1MK4A

Structure of protein of unknown function yqjy from bacillus subtilis, probable acetyltransferase
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
157
structure length
157
Chain Sequence
b'HMDIRTITSSDYEMVTSVLNEWWGGRQLKEKLPRLFFEHFQDTSFITSEHNSMTGFLIGFQSQSDPETAYIHFSGVHPDFRKMQIGKQLYDVFIETVKQRGCTRVKCVTSPVNKVSIAYHTKLGFDIEKGTKTVNGISVFANYDGPGQDRVLFVKNI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical protein yqjY
publication title 1.7A crystal structure of a hypothetical protein yqjY from Bacillus subtilis
rcsb
source organism Bacillus subtilis
molecule tags Structural genomics, unknown function
total genus 43
structure length 157
sequence length 157
chains with identical sequence B
ec nomenclature
pdb deposition date 2002-08-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 1mk4A00
3D2MA 4BMHA 4PK3A 4JWPA 3PGPA 1YR0A 4UWIA 4UA3A 2ZW6A 3EY5A 4LX9A 5KTAA 1L0CA 2Q4YA 1KUXA 1Y9WA 1YREA 3T9YA 3CXQA 2PR8A 4DNCA 1XEBA 4K30A 4F0YA 2Q04A 1KZFA 3TO9A 4JXQA 1Y7RA 4QB9A 1MJAA 3E0KA 1S5KA 5F47A 1IICA 1KUVA 3D3SA 5I0CA 3FIXA 1PUAA 3G3SA 4FD4A 1QSTA 2ZPAA 3N7ZA 4UWJA 2ATRA 4NSQA 4JXRA 1M4GA 5KTCA 2FCKA 3SXOA 4OADA 4ONUA 2BSWA 1RO5A 2RC4A 4XNHB 4U9ZA 1I12A 2Q44A 1P0HA 4MBUA 2AE6A 1S3ZA 1CJWA 2REFA 3QB8A 3TO7A 5JPHA 4FD5A 2B58A 4AG7A 2VEZA 2J8RA 1ON0A 3R95A 5F46A 3D8PA 3R96A 4YGOA 2JEVA 1Z4EA 2OB0A 1IB1E 4MI4A 3SXNA 4CRYB 1VKCA 1B6BA 3JVNA 1YGHA 2BL1A 2B4BA 4E0AA 1WWZA 2R7HA 4MY0A 2Q4VA 3H4QA 1YX0A 3TOBA 5GCNA 4MJ8A 4AB7A 1U6MA 2OU2A 2VXKA 1XIXA 5C82A 1M4IA 2VZZA 1MJ9A 1CM0A 4U5YA 4L8AA 4CAXA 2P6GA 2Q0YA 1LRZA 1Z4RA 4J3GA 4PV6A 1K4JA 2I00A 1GHEA 3BJ8A 4HNXB 5H86A 4YFJA 2PR1A 1NMTA 1Q2DA 1RXTA 4OLLA 5E96A 2NMTA 3TOAA 2FIWA 2FS5A 2ZW5A 2VBQA 4YRHA 2B3UA 3F0AA 3RYOA 3W6XA 4XPDB 2OH1A 4XNHC 3DSBA 4HNYB 4F6AA 2IL4A 3S6GA 4GS4A 1J4JA 1YLEA 3TCVA 3IGRA 3T90A 1Y9KA 4AVAA 1BO4A 3LD2A 3F5BA 1S7NA 2I79A 5J8CA 3R9FA 2FIAA 4CAVA 1VHSA 2PSWA 2VQYA 4PSXA 3TFYA 3FNCA 5FVJA 3F8KA 4IUSA 4HKFA 5DWMA 3NE7A 4M85A 2ZXVA 2Z11A 1N71A 4RI1A 3DR8A 3R9EA 2OZUA 4QUSA 1IIDA 4M3SA 2CY2A 2QECA 3SHPA 2K5TA 2X7BA 3D2PA 2VI7A 1M1DA 4KZTA 2JLMA 4JD6A 3R9GA 4ZBGA 1XE4A 5F49A 3FXTA 3FYNA 2FXFA 1PU9A 4MY3A 2QIRA 4KOXA 4KOVA 5EC4A 5EBVA 5DWNA 1Z9UA 4KUAA 4AVCA 4QC6A 2P6EA 1YVOA 1S7FA 2VZYA 4XPDC 1XMTA 5HMNA 2F5IA 3UY5A 2JDDA 5JQ4A 1NE9A 2BEIA 3PZJA 4JJXA 4EVYA 3GY9A 2R98A 4R9MA 5IB0A 3DNSA 3I3GA 3B8GA 1IYLA 1QSMA 4CAWA 2WPXA 2KCWA 3TTHA 3W6SA 4E8OA 4NEXA 3CXSA 2P6FA 3GYAA 2FT0A 1P4NA 2P0WA 2ZW4A 3BJ7A 4RS2A 3FB3A 1V0CA 4MHDA 2EUIA 1KUYA 3W91A 3OWCA 3S6FA 4KLVA 4R3LA 1QSOA 3FBUA 2R8VA 4PK2A 2ARHA 4KOYA 2G3AA 3CXPA 4AVBA 2PDOA 1S7KA 1MK4A 2B5GA 2B5GB 3EXNA 3P2FA 2WPWA 2B4DA 4II9A 1I21A 2B4DB 1M4DA 4NXYA 3C26A 4R57A 2B3VA 1M44A 4QVTA 4PSWA 5F48A 2FSRA 3LODA 1WK4A 4KOTA 3GKRA 2DXQA 4NF1A 1FY7A 3BLNA 2BUEA 3EC4A 2PRBA 4R87A 4KVOE 3WR7A 2Y0MA 4ORFA 1BOBA 4Y49B 5ISVA 5H84A 1YVKA 2C27A 4QBJA 2GIVA 3KKWA 4FD6A 1R57A 1S60A 3V8IA 2HV2A 3EO4A 2PQ8A 4NCZA 3DR6A 2J8MA 3TO6A 2D4OA 2REEA 2FE7A 5KTDA 2G0BA 1IYKA 3ZJ0A 2FL4A 4L89A 3IWGA 4XPLA 1SQHA 5CNPA 2D4PA 4KVXA 2J8NA 3DDDA 3K9UA 3VWDA 3S6KA 4JLYA 2R1IA 2PC1A 2JDCA 1S7LA 3FRMA 1OZPA 3PP9A 4H89A 4LUAA 2OZGA 1Q2CA 4B5OA 1QSRA 2H5MA 2CNSA 3VWEA 4AG9A 5IV0A 2Q7BA 2CNMA 4U9YA 3S6HA 4IF5A 4XPKA 5IX3A 4OAEA 3JUWA 4R3KA 3QAHA 3TT2A 1TIQA 1XF8A 2QMLA 5C88A 2O28A 4UBRA 4H6UA 3I9SA 4X5KA 4E2AA 1QSNA 3G8WA 4KORA 5J8FA 2HUZA 5HH1A 2AJ6A 4CRZB 2CNTA 4H6ZA 1I1DA 3MGDA 2OZHA 4B5PA 4KOSA 4B5PB 2Z0ZA 1B87A 3ZZIA 4KLWA 2GANA 2HQYA 3R1KA 4Y49C 2Z10A 2A4NA 4KUBA 1YK3A 3TE4A 2GE3A 4KOUA 4CS0B 4HNWB 1UFHA 3EFAA 4KOWA 2EVNA 2ZW7A 4FD7A 2G3TA 1MJBA 4KVME 1NSLA 1Q2YA 4I49A 3P2HA
chains in the Genus database with same CATH superfamily
4MFQA 3D2MA 1ARMA 4BMHA 2C6GA 2DEAA 4JWPA 4PK3A 2I3CA 3PGPA 5CBMA 1NSAA 1YR0A 2PJ6A 5G1ZA 3RBUA 4UWIA 4UA3A 2ZW6A 2ZELA 3EY5A 3HUVA 3FMCA 4LX9A 4UCPA 1LOKA 3KHZA 5KTAA 4G1PA 1L0CA 1XOVA 3T8WA 1CG2A 2Q4YA 3PFOA 1LFWA 1YLOA 2V8VA 3NH5A 4M6GA 1KUXA 1Y9WA 1YREA 3D4UA 4IHMA 3T9YA 5HXDA 3CXQA 4IK2A 2PR8A 2HB6A 3FEEA 4DNCA 4ZGYB 4F9VA 4C7HA 1XEBA 2C6PA 3KZWA 2ZEDA 4K30A 4F0YA 2Q04A 3PB7X 2POKA 2J9AA 3K2KA 4M6IA 3B3VA 1KZFA 1GYTA 4MHYA 4PXCA 3TO9A 4JXQA 4B13A 1Y7RA 4QB9A 1MJAA 4ZI6A 3V7ZA 2ZEGA 3E0KA 1S5KA 5F47A 4BD9A 4C2YA 2DPSA 1IICA 2PVWA 2PJ0A 2PJ9A 3WC5A 1KUVA 3D3SA 3IFEA 1CX8A 4C2ZA 5I0CA 3FIXA 1PUAA 4CGPA 4F0XA 1ELLP 3G3SA 1H8LA 4FD4A 1QSTA 2QJ8A 2ZPAA 3N7ZA 4GM5A 2CF4A 5K8NA 4UWJA 3K9TA 2ATRA 4IAVA 1VGYA 1X12A 3I1UA 1M4GA 4JXRA 4NSQA 3TC8A 5KTCA 2FCKA 2OR4A 3SXOA 4OADA 1ARLA 3WT4A 4M6HA 2FVGA 4ONUA 5D29A 2BSWA 4Q7AA 1RO5A 2RC4A 4XNHB 4U9ZA 3PBEA 4UEEA 1TKJA 1I12A 2PJCA 2Q44A 1P0HA 2QVPA 2WSAA 4MBUA 2AE6A 2F7VA 1S3ZA 2C1CA 4C7IA 1CJWA 2IQ6A 2REFA 3QB8A 4WJBA 3TO7A 5JPHA 4JYWA 2DPTA 4UFVA 3BHXA 4FD5A 1HEEA 2B58A 4AG7A 2VEZA 1X10A 1ON0A 2J8RA 3JRUA 3MRUA 3R95A 5LYIA 4FBEA 5F46A 3NE8A 5LYFA 3SI1A 4OIDA 3D8PA 3B7IA 2NYQA 3R96A 2GLJA 4YGOA 2JEVA 3A9LA 1Z4EA 2OB0A 4MFJA 1IB1E 4MI4A 4ZY0A 5K8OA 2XEGA 4K3NA 3SXNA 1ELMP 4CRYB 5CPAA 1VKCA 5HVFA 4P45A 1B6BA 3KQZA 3JVNA 3GLJA 1YGHA 2PCUA 2Z3LA 2BL1A 1YW6A 4A94A 1YW4A 3PBBA 4A2ZA 2B4BA 4E0AA 1WWZA 2R7HA 4MY0A 5K8MA 4ZX8A 4WWVA 2Q4VA 3H4QA 3CPAA 1YX0A 4P4JA 3TOBA 4OC4A 5K8PA 5GCNA 4MJ8A 3IU1A 1U6MA 2OU2A 2JEWA 2VXKA 4AB7A 1TF8A 1XIXA 4MCQA 5C82A 2GLFA 1M4IA 4CGMA 2ANPA 2VZZA 1MJ9A 2BO9A 1CM0A 4MCSA 3IO1A 4OMEA 4RUHA 3SI0A 4U5YA 4L8AA 4AXVA 4BBHA 3BXMA 4CAXA 3SJXA 2P6GA 4MCPA 4EMEA 4Z65A 3KR5A 3BI1A 3D66A 4B11A 1PCAA 2Q0YA 1LRZA 1Z4RA 1Z8XA 2YNDA 4J3GA 1K4JA 4PV6A 4UFXA 2PJBA 2EK8A 4EFDA 2I00A 3TX8A 3PB4X 1GHEA 3BJ8A 3B2YA 4HNXB 4NGNA 4NGRA 5H86A 4YFJA 2PR1A 3NFZA 4DYOA 1HDUA 2PJ1A 2DF5A 1NMTA 3WABA 1Q2DA 1RXTA 4PPZA 3B3CA 4OLLA 5E96A 3WC7A 2NMTA 3TOAA 2FIWA 5AG4A 4O23A 2FS5A 4RN7A 2ZW5A 4TNUA 2EBJA 2VBQA 3IIBA 3IJ3A 3LMSA 4YRHA 4PXDA 5AGEA 2B3UA 3F0AA 5DS0A 2CIJA 3RYOA 3PEIA 4R7MA 1BPNA 1VHEA 2V8GA 3FJUA 3RO0A 3SJFA 3W6XA 3D7FA 1DE4C 4XPDB 3D68A 1CBXA 2Q51A 1Z8WA 2OH1A 4X2TA 3KL9A 4XNHC 3DSBA 4HNYB 4F6AA 1QMUA 2BOAA 3NH8A 4NGTA 3JTKA 2IL4A 1XMBA 5A27A 2AFZA 3IWWA 2O53A 3ISXA 2JBJA 3DGVA 3S6GA 4A31A 4BINA 1ZG9A 4X3RA 4A38A 2BCOA 4GS4A 1J4JA 1YLEA 3TCVA 3IGRA 3T90A 2NSMA 1BLLE 1Y9KA 4AVAA 1BO4A 2ZOFA 1OBRA 3LD2A 5LRJA 5A28A 3FH4A 3F5BA 1S7NA 2I79A 2GU2A 2WYRA 4R6TA 1BAVA 4UEFA 3R9FA 2FIAA 5J8CA 4OC1A 3D67A 4CAVA 3S9LA 1VHSA 2PSWA 2VQYA 4KSAA 4MFKA 3SJGA 4PSXA 3TFYA 3FNCA 4R8FA 3F8KA 2YNEA 4MCRA 5FVJA 1YMEA 3CT9A 3FECA 4HKFA 4IUSA 2WZNA 3KI9A 4UIBA 4NGSA 5DWMA 3NE7A 4M85A 5LYDA 2ZXVA 1HDQA 2Z11A 1N71A 1LANA 4RI1A 3V38A 2YNCA 4B12A 2G9DA 3IU2A 4P4IA 3BI0A 3DR8A 3R9EA 4A30A 4PXBA 2ZEEA 2IMOA 2OZUA 4QUSA 2EWBA 1IIDA 4CGLA 4M3SA 2CY2A 2QECA 1Y0RA 4NFRA 1IGBA 3SHPA 2K5TA 2X7BA 5THWA 4CYQA 3D2PA 3DLJA 3KR4A 2VI7A 1M1DA 4KZTA 4KS9A 2JLMA 3FEDA 4JD6A 3R9GA 2ZEPA 4ZBGA 1XE4A 5F49A 3FXTA 3FYNA 4P10A 2FXFA 1PU9A 4MY3A 2QIRA 4KOXA 4KOVA 5EC4A 2PRQA 1FT7A 2RFHA 4ZX9A 5EMIA 2AFXA 5EBVA 5DWNA 1YQEA 3HLPA 2Z3MA 8CPAA 1Z9UA 4KUAA 4UEZA 4UIAA 4QC6A 2P6EA 3B35A 4AVCA 1YVOA 4B14A 3L2NA 4Q36A 1S7FA 4A32A 2VZYA 1XJOA 1CP6A 1R43A 4XPDC 2EO8A 3N5FA 3RZAA 2ZOGA 1XMTA 5HMNA 1JWQA 2F5IA 3UY5A 4CYNA 2JDDA 5JQ4A 1NE9A 2BEIA 1JQGA 4OKOA 5JM6A 3PZJA 1AYEA 5JGFA 4JJXA 4EVYA 1IOFA 3GY9A 2EK9A 2R98A 4R9MA 5IB0A 4OC0A 1Z8TA 3DNSA 3I3GA 3NA6A 2V8DA 2ZEOA 1R3NA 3LWUA 1TKFA 3B8GA 1IYLA 4CAEA 1AMPA 4P6YA 2RB7A 1XBUA 2PJ2A 4OIWA 1CPSA 2PJ5A 1Z2LA 4MFPA 4H2KA 2AFWA 1QSMA 5IB9A 3H5ZA 4CAWA 1ZLHA 3VATA 2WPXA 2WUUA 2KCWA 3TTHA 3W6SA 4E8OA 4CGNA 4LQ6A 4NEXA 2CXAA 3CXSA 2P6FA 3GYAA 2FT0A 1P4NA 6CPAA 2P0WA 2ZW4A 3RNZA 3BJ7A 4JZ0A 1AUGA 4RS2A 3FB3A 2AFSA 1F2PA 2YNCC 1V0CA 5J1QA 4MHDA 2EUIA 3GB0A 3H8FA 1XFOA 3IWEA 2V8HA 1KUYA 5G21A 3SI2A 4C2XA 1TF9A 3PB6X 3W91A 2QYVA 1TXRA 4OC2A 3OWCA 3S6FA 3IEHA 1Q7LA 4KLVA 4R3LA 1QSOA 1M4LA 2GFQA 4LQGA 2JBKA 3FBUA 1TKHA 2R8VA 4PK2A 2PJ8A 4CPAA 4EWTA 2ARHA 4KOYA 4B10A 2G3AA 3CXPA 4AVBA 2PDOA 1S7KA 1MK4A 2B5GA 4PXEA 3IC1A 4ZYQA 4MFZA 2B5GB 2Q4ZA 3EXNA 3P2FA 3ISZA 2WPWA 1Y7EA 2ABZA 2B4DA 5AG7A 4II9A 1I21A 1YSJA 2B4DB 4R76A 3H8EA 5F09A 1M4DA 4NXYA 3FVLA 5LYLA 3C26A 4R57A 2IJZA 2XEIA 4W9YA 2B3VA 3S9MA 1M44A 4QVTA 3B3WA 2PJ4A 5D8NA 4PSWA 5F48A 2FSRA 3VARA 1Z8LA 3LODA 1WK4A 3KHXA 4KOTA 3GKRA 4NJRA 2DXQA 4NF1A 3PFEA 2Z3OA 4KSIA 1FY7A 2PJ3A 2ZEFA 4Q38A 3BLNA 1CP7A 2Q43A 3FX6A 2BUEA 1QQ9A 1ZLIA 1ZO0A 2PRBA 3EC4A 4R87A 4KVOE 3WR7A 5LRKA 3QNVA 2Y0MA 3GUXA 4ORFA 3D7HA 2PVVA 1BOBA 1F57A 4HPSA 4MXUA 4TWEA 4Y49B 5AG5A 1IU8A 5ISVA 3B3TA 5H84A 2CTCA 2YGWA 2OOTA 1YVKA 2XEFA 4MMOA 2C27A 2Z3PA 4QBJA 4A37A 2GIVA 4MHNA 2PIZA 3KKWA 1R57A 1S60A 1Y0YA 2HV2A 4FD6A 3V8IA 1ZG8A 4NGQA 3EO4A 2PQ8A 4NCZA 3DR6A 2C6CA 2J8MA 4YWYA 3TO6A 5HVGA 2D4OA 2REEA 2FE7A 1CPXA 2ZEMA 4NGMA 5KTDA 3KGQA 4P4DA 5G22A 4FAIA 2AFUA 2G0BA 2ODFA 3CZXA 3S9NA 1IYKA 1EE3P 3ZJ0A 4MHZA 2FL4A 2XEJA 2Q7SA 1LAMA 4C68A 4L89A 4DUKA 3PB8X 3KASA 3IWGA 3QAYA 4XPLA 2V77A 3LACA 4YU9A 1SQHA 4FWUA 5CNPA 2PJ7A 2D4PA 4KVXA 2J8NA 1FNOA 3DDDA 4KSFA 4P44A 5ELYA 1A2ZA 3K9UA 4B6ZA 3VWDA 4ZY1A 3S6KA 2CTBA 4F9UA 2Z3KA 5LRGA 4JLYA 2R1IA 4CYOA 2PC1A 2JDCA 4NGPA 1S7LA 3FRMA 4ONWA 2ZENA 4MHPA 1OZPA 3FF3A 3PP9A 4H89A 4A33A 4LUAA 3PRTA 2OZGA 1Q2CA 4B5OA 1QSRA 4OC3A 2H5MA 1XRYA 2CNSA 7CPAA 1Z5RA 2ZEHA 1RTQA 3VWEA 4AG9A 4X8IA 5IV0A 3CPXA 2Q7BA 2F8HA 4P4EA 2CNMA 3D7GA 2PE3A 4U9YA 3S6HA 4IF5A 4XPKA 5IX3A 4CAFA 4A39A 4OAEA 4F8ZA 3KQXA 3B3SA 3JUWA 4R3KA 3QAHA 3TT2A 4OC5A 3H8GA 4OP4A 1TIQA 1XF8A 2O4HA 4UCNA 3SJEA 1DTDA 4P4BA 2QMLA 3VH9A 2AFMA 2PIYA 5C88A 2O28A 4CYPA 4UBRA 3CDXA 4H6UA 3I9SA 4PQAA 4X5KA 4E2AA 1QSNA 3G8WA 4KORA 2PJAA 5J8FA 2HUZA 5JH9A 5HH1A 4MFLA 3MN8A 4A95A 2AJ6A 5G20A 4CRZB 2CNTA 4H6ZA 1I1DA 1VHOA 3MGDA 1VIXA 3RAMA 5HVHA 2OZHA 1LCPA 2Z3NA 4MRIA 4B5PA 4KOSA 4B5PB 4P4FA 4NJQA 5BWAB 4GXHA 2Z0ZA 1B87A 3ZZIA 4KLWA 4UFWA 4ZY2A 2GANA 4UCMA 2HQYA 2GREA 3R1KA 1KWMA 4Y49C 3NH4A 4FUUA 2HC9A 1ZG7A 2Z10A 3WC6A 2A4NA 4KUBA 1YK3A 3TE4A 1F2OA 2GE3A 5AG6A 4KOUA 1IOIA 3D7DA 3GIUA 1IY7A 3PB9X 4CS0B 4HNWB 1UFHA 3EFAA 1BPMA 4KOWA 1LAPA 5I4MA 2EVNA 2AFOA 4UF4A 1UWYA 2ZW7A 4DJLA 4FD7A 2G3TA 1MJBA 4KVME 1PYTB 1NSLA 1Q2YA 4CGOA 4I49A 2VL1A 3P2HA
chains in the Genus database with same CATH topology
4MFQA 3D2MA 4BMHA 4PK3A 4JWPA 3PGPA 1YR0A 5G1ZA 4UWIA 4UA3A 2ZW6A 3EY5A 4LX9A 4UCPA 5KTAA 1L0CA 2Q4YA 1KUXA 1Y9WA 1YREA 3T9YA 3CXQA 2PR8A 4DNCA 4ZGYB 4C7HA 1XEBA 4K30A 4F0YA 2Q04A 1KZFA 3TO9A 4JXQA 4B13A 1Y7RA 4QB9A 1MJAA 3E0KA 1S5KA 5F47A 4C2YA 2DPSA 1IICA 1KUVA 3D3SA 4C2ZA 5I0CA 3FIXA 1PUAA 4CGPA 4F0XA 3G3SA 4FD4A 1QSTA 2ZPAA 3N7ZA 4UWJA 2ATRA 4NSQA 4JXRA 1M4GA 5KTCA 2FCKA 3SXOA 4OADA 4ONUA 2BSWA 1RO5A 2RC4A 4XNHB 4U9ZA 1I12A 2Q44A 1P0HA 2WSAA 4MBUA 2AE6A 1S3ZA 4C7IA 1CJWA 2REFA 3QB8A 3TO7A 5JPHA 2DPTA 4UFVA 4FD5A 2B58A 4AG7A 2VEZA 2J8RA 1ON0A 3R95A 5F46A 3D8PA 3R96A 4YGOA 2JEVA 3A9LA 1Z4EA 2OB0A 4MFJA 1IB1E 4MI4A 3SXNA 4CRYB 1VKCA 1B6BA 3JVNA 1YGHA 2Z3LA 2BL1A 4A2ZA 2B4BA 4E0AA 1WWZA 2R7HA 4MY0A 2Q4VA 3H4QA 1YX0A 3TOBA 5GCNA 4MJ8A 3IU1A 1U6MA 2OU2A 2VXKA 4AB7A 1XIXA 5C82A 1M4IA 4CGMA 2VZZA 1MJ9A 1CM0A 4U5YA 4L8AA 4BBHA 4CAXA 2P6GA 4B11A 2Q0YA 1LRZA 1Z4RA 2YNDA 4J3GA 4PV6A 1K4JA 4UFXA 2I00A 1GHEA 3BJ8A 4HNXB 5H86A 4YFJA 2PR1A 1NMTA 1Q2DA 1RXTA 4OLLA 5E96A 5AG4A 2NMTA 3TOAA 2FIWA 2FS5A 2ZW5A 2VBQA 4YRHA 5AGEA 2B3UA 3F0AA 3RYOA 3W6XA 4XPDB 2OH1A 4XNHC 3DSBA 4HNYB 4F6AA 3JTKA 2IL4A 5A27A 3S6GA 4A31A 4GS4A 1J4JA 1YLEA 3TCVA 3IGRA 3T90A 1Y9KA 4AVAA 1BO4A 3LD2A 5A28A 3F5BA 1S7NA 2I79A 5J8CA 3R9FA 2FIAA 4CAVA 1VHSA 2PSWA 2VQYA 4KSAA 4MFKA 4PSXA 3TFYA 3FNCA 5FVJA 3F8KA 2YNEA 4IUSA 4HKFA 5DWMA 3NE7A 4M85A 2ZXVA 2Z11A 1N71A 4RI1A 2YNCA 4B12A 3IU2A 3DR8A 3R9EA 4A30A 2OZUA 4QUSA 1IIDA 4CGLA 4M3SA 2CY2A 2QECA 3SHPA 2K5TA 2X7BA 4CYQA 3D2PA 2VI7A 1M1DA 4KZTA 4KS9A 2JLMA 4JD6A 3R9GA 4ZBGA 1XE4A 5F49A 3FXTA 3FYNA 2FXFA 1PU9A 4MY3A 2QIRA 4KOXA 4KOVA 5EC4A 5EBVA 5DWNA 2Z3MA 1Z9UA 4KUAA 4AVCA 4QC6A 2P6EA 1YVOA 4B14A 4Q36A 1S7FA 4A32A 2VZYA 4XPDC 1XMTA 5HMNA 2F5IA 3UY5A 4CYNA 2JDDA 5JQ4A 1NE9A 2BEIA 3PZJA 4JJXA 4EVYA 3GY9A 2R98A 4R9MA 5IB0A 3DNSA 3I3GA 3B8GA 1IYLA 4CAEA 4MFPA 1QSMA 3H5ZA 4CAWA 2WPXA 2WUUA 2KCWA 3TTHA 3W6SA 4E8OA 4CGNA 4NEXA 2CXAA 3CXSA 2P6FA 3GYAA 2FT0A 1P4NA 2P0WA 2ZW4A 3BJ7A 4RS2A 3FB3A 2YNCC 1V0CA 4MHDA 2EUIA 3IWEA 1KUYA 5G21A 4C2XA 3W91A 3OWCA 3S6FA 4KLVA 4R3LA 1QSOA 3FBUA 2R8VA 4PK2A 2ARHA 4KOYA 4B10A 2G3AA 3CXPA 4AVBA 2PDOA 1S7KA 1MK4A 2B5GA 4MFZA 2B5GB 3EXNA 3P2FA 2WPWA 5AG7A 2B4DA 4II9A 1I21A 2B4DB 1M4DA 4NXYA 3C26A 4R57A 2B3VA 1M44A 4QVTA 4PSWA 5F48A 2FSRA 3LODA 1WK4A 4KOTA 3GKRA 2DXQA 4NF1A 2Z3OA 1FY7A 4Q38A 3BLNA 2BUEA 3EC4A 2PRBA 1ZO0A 4R87A 4KVOE 3WR7A 2Y0MA 4ORFA 1BOBA 4Y49B 5AG5A 5ISVA 5H84A 2YGWA 1YVKA 2C27A 2Z3PA 4QBJA 2GIVA 3KKWA 4FD6A 1R57A 1S60A 3V8IA 2HV2A 3EO4A 2PQ8A 4NCZA 3DR6A 2J8MA 3TO6A 2D4OA 2REEA 2FE7A 5KTDA 5G22A 2G0BA 1IYKA 3ZJ0A 2FL4A 4C68A 4L89A 3IWGA 4XPLA 1SQHA 5CNPA 2D4PA 4KVXA 2J8NA 4KSFA 3DDDA 3K9UA 3VWDA 3S6KA 2Z3KA 4JLYA 2R1IA 4CYOA 2PC1A 2JDCA 1S7LA 3FRMA 1OZPA 4A33A 3PP9A 4H89A 4LUAA 2OZGA 1Q2CA 4B5OA 1QSRA 2H5MA 2CNSA 3VWEA 4AG9A 5IV0A 2Q7BA 2CNMA 4U9YA 3S6HA 4IF5A 4XPKA 5IX3A 4CAFA 4OAEA 3JUWA 4R3KA 3QAHA 3TT2A 1TIQA 1XF8A 4UCNA 2QMLA 5C88A 2O28A 4CYPA 4UBRA 4H6UA 3I9SA 4X5KA 4E2AA 1QSNA 3G8WA 4KORA 5J8FA 2HUZA 5HH1A 4MFLA 4A95A 2AJ6A 5G20A 4CRZB 2CNTA 4H6ZA 1I1DA 3MGDA 2OZHA 4B5PA 2Z3NA 4KOSA 4B5PB 5BWAB 2Z0ZA 1B87A 3ZZIA 4KLWA 4UFWA 2GANA 4UCMA 2HQYA 3R1KA 4Y49C 2Z10A 2A4NA 4KUBA 1YK3A 3TE4A 2GE3A 5AG6A 4KOUA 4CS0B 4HNWB 1UFHA 3EFAA 4KOWA 2EVNA 2ZW7A 4FD7A 2G3TA 1MJBA 4KVME 1NSLA 1Q2YA 4CGOA 4I49A 3P2HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3D2M A;  4BMH A;  4PK3 A;  4JWP A;  3PGP A;  1YR0 A;  4UWI A;  4UA3 A;  2ZW6 A;  3EY5 A;  4LX9 A;  5KTA A;  1L0C A;  2Q4Y A;  1KUX A;  1Y9W A;  1YRE A;  3T9Y A;  3CXQ A;  2PR8 A;  4DNC A;  1XEB A;  4K30 A;  4F0Y A;  2Q04 A;  1KZF A;  3TO9 A;  4JXQ A;  1Y7R A;  4QB9 A;  1MJA A;  3E0K A;  1S5K A;  5F47 A;  1IIC A;  1KUV A;  3D3S A;  5I0C A;  3FIX A;  1PUA A;  3G3S A;  4FD4 A;  1QST A;  2ZPA A;  3N7Z A;  4UWJ A;  2ATR A;  4NSQ A;  4JXR A;  1M4G A;  5KTC A;  2FCK A;  3SXO A;  4OAD A;  4ONU A;  2BSW A;  1RO5 A;  2RC4 A;  4XNH B;  4U9Z A;  1I12 A;  2Q44 A;  1P0H A;  4MBU A;  2AE6 A;  1S3Z A;  1CJW A;  2REF A;  3QB8 A;  3TO7 A;  5JPH A;  4FD5 A;  2B58 A;  4AG7 A;  2VEZ A;  2J8R A;  1ON0 A;  3R95 A;  5F46 A;  3D8P A;  3R96 A;  4YGO A;  2JEV A;  1Z4E A;  2OB0 A;  1IB1 E;  4MI4 A;  3SXN A;  4CRY B;  1VKC A;  1B6B A;  3JVN A;  1YGH A;  2BL1 A;  2B4B A;  4E0A A;  1WWZ A;  2R7H A;  4MY0 A;  2Q4V A;  3H4Q A;  1YX0 A;  3TOB A;  5GCN A;  4MJ8 A;  4AB7 A;  1U6M A;  2OU2 A;  2VXK A;  1XIX A;  5C82 A;  1M4I A;  2VZZ A;  1MJ9 A;  1CM0 A;  4U5Y A;  4L8A A;  4CAX A;  2P6G A;  2Q0Y A;  1LRZ A;  1Z4R A;  4J3G A;  4PV6 A;  1K4J A;  2I00 A;  1GHE A;  3BJ8 A;  4HNX B;  5H86 A;  4YFJ A;  2PR1 A;  1NMT A;  1Q2D A;  1RXT A;  4OLL A;  5E96 A;  2NMT A;  3TOA A;  2FIW A;  2FS5 A;  2ZW5 A;  2VBQ A;  4YRH A;  2B3U A;  3F0A A;  3RYO A;  3W6X A;  4XPD B;  2OH1 A;  4XNH C;  3DSB A;  4HNY B;  4F6A A;  2IL4 A;  3S6G A;  4GS4 A;  1J4J A;  1YLE A;  3TCV A;  3IGR A;  3T90 A;  1Y9K A;  4AVA A;  1BO4 A;  3LD2 A;  3F5B A;  1S7N A;  2I79 A;  5J8C A;  3R9F A;  2FIA A;  4CAV A;  1VHS A;  2PSW A;  2VQY A;  4PSX A;  3TFY A;  3FNC A;  5FVJ A;  3F8K A;  4IUS A;  4HKF A;  5DWM A;  3NE7 A;  4M85 A;  2ZXV A;  2Z11 A;  1N71 A;  4RI1 A;  3DR8 A;  3R9E A;  2OZU A;  4QUS A;  1IID A;  4M3S A;  2CY2 A;  2QEC A;  3SHP A;  2K5T A;  2X7B A;  3D2P A;  2VI7 A;  1M1D A;  4KZT A;  2JLM A;  4JD6 A;  3R9G A;  4ZBG A;  1XE4 A;  5F49 A;  3FXT A;  3FYN A;  2FXF A;  1PU9 A;  4MY3 A;  2QIR A;  4KOX A;  4KOV A;  5EC4 A;  5EBV A;  5DWN A;  1Z9U A;  4KUA A;  4AVC A;  4QC6 A;  2P6E A;  1YVO A;  1S7F A;  2VZY A;  4XPD C;  1XMT A;  5HMN A;  2F5I A;  3UY5 A;  2JDD A;  5JQ4 A;  1NE9 A;  2BEI A;  3PZJ A;  4JJX A;  4EVY A;  3GY9 A;  2R98 A;  4R9M A;  5IB0 A;  3DNS A;  3I3G A;  3B8G A;  1IYL A;  1QSM A;  4CAW A;  2WPX A;  2KCW A;  3TTH A;  3W6S A;  4E8O A;  4NEX A;  3CXS A;  2P6F A;  3GYA A;  2FT0 A;  1P4N A;  2P0W A;  2ZW4 A;  3BJ7 A;  4RS2 A;  3FB3 A;  1V0C A;  4MHD A;  2EUI A;  1KUY A;  3W91 A;  3OWC A;  3S6F A;  4KLV A;  4R3L A;  1QSO A;  3FBU A;  2R8V A;  4PK2 A;  2ARH A;  4KOY A;  2G3A A;  3CXP A;  4AVB A;  2PDO A;  1S7K A;  1MK4 A;  2B5G A;  2B5G B;  3EXN A;  3P2F A;  2WPW A;  2B4D A;  4II9 A;  1I21 A;  2B4D B;  1M4D A;  4NXY A;  3C26 A;  4R57 A;  2B3V A;  1M44 A;  4QVT A;  4PSW A;  5F48 A;  2FSR A;  3LOD A;  1WK4 A;  4KOT A;  3GKR A;  2DXQ A;  4NF1 A;  1FY7 A;  3BLN A;  2BUE A;  3EC4 A;  2PRB A;  4R87 A;  4KVO E;  3WR7 A;  2Y0M A;  4ORF A;  1BOB A;  4Y49 B;  5ISV A;  5H84 A;  1YVK A;  2C27 A;  4QBJ A;  2GIV A;  3KKW A;  4FD6 A;  1R57 A;  1S60 A;  3V8I A;  2HV2 A;  3EO4 A;  2PQ8 A;  4NCZ A;  3DR6 A;  2J8M A;  3TO6 A;  2D4O A;  2REE A;  2FE7 A;  5KTD A;  2G0B A;  1IYK A;  3ZJ0 A;  2FL4 A;  4L89 A;  3IWG A;  4XPL A;  1SQH A;  5CNP A;  2D4P A;  4KVX A;  2J8N A;  3DDD A;  3K9U A;  3VWD A;  3S6K A;  4JLY A;  2R1I A;  2PC1 A;  2JDC A;  1S7L A;  3FRM A;  1OZP A;  3PP9 A;  4H89 A;  4LUA A;  2OZG A;  1Q2C A;  4B5O A;  1QSR A;  2H5M A;  2CNS A;  3VWE A;  4AG9 A;  5IV0 A;  2Q7B A;  2CNM A;  4U9Y A;  3S6H A;  4IF5 A;  4XPK A;  5IX3 A;  4OAE A;  3JUW A;  4R3K A;  3QAH A;  3TT2 A;  1TIQ A;  1XF8 A;  2QML A;  5C88 A;  2O28 A;  4UBR A;  4H6U A;  3I9S A;  4X5K A;  4E2A A;  1QSN A;  3G8W A;  4KOR A;  5J8F A;  2HUZ A;  5HH1 A;  2AJ6 A;  4CRZ B;  2CNT A;  4H6Z A;  1I1D A;  3MGD A;  2OZH A;  4B5P A;  4KOS A;  4B5P B;  2Z0Z A;  1B87 A;  3ZZI A;  4KLW A;  2GAN A;  2HQY A;  3R1K A;  4Y49 C;  2Z10 A;  2A4N A;  4KUB A;  1YK3 A;  3TE4 A;  2GE3 A;  4KOU A;  4CS0 B;  4HNW B;  1UFH A;  3EFA A;  4KOW A;  2EVN A;  2ZW7 A;  4FD7 A;  2G3T A;  1MJB A;  4KVM E;  1NSL A;  1Q2Y A;  4I49 A;  3P2H A; 
#chains in the Genus database with same CATH topology
 4MFQ A;  3D2M A;  1ARM A;  4BMH A;  2C6G A;  2DEA A;  4JWP A;  4PK3 A;  2I3C A;  3PGP A;  5CBM A;  1NSA A;  1YR0 A;  2PJ6 A;  5G1Z A;  3RBU A;  4UWI A;  4UA3 A;  2ZW6 A;  2ZEL A;  3EY5 A;  3HUV A;  3FMC A;  4LX9 A;  4UCP A;  1LOK A;  3KHZ A;  5KTA A;  4G1P A;  1L0C A;  1XOV A;  3T8W A;  1CG2 A;  2Q4Y A;  3PFO A;  1LFW A;  1YLO A;  2V8V A;  3NH5 A;  4M6G A;  1KUX A;  1Y9W A;  1YRE A;  3D4U A;  4IHM A;  3T9Y A;  5HXD A;  3CXQ A;  4IK2 A;  2PR8 A;  2HB6 A;  3FEE A;  4DNC A;  4ZGY B;  4F9V A;  4C7H A;  1XEB A;  2C6P A;  3KZW A;  2ZED A;  4K30 A;  4F0Y A;  2Q04 A;  3PB7 X;  2POK A;  2J9A A;  3K2K A;  4M6I A;  3B3V A;  1KZF A;  1GYT A;  4MHY A;  4PXC A;  3TO9 A;  4JXQ A;  4B13 A;  1Y7R A;  4QB9 A;  1MJA A;  4ZI6 A;  3V7Z A;  2ZEG A;  3E0K A;  1S5K A;  5F47 A;  4BD9 A;  4C2Y A;  2DPS A;  1IIC A;  2PVW A;  2PJ0 A;  2PJ9 A;  3WC5 A;  1KUV A;  3D3S A;  3IFE A;  1CX8 A;  4C2Z A;  5I0C A;  3FIX A;  1PUA A;  4CGP A;  4F0X A;  1ELL P;  3G3S A;  1H8L A;  4FD4 A;  1QST A;  2QJ8 A;  2ZPA A;  3N7Z A;  4GM5 A;  2CF4 A;  5K8N A;  4UWJ A;  3K9T A;  2ATR A;  4IAV A;  1VGY A;  1X12 A;  3I1U A;  1M4G A;  4JXR A;  4NSQ A;  3TC8 A;  5KTC A;  2FCK A;  2OR4 A;  3SXO A;  4OAD A;  1ARL A;  3WT4 A;  4M6H A;  2FVG A;  4ONU A;  5D29 A;  2BSW A;  4Q7A A;  1RO5 A;  2RC4 A;  4XNH B;  4U9Z A;  3PBE A;  4UEE A;  1TKJ A;  1I12 A;  2PJC A;  2Q44 A;  1P0H A;  2QVP A;  2WSA A;  4MBU A;  2AE6 A;  2F7V A;  1S3Z A;  2C1C A;  4C7I A;  1CJW A;  2IQ6 A;  2REF A;  3QB8 A;  4WJB A;  3TO7 A;  5JPH A;  4JYW A;  2DPT A;  4UFV A;  3BHX A;  4FD5 A;  1HEE A;  2B58 A;  4AG7 A;  2VEZ A;  1X10 A;  1ON0 A;  2J8R A;  3JRU A;  3MRU A;  3R95 A;  5LYI A;  4FBE A;  5F46 A;  3NE8 A;  5LYF A;  3SI1 A;  4OID A;  3D8P A;  3B7I A;  2NYQ A;  3R96 A;  2GLJ A;  4YGO A;  2JEV A;  3A9L A;  1Z4E A;  2OB0 A;  4MFJ A;  1IB1 E;  4MI4 A;  4ZY0 A;  5K8O A;  2XEG A;  4K3N A;  3SXN A;  1ELM P;  4CRY B;  5CPA A;  1VKC A;  5HVF A;  4P45 A;  1B6B A;  3KQZ A;  3JVN A;  3GLJ A;  1YGH A;  2PCU A;  2Z3L A;  2BL1 A;  1YW6 A;  4A94 A;  1YW4 A;  3PBB A;  4A2Z A;  2B4B A;  4E0A A;  1WWZ A;  2R7H A;  4MY0 A;  5K8M A;  4ZX8 A;  4WWV A;  2Q4V A;  3H4Q A;  3CPA A;  1YX0 A;  4P4J A;  3TOB A;  4OC4 A;  5K8P A;  5GCN A;  4MJ8 A;  3IU1 A;  1U6M A;  2OU2 A;  2JEW A;  2VXK A;  4AB7 A;  1TF8 A;  1XIX A;  4MCQ A;  5C82 A;  2GLF A;  1M4I A;  4CGM A;  2ANP A;  2VZZ A;  1MJ9 A;  2BO9 A;  1CM0 A;  4MCS A;  3IO1 A;  4OME A;  4RUH A;  3SI0 A;  4U5Y A;  4L8A A;  4AXV A;  4BBH A;  3BXM A;  4CAX A;  3SJX A;  2P6G A;  4MCP A;  4EME A;  4Z65 A;  3KR5 A;  3BI1 A;  3D66 A;  4B11 A;  1PCA A;  2Q0Y A;  1LRZ A;  1Z4R A;  1Z8X A;  2YND A;  4J3G A;  1K4J A;  4PV6 A;  4UFX A;  2PJB A;  2EK8 A;  4EFD A;  2I00 A;  3TX8 A;  3PB4 X;  1GHE A;  3BJ8 A;  3B2Y A;  4HNX B;  4NGN A;  4NGR A;  5H86 A;  4YFJ A;  2PR1 A;  3NFZ A;  4DYO A;  1HDU A;  2PJ1 A;  2DF5 A;  1NMT A;  3WAB A;  1Q2D A;  1RXT A;  4PPZ A;  3B3C A;  4OLL A;  5E96 A;  3WC7 A;  2NMT A;  3TOA A;  2FIW A;  5AG4 A;  4O23 A;  2FS5 A;  4RN7 A;  2ZW5 A;  4TNU A;  2EBJ A;  2VBQ A;  3IIB A;  3IJ3 A;  3LMS A;  4YRH A;  4PXD A;  5AGE A;  2B3U A;  3F0A A;  5DS0 A;  2CIJ A;  3RYO A;  3PEI A;  4R7M A;  1BPN A;  1VHE A;  2V8G A;  3FJU A;  3RO0 A;  3SJF A;  3W6X A;  3D7F A;  1DE4 C;  4XPD B;  3D68 A;  1CBX A;  2Q51 A;  1Z8W A;  2OH1 A;  4X2T A;  3KL9 A;  4XNH C;  3DSB A;  4HNY B;  4F6A A;  1QMU A;  2BOA A;  3NH8 A;  4NGT A;  3JTK A;  2IL4 A;  1XMB A;  5A27 A;  2AFZ A;  3IWW A;  2O53 A;  3ISX A;  2JBJ A;  3DGV A;  3S6G A;  4A31 A;  4BIN A;  1ZG9 A;  4X3R A;  4A38 A;  2BCO A;  4GS4 A;  1J4J A;  1YLE A;  3TCV A;  3IGR A;  3T90 A;  2NSM A;  1BLL E;  1Y9K A;  4AVA A;  1BO4 A;  2ZOF A;  1OBR A;  3LD2 A;  5LRJ A;  5A28 A;  3FH4 A;  3F5B A;  1S7N A;  2I79 A;  2GU2 A;  2WYR A;  4R6T A;  1BAV A;  4UEF A;  3R9F A;  2FIA A;  5J8C A;  4OC1 A;  3D67 A;  4CAV A;  3S9L A;  1VHS A;  2PSW A;  2VQY A;  4KSA A;  4MFK A;  3SJG A;  4PSX A;  3TFY A;  3FNC A;  4R8F A;  3F8K A;  2YNE A;  4MCR A;  5FVJ A;  1YME A;  3CT9 A;  3FEC A;  4HKF A;  4IUS A;  2WZN A;  3KI9 A;  4UIB A;  4NGS A;  5DWM A;  3NE7 A;  4M85 A;  5LYD A;  2ZXV A;  1HDQ A;  2Z11 A;  1N71 A;  1LAN A;  4RI1 A;  3V38 A;  2YNC A;  4B12 A;  2G9D A;  3IU2 A;  4P4I A;  3BI0 A;  3DR8 A;  3R9E A;  4A30 A;  4PXB A;  2ZEE A;  2IMO A;  2OZU A;  4QUS A;  2EWB A;  1IID A;  4CGL A;  4M3S A;  2CY2 A;  2QEC A;  1Y0R A;  4NFR A;  1IGB A;  3SHP A;  2K5T A;  2X7B A;  5THW A;  4CYQ A;  3D2P A;  3DLJ A;  3KR4 A;  2VI7 A;  1M1D A;  4KZT A;  4KS9 A;  2JLM A;  3FED A;  4JD6 A;  3R9G A;  2ZEP A;  4ZBG A;  1XE4 A;  5F49 A;  3FXT A;  3FYN A;  4P10 A;  2FXF A;  1PU9 A;  4MY3 A;  2QIR A;  4KOX A;  4KOV A;  5EC4 A;  2PRQ A;  1FT7 A;  2RFH A;  4ZX9 A;  5EMI A;  2AFX A;  5EBV A;  5DWN A;  1YQE A;  3HLP A;  2Z3M A;  8CPA A;  1Z9U A;  4KUA A;  4UEZ A;  4UIA A;  4QC6 A;  2P6E A;  3B35 A;  4AVC A;  1YVO A;  4B14 A;  3L2N A;  4Q36 A;  1S7F A;  4A32 A;  2VZY A;  1XJO A;  1CP6 A;  1R43 A;  4XPD C;  2EO8 A;  3N5F A;  3RZA A;  2ZOG A;  1XMT A;  5HMN A;  1JWQ A;  2F5I A;  3UY5 A;  4CYN A;  2JDD A;  5JQ4 A;  1NE9 A;  2BEI A;  1JQG A;  4OKO A;  5JM6 A;  3PZJ A;  1AYE A;  5JGF A;  4JJX A;  4EVY A;  1IOF A;  3GY9 A;  2EK9 A;  2R98 A;  4R9M A;  5IB0 A;  4OC0 A;  1Z8T A;  3DNS A;  3I3G A;  3NA6 A;  2V8D A;  2ZEO A;  1R3N A;  3LWU A;  1TKF A;  3B8G A;  1IYL A;  4CAE A;  1AMP A;  4P6Y A;  2RB7 A;  1XBU A;  2PJ2 A;  4OIW A;  1CPS A;  2PJ5 A;  1Z2L A;  4MFP A;  4H2K A;  2AFW A;  1QSM A;  5IB9 A;  3H5Z A;  4CAW A;  1ZLH A;  3VAT A;  2WPX A;  2WUU A;  2KCW A;  3TTH A;  3W6S A;  4E8O A;  4CGN A;  4LQ6 A;  4NEX A;  2CXA A;  3CXS A;  2P6F A;  3GYA A;  2FT0 A;  1P4N A;  6CPA A;  2P0W A;  2ZW4 A;  3RNZ A;  3BJ7 A;  4JZ0 A;  1AUG A;  4RS2 A;  3FB3 A;  2AFS A;  1F2P A;  2YNC C;  1V0C A;  5J1Q A;  4MHD A;  2EUI A;  3GB0 A;  3H8F A;  1XFO A;  3IWE A;  2V8H A;  1KUY A;  5G21 A;  3SI2 A;  4C2X A;  1TF9 A;  3PB6 X;  3W91 A;  2QYV A;  1TXR A;  4OC2 A;  3OWC A;  3S6F A;  3IEH A;  1Q7L A;  4KLV A;  4R3L A;  1QSO A;  1M4L A;  2GFQ A;  4LQG A;  2JBK A;  3FBU A;  1TKH A;  2R8V A;  4PK2 A;  2PJ8 A;  4CPA A;  4EWT A;  2ARH A;  4KOY A;  4B10 A;  2G3A A;  3CXP A;  4AVB A;  2PDO A;  1S7K A;  1MK4 A;  2B5G A;  4PXE A;  3IC1 A;  4ZYQ A;  4MFZ A;  2B5G B;  2Q4Z A;  3EXN A;  3P2F A;  3ISZ A;  2WPW A;  1Y7E A;  2ABZ A;  2B4D A;  5AG7 A;  4II9 A;  1I21 A;  1YSJ A;  2B4D B;  4R76 A;  3H8E A;  5F09 A;  1M4D A;  4NXY A;  3FVL A;  5LYL A;  3C26 A;  4R57 A;  2IJZ A;  2XEI A;  4W9Y A;  2B3V A;  3S9M A;  1M44 A;  4QVT A;  3B3W A;  2PJ4 A;  5D8N A;  4PSW A;  5F48 A;  2FSR A;  3VAR A;  1Z8L A;  3LOD A;  1WK4 A;  3KHX A;  4KOT A;  3GKR A;  4NJR A;  2DXQ A;  4NF1 A;  3PFE A;  2Z3O A;  4KSI A;  1FY7 A;  2PJ3 A;  2ZEF A;  4Q38 A;  3BLN A;  1CP7 A;  2Q43 A;  3FX6 A;  2BUE A;  1QQ9 A;  1ZLI A;  1ZO0 A;  2PRB A;  3EC4 A;  4R87 A;  4KVO E;  3WR7 A;  5LRK A;  3QNV A;  2Y0M A;  3GUX A;  4ORF A;  3D7H A;  2PVV A;  1BOB A;  1F57 A;  4HPS A;  4MXU A;  4TWE A;  4Y49 B;  5AG5 A;  1IU8 A;  5ISV A;  3B3T A;  5H84 A;  2CTC A;  2YGW A;  2OOT A;  1YVK A;  2XEF A;  4MMO A;  2C27 A;  2Z3P A;  4QBJ A;  4A37 A;  2GIV A;  4MHN A;  2PIZ A;  3KKW A;  1R57 A;  1S60 A;  1Y0Y A;  2HV2 A;  4FD6 A;  3V8I A;  1ZG8 A;  4NGQ A;  3EO4 A;  2PQ8 A;  4NCZ A;  3DR6 A;  2C6C A;  2J8M A;  4YWY A;  3TO6 A;  5HVG A;  2D4O A;  2REE A;  2FE7 A;  1CPX A;  2ZEM A;  4NGM A;  5KTD A;  3KGQ A;  4P4D A;  5G22 A;  4FAI A;  2AFU A;  2G0B A;  2ODF A;  3CZX A;  3S9N A;  1IYK A;  1EE3 P;  3ZJ0 A;  4MHZ A;  2FL4 A;  2XEJ A;  2Q7S A;  1LAM A;  4C68 A;  4L89 A;  4DUK A;  3PB8 X;  3KAS A;  3IWG A;  3QAY A;  4XPL A;  2V77 A;  3LAC A;  4YU9 A;  1SQH A;  4FWU A;  5CNP A;  2PJ7 A;  2D4P A;  4KVX A;  2J8N A;  1FNO A;  3DDD A;  4KSF A;  4P44 A;  5ELY A;  1A2Z A;  3K9U A;  4B6Z A;  3VWD A;  4ZY1 A;  3S6K A;  2CTB A;  4F9U A;  2Z3K A;  5LRG A;  4JLY A;  2R1I A;  4CYO A;  2PC1 A;  2JDC A;  4NGP A;  1S7L A;  3FRM A;  4ONW A;  2ZEN A;  4MHP A;  1OZP A;  3FF3 A;  3PP9 A;  4H89 A;  4A33 A;  4LUA A;  3PRT A;  2OZG A;  1Q2C A;  4B5O A;  1QSR A;  4OC3 A;  2H5M A;  1XRY A;  2CNS A;  7CPA A;  1Z5R A;  2ZEH A;  1RTQ A;  3VWE A;  4AG9 A;  4X8I A;  5IV0 A;  3CPX A;  2Q7B A;  2F8H A;  4P4E A;  2CNM A;  3D7G A;  2PE3 A;  4U9Y A;  3S6H A;  4IF5 A;  4XPK A;  5IX3 A;  4CAF A;  4A39 A;  4OAE A;  4F8Z A;  3KQX A;  3B3S A;  3JUW A;  4R3K A;  3QAH A;  3TT2 A;  4OC5 A;  3H8G A;  4OP4 A;  1TIQ A;  1XF8 A;  2O4H A;  4UCN A;  3SJE A;  1DTD A;  4P4B A;  2QML A;  3VH9 A;  2AFM A;  2PIY A;  5C88 A;  2O28 A;  4CYP A;  4UBR A;  3CDX A;  4H6U A;  3I9S A;  4PQA A;  4X5K A;  4E2A A;  1QSN A;  3G8W A;  4KOR A;  2PJA A;  5J8F A;  2HUZ A;  5JH9 A;  5HH1 A;  4MFL A;  3MN8 A;  4A95 A;  2AJ6 A;  5G20 A;  4CRZ B;  2CNT A;  4H6Z A;  1I1D A;  1VHO A;  3MGD A;  1VIX A;  3RAM A;  5HVH A;  2OZH A;  1LCP A;  2Z3N A;  4MRI A;  4B5P A;  4KOS A;  4B5P B;  4P4F A;  4NJQ A;  5BWA B;  4GXH A;  2Z0Z A;  1B87 A;  3ZZI A;  4KLW A;  4UFW A;  4ZY2 A;  2GAN A;  4UCM A;  2HQY A;  2GRE A;  3R1K A;  1KWM A;  4Y49 C;  3NH4 A;  4FUU A;  2HC9 A;  1ZG7 A;  2Z10 A;  3WC6 A;  2A4N A;  4KUB A;  1YK3 A;  3TE4 A;  1F2O A;  2GE3 A;  5AG6 A;  4KOU A;  1IOI A;  3D7D A;  3GIU A;  1IY7 A;  3PB9 X;  4CS0 B;  4HNW B;  1UFH A;  3EFA A;  1BPM A;  4KOW A;  1LAP A;  5I4M A;  2EVN A;  2AFO A;  4UF4 A;  1UWY A;  2ZW7 A;  4DJL A;  4FD7 A;  2G3T A;  1MJB A;  4KVM E;  1PYT B;  1NSL A;  1Q2Y A;  4CGO A;  4I49 A;  2VL1 A;  3P2H A; 
#chains in the Genus database with same CATH homology
 4MFQ A;  3D2M A;  4BMH A;  4PK3 A;  4JWP A;  3PGP A;  1YR0 A;  5G1Z A;  4UWI A;  4UA3 A;  2ZW6 A;  3EY5 A;  4LX9 A;  4UCP A;  5KTA A;  1L0C A;  2Q4Y A;  1KUX A;  1Y9W A;  1YRE A;  3T9Y A;  3CXQ A;  2PR8 A;  4DNC A;  4ZGY B;  4C7H A;  1XEB A;  4K30 A;  4F0Y A;  2Q04 A;  1KZF A;  3TO9 A;  4JXQ A;  4B13 A;  1Y7R A;  4QB9 A;  1MJA A;  3E0K A;  1S5K A;  5F47 A;  4C2Y A;  2DPS A;  1IIC A;  1KUV A;  3D3S A;  4C2Z A;  5I0C A;  3FIX A;  1PUA A;  4CGP A;  4F0X A;  3G3S A;  4FD4 A;  1QST A;  2ZPA A;  3N7Z A;  4UWJ A;  2ATR A;  4NSQ A;  4JXR A;  1M4G A;  5KTC A;  2FCK A;  3SXO A;  4OAD A;  4ONU A;  2BSW A;  1RO5 A;  2RC4 A;  4XNH B;  4U9Z A;  1I12 A;  2Q44 A;  1P0H A;  2WSA A;  4MBU A;  2AE6 A;  1S3Z A;  4C7I A;  1CJW A;  2REF A;  3QB8 A;  3TO7 A;  5JPH A;  2DPT A;  4UFV A;  4FD5 A;  2B58 A;  4AG7 A;  2VEZ A;  2J8R A;  1ON0 A;  3R95 A;  5F46 A;  3D8P A;  3R96 A;  4YGO A;  2JEV A;  3A9L A;  1Z4E A;  2OB0 A;  4MFJ A;  1IB1 E;  4MI4 A;  3SXN A;  4CRY B;  1VKC A;  1B6B A;  3JVN A;  1YGH A;  2Z3L A;  2BL1 A;  4A2Z A;  2B4B A;  4E0A A;  1WWZ A;  2R7H A;  4MY0 A;  2Q4V A;  3H4Q A;  1YX0 A;  3TOB A;  5GCN A;  4MJ8 A;  3IU1 A;  1U6M A;  2OU2 A;  2VXK A;  4AB7 A;  1XIX A;  5C82 A;  1M4I A;  4CGM A;  2VZZ A;  1MJ9 A;  1CM0 A;  4U5Y A;  4L8A A;  4BBH A;  4CAX A;  2P6G A;  4B11 A;  2Q0Y A;  1LRZ A;  1Z4R A;  2YND A;  4J3G A;  4PV6 A;  1K4J A;  4UFX A;  2I00 A;  1GHE A;  3BJ8 A;  4HNX B;  5H86 A;  4YFJ A;  2PR1 A;  1NMT A;  1Q2D A;  1RXT A;  4OLL A;  5E96 A;  5AG4 A;  2NMT A;  3TOA A;  2FIW A;  2FS5 A;  2ZW5 A;  2VBQ A;  4YRH A;  5AGE A;  2B3U A;  3F0A A;  3RYO A;  3W6X A;  4XPD B;  2OH1 A;  4XNH C;  3DSB A;  4HNY B;  4F6A A;  3JTK A;  2IL4 A;  5A27 A;  3S6G A;  4A31 A;  4GS4 A;  1J4J A;  1YLE A;  3TCV A;  3IGR A;  3T90 A;  1Y9K A;  4AVA A;  1BO4 A;  3LD2 A;  5A28 A;  3F5B A;  1S7N A;  2I79 A;  5J8C A;  3R9F A;  2FIA A;  4CAV A;  1VHS A;  2PSW A;  2VQY A;  4KSA A;  4MFK A;  4PSX A;  3TFY A;  3FNC A;  5FVJ A;  3F8K A;  2YNE A;  4IUS A;  4HKF A;  5DWM A;  3NE7 A;  4M85 A;  2ZXV A;  2Z11 A;  1N71 A;  4RI1 A;  2YNC A;  4B12 A;  3IU2 A;  3DR8 A;  3R9E A;  4A30 A;  2OZU A;  4QUS A;  1IID A;  4CGL A;  4M3S A;  2CY2 A;  2QEC A;  3SHP A;  2K5T A;  2X7B A;  4CYQ A;  3D2P A;  2VI7 A;  1M1D A;  4KZT A;  4KS9 A;  2JLM A;  4JD6 A;  3R9G A;  4ZBG A;  1XE4 A;  5F49 A;  3FXT A;  3FYN A;  2FXF A;  1PU9 A;  4MY3 A;  2QIR A;  4KOX A;  4KOV A;  5EC4 A;  5EBV A;  5DWN A;  2Z3M A;  1Z9U A;  4KUA A;  4AVC A;  4QC6 A;  2P6E A;  1YVO A;  4B14 A;  4Q36 A;  1S7F A;  4A32 A;  2VZY A;  4XPD C;  1XMT A;  5HMN A;  2F5I A;  3UY5 A;  4CYN A;  2JDD A;  5JQ4 A;  1NE9 A;  2BEI A;  3PZJ A;  4JJX A;  4EVY A;  3GY9 A;  2R98 A;  4R9M A;  5IB0 A;  3DNS A;  3I3G A;  3B8G A;  1IYL A;  4CAE A;  4MFP A;  1QSM A;  3H5Z A;  4CAW A;  2WPX A;  2WUU A;  2KCW A;  3TTH A;  3W6S A;  4E8O A;  4CGN A;  4NEX A;  2CXA A;  3CXS A;  2P6F A;  3GYA A;  2FT0 A;  1P4N A;  2P0W A;  2ZW4 A;  3BJ7 A;  4RS2 A;  3FB3 A;  2YNC C;  1V0C A;  4MHD A;  2EUI A;  3IWE A;  1KUY A;  5G21 A;  4C2X A;  3W91 A;  3OWC A;  3S6F A;  4KLV A;  4R3L A;  1QSO A;  3FBU A;  2R8V A;  4PK2 A;  2ARH A;  4KOY A;  4B10 A;  2G3A A;  3CXP A;  4AVB A;  2PDO A;  1S7K A;  1MK4 A;  2B5G A;  4MFZ A;  2B5G B;  3EXN A;  3P2F A;  2WPW A;  5AG7 A;  2B4D A;  4II9 A;  1I21 A;  2B4D B;  1M4D A;  4NXY A;  3C26 A;  4R57 A;  2B3V A;  1M44 A;  4QVT A;  4PSW A;  5F48 A;  2FSR A;  3LOD A;  1WK4 A;  4KOT A;  3GKR A;  2DXQ A;  4NF1 A;  2Z3O A;  1FY7 A;  4Q38 A;  3BLN A;  2BUE A;  3EC4 A;  2PRB A;  1ZO0 A;  4R87 A;  4KVO E;  3WR7 A;  2Y0M A;  4ORF A;  1BOB A;  4Y49 B;  5AG5 A;  5ISV A;  5H84 A;  2YGW A;  1YVK A;  2C27 A;  2Z3P A;  4QBJ A;  2GIV A;  3KKW A;  4FD6 A;  1R57 A;  1S60 A;  3V8I A;  2HV2 A;  3EO4 A;  2PQ8 A;  4NCZ A;  3DR6 A;  2J8M A;  3TO6 A;  2D4O A;  2REE A;  2FE7 A;  5KTD A;  5G22 A;  2G0B A;  1IYK A;  3ZJ0 A;  2FL4 A;  4C68 A;  4L89 A;  3IWG A;  4XPL A;  1SQH A;  5CNP A;  2D4P A;  4KVX A;  2J8N A;  4KSF A;  3DDD A;  3K9U A;  3VWD A;  3S6K A;  2Z3K A;  4JLY A;  2R1I A;  4CYO A;  2PC1 A;  2JDC A;  1S7L A;  3FRM A;  1OZP A;  4A33 A;  3PP9 A;  4H89 A;  4LUA A;  2OZG A;  1Q2C A;  4B5O A;  1QSR A;  2H5M A;  2CNS A;  3VWE A;  4AG9 A;  5IV0 A;  2Q7B A;  2CNM A;  4U9Y A;  3S6H A;  4IF5 A;  4XPK A;  5IX3 A;  4CAF A;  4OAE A;  3JUW A;  4R3K A;  3QAH A;  3TT2 A;  1TIQ A;  1XF8 A;  4UCN A;  2QML A;  5C88 A;  2O28 A;  4CYP A;  4UBR A;  4H6U A;  3I9S A;  4X5K A;  4E2A A;  1QSN A;  3G8W A;  4KOR A;  5J8F A;  2HUZ A;  5HH1 A;  4MFL A;  4A95 A;  2AJ6 A;  5G20 A;  4CRZ B;  2CNT A;  4H6Z A;  1I1D A;  3MGD A;  2OZH A;  4B5P A;  2Z3N A;  4KOS A;  4B5P B;  5BWA B;  2Z0Z A;  1B87 A;  3ZZI A;  4KLW A;  4UFW A;  2GAN A;  4UCM A;  2HQY A;  3R1K A;  4Y49 C;  2Z10 A;  2A4N A;  4KUB A;  1YK3 A;  3TE4 A;  2GE3 A;  5AG6 A;  4KOU A;  4CS0 B;  4HNW B;  1UFH A;  3EFA A;  4KOW A;  2EVN A;  2ZW7 A;  4FD7 A;  2G3T A;  1MJB A;  4KVM E;  1NSL A;  1Q2Y A;  4CGO A;  4I49 A;  3P2H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...