2FIWA

Crystal structure of the gcn5-related n-acetyltransferase: aminotransferase, class-ii from rhodopseudomonas palustris
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
160
structure length
160
Chain Sequence
GHMVMSTPALRPYLPEDAAVTAAIFVASIEQLTADDYSEEQQEAWASAADDEAKFAARLSGQLTLIATLQGVPVGFASLKGPDHIDMLYVHPDYVGRDVGTTLIDALEKLAGARGALILTVDASDNAAEFFAKRGYVAKQRNTVSINGEWLANTTMTKSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GCN5-related N-acetyltransferase:Aminotransferase, class-II
publication title Crystal Structure of the GCN5-Related N-acetyltransferase: Aminotransferase, Class-II from Rhodopseudomonas palustris
rcsb
source organism Rhodopseudomonas palustris
molecule tags Transferase
total genus 46
structure length 160
sequence length 160
ec nomenclature
pdb deposition date 2005-12-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13673 Acetyltransf_10 Acetyltransferase (GNAT) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 2fiwA00
1QSTA 4Y49C 5J8CA 1BO4A 2FT0A 4E8OA 2B4DA 3W6SA 2OB0A 3T90A 4QC6A 4YFJA 2ZW4A 1CM0A 2B4BA 3EFAA 3H4QA 4MY3A 1S7FA 4K30A 5IV0A 1M44A 3TO7A 1Y9KA 1S7KA 4UWJA 3QAHA 3OWCA 5H84A 5EBVA 2AE6A 1Q2YA 2Y0MA 4ONUA 3F8KA 4B5PB 3W6XA 1XEBA 3R1KA 4MHDA 1PU9A 4KZTA 2H5MA 2Q0YA 1S3ZA 4L89A 3SXNA 2FXFA 5DWNA 2FE7A 4KVME 2Z0ZA 4E2AA 3TTHA 4XPLA 5JQ4A 1YX0A 4UBRA 4X5KA 5F47A 5EC4A 3P2HA 3NE7A 1J4JA 1CJWA 4M3SA 2HUZA 5DWMA 4MJ8A 2A4NA 3DR8A 4H6UA 1P0HA 4R9MA 1YVOA 4AVAA 4IF5A 4KLVA 3TCVA 4EVYA 2D4PA 1VHSA 4CAVA 2PSWA 2P6GA 2VI7A 4E0AA 1L0CA 3TOBA 3T9YA 3W91A 3V8IA 2JEVA 1Z4EA 3PP9A 4NEXA 4XPKA 3F0AA 2WPWA 1Z4RA 5KTCA 3D3SA 4LX9A 5FVJA 1N71A 2CNSA 2GIVA 3BJ7A 3LODA 3F5BA 2CNMA 3QB8A 2BUEA 1TIQA 1IYKA 2REEA 1NE9A 2KCWA 2J8NA 2R8VA 2ZW7A 4DNCA 3DNSA 2IL4A 3FBUA 4PK2A 2BL1A 4JJXA 3TT2A 3EO4A 2PDOA 2ATRA 3VWDA 4H89A 4YRHA 4PSWA 1YR0A 1Q2CA 3PGPA 1B6BA 4RI1A 3CXSA 3BJ8A 4JXRA 2I00A 3R9EA 2OU2A 5HMNA 4KLWA 1RXTA 3DSBA 2VZYA 5IB0A 2DXQA 3SXOA 2B5GB 1QSNA 2CY2A 2J8MA 2R7HA 4KORA 1IYLA 4KOYA 1S7NA 1XE4A 3EC4A 3R95A 4Y49B 4OADA 2Z11A 2PR1A 4B5OA 4HKFA 2QIRA 2EUIA 4NXYA 1IIDA 3FNCA 4QUSA 2WPXA 5I0CA 1S7LA 4CRYB 3WR7A 4NCZA 2REFA 2B4DB 5HH1A 4II9A 4AVCA 2FL4A 2QECA 2FCKA 1MJAA 1I1DA 1YK3A 4NSQA 2JDDA 4QVTA 3UY5A 2O28A 2ZXVA 4JLYA 3VWEA 3G3SA 1IICA 1M1DA 5F49A 5C88A 2RC4A 4KOUA 1M4DA 4UA3A 2JDCA 1I21A 3TOAA 4FD7A 4R57A 4HNXB 1BOBA 3D2MA 2G3TA 4I49A 1GHEA 2HQYA 4H6ZA 2P6EA 4U9ZA 2OZHA 3S6FA 3SHPA 1B87A 1K4JA 1S60A 3DR6A 2G0BA 4XNHB 4BMHA 4KVXA 5F48A 2PC1A 1MK4A 1PUAA 4CAWA 3EXNA 4KOSA 5E96A 4YGOA 1QSRA 4JD6A 3C26A 4PSXA 4RS2A 2D4OA 1RO5A 1KUVA 4R3LA 2CNTA 2VZZA 3IGRA 1V0CA 2B58A 1SQHA 4HNYB 2F5IA 3N7ZA 3E0KA 1LRZA 3ZZIA 2X7BA 4FD5A 2G3AA 5KTDA 3S6GA 3BLNA 2B3UA 1WK4A 3IWGA 2BEIA 4JXQA 5IX3A 3FYNA 4NF1A 2VEZA 4MBUA 3FB3A 3S6KA 2Q7BA 3R96A 4U9YA 4XPDC 4AB7A 4F0YA 3TO9A 3D2PA 2I79A 5H86A 4CAXA 4KOXA 1FY7A 1VKCA 2PQ8A 5C82A 1KUYA 4MY0A 2FIAA 2Q04A 3P2FA 2QMLA 3PZJA 4FD4A 2PR8A 3JUWA 3G8WA 4IUSA 5J8FA 2PRBA 1NMTA 1NSLA 2Z10A 5CNPA 4GS4A 4PK3A 2Q4VA 4KOWA 2FSRA 1XMTA 3LD2A 4B5PA 3RYOA 1UFHA 2ZPAA 3GYAA 4KUBA 3KKWA 1OZPA 4LUAA 2FS5A 4F6AA 2ZW6A 3CXQA 4R87A 4OLLA 1ON0A 2K5TA 3I3GA 2AJ6A 4KVOE 1YVKA 4JWPA 2VBQA 4UWIA 4KUAA 3JVNA 5JPHA 3DDDA 3ZJ0A 1MJ9A 2NMTA 4FD6A 4J3GA 4QB9A 2OZGA 1IB1E 1Y9WA 2BSWA 2R98A 1Y7RA 5F46A 2OZUA 4XNHC 2C27A 5KTAA 3I9SA 3FXTA 4AG7A 2P0WA 1Q2DA 3TE4A 3TFYA 1U6MA 2Q4YA 4QBJA 4KOVA 5ISVA 2R1IA 2B3VA 4HNWB 2GANA 3D8PA 3MGDA 1KUXA 3S6HA 4CRZB 2JLMA 3R9FA 2Q44A 1QSOA 4U5YA 3CXPA 3R9GA 4M85A 2ARHA 4AVBA 3FIXA 1S5KA 2EVNA 1QSMA 2HV2A 4L8AA 4MI4A 1MJBA 3B8GA 4PV6A 2P6FA 1Z9UA 3FRMA 4ZBGA 4R3KA 3K9UA 3GY9A 2VXKA 2ZW5A 4KOTA 4AG9A 1YREA 2OH1A 1M4IA 2B5GA 1XIXA 4ORFA 1WWZA 1XF8A 3EY5A 2VQYA 5GCNA 1YLEA 2J8RA 3TO6A 1YGHA 1KZFA 3GKRA 4XPDB 1P4NA 1M4GA 2GE3A 1R57A 4CS0B 4OAEA 1I12A 2FIWA
chains in the Genus database with same CATH superfamily
4A31A 3FF3A 1QSTA 1VHOA 1ZG9A 4Y49C 5J8CA 1Y0RA 1Y7EA 3KHXA 1Z2LA 2QJ8A 1BO4A 1DE4C 4IHMA 2O4HA 2Q51A 2J9AA 3SJFA 2FT0A 2V8HA 1H8LA 2B4DA 3FMCA 4E8OA 3W6SA 2OB0A 3T90A 4QC6A 2JEWA 4PQAA 4YFJA 4LQGA 3L2NA 3FVLA 2ZW4A 1CM0A 2B4BA 1XBUA 3EFAA 3SI2A 3H4QA 1ELMP 4M6IA 4MY3A 4NGPA 4R8FA 1S7FA 4K30A 4RN7A 5IV0A 5LYFA 1M44A 3TO7A 2PE3A 5LRKA 2Z3OA 5D29A 1Y9KA 1LANA 1S7KA 4EWTA 1Z5RA 1IOFA 4R6TA 2Q7SA 4UWJA 3QAHA 3OWCA 3RAMA 3SI0A 5H84A 3WC6A 2CXAA 2IMOA 1IOIA 4CYPA 5EBVA 1TF9A 2ZEOA 3RNZA 2AE6A 1Q2YA 1Q7LA 3K2KA 1AYEA 4MXUA 2Y0MA 2AFWA 4P44A 5HVGA 4P45A 5AG5A 4ONUA 3F8KA 4B5PB 3W6XA 4K3NA 1CPXA 2C6CA 3FH4A 4C7IA 1XEBA 2ZEPA 3R1KA 4MHDA 4MFZA 7CPAA 1PU9A 4KZTA 1XOVA 3VARA 2H5MA 1CP6A 1JQGA 2Q0YA 4FUUA 1S3ZA 2OR4A 4L89A 3SXNA 2FXFA 5DWNA 3FEEA 2FE7A 3PB7X 4OIDA 4KVME 2Z0ZA 2ZOFA 5THWA 4E2AA 2PCUA 4XPLA 2OOTA 3TTHA 5JQ4A 1YX0A 2PRQA 3PB8X 4UBRA 4X5KA 5F47A 5EC4A 3P2HA 3NE7A 4DUKA 4A37A 3GB0A 1J4JA 2PJ2A 1CJWA 4M3SA 2HUZA 5DWMA 4MJ8A 2A4NA 4MHNA 3DR8A 4MCSA 2PJ4A 4PXEA 3NH5A 4H6UA 4A2ZA 1P0HA 4R9MA 1GYTA 1YVOA 5LRJA 4AVAA 2CTBA 2HB6A 3MRUA 4IF5A 4KLVA 3TCVA 3B3CA 4TWEA 2C6GA 4EVYA 1A2ZA 1Z8LA 2PJAA 2D4PA 1VHSA 4CAVA 3ISXA 2PSWA 5CPAA 2P6GA 3H8GA 4Z65A 4CAEA 2AFXA 2VI7A 1YMEA 4E0AA 1VGYA 1L0CA 3TOBA 3T9YA 4X2TA 3W91A 3V8IA 3IU2A 2JEVA 1Z4EA 3PP9A 4NEXA 2DPTA 5LYDA 4XPKA 1FNOA 2WPWA 3F0AA 5LRGA 1Z4RA 2V77A 3B3SA 2JBJA 3BHXA 2POKA 1R43A 5KTCA 2DPSA 4WJBA 2Z3NA 3D3SA 4LX9A 1VHEA 5FVJA 3TX8A 1N71A 2CNSA 4NGSA 2GIVA 5G1ZA 3BJ7A 3LODA 3PBBA 3D7DA 4A38A 4O23A 5K8MA 4CGOA 1QMUA 3F5BA 2CNMA 3QB8A 3B35A 5ELYA 3FECA 2BUEA 1TIQA 1IYKA 1IU8A 2PJBA 2REEA 4PXBA 3VATA 1NE9A 4NFRA 2I3CA 2KCWA 2WUUA 1Y0YA 2J8NA 2R8VA 2ZEFA 2ZW7A 4KSIA 3JTKA 4B6ZA 3DNSA 4DNCA 4RUHA 1BAVA 2IL4A 3D68A 1CX8A 3FBUA 1X12A 4PK2A 2BL1A 4JJXA 5JGFA 3TT2A 2ZEEA 3EO4A 3KZWA 2PDOA 2EO8A 2ATRA 3SI1A 3VWDA 4H89A 4NGQA 4YRHA 2ZEMA 2CTCA 1LCPA 1FT7A 2JBKA 4PSWA 2GLJA 4CAFA 1YR0A 5K8NA 4KSAA 4MFJA 4MMOA 4ONWA 1Q2CA 3PFEA 2ZEGA 3RO0A 4CYOA 3PGPA 4LQ6A 1B6BA 1XMBA 3QAYA 4RI1A 4F9VA 4P10A 3CXSA 3FJUA 3BJ8A 4JXRA 5AGEA 3IU1A 2I00A 2XEFA 4IAVA 1CG2A 3R9EA 2OU2A 5HMNA 1RXTA 3DSBA 4KLWA 2Z3MA 4B14A 2RFHA 2VZYA 5IB0A 2DXQA 3SXOA 3NE8A 2B5GB 4ZX9A 2EK9A 2PJ5A 1QSNA 1LAPA 2CY2A 4ZY1A 2J8MA 3KQXA 4MFKA 1PCAA 3SJEA 2R7HA 2WZNA 4P4FA 4KORA 4Q36A 1IYLA 2AFMA 4KOYA 3T8WA 1S7NA 1TKFA 1XE4A 3EC4A 4Y49B 4OADA 2Z11A 2PR1A 3R95A 4B5OA 3H8EA 3NFZA 1ZLIA 4Q38A 4HKFA 2QIRA 2EUIA 4NXYA 1IIDA 4PXCA 3D7FA 3FNCA 4QUSA 2YGWA 1HDUA 2WPXA 1TKJA 1UWYA 2YNDA 1NSAA 1S7LA 3KL9A 4CRYB 4WWVA 3WR7A 4NCZA 5I0CA 2REFA 2B4DB 4Q7AA 4OIWA 4PPZA 3KQZA 5HH1A 4II9A 4AVCA 2FL4A 2QECA 2NSMA 4A32A 4A94A 3D66A 2FCKA 1MJAA 1I1DA 1YK3A 4NSQA 3CPAA 3NH8A 1AUGA 4EFDA 1ZG7A 4UFVA 2JDDA 4QVTA 4BINA 4CGLA 3UY5A 2ZEHA 4JZ0A 2O28A 2PJCA 2ZXVA 4JLYA 3B7IA 3VWEA 3IIBA 4UF4A 3B2YA 3G3SA 1IICA 1M1DA 2WYRA 5F49A 4ZI6A 5C88A 2EK8A 2RC4A 4KOUA 2BOAA 1M4DA 4OC3A 2JDCA 4FWUA 4UA3A 4UEFA 1I21A 5HVHA 3V7ZA 3TOAA 4FD7A 4R57A 5G22A 2ODFA 3KI9A 4HNXB 4TNUA 3HLPA 1ZLHA 1F2OA 1BOBA 3DGVA 3D2MA 2G3TA 4I49A 1DTDA 1GHEA 2QYVA 4FBEA 2O53A 2HQYA 3WC5A 2C1CA 2IJZA 4H6ZA 2P6EA 4U9ZA 2ZENA 4MCRA 5K8PA 2OZHA 1LAMA 3S6FA 2DF5A 4OKOA 4ZX8A 5IB9A 3SHPA 5HXDA 1B87A 1K4JA 1S60A 2Z3KA 3BXMA 3K9TA 1AMPA 3DR6A 2G0BA 5F09A 4XNHB 3VH9A 2V8GA 4KVXA 4ZY2A 4BMHA 2WSAA 1RTQA 3PEIA 4NGTA 4CGPA 5F48A 4MFPA 2EBJA 2PIYA 2GFQA 4C2XA 2PC1A 1MK4A 1PUAA 2AFOA 3H8FA 4GM5A 4CAWA 4MRIA 3EXNA 4KOSA 5E96A 4YGOA 1QSRA 4JD6A 3C26A 4PSXA 4RS2A 1ARMA 2D4OA 4UFXA 1RO5A 4ZY0A 1CBXA 1KUVA 4R3LA 2CNTA 2VZZA 2XEIA 2PJ7A 4A33A 3IGRA 1V0CA 2GU2A 2B58A 4MHZA 1SQHA 1X10A 4UEEA 4HNYB 4MHYA 2F5IA 3WABA 1OBRA 3N7ZA 4M6GA 4CGMA 3WC7A 3E0KA 8CPAA 1LRZA 3ZZIA 2X7BA 4FD5A 4KS9A 2G3AA 4MCPA 4NGMA 1CP7A 3KGQA 3S6GA 3BLNA 4NGRA 4A39A 5KTDA 5LYLA 4OC1A 4C2YA 2ANPA 1HDQA 1WK4A 2B3UA 3IWGA 4C68A 4CYNA 4DJLA 2BEIA 4JXQA 1ARLA 5IX3A 3FYNA 2V8DA 4NF1A 2VEZA 2Q43A 1YW6A 3PRTA 3BI1A 4YWYA 3IFEA 4MBUA 3FB3A 4OP4A 1HEEA 3H5ZA 5AG7A 4MFLA 4DYOA 3S6KA 2Q7BA 3R96A 4U9YA 2AFUA 4XPDC 4AB7A 4OC5A 1TF8A 4F0YA 3CZXA 3TO9A 4CGNA 3D2PA 3S9MA 2IQ6A 4P4EA 6CPAA 1TKHA 2I79A 2PVVA 1F57A 5H86A 3WT4A 2AFZA 3IWWA 4KOXA 4CAXA 4NJRA 1FY7A 1ZO0A 3CPXA 4H2KA 2F7VA 1VKCA 3SJGA 5A27A 5AG4A 3S9NA 5JH9A 2PQ8A 5C82A 5G21A 4PXDA 1KUYA 5CBMA 3LACA 4MY0A 4P4BA 2FIAA 2Q04A 3P2FA 1KWMA 2QMLA 3PZJA 4W9YA 4C7HA 4EMEA 3FEDA 4FD4A 4F9UA 2PR8A 3JUWA 2GLFA 3G8WA 1YSJA 3I1UA 4IUSA 5J8FA 2PJ6A 2G9DA 2PRBA 2Z3PA 3CDXA 1NMTA 2YNCA 3KASA 3KR5A 4UCMA 2ZEDA 4P4JA 3IWEA 1NSLA 2NYQA 3RZAA 4ZYQA 5G20A 2Z10A 2XEJA 3KHZA 3MN8A 1CPSA 2YNCC 5CNPA 4GS4A 2BCOA 2YNEA 4AXVA 5LYIA 4PK3A 2Q4VA 4KOWA 2FSRA 4NJQA 4R7MA 1XMTA 3LD2A 5D8NA 4B5PA 4UIAA 3RYOA 1UFHA 2ZPAA 3GYAA 3FX6A 3B3WA 4KUBA 3S9LA 3KKWA 1OZPA 3PBEA 2ABZA 2VL1A 1LFWA 3D67A 2QVPA 4F8ZA 1JWQA 5AG6A 1IGBA 4LUAA 4UIBA 1TXRA 1R3NA 2FS5A 4MCQA 3BI0A 4F6AA 2ZW6A 3CXQA 4R87A 4OLLA 4OMEA 1ON0A 2K5TA 2PJ1A 4UCNA 1QQ9A 2EWBA 3I3GA 2AJ6A 3PB4X 4KVOE 4KSFA 3TC8A 3B3TA 1YVKA 4JWPA 1YQEA 2FVGA 3GUXA 1XFOA 3IO1A 2VBQA 5BWAB 1ZG8A 4UWIA 4KUAA 3JVNA 5JPHA 3DDDA 3LMSA 2Z3LA 4A30A 3ZJ0A 4YU9A 4FAIA 1MJ9A 2NMTA 4FD6A 4J3GA 4QB9A 1ELLP 3DLJA 4CYQA 5JM6A 2OZGA 1IB1E 1Y9WA 2V8VA 4OC2A 3PB6X 4BBHA 4UCPA 2BSWA 4JYWA 4ZGYB 2R98A 1XRYA 4B13A 2PJ3A 4X8IA 4G1PA 2AFSA 1BPMA 1Y7RA 5HVFA 5F46A 4P4IA 2PJ9A 4HPSA 1EE3P 2OZUA 3KR4A 1LOKA 2PIZA 4XNHC 4F0XA 4P6YA 2C27A 1Z8WA 5KTAA 3V38A 3I9SA 4UFWA 1XJOA 3FXTA 4AG7A 4B11A 3D7GA 4A95A 2P0WA 1Q2DA 3TE4A 3TFYA 1U6MA 2Q4YA 3RBUA 4B10A 3B3VA 4QBJA 4BD9A 4KOVA 1M4LA 1YLOA 2B3VA 2R1IA 4HNWB 4M6HA 5ISVA 2GANA 3D8PA 3MGDA 2PJ0A 4CPAA 1KUXA 4OC4A 3S6HA 1PYTB 3D4UA 2Q4ZA 4CRZB 2JLMA 4MHPA 1BLLE 3R9FA 2Q44A 3JRUA 1YW4A 1QSOA 4U5YA 3CXPA 3R9GA 2CF4A 1F2PA 5J1QA 4M85A 2ARHA 2GREA 4AVBA 2RB7A 3QNVA 3GLJA 2ZELA 1BPNA 3FIXA 5K8OA 1S5KA 4GXHA 4NGNA 2CIJA 2EVNA 1QSMA 2DEAA 2HV2A 2HC9A 3SJXA 3IJ3A 3PB9X 4L8AA 4MI4A 1MJBA 3B8GA 4R76A 5A28A 3D7HA 4PV6A 2P6FA 2BO9A 1Z9UA 4OC0A 4UEZA 2ZOGA 3FRMA 4C2ZA 4ZBGA 5I4MA 4B12A 4IK2A 2XEGA 4R3KA 4X3RA 3A9LA 3K9UA 3NA6A 3GY9A 2VXKA 1Z8XA 2ZW5A 2PVWA 3IEHA 2C6PA 3LWUA 4KOTA 3GIUA 3IC1A 4AG9A 1YREA 2OH1A 2PJ8A 1M4IA 2B5GA 5DS0A 1XIXA 4MFQA 4ORFA 1WWZA 1XF8A 3EY5A 1VIXA 2VQYA 3NH4A 5GCNA 1YLEA 2J8RA 3TO6A 1YGHA 1KZFA 3GKRA 4XPDB 1P4NA 1M4GA 2GE3A 1R57A 4CS0B 2F8HA 3ISZA 4OAEA 4P4DA 1I12A 1Z8TA 2FIWA 3CT9A 3PFOA 5EMIA 3HUVA 3N5FA 1IY7A
chains in the Genus database with same CATH topology
4A31A 1QSTA 4Y49C 5J8CA 1BO4A 2FT0A 4E8OA 2B4DA 3W6SA 2OB0A 3T90A 4QC6A 4YFJA 2ZW4A 1CM0A 2B4BA 3EFAA 3H4QA 4MY3A 1S7FA 4K30A 5IV0A 1M44A 3TO7A 2Z3OA 1Y9KA 1S7KA 4UWJA 3QAHA 3OWCA 5H84A 2CXAA 4CYPA 5EBVA 2AE6A 1Q2YA 2Y0MA 5AG5A 4ONUA 3F8KA 4B5PB 3W6XA 4C7IA 1XEBA 3R1KA 4MHDA 4MFZA 1PU9A 4KZTA 2H5MA 2Q0YA 1S3ZA 4L89A 3SXNA 2FXFA 5DWNA 2FE7A 4KVME 2Z0ZA 4E2AA 3TTHA 4XPLA 5JQ4A 1YX0A 4UBRA 4X5KA 5F47A 5EC4A 3P2HA 3NE7A 1J4JA 1CJWA 4M3SA 2HUZA 5DWMA 4MJ8A 2A4NA 3DR8A 4H6UA 4A2ZA 1P0HA 4R9MA 1YVOA 4AVAA 4IF5A 4KLVA 3TCVA 4EVYA 2D4PA 1VHSA 4CAVA 2PSWA 2P6GA 4CAEA 2VI7A 4E0AA 1L0CA 3TOBA 3T9YA 3W91A 3V8IA 3IU2A 2JEVA 1Z4EA 3PP9A 4NEXA 2DPTA 4XPKA 3F0AA 2WPWA 1Z4RA 5KTCA 2DPSA 2Z3NA 3D3SA 4LX9A 5FVJA 1N71A 2CNSA 2GIVA 5G1ZA 3BJ7A 3LODA 4CGOA 3F5BA 2CNMA 3QB8A 2BUEA 1TIQA 1IYKA 2REEA 1NE9A 2KCWA 2WUUA 2J8NA 2R8VA 2ZW7A 4DNCA 3JTKA 3DNSA 2IL4A 3FBUA 4PK2A 2BL1A 4JJXA 3TT2A 3EO4A 2PDOA 2ATRA 3VWDA 4H89A 4YRHA 4PSWA 4CAFA 1YR0A 4KSAA 4MFJA 4CYOA 1Q2CA 3PGPA 1B6BA 4RI1A 3CXSA 3BJ8A 4JXRA 5AGEA 3IU1A 2I00A 3R9EA 2OU2A 5HMNA 1RXTA 3DSBA 4KLWA 2Z3MA 4B14A 2VZYA 5IB0A 2DXQA 3SXOA 2B5GB 1QSNA 2CY2A 2J8MA 4MFKA 2R7HA 4KORA 4Q36A 1IYLA 4KOYA 1S7NA 1XE4A 3EC4A 3R95A 4Y49B 4OADA 2Z11A 2PR1A 4B5OA 4Q38A 4HKFA 2QIRA 2EUIA 4NXYA 1IIDA 3FNCA 4QUSA 2YGWA 2WPXA 2YNDA 5I0CA 1S7LA 4CRYB 3WR7A 4NCZA 2REFA 2B4DB 5HH1A 4II9A 4AVCA 2FL4A 2QECA 4A32A 2FCKA 1MJAA 1I1DA 1YK3A 4NSQA 4UFVA 2JDDA 4QVTA 4CGLA 3UY5A 2O28A 2ZXVA 4JLYA 3VWEA 3G3SA 1IICA 1M1DA 5F49A 5C88A 2RC4A 4KOUA 1M4DA 4UA3A 2JDCA 1I21A 3TOAA 4FD7A 4R57A 5G22A 4HNXB 1BOBA 3D2MA 2G3TA 4I49A 1GHEA 2HQYA 4H6ZA 2P6EA 4U9ZA 2OZHA 3S6FA 3SHPA 1B87A 1K4JA 1S60A 2Z3KA 3DR6A 2G0BA 4XNHB 4BMHA 4KVXA 2WSAA 4CGPA 5F48A 4MFPA 4C2XA 2PC1A 1MK4A 1PUAA 4CAWA 3EXNA 4KOSA 5E96A 4YGOA 1QSRA 4JD6A 3C26A 4PSXA 4RS2A 2D4OA 4UFXA 1RO5A 1KUVA 4R3LA 2CNTA 2VZZA 4A33A 3IGRA 1V0CA 2B58A 1SQHA 4HNYB 2F5IA 4CGMA 3N7ZA 3E0KA 1LRZA 3ZZIA 2X7BA 4FD5A 4KS9A 2G3AA 5KTDA 3S6GA 3BLNA 4C2YA 2B3UA 1WK4A 4CYNA 3IWGA 4C68A 2BEIA 4JXQA 5IX3A 3FYNA 4NF1A 2VEZA 4MBUA 3FB3A 3H5ZA 5AG7A 4MFLA 3S6KA 2Q7BA 3R96A 4U9YA 4XPDC 4AB7A 4F0YA 3TO9A 4CGNA 3D2PA 2I79A 5H86A 4CAXA 4KOXA 1FY7A 1ZO0A 1VKCA 5A27A 5AG4A 2PQ8A 5C82A 5G21A 1KUYA 4MY0A 2FIAA 2Q04A 3P2FA 2QMLA 3PZJA 4C7HA 4FD4A 2PR8A 3JUWA 3G8WA 4IUSA 5J8FA 2PRBA 2Z3PA 4UCMA 1NMTA 2YNCA 1NSLA 3IWEA 5G20A 2Z10A 2YNCC 5CNPA 4GS4A 2YNEA 4PK3A 2Q4VA 4KOWA 2FSRA 1XMTA 3LD2A 4B5PA 3RYOA 1UFHA 2ZPAA 3GYAA 4KUBA 3KKWA 1OZPA 5AG6A 4LUAA 2FS5A 4F6AA 2ZW6A 3CXQA 4R87A 4OLLA 1ON0A 2K5TA 4UCNA 3I3GA 2AJ6A 4KVOE 4KSFA 1YVKA 4JWPA 5BWAB 2VBQA 4UWIA 4KUAA 3JVNA 5JPHA 3DDDA 2Z3LA 4A30A 3ZJ0A 1MJ9A 2NMTA 4FD6A 4J3GA 4QB9A 4CYQA 2OZGA 1IB1E 1Y9WA 4BBHA 4UCPA 2BSWA 4ZGYB 2R98A 4B13A 1Y7RA 5F46A 2OZUA 4XNHC 4F0XA 2C27A 5KTAA 3I9SA 4UFWA 3FXTA 4AG7A 4B11A 4A95A 2P0WA 1Q2DA 3TE4A 3TFYA 1U6MA 2Q4YA 4B10A 4QBJA 4KOVA 5ISVA 2R1IA 2B3VA 4HNWB 2GANA 3D8PA 3MGDA 1KUXA 3S6HA 4CRZB 2JLMA 3R9FA 2Q44A 1QSOA 4U5YA 3CXPA 3R9GA 4M85A 2ARHA 4AVBA 3FIXA 1S5KA 2EVNA 1QSMA 2HV2A 4L8AA 4MI4A 1MJBA 3B8GA 5A28A 4PV6A 2P6FA 1Z9UA 3FRMA 4C2ZA 4ZBGA 4B12A 4R3KA 3A9LA 3K9UA 3GY9A 2VXKA 2ZW5A 4KOTA 4AG9A 1YREA 2OH1A 1M4IA 2B5GA 1XIXA 4MFQA 4ORFA 1WWZA 1XF8A 3EY5A 2VQYA 5GCNA 1YLEA 2J8RA 3TO6A 1YGHA 1KZFA 3GKRA 4XPDB 1P4NA 1M4GA 2GE3A 1R57A 4CS0B 4OAEA 1I12A 2FIWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QST A;  4Y49 C;  5J8C A;  1BO4 A;  2FT0 A;  4E8O A;  2B4D A;  3W6S A;  2OB0 A;  3T90 A;  4QC6 A;  4YFJ A;  2ZW4 A;  1CM0 A;  2B4B A;  3EFA A;  3H4Q A;  4MY3 A;  1S7F A;  4K30 A;  5IV0 A;  1M44 A;  3TO7 A;  1Y9K A;  1S7K A;  4UWJ A;  3QAH A;  3OWC A;  5H84 A;  5EBV A;  2AE6 A;  1Q2Y A;  2Y0M A;  4ONU A;  3F8K A;  4B5P B;  3W6X A;  1XEB A;  3R1K A;  4MHD A;  1PU9 A;  4KZT A;  2H5M A;  2Q0Y A;  1S3Z A;  4L89 A;  3SXN A;  2FXF A;  5DWN A;  2FE7 A;  4KVM E;  2Z0Z A;  4E2A A;  3TTH A;  4XPL A;  5JQ4 A;  1YX0 A;  4UBR A;  4X5K A;  5F47 A;  5EC4 A;  3P2H A;  3NE7 A;  1J4J A;  1CJW A;  4M3S A;  2HUZ A;  5DWM A;  4MJ8 A;  2A4N A;  3DR8 A;  4H6U A;  1P0H A;  4R9M A;  1YVO A;  4AVA A;  4IF5 A;  4KLV A;  3TCV A;  4EVY A;  2D4P A;  1VHS A;  4CAV A;  2PSW A;  2P6G A;  2VI7 A;  4E0A A;  1L0C A;  3TOB A;  3T9Y A;  3W91 A;  3V8I A;  2JEV A;  1Z4E A;  3PP9 A;  4NEX A;  4XPK A;  3F0A A;  2WPW A;  1Z4R A;  5KTC A;  3D3S A;  4LX9 A;  5FVJ A;  1N71 A;  2CNS A;  2GIV A;  3BJ7 A;  3LOD A;  3F5B A;  2CNM A;  3QB8 A;  2BUE A;  1TIQ A;  1IYK A;  2REE A;  1NE9 A;  2KCW A;  2J8N A;  2R8V A;  2ZW7 A;  4DNC A;  3DNS A;  2IL4 A;  3FBU A;  4PK2 A;  2BL1 A;  4JJX A;  3TT2 A;  3EO4 A;  2PDO A;  2ATR A;  3VWD A;  4H89 A;  4YRH A;  4PSW A;  1YR0 A;  1Q2C A;  3PGP A;  1B6B A;  4RI1 A;  3CXS A;  3BJ8 A;  4JXR A;  2I00 A;  3R9E A;  2OU2 A;  5HMN A;  4KLW A;  1RXT A;  3DSB A;  2VZY A;  5IB0 A;  2DXQ A;  3SXO A;  2B5G B;  1QSN A;  2CY2 A;  2J8M A;  2R7H A;  4KOR A;  1IYL A;  4KOY A;  1S7N A;  1XE4 A;  3EC4 A;  3R95 A;  4Y49 B;  4OAD A;  2Z11 A;  2PR1 A;  4B5O A;  4HKF A;  2QIR A;  2EUI A;  4NXY A;  1IID A;  3FNC A;  4QUS A;  2WPX A;  5I0C A;  1S7L A;  4CRY B;  3WR7 A;  4NCZ A;  2REF A;  2B4D B;  5HH1 A;  4II9 A;  4AVC A;  2FL4 A;  2QEC A;  2FCK A;  1MJA A;  1I1D A;  1YK3 A;  4NSQ A;  2JDD A;  4QVT A;  3UY5 A;  2O28 A;  2ZXV A;  4JLY A;  3VWE A;  3G3S A;  1IIC A;  1M1D A;  5F49 A;  5C88 A;  2RC4 A;  4KOU A;  1M4D A;  4UA3 A;  2JDC A;  1I21 A;  3TOA A;  4FD7 A;  4R57 A;  4HNX B;  1BOB A;  3D2M A;  2G3T A;  4I49 A;  1GHE A;  2HQY A;  4H6Z A;  2P6E A;  4U9Z A;  2OZH A;  3S6F A;  3SHP A;  1B87 A;  1K4J A;  1S60 A;  3DR6 A;  2G0B A;  4XNH B;  4BMH A;  4KVX A;  5F48 A;  2PC1 A;  1MK4 A;  1PUA A;  4CAW A;  3EXN A;  4KOS A;  5E96 A;  4YGO A;  1QSR A;  4JD6 A;  3C26 A;  4PSX A;  4RS2 A;  2D4O A;  1RO5 A;  1KUV A;  4R3L A;  2CNT A;  2VZZ A;  3IGR A;  1V0C A;  2B58 A;  1SQH A;  4HNY B;  2F5I A;  3N7Z A;  3E0K A;  1LRZ A;  3ZZI A;  2X7B A;  4FD5 A;  2G3A A;  5KTD A;  3S6G A;  3BLN A;  2B3U A;  1WK4 A;  3IWG A;  2BEI A;  4JXQ A;  5IX3 A;  3FYN A;  4NF1 A;  2VEZ A;  4MBU A;  3FB3 A;  3S6K A;  2Q7B A;  3R96 A;  4U9Y A;  4XPD C;  4AB7 A;  4F0Y A;  3TO9 A;  3D2P A;  2I79 A;  5H86 A;  4CAX A;  4KOX A;  1FY7 A;  1VKC A;  2PQ8 A;  5C82 A;  1KUY A;  4MY0 A;  2FIA A;  2Q04 A;  3P2F A;  2QML A;  3PZJ A;  4FD4 A;  2PR8 A;  3JUW A;  3G8W A;  4IUS A;  5J8F A;  2PRB A;  1NMT A;  1NSL A;  2Z10 A;  5CNP A;  4GS4 A;  4PK3 A;  2Q4V A;  4KOW A;  2FSR A;  1XMT A;  3LD2 A;  4B5P A;  3RYO A;  1UFH A;  2ZPA A;  3GYA A;  4KUB A;  3KKW A;  1OZP A;  4LUA A;  2FS5 A;  4F6A A;  2ZW6 A;  3CXQ A;  4R87 A;  4OLL A;  1ON0 A;  2K5T A;  3I3G A;  2AJ6 A;  4KVO E;  1YVK A;  4JWP A;  2VBQ A;  4UWI A;  4KUA A;  3JVN A;  5JPH A;  3DDD A;  3ZJ0 A;  1MJ9 A;  2NMT A;  4FD6 A;  4J3G A;  4QB9 A;  2OZG A;  1IB1 E;  1Y9W A;  2BSW A;  2R98 A;  1Y7R A;  5F46 A;  2OZU A;  4XNH C;  2C27 A;  5KTA A;  3I9S A;  3FXT A;  4AG7 A;  2P0W A;  1Q2D A;  3TE4 A;  3TFY A;  1U6M A;  2Q4Y A;  4QBJ A;  4KOV A;  5ISV A;  2R1I A;  2B3V A;  4HNW B;  2GAN A;  3D8P A;  3MGD A;  1KUX A;  3S6H A;  4CRZ B;  2JLM A;  3R9F A;  2Q44 A;  1QSO A;  4U5Y A;  3CXP A;  3R9G A;  4M85 A;  2ARH A;  4AVB A;  3FIX A;  1S5K A;  2EVN A;  1QSM A;  2HV2 A;  4L8A A;  4MI4 A;  1MJB A;  3B8G A;  4PV6 A;  2P6F A;  1Z9U A;  3FRM A;  4ZBG A;  4R3K A;  3K9U A;  3GY9 A;  2VXK A;  2ZW5 A;  4KOT A;  4AG9 A;  1YRE A;  2OH1 A;  1M4I A;  2B5G A;  1XIX A;  4ORF A;  1WWZ A;  1XF8 A;  3EY5 A;  2VQY A;  5GCN A;  1YLE A;  2J8R A;  3TO6 A;  1YGH A;  1KZF A;  3GKR A;  4XPD B;  1P4N A;  1M4G A;  2GE3 A;  1R57 A;  4CS0 B;  4OAE A;  1I12 A;  2FIW A; 
#chains in the Genus database with same CATH topology
 4A31 A;  3FF3 A;  1QST A;  1VHO A;  1ZG9 A;  4Y49 C;  5J8C A;  1Y0R A;  1Y7E A;  3KHX A;  1Z2L A;  2QJ8 A;  1BO4 A;  1DE4 C;  4IHM A;  2O4H A;  2Q51 A;  2J9A A;  3SJF A;  2FT0 A;  2V8H A;  1H8L A;  2B4D A;  3FMC A;  4E8O A;  3W6S A;  2OB0 A;  3T90 A;  4QC6 A;  2JEW A;  4PQA A;  4YFJ A;  4LQG A;  3L2N A;  3FVL A;  2ZW4 A;  1CM0 A;  2B4B A;  1XBU A;  3EFA A;  3SI2 A;  3H4Q A;  1ELM P;  4M6I A;  4MY3 A;  4NGP A;  4R8F A;  1S7F A;  4K30 A;  4RN7 A;  5IV0 A;  5LYF A;  1M44 A;  3TO7 A;  2PE3 A;  5LRK A;  2Z3O A;  5D29 A;  1Y9K A;  1LAN A;  1S7K A;  4EWT A;  1Z5R A;  1IOF A;  4R6T A;  2Q7S A;  4UWJ A;  3QAH A;  3OWC A;  3RAM A;  3SI0 A;  5H84 A;  3WC6 A;  2CXA A;  2IMO A;  1IOI A;  4CYP A;  5EBV A;  1TF9 A;  2ZEO A;  3RNZ A;  2AE6 A;  1Q2Y A;  1Q7L A;  3K2K A;  1AYE A;  4MXU A;  2Y0M A;  2AFW A;  4P44 A;  5HVG A;  4P45 A;  5AG5 A;  4ONU A;  3F8K A;  4B5P B;  3W6X A;  4K3N A;  1CPX A;  2C6C A;  3FH4 A;  4C7I A;  1XEB A;  2ZEP A;  3R1K A;  4MHD A;  4MFZ A;  7CPA A;  1PU9 A;  4KZT A;  1XOV A;  3VAR A;  2H5M A;  1CP6 A;  1JQG A;  2Q0Y A;  4FUU A;  1S3Z A;  2OR4 A;  4L89 A;  3SXN A;  2FXF A;  5DWN A;  3FEE A;  2FE7 A;  3PB7 X;  4OID A;  4KVM E;  2Z0Z A;  2ZOF A;  5THW A;  4E2A A;  2PCU A;  4XPL A;  2OOT A;  3TTH A;  5JQ4 A;  1YX0 A;  2PRQ A;  3PB8 X;  4UBR A;  4X5K A;  5F47 A;  5EC4 A;  3P2H A;  3NE7 A;  4DUK A;  4A37 A;  3GB0 A;  1J4J A;  2PJ2 A;  1CJW A;  4M3S A;  2HUZ A;  5DWM A;  4MJ8 A;  2A4N A;  4MHN A;  3DR8 A;  4MCS A;  2PJ4 A;  4PXE A;  3NH5 A;  4H6U A;  4A2Z A;  1P0H A;  4R9M A;  1GYT A;  1YVO A;  5LRJ A;  4AVA A;  2CTB A;  2HB6 A;  3MRU A;  4IF5 A;  4KLV A;  3TCV A;  3B3C A;  4TWE A;  2C6G A;  4EVY A;  1A2Z A;  1Z8L A;  2PJA A;  2D4P A;  1VHS A;  4CAV A;  3ISX A;  2PSW A;  5CPA A;  2P6G A;  3H8G A;  4Z65 A;  4CAE A;  2AFX A;  2VI7 A;  1YME A;  4E0A A;  1VGY A;  1L0C A;  3TOB A;  3T9Y A;  4X2T A;  3W91 A;  3V8I A;  3IU2 A;  2JEV A;  1Z4E A;  3PP9 A;  4NEX A;  2DPT A;  5LYD A;  4XPK A;  1FNO A;  2WPW A;  3F0A A;  5LRG A;  1Z4R A;  2V77 A;  3B3S A;  2JBJ A;  3BHX A;  2POK A;  1R43 A;  5KTC A;  2DPS A;  4WJB A;  2Z3N A;  3D3S A;  4LX9 A;  1VHE A;  5FVJ A;  3TX8 A;  1N71 A;  2CNS A;  4NGS A;  2GIV A;  5G1Z A;  3BJ7 A;  3LOD A;  3PBB A;  3D7D A;  4A38 A;  4O23 A;  5K8M A;  4CGO A;  1QMU A;  3F5B A;  2CNM A;  3QB8 A;  3B35 A;  5ELY A;  3FEC A;  2BUE A;  1TIQ A;  1IYK A;  1IU8 A;  2PJB A;  2REE A;  4PXB A;  3VAT A;  1NE9 A;  4NFR A;  2I3C A;  2KCW A;  2WUU A;  1Y0Y A;  2J8N A;  2R8V A;  2ZEF A;  2ZW7 A;  4KSI A;  3JTK A;  4B6Z A;  3DNS A;  4DNC A;  4RUH A;  1BAV A;  2IL4 A;  3D68 A;  1CX8 A;  3FBU A;  1X12 A;  4PK2 A;  2BL1 A;  4JJX A;  5JGF A;  3TT2 A;  2ZEE A;  3EO4 A;  3KZW A;  2PDO A;  2EO8 A;  2ATR A;  3SI1 A;  3VWD A;  4H89 A;  4NGQ A;  4YRH A;  2ZEM A;  2CTC A;  1LCP A;  1FT7 A;  2JBK A;  4PSW A;  2GLJ A;  4CAF A;  1YR0 A;  5K8N A;  4KSA A;  4MFJ A;  4MMO A;  4ONW A;  1Q2C A;  3PFE A;  2ZEG A;  3RO0 A;  4CYO A;  3PGP A;  4LQ6 A;  1B6B A;  1XMB A;  3QAY A;  4RI1 A;  4F9V A;  4P10 A;  3CXS A;  3FJU A;  3BJ8 A;  4JXR A;  5AGE A;  3IU1 A;  2I00 A;  2XEF A;  4IAV A;  1CG2 A;  3R9E A;  2OU2 A;  5HMN A;  1RXT A;  3DSB A;  4KLW A;  2Z3M A;  4B14 A;  2RFH A;  2VZY A;  5IB0 A;  2DXQ A;  3SXO A;  3NE8 A;  2B5G B;  4ZX9 A;  2EK9 A;  2PJ5 A;  1QSN A;  1LAP A;  2CY2 A;  4ZY1 A;  2J8M A;  3KQX A;  4MFK A;  1PCA A;  3SJE A;  2R7H A;  2WZN A;  4P4F A;  4KOR A;  4Q36 A;  1IYL A;  2AFM A;  4KOY A;  3T8W A;  1S7N A;  1TKF A;  1XE4 A;  3EC4 A;  4Y49 B;  4OAD A;  2Z11 A;  2PR1 A;  3R95 A;  4B5O A;  3H8E A;  3NFZ A;  1ZLI A;  4Q38 A;  4HKF A;  2QIR A;  2EUI A;  4NXY A;  1IID A;  4PXC A;  3D7F A;  3FNC A;  4QUS A;  2YGW A;  1HDU A;  2WPX A;  1TKJ A;  1UWY A;  2YND A;  1NSA A;  1S7L A;  3KL9 A;  4CRY B;  4WWV A;  3WR7 A;  4NCZ A;  5I0C A;  2REF A;  2B4D B;  4Q7A A;  4OIW A;  4PPZ A;  3KQZ A;  5HH1 A;  4II9 A;  4AVC A;  2FL4 A;  2QEC A;  2NSM A;  4A32 A;  4A94 A;  3D66 A;  2FCK A;  1MJA A;  1I1D A;  1YK3 A;  4NSQ A;  3CPA A;  3NH8 A;  1AUG A;  4EFD A;  1ZG7 A;  4UFV A;  2JDD A;  4QVT A;  4BIN A;  4CGL A;  3UY5 A;  2ZEH A;  4JZ0 A;  2O28 A;  2PJC A;  2ZXV A;  4JLY A;  3B7I A;  3VWE A;  3IIB A;  4UF4 A;  3B2Y A;  3G3S A;  1IIC A;  1M1D A;  2WYR A;  5F49 A;  4ZI6 A;  5C88 A;  2EK8 A;  2RC4 A;  4KOU A;  2BOA A;  1M4D A;  4OC3 A;  2JDC A;  4FWU A;  4UA3 A;  4UEF A;  1I21 A;  5HVH A;  3V7Z A;  3TOA A;  4FD7 A;  4R57 A;  5G22 A;  2ODF A;  3KI9 A;  4HNX B;  4TNU A;  3HLP A;  1ZLH A;  1F2O A;  1BOB A;  3DGV A;  3D2M A;  2G3T A;  4I49 A;  1DTD A;  1GHE A;  2QYV A;  4FBE A;  2O53 A;  2HQY A;  3WC5 A;  2C1C A;  2IJZ A;  4H6Z A;  2P6E A;  4U9Z A;  2ZEN A;  4MCR A;  5K8P A;  2OZH A;  1LAM A;  3S6F A;  2DF5 A;  4OKO A;  4ZX8 A;  5IB9 A;  3SHP A;  5HXD A;  1B87 A;  1K4J A;  1S60 A;  2Z3K A;  3BXM A;  3K9T A;  1AMP A;  3DR6 A;  2G0B A;  5F09 A;  4XNH B;  3VH9 A;  2V8G A;  4KVX A;  4ZY2 A;  4BMH A;  2WSA A;  1RTQ A;  3PEI A;  4NGT A;  4CGP A;  5F48 A;  4MFP A;  2EBJ A;  2PIY A;  2GFQ A;  4C2X A;  2PC1 A;  1MK4 A;  1PUA A;  2AFO A;  3H8F A;  4GM5 A;  4CAW A;  4MRI A;  3EXN A;  4KOS A;  5E96 A;  4YGO A;  1QSR A;  4JD6 A;  3C26 A;  4PSX A;  4RS2 A;  1ARM A;  2D4O A;  4UFX A;  1RO5 A;  4ZY0 A;  1CBX A;  1KUV A;  4R3L A;  2CNT A;  2VZZ A;  2XEI A;  2PJ7 A;  4A33 A;  3IGR A;  1V0C A;  2GU2 A;  2B58 A;  4MHZ A;  1SQH A;  1X10 A;  4UEE A;  4HNY B;  4MHY A;  2F5I A;  3WAB A;  1OBR A;  3N7Z A;  4M6G A;  4CGM A;  3WC7 A;  3E0K A;  8CPA A;  1LRZ A;  3ZZI A;  2X7B A;  4FD5 A;  4KS9 A;  2G3A A;  4MCP A;  4NGM A;  1CP7 A;  3KGQ A;  3S6G A;  3BLN A;  4NGR A;  4A39 A;  5KTD A;  5LYL A;  4OC1 A;  4C2Y A;  2ANP A;  1HDQ A;  1WK4 A;  2B3U A;  3IWG A;  4C68 A;  4CYN A;  4DJL A;  2BEI A;  4JXQ A;  1ARL A;  5IX3 A;  3FYN A;  2V8D A;  4NF1 A;  2VEZ A;  2Q43 A;  1YW6 A;  3PRT A;  3BI1 A;  4YWY A;  3IFE A;  4MBU A;  3FB3 A;  4OP4 A;  1HEE A;  3H5Z A;  5AG7 A;  4MFL A;  4DYO A;  3S6K A;  2Q7B A;  3R96 A;  4U9Y A;  2AFU A;  4XPD C;  4AB7 A;  4OC5 A;  1TF8 A;  4F0Y A;  3CZX A;  3TO9 A;  4CGN A;  3D2P A;  3S9M A;  2IQ6 A;  4P4E A;  6CPA A;  1TKH A;  2I79 A;  2PVV A;  1F57 A;  5H86 A;  3WT4 A;  2AFZ A;  3IWW A;  4KOX A;  4CAX A;  4NJR A;  1FY7 A;  1ZO0 A;  3CPX A;  4H2K A;  2F7V A;  1VKC A;  3SJG A;  5A27 A;  5AG4 A;  3S9N A;  5JH9 A;  2PQ8 A;  5C82 A;  5G21 A;  4PXD A;  1KUY A;  5CBM A;  3LAC A;  4MY0 A;  4P4B A;  2FIA A;  2Q04 A;  3P2F A;  1KWM A;  2QML A;  3PZJ A;  4W9Y A;  4C7H A;  4EME A;  3FED A;  4FD4 A;  4F9U A;  2PR8 A;  3JUW A;  2GLF A;  3G8W A;  1YSJ A;  3I1U A;  4IUS A;  5J8F A;  2PJ6 A;  2G9D A;  2PRB A;  2Z3P A;  3CDX A;  1NMT A;  2YNC A;  3KAS A;  3KR5 A;  4UCM A;  2ZED A;  4P4J A;  3IWE A;  1NSL A;  2NYQ A;  3RZA A;  4ZYQ A;  5G20 A;  2Z10 A;  2XEJ A;  3KHZ A;  3MN8 A;  1CPS A;  2YNC C;  5CNP A;  4GS4 A;  2BCO A;  2YNE A;  4AXV A;  5LYI A;  4PK3 A;  2Q4V A;  4KOW A;  2FSR A;  4NJQ A;  4R7M A;  1XMT A;  3LD2 A;  5D8N A;  4B5P A;  4UIA A;  3RYO A;  1UFH A;  2ZPA A;  3GYA A;  3FX6 A;  3B3W A;  4KUB A;  3S9L A;  3KKW A;  1OZP A;  3PBE A;  2ABZ A;  2VL1 A;  1LFW A;  3D67 A;  2QVP A;  4F8Z A;  1JWQ A;  5AG6 A;  1IGB A;  4LUA A;  4UIB A;  1TXR A;  1R3N A;  2FS5 A;  4MCQ A;  3BI0 A;  4F6A A;  2ZW6 A;  3CXQ A;  4R87 A;  4OLL A;  4OME A;  1ON0 A;  2K5T A;  2PJ1 A;  4UCN A;  1QQ9 A;  2EWB A;  3I3G A;  2AJ6 A;  3PB4 X;  4KVO E;  4KSF A;  3TC8 A;  3B3T A;  1YVK A;  4JWP A;  1YQE A;  2FVG A;  3GUX A;  1XFO A;  3IO1 A;  2VBQ A;  5BWA B;  1ZG8 A;  4UWI A;  4KUA A;  3JVN A;  5JPH A;  3DDD A;  3LMS A;  2Z3L A;  4A30 A;  3ZJ0 A;  4YU9 A;  4FAI A;  1MJ9 A;  2NMT A;  4FD6 A;  4J3G A;  4QB9 A;  1ELL P;  3DLJ A;  4CYQ A;  5JM6 A;  2OZG A;  1IB1 E;  1Y9W A;  2V8V A;  4OC2 A;  3PB6 X;  4BBH A;  4UCP A;  2BSW A;  4JYW A;  4ZGY B;  2R98 A;  1XRY A;  4B13 A;  2PJ3 A;  4X8I A;  4G1P A;  2AFS A;  1BPM A;  1Y7R A;  5HVF A;  5F46 A;  4P4I A;  2PJ9 A;  4HPS A;  1EE3 P;  2OZU A;  3KR4 A;  1LOK A;  2PIZ A;  4XNH C;  4F0X A;  4P6Y A;  2C27 A;  1Z8W A;  5KTA A;  3V38 A;  3I9S A;  4UFW A;  1XJO A;  3FXT A;  4AG7 A;  4B11 A;  3D7G A;  4A95 A;  2P0W A;  1Q2D A;  3TE4 A;  3TFY A;  1U6M A;  2Q4Y A;  3RBU A;  4B10 A;  3B3V A;  4QBJ A;  4BD9 A;  4KOV A;  1M4L A;  1YLO A;  2B3V A;  2R1I A;  4HNW B;  4M6H A;  5ISV A;  2GAN A;  3D8P A;  3MGD A;  2PJ0 A;  4CPA A;  1KUX A;  4OC4 A;  3S6H A;  1PYT B;  3D4U A;  2Q4Z A;  4CRZ B;  2JLM A;  4MHP A;  1BLL E;  3R9F A;  2Q44 A;  3JRU A;  1YW4 A;  1QSO A;  4U5Y A;  3CXP A;  3R9G A;  2CF4 A;  1F2P A;  5J1Q A;  4M85 A;  2ARH A;  2GRE A;  4AVB A;  2RB7 A;  3QNV A;  3GLJ A;  2ZEL A;  1BPN A;  3FIX A;  5K8O A;  1S5K A;  4GXH A;  4NGN A;  2CIJ A;  2EVN A;  1QSM A;  2DEA A;  2HV2 A;  2HC9 A;  3SJX A;  3IJ3 A;  3PB9 X;  4L8A A;  4MI4 A;  1MJB A;  3B8G A;  4R76 A;  5A28 A;  3D7H A;  4PV6 A;  2P6F A;  2BO9 A;  1Z9U A;  4OC0 A;  4UEZ A;  2ZOG A;  3FRM A;  4C2Z A;  4ZBG A;  5I4M A;  4B12 A;  4IK2 A;  2XEG A;  4R3K A;  4X3R A;  3A9L A;  3K9U A;  3NA6 A;  3GY9 A;  2VXK A;  1Z8X A;  2ZW5 A;  2PVW A;  3IEH A;  2C6P A;  3LWU A;  4KOT A;  3GIU A;  3IC1 A;  4AG9 A;  1YRE A;  2OH1 A;  2PJ8 A;  1M4I A;  2B5G A;  5DS0 A;  1XIX A;  4MFQ A;  4ORF A;  1WWZ A;  1XF8 A;  3EY5 A;  1VIX A;  2VQY A;  3NH4 A;  5GCN A;  1YLE A;  2J8R A;  3TO6 A;  1YGH A;  1KZF A;  3GKR A;  4XPD B;  1P4N A;  1M4G A;  2GE3 A;  1R57 A;  4CS0 B;  2F8H A;  3ISZ A;  4OAE A;  4P4D A;  1I12 A;  1Z8T A;  2FIW A;  3CT9 A;  3PFO A;  5EMI A;  3HUV A;  3N5F A;  1IY7 A; 
#chains in the Genus database with same CATH homology
 4A31 A;  1QST A;  4Y49 C;  5J8C A;  1BO4 A;  2FT0 A;  4E8O A;  2B4D A;  3W6S A;  2OB0 A;  3T90 A;  4QC6 A;  4YFJ A;  2ZW4 A;  1CM0 A;  2B4B A;  3EFA A;  3H4Q A;  4MY3 A;  1S7F A;  4K30 A;  5IV0 A;  1M44 A;  3TO7 A;  2Z3O A;  1Y9K A;  1S7K A;  4UWJ A;  3QAH A;  3OWC A;  5H84 A;  2CXA A;  4CYP A;  5EBV A;  2AE6 A;  1Q2Y A;  2Y0M A;  5AG5 A;  4ONU A;  3F8K A;  4B5P B;  3W6X A;  4C7I A;  1XEB A;  3R1K A;  4MHD A;  4MFZ A;  1PU9 A;  4KZT A;  2H5M A;  2Q0Y A;  1S3Z A;  4L89 A;  3SXN A;  2FXF A;  5DWN A;  2FE7 A;  4KVM E;  2Z0Z A;  4E2A A;  3TTH A;  4XPL A;  5JQ4 A;  1YX0 A;  4UBR A;  4X5K A;  5F47 A;  5EC4 A;  3P2H A;  3NE7 A;  1J4J A;  1CJW A;  4M3S A;  2HUZ A;  5DWM A;  4MJ8 A;  2A4N A;  3DR8 A;  4H6U A;  4A2Z A;  1P0H A;  4R9M A;  1YVO A;  4AVA A;  4IF5 A;  4KLV A;  3TCV A;  4EVY A;  2D4P A;  1VHS A;  4CAV A;  2PSW A;  2P6G A;  4CAE A;  2VI7 A;  4E0A A;  1L0C A;  3TOB A;  3T9Y A;  3W91 A;  3V8I A;  3IU2 A;  2JEV A;  1Z4E A;  3PP9 A;  4NEX A;  2DPT A;  4XPK A;  3F0A A;  2WPW A;  1Z4R A;  5KTC A;  2DPS A;  2Z3N A;  3D3S A;  4LX9 A;  5FVJ A;  1N71 A;  2CNS A;  2GIV A;  5G1Z A;  3BJ7 A;  3LOD A;  4CGO A;  3F5B A;  2CNM A;  3QB8 A;  2BUE A;  1TIQ A;  1IYK A;  2REE A;  1NE9 A;  2KCW A;  2WUU A;  2J8N A;  2R8V A;  2ZW7 A;  4DNC A;  3JTK A;  3DNS A;  2IL4 A;  3FBU A;  4PK2 A;  2BL1 A;  4JJX A;  3TT2 A;  3EO4 A;  2PDO A;  2ATR A;  3VWD A;  4H89 A;  4YRH A;  4PSW A;  4CAF A;  1YR0 A;  4KSA A;  4MFJ A;  4CYO A;  1Q2C A;  3PGP A;  1B6B A;  4RI1 A;  3CXS A;  3BJ8 A;  4JXR A;  5AGE A;  3IU1 A;  2I00 A;  3R9E A;  2OU2 A;  5HMN A;  1RXT A;  3DSB A;  4KLW A;  2Z3M A;  4B14 A;  2VZY A;  5IB0 A;  2DXQ A;  3SXO A;  2B5G B;  1QSN A;  2CY2 A;  2J8M A;  4MFK A;  2R7H A;  4KOR A;  4Q36 A;  1IYL A;  4KOY A;  1S7N A;  1XE4 A;  3EC4 A;  3R95 A;  4Y49 B;  4OAD A;  2Z11 A;  2PR1 A;  4B5O A;  4Q38 A;  4HKF A;  2QIR A;  2EUI A;  4NXY A;  1IID A;  3FNC A;  4QUS A;  2YGW A;  2WPX A;  2YND A;  5I0C A;  1S7L A;  4CRY B;  3WR7 A;  4NCZ A;  2REF A;  2B4D B;  5HH1 A;  4II9 A;  4AVC A;  2FL4 A;  2QEC A;  4A32 A;  2FCK A;  1MJA A;  1I1D A;  1YK3 A;  4NSQ A;  4UFV A;  2JDD A;  4QVT A;  4CGL A;  3UY5 A;  2O28 A;  2ZXV A;  4JLY A;  3VWE A;  3G3S A;  1IIC A;  1M1D A;  5F49 A;  5C88 A;  2RC4 A;  4KOU A;  1M4D A;  4UA3 A;  2JDC A;  1I21 A;  3TOA A;  4FD7 A;  4R57 A;  5G22 A;  4HNX B;  1BOB A;  3D2M A;  2G3T A;  4I49 A;  1GHE A;  2HQY A;  4H6Z A;  2P6E A;  4U9Z A;  2OZH A;  3S6F A;  3SHP A;  1B87 A;  1K4J A;  1S60 A;  2Z3K A;  3DR6 A;  2G0B A;  4XNH B;  4BMH A;  4KVX A;  2WSA A;  4CGP A;  5F48 A;  4MFP A;  4C2X A;  2PC1 A;  1MK4 A;  1PUA A;  4CAW A;  3EXN A;  4KOS A;  5E96 A;  4YGO A;  1QSR A;  4JD6 A;  3C26 A;  4PSX A;  4RS2 A;  2D4O A;  4UFX A;  1RO5 A;  1KUV A;  4R3L A;  2CNT A;  2VZZ A;  4A33 A;  3IGR A;  1V0C A;  2B58 A;  1SQH A;  4HNY B;  2F5I A;  4CGM A;  3N7Z A;  3E0K A;  1LRZ A;  3ZZI A;  2X7B A;  4FD5 A;  4KS9 A;  2G3A A;  5KTD A;  3S6G A;  3BLN A;  4C2Y A;  2B3U A;  1WK4 A;  4CYN A;  3IWG A;  4C68 A;  2BEI A;  4JXQ A;  5IX3 A;  3FYN A;  4NF1 A;  2VEZ A;  4MBU A;  3FB3 A;  3H5Z A;  5AG7 A;  4MFL A;  3S6K A;  2Q7B A;  3R96 A;  4U9Y A;  4XPD C;  4AB7 A;  4F0Y A;  3TO9 A;  4CGN A;  3D2P A;  2I79 A;  5H86 A;  4CAX A;  4KOX A;  1FY7 A;  1ZO0 A;  1VKC A;  5A27 A;  5AG4 A;  2PQ8 A;  5C82 A;  5G21 A;  1KUY A;  4MY0 A;  2FIA A;  2Q04 A;  3P2F A;  2QML A;  3PZJ A;  4C7H A;  4FD4 A;  2PR8 A;  3JUW A;  3G8W A;  4IUS A;  5J8F A;  2PRB A;  2Z3P A;  4UCM A;  1NMT A;  2YNC A;  1NSL A;  3IWE A;  5G20 A;  2Z10 A;  2YNC C;  5CNP A;  4GS4 A;  2YNE A;  4PK3 A;  2Q4V A;  4KOW A;  2FSR A;  1XMT A;  3LD2 A;  4B5P A;  3RYO A;  1UFH A;  2ZPA A;  3GYA A;  4KUB A;  3KKW A;  1OZP A;  5AG6 A;  4LUA A;  2FS5 A;  4F6A A;  2ZW6 A;  3CXQ A;  4R87 A;  4OLL A;  1ON0 A;  2K5T A;  4UCN A;  3I3G A;  2AJ6 A;  4KVO E;  4KSF A;  1YVK A;  4JWP A;  5BWA B;  2VBQ A;  4UWI A;  4KUA A;  3JVN A;  5JPH A;  3DDD A;  2Z3L A;  4A30 A;  3ZJ0 A;  1MJ9 A;  2NMT A;  4FD6 A;  4J3G A;  4QB9 A;  4CYQ A;  2OZG A;  1IB1 E;  1Y9W A;  4BBH A;  4UCP A;  2BSW A;  4ZGY B;  2R98 A;  4B13 A;  1Y7R A;  5F46 A;  2OZU A;  4XNH C;  4F0X A;  2C27 A;  5KTA A;  3I9S A;  4UFW A;  3FXT A;  4AG7 A;  4B11 A;  4A95 A;  2P0W A;  1Q2D A;  3TE4 A;  3TFY A;  1U6M A;  2Q4Y A;  4B10 A;  4QBJ A;  4KOV A;  5ISV A;  2R1I A;  2B3V A;  4HNW B;  2GAN A;  3D8P A;  3MGD A;  1KUX A;  3S6H A;  4CRZ B;  2JLM A;  3R9F A;  2Q44 A;  1QSO A;  4U5Y A;  3CXP A;  3R9G A;  4M85 A;  2ARH A;  4AVB A;  3FIX A;  1S5K A;  2EVN A;  1QSM A;  2HV2 A;  4L8A A;  4MI4 A;  1MJB A;  3B8G A;  5A28 A;  4PV6 A;  2P6F A;  1Z9U A;  3FRM A;  4C2Z A;  4ZBG A;  4B12 A;  4R3K A;  3A9L A;  3K9U A;  3GY9 A;  2VXK A;  2ZW5 A;  4KOT A;  4AG9 A;  1YRE A;  2OH1 A;  1M4I A;  2B5G A;  1XIX A;  4MFQ A;  4ORF A;  1WWZ A;  1XF8 A;  3EY5 A;  2VQY A;  5GCN A;  1YLE A;  2J8R A;  3TO6 A;  1YGH A;  1KZF A;  3GKR A;  4XPD B;  1P4N A;  1M4G A;  2GE3 A;  1R57 A;  4CS0 B;  4OAE A;  1I12 A;  2FIW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...