1MK4A

Structure of protein of unknown function yqjy from bacillus subtilis, probable acetyltransferase
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
157
structure length
157
Chain Sequence
HMDIRTITSSDYEMVTSVLNEWWGGRQLKEKLPRLFFEHFQDTSFITSEHNSMTGFLIGFQSQSDPETAYIHFSGVHPDFRKMQIGKQLYDVFIETVKQRGCTRVKCVTSPVNKVSIAYHTKLGFDIEKGTKTVNGISVFANYDGPGQDRVLFVKNI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title 1.7A crystal structure of a hypothetical protein yqjY from Bacillus subtilis
rcsb
source organism Bacillus subtilis
molecule tags Structural genomics, unknown function
molecule keywords Hypothetical protein yqjY
total genus 43
structure length 157
sequence length 157
chains with identical sequence B
ec nomenclature
pdb deposition date 2002-08-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 1mk4A00
3G3SA 4FD4A 1U6MA 4CRZB 4HNWB 3C26A 4H6UA 3ZZIA 1Z4RA 1IICA 5CNPA 1R57A 1Q2YA 3GYAA 1TIQA 2EUIA 3VWEA 5IV0A 2JLMA 4UWIA 1S3ZA 2OZHA 4UBRA 3R96A 1BOBA 5KTCA 4AVAA 2Q4YA 2VZYA 5F48A 5J8FA 3TCVA 1YVKA 2PR1A 1IYKA 4PV6A 1KUYA 3N7ZA 3TTHA 3W91A 2PDOA 2C27A 2CNMA 2B58A 2CNSA 2FT0A 3P2HA 4XNHB 3TT2A 2KCWA 4EVYA 2VXKA 2PC1A 2ZW7A 3DR8A 5FVJA 4KVXA 3TO9A 3P2FA 4E8OA 1XIXA 4RS2A 1Z9UA 2FL4A 2J8RA 1XF8A 4R3LA 4ORFA 2FE7A 1YLEA 3D3SA 4J3GA 1GHEA 1QSNA 2PR8A 1QSMA 4FD6A 1S7KA 2ZW4A 1XMTA 4U9YA 5HH1A 2PSWA 4HNYB 3TOBA 2K5TA 5DWNA 5C88A 1S7NA 3R9FA 4ONUA 2Z11A 4II9A 4KLWA 3EC4A 3EXNA 1P4NA 2AE6A 2Q7BA 3RYOA 2BL1A 1I21A 1MJAA 1B87A 2GANA 4KUAA 4QBJA 5F47A 4OADA 4L8AA 3IWGA 5GCNA 5JPHA 5KTDA 4KVME 5IB0A 4CRYB 4NEXA 2R1IA 1L0CA 4R3KA 1Y9WA 2VEZA 3SXNA 4GS4A 1YX0A 2REEA 3BJ7A 2JDDA 3QAHA 3G8WA 4KLVA 3EFAA 4Y49C 4KOUA 2J8MA 2REFA 4FD7A 4DNCA 2EVNA 2FSRA 2G3AA 1FY7A 4MY0A 3GKRA 2FXFA 3CXPA 3TO7A 4AG7A 3TFYA 1S7LA 3LODA 4KOYA 3I9SA 1M1DA 4XPLA 3R9EA 3R95A 3S6FA 1Y7RA 2ZW6A 5F46A 2OH1A 1QSTA 3BLNA 3CXSA 1CM0A 5KTAA 3ZJ0A 3TO6A 4OAEA 1NMTA 2OZGA 1UFHA 2QECA 1RXTA 1VHSA 3EO4A 1N71A 2FCKA 2PQ8A 3WR7A 4X5KA 4E0AA 4RI1A 2BEIA 1Y9KA 2O28A 4M3SA 2ZPAA 5HMNA 4QUSA 1M44A 1Z4EA 3FNCA 2VQYA 3V8IA 1V0CA 2OU2A 5EC4A 3FIXA 2RC4A 1QSOA 2P6FA 1IIDA 1NSLA 3DSBA 3FRMA 4OLLA 1CJWA 1B6BA 4AB7A 4CAXA 4YFJA 1P0HA 5I0CA 4UA3A 3S6KA 2FIWA 4JWPA 2HQYA 4PSWA 1YREA 2HV2A 2Y0MA 3F5BA 4XPDB 1KUXA 4MJ8A 4M85A 4XPKA 5IX3A 3DDDA 1PU9A 3S6HA 2Q04A 5E96A 4HNXB 4F6AA 4AVBA 1ON0A 4NXYA 4KORA 1RO5A 4K30A 1KUVA 3BJ8A 3T9YA 4IUSA 4QB9A 2X7BA 4MI4A 3QB8A 4H6ZA 2BSWA 2B3UA 2R8VA 2R98A 2IL4A 4FD5A 1WK4A 2NMTA 4ZBGA 3FB3A 3I3GA 2Q4VA 1M4DA 5ISVA 3T90A 4AVCA 4KZTA 4IF5A 4JXRA 1K4JA 4JD6A 2Q44A 3NE7A 3E0KA 3OWCA 3B8GA 3PZJA 1M4IA 1QSRA 1NE9A 2CY2A 3DNSA 3D8PA 4MHDA 4NSQA 2GE3A 2QIRA 1I1DA 4B5OA 3D2MA 1OZPA 1S5KA 5F49A 1MJ9A 2G3TA 2BUEA 2WPWA 3JUWA 3W6XA 2JDCA 2ARHA 2QMLA 3F0AA 1YK3A 3PP9A 4UWJA 4KUBA 4XNHC 3SXOA 1S60A 4QC6A 3FXTA 3PGPA 4AG9A 3TOAA 3VWDA 4KOWA 5C82A 4CS0B 1VKCA 4R9MA 4L89A 3S6GA 5H86A 1MK4A 1YGHA 2FS5A 1KZFA 3MGDA 2DXQA 4KOSA 3FBUA 3IGRA 2AJ6A 2P6EA 4I49A 1I12A 2A4NA 2Q0YA 3R9GA 4BMHA 4Y49B 2VI7A 1WWZA 2OZUA 3W6SA 2I00A 3F8KA 3EY5A 4HKFA 2WPXA 2D4PA 3K9UA 2B5GA 2F5IA 1YR0A 2ATRA 4U9ZA 4LUAA 2ZW5A 4JLYA 4QVTA 3SHPA 2ZXVA 1SQHA 2Z10A 4MBUA 3GY9A 5EBVA 2VBQA 2HUZA 1XE4A 1BO4A 4PK2A 4MY3A 4R57A 2B3VA 4KOVA 2J8NA 3JVNA 4U5YA 3H4QA 1XEBA 5J8CA 2JEVA 1Q2DA 2PRBA 5DWMA 4KOXA 4LX9A 4KOTA 4YRHA 4E2AA 3FYNA 3DR6A 1M4GA 2VZZA 2B4BA 2D4OA 1IB1E 1J4JA 4H89A 2B5GB 2OB0A 3TE4A 3CXQA 3LD2A 5JQ4A 4JJXA 4R87A 1MJBA 1IYLA 4CAVA 4PSXA 4NCZA 4JXQA 1PUAA 4NF1A 2CNTA 4XPDC 2B4DA 2I79A 3D2PA 1Q2CA 2B4DB 2P0WA 2Z0ZA 4F0YA 4B5PB 2H5MA 1YVOA 4KVOE 2GIVA 1LRZA 4B5PA 5H84A 2R7HA 2P6GA 3R1KA 1S7FA 3KKWA 2FIAA 4PK3A 3UY5A 4YGOA 2G0BA 4CAWA
chains in the Genus database with same CATH superfamily
2ZELA 2VL1A 2PJ4A 2PJBA 2ZEEA 4GM5A 1CPSA 5D8NA 3G3SA 4FD4A 3KQZA 4OC5A 1U6MA 4CRZB 3VH9A 2Q4ZA 4F8ZA 4HNWB 3C26A 4B14A 4H6UA 2HC9A 3CDXA 3ZZIA 1BPMA 2NSMA 1Z4RA 2DPSA 2Z3PA 2DPTA 1IICA 5CNPA 1UWYA 1IU8A 1R57A 2PCUA 2QVPA 4ZY0A 5G22A 2ZEGA 1Q2YA 4PXEA 3GYAA 1TIQA 2EUIA 3VWEA 5IV0A 2JLMA 1OBRA 3KR5A 1S3ZA 4UWIA 2OZHA 4UBRA 1VIXA 2GLFA 2JBKA 3R96A 2CTBA 1BOBA 4LQGA 2HB6A 5KTCA 1F2OA 3JRUA 1CG2A 4AVAA 2Q4YA 2VZYA 5HVHA 5DS0A 5F48A 5K8OA 5J8FA 4UIBA 3TCVA 1HDUA 1YVKA 3CPXA 3DGVA 1Y0RA 2PR1A 1IYKA 4PV6A 4C2ZA 1VHOA 1KUYA 3N7ZA 3TTHA 3W91A 2PDOA 2PJCA 3ISXA 4MFPA 4WJBA 4EMEA 1X10A 1TKHA 2C27A 2B58A 2CNMA 2CNSA 2FT0A 5BWAB 3P2HA 4ZX9A 4XNHB 1AMPA 3TT2A 3N5FA 3RBUA 2KCWA 4EVYA 1XMBA 2VXKA 2Z3LA 4CGLA 2PC1A 2ZW7A 3D67A 3DR8A 5FVJA 4KVXA 4X3RA 3TO9A 4MCPA 3P2FA 4E8OA 4ZX8A 1XIXA 1FT7A 2ZOFA 1Z9UA 4RS2A 3NH5A 3KGQA 2FL4A 4B11A 2J8RA 4EWTA 1XF8A 2G9DA 1Z8WA 4R3LA 2YGWA 2O53A 4CYNA 4CYPA 2XEGA 2YNCC 4ORFA 2FE7A 4UCNA 3B3CA 4MMOA 1YLEA 2GLJA 1GHEA 1QSNA 3D3SA 4J3GA 2PR8A 5AG6A 1QSMA 4FD6A 1S7KA 2EK9A 2ZW4A 1XMTA 1VGYA 3K9TA 4U9YA 5HH1A 3SJFA 5A28A 5AG4A 1IY7A 2PSWA 1BAVA 4FUUA 4W9YA 4YWYA 2C6GA 3SI1A 1PCAA 4HNYB 3TOBA 2K5TA 5EMIA 4DJLA 5DWNA 5A27A 5JGFA 1CP6A 5C88A 1S7NA 2XEFA 4A38A 1BPNA 2AFZA 3R9FA 4PXDA 4MCRA 4ONUA 3I1UA 2Z11A 3PEIA 4II9A 3PBBA 4OC4A 3T8WA 4KLWA 2PJ6A 2OR4A 5G21A 2FVGA 1KWMA 4B10A 5AGEA 3EC4A 1CX8A 2BCOA 3EXNA 1P4NA 2AE6A 4A39A 2Q7BA 3RYOA 2BL1A 1Z8LA 1I21A 1MJAA 3PBEA 4A30A 5LRGA 1QMUA 1B87A 3KASA 2AFUA 3D68A 3GIUA 3JTKA 4ONWA 2V77A 2GANA 4KUAA 3GUXA 4F0XA 4QBJA 3KL9A 3BHXA 5F47A 4OADA 4Q38A 4L8AA 3B7IA 4OP4A 3IWGA 5GCNA 5JPHA 5KTDA 3KR4A 1EE3P 3IC1A 1XRYA 2EBJA 4KVME 5IB0A 4CRYB 3S9LA 4NEXA 2R1IA 1L0CA 2WYRA 6CPAA 4R3KA 1Y9WA 1LCPA 5D29A 2V8HA 2VEZA 3PFOA 4GS4A 3SXNA 1YX0A 1LFWA 2Q43A 1YSJA 2REEA 3BJ7A 3H5ZA 4P6YA 4UFVA 5LRKA 3H8FA 1F2PA 2JDDA 2Z3OA 4YU9A 4CYQA 3A9LA 4KSAA 3QAHA 3G8WA 4KLVA 4NGNA 3B3VA 3MRUA 3EFAA 4Y49C 4KOUA 4B12A 2J8MA 2REFA 4FD7A 4DNCA 2EVNA 2FSRA 4Z65A 2ABZA 4ZI6A 1TXRA 2WSAA 2G3AA 1XBUA 1XFOA 3TX8A 1FY7A 2WZNA 3NA6A 4A94A 4MY0A 3GKRA 2FXFA 3CXPA 3SJEA 4IHMA 3TO7A 4AG7A 2J9AA 4X2TA 4UCMA 5HVGA 4P4IA 3IO1A 4NGMA 3TFYA 4F9VA 1S7LA 3LODA 3CZXA 3IEHA 4KOYA 1ARLA 1VHEA 3WC5A 3I9SA 1M1DA 4XPLA 3R9EA 3R95A 4DYOA 4P44A 3S6FA 1Y7RA 2ZW6A 3FF3A 1YW6A 4P4DA 2V8GA 5LRJA 2OH1A 5F46A 2C6CA 4OC3A 5F09A 1QSTA 3BLNA 3CXSA 3CPAA 3D7DA 1CM0A 5KTAA 3ZJ0A 4WWVA 2YNDA 4NGTA 2OZGA 1NMTA 3KHXA 3KQXA 4OAEA 4PPZA 1UFHA 1FNOA 2QECA 1RXTA 1VHSA 3EO4A 1N71A 2FCKA 2PQ8A 3WR7A 4X5KA 3TO6A 2PRQA 3SI0A 4E0AA 4RI1A 3L2NA 2DF5A 2BEIA 3V7ZA 1Y9KA 2O28A 4M3SA 2ZPAA 3SJXA 5HMNA 4QUSA 1M44A 1Z4EA 1CBXA 5K8MA 3FNCA 2VQYA 1YQEA 3BXMA 4Q7AA 2OU2A 1V0CA 5EC4A 3V8IA 3FIXA 4ZGYB 1LAMA 2PJ1A 2PJ8A 2RC4A 1QSOA 4MHZA 2P6FA 3NH8A 5AG7A 4UEFA 1IIDA 1DTDA 3WT4A 4CPAA 4F9UA 2ZOGA 1NSLA 3DSBA 3FRMA 3KZWA 4OLLA 1CJWA 3KI9A 4OC2A 3RNZA 1B6BA 4AB7A 4CAXA 4YFJA 1P0HA 5I0CA 1Y7EA 4BBHA 1JWQA 3LWUA 4UA3A 3S6KA 5CBMA 2FIWA 4C2XA 4JWPA 2HQYA 1YREA 2HV2A 4PSWA 2Y0MA 4NFRA 4IK2A 3F5BA 4B13A 4XPDB 2QYVA 4HPSA 2CF4A 4MHNA 3QAYA 1KUXA 4MCQA 4MJ8A 3IWEA 5K8PA 4KS9A 4M85A 3PB6X 3TC8A 4B6ZA 4XPKA 2GU2A 5IX3A 2Z3MA 1ELMP 4CAEA 3DDDA 1PU9A 3S6HA 2PIZA 2Q04A 5E96A 4HNXB 2ANPA 2PJ3A 5I4MA 4F6AA 4MFQA 4CGPA 4AVBA 4RN7A 2RB7A 2F7VA 1ON0A 4NXYA 4KORA 1RO5A 2CTCA 4K30A 7CPAA 2OOTA 1KUVA 3BJ8A 3T9YA 4IUSA 1YW4A 3MN8A 4QB9A 2X7BA 3FEEA 3IJ3A 1A2ZA 4MI4A 2V8VA 3QB8A 4M6IA 4H6ZA 4CGNA 2BSWA 4CAFA 2B3UA 2R8VA 2GFQA 2PJ5A 2R98A 5G20A 3V38A 1Q7LA 3FJUA 3HLPA 4NGRA 5JH9A 2ZEPA 1X12A 2JEWA 3D4UA 2AFXA 2IL4A 3NE8A 4FD5A 3HUVA 4ZY1A 1WK4A 2NMTA 2ZEOA 4ZBGA 3FB3A 1HEEA 3D7GA 2PIYA 4R6TA 3I3GA 2Q4VA 3KHZA 1M4DA 5ISVA 1ZLIA 1XJOA 3T90A 2ZEHA 4CYOA 3DLJA 4BD9A 4FAIA 4AVCA 1ZG7A 4IF5A 4KZTA 4OC0A 4FWUA 4JXRA 1K4JA 4JD6A 3K2KA 2Q44A 3NE7A 3E0KA 3OWCA 3B8GA 3PZJA 1M4IA 3FVLA 4H2KA 1QSRA 1LAPA 1NE9A 2CY2A 4P10A 1ZO0A 3DNSA 3D8PA 3H8GA 4MHDA 4NSQA 2GE3A 2QIRA 4R7MA 3FEDA 1I1DA 4B5OA 2XEJA 4P4EA 1LOKA 3D2MA 1OZPA 2C1CA 1S5KA 4OIWA 1TF9A 4MFJA 2CXAA 4A31A 4OKOA 5F49A 1MJ9A 2G3TA 2BUEA 2WPWA 3JUWA 3W6XA 5K8NA 2JDCA 2ARHA 2QMLA 3F0AA 1TF8A 5ELYA 2DEAA 1ELLP 2BOAA 2IQ6A 3IFEA 1YK3A 1ARMA 1IGBA 3PP9A 4UWJA 4KUBA 4UEZA 4A2ZA 4XNHC 2O4HA 3SXOA 1S60A 4K3NA 3FXTA 4QC6A 3PGPA 4AG9A 3BI0A 4IAVA 3TOAA 2EWBA 2JBJA 4A95A 3B3TA 4C7HA 3VWDA 2IJZA 4KOWA 1TKJA 5C82A 4UFXA 5CPAA 2XEIA 3H8EA 4CS0B 4RUHA 3VATA 1VKCA 4R9MA 4L89A 3S6GA 1RTQA 4NGPA 3PB8X 5H86A 4LQ6A 4C68A 1MK4A 1YGHA 1DE4C 2FS5A 2ZENA 3CT9A 4M6HA 1KZFA 3MGDA 2DXQA 4KOSA 5LYDA 4Q36A 1IOFA 3FBUA 4GXHA 4TWEA 3IGRA 2ZEDA 2AJ6A 2P6EA 1TKFA 2I3CA 2EO8A 3FH4A 3GLJA 1I12A 3IU1A 4I49A 3WC6A 2A4NA 1NSAA 4G1PA 2Q0YA 2Z3NA 2Q51A 3BI1A 1ZG9A 2ZEFA 3PFEA 3PRTA 4NJRA 1ZLHA 1JQGA 3R9GA 1IOIA 3IIBA 1R43A 4BMHA 4Y49B 4MFLA 4P45A 2VI7A 1ZG8A 5JM6A 1WWZA 5LYLA 5THWA 2OZUA 3W6SA 4MFKA 4R76A 3IWWA 3FX6A 4MCSA 2I00A 3F8KA 1LANA 3EY5A 3ISZA 3RO0A 4P4BA 2V8DA 4HKFA 2AFMA 2AFWA 2BO9A 1QQ9A 2WPXA 4TNUA 3FMCA 5IB9A 2D4PA 1H8LA 3K9UA 2B5GA 2PVWA 2F5IA 3B3SA 4MHPA 4JYWA 1YR0A 2ATRA 2AFOA 4U9ZA 4LUAA 2PE3A 2Z3KA 2ZW5A 3S9MA 1M4LA 4JLYA 4NGSA 4QVTA 3LMSA 4A33A 3SHPA 2ODFA 2Q7SA 2ZXVA 1SQHA 2NYQA 2Z10A 4EFDA 4M6GA 4MBUA 3GY9A 3SJGA 4NGQA 2PJ7A 2PJ2A 5EBVA 5HVFA 3VARA 2VBQA 3WC7A 1PYTB 4ZY2A 2HUZA 3RAMA 3NFZA 1XE4A 1BO4A 4PK2A 4MY3A 4R57A 2B3VA 1YMEA 4UEEA 4KOVA 2J8NA 4MFZA 3JVNA 4NJQA 4U5YA 1F57A 3H4QA 4PXBA 1XOVA 1XEBA 3D7HA 3GB0A 5J8CA 2IMOA 1Z5RA 1Z8XA 1Q2DA 2JEVA 2PRBA 3D66A 4JZ0A 4UFWA 5DWMA 4KOXA 2EK8A 2POKA 3FECA 4LX9A 4KOTA 4MXUA 4OIDA 4YRHA 4E2AA 2GREA 3FYNA 4A37A 3B2YA 3IU2A 3DR6A 1M4GA 4FBEA 2VZZA 8CPAA 2CIJA 2B4BA 4UF4A 3RZAA 4KSFA 2AFSA 1IB1E 1J4JA 2D4OA 4CGMA 2PJAA 4H89A 4OC1A 2B5GB 4C7IA 3LACA 1R3NA 2OB0A 4MHYA 3TE4A 3CXQA 3LD2A 5JQ4A 2YNCA 4PQAA 3B35A 4JJXA 4R87A 1AUGA 5G1ZA 1MJBA 1IYLA 4CAVA 2F8HA 2WUUA 4NCZA 4PSXA 4JXQA 5HXDA 1HDQA 5AG5A 3SI2A 2ZEMA 1PUAA 4P4FA 1BLLE 4NF1A 4CGOA 2CNTA 1GYTA 4XPDC 2B4DA 4MRIA 2I79A 4AXVA 1YLOA 4C2YA 3D2PA 1Q2CA 4DUKA 2B4DB 2P0WA 2Z0ZA 4F0YA 4B5PB 3PB9X 3NH4A 4UIAA 2H5MA 1YVOA 2PVVA 1Z8TA 1Z2LA 3D7FA 4KVOE 4X8IA 4PXCA 5J1QA 2GIVA 5LYIA 1LRZA 4B5PA 5H84A 2RFHA 3B3WA 2YNEA 4UCPA 4ZYQA 3PB4X 2R7HA 2P6GA 1CP7A 2C6PA 3PB7X 4BINA 3R1KA 3S9NA 2PJ9A 3QNVA 1S7FA 1AYEA 2PJ0A 3KKWA 4P4JA 5LYFA 1Y0YA 2FIAA 4PK3A 4R8FA 3UY5A 4OMEA 4YGOA 4O23A 2G0BA 2QJ8A 4A32A 1CPXA 4KSIA 3WABA 4CAWA
chains in the Genus database with same CATH topology
3G3SA 4FD4A 1U6MA 4CRZB 4HNWB 3C26A 4B14A 4H6UA 3ZZIA 1Z4RA 2DPSA 2Z3PA 2DPTA 1IICA 5CNPA 1R57A 5G22A 1Q2YA 3GYAA 1TIQA 2EUIA 3VWEA 5IV0A 2JLMA 4UWIA 1S3ZA 2OZHA 4UBRA 3R96A 1BOBA 5KTCA 4AVAA 2Q4YA 2VZYA 5F48A 5J8FA 3TCVA 1YVKA 2PR1A 1IYKA 4PV6A 4C2ZA 1KUYA 3N7ZA 3TTHA 3W91A 2PDOA 4MFPA 2C27A 2CNMA 2B58A 2CNSA 2FT0A 5BWAB 3P2HA 4XNHB 3TT2A 2KCWA 4EVYA 2VXKA 2Z3LA 4CGLA 2PC1A 2ZW7A 3DR8A 5FVJA 4KVXA 3TO9A 3P2FA 4E8OA 1XIXA 4RS2A 1Z9UA 2FL4A 4B11A 2J8RA 1XF8A 4R3LA 2YGWA 4CYNA 4CYPA 2YNCC 4ORFA 2FE7A 4UCNA 1YLEA 3D3SA 4J3GA 1GHEA 1QSNA 2PR8A 5AG6A 1QSMA 4FD6A 1S7KA 2ZW4A 5A28A 1XMTA 4U9YA 5HH1A 2PSWA 4HNYB 3TOBA 2K5TA 5DWNA 5A27A 5C88A 1S7NA 3R9FA 4ONUA 2Z11A 4II9A 4KLWA 5G21A 4B10A 5AGEA 3EC4A 3EXNA 1P4NA 2AE6A 2Q7BA 3RYOA 2BL1A 1I21A 1MJAA 4A30A 1B87A 3JTKA 2GANA 4KUAA 4F0XA 4QBJA 5F47A 4OADA 4Q38A 4L8AA 3IWGA 5GCNA 5JPHA 5KTDA 4KVME 5IB0A 4CRYB 4NEXA 2R1IA 1L0CA 4R3KA 1Y9WA 2VEZA 3SXNA 4GS4A 1YX0A 2REEA 3BJ7A 3H5ZA 4UFVA 4CYQA 2JDDA 2Z3OA 3A9LA 4KSAA 3QAHA 3G8WA 4KLVA 3EFAA 4Y49C 4KOUA 4B12A 2J8MA 2REFA 4FD7A 4DNCA 2EVNA 2FSRA 2WSAA 2G3AA 1FY7A 4MY0A 3GKRA 2FXFA 3CXPA 3TO7A 4AG7A 4UCMA 3TFYA 1S7LA 3LODA 4KOYA 3I9SA 1M1DA 4XPLA 3R9EA 3R95A 3S6FA 1Y7RA 2ZW6A 5F46A 2OH1A 1QSTA 3BLNA 3CXSA 1CM0A 5KTAA 3ZJ0A 2YNDA 3TO6A 2OZGA 1NMTA 4OAEA 1UFHA 2QECA 1RXTA 1VHSA 3EO4A 1N71A 2FCKA 2PQ8A 3WR7A 4X5KA 4E0AA 4RI1A 2BEIA 1Y9KA 2O28A 4M3SA 2ZPAA 5HMNA 4QUSA 1M44A 1Z4EA 3FNCA 2VQYA 3V8IA 1V0CA 2OU2A 5EC4A 5AG4A 3FIXA 4ZGYB 2RC4A 1QSOA 2P6FA 5AG7A 1IIDA 1NSLA 3DSBA 3FRMA 4OLLA 1CJWA 1B6BA 4AB7A 4CAXA 4YFJA 1P0HA 5I0CA 4BBHA 4UA3A 3S6KA 2FIWA 4C2XA 4JWPA 2HQYA 1YREA 2HV2A 4PSWA 2Y0MA 3F5BA 4B13A 4XPDB 1KUXA 4MJ8A 3IWEA 4KS9A 4M85A 4XPKA 5IX3A 2Z3MA 4CAEA 3DDDA 1PU9A 3S6HA 2Q04A 5E96A 4HNXB 4F6AA 4MFQA 4CGPA 4AVBA 1ON0A 4NXYA 4KORA 1RO5A 4K30A 1KUVA 3BJ8A 3T9YA 4IUSA 4QB9A 2X7BA 4MI4A 3QB8A 4H6ZA 4CGNA 2BSWA 4CAFA 2B3UA 2R8VA 2R98A 5G20A 2IL4A 4FD5A 1WK4A 2NMTA 4ZBGA 3FB3A 3I3GA 2Q4VA 1M4DA 5ISVA 3T90A 4CYOA 4AVCA 4KZTA 4IF5A 4JXRA 1K4JA 4JD6A 2Q44A 3NE7A 3E0KA 3OWCA 3B8GA 3PZJA 1M4IA 1QSRA 1NE9A 2CY2A 4CGOA 1ZO0A 3DNSA 3D8PA 4MHDA 4NSQA 2GE3A 2QIRA 1I1DA 4B5OA 3D2MA 1OZPA 1S5KA 4MFJA 2CXAA 4A31A 5F49A 1MJ9A 2G3TA 2BUEA 2WPWA 3JUWA 3W6XA 2JDCA 2ARHA 2QMLA 3F0AA 1YK3A 4A2ZA 3PP9A 4UWJA 4KUBA 4XNHC 3SXOA 1S60A 4QC6A 3FXTA 3PGPA 4AG9A 3TOAA 4A95A 4C7HA 3VWDA 4KOWA 5C82A 4UFXA 4CS0B 1VKCA 4R9MA 4L89A 3S6GA 5H86A 4C68A 1MK4A 1YGHA 2FS5A 1KZFA 3MGDA 2DXQA 4KOSA 4Q36A 3FBUA 3IGRA 2AJ6A 2P6EA 4I49A 3IU1A 1I12A 2A4NA 2Q0YA 2Z3NA 3R9GA 4BMHA 4Y49B 4MFLA 2VI7A 1WWZA 2OZUA 3W6SA 4MFKA 2I00A 3F8KA 3EY5A 4HKFA 2WPXA 2D4PA 3K9UA 2B5GA 2F5IA 1YR0A 2ATRA 4U9ZA 4LUAA 2Z3KA 2ZW5A 4JLYA 4QVTA 4A33A 3SHPA 2ZXVA 1SQHA 2Z10A 4MBUA 3GY9A 5EBVA 2VBQA 2HUZA 1XE4A 1BO4A 4PK2A 4MY3A 4R57A 2B3VA 4KOVA 4MFZA 2J8NA 3JVNA 4U5YA 3H4QA 1XEBA 5J8CA 2JEVA 1Q2DA 2PRBA 4UFWA 5DWMA 4KOXA 4LX9A 4KOTA 4YRHA 4E2AA 3FYNA 3IU2A 3DR6A 1M4GA 2VZZA 2B4BA 4KSFA 2D4OA 1IB1E 1J4JA 4CGMA 4H89A 4C7IA 2B5GB 2OB0A 3TE4A 3CXQA 3LD2A 5JQ4A 2YNCA 4JJXA 4R87A 5G1ZA 1MJBA 1IYLA 4CAVA 4PSXA 2WUUA 4NCZA 4JXQA 5AG5A 1PUAA 4NF1A 2CNTA 4XPDC 2B4DA 2I79A 4C2YA 3D2PA 1Q2CA 2B4DB 2P0WA 2Z0ZA 4F0YA 4B5PB 2H5MA 1YVOA 4KVOE 2GIVA 1LRZA 4B5PA 5H84A 4UCPA 2YNEA 2R7HA 2P6GA 3R1KA 1S7FA 3KKWA 2FIAA 4PK3A 3UY5A 4YGOA 2G0BA 4A32A 4CAWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3G3S A;  4FD4 A;  1U6M A;  4CRZ B;  4HNW B;  3C26 A;  4H6U A;  3ZZI A;  1Z4R A;  1IIC A;  5CNP A;  1R57 A;  1Q2Y A;  3GYA A;  1TIQ A;  2EUI A;  3VWE A;  5IV0 A;  2JLM A;  4UWI A;  1S3Z A;  2OZH A;  4UBR A;  3R96 A;  1BOB A;  5KTC A;  4AVA A;  2Q4Y A;  2VZY A;  5F48 A;  5J8F A;  3TCV A;  1YVK A;  2PR1 A;  1IYK A;  4PV6 A;  1KUY A;  3N7Z A;  3TTH A;  3W91 A;  2PDO A;  2C27 A;  2CNM A;  2B58 A;  2CNS A;  2FT0 A;  3P2H A;  4XNH B;  3TT2 A;  2KCW A;  4EVY A;  2VXK A;  2PC1 A;  2ZW7 A;  3DR8 A;  5FVJ A;  4KVX A;  3TO9 A;  3P2F A;  4E8O A;  1XIX A;  4RS2 A;  1Z9U A;  2FL4 A;  2J8R A;  1XF8 A;  4R3L A;  4ORF A;  2FE7 A;  1YLE A;  3D3S A;  4J3G A;  1GHE A;  1QSN A;  2PR8 A;  1QSM A;  4FD6 A;  1S7K A;  2ZW4 A;  1XMT A;  4U9Y A;  5HH1 A;  2PSW A;  4HNY B;  3TOB A;  2K5T A;  5DWN A;  5C88 A;  1S7N A;  3R9F A;  4ONU A;  2Z11 A;  4II9 A;  4KLW A;  3EC4 A;  3EXN A;  1P4N A;  2AE6 A;  2Q7B A;  3RYO A;  2BL1 A;  1I21 A;  1MJA A;  1B87 A;  2GAN A;  4KUA A;  4QBJ A;  5F47 A;  4OAD A;  4L8A A;  3IWG A;  5GCN A;  5JPH A;  5KTD A;  4KVM E;  5IB0 A;  4CRY B;  4NEX A;  2R1I A;  1L0C A;  4R3K A;  1Y9W A;  2VEZ A;  3SXN A;  4GS4 A;  1YX0 A;  2REE A;  3BJ7 A;  2JDD A;  3QAH A;  3G8W A;  4KLV A;  3EFA A;  4Y49 C;  4KOU A;  2J8M A;  2REF A;  4FD7 A;  4DNC A;  2EVN A;  2FSR A;  2G3A A;  1FY7 A;  4MY0 A;  3GKR A;  2FXF A;  3CXP A;  3TO7 A;  4AG7 A;  3TFY A;  1S7L A;  3LOD A;  4KOY A;  3I9S A;  1M1D A;  4XPL A;  3R9E A;  3R95 A;  3S6F A;  1Y7R A;  2ZW6 A;  5F46 A;  2OH1 A;  1QST A;  3BLN A;  3CXS A;  1CM0 A;  5KTA A;  3ZJ0 A;  3TO6 A;  4OAE A;  1NMT A;  2OZG A;  1UFH A;  2QEC A;  1RXT A;  1VHS A;  3EO4 A;  1N71 A;  2FCK A;  2PQ8 A;  3WR7 A;  4X5K A;  4E0A A;  4RI1 A;  2BEI A;  1Y9K A;  2O28 A;  4M3S A;  2ZPA A;  5HMN A;  4QUS A;  1M44 A;  1Z4E A;  3FNC A;  2VQY A;  3V8I A;  1V0C A;  2OU2 A;  5EC4 A;  3FIX A;  2RC4 A;  1QSO A;  2P6F A;  1IID A;  1NSL A;  3DSB A;  3FRM A;  4OLL A;  1CJW A;  1B6B A;  4AB7 A;  4CAX A;  4YFJ A;  1P0H A;  5I0C A;  4UA3 A;  3S6K A;  2FIW A;  4JWP A;  2HQY A;  4PSW A;  1YRE A;  2HV2 A;  2Y0M A;  3F5B A;  4XPD B;  1KUX A;  4MJ8 A;  4M85 A;  4XPK A;  5IX3 A;  3DDD A;  1PU9 A;  3S6H A;  2Q04 A;  5E96 A;  4HNX B;  4F6A A;  4AVB A;  1ON0 A;  4NXY A;  4KOR A;  1RO5 A;  4K30 A;  1KUV A;  3BJ8 A;  3T9Y A;  4IUS A;  4QB9 A;  2X7B A;  4MI4 A;  3QB8 A;  4H6Z A;  2BSW A;  2B3U A;  2R8V A;  2R98 A;  2IL4 A;  4FD5 A;  1WK4 A;  2NMT A;  4ZBG A;  3FB3 A;  3I3G A;  2Q4V A;  1M4D A;  5ISV A;  3T90 A;  4AVC A;  4KZT A;  4IF5 A;  4JXR A;  1K4J A;  4JD6 A;  2Q44 A;  3NE7 A;  3E0K A;  3OWC A;  3B8G A;  3PZJ A;  1M4I A;  1QSR A;  1NE9 A;  2CY2 A;  3DNS A;  3D8P A;  4MHD A;  4NSQ A;  2GE3 A;  2QIR A;  1I1D A;  4B5O A;  3D2M A;  1OZP A;  1S5K A;  5F49 A;  1MJ9 A;  2G3T A;  2BUE A;  2WPW A;  3JUW A;  3W6X A;  2JDC A;  2ARH A;  2QML A;  3F0A A;  1YK3 A;  3PP9 A;  4UWJ A;  4KUB A;  4XNH C;  3SXO A;  1S60 A;  4QC6 A;  3FXT A;  3PGP A;  4AG9 A;  3TOA A;  3VWD A;  4KOW A;  5C82 A;  4CS0 B;  1VKC A;  4R9M A;  4L89 A;  3S6G A;  5H86 A;  1MK4 A;  1YGH A;  2FS5 A;  1KZF A;  3MGD A;  2DXQ A;  4KOS A;  3FBU A;  3IGR A;  2AJ6 A;  2P6E A;  4I49 A;  1I12 A;  2A4N A;  2Q0Y A;  3R9G A;  4BMH A;  4Y49 B;  2VI7 A;  1WWZ A;  2OZU A;  3W6S A;  2I00 A;  3F8K A;  3EY5 A;  4HKF A;  2WPX A;  2D4P A;  3K9U A;  2B5G A;  2F5I A;  1YR0 A;  2ATR A;  4U9Z A;  4LUA A;  2ZW5 A;  4JLY A;  4QVT A;  3SHP A;  2ZXV A;  1SQH A;  2Z10 A;  4MBU A;  3GY9 A;  5EBV A;  2VBQ A;  2HUZ A;  1XE4 A;  1BO4 A;  4PK2 A;  4MY3 A;  4R57 A;  2B3V A;  4KOV A;  2J8N A;  3JVN A;  4U5Y A;  3H4Q A;  1XEB A;  5J8C A;  2JEV A;  1Q2D A;  2PRB A;  5DWM A;  4KOX A;  4LX9 A;  4KOT A;  4YRH A;  4E2A A;  3FYN A;  3DR6 A;  1M4G A;  2VZZ A;  2B4B A;  2D4O A;  1IB1 E;  1J4J A;  4H89 A;  2B5G B;  2OB0 A;  3TE4 A;  3CXQ A;  3LD2 A;  5JQ4 A;  4JJX A;  4R87 A;  1MJB A;  1IYL A;  4CAV A;  4PSX A;  4NCZ A;  4JXQ A;  1PUA A;  4NF1 A;  2CNT A;  4XPD C;  2B4D A;  2I79 A;  3D2P A;  1Q2C A;  2B4D B;  2P0W A;  2Z0Z A;  4F0Y A;  4B5P B;  2H5M A;  1YVO A;  4KVO E;  2GIV A;  1LRZ A;  4B5P A;  5H84 A;  2R7H A;  2P6G A;  3R1K A;  1S7F A;  3KKW A;  2FIA A;  4PK3 A;  3UY5 A;  4YGO A;  2G0B A;  4CAW A; 
#chains in the Genus database with same CATH topology
 2ZEL A;  2VL1 A;  2PJ4 A;  2PJB A;  2ZEE A;  4GM5 A;  1CPS A;  5D8N A;  3G3S A;  4FD4 A;  3KQZ A;  4OC5 A;  1U6M A;  4CRZ B;  3VH9 A;  2Q4Z A;  4F8Z A;  4HNW B;  3C26 A;  4B14 A;  4H6U A;  2HC9 A;  3CDX A;  3ZZI A;  1BPM A;  2NSM A;  1Z4R A;  2DPS A;  2Z3P A;  2DPT A;  1IIC A;  5CNP A;  1UWY A;  1IU8 A;  1R57 A;  2PCU A;  2QVP A;  4ZY0 A;  5G22 A;  2ZEG A;  1Q2Y A;  4PXE A;  3GYA A;  1TIQ A;  2EUI A;  3VWE A;  5IV0 A;  2JLM A;  1OBR A;  3KR5 A;  1S3Z A;  4UWI A;  2OZH A;  4UBR A;  1VIX A;  2GLF A;  2JBK A;  3R96 A;  2CTB A;  1BOB A;  4LQG A;  2HB6 A;  5KTC A;  1F2O A;  3JRU A;  1CG2 A;  4AVA A;  2Q4Y A;  2VZY A;  5HVH A;  5DS0 A;  5F48 A;  5K8O A;  5J8F A;  4UIB A;  3TCV A;  1HDU A;  1YVK A;  3CPX A;  3DGV A;  1Y0R A;  2PR1 A;  1IYK A;  4PV6 A;  4C2Z A;  1VHO A;  1KUY A;  3N7Z A;  3TTH A;  3W91 A;  2PDO A;  2PJC A;  3ISX A;  4MFP A;  4WJB A;  4EME A;  1X10 A;  1TKH A;  2C27 A;  2B58 A;  2CNM A;  2CNS A;  2FT0 A;  5BWA B;  3P2H A;  4ZX9 A;  4XNH B;  1AMP A;  3TT2 A;  3N5F A;  3RBU A;  2KCW A;  4EVY A;  1XMB A;  2VXK A;  2Z3L A;  4CGL A;  2PC1 A;  2ZW7 A;  3D67 A;  3DR8 A;  5FVJ A;  4KVX A;  4X3R A;  3TO9 A;  4MCP A;  3P2F A;  4E8O A;  4ZX8 A;  1XIX A;  1FT7 A;  2ZOF A;  1Z9U A;  4RS2 A;  3NH5 A;  3KGQ A;  2FL4 A;  4B11 A;  2J8R A;  4EWT A;  1XF8 A;  2G9D A;  1Z8W A;  4R3L A;  2YGW A;  2O53 A;  4CYN A;  4CYP A;  2XEG A;  2YNC C;  4ORF A;  2FE7 A;  4UCN A;  3B3C A;  4MMO A;  1YLE A;  2GLJ A;  1GHE A;  1QSN A;  3D3S A;  4J3G A;  2PR8 A;  5AG6 A;  1QSM A;  4FD6 A;  1S7K A;  2EK9 A;  2ZW4 A;  1XMT A;  1VGY A;  3K9T A;  4U9Y A;  5HH1 A;  3SJF A;  5A28 A;  5AG4 A;  1IY7 A;  2PSW A;  1BAV A;  4FUU A;  4W9Y A;  4YWY A;  2C6G A;  3SI1 A;  1PCA A;  4HNY B;  3TOB A;  2K5T A;  5EMI A;  4DJL A;  5DWN A;  5A27 A;  5JGF A;  1CP6 A;  5C88 A;  1S7N A;  2XEF A;  4A38 A;  1BPN A;  2AFZ A;  3R9F A;  4PXD A;  4MCR A;  4ONU A;  3I1U A;  2Z11 A;  3PEI A;  4II9 A;  3PBB A;  4OC4 A;  3T8W A;  4KLW A;  2PJ6 A;  2OR4 A;  5G21 A;  2FVG A;  1KWM A;  4B10 A;  5AGE A;  3EC4 A;  1CX8 A;  2BCO A;  3EXN A;  1P4N A;  2AE6 A;  4A39 A;  2Q7B A;  3RYO A;  2BL1 A;  1Z8L A;  1I21 A;  1MJA A;  3PBE A;  4A30 A;  5LRG A;  1QMU A;  1B87 A;  3KAS A;  2AFU A;  3D68 A;  3GIU A;  3JTK A;  4ONW A;  2V77 A;  2GAN A;  4KUA A;  3GUX A;  4F0X A;  4QBJ A;  3KL9 A;  3BHX A;  5F47 A;  4OAD A;  4Q38 A;  4L8A A;  3B7I A;  4OP4 A;  3IWG A;  5GCN A;  5JPH A;  5KTD A;  3KR4 A;  1EE3 P;  3IC1 A;  1XRY A;  2EBJ A;  4KVM E;  5IB0 A;  4CRY B;  3S9L A;  4NEX A;  2R1I A;  1L0C A;  2WYR A;  6CPA A;  4R3K A;  1Y9W A;  1LCP A;  5D29 A;  2V8H A;  2VEZ A;  3PFO A;  4GS4 A;  3SXN A;  1YX0 A;  1LFW A;  2Q43 A;  1YSJ A;  2REE A;  3BJ7 A;  3H5Z A;  4P6Y A;  4UFV A;  5LRK A;  3H8F A;  1F2P A;  2JDD A;  2Z3O A;  4YU9 A;  4CYQ A;  3A9L A;  4KSA A;  3QAH A;  3G8W A;  4KLV A;  4NGN A;  3B3V A;  3MRU A;  3EFA A;  4Y49 C;  4KOU A;  4B12 A;  2J8M A;  2REF A;  4FD7 A;  4DNC A;  2EVN A;  2FSR A;  4Z65 A;  2ABZ A;  4ZI6 A;  1TXR A;  2WSA A;  2G3A A;  1XBU A;  1XFO A;  3TX8 A;  1FY7 A;  2WZN A;  3NA6 A;  4A94 A;  4MY0 A;  3GKR A;  2FXF A;  3CXP A;  3SJE A;  4IHM A;  3TO7 A;  4AG7 A;  2J9A A;  4X2T A;  4UCM A;  5HVG A;  4P4I A;  3IO1 A;  4NGM A;  3TFY A;  4F9V A;  1S7L A;  3LOD A;  3CZX A;  3IEH A;  4KOY A;  1ARL A;  1VHE A;  3WC5 A;  3I9S A;  1M1D A;  4XPL A;  3R9E A;  3R95 A;  4DYO A;  4P44 A;  3S6F A;  1Y7R A;  2ZW6 A;  3FF3 A;  1YW6 A;  4P4D A;  2V8G A;  5LRJ A;  2OH1 A;  5F46 A;  2C6C A;  4OC3 A;  5F09 A;  1QST A;  3BLN A;  3CXS A;  3CPA A;  3D7D A;  1CM0 A;  5KTA A;  3ZJ0 A;  4WWV A;  2YND A;  4NGT A;  2OZG A;  1NMT A;  3KHX A;  3KQX A;  4OAE A;  4PPZ A;  1UFH A;  1FNO A;  2QEC A;  1RXT A;  1VHS A;  3EO4 A;  1N71 A;  2FCK A;  2PQ8 A;  3WR7 A;  4X5K A;  3TO6 A;  2PRQ A;  3SI0 A;  4E0A A;  4RI1 A;  3L2N A;  2DF5 A;  2BEI A;  3V7Z A;  1Y9K A;  2O28 A;  4M3S A;  2ZPA A;  3SJX A;  5HMN A;  4QUS A;  1M44 A;  1Z4E A;  1CBX A;  5K8M A;  3FNC A;  2VQY A;  1YQE A;  3BXM A;  4Q7A A;  2OU2 A;  1V0C A;  5EC4 A;  3V8I A;  3FIX A;  4ZGY B;  1LAM A;  2PJ1 A;  2PJ8 A;  2RC4 A;  1QSO A;  4MHZ A;  2P6F A;  3NH8 A;  5AG7 A;  4UEF A;  1IID A;  1DTD A;  3WT4 A;  4CPA A;  4F9U A;  2ZOG A;  1NSL A;  3DSB A;  3FRM A;  3KZW A;  4OLL A;  1CJW A;  3KI9 A;  4OC2 A;  3RNZ A;  1B6B A;  4AB7 A;  4CAX A;  4YFJ A;  1P0H A;  5I0C A;  1Y7E A;  4BBH A;  1JWQ A;  3LWU A;  4UA3 A;  3S6K A;  5CBM A;  2FIW A;  4C2X A;  4JWP A;  2HQY A;  1YRE A;  2HV2 A;  4PSW A;  2Y0M A;  4NFR A;  4IK2 A;  3F5B A;  4B13 A;  4XPD B;  2QYV A;  4HPS A;  2CF4 A;  4MHN A;  3QAY A;  1KUX A;  4MCQ A;  4MJ8 A;  3IWE A;  5K8P A;  4KS9 A;  4M85 A;  3PB6 X;  3TC8 A;  4B6Z A;  4XPK A;  2GU2 A;  5IX3 A;  2Z3M A;  1ELM P;  4CAE A;  3DDD A;  1PU9 A;  3S6H A;  2PIZ A;  2Q04 A;  5E96 A;  4HNX B;  2ANP A;  2PJ3 A;  5I4M A;  4F6A A;  4MFQ A;  4CGP A;  4AVB A;  4RN7 A;  2RB7 A;  2F7V A;  1ON0 A;  4NXY A;  4KOR A;  1RO5 A;  2CTC A;  4K30 A;  7CPA A;  2OOT A;  1KUV A;  3BJ8 A;  3T9Y A;  4IUS A;  1YW4 A;  3MN8 A;  4QB9 A;  2X7B A;  3FEE A;  3IJ3 A;  1A2Z A;  4MI4 A;  2V8V A;  3QB8 A;  4M6I A;  4H6Z A;  4CGN A;  2BSW A;  4CAF A;  2B3U A;  2R8V A;  2GFQ A;  2PJ5 A;  2R98 A;  5G20 A;  3V38 A;  1Q7L A;  3FJU A;  3HLP A;  4NGR A;  5JH9 A;  2ZEP A;  1X12 A;  2JEW A;  3D4U A;  2AFX A;  2IL4 A;  3NE8 A;  4FD5 A;  3HUV A;  4ZY1 A;  1WK4 A;  2NMT A;  2ZEO A;  4ZBG A;  3FB3 A;  1HEE A;  3D7G A;  2PIY A;  4R6T A;  3I3G A;  2Q4V A;  3KHZ A;  1M4D A;  5ISV A;  1ZLI A;  1XJO A;  3T90 A;  2ZEH A;  4CYO A;  3DLJ A;  4BD9 A;  4FAI A;  4AVC A;  1ZG7 A;  4IF5 A;  4KZT A;  4OC0 A;  4FWU A;  4JXR A;  1K4J A;  4JD6 A;  3K2K A;  2Q44 A;  3NE7 A;  3E0K A;  3OWC A;  3B8G A;  3PZJ A;  1M4I A;  3FVL A;  4H2K A;  1QSR A;  1LAP A;  1NE9 A;  2CY2 A;  4P10 A;  1ZO0 A;  3DNS A;  3D8P A;  3H8G A;  4MHD A;  4NSQ A;  2GE3 A;  2QIR A;  4R7M A;  3FED A;  1I1D A;  4B5O A;  2XEJ A;  4P4E A;  1LOK A;  3D2M A;  1OZP A;  2C1C A;  1S5K A;  4OIW A;  1TF9 A;  4MFJ A;  2CXA A;  4A31 A;  4OKO A;  5F49 A;  1MJ9 A;  2G3T A;  2BUE A;  2WPW A;  3JUW A;  3W6X A;  5K8N A;  2JDC A;  2ARH A;  2QML A;  3F0A A;  1TF8 A;  5ELY A;  2DEA A;  1ELL P;  2BOA A;  2IQ6 A;  3IFE A;  1YK3 A;  1ARM A;  1IGB A;  3PP9 A;  4UWJ A;  4KUB A;  4UEZ A;  4A2Z A;  4XNH C;  2O4H A;  3SXO A;  1S60 A;  4K3N A;  3FXT A;  4QC6 A;  3PGP A;  4AG9 A;  3BI0 A;  4IAV A;  3TOA A;  2EWB A;  2JBJ A;  4A95 A;  3B3T A;  4C7H A;  3VWD A;  2IJZ A;  4KOW A;  1TKJ A;  5C82 A;  4UFX A;  5CPA A;  2XEI A;  3H8E A;  4CS0 B;  4RUH A;  3VAT A;  1VKC A;  4R9M A;  4L89 A;  3S6G A;  1RTQ A;  4NGP A;  3PB8 X;  5H86 A;  4LQ6 A;  4C68 A;  1MK4 A;  1YGH A;  1DE4 C;  2FS5 A;  2ZEN A;  3CT9 A;  4M6H A;  1KZF A;  3MGD A;  2DXQ A;  4KOS A;  5LYD A;  4Q36 A;  1IOF A;  3FBU A;  4GXH A;  4TWE A;  3IGR A;  2ZED A;  2AJ6 A;  2P6E A;  1TKF A;  2I3C A;  2EO8 A;  3FH4 A;  3GLJ A;  1I12 A;  3IU1 A;  4I49 A;  3WC6 A;  2A4N A;  1NSA A;  4G1P A;  2Q0Y A;  2Z3N A;  2Q51 A;  3BI1 A;  1ZG9 A;  2ZEF A;  3PFE A;  3PRT A;  4NJR A;  1ZLH A;  1JQG A;  3R9G A;  1IOI A;  3IIB A;  1R43 A;  4BMH A;  4Y49 B;  4MFL A;  4P45 A;  2VI7 A;  1ZG8 A;  5JM6 A;  1WWZ A;  5LYL A;  5THW A;  2OZU A;  3W6S A;  4MFK A;  4R76 A;  3IWW A;  3FX6 A;  4MCS A;  2I00 A;  3F8K A;  1LAN A;  3EY5 A;  3ISZ A;  3RO0 A;  4P4B A;  2V8D A;  4HKF A;  2AFM A;  2AFW A;  2BO9 A;  1QQ9 A;  2WPX A;  4TNU A;  3FMC A;  5IB9 A;  2D4P A;  1H8L A;  3K9U A;  2B5G A;  2PVW A;  2F5I A;  3B3S A;  4MHP A;  4JYW A;  1YR0 A;  2ATR A;  2AFO A;  4U9Z A;  4LUA A;  2PE3 A;  2Z3K A;  2ZW5 A;  3S9M A;  1M4L A;  4JLY A;  4NGS A;  4QVT A;  3LMS A;  4A33 A;  3SHP A;  2ODF A;  2Q7S A;  2ZXV A;  1SQH A;  2NYQ A;  2Z10 A;  4EFD A;  4M6G A;  4MBU A;  3GY9 A;  3SJG A;  4NGQ A;  2PJ7 A;  2PJ2 A;  5EBV A;  5HVF A;  3VAR A;  2VBQ A;  3WC7 A;  1PYT B;  4ZY2 A;  2HUZ A;  3RAM A;  3NFZ A;  1XE4 A;  1BO4 A;  4PK2 A;  4MY3 A;  4R57 A;  2B3V A;  1YME A;  4UEE A;  4KOV A;  2J8N A;  4MFZ A;  3JVN A;  4NJQ A;  4U5Y A;  1F57 A;  3H4Q A;  4PXB A;  1XOV A;  1XEB A;  3D7H A;  3GB0 A;  5J8C A;  2IMO A;  1Z5R A;  1Z8X A;  1Q2D A;  2JEV A;  2PRB A;  3D66 A;  4JZ0 A;  4UFW A;  5DWM A;  4KOX A;  2EK8 A;  2POK A;  3FEC A;  4LX9 A;  4KOT A;  4MXU A;  4OID A;  4YRH A;  4E2A A;  2GRE A;  3FYN A;  4A37 A;  3B2Y A;  3IU2 A;  3DR6 A;  1M4G A;  4FBE A;  2VZZ A;  8CPA A;  2CIJ A;  2B4B A;  4UF4 A;  3RZA A;  4KSF A;  2AFS A;  1IB1 E;  1J4J A;  2D4O A;  4CGM A;  2PJA A;  4H89 A;  4OC1 A;  2B5G B;  4C7I A;  3LAC A;  1R3N A;  2OB0 A;  4MHY A;  3TE4 A;  3CXQ A;  3LD2 A;  5JQ4 A;  2YNC A;  4PQA A;  3B35 A;  4JJX A;  4R87 A;  1AUG A;  5G1Z A;  1MJB A;  1IYL A;  4CAV A;  2F8H A;  2WUU A;  4NCZ A;  4PSX A;  4JXQ A;  5HXD A;  1HDQ A;  5AG5 A;  3SI2 A;  2ZEM A;  1PUA A;  4P4F A;  1BLL E;  4NF1 A;  4CGO A;  2CNT A;  1GYT A;  4XPD C;  2B4D A;  4MRI A;  2I79 A;  4AXV A;  1YLO A;  4C2Y A;  3D2P A;  1Q2C A;  4DUK A;  2B4D B;  2P0W A;  2Z0Z A;  4F0Y A;  4B5P B;  3PB9 X;  3NH4 A;  4UIA A;  2H5M A;  1YVO A;  2PVV A;  1Z8T A;  1Z2L A;  3D7F A;  4KVO E;  4X8I A;  4PXC A;  5J1Q A;  2GIV A;  5LYI A;  1LRZ A;  4B5P A;  5H84 A;  2RFH A;  3B3W A;  2YNE A;  4UCP A;  4ZYQ A;  3PB4 X;  2R7H A;  2P6G A;  1CP7 A;  2C6P A;  3PB7 X;  4BIN A;  3R1K A;  3S9N A;  2PJ9 A;  3QNV A;  1S7F A;  1AYE A;  2PJ0 A;  3KKW A;  4P4J A;  5LYF A;  1Y0Y A;  2FIA A;  4PK3 A;  4R8F A;  3UY5 A;  4OME A;  4YGO A;  4O23 A;  2G0B A;  2QJ8 A;  4A32 A;  1CPX A;  4KSI A;  3WAB A;  4CAW A; 
#chains in the Genus database with same CATH homology
 3G3S A;  4FD4 A;  1U6M A;  4CRZ B;  4HNW B;  3C26 A;  4B14 A;  4H6U A;  3ZZI A;  1Z4R A;  2DPS A;  2Z3P A;  2DPT A;  1IIC A;  5CNP A;  1R57 A;  5G22 A;  1Q2Y A;  3GYA A;  1TIQ A;  2EUI A;  3VWE A;  5IV0 A;  2JLM A;  4UWI A;  1S3Z A;  2OZH A;  4UBR A;  3R96 A;  1BOB A;  5KTC A;  4AVA A;  2Q4Y A;  2VZY A;  5F48 A;  5J8F A;  3TCV A;  1YVK A;  2PR1 A;  1IYK A;  4PV6 A;  4C2Z A;  1KUY A;  3N7Z A;  3TTH A;  3W91 A;  2PDO A;  4MFP A;  2C27 A;  2CNM A;  2B58 A;  2CNS A;  2FT0 A;  5BWA B;  3P2H A;  4XNH B;  3TT2 A;  2KCW A;  4EVY A;  2VXK A;  2Z3L A;  4CGL A;  2PC1 A;  2ZW7 A;  3DR8 A;  5FVJ A;  4KVX A;  3TO9 A;  3P2F A;  4E8O A;  1XIX A;  4RS2 A;  1Z9U A;  2FL4 A;  4B11 A;  2J8R A;  1XF8 A;  4R3L A;  2YGW A;  4CYN A;  4CYP A;  2YNC C;  4ORF A;  2FE7 A;  4UCN A;  1YLE A;  3D3S A;  4J3G A;  1GHE A;  1QSN A;  2PR8 A;  5AG6 A;  1QSM A;  4FD6 A;  1S7K A;  2ZW4 A;  5A28 A;  1XMT A;  4U9Y A;  5HH1 A;  2PSW A;  4HNY B;  3TOB A;  2K5T A;  5DWN A;  5A27 A;  5C88 A;  1S7N A;  3R9F A;  4ONU A;  2Z11 A;  4II9 A;  4KLW A;  5G21 A;  4B10 A;  5AGE A;  3EC4 A;  3EXN A;  1P4N A;  2AE6 A;  2Q7B A;  3RYO A;  2BL1 A;  1I21 A;  1MJA A;  4A30 A;  1B87 A;  3JTK A;  2GAN A;  4KUA A;  4F0X A;  4QBJ A;  5F47 A;  4OAD A;  4Q38 A;  4L8A A;  3IWG A;  5GCN A;  5JPH A;  5KTD A;  4KVM E;  5IB0 A;  4CRY B;  4NEX A;  2R1I A;  1L0C A;  4R3K A;  1Y9W A;  2VEZ A;  3SXN A;  4GS4 A;  1YX0 A;  2REE A;  3BJ7 A;  3H5Z A;  4UFV A;  4CYQ A;  2JDD A;  2Z3O A;  3A9L A;  4KSA A;  3QAH A;  3G8W A;  4KLV A;  3EFA A;  4Y49 C;  4KOU A;  4B12 A;  2J8M A;  2REF A;  4FD7 A;  4DNC A;  2EVN A;  2FSR A;  2WSA A;  2G3A A;  1FY7 A;  4MY0 A;  3GKR A;  2FXF A;  3CXP A;  3TO7 A;  4AG7 A;  4UCM A;  3TFY A;  1S7L A;  3LOD A;  4KOY A;  3I9S A;  1M1D A;  4XPL A;  3R9E A;  3R95 A;  3S6F A;  1Y7R A;  2ZW6 A;  5F46 A;  2OH1 A;  1QST A;  3BLN A;  3CXS A;  1CM0 A;  5KTA A;  3ZJ0 A;  2YND A;  3TO6 A;  2OZG A;  1NMT A;  4OAE A;  1UFH A;  2QEC A;  1RXT A;  1VHS A;  3EO4 A;  1N71 A;  2FCK A;  2PQ8 A;  3WR7 A;  4X5K A;  4E0A A;  4RI1 A;  2BEI A;  1Y9K A;  2O28 A;  4M3S A;  2ZPA A;  5HMN A;  4QUS A;  1M44 A;  1Z4E A;  3FNC A;  2VQY A;  3V8I A;  1V0C A;  2OU2 A;  5EC4 A;  5AG4 A;  3FIX A;  4ZGY B;  2RC4 A;  1QSO A;  2P6F A;  5AG7 A;  1IID A;  1NSL A;  3DSB A;  3FRM A;  4OLL A;  1CJW A;  1B6B A;  4AB7 A;  4CAX A;  4YFJ A;  1P0H A;  5I0C A;  4BBH A;  4UA3 A;  3S6K A;  2FIW A;  4C2X A;  4JWP A;  2HQY A;  1YRE A;  2HV2 A;  4PSW A;  2Y0M A;  3F5B A;  4B13 A;  4XPD B;  1KUX A;  4MJ8 A;  3IWE A;  4KS9 A;  4M85 A;  4XPK A;  5IX3 A;  2Z3M A;  4CAE A;  3DDD A;  1PU9 A;  3S6H A;  2Q04 A;  5E96 A;  4HNX B;  4F6A A;  4MFQ A;  4CGP A;  4AVB A;  1ON0 A;  4NXY A;  4KOR A;  1RO5 A;  4K30 A;  1KUV A;  3BJ8 A;  3T9Y A;  4IUS A;  4QB9 A;  2X7B A;  4MI4 A;  3QB8 A;  4H6Z A;  4CGN A;  2BSW A;  4CAF A;  2B3U A;  2R8V A;  2R98 A;  5G20 A;  2IL4 A;  4FD5 A;  1WK4 A;  2NMT A;  4ZBG A;  3FB3 A;  3I3G A;  2Q4V A;  1M4D A;  5ISV A;  3T90 A;  4CYO A;  4AVC A;  4KZT A;  4IF5 A;  4JXR A;  1K4J A;  4JD6 A;  2Q44 A;  3NE7 A;  3E0K A;  3OWC A;  3B8G A;  3PZJ A;  1M4I A;  1QSR A;  1NE9 A;  2CY2 A;  4CGO A;  1ZO0 A;  3DNS A;  3D8P A;  4MHD A;  4NSQ A;  2GE3 A;  2QIR A;  1I1D A;  4B5O A;  3D2M A;  1OZP A;  1S5K A;  4MFJ A;  2CXA A;  4A31 A;  5F49 A;  1MJ9 A;  2G3T A;  2BUE A;  2WPW A;  3JUW A;  3W6X A;  2JDC A;  2ARH A;  2QML A;  3F0A A;  1YK3 A;  4A2Z A;  3PP9 A;  4UWJ A;  4KUB A;  4XNH C;  3SXO A;  1S60 A;  4QC6 A;  3FXT A;  3PGP A;  4AG9 A;  3TOA A;  4A95 A;  4C7H A;  3VWD A;  4KOW A;  5C82 A;  4UFX A;  4CS0 B;  1VKC A;  4R9M A;  4L89 A;  3S6G A;  5H86 A;  4C68 A;  1MK4 A;  1YGH A;  2FS5 A;  1KZF A;  3MGD A;  2DXQ A;  4KOS A;  4Q36 A;  3FBU A;  3IGR A;  2AJ6 A;  2P6E A;  4I49 A;  3IU1 A;  1I12 A;  2A4N A;  2Q0Y A;  2Z3N A;  3R9G A;  4BMH A;  4Y49 B;  4MFL A;  2VI7 A;  1WWZ A;  2OZU A;  3W6S A;  4MFK A;  2I00 A;  3F8K A;  3EY5 A;  4HKF A;  2WPX A;  2D4P A;  3K9U A;  2B5G A;  2F5I A;  1YR0 A;  2ATR A;  4U9Z A;  4LUA A;  2Z3K A;  2ZW5 A;  4JLY A;  4QVT A;  4A33 A;  3SHP A;  2ZXV A;  1SQH A;  2Z10 A;  4MBU A;  3GY9 A;  5EBV A;  2VBQ A;  2HUZ A;  1XE4 A;  1BO4 A;  4PK2 A;  4MY3 A;  4R57 A;  2B3V A;  4KOV A;  4MFZ A;  2J8N A;  3JVN A;  4U5Y A;  3H4Q A;  1XEB A;  5J8C A;  2JEV A;  1Q2D A;  2PRB A;  4UFW A;  5DWM A;  4KOX A;  4LX9 A;  4KOT A;  4YRH A;  4E2A A;  3FYN A;  3IU2 A;  3DR6 A;  1M4G A;  2VZZ A;  2B4B A;  4KSF A;  2D4O A;  1IB1 E;  1J4J A;  4CGM A;  4H89 A;  4C7I A;  2B5G B;  2OB0 A;  3TE4 A;  3CXQ A;  3LD2 A;  5JQ4 A;  2YNC A;  4JJX A;  4R87 A;  5G1Z A;  1MJB A;  1IYL A;  4CAV A;  4PSX A;  2WUU A;  4NCZ A;  4JXQ A;  5AG5 A;  1PUA A;  4NF1 A;  2CNT A;  4XPD C;  2B4D A;  2I79 A;  4C2Y A;  3D2P A;  1Q2C A;  2B4D B;  2P0W A;  2Z0Z A;  4F0Y A;  4B5P B;  2H5M A;  1YVO A;  4KVO E;  2GIV A;  1LRZ A;  4B5P A;  5H84 A;  4UCP A;  2YNE A;  2R7H A;  2P6G A;  3R1K A;  1S7F A;  3KKW A;  2FIA A;  4PK3 A;  3UY5 A;  4YGO A;  2G0B A;  4A32 A;  4CAW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...