1MK4A

Structure of protein of unknown function yqjy from bacillus subtilis, probable acetyltransferase
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
157
structure length
157
Chain Sequence
HMDIRTITSSDYEMVTSVLNEWWGGRQLKEKLPRLFFEHFQDTSFITSEHNSMTGFLIGFQSQSDPETAYIHFSGVHPDFRKMQIGKQLYDVFIETVKQRGCTRVKCVTSPVNKVSIAYHTKLGFDIEKGTKTVNGISVFANYDGPGQDRVLFVKNI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords Hypothetical protein yqjY
publication title 1.7A crystal structure of a hypothetical protein yqjY from Bacillus subtilis
rcsb
source organism Bacillus subtilis
total genus 43
structure length 157
sequence length 157
chains with identical sequence B
ec nomenclature
pdb deposition date 2002-08-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 1mk4A00
4U9YA 4K30A 4LX9A 4YGOA 4KVME 2GIVA 3DR8A 2OZGA 2FIAA 1SQHA 3D3SA 3DDDA 3R9EA 3FBUA 2OH1A 2F5IA 1S7FA 4II9A 1Q2DA 5H84A 3IGRA 2J8RA 2DXQA 4IUSA 3ZZIA 3CXSA 3K9UA 2P0WA 5EBVA 3FRMA 1IYLA 5KTAA 3GYAA 1S60A 4FD5A 4E8OA 4M85A 3TFYA 2B5GB 2FSRA 2Q44A 4L89A 5IV0A 2B58A 1YX0A 1OZPA 2OZHA 4AG7A 3F0AA 2VBQA 4HNYB 4XPDC 1M1DA 1QSTA 3TO6A 1Z4EA 3LD2A 1QSRA 1S7NA 2CY2A 3QAHA 4NSQA 2HUZA 2AJ6A 4EVYA 4H6UA 2PR8A 2ZW4A 4UA3A 2WPXA 4PK3A 2FT0A 1MK4A 5JPHA 1FY7A 4R3KA 3FB3A 4NXYA 4YFJA 4KOYA 2CNMA 4UWJA 1Q2CA 5IX3A 3B8GA 4FD7A 4PK2A 3G3SA 4QB9A 2B5GA 2PQ8A 3SHPA 3SXNA 3S6FA 1MJ9A 2VEZA 2A4NA 1Y9KA 4CS0B 4JXQA 3UY5A 1XIXA 2VI7A 2VZZA 3QB8A 2ZW5A 5F47A 1CJWA 3F8KA 5H86A 4ONUA 4YRHA 2NMTA 5KTDA 4R57A 4AVAA 3JVNA 3FNCA 1S5KA 2QECA 3PGPA 5J8CA 4QUSA 3TE4A 4GS4A 3EY5A 1Z4RA 2R8VA 3F5BA 4QBJA 2Q4VA 2FE7A 4UWIA 1IYKA 2P6FA 1YVOA 1M4IA 3VWDA 2CNSA 1XEBA 2G0BA 1P4NA 1YREA 2HQYA 3BJ7A 2ATRA 4LUAA 4E2AA 2OB0A 2X7BA 4JJXA 1KZFA 1K4JA 1CM0A 3GKRA 1QSNA 3EFAA 2G3AA 1IB1E 2Q4YA 2WPWA 1VKCA 1I21A 1YVKA 2O28A 1UFHA 4MY3A 4OAEA 2I00A 5CNPA 1M44A 2R7HA 2P6EA 2BEIA 1B87A 2VXKA 2FIWA 1B6BA 4JXRA 2D4PA 3D2PA 4XPDB 5HMNA 2JDDA 3JUWA 2BL1A 2FCKA 5ISVA 2FXFA 4BMHA 3OWCA 4I49A 4CRYB 1QSMA 2EUIA 4PSXA 4FD6A 2Z0ZA 3IWGA 4RS2A 4XPLA 1XF8A 4KVOE 4KLWA 4L8AA 2D4OA 4XPKA 3S6GA 2B4DB 1Z9UA 2K5TA 4Y49C 3EC4A 1KUVA 1N71A 4CAXA 3I9SA 2PDOA 3RYOA 3FXTA 4KOXA 2IL4A 1QSOA 3LODA 4MHDA 2ZXVA 4JD6A 2FS5A 4UBRA 2ZW6A 3TTHA 1KUXA 1BOBA 2REEA 3ZJ0A 2Q0YA 1M4GA 2JDCA 2VZYA 2JLMA 5JQ4A 2GE3A 4KOTA 4H89A 3TOBA 1Y7RA 1Q2YA 2VQYA 3GY9A 2Z10A 2B4DA 4KLVA 3PP9A 4KORA 3FYNA 4B5OA 4HNXB 2J8MA 2PRBA 2B3VA 1MJAA 5F46A 4NF1A 1IIDA 1NMTA 2R98A 4OADA 3H4QA 1M4DA 2H5MA 2OZUA 4M3SA 3FIXA 4KOSA 3S6KA 1S7LA 4AG9A 3R1KA 4HKFA 5DWMA 3WR7A 1WK4A 3EO4A 4XNHC 2ARHA 4ZBGA 4X5KA 3R9GA 4H6ZA 5I0CA 1R57A 1J4JA 2GANA 4JWPA 1P0HA 3TO7A 2Z11A 2BSWA 3P2HA 4B5PB 1Y9WA 4KOWA 3DNSA 1I1DA 1YR0A 1RO5A 2AE6A 1S7KA 3V8IA 4MJ8A 1L0CA 1I12A 3W91A 1XMTA 4AB7A 4FD4A 2PR1A 2BUEA 3TOAA 3NE7A 1V0CA 5J8FA 1GHEA 1KUYA 3VWEA 2RC4A 4R3LA 1MJBA 5C82A 3S6HA 2EVNA 2B3UA 3R95A 4F0YA 2Y0MA 3D2MA 5HH1A 3KKWA 4Y49B 3I3GA 4KZTA 4AVBA 3CXPA 4U9ZA 3C26A 4IF5A 4B5PA 1YLEA 4NCZA 1PUAA 4KOUA 5GCNA 2ZW7A 3N7ZA 4KOVA 2KCWA 2CNTA 3MGDA 3BJ8A 3TT2A 5FVJA 2J8NA 4KUAA 4MI4A 1YK3A 2I79A 4QVTA 5E96A 2B4BA 1S3ZA 2QIRA 2QMLA 3TCVA 4KVXA 1IICA 1WWZA 4JLYA 4U5YA 1NE9A 4QC6A 2Q04A 5F48A 4RI1A 4R87A 5IB0A 4E0AA 4NEXA 4CAWA 3G8WA 1TIQA 4CRZB 2OU2A 3BLNA 3W6SA 5F49A 1VHSA 3W6XA 1XE4A 4KUBA 5KTCA 3R9FA 3PZJA 2P6GA 4XNHB 4CAVA 5EC4A 3R96A 4J3GA 3T90A 3SXOA 4AVCA 1LRZA 1ON0A 5DWNA 4MBUA 5C88A 3DSBA 3DR6A 4PV6A 2R1IA 1YGHA 2JEVA 3T9YA 4ORFA 2PSWA 2C27A 2ZPAA 3P2FA 4DNCA 4HNWB 3EXNA 1U6MA 4R9MA 2REFA 2FL4A 3CXQA 4MY0A 2PC1A 1RXTA 3D8PA 3E0KA 3TO9A 1PU9A 2Q7BA 4OLLA 4F6AA 1NSLA 2HV2A 4PSWA 2G3TA 1BO4A
chains in the Genus database with same CATH superfamily
5AGEA 5D8NA 4U9YA 3K2KA 4K30A 4LX9A 4YGOA 4KVME 3WT4A 3LACA 5F09A 2YNDA 3SJGA 2GIVA 3DR8A 4UEEA 4UCNA 4NGPA 5K8MA 2V8DA 2WSAA 2OZGA 2FIAA 4TWEA 1XJOA 1SQHA 3D3SA 3DDDA 4M6GA 1VHOA 4UCMA 3R9EA 8CPAA 1ZLIA 2OH1A 3FBUA 5HVHA 2F5IA 3S9MA 1S7FA 2AFSA 3B3SA 3CDXA 3PFOA 4II9A 1Q2DA 4ZYQA 1CPSA 5H84A 2PJ8A 3IGRA 4A39A 2J8RA 1AUGA 2DXQA 4IUSA 3ZZIA 1HDUA 3BI1A 3CXSA 2P0WA 1A2ZA 3K9UA 2ZELA 4UEFA 3FRMA 5EBVA 5LYIA 1IYLA 4A33A 4C68A 5KTAA 3GYAA 4MRIA 1LOKA 2JBKA 1S60A 1Z8XA 4FD5A 4E8OA 3H8EA 4M85A 1YW4A 2AFOA 3TFYA 2B5GB 2FSRA 2Q44A 1PCAA 3DLJA 4L89A 4A37A 5IV0A 2B58A 1IGBA 4KSAA 1YX0A 1CPXA 1OZPA 1Z5RA 2OZHA 2PJ7A 2GLFA 3RBUA 1ARLA 2EO8A 3F0AA 1TF8A 2VBQA 4R76A 4HNYB 4XPDC 1TF9A 1M1DA 1QSTA 3TO6A 4ZY2A 1ELLP 1Z4EA 4OC1A 2ZEGA 3LD2A 4R6TA 1QSRA 2EBJA 2ZEEA 1S7NA 2WYRA 4P4BA 2CY2A 3QAHA 1YLOA 4NSQA 2HUZA 2ODFA 3KGQA 2AJ6A 4A38A 5G20A 4EVYA 3SI2A 4BD9A 2AFMA 4MFQA 2YGWA 4H6UA 2PR8A 2ZW4A 4UA3A 1Z8LA 2WPXA 4PK3A 2FT0A 3BI0A 1MK4A 3NH8A 5JH9A 5JPHA 2ZOGA 1FY7A 4R3KA 5HVFA 3FB3A 3NH5A 4NXYA 4DYOA 4YFJA 4F9UA 2BOAA 4KOYA 2CNMA 4UWJA 1Q2CA 5IX3A 3B8GA 4FD7A 4PK2A 3G3SA 3GB0A 3SJXA 4PXDA 4QB9A 2B5GA 2PQ8A 2AFXA 2CXAA 3FF3A 3FH4A 1GYTA 2PJCA 7CPAA 3SHPA 2PJ9A 4OC0A 3SXNA 3PBBA 3S6FA 1MJ9A 5K8NA 3VH9A 2VEZA 2A4NA 2JEWA 1Y9KA 5IB0A 4CS0B 4JXQA 5JGFA 4LQGA 3UY5A 3WABA 1XIXA 1XRYA 1VIXA 3IC1A 3NFZA 2J9AA 4B12A 4ZY0A 2VI7A 2VZZA 2V8GA 2Z3LA 2NYQA 4NFRA 4A2ZA 2IJZA 3QB8A 2ZW5A 5F47A 3PB8X 4ZI6A 1CJWA 4OIDA 2OOTA 3V38A 4OC4A 3F8KA 5H86A 5JM6A 4ONUA 2ZEPA 4YRHA 2NMTA 2PVWA 4IHMA 5KTDA 4R57A 4AVAA 3JVNA 4EMEA 4UEZA 3FNCA 2YNEA 1S5KA 2QECA 3PGPA 5J8CA 4QUSA 3TE4A 4NJQA 3S9LA 1ZO0A 3B3VA 3PEIA 1UWYA 4GS4A 2QYVA 4PXCA 1Z4RA 3EY5A 2R8VA 3F5BA 4QBJA 2Q4VA 1IOIA 4P4DA 1XBUA 3NA6A 2FE7A 2PJAA 4UWIA 2CTCA 1IYKA 2P6FA 5LRKA 1YVOA 1M4IA 3VWDA 4MHZA 2ZEHA 3ISXA 2C6CA 2DPTA 2CNSA 3VARA 2PIZA 3SJEA 5THWA 1XEBA 2G0BA 1P4NA 2PJ5A 1YREA 3D7HA 2HQYA 1HDQA 1R3NA 2ATRA 3BJ7A 4LUAA 1PYTB 3IWWA 4E2AA 5G1ZA 1X10A 5D29A 2OB0A 2X7BA 2RFHA 4JJXA 1KZFA 1F57A 1VHEA 1K4JA 1CP7A 4PXEA 1CM0A 3GKRA 1QSNA 4CYNA 3EFAA 2G3AA 1IB1E 2Q4YA 5I4MA 2WPWA 1VKCA 1Z8WA 2O53A 2Z3NA 3FVLA 1I21A 1YVKA 4B11A 5A27A 2O28A 3PB7X 4B6ZA 1UFHA 2ZEMA 4ZX9A 5LYFA 4X3RA 4B13A 3KZWA 4MY3A 4OAEA 2I00A 4CGNA 3KHZA 5CNPA 1M44A 2R7HA 1H8LA 5K8PA 4BINA 3PB6X 2P6EA 2BEIA 1B87A 2VXKA 4Q7AA 4UF4A 2FIWA 4P6YA 1B6BA 2PE3A 4JXRA 2D4PA 3IU1A 3D2PA 4XPDB 5HMNA 2JDDA 1LCPA 3JUWA 1CG2A 2BL1A 2FCKA 1TKFA 1HEEA 1Z8TA 4MCRA 3TC8A 4UFXA 2JBJA 4JZ0A 4A95A 1AMPA 2FXFA 4BMHA 5ISVA 3OWCA 4AG7A 2GU2A 4I49A 4MCSA 2ABZA 1QSMA 3QNVA 4NJRA 1ZG9A 4CRYB 2YNCC 2EUIA 4CYPA 4UIBA 3IEHA 4PSXA 5AG7A 2PJ4A 4FD6A 3ISZA 2Z0ZA 1LANA 3TX8A 2ZENA 4P10A 3B3TA 3D7GA 3IWGA 3LWUA 4CGMA 4RS2A 4XPLA 4A31A 2PJ1A 1BPNA 1XF8A 4KVOE 4AXVA 2AFWA 2FVGA 3D4UA 4MFKA 5G22A 2C6PA 4KLWA 4B14A 2RB7A 3RNZA 4IK2A 4MCQA 5IB9A 1JQGA 4MHNA 4LQ6A 1LAPA 2D4OA 4L8AA 4XPKA 3S6GA 1JWQA 4KS9A 2B4DB 5HVGA 1Z9UA 3PRTA 2K5TA 4Y49C 1BAVA 3EC4A 5LYDA 1KUVA 1FT7A 5F48A 3FEDA 1NSAA 1N71A 4CAXA 2PVVA 3I9SA 2QJ8A 4K3NA 2PDOA 4M6HA 3RYOA 3FXTA 5CPAA 3HUVA 4FUUA 4KOXA 4MFLA 2BCOA 5AG5A 2IL4A 1QSOA 3LODA 4MHDA 3WC5A 4NGSA 2ZXVA 4JD6A 3B3CA 2FS5A 4NGMA 4UBRA 3PB4X 3FMCA 2ZW6A 1QQ9A 3TTHA 1AYEA 2C1CA 1KUXA 3IJ3A 1BOBA 4WWVA 2REEA 4Z65A 3B7IA 3FEEA 3ZJ0A 2Q0YA 1M4GA 3BHXA 4C7HA 1DE4C 4CGOA 1Q7LA 2JDCA 4ZY1A 4Q36A 2VZYA 1TKHA 2JLMA 5JQ4A 1XOVA 2GE3A 1Z2LA 3KI9A 2F8HA 3B3WA 4H89A 4KOTA 3TOBA 4C7IA 1Y7RA 3MRUA 1Q2YA 2VQYA 4OIWA 2V77A 3GY9A 4G1PA 1ELMP 2Z10A 1LFWA 2B4DA 3KASA 4KLVA 4F0XA 4FAIA 4OKOA 2PRQA 3PP9A 4KORA 4C2ZA 2IMOA 2I3CA 3FYNA 4B5OA 4HNXB 3PFEA 2J8MA 2PRBA 3KHXA 1FNOA 4UIAA 2B3VA 1MJAA 1TKJA 5F46A 4NF1A 1IIDA 1NMTA 2R98A 4OADA 3H4QA 2Q51A 1M4DA 4CGLA 1OBRA 3KQZA 2H5MA 1IOFA 4EWTA 2CF4A 4CYQA 2OZUA 4M3SA 3FIXA 4PQAA 4KOSA 3SJFA 3S6KA 1S7LA 4C2YA 4UCPA 4AG9A 3R1KA 4HKFA 5DWMA 4C2XA 4MFJA 1F2OA 4OP4A 4YWYA 2HB6A 3WR7A 3D68A 1R43A 1WK4A 4DUKA 3D67A 3EO4A 2ARHA 1CX8A 4PPZA 3CT9A 4XNHC 2OR4A 4ZBGA 1ZG8A 4R7MA 4X5KA 3N5FA 2Z3KA 3WC7A 2GLJA 3R9GA 4H6ZA 5I0CA 3KL9A 1R57A 1J4JA 4KSIA 2G9DA 4X8IA 1BLLE 2GFQA 2GANA 4JWPA 5ELYA 4FBEA 1LAMA 1P0HA 2ANPA 3TO7A 4OC3A 2Z11A 1YMEA 2BSWA 3P2HA 4B5PB 1Y9WA 3IU2A 4NGRA 4R8FA 4W9YA 4KOWA 4ONWA 3DNSA 3D66A 2GREA 1I1DA 1YR0A 4M6IA 1RO5A 3GUXA 5EMIA 5K8OA 2AE6A 2XEIA 1S7KA 3V8IA 4MJ8A 1L0CA 1I12A 3W91A 1XMTA 4AB7A 4FWUA 2AFUA 4FD4A 4P4IA 2PR1A 3KR4A 2BUEA 3WC6A 3TOAA 3NE7A 1V0CA 5J8FA 1GHEA 1KUYA 4P4JA 3VWEA 2V8VA 2RC4A 1ZLHA 4R3LA 2VL1A 2BO9A 1MJBA 5C82A 3S6HA 3KR5A 4O23A 2Z3MA 2EVNA 3CPXA 5AG6A 2B3UA 3R95A 4F0YA 2Y0MA 3D2MA 4P4EA 3CZXA 5HH1A 3KKWA 4Y49B 2PIYA 3I3GA 1IU8A 4RUHA 3H8GA 3I1UA 1YSJA 2CIJA 3K9TA 4X2TA 2ZOFA 3CPAA 4OC2A 3IWEA 4UFVA 3SI0A 4KZTA 4AVBA 1CBXA 2XEFA 4OC5A 3CXPA 3RO0A 4U9ZA 3C26A 4IF5A 4B5PA 1YLEA 4NCZA 1PUAA 2YNCA 4RN7A 3GIUA 4P45A 4JYWA 4KOUA 2WZNA 5GCNA 2ZW7A 3N7ZA 4KOVA 2WUUA 3S9NA 2KCWA 4F9VA 2CNTA 1F2PA 3HLPA 2PJ0A 3RAMA 3KQXA 3MGDA 3BJ8A 1VGYA 3IFEA 4MFPA 3TT2A 5FVJA 3IO1A 2J8NA 3H8FA 3LMSA 2ZEOA 4KUAA 4MI4A 1YK3A 1CP6A 1Y0YA 2I79A 3MN8A 4QVTA 2EWBA 2PJ6A 1RTQA 2Q4ZA 5E96A 2B4BA 2EK9A 3A9LA 5G21A 1Y7EA 3L2NA 1S3ZA 2PJBA 2QIRA 5CBMA 2QMLA 4EFDA 5BWAB 1YW6A 3TCVA 2DPSA 2XEJA 4F8ZA 4KVXA 3PBEA 4UFWA 4YU9A 5LRGA 1IICA 1WWZA 4JLYA 4U5YA 1NE9A 1KWMA 4IAVA 4MHPA 4NGTA 4QC6A 5DS0A 2O4HA 4NGNA 3D7DA 3VATA 5LRJA 3JTKA 2Z3PA 2PJ2A 2Q04A 1DTDA 3IIBA 3JRUA 2CTBA 3NH4A 4R87A 4RI1A 4TNUA 1ARMA 4NEXA 4CAWA 4E0AA 5AG4A 3SI1A 2POKA 3PB9X 4WJBA 3T8WA 3G8WA 1TIQA 1BPMA 4A30A 4CAFA 4CRZB 2OU2A 3BLNA 2Q43A 3V7ZA 1XMBA 3W6SA 4H2KA 5F49A 4OMEA 1QMUA 3FJUA 1VHSA 4KSFA 3W6XA 1XE4A 4KUBA 4MCPA 5KTCA 4MXUA 2AFZA 3R9FA 4DJLA 3PZJA 2P6GA 4XNHB 4CAVA 3B2YA 4A94A 5J1QA 5EC4A 1Y0RA 2Z3OA 1EE3P 4ZGYB 3R96A 4J3GA 1TXRA 3T90A 5LYLA 3SXOA 3NE8A 4AVCA 2C6GA 4CAEA 3GLJA 3RZAA 4CGPA 1LRZA 1ON0A 2EK8A 5DWNA 4MBUA 5C88A 2DF5A 3DSBA 4A32A 2QVPA 4MFZA 3DR6A 4ZX8A 1IY7A 4PV6A 2R1IA 3FX6A 4MMOA 2ZEFA 2V8HA 1YGHA 4GM5A 2JEVA 3D7FA 2IQ6A 3FECA 3T9YA 4ORFA 5HXDA 2PSWA 6CPAA 4Q38A 3H5ZA 4HPSA 2C27A 2ZPAA 2PJ3A 3P2FA 2NSMA 2PCUA 2ZEDA 4DNCA 4MHYA 4P44A 4CPAA 4HNWB 4PXBA 2Q7SA 3EXNA 1U6MA 1YQEA 4R9MA 2REFA 2XEGA 4NGQA 1ZG7A 3BXMA 1X12A 1XFOA 4B10A 2FL4A 3CXQA 4MY0A 2PC1A 1RXTA 3D8PA 4BBHA 3E0KA 3QAYA 3TO9A 4CYOA 1PU9A 3B35A 4GXHA 5A28A 3DGVA 4P4FA 4OLLA 2Q7BA 1M4LA 2F7VA 2DEAA 1NSLA 4F6AA 2HC9A 2HV2A 4PSWA 2G3TA 1BO4A
chains in the Genus database with same CATH topology
5AGEA 4U9YA 4K30A 4LX9A 4YGOA 4KVME 2YNDA 2GIVA 3DR8A 4UCNA 2WSAA 2OZGA 2FIAA 1SQHA 3D3SA 3DDDA 4UCMA 3R9EA 3FBUA 2OH1A 2F5IA 1S7FA 4II9A 1Q2DA 5H84A 3IGRA 2J8RA 2DXQA 4IUSA 3ZZIA 3CXSA 3K9UA 2P0WA 5EBVA 3FRMA 1IYLA 4A33A 4C68A 5KTAA 3GYAA 1S60A 4FD5A 4E8OA 4M85A 3TFYA 2B5GB 2FSRA 2Q44A 4L89A 5IV0A 2B58A 4KSAA 1YX0A 1OZPA 2OZHA 4AG7A 3F0AA 2VBQA 4HNYB 4XPDC 1M1DA 1QSTA 3TO6A 1Z4EA 3LD2A 1QSRA 1S7NA 2CY2A 3QAHA 4NSQA 2HUZA 2AJ6A 5G20A 4EVYA 4MFQA 2YGWA 4H6UA 2PR8A 2ZW4A 4UA3A 2WPXA 4PK3A 2FT0A 1MK4A 5JPHA 1FY7A 4R3KA 3FB3A 4NXYA 4YFJA 4KOYA 2CNMA 4UWJA 1Q2CA 5IX3A 3B8GA 4FD7A 4PK2A 3G3SA 4QB9A 2B5GA 2PQ8A 2CXAA 3SHPA 3SXNA 3S6FA 1MJ9A 2VEZA 2A4NA 1Y9KA 4CS0B 4JXQA 3UY5A 1XIXA 4B12A 2VI7A 2VZZA 2Z3LA 4A2ZA 3QB8A 2ZW5A 5F47A 1CJWA 3F8KA 5H86A 4ONUA 4YRHA 2NMTA 5KTDA 4R57A 4AVAA 3JVNA 3FNCA 2YNEA 1S5KA 2QECA 3PGPA 5J8CA 4QUSA 3TE4A 1ZO0A 4GS4A 3EY5A 1Z4RA 2R8VA 3F5BA 4QBJA 2Q4VA 2FE7A 4UWIA 1IYKA 2P6FA 1YVOA 1M4IA 3VWDA 2DPTA 2CNSA 1XEBA 2G0BA 1P4NA 1YREA 2HQYA 3BJ7A 2ATRA 4LUAA 4E2AA 5G1ZA 2OB0A 2X7BA 4JJXA 1KZFA 1K4JA 1CM0A 3GKRA 1QSNA 4CYNA 3EFAA 2G3AA 1IB1E 2Q4YA 2WPWA 1VKCA 2Z3NA 1I21A 1YVKA 4B11A 5A27A 2O28A 1UFHA 4B13A 4MY3A 4OAEA 2I00A 4CGNA 5CNPA 1M44A 2R7HA 2P6EA 2BEIA 1B87A 2VXKA 2FIWA 1B6BA 4JXRA 2D4PA 3IU1A 3D2PA 4XPDB 5HMNA 2JDDA 3JUWA 2BL1A 2FCKA 4UFXA 4A95A 5ISVA 2FXFA 4BMHA 3OWCA 4I49A 4CYPA 4CRYB 1QSMA 2YNCC 2EUIA 4PSXA 5AG7A 4FD6A 2Z0ZA 3IWGA 4CGMA 4RS2A 4XPLA 4A31A 1XF8A 4KVOE 4MFKA 5G22A 4KLWA 4B14A 4L8AA 2D4OA 4XPKA 3S6GA 4KS9A 2B4DB 1Z9UA 2K5TA 4Y49C 3EC4A 1KUVA 1N71A 4CAXA 3I9SA 2PDOA 3RYOA 3FXTA 4MFLA 4KOXA 5AG5A 2IL4A 1QSOA 3LODA 4MHDA 2ZXVA 4JD6A 2FS5A 4UBRA 2ZW6A 3TTHA 1KUXA 1BOBA 2REEA 3ZJ0A 2Q0YA 1M4GA 4C7HA 4CGOA 2JDCA 4Q36A 2VZYA 2JLMA 5JQ4A 2GE3A 4C7IA 4KOTA 4H89A 3TOBA 1Y7RA 1Q2YA 2VQYA 3GY9A 2Z10A 2B4DA 4KLVA 4F0XA 3PP9A 4KORA 4C2ZA 3FYNA 4B5OA 4HNXB 2J8MA 2PRBA 2B3VA 1MJAA 5F46A 4NF1A 1IIDA 1NMTA 2R98A 4OADA 3H4QA 1M4DA 4CGLA 2H5MA 4CYQA 2OZUA 4M3SA 3FIXA 4KOSA 3S6KA 1S7LA 4C2YA 4UCPA 4AG9A 3R1KA 4HKFA 5DWMA 4C2XA 4MFJA 3WR7A 1WK4A 3EO4A 4XNHC 2ARHA 4ZBGA 4X5KA 2Z3KA 3R9GA 4H6ZA 5I0CA 1R57A 1J4JA 2GANA 4JWPA 1P0HA 3TO7A 2Z11A 2BSWA 3P2HA 4B5PB 1Y9WA 3IU2A 4KOWA 3DNSA 1I1DA 1YR0A 1RO5A 2AE6A 1S7KA 3V8IA 4MJ8A 1L0CA 1I12A 3W91A 1XMTA 4AB7A 4FD4A 2PR1A 2BUEA 3TOAA 3NE7A 1V0CA 5J8FA 1GHEA 1KUYA 3VWEA 2RC4A 4R3LA 1MJBA 5C82A 3S6HA 2Z3MA 2EVNA 5AG6A 2B3UA 3R95A 4F0YA 2Y0MA 3D2MA 5HH1A 3KKWA 4Y49B 3I3GA 4UFVA 3IWEA 4KZTA 4AVBA 3CXPA 4U9ZA 3C26A 4IF5A 4B5PA 1YLEA 4NCZA 1PUAA 2YNCA 4KOUA 5GCNA 2ZW7A 3N7ZA 4KOVA 2WUUA 2KCWA 2CNTA 3MGDA 3BJ8A 4MFPA 3TT2A 5FVJA 2J8NA 4KUAA 4MI4A 1YK3A 2I79A 4QVTA 5E96A 2B4BA 3A9LA 5G21A 1S3ZA 2QIRA 2QMLA 5BWAB 3TCVA 2DPSA 4KVXA 4UFWA 1IICA 1WWZA 4JLYA 4U5YA 1NE9A 4QC6A 3JTKA 2Z3PA 2Q04A 5F48A 4RI1A 4R87A 5IB0A 4E0AA 5AG4A 4NEXA 4CAWA 3G8WA 1TIQA 4A30A 4CRZB 2OU2A 3BLNA 3W6SA 5F49A 1VHSA 4KSFA 3W6XA 1XE4A 4KUBA 5KTCA 3R9FA 3PZJA 2P6GA 4XNHB 4CAVA 5EC4A 2Z3OA 4ZGYB 3R96A 4J3GA 3T90A 3SXOA 4AVCA 4CAEA 4CGPA 1LRZA 1ON0A 5DWNA 4MBUA 5C88A 3DSBA 4A32A 4MFZA 3DR6A 4PV6A 2R1IA 1YGHA 2JEVA 3T9YA 4ORFA 2PSWA 4Q38A 3H5ZA 2C27A 2ZPAA 3P2FA 4DNCA 4HNWB 3EXNA 1U6MA 4R9MA 2REFA 4B10A 2FL4A 3CXQA 4MY0A 2PC1A 1RXTA 3D8PA 4BBHA 3E0KA 3TO9A 4CYOA 1PU9A 5A28A 2Q7BA 4OLLA 4F6AA 1NSLA 4CAFA 2HV2A 4PSWA 2G3TA 1BO4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4U9Y A;  4K30 A;  4LX9 A;  4YGO A;  4KVM E;  2GIV A;  3DR8 A;  2OZG A;  2FIA A;  1SQH A;  3D3S A;  3DDD A;  3R9E A;  3FBU A;  2OH1 A;  2F5I A;  1S7F A;  4II9 A;  1Q2D A;  5H84 A;  3IGR A;  2J8R A;  2DXQ A;  4IUS A;  3ZZI A;  3CXS A;  3K9U A;  2P0W A;  5EBV A;  3FRM A;  1IYL A;  5KTA A;  3GYA A;  1S60 A;  4FD5 A;  4E8O A;  4M85 A;  3TFY A;  2B5G B;  2FSR A;  2Q44 A;  4L89 A;  5IV0 A;  2B58 A;  1YX0 A;  1OZP A;  2OZH A;  4AG7 A;  3F0A A;  2VBQ A;  4HNY B;  4XPD C;  1M1D A;  1QST A;  3TO6 A;  1Z4E A;  3LD2 A;  1QSR A;  1S7N A;  2CY2 A;  3QAH A;  4NSQ A;  2HUZ A;  2AJ6 A;  4EVY A;  4H6U A;  2PR8 A;  2ZW4 A;  4UA3 A;  2WPX A;  4PK3 A;  2FT0 A;  1MK4 A;  5JPH A;  1FY7 A;  4R3K A;  3FB3 A;  4NXY A;  4YFJ A;  4KOY A;  2CNM A;  4UWJ A;  1Q2C A;  5IX3 A;  3B8G A;  4FD7 A;  4PK2 A;  3G3S A;  4QB9 A;  2B5G A;  2PQ8 A;  3SHP A;  3SXN A;  3S6F A;  1MJ9 A;  2VEZ A;  2A4N A;  1Y9K A;  4CS0 B;  4JXQ A;  3UY5 A;  1XIX A;  2VI7 A;  2VZZ A;  3QB8 A;  2ZW5 A;  5F47 A;  1CJW A;  3F8K A;  5H86 A;  4ONU A;  4YRH A;  2NMT A;  5KTD A;  4R57 A;  4AVA A;  3JVN A;  3FNC A;  1S5K A;  2QEC A;  3PGP A;  5J8C A;  4QUS A;  3TE4 A;  4GS4 A;  3EY5 A;  1Z4R A;  2R8V A;  3F5B A;  4QBJ A;  2Q4V A;  2FE7 A;  4UWI A;  1IYK A;  2P6F A;  1YVO A;  1M4I A;  3VWD A;  2CNS A;  1XEB A;  2G0B A;  1P4N A;  1YRE A;  2HQY A;  3BJ7 A;  2ATR A;  4LUA A;  4E2A A;  2OB0 A;  2X7B A;  4JJX A;  1KZF A;  1K4J A;  1CM0 A;  3GKR A;  1QSN A;  3EFA A;  2G3A A;  1IB1 E;  2Q4Y A;  2WPW A;  1VKC A;  1I21 A;  1YVK A;  2O28 A;  1UFH A;  4MY3 A;  4OAE A;  2I00 A;  5CNP A;  1M44 A;  2R7H A;  2P6E A;  2BEI A;  1B87 A;  2VXK A;  2FIW A;  1B6B A;  4JXR A;  2D4P A;  3D2P A;  4XPD B;  5HMN A;  2JDD A;  3JUW A;  2BL1 A;  2FCK A;  5ISV A;  2FXF A;  4BMH A;  3OWC A;  4I49 A;  4CRY B;  1QSM A;  2EUI A;  4PSX A;  4FD6 A;  2Z0Z A;  3IWG A;  4RS2 A;  4XPL A;  1XF8 A;  4KVO E;  4KLW A;  4L8A A;  2D4O A;  4XPK A;  3S6G A;  2B4D B;  1Z9U A;  2K5T A;  4Y49 C;  3EC4 A;  1KUV A;  1N71 A;  4CAX A;  3I9S A;  2PDO A;  3RYO A;  3FXT A;  4KOX A;  2IL4 A;  1QSO A;  3LOD A;  4MHD A;  2ZXV A;  4JD6 A;  2FS5 A;  4UBR A;  2ZW6 A;  3TTH A;  1KUX A;  1BOB A;  2REE A;  3ZJ0 A;  2Q0Y A;  1M4G A;  2JDC A;  2VZY A;  2JLM A;  5JQ4 A;  2GE3 A;  4KOT A;  4H89 A;  3TOB A;  1Y7R A;  1Q2Y A;  2VQY A;  3GY9 A;  2Z10 A;  2B4D A;  4KLV A;  3PP9 A;  4KOR A;  3FYN A;  4B5O A;  4HNX B;  2J8M A;  2PRB A;  2B3V A;  1MJA A;  5F46 A;  4NF1 A;  1IID A;  1NMT A;  2R98 A;  4OAD A;  3H4Q A;  1M4D A;  2H5M A;  2OZU A;  4M3S A;  3FIX A;  4KOS A;  3S6K A;  1S7L A;  4AG9 A;  3R1K A;  4HKF A;  5DWM A;  3WR7 A;  1WK4 A;  3EO4 A;  4XNH C;  2ARH A;  4ZBG A;  4X5K A;  3R9G A;  4H6Z A;  5I0C A;  1R57 A;  1J4J A;  2GAN A;  4JWP A;  1P0H A;  3TO7 A;  2Z11 A;  2BSW A;  3P2H A;  4B5P B;  1Y9W A;  4KOW A;  3DNS A;  1I1D A;  1YR0 A;  1RO5 A;  2AE6 A;  1S7K A;  3V8I A;  4MJ8 A;  1L0C A;  1I12 A;  3W91 A;  1XMT A;  4AB7 A;  4FD4 A;  2PR1 A;  2BUE A;  3TOA A;  3NE7 A;  1V0C A;  5J8F A;  1GHE A;  1KUY A;  3VWE A;  2RC4 A;  4R3L A;  1MJB A;  5C82 A;  3S6H A;  2EVN A;  2B3U A;  3R95 A;  4F0Y A;  2Y0M A;  3D2M A;  5HH1 A;  3KKW A;  4Y49 B;  3I3G A;  4KZT A;  4AVB A;  3CXP A;  4U9Z A;  3C26 A;  4IF5 A;  4B5P A;  1YLE A;  4NCZ A;  1PUA A;  4KOU A;  5GCN A;  2ZW7 A;  3N7Z A;  4KOV A;  2KCW A;  2CNT A;  3MGD A;  3BJ8 A;  3TT2 A;  5FVJ A;  2J8N A;  4KUA A;  4MI4 A;  1YK3 A;  2I79 A;  4QVT A;  5E96 A;  2B4B A;  1S3Z A;  2QIR A;  2QML A;  3TCV A;  4KVX A;  1IIC A;  1WWZ A;  4JLY A;  4U5Y A;  1NE9 A;  4QC6 A;  2Q04 A;  5F48 A;  4RI1 A;  4R87 A;  5IB0 A;  4E0A A;  4NEX A;  4CAW A;  3G8W A;  1TIQ A;  4CRZ B;  2OU2 A;  3BLN A;  3W6S A;  5F49 A;  1VHS A;  3W6X A;  1XE4 A;  4KUB A;  5KTC A;  3R9F A;  3PZJ A;  2P6G A;  4XNH B;  4CAV A;  5EC4 A;  3R96 A;  4J3G A;  3T90 A;  3SXO A;  4AVC A;  1LRZ A;  1ON0 A;  5DWN A;  4MBU A;  5C88 A;  3DSB A;  3DR6 A;  4PV6 A;  2R1I A;  1YGH A;  2JEV A;  3T9Y A;  4ORF A;  2PSW A;  2C27 A;  2ZPA A;  3P2F A;  4DNC A;  4HNW B;  3EXN A;  1U6M A;  4R9M A;  2REF A;  2FL4 A;  3CXQ A;  4MY0 A;  2PC1 A;  1RXT A;  3D8P A;  3E0K A;  3TO9 A;  1PU9 A;  2Q7B A;  4OLL A;  4F6A A;  1NSL A;  2HV2 A;  4PSW A;  2G3T A;  1BO4 A; 
#chains in the Genus database with same CATH topology
 5AGE A;  5D8N A;  4U9Y A;  3K2K A;  4K30 A;  4LX9 A;  4YGO A;  4KVM E;  3WT4 A;  3LAC A;  5F09 A;  2YND A;  3SJG A;  2GIV A;  3DR8 A;  4UEE A;  4UCN A;  4NGP A;  5K8M A;  2V8D A;  2WSA A;  2OZG A;  2FIA A;  4TWE A;  1XJO A;  1SQH A;  3D3S A;  3DDD A;  4M6G A;  1VHO A;  4UCM A;  3R9E A;  8CPA A;  1ZLI A;  2OH1 A;  3FBU A;  5HVH A;  2F5I A;  3S9M A;  1S7F A;  2AFS A;  3B3S A;  3CDX A;  3PFO A;  4II9 A;  1Q2D A;  4ZYQ A;  1CPS A;  5H84 A;  2PJ8 A;  3IGR A;  4A39 A;  2J8R A;  1AUG A;  2DXQ A;  4IUS A;  3ZZI A;  1HDU A;  3BI1 A;  3CXS A;  2P0W A;  1A2Z A;  3K9U A;  2ZEL A;  4UEF A;  3FRM A;  5EBV A;  5LYI A;  1IYL A;  4A33 A;  4C68 A;  5KTA A;  3GYA A;  4MRI A;  1LOK A;  2JBK A;  1S60 A;  1Z8X A;  4FD5 A;  4E8O A;  3H8E A;  4M85 A;  1YW4 A;  2AFO A;  3TFY A;  2B5G B;  2FSR A;  2Q44 A;  1PCA A;  3DLJ A;  4L89 A;  4A37 A;  5IV0 A;  2B58 A;  1IGB A;  4KSA A;  1YX0 A;  1CPX A;  1OZP A;  1Z5R A;  2OZH A;  2PJ7 A;  2GLF A;  3RBU A;  1ARL A;  2EO8 A;  3F0A A;  1TF8 A;  2VBQ A;  4R76 A;  4HNY B;  4XPD C;  1TF9 A;  1M1D A;  1QST A;  3TO6 A;  4ZY2 A;  1ELL P;  1Z4E A;  4OC1 A;  2ZEG A;  3LD2 A;  4R6T A;  1QSR A;  2EBJ A;  2ZEE A;  1S7N A;  2WYR A;  4P4B A;  2CY2 A;  3QAH A;  1YLO A;  4NSQ A;  2HUZ A;  2ODF A;  3KGQ A;  2AJ6 A;  4A38 A;  5G20 A;  4EVY A;  3SI2 A;  4BD9 A;  2AFM A;  4MFQ A;  2YGW A;  4H6U A;  2PR8 A;  2ZW4 A;  4UA3 A;  1Z8L A;  2WPX A;  4PK3 A;  2FT0 A;  3BI0 A;  1MK4 A;  3NH8 A;  5JH9 A;  5JPH A;  2ZOG A;  1FY7 A;  4R3K A;  5HVF A;  3FB3 A;  3NH5 A;  4NXY A;  4DYO A;  4YFJ A;  4F9U A;  2BOA A;  4KOY A;  2CNM A;  4UWJ A;  1Q2C A;  5IX3 A;  3B8G A;  4FD7 A;  4PK2 A;  3G3S A;  3GB0 A;  3SJX A;  4PXD A;  4QB9 A;  2B5G A;  2PQ8 A;  2AFX A;  2CXA A;  3FF3 A;  3FH4 A;  1GYT A;  2PJC A;  7CPA A;  3SHP A;  2PJ9 A;  4OC0 A;  3SXN A;  3PBB A;  3S6F A;  1MJ9 A;  5K8N A;  3VH9 A;  2VEZ A;  2A4N A;  2JEW A;  1Y9K A;  5IB0 A;  4CS0 B;  4JXQ A;  5JGF A;  4LQG A;  3UY5 A;  3WAB A;  1XIX A;  1XRY A;  1VIX A;  3IC1 A;  3NFZ A;  2J9A A;  4B12 A;  4ZY0 A;  2VI7 A;  2VZZ A;  2V8G A;  2Z3L A;  2NYQ A;  4NFR A;  4A2Z A;  2IJZ A;  3QB8 A;  2ZW5 A;  5F47 A;  3PB8 X;  4ZI6 A;  1CJW A;  4OID A;  2OOT A;  3V38 A;  4OC4 A;  3F8K A;  5H86 A;  5JM6 A;  4ONU A;  2ZEP A;  4YRH A;  2NMT A;  2PVW A;  4IHM A;  5KTD A;  4R57 A;  4AVA A;  3JVN A;  4EME A;  4UEZ A;  3FNC A;  2YNE A;  1S5K A;  2QEC A;  3PGP A;  5J8C A;  4QUS A;  3TE4 A;  4NJQ A;  3S9L A;  1ZO0 A;  3B3V A;  3PEI A;  1UWY A;  4GS4 A;  2QYV A;  4PXC A;  1Z4R A;  3EY5 A;  2R8V A;  3F5B A;  4QBJ A;  2Q4V A;  1IOI A;  4P4D A;  1XBU A;  3NA6 A;  2FE7 A;  2PJA A;  4UWI A;  2CTC A;  1IYK A;  2P6F A;  5LRK A;  1YVO A;  1M4I A;  3VWD A;  4MHZ A;  2ZEH A;  3ISX A;  2C6C A;  2DPT A;  2CNS A;  3VAR A;  2PIZ A;  3SJE A;  5THW A;  1XEB A;  2G0B A;  1P4N A;  2PJ5 A;  1YRE A;  3D7H A;  2HQY A;  1HDQ A;  1R3N A;  2ATR A;  3BJ7 A;  4LUA A;  1PYT B;  3IWW A;  4E2A A;  5G1Z A;  1X10 A;  5D29 A;  2OB0 A;  2X7B A;  2RFH A;  4JJX A;  1KZF A;  1F57 A;  1VHE A;  1K4J A;  1CP7 A;  4PXE A;  1CM0 A;  3GKR A;  1QSN A;  4CYN A;  3EFA A;  2G3A A;  1IB1 E;  2Q4Y A;  5I4M A;  2WPW A;  1VKC A;  1Z8W A;  2O53 A;  2Z3N A;  3FVL A;  1I21 A;  1YVK A;  4B11 A;  5A27 A;  2O28 A;  3PB7 X;  4B6Z A;  1UFH A;  2ZEM A;  4ZX9 A;  5LYF A;  4X3R A;  4B13 A;  3KZW A;  4MY3 A;  4OAE A;  2I00 A;  4CGN A;  3KHZ A;  5CNP A;  1M44 A;  2R7H A;  1H8L A;  5K8P A;  4BIN A;  3PB6 X;  2P6E A;  2BEI A;  1B87 A;  2VXK A;  4Q7A A;  4UF4 A;  2FIW A;  4P6Y A;  1B6B A;  2PE3 A;  4JXR A;  2D4P A;  3IU1 A;  3D2P A;  4XPD B;  5HMN A;  2JDD A;  1LCP A;  3JUW A;  1CG2 A;  2BL1 A;  2FCK A;  1TKF A;  1HEE A;  1Z8T A;  4MCR A;  3TC8 A;  4UFX A;  2JBJ A;  4JZ0 A;  4A95 A;  1AMP A;  2FXF A;  4BMH A;  5ISV A;  3OWC A;  4AG7 A;  2GU2 A;  4I49 A;  4MCS A;  2ABZ A;  1QSM A;  3QNV A;  4NJR A;  1ZG9 A;  4CRY B;  2YNC C;  2EUI A;  4CYP A;  4UIB A;  3IEH A;  4PSX A;  5AG7 A;  2PJ4 A;  4FD6 A;  3ISZ A;  2Z0Z A;  1LAN A;  3TX8 A;  2ZEN A;  4P10 A;  3B3T A;  3D7G A;  3IWG A;  3LWU A;  4CGM A;  4RS2 A;  4XPL A;  4A31 A;  2PJ1 A;  1BPN A;  1XF8 A;  4KVO E;  4AXV A;  2AFW A;  2FVG A;  3D4U A;  4MFK A;  5G22 A;  2C6P A;  4KLW A;  4B14 A;  2RB7 A;  3RNZ A;  4IK2 A;  4MCQ A;  5IB9 A;  1JQG A;  4MHN A;  4LQ6 A;  1LAP A;  2D4O A;  4L8A A;  4XPK A;  3S6G A;  1JWQ A;  4KS9 A;  2B4D B;  5HVG A;  1Z9U A;  3PRT A;  2K5T A;  4Y49 C;  1BAV A;  3EC4 A;  5LYD A;  1KUV A;  1FT7 A;  5F48 A;  3FED A;  1NSA A;  1N71 A;  4CAX A;  2PVV A;  3I9S A;  2QJ8 A;  4K3N A;  2PDO A;  4M6H A;  3RYO A;  3FXT A;  5CPA A;  3HUV A;  4FUU A;  4KOX A;  4MFL A;  2BCO A;  5AG5 A;  2IL4 A;  1QSO A;  3LOD A;  4MHD A;  3WC5 A;  4NGS A;  2ZXV A;  4JD6 A;  3B3C A;  2FS5 A;  4NGM A;  4UBR A;  3PB4 X;  3FMC A;  2ZW6 A;  1QQ9 A;  3TTH A;  1AYE A;  2C1C A;  1KUX A;  3IJ3 A;  1BOB A;  4WWV A;  2REE A;  4Z65 A;  3B7I A;  3FEE A;  3ZJ0 A;  2Q0Y A;  1M4G A;  3BHX A;  4C7H A;  1DE4 C;  4CGO A;  1Q7L A;  2JDC A;  4ZY1 A;  4Q36 A;  2VZY A;  1TKH A;  2JLM A;  5JQ4 A;  1XOV A;  2GE3 A;  1Z2L A;  3KI9 A;  2F8H A;  3B3W A;  4H89 A;  4KOT A;  3TOB A;  4C7I A;  1Y7R A;  3MRU A;  1Q2Y A;  2VQY A;  4OIW A;  2V77 A;  3GY9 A;  4G1P A;  1ELM P;  2Z10 A;  1LFW A;  2B4D A;  3KAS A;  4KLV A;  4F0X A;  4FAI A;  4OKO A;  2PRQ A;  3PP9 A;  4KOR A;  4C2Z A;  2IMO A;  2I3C A;  3FYN A;  4B5O A;  4HNX B;  3PFE A;  2J8M A;  2PRB A;  3KHX A;  1FNO A;  4UIA A;  2B3V A;  1MJA A;  1TKJ A;  5F46 A;  4NF1 A;  1IID A;  1NMT A;  2R98 A;  4OAD A;  3H4Q A;  2Q51 A;  1M4D A;  4CGL A;  1OBR A;  3KQZ A;  2H5M A;  1IOF A;  4EWT A;  2CF4 A;  4CYQ A;  2OZU A;  4M3S A;  3FIX A;  4PQA A;  4KOS A;  3SJF A;  3S6K A;  1S7L A;  4C2Y A;  4UCP A;  4AG9 A;  3R1K A;  4HKF A;  5DWM A;  4C2X A;  4MFJ A;  1F2O A;  4OP4 A;  4YWY A;  2HB6 A;  3WR7 A;  3D68 A;  1R43 A;  1WK4 A;  4DUK A;  3D67 A;  3EO4 A;  2ARH A;  1CX8 A;  4PPZ A;  3CT9 A;  4XNH C;  2OR4 A;  4ZBG A;  1ZG8 A;  4R7M A;  4X5K A;  3N5F A;  2Z3K A;  3WC7 A;  2GLJ A;  3R9G A;  4H6Z A;  5I0C A;  3KL9 A;  1R57 A;  1J4J A;  4KSI A;  2G9D A;  4X8I A;  1BLL E;  2GFQ A;  2GAN A;  4JWP A;  5ELY A;  4FBE A;  1LAM A;  1P0H A;  2ANP A;  3TO7 A;  4OC3 A;  2Z11 A;  1YME A;  2BSW A;  3P2H A;  4B5P B;  1Y9W A;  3IU2 A;  4NGR A;  4R8F A;  4W9Y A;  4KOW A;  4ONW A;  3DNS A;  3D66 A;  2GRE A;  1I1D A;  1YR0 A;  4M6I A;  1RO5 A;  3GUX A;  5EMI A;  5K8O A;  2AE6 A;  2XEI A;  1S7K A;  3V8I A;  4MJ8 A;  1L0C A;  1I12 A;  3W91 A;  1XMT A;  4AB7 A;  4FWU A;  2AFU A;  4FD4 A;  4P4I A;  2PR1 A;  3KR4 A;  2BUE A;  3WC6 A;  3TOA A;  3NE7 A;  1V0C A;  5J8F A;  1GHE A;  1KUY A;  4P4J A;  3VWE A;  2V8V A;  2RC4 A;  1ZLH A;  4R3L A;  2VL1 A;  2BO9 A;  1MJB A;  5C82 A;  3S6H A;  3KR5 A;  4O23 A;  2Z3M A;  2EVN A;  3CPX A;  5AG6 A;  2B3U A;  3R95 A;  4F0Y A;  2Y0M A;  3D2M A;  4P4E A;  3CZX A;  5HH1 A;  3KKW A;  4Y49 B;  2PIY A;  3I3G A;  1IU8 A;  4RUH A;  3H8G A;  3I1U A;  1YSJ A;  2CIJ A;  3K9T A;  4X2T A;  2ZOF A;  3CPA A;  4OC2 A;  3IWE A;  4UFV A;  3SI0 A;  4KZT A;  4AVB A;  1CBX A;  2XEF A;  4OC5 A;  3CXP A;  3RO0 A;  4U9Z A;  3C26 A;  4IF5 A;  4B5P A;  1YLE A;  4NCZ A;  1PUA A;  2YNC A;  4RN7 A;  3GIU A;  4P45 A;  4JYW A;  4KOU A;  2WZN A;  5GCN A;  2ZW7 A;  3N7Z A;  4KOV A;  2WUU A;  3S9N A;  2KCW A;  4F9V A;  2CNT A;  1F2P A;  3HLP A;  2PJ0 A;  3RAM A;  3KQX A;  3MGD A;  3BJ8 A;  1VGY A;  3IFE A;  4MFP A;  3TT2 A;  5FVJ A;  3IO1 A;  2J8N A;  3H8F A;  3LMS A;  2ZEO A;  4KUA A;  4MI4 A;  1YK3 A;  1CP6 A;  1Y0Y A;  2I79 A;  3MN8 A;  4QVT A;  2EWB A;  2PJ6 A;  1RTQ A;  2Q4Z A;  5E96 A;  2B4B A;  2EK9 A;  3A9L A;  5G21 A;  1Y7E A;  3L2N A;  1S3Z A;  2PJB A;  2QIR A;  5CBM A;  2QML A;  4EFD A;  5BWA B;  1YW6 A;  3TCV A;  2DPS A;  2XEJ A;  4F8Z A;  4KVX A;  3PBE A;  4UFW A;  4YU9 A;  5LRG A;  1IIC A;  1WWZ A;  4JLY A;  4U5Y A;  1NE9 A;  1KWM A;  4IAV A;  4MHP A;  4NGT A;  4QC6 A;  5DS0 A;  2O4H A;  4NGN A;  3D7D A;  3VAT A;  5LRJ A;  3JTK A;  2Z3P A;  2PJ2 A;  2Q04 A;  1DTD A;  3IIB A;  3JRU A;  2CTB A;  3NH4 A;  4R87 A;  4RI1 A;  4TNU A;  1ARM A;  4NEX A;  4CAW A;  4E0A A;  5AG4 A;  3SI1 A;  2POK A;  3PB9 X;  4WJB A;  3T8W A;  3G8W A;  1TIQ A;  1BPM A;  4A30 A;  4CAF A;  4CRZ B;  2OU2 A;  3BLN A;  2Q43 A;  3V7Z A;  1XMB A;  3W6S A;  4H2K A;  5F49 A;  4OME A;  1QMU A;  3FJU A;  1VHS A;  4KSF A;  3W6X A;  1XE4 A;  4KUB A;  4MCP A;  5KTC A;  4MXU A;  2AFZ A;  3R9F A;  4DJL A;  3PZJ A;  2P6G A;  4XNH B;  4CAV A;  3B2Y A;  4A94 A;  5J1Q A;  5EC4 A;  1Y0R A;  2Z3O A;  1EE3 P;  4ZGY B;  3R96 A;  4J3G A;  1TXR A;  3T90 A;  5LYL A;  3SXO A;  3NE8 A;  4AVC A;  2C6G A;  4CAE A;  3GLJ A;  3RZA A;  4CGP A;  1LRZ A;  1ON0 A;  2EK8 A;  5DWN A;  4MBU A;  5C88 A;  2DF5 A;  3DSB A;  4A32 A;  2QVP A;  4MFZ A;  3DR6 A;  4ZX8 A;  1IY7 A;  4PV6 A;  2R1I A;  3FX6 A;  4MMO A;  2ZEF A;  2V8H A;  1YGH A;  4GM5 A;  2JEV A;  3D7F A;  2IQ6 A;  3FEC A;  3T9Y A;  4ORF A;  5HXD A;  2PSW A;  6CPA A;  4Q38 A;  3H5Z A;  4HPS A;  2C27 A;  2ZPA A;  2PJ3 A;  3P2F A;  2NSM A;  2PCU A;  2ZED A;  4DNC A;  4MHY A;  4P44 A;  4CPA A;  4HNW B;  4PXB A;  2Q7S A;  3EXN A;  1U6M A;  1YQE A;  4R9M A;  2REF A;  2XEG A;  4NGQ A;  1ZG7 A;  3BXM A;  1X12 A;  1XFO A;  4B10 A;  2FL4 A;  3CXQ A;  4MY0 A;  2PC1 A;  1RXT A;  3D8P A;  4BBH A;  3E0K A;  3QAY A;  3TO9 A;  4CYO A;  1PU9 A;  3B35 A;  4GXH A;  5A28 A;  3DGV A;  4P4F A;  4OLL A;  2Q7B A;  1M4L A;  2F7V A;  2DEA A;  1NSL A;  4F6A A;  2HC9 A;  2HV2 A;  4PSW A;  2G3T A;  1BO4 A; 
#chains in the Genus database with same CATH homology
 5AGE A;  4U9Y A;  4K30 A;  4LX9 A;  4YGO A;  4KVM E;  2YND A;  2GIV A;  3DR8 A;  4UCN A;  2WSA A;  2OZG A;  2FIA A;  1SQH A;  3D3S A;  3DDD A;  4UCM A;  3R9E A;  3FBU A;  2OH1 A;  2F5I A;  1S7F A;  4II9 A;  1Q2D A;  5H84 A;  3IGR A;  2J8R A;  2DXQ A;  4IUS A;  3ZZI A;  3CXS A;  3K9U A;  2P0W A;  5EBV A;  3FRM A;  1IYL A;  4A33 A;  4C68 A;  5KTA A;  3GYA A;  1S60 A;  4FD5 A;  4E8O A;  4M85 A;  3TFY A;  2B5G B;  2FSR A;  2Q44 A;  4L89 A;  5IV0 A;  2B58 A;  4KSA A;  1YX0 A;  1OZP A;  2OZH A;  4AG7 A;  3F0A A;  2VBQ A;  4HNY B;  4XPD C;  1M1D A;  1QST A;  3TO6 A;  1Z4E A;  3LD2 A;  1QSR A;  1S7N A;  2CY2 A;  3QAH A;  4NSQ A;  2HUZ A;  2AJ6 A;  5G20 A;  4EVY A;  4MFQ A;  2YGW A;  4H6U A;  2PR8 A;  2ZW4 A;  4UA3 A;  2WPX A;  4PK3 A;  2FT0 A;  1MK4 A;  5JPH A;  1FY7 A;  4R3K A;  3FB3 A;  4NXY A;  4YFJ A;  4KOY A;  2CNM A;  4UWJ A;  1Q2C A;  5IX3 A;  3B8G A;  4FD7 A;  4PK2 A;  3G3S A;  4QB9 A;  2B5G A;  2PQ8 A;  2CXA A;  3SHP A;  3SXN A;  3S6F A;  1MJ9 A;  2VEZ A;  2A4N A;  1Y9K A;  4CS0 B;  4JXQ A;  3UY5 A;  1XIX A;  4B12 A;  2VI7 A;  2VZZ A;  2Z3L A;  4A2Z A;  3QB8 A;  2ZW5 A;  5F47 A;  1CJW A;  3F8K A;  5H86 A;  4ONU A;  4YRH A;  2NMT A;  5KTD A;  4R57 A;  4AVA A;  3JVN A;  3FNC A;  2YNE A;  1S5K A;  2QEC A;  3PGP A;  5J8C A;  4QUS A;  3TE4 A;  1ZO0 A;  4GS4 A;  3EY5 A;  1Z4R A;  2R8V A;  3F5B A;  4QBJ A;  2Q4V A;  2FE7 A;  4UWI A;  1IYK A;  2P6F A;  1YVO A;  1M4I A;  3VWD A;  2DPT A;  2CNS A;  1XEB A;  2G0B A;  1P4N A;  1YRE A;  2HQY A;  3BJ7 A;  2ATR A;  4LUA A;  4E2A A;  5G1Z A;  2OB0 A;  2X7B A;  4JJX A;  1KZF A;  1K4J A;  1CM0 A;  3GKR A;  1QSN A;  4CYN A;  3EFA A;  2G3A A;  1IB1 E;  2Q4Y A;  2WPW A;  1VKC A;  2Z3N A;  1I21 A;  1YVK A;  4B11 A;  5A27 A;  2O28 A;  1UFH A;  4B13 A;  4MY3 A;  4OAE A;  2I00 A;  4CGN A;  5CNP A;  1M44 A;  2R7H A;  2P6E A;  2BEI A;  1B87 A;  2VXK A;  2FIW A;  1B6B A;  4JXR A;  2D4P A;  3IU1 A;  3D2P A;  4XPD B;  5HMN A;  2JDD A;  3JUW A;  2BL1 A;  2FCK A;  4UFX A;  4A95 A;  5ISV A;  2FXF A;  4BMH A;  3OWC A;  4I49 A;  4CYP A;  4CRY B;  1QSM A;  2YNC C;  2EUI A;  4PSX A;  5AG7 A;  4FD6 A;  2Z0Z A;  3IWG A;  4CGM A;  4RS2 A;  4XPL A;  4A31 A;  1XF8 A;  4KVO E;  4MFK A;  5G22 A;  4KLW A;  4B14 A;  4L8A A;  2D4O A;  4XPK A;  3S6G A;  4KS9 A;  2B4D B;  1Z9U A;  2K5T A;  4Y49 C;  3EC4 A;  1KUV A;  1N71 A;  4CAX A;  3I9S A;  2PDO A;  3RYO A;  3FXT A;  4MFL A;  4KOX A;  5AG5 A;  2IL4 A;  1QSO A;  3LOD A;  4MHD A;  2ZXV A;  4JD6 A;  2FS5 A;  4UBR A;  2ZW6 A;  3TTH A;  1KUX A;  1BOB A;  2REE A;  3ZJ0 A;  2Q0Y A;  1M4G A;  4C7H A;  4CGO A;  2JDC A;  4Q36 A;  2VZY A;  2JLM A;  5JQ4 A;  2GE3 A;  4C7I A;  4KOT A;  4H89 A;  3TOB A;  1Y7R A;  1Q2Y A;  2VQY A;  3GY9 A;  2Z10 A;  2B4D A;  4KLV A;  4F0X A;  3PP9 A;  4KOR A;  4C2Z A;  3FYN A;  4B5O A;  4HNX B;  2J8M A;  2PRB A;  2B3V A;  1MJA A;  5F46 A;  4NF1 A;  1IID A;  1NMT A;  2R98 A;  4OAD A;  3H4Q A;  1M4D A;  4CGL A;  2H5M A;  4CYQ A;  2OZU A;  4M3S A;  3FIX A;  4KOS A;  3S6K A;  1S7L A;  4C2Y A;  4UCP A;  4AG9 A;  3R1K A;  4HKF A;  5DWM A;  4C2X A;  4MFJ A;  3WR7 A;  1WK4 A;  3EO4 A;  4XNH C;  2ARH A;  4ZBG A;  4X5K A;  2Z3K A;  3R9G A;  4H6Z A;  5I0C A;  1R57 A;  1J4J A;  2GAN A;  4JWP A;  1P0H A;  3TO7 A;  2Z11 A;  2BSW A;  3P2H A;  4B5P B;  1Y9W A;  3IU2 A;  4KOW A;  3DNS A;  1I1D A;  1YR0 A;  1RO5 A;  2AE6 A;  1S7K A;  3V8I A;  4MJ8 A;  1L0C A;  1I12 A;  3W91 A;  1XMT A;  4AB7 A;  4FD4 A;  2PR1 A;  2BUE A;  3TOA A;  3NE7 A;  1V0C A;  5J8F A;  1GHE A;  1KUY A;  3VWE A;  2RC4 A;  4R3L A;  1MJB A;  5C82 A;  3S6H A;  2Z3M A;  2EVN A;  5AG6 A;  2B3U A;  3R95 A;  4F0Y A;  2Y0M A;  3D2M A;  5HH1 A;  3KKW A;  4Y49 B;  3I3G A;  4UFV A;  3IWE A;  4KZT A;  4AVB A;  3CXP A;  4U9Z A;  3C26 A;  4IF5 A;  4B5P A;  1YLE A;  4NCZ A;  1PUA A;  2YNC A;  4KOU A;  5GCN A;  2ZW7 A;  3N7Z A;  4KOV A;  2WUU A;  2KCW A;  2CNT A;  3MGD A;  3BJ8 A;  4MFP A;  3TT2 A;  5FVJ A;  2J8N A;  4KUA A;  4MI4 A;  1YK3 A;  2I79 A;  4QVT A;  5E96 A;  2B4B A;  3A9L A;  5G21 A;  1S3Z A;  2QIR A;  2QML A;  5BWA B;  3TCV A;  2DPS A;  4KVX A;  4UFW A;  1IIC A;  1WWZ A;  4JLY A;  4U5Y A;  1NE9 A;  4QC6 A;  3JTK A;  2Z3P A;  2Q04 A;  5F48 A;  4RI1 A;  4R87 A;  5IB0 A;  4E0A A;  5AG4 A;  4NEX A;  4CAW A;  3G8W A;  1TIQ A;  4A30 A;  4CRZ B;  2OU2 A;  3BLN A;  3W6S A;  5F49 A;  1VHS A;  4KSF A;  3W6X A;  1XE4 A;  4KUB A;  5KTC A;  3R9F A;  3PZJ A;  2P6G A;  4XNH B;  4CAV A;  5EC4 A;  2Z3O A;  4ZGY B;  3R96 A;  4J3G A;  3T90 A;  3SXO A;  4AVC A;  4CAE A;  4CGP A;  1LRZ A;  1ON0 A;  5DWN A;  4MBU A;  5C88 A;  3DSB A;  4A32 A;  4MFZ A;  3DR6 A;  4PV6 A;  2R1I A;  1YGH A;  2JEV A;  3T9Y A;  4ORF A;  2PSW A;  4Q38 A;  3H5Z A;  2C27 A;  2ZPA A;  3P2F A;  4DNC A;  4HNW B;  3EXN A;  1U6M A;  4R9M A;  2REF A;  4B10 A;  2FL4 A;  3CXQ A;  4MY0 A;  2PC1 A;  1RXT A;  3D8P A;  4BBH A;  3E0K A;  3TO9 A;  4CYO A;  1PU9 A;  5A28 A;  2Q7B A;  4OLL A;  4F6A A;  1NSL A;  4CAF A;  2HV2 A;  4PSW A;  2G3T A;  1BO4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...