;  3BLN A;  2PJB A;  1AUG A;  1Q2D A;  3B3V A;  3KHZ A;  4UCM A;  1Z4R A;  2P0W A;  1Q2Y A;  3ISX A;  4JLY A;  4OME A;  1QQ9 A;  1S7K A;  4FBE A;  4CAW A;  4C7I A;  4ZX9 A;  1MJB A;  2ZW7 A;  2JDC A;  2RC4 A;  2WYR A;  2ZW5 A;  4P4J A;  4EFD A;  4UFV A;  1YK3 A;  2ZEM A;  4B13 A;  4X5K A;  4XNH B;  1K4J A;  3SJE A;  2Q04 A;  3I1U A;  3C26 A;  3I9S A;  2Z3N A;  3A9L A;  2PRB A;  2VQY A;  2YNE A;  5C88 A;  4XPD C;  4CAE A;  8CPA A;  3FIX A;  5HXD A;  4P4F A;  5K8P A;  1V0C A;  2PSW A;  4P10 A;  3DR8 A;  3JUW A;  1OZP A;  4H6Z A;  1LFW A;  1XOV A;  1WWZ A;  5EMI A;  2C27 A;  4CYP A;  3P2H A;  4AG7 A;  1I1D A;  3KI9 A;  4MCP A;  5DWN A;  1ELL P;  2Q7S A;  3KR4 A;  3SI1 A;  2PJ4 A;  3T9Y A;  3TX8 A;  2EVN A;  3NH5 A;  4A37 A;  2PR8 A;  4UF4 A;  4P6Y A;  5I0C A;  4MHD A;  3NA6 A;  4UFX A;  2OOT A;  4DNC A;  4PSX A;  5CPA A;  1IOF A;  4A2Z A;  4C68 A;  3F8K A;  1TKF A;  1XF8 A;  1Q2C A;  2D4O A;  2BO9 A;  2V8V A;  4PXB A;  3QB8 A;  5ELY A;  2JLM A;  4YWY A;  1FY7 A;  3EC4 A;  4H6U A;  4DJL A;  1XRY A;  3V38 A;  3SJX A;  2GU2 A;  4MCQ A;  4NEX A;  2ZW6 A;  3D7D A;  4IAV A;  6CPA A;  1Z4E A;  2Z10 A;  5G22 A;  1LRZ A;  3R96 A;  1ZLI A;  1VGY A;  3K9T A;  1J4J A;  1NSA A;  1WK4 A;  3B3S A;  3PRT A;  3DGV A;  4FWU A;  2XEF A;  2PQ8 A;  1QMU A;  2HC9 A;  3D7H A;  1VHO A;  2VZY A;  4FD5 A;  4JJX A;  4IHM A;  4CYN A;  1QSN A;  1TF9 A;  3DDD A;  4KUA A;  3R9E A;  2JEV A;  1TF8 A;  2OZH A;  2Q4Y A;  3FVL A;  4KS9 A;  2GAN A;  1M44 A;  4A38 A;  2VI7 A;  2Z11 A;  4Q36 A;  2GLJ A;  5LYI A;  3N7Z A;  4QC6 A;  4AB7 A;  4UEF A;  4Y49 C;  3PP9 A;  4OP4 A;  1H8L A;  3PBE A;  2NSM A;  4HKF A;  1LOK A;  2POK A;  3FNC A;  3S6F A;  4CGP A;  4CYQ A;  1YGH A;  1ARM A;  4R87 A;  4MMO A;  4YGO A;  4E2A A;  3EY5 A;  2CIJ A;  3ISZ A;  3D68 A;  1S7N A;  2JBJ A;  3KQZ A;  2YND A;  1Y9K A;  3N5F A;  4TWE A;  3WT4 A;  4AG9 A;  5CBM A;  4OLL A;  3IIB A;  4PXC A;  1DE4 C;  1Y7E A;  3DLJ A;  1NMT A;  2ZW4 A;  3EFA A;  3EXN A;  3DSB A;  4GXH A;  2ZXV A;  3LWU A;  2WPX A;  1YLO A;  3FRM A;  4ZBG A;  3I3G A;  2PJ0 A;  4MXU A;  1QSO A;  4KOU A;  4NJQ A;  4PPZ A;  1Y9W A;  3TE4 A;  4AXV A;  2C6G A;  2ZEP A;  1TIQ A;  2XEJ A;  1NSL A;  2HB6 A;  4Q38 A;  1FNO A;  3PB7 X;  4XPD B;  2X7B A;  2OR4 A;  3ZZI A;  3TT2 A;  1M1D A;  1YLE A;  3D66 A;  5I4M A;  4OC0 A;  1JWQ A;  2Q7B A;  4P45 A;  4CAF A;  2Z3L A;  2P6F A;  3H8G A;  3KR5 A;  4MFZ A;  5H86 A;  4YFJ A;  4B5P A;  2FT0 A;  3IO1 A;  5EBV A;  2WPW A;  4WWV A;  2VBQ A;  1R3N A;  1YRE A;  2BEI A;  2BUE A;  1XFO A;  2C6C A;  2PJ3 A;  4NFR A;  2Q44 A;  1KUV A;  2R98 A;  3WAB A;  3GIU A;  4WJB A;  4X8I A;  2PVW A;  2XEI A;  3B2Y A;  2F5I A;  3QAH A;  4JXQ A;  5F49 A;  3MGD A;  2WZN A;  4MFK A;  3NFZ A;  3R9F A;  1AMP A;  4O23 A;  1F2O A;  2Z3P A;  1M4G A;  2J8R A;  3RBU A;  1YW6 A;  2CNM A;  2V8G A;  3UY5 A;  1FT7 A;  4CRZ B;  4Q7A A;  3RAM A;  2AFM A;  5LYD A;  2ZOG A;  3CPA A;  3TO7 A;  5FVJ A;  4DYO A;  5GCN A;  2D4P A;  2OZG A;  4U9Z A;  2IL4 A;  4KOS A;  1N71 A;  4B14 A;  4UEZ A;  3B35 A;  2PJ9 A;  5F46 A;  2J8M A;  1F57 A;  2C6P A;  3PFE A;  1XMB A;  4W9Y A;  4L89 A;  4CAV A;  4MBU A;  2OH1 A;  1Q7L A;  1VKC A;  1GHE A;  4KUB A;  3W6X A;  1BPN A;  2Z0Z A;  2YNC C;  3HLP A;  1LCP A;  2PIZ A;  4XPK A;  4CPA A;  3P2F A;  4H2K A;  4X2T A;  3FBU A;  3NH8 A;  5C82 A;  2ANP A;  1LAP A;  3VH9 A;  5IV0 A;  1HDU A;  4ZY2 A;  4B6Z A;  4A95 A;  4MFQ A;  5IB0 A;  4Y49 B;  2Q51 A;  1RTQ A;  3GYA A;  2H5M A; 
#chains in the Genus database with same CATH homology
 3CXQ A;  4RS2 A;  5G20 A;  4NCZ A;  4F0Y A;  4B10 A;  1Y7R A;  2DXQ A;  4GS4 A;  4KOW A;  4B5P B;  3T90 A;  4QBJ A;  4A31 A;  4KLV A;  1M4I A;  3CXP A;  2REE A;  4UCP A;  3S6H A;  4HNX B;  3TTH A;  1NE9 A;  3H4Q A;  3R9G A;  1I12 A;  2YNC A;  5JQ4 A;  1CM0 A;  1MJ9 A;  3D8P A;  2B5G B;  1MJA A;  2J8N A;  3FXT A;  1IIC A;  4BMH A;  5AG6 A;  1KUY A;  3TOA A;  2A4N A;  2BL1 A;  3RYO A;  4BBH A;  5CNP A;  1YVK A;  2JDD A;  2R7H A;  4IUS A;  2FXF A;  3GKR A;  2QIR A;  3DR6 A;  4FD7 A;  3E0K A;  4AVA A;  4ONU A;  3SHP A;  2R1I A;  4R3K A;  4CAX A;  2B3V A;  1S7F A;  2BSW A;  3D3S A;  4PV6 A;  2ZPA A;  2HV2 A;  4LUA A;  2VXK A;  2DPS A;  1YX0 A;  4KLW A;  1QST A;  1R57 A;  5A27 A;  4KOR A;  1ZO0 A;  3WR7 A;  2FSR A;  2B4D A;  4MY3 A;  5BWA B;  4H89 A;  1RO5 A;  1CJW A;  4KSA A;  1YVO A;  4JXR A;  3S6K A;  4R9M A;  4KSF A;  5EC4 A;  1P4N A;  1M4D A;  1IYL A;  4XPL A;  4RI1 A;  2G3T A;  2CNT A;  5JPH A;  2HQY A;  4UCN A;  4HNW B;  2PDO A;  3JTK A;  5F48 A;  5ISV A;  2VEZ A;  3TOB A;  2CXA A;  5IX3 A;  2QML A;  1ON0 A;  4I49 A;  4MFP A;  4CGM A;  2GE3 A;  4CGN A;  1KUX A;  1XIX A;  2HUZ A;  2WSA A;  3JVN A;  5KTA A;  3PZJ A;  2GIV A;  2B3U A;  2OU2 A;  4UBR A;  2O28 A;  2EUI A;  1PUA A;  2ATR A;  2B4D B;  3S6G A;  3FB3 A;  4MJ8 A;  5H84 A;  5J8F A;  4AVB A;  1U6M A;  1I21 A;  5E96 A;  4M85 A;  2FIA A;  3NE7 A;  1QSM A;  5AGE A;  2G0B A;  3TO6 A;  3OWC A;  2Z3O A;  1QSR A;  4A33 A;  3H5Z A;  5AG4 A;  2DPT A;  2R8V A;  3R1K A;  2Z3M A;  3PGP A;  2QEC A;  4C2Z A;  1XMT A;  2KCW A;  4C2X A;  1UFH A;  2P6G A;  4JD6 A;  4CYO A;  4ZGY B;  2OZU A;  3DNS A;  1MK4 A;  4UWI A;  4U5Y A;  3TCV A;  2AJ6 A;  1SQH A;  3V8I A;  4HNY B;  4F0X A;  4C7H A;  1B87 A;  2WUU A;  4KVM E;  5AG7 A;  4F6A A;  4J3G A;  5J8C A;  3FYN A;  2CNS A;  1XE4 A;  2Q4V A;  4KOT A;  3B8G A;  3VWE A;  4II9 A;  4CRY B;  2FS5 A;  3KKW A;  4PK2 A;  2REF A;  4B12 A;  1S5K A;  1BOB A;  3GY9 A;  4JWP A;  1IID A;  4NXY A;  3F0A A;  3W91 A;  1VHS A;  5G21 A;  1P0H A;  4NF1 A;  3BJ8 A;  2FE7 A;  4PK3 A;  1IB1 E;  1S3Z A;  2PC1 A;  4R3L A;  4MFL A;  3EO4 A;  4UWJ A;  5HH1 A;  4YRH A;  4MI4 A;  3ZJ0 A;  4U9Y A;  4A32 A;  2G3A A;  2ARH A;  4FD4 A;  1B6B A;  3CXS A;  5G1Z A;  4XNH C;  5AG5 A;  4A30 A;  2P6E A;  4KZT A;  4ORF A;  4PSW A;  3G3S A;  1KZF A;  1RXT A;  1S7L A;  4KOY A;  2CY2 A;  3BJ7 A;  1YR0 A;  1BO4 A;  2B58 A;  3D2M A;  4AVC A;  3IGR A;  4NSQ A;  3IWG A;  4QUS A;  4CGL A;  3G8W A;  4MFJ A;  2K5T A;  4OAD A;  5KTC A;  4CRZ B;  4UA3 A;  4IF5 A;  4KVX A;  3LOD A;  4L8A A;  4KOV A;  4FD6 A;  5DWM A;  4B5O A;  1IYK A;  3R95 A;  3IWE A;  4B11 A;  4C2Y A;  3TFY A;  4MY0 A;  3K9U A;  3VWD A;  2Z3K A;  2FL4 A;  4KOX A;  3IU2 A;  4QB9 A;  4QVT A;  2NMT A;  3LD2 A;  4E8O A;  3D2P A;  1XEB A;  4K30 A;  4OAE A;  2B4B A;  4UFW A;  5A28 A;  1PU9 A;  5HMN A;  2YGW A;  2OB0 A;  4LX9 A;  5KTD A;  3TO9 A;  3IU1 A;  2Y0M A;  1S60 A;  4CS0 B;  4KVO E;  2Q0Y A;  4CGO A;  2I00 A;  1Z9U A;  2I79 A;  2AE6 A;  3SXN A;  5F47 A;  2B5G A;  1L0C A;  4M3S A;  3SXO A;  2FIW A;  3W6S A;  4E0A A;  2FCK A;  3F5B A;  4R57 A;  2PR1 A;  2VZZ A;  3BLN A;  1Q2D A;  4UCM A;  1Z4R A;  2P0W A;  1Q2Y A;  4JLY A;  1S7K A;  4CAW A;  4C7I A;  1MJB A;  2ZW7 A;  2JDC A;  2RC4 A;  2ZW5 A;  4UFV A;  1YK3 A;  4B13 A;  4X5K A;  4XNH B;  1K4J A;  2Q04 A;  3C26 A;  3I9S A;  2Z3N A;  3A9L A;  2PRB A;  2VQY A;  2YNE A;  5C88 A;  4XPD C;  4CAE A;  3FIX A;  1V0C A;  2PSW A;  3DR8 A;  3JUW A;  1OZP A;  4H6Z A;  1WWZ A;  2C27 A;  4CYP A;  3P2H A;  4AG7 A;  1I1D A;  5DWN A;  3T9Y A;  2EVN A;  2PR8 A;  5I0C A;  4MHD A;  4UFX A;  4DNC A;  4PSX A;  4C68 A;  4A2Z A;  3F8K A;  1XF8 A;  1Q2C A;  2D4O A;  3QB8 A;  2JLM A;  1FY7 A;  3EC4 A;  4H6U A;  4NEX A;  2ZW6 A;  1Z4E A;  2Z10 A;  5G22 A;  1LRZ A;  3R96 A;  1J4J A;  1WK4 A;  2PQ8 A;  2VZY A;  4JJX A;  4FD5 A;  4CYN A;  1QSN A;  3DDD A;  3R9E A;  4KUA A;  2JEV A;  2OZH A;  4KS9 A;  2Q4Y A;  2GAN A;  1M44 A;  2VI7 A;  2Z11 A;  4Q36 A;  3N7Z A;  4QC6 A;  4AB7 A;  4Y49 C;  3PP9 A;  4HKF A;  3FNC A;  3S6F A;  4CGP A;  4CYQ A;  1YGH A;  4R87 A;  4YGO A;  4E2A A;  3EY5 A;  1S7N A;  2YND A;  1Y9K A;  4AG9 A;  4OLL A;  1NMT A;  2ZW4 A;  3EFA A;  3EXN A;  3DSB A;  2ZXV A;  2WPX A;  3FRM A;  4ZBG A;  3I3G A;  1QSO A;  4KOU A;  1Y9W A;  3TE4 A;  1TIQ A;  1NSL A;  4Q38 A;  4XPD B;  2X7B A;  3ZZI A;  3TT2 A;  1M1D A;  1YLE A;  2Q7B A;  4CAF A;  2Z3L A;  2P6F A;  4MFZ A;  5H86 A;  4YFJ A;  4B5P A;  2FT0 A;  5EBV A;  2WPW A;  2VBQ A;  1YRE A;  2BEI A;  2BUE A;  2Q44 A;  1KUV A;  2R98 A;  2F5I A;  3QAH A;  4JXQ A;  5F49 A;  3MGD A;  3R9F A;  4MFK A;  4EVY A;  2Z3P A;  3UY5 A;  1M4G A;  2J8R A;  2CNM A;  3TO7 A;  5FVJ A;  5GCN A;  2D4P A;  2OZG A;  4U9Z A;  2IL4 A;  4KOS A;  1N71 A;  4B14 A;  5F46 A;  2J8M A;  4CAV A;  4L89 A;  4MBU A;  2OH1 A;  1VKC A;  1GHE A;  4KUB A;  3W6X A;  2Z0Z A;  2YNC C;  4XPK A;  3P2F A;  3FBU A;  5C82 A;  5IV0 A;  4A95 A;  4MFQ A;  5IB0 A;  4Y49 B;  3GYA A;  2H5M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...