1TF9A

Streptomyces griseus aminopeptidase complexed with p-iodo-l-phenylalanine
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
277
structure length
275
Chain Sequence
APDIPLANVKAHLTQLSTIAANNGGNRAHGRPGYKASVDYVKAKLDAAGYTTTLQQFTSGGATGYNLIANWPGGDPNKVLMAGAHLDSVSSGAGINDNGSGSAAVLETALAVSRAGYQPDKHLRFAWWGAEELGLIGSKFYVNNLPSADRSKLAGYLNFDMIGSPNPGYFVYDDDPVIEKTFKNYFAGLNVPTEIETEGRSDHAPFKNVGVPVGGLFTGAGYTKSAAQAQKWGGTAGQAFDRCYHSSCDSLSNINDTALDRNSDAAAHAIWTLSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Binding of inhibitory aromatic amino acids to Streptomyces griseus aminopeptidase.
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords Aminopeptidase
total genus 108
structure length 275
sequence length 277
ec nomenclature ec 3.4.11.24: Aminopeptidase S.
pdb deposition date 2004-05-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 1tf9A00
1IGBA 1XMBA 4MHZA 1TXRA 4OIWA 3FX6A 5F09A 3PEIA 2ZOFA 2WZNA 2AFSA 3VATA 4NGSA 3VARA 1ZLIA 3PB4X 2C6PA 5LYLA 2XEJA 4NJQA 1M4LA 3IC1A 4FWUA 4UEEA 1F2OA 3ISZA 3MN8A 2CTCA 4F8ZA 1Q7LA 2AFWA 1Z2LA 2PIZA 4UF4A 3MRUA 1CP7A 4NFRA 4A38A 2IMOA 2PJCA 3NA6A 1BPNA 5ELYA 2JEWA 4P4JA 5HVFA 5K8NA 2PJ3A 1ZG7A 2PJ0A 3IIBA 4P4EA 4TWEA 1TF9A 3KL9A 2QJ8A 3S9NA 4GM5A 4W9YA 5HVGA 2EWBA 4IHMA 5I4MA 3KI9A 3H8GA 1Z8LA 5K8OA 5LYFA 3S9LA 1Y0YA 3BHXA 1VHEA 4OC4A 4PXEA 3JRUA 1QQ9A 5THWA 1RTQA 2ZEEA 4A39A 4NGMA 1DE4C 4PXCA 1LFWA 3WC7A 2OR4A 2HC9A 3FJUA 2JBJA 4RUHA 2O4HA 2BO9A 4OC2A 4MXUA 8CPAA 2I3CA 3KZWA 2C6CA 3D7FA 3PB8X 3B2YA 3DGVA 2Q43A 5K8MA 2AFXA 2PJAA 3S9MA 3PB6X 2CIJA 3B3SA 4IK2A 2IQ6A 3D4UA 3PB7X 4PXDA 3PBEA 4G1PA 2GREA 3SI2A 4JZ0A 3FMCA 3KR4A 4P45A 4NGNA 5LYIA 1VHOA 3D7DA 2CTBA 1HDUA 3CDXA 1ARMA 2ANPA 4P10A 1HEEA 1TF8A 3B35A 2QYVA 2PRQA 3B7IA 3VH9A 1YLOA 4EWTA 1CPXA 2XEFA 3IO1A 1XRYA 3LWUA 4NJRA 4JYWA 1ZG8A 2Q4ZA 4FAIA 3CT9A 1FT7A 1CPSA 3KQXA 4A94A 1EE3P 1DTDA 3FF3A 4NGQA 2PJ7A 2NSMA 1YW4A 4Z65A 2RFHA 4ZYQA 3B3WA 3SI0A 4ZY0A 3V38A 4OC3A 3PBBA 2PJ8A 1FNOA 3FEDA 1UWYA 1ELMP 4OC5A 2PJ2A 2XEIA 3I1UA 2ZEHA 4H2KA 1BLLE 1YSJA 4YWYA 4MCQA 4BD9A 5LRKA 1GYTA 3IEHA 2ZEPA 2PJ9A 3DLJA 3HLPA 4UEFA 2HB6A 2IJZA 3KHXA 1Z5RA 4FUUA 3B3VA 3B3TA 4B6ZA 5D29A 3KQZA 4PPZA 3CPXA 2V8VA 2ZELA 3PB9X 1ZG9A 4DYOA 2PVWA 2FVGA 3KASA 4P4FA 3HUVA 4IAVA 5DS0A 3TC8A 3WABA 3RBUA 5LYDA 4AXVA 4ZY1A 4X8IA 1LAMA 1IY7A 5J1QA 4R8FA 2ZOGA 3FEEA 3V7ZA 4A37A 4DJLA 1CG2A 4WJBA 2F8HA 2PE3A 4ONWA 3QNVA 3SJXA 2JBKA 3NH4A 1R43A 4MMOA 2PJBA 4EMEA 1HDQA 2NYQA 1CX8A 2AFMA 3K9TA 4PQAA 3BI0A 2V8HA 4FBEA 1LAPA 1YW6A 2POKA 4K3NA 2DEAA 4MHYA 5K8PA 2PJ5A 1LCPA 4TNUA 3PRTA 4MCSA 4EFDA 2PVVA 1TKFA 2RB7A 5HXDA 1ZLHA 2F7VA 3SJEA 1KWMA 3IFEA 4MCPA 4KSIA 2AFOA 5CPAA 4OC0A 2PCUA 3D7HA 2J9AA 1XJOA 3NFZA 4OKOA 2ZEOA 2ZEMA 3LMSA 4NGPA 2PJ4A 4O23A 5JGFA 4F9VA 4OP4A 3SI1A 2PJ6A 2GLFA 1VGYA 3L2NA 4UEZA 1Y7EA 4MCRA 4NGRA 4X3RA 4YU9A 3WT4A 2ZEDA 4MHNA 2O53A 4P4IA 1AYEA 2V77A 1NSAA 7CPAA 2AFUA 3IJ3A 3KHZA 1CP6A 3NH8A 1YMEA 3T8WA 1F57A 2G9DA 3WC5A 4F9UA 2AFZA 3BXMA 4P44A 4ZX8A 4R76A 2EK8A 3SJGA 4MHPA 3FVLA 1PYTB 2V8DA 2ZENA 3NH5A 1Y0RA 5D8NA 4CPAA 4X2TA 1CBXA 1XFOA 2BOAA 3D68A 4P6YA 1BPMA 4ZX9A 1ARLA 2ABZA 4P4DA 2WYRA 3GUXA 3GLJA 4OIDA 5JH9A 3N5FA 1AMPA 3KGQA 1VIXA 3GB0A 3FH4A 3FECA 1LOKA 1LANA 3SJFA 3K2KA 2GLJA 2XEGA 4ZY2A 2VL1A 4P4BA 2CF4A 5LRJA 4ZI6A 2C1CA 2QVPA 3D67A 3RZAA 5HVHA 3D7GA 1BAVA 2ZEGA 3PFOA 4WWVA 1XBUA 1F2PA 4R7MA 1R3NA 3KR5A 3H8FA 1TKJA 3PFEA 4PXBA 4Q7AA 1PCAA 3H8EA 3IWWA 5CBMA 4LQGA 4MRIA 3D66A 2OOTA 1TKHA 3B3CA 3WC6A 4R6TA 4DUKA 3TX8A 1ELLP 6CPAA 1H8LA 3ISXA 5LRGA 2Q51A 3CPAA 5JM6A 2C6GA 2V8GA 4UIAA 2PIYA 3BI1A 2ZEFA 4NGTA 2GU2A 2BCOA 1QMUA 2EK9A 4UIBA 1JQGA 3RAMA 4OMEA 4OC1A 5IB9A 1OBRA 2PJ1A
chains in the Genus database with same CATH superfamily
4JD6A 1IGBA 1V0CA 2YNCA 1XMBA 4MHZA 1TXRA 4OIWA 2P6EA 3FX6A 5F09A 3PEIA 4A30A 4MHDA 3H4QA 4KUAA 3DNSA 2ZOFA 2WZNA 4M3SA 5F46A 2AFSA 4UFWA 1Z8TA 2GFQA 4B13A 2OZGA 4MBUA 2WUUA 4KOVA 4UFXA 4FD6A 3P2HA 3R9EA 3VATA 4CGLA 3S6FA 1YK3A 4NGSA 1KUYA 4CAWA 3VARA 1ZLIA 3PB4X 3S6KA 2C6PA 4CGOA 5LYLA 2XEJA 3ZZIA 4NJQA 1M4LA 3IC1A 4FWUA 4M6GA 4MFZA 4UEEA 1F2OA 4U9YA 2B4BA 2FIAA 3TCVA 3JVNA 4OAEA 3ISZA 4MJ8A 3MN8A 2CTCA 4XPDB 1Q7LA 2AFWA 4F8ZA 1Z2LA 2PIZA 4UF4A 1CM0A 3MRUA 4XNHC 1CP7A 1BO4A 5C82A 4NFRA 1MJBA 4A38A 3DR8A 4AVBA 2IMOA 2PJCA 3E0KA 3IU2A 1ON0A 2Z11A 4LX9A 2GIVA 3NA6A 1BPNA 1M4DA 4R57A 5ELYA 2ATRA 2JEWA 5DWMA 4P4JA 5HVFA 2Q7SA 5KTAA 5K8NA 4PSWA 1QSRA 2OU2A 3FB3A 4KOSA 5AG4A 2PJ3A 1ZG7A 2CNTA 2PJ0A 3IIBA 4CYPA 4KOWA 4P4EA 1XIXA 1FY7A 1TF9A 4TWEA 1YX0A 3TO6A 4CGMA 3KL9A 2QJ8A 2AE6A 3S9NA 4GM5A 4W9YA 5HVGA 2ZXVA 2EWBA 4IHMA 5I4MA 5K8PA 4HKFA 3KI9A 3H8GA 4H6ZA 2P6GA 1Z8LA 5K8OA 5LYFA 1Y9WA 2Z10A 5IV0A 4L89A 3S9LA 2FSRA 3OWCA 1XE4A 2ARHA 2Z3LA 1YREA 5F49A 1Y0YA 4H89A 4B11A 2Z3OA 1A2ZA 5KTCA 3LODA 3BHXA 4M6IA 1YVOA 4KSFA 1VHEA 1MK4A 4OC4A 4PXEA 3H5ZA 3JRUA 1QQ9A 2HUZA 5THWA 1PU9A 4K30A 4ONUA 2BUEA 3UY5A 2G3AA 1RTQA 4MFPA 3D2MA 4R9MA 2ZEEA 4M85A 1YGHA 4MFQA 5C88A 2ZW6A 4U5YA 4A39A 2I00A 1L0CA 2J8MA 3G3SA 4NGMA 2FIWA 5IX3A 2JEVA 2B5GA 4C2YA 1DE4C 4PXCA 5ISVA 4MY3A 4CYOA 1LFWA 3EO4A 4UCNA 3WC7A 2VXKA 4B5PB 2B4DA 2R1IA 4PV6A 2OR4A 4HNWB 4MFKA 3N7ZA 2HC9A 1Z4RA 2QIRA 3FJUA 2JBJA 3TOAA 4RUHA 2O4HA 4LQ6A 2R8VA 3A9LA 2BO9A 4OC2A 4MXUA 8CPAA 2I3CA 1VKCA 3KZWA 5A28A 2C6CA 2WPXA 4CAVA 4GXHA 2YGWA 2Q44A 3D7FA 2OB0A 3RO0A 1QSMA 3PB8X 4CAFA 3B2YA 3DGVA 1Z9UA 2Q43A 1JWQA 5K8MA 3RNZA 2AFXA 2PJAA 3S9MA 4UA3A 3PB6X 2CIJA 2FS5A 3B3SA 3FBUA 4IK2A 2IQ6A 3D4UA 3PB7X 4MFLA 4ORFA 4PK2A 3PBEA 4FD5A 4G1PA 2GREA 4PXDA 3SHPA 3SI2A 5AGEA 1YR0A 4JZ0A 1IYKA 3FMCA 3KR4A 4NGNA 4P45A 5LYIA 1VHOA 3D7DA 2CTBA 5HMNA 3S6HA 1HDUA 1QSTA 3CDXA 1ARMA 2ANPA 4P10A 1S60A 1HEEA 1TF8A 3B35A 4C68A 3SXOA 2G3TA 2QYVA 1I12A 4KSAA 2PC1A 2VZYA 2EO8A 1Z8XA 2PRQA 3B7IA 5AG7A 3VH9A 4R3LA 1YLOA 2C27A 4M6HA 2J8NA 2F5IA 4EWTA 4CYNA 2RC4A 1CPXA 2XEFA 3IO1A 2PRBA 4C7IA 1XRYA 2Q4VA 2Z3NA 3LWUA 4NJRA 2PR8A 4JYWA 1ZG8A 2Q4ZA 4EVYA 3CT9A 1FT7A 1CPSA 3VWDA 1X12A 4FAIA 3C26A 3KQXA 4R87A 1EE3P 3IWGA 4A94A 1S5KA 4LUAA 4CGPA 1DTDA 3DR6A 3FF3A 5EMIA 4NGQA 2PJ7A 2NSMA 4F0YA 1YW4A 3IU1A 4CRZB 4Z65A 2RFHA 4KLVA 2OZHA 1Z4EA 4UBRA 4ZYQA 4F6AA 4ZGYB 3B3WA 3SI0A 5J8CA 4ZY0A 3V38A 4OC3A 3PBBA 5JPHA 2PJ8A 1J4JA 1FNOA 1WWZA 1B6BA 5IB0A 1TIQA 2DPSA 3FEDA 1M44A 4RI1A 1UWYA 3CXSA 2ZW4A 1ELMP 4J3GA 5E96A 4OC5A 2PJ2A 2XEIA 3I1UA 1KZFA 2BEIA 2ZEHA 3CZXA 4H2KA 4CS0B 1BLLE 1LRZA 3FNCA 2WPWA 1YSJA 2EBJA 4YRHA 4YWYA 4MCQA 4CRYB 2HV2A 2OZUA 4BD9A 2X7BA 5AG6A 3CXPA 4KUBA 3PZJA 1NE9A 5LRKA 1GYTA 3BJ7A 3IEHA 1SQHA 2ZEPA 2PJ9A 3DLJA 3HLPA 4UEFA 3W6XA 2HB6A 2IJZA 1MJ9A 3KHXA 2VI7A 3R9FA 2DF5A 1Z5RA 4FUUA 2Q0YA 3B3VA 3R9GA 2DPTA 2Z3PA 3B3TA 4B6ZA 1KUXA 1KUVA 5D29A 4MFJA 3KQZA 2I79A 3CPXA 2V8VA 2ZELA 4PPZA 2PSWA 3PB9X 1ZG9A 4DYOA 2PVWA 2QMLA 2FVGA 1GHEA 4AVAA 4A2ZA 5KTDA 1XMTA 3KASA 4P4FA 3TFYA 2JLMA 4HNXB 4B12A 3P2FA 3HUVA 4IAVA 5DS0A 3TC8A 2P6FA 4KOTA 3WABA 1Q2YA 3RBUA 5LYDA 2PR1A 3GKRA 4AXVA 4ZY1A 4H6UA 4X8IA 3LD2A 1LAMA 4KS9A 1IY7A 5J1QA 4R8FA 2Q7BA 2ZOGA 3FEEA 4UCMA 3V7ZA 2R98A 4GS4A 4A37A 1IYLA 1XF8A 5EC4A 4QC6A 1YQEA 4DJLA 1Y7RA 1MJAA 4FD4A 1CG2A 4UWJA 4WJBA 2HQYA 2Z3MA 4CAXA 2CNMA 2F8HA 1BOBA 4FD7A 2VZZA 4I49A 2PE3A 4ONWA 3QNVA 3SJXA 2JBKA 3NH4A 3S6GA 4RN7A 1R43A 1PUAA 2DXQA 2B58A 4F0XA 4MMOA 2PJBA 2FL4A 4EMEA 4NF1A 2CNSA 1HDQA 1Y9KA 4XNHB 2NYQA 3D2PA 1CX8A 2AFMA 2J8RA 5DWNA 1ZO0A 3K9TA 3QB8A 2FXFA 4PQAA 3SXNA 4AG9A 3BI0A 2V8HA 4JXRA 1LAPA 1YW6A 2POKA 1I1DA 2DEAA 4K3NA 4L8AA 4MHYA 2PJ5A 4XPDC 5G21A 1LCPA 4KZTA 2Y0MA 2ZPAA 4TNUA 4YGOA 1XEBA 3PRTA 1QSOA 4MCSA 3T90A 4CYQA 4X5KA 1IOIA 5H84A 2PVVA 1TKFA 2RB7A 4EFDA 1QSNA 5HXDA 1ZLHA 2F7VA 3SJEA 5HH1A 2JDDA 1KWMA 3IFEA 4MCPA 4QUSA 4KSIA 4XPKA 4CGNA 2AFOA 5CPAA 5EBVA 1S7NA 4QB9A 5G22A 4OC0A 3RYOA 2PCUA 3D7HA 2A4NA 2J9AA 2BL1A 1M1DA 2VEZA 1S7LA 2ZW5A 1XJOA 1IICA 3TTHA 3NFZA 4OKOA 1M4GA 2Z3KA 5GCNA 2GE3A 4A95A 2ZEOA 2ZEMA 3LMSA 5J8FA 4NGPA 2PJ4A 1CJWA 4C2XA 4A31A 4O23A 1N71A 5JGFA 3FXTA 5I0CA 4F9VA 4NXYA 4OP4A 3SI1A 3V8IA 3PP9A 2KCWA 2PJ6A 4IF5A 2GLFA 1VGYA 3L2NA 5A27A 4UEZA 1Y7EA 3BJ8A 5G20A 2Z0ZA 3F5BA 4MCRA 4NEXA 2PDOA 1IOFA 4NGRA 4X3RA 3FRMA 4YU9A 3WT4A 2ZEDA 4MHNA 1S7KA 2O53A 2QECA 1AYEA 4KOYA 4P4IA 3EC4A 2D4OA 3TT2A 1S7FA 2V77A 4OADA 4E0AA 1NSAA 3BLNA 7CPAA 4HNYB 3F0AA 3I9SA 4AVCA 2AFUA 3MGDA 3NE7A 4HPSA 1RO5A 4KLWA 3IJ3A 3KHZA 1CP6A 3NH8A 5CNPA 5F48A 4AG7A 1OZPA 2BSWA 1YMEA 3F8KA 4BINA 4BBHA 4QVTA 4II9A 3T8WA 1F57A 2G9DA 4JLYA 4NCZA 1UFHA 3DDDA 3WC5A 4DNCA 4F9UA 2AFZA 2YNCC 3BXMA 4P44A 4ZX8A 4R76A 4PSXA 2EK8A 3SJGA 1YLEA 2IL4A 4Q36A 4KORA 4MHPA 2VBQA 3FVLA 4CAEA 4JWPA 1PYTB 2V8DA 2ZENA 3QAHA 3W91A 3KKWA 3NH5A 1Y0RA 2GANA 1R57A 3NE8A 5D8NA 4CPAA 4Q38A 4X2TA 3IGRA 1CBXA 2P0WA 1XFOA 4XPLA 2BOAA 4KVXA 1WK4A 4B10A 4KOXA 3D68A 4P6YA 3EY5A 1BPMA 3D8PA 4ZX9A 3GYAA 4C2ZA 2FT0A 3R95A 2NMTA 1ARLA 3FYNA 2ABZA 1Q2DA 2EUIA 3B8GA 4P4DA 4A33A 3JTKA 2WYRA 3GUXA 4A32A 3GLJA 4OIDA 4AB7A 2REFA 5JH9A 2H5MA 1K4JA 1AMPA 2O28A 2ODFA 2Q4YA 3N5FA 2YNEA 1IIDA 3KGQA 4YFJA 1VIXA 3GB0A 3FH4A 3R1KA 4Y49C 3EXNA 4RS2A 3FECA 1LOKA 4QBJA 1B87A 1LANA 3SJFA 4U9ZA 3K2KA 2GLJA 4MI4A 1M4IA 2XEGA 4ZY2A 2VL1A 4P4BA 2B3UA 2CF4A 3I3GA 4Y49B 5LRJA 3TO7A 4ZI6A 4KVOE 2B3VA 2C1CA 1P0HA 2QVPA 5FVJA 1IB1E 5BWAB 3D67A 3RZAA 2OH1A 5AG5A 4KVME 5HVHA 3D7GA 3GIUA 1BAVA 2ZEGA 4JXQA 4E2AA 3PFOA 2JDCA 3T9YA 1U6MA 1P4NA 2CXAA 3W6SA 4C7HA 3G8WA 4WWVA 4UFVA 3WR7A 1XBUA 1F2PA 4R7MA 3PGPA 1R3NA 2EVNA 3KR5A 5G1ZA 3IWEA 3H8FA 4BMHA 3LACA 3CXQA 4UWIA 2FCKA 3DSBA 4E8OA 1S3ZA 1YVKA 2WSAA 3GY9A 3ZJ0A 2Q04A 1AUGA 1TKJA 4B14A 4ZBGA 3PFEA 4PXBA 2G0BA 4Q7AA 1PCAA 3TO9A 3H8EA 3IWWA 5CBMA 2AJ6A 4LQGA 4MRIA 3D66A 2OOTA 3TOBA 4B5OA 4MY0A 1TKHA 3B3CA 3WC6A 4R6TA 2VQYA 4DUKA 3JUWA 3TX8A 5F47A 3EFAA 1Q2CA 3VWEA 1ELLP 2PQ8A 5JQ4A 1X10A 2YNDA 6CPAA 1XOVA 1H8LA 3K9UA 4IUSA 1I21A 2ZW7A 3D3SA 3ISXA 1NMTA 4KOUA 5LRGA 2Q51A 2B5GB 3CPAA 3QAYA 1IU8A 4UCPA 5JM6A 2D4PA 1NSLA 4JJXA 3FIXA 2B4DB 2R7HA 4B5PA 1RXTA 2FE7A 4FBEA 2C6GA 2V8GA 4PK3A 2CY2A 2K5TA 4UIAA 2PIYA 3BI1A 2ZEFA 4OLLA 1Z8WA 2BCOA 2GU2A 4NGTA 1QMUA 2EK9A 2REEA 4NSQA 4UIBA 1JQGA 3RAMA 4OMEA 4OC1A 4R3KA 5IB9A 1OBRA 2PJ1A 3TE4A 1VHSA 3R96A 5H86A
chains in the Genus database with same CATH topology
1IGBA 1XMBA 4MHZA 1TXRA 4OIWA 3FX6A 5F09A 3PEIA 2ZOFA 2WZNA 2AFSA 3VATA 4NGSA 3VARA 1ZLIA 3PB4X 2C6PA 5LYLA 2XEJA 4NJQA 1M4LA 3IC1A 4FWUA 4UEEA 1F2OA 3ISZA 3MN8A 2CTCA 4F8ZA 1Q7LA 2AFWA 1Z2LA 2PIZA 4UF4A 3MRUA 1CP7A 4NFRA 4A38A 2IMOA 2PJCA 3NA6A 1BPNA 5ELYA 2JEWA 4P4JA 5HVFA 5K8NA 2PJ3A 1ZG7A 2PJ0A 3IIBA 4P4EA 4TWEA 1TF9A 3KL9A 2QJ8A 3S9NA 4GM5A 4W9YA 5HVGA 2EWBA 4IHMA 5I4MA 3KI9A 3H8GA 1Z8LA 5K8OA 5LYFA 3S9LA 1Y0YA 3BHXA 1VHEA 4OC4A 4PXEA 3JRUA 1QQ9A 5THWA 1RTQA 2ZEEA 4A39A 4NGMA 1DE4C 4PXCA 1LFWA 3WC7A 2OR4A 2HC9A 3FJUA 2JBJA 4RUHA 2O4HA 2BO9A 4OC2A 4MXUA 8CPAA 2I3CA 3KZWA 2C6CA 3D7FA 3PB8X 3B2YA 3DGVA 2Q43A 5K8MA 2AFXA 2PJAA 3S9MA 3PB6X 2CIJA 3B3SA 4IK2A 2IQ6A 3D4UA 3PB7X 4PXDA 3PBEA 4G1PA 2GREA 3SI2A 4JZ0A 3FMCA 3KR4A 4P45A 4NGNA 5LYIA 1VHOA 3D7DA 2CTBA 1HDUA 3CDXA 1ARMA 2ANPA 4P10A 1HEEA 1TF8A 3B35A 2QYVA 2PRQA 3B7IA 3VH9A 1YLOA 4EWTA 1CPXA 2XEFA 3IO1A 1XRYA 3LWUA 4NJRA 4JYWA 1ZG8A 2Q4ZA 4FAIA 3CT9A 1FT7A 1CPSA 3KQXA 4A94A 1EE3P 1DTDA 3FF3A 4NGQA 2PJ7A 2NSMA 1YW4A 4Z65A 2RFHA 4ZYQA 3B3WA 3SI0A 4ZY0A 3V38A 4OC3A 3PBBA 2PJ8A 1FNOA 3FEDA 1UWYA 1ELMP 4OC5A 2PJ2A 2XEIA 3I1UA 2ZEHA 4H2KA 1BLLE 1YSJA 4YWYA 4MCQA 4BD9A 5LRKA 1GYTA 3IEHA 2ZEPA 2PJ9A 3DLJA 3HLPA 4UEFA 2HB6A 2IJZA 3KHXA 1Z5RA 4FUUA 3B3VA 3B3TA 4B6ZA 5D29A 3KQZA 4PPZA 3CPXA 2V8VA 2ZELA 3PB9X 1ZG9A 4DYOA 2PVWA 2FVGA 3KASA 4P4FA 3HUVA 4IAVA 5DS0A 3TC8A 3WABA 3RBUA 5LYDA 4AXVA 4ZY1A 4X8IA 1LAMA 1IY7A 5J1QA 4R8FA 2ZOGA 3FEEA 3V7ZA 4A37A 4DJLA 1CG2A 4WJBA 2F8HA 2PE3A 4ONWA 3QNVA 3SJXA 2JBKA 3NH4A 1R43A 4MMOA 2PJBA 4EMEA 1HDQA 2NYQA 1CX8A 2AFMA 3K9TA 4PQAA 3BI0A 2V8HA 4FBEA 1LAPA 1YW6A 2POKA 4K3NA 2DEAA 4MHYA 5K8PA 2PJ5A 1LCPA 4TNUA 3PRTA 4MCSA 4EFDA 2PVVA 1TKFA 2RB7A 5HXDA 1ZLHA 2F7VA 3SJEA 1KWMA 3IFEA 4MCPA 4KSIA 2AFOA 5CPAA 4OC0A 2PCUA 3D7HA 2J9AA 1XJOA 3NFZA 4OKOA 2ZEOA 2ZEMA 3LMSA 4NGPA 2PJ4A 4O23A 5JGFA 4F9VA 4OP4A 3SI1A 2PJ6A 2GLFA 1VGYA 3L2NA 4UEZA 1Y7EA 4MCRA 4NGRA 4X3RA 4YU9A 3WT4A 2ZEDA 4MHNA 2O53A 4P4IA 1AYEA 2V77A 1NSAA 7CPAA 2AFUA 3IJ3A 3KHZA 1CP6A 3NH8A 1YMEA 3T8WA 1F57A 2G9DA 3WC5A 4F9UA 2AFZA 3BXMA 4P44A 4ZX8A 4R76A 2EK8A 3SJGA 4MHPA 3FVLA 1PYTB 2V8DA 2ZENA 3NH5A 1Y0RA 5D8NA 4CPAA 4X2TA 1CBXA 1XFOA 2BOAA 3D68A 4P6YA 1BPMA 4ZX9A 1ARLA 2ABZA 4P4DA 2WYRA 3GUXA 3GLJA 4OIDA 5JH9A 3N5FA 1AMPA 3KGQA 1VIXA 3GB0A 3FH4A 3FECA 1LOKA 1LANA 3SJFA 3K2KA 2GLJA 2XEGA 4ZY2A 2VL1A 4P4BA 2CF4A 5LRJA 4ZI6A 2C1CA 2QVPA 3D67A 3RZAA 5HVHA 3D7GA 1BAVA 2ZEGA 3PFOA 4WWVA 1XBUA 1F2PA 4R7MA 1R3NA 3KR5A 3H8FA 1TKJA 3PFEA 4PXBA 4Q7AA 1PCAA 3H8EA 3IWWA 5CBMA 4LQGA 4MRIA 3D66A 2OOTA 1TKHA 3B3CA 3WC6A 4R6TA 4DUKA 3TX8A 1ELLP 6CPAA 1H8LA 3ISXA 5LRGA 2Q51A 3CPAA 5JM6A 2C6GA 2V8GA 4UIAA 2PIYA 3BI1A 2ZEFA 4NGTA 2GU2A 2BCOA 1QMUA 2EK9A 4UIBA 1JQGA 3RAMA 4OMEA 4OC1A 5IB9A 1OBRA 2PJ1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IGB A;  1XMB A;  4MHZ A;  1TXR A;  4OIW A;  3FX6 A;  5F09 A;  3PEI A;  2ZOF A;  2WZN A;  2AFS A;  3VAT A;  4NGS A;  3VAR A;  1ZLI A;  3PB4 X;  2C6P A;  5LYL A;  2XEJ A;  4NJQ A;  1M4L A;  3IC1 A;  4FWU A;  4UEE A;  1F2O A;  3ISZ A;  3MN8 A;  2CTC A;  4F8Z A;  1Q7L A;  2AFW A;  1Z2L A;  2PIZ A;  4UF4 A;  3MRU A;  1CP7 A;  4NFR A;  4A38 A;  2IMO A;  2PJC A;  3NA6 A;  1BPN A;  5ELY A;  2JEW A;  4P4J A;  5HVF A;  5K8N A;  2PJ3 A;  1ZG7 A;  2PJ0 A;  3IIB A;  4P4E A;  4TWE A;  1TF9 A;  3KL9 A;  2QJ8 A;  3S9N A;  4GM5 A;  4W9Y A;  5HVG A;  2EWB A;  4IHM A;  5I4M A;  3KI9 A;  3H8G A;  1Z8L A;  5K8O A;  5LYF A;  3S9L A;  1Y0Y A;  3BHX A;  1VHE A;  4OC4 A;  4PXE A;  3JRU A;  1QQ9 A;  5THW A;  1RTQ A;  2ZEE A;  4A39 A;  4NGM A;  1DE4 C;  4PXC A;  1LFW A;  3WC7 A;  2OR4 A;  2HC9 A;  3FJU A;  2JBJ A;  4RUH A;  2O4H A;  2BO9 A;  4OC2 A;  4MXU A;  8CPA A;  2I3C A;  3KZW A;  2C6C A;  3D7F A;  3PB8 X;  3B2Y A;  3DGV A;  2Q43 A;  5K8M A;  2AFX A;  2PJA A;  3S9M A;  3PB6 X;  2CIJ A;  3B3S A;  4IK2 A;  2IQ6 A;  3D4U A;  3PB7 X;  4PXD A;  3PBE A;  4G1P A;  2GRE A;  3SI2 A;  4JZ0 A;  3FMC A;  3KR4 A;  4P45 A;  4NGN A;  5LYI A;  1VHO A;  3D7D A;  2CTB A;  1HDU A;  3CDX A;  1ARM A;  2ANP A;  4P10 A;  1HEE A;  1TF8 A;  3B35 A;  2QYV A;  2PRQ A;  3B7I A;  3VH9 A;  1YLO A;  4EWT A;  1CPX A;  2XEF A;  3IO1 A;  1XRY A;  3LWU A;  4NJR A;  4JYW A;  1ZG8 A;  2Q4Z A;  4FAI A;  3CT9 A;  1FT7 A;  1CPS A;  3KQX A;  4A94 A;  1EE3 P;  1DTD A;  3FF3 A;  4NGQ A;  2PJ7 A;  2NSM A;  1YW4 A;  4Z65 A;  2RFH A;  4ZYQ A;  3B3W A;  3SI0 A;  4ZY0 A;  3V38 A;  4OC3 A;  3PBB A;  2PJ8 A;  1FNO A;  3FED A;  1UWY A;  1ELM P;  4OC5 A;  2PJ2 A;  2XEI A;  3I1U A;  2ZEH A;  4H2K A;  1BLL E;  1YSJ A;  4YWY A;  4MCQ A;  4BD9 A;  5LRK A;  1GYT A;  3IEH A;  2ZEP A;  2PJ9 A;  3DLJ A;  3HLP A;  4UEF A;  2HB6 A;  2IJZ A;  3KHX A;  1Z5R A;  4FUU A;  3B3V A;  3B3T A;  4B6Z A;  5D29 A;  3KQZ A;  4PPZ A;  3CPX A;  2V8V A;  2ZEL A;  3PB9 X;  1ZG9 A;  4DYO A;  2PVW A;  2FVG A;  3KAS A;  4P4F A;  3HUV A;  4IAV A;  5DS0 A;  3TC8 A;  3WAB A;  3RBU A;  5LYD A;  4AXV A;  4ZY1 A;  4X8I A;  1LAM A;  1IY7 A;  5J1Q A;  4R8F A;  2ZOG A;  3FEE A;  3V7Z A;  4A37 A;  4DJL A;  1CG2 A;  4WJB A;  2F8H A;  2PE3 A;  4ONW A;  3QNV A;  3SJX A;  2JBK A;  3NH4 A;  1R43 A;  4MMO A;  2PJB A;  4EME A;  1HDQ A;  2NYQ A;  1CX8 A;  2AFM A;  3K9T A;  4PQA A;  3BI0 A;  2V8H A;  4FBE A;  1LAP A;  1YW6 A;  2POK A;  4K3N A;  2DEA A;  4MHY A;  5K8P A;  2PJ5 A;  1LCP A;  4TNU A;  3PRT A;  4MCS A;  4EFD A;  2PVV A;  1TKF A;  2RB7 A;  5HXD A;  1ZLH A;  2F7V A;  3SJE A;  1KWM A;  3IFE A;  4MCP A;  4KSI A;  2AFO A;  5CPA A;  4OC0 A;  2PCU A;  3D7H A;  2J9A A;  1XJO A;  3NFZ A;  4OKO A;  2ZEO A;  2ZEM A;  3LMS A;  4NGP A;  2PJ4 A;  4O23 A;  5JGF A;  4F9V A;  4OP4 A;  3SI1 A;  2PJ6 A;  2GLF A;  1VGY A;  3L2N A;  4UEZ A;  1Y7E A;  4MCR A;  4NGR A;  4X3R A;  4YU9 A;  3WT4 A;  2ZED A;  4MHN A;  2O53 A;  4P4I A;  1AYE A;  2V77 A;  1NSA A;  7CPA A;  2AFU A;  3IJ3 A;  3KHZ A;  1CP6 A;  3NH8 A;  1YME A;  3T8W A;  1F57 A;  2G9D A;  3WC5 A;  4F9U A;  2AFZ A;  3BXM A;  4P44 A;  4ZX8 A;  4R76 A;  2EK8 A;  3SJG A;  4MHP A;  3FVL A;  1PYT B;  2V8D A;  2ZEN A;  3NH5 A;  1Y0R A;  5D8N A;  4CPA A;  4X2T A;  1CBX A;  1XFO A;  2BOA A;  3D68 A;  4P6Y A;  1BPM A;  4ZX9 A;  1ARL A;  2ABZ A;  4P4D A;  2WYR A;  3GUX A;  3GLJ A;  4OID A;  5JH9 A;  3N5F A;  1AMP A;  3KGQ A;  1VIX A;  3GB0 A;  3FH4 A;  3FEC A;  1LOK A;  1LAN A;  3SJF A;  3K2K A;  2GLJ A;  2XEG A;  4ZY2 A;  2VL1 A;  4P4B A;  2CF4 A;  5LRJ A;  4ZI6 A;  2C1C A;  2QVP A;  3D67 A;  3RZA A;  5HVH A;  3D7G A;  1BAV A;  2ZEG A;  3PFO A;  4WWV A;  1XBU A;  1F2P A;  4R7M A;  1R3N A;  3KR5 A;  3H8F A;  1TKJ A;  3PFE A;  4PXB A;  4Q7A A;  1PCA A;  3H8E A;  3IWW A;  5CBM A;  4LQG A;  4MRI A;  3D66 A;  2OOT A;  1TKH A;  3B3C A;  3WC6 A;  4R6T A;  4DUK A;  3TX8 A;  1ELL P;  6CPA A;  1H8L A;  3ISX A;  5LRG A;  2Q51 A;  3CPA A;  5JM6 A;  2C6G A;  2V8G A;  4UIA A;  2PIY A;  3BI1 A;  2ZEF A;  4NGT A;  2GU2 A;  2BCO A;  1QMU A;  2EK9 A;  4UIB A;  1JQG A;  3RAM A;  4OME A;  4OC1 A;  5IB9 A;  1OBR A;  2PJ1 A; 
#chains in the Genus database with same CATH topology
 4JD6 A;  1IGB A;  1V0C A;  2YNC A;  1XMB A;  4MHZ A;  1TXR A;  4OIW A;  2P6E A;  3FX6 A;  5F09 A;  3PEI A;  4A30 A;  4MHD A;  3H4Q A;  4KUA A;  3DNS A;  2ZOF A;  2WZN A;  4M3S A;  5F46 A;  2AFS A;  4UFW A;  1Z8T A;  2GFQ A;  4B13 A;  2OZG A;  4MBU A;  2WUU A;  4KOV A;  4UFX A;  4FD6 A;  3P2H A;  3R9E A;  3VAT A;  4CGL A;  3S6F A;  1YK3 A;  4NGS A;  1KUY A;  4CAW A;  3VAR A;  1ZLI A;  3PB4 X;  3S6K A;  2C6P A;  4CGO A;  5LYL A;  2XEJ A;  3ZZI A;  4NJQ A;  1M4L A;  3IC1 A;  4FWU A;  4M6G A;  4MFZ A;  4UEE A;  1F2O A;  4U9Y A;  2B4B A;  2FIA A;  3TCV A;  3JVN A;  4OAE A;  3ISZ A;  4MJ8 A;  3MN8 A;  2CTC A;  4XPD B;  1Q7L A;  2AFW A;  4F8Z A;  1Z2L A;  2PIZ A;  4UF4 A;  1CM0 A;  3MRU A;  4XNH C;  1CP7 A;  1BO4 A;  5C82 A;  4NFR A;  1MJB A;  4A38 A;  3DR8 A;  4AVB A;  2IMO A;  2PJC A;  3E0K A;  3IU2 A;  1ON0 A;  2Z11 A;  4LX9 A;  2GIV A;  3NA6 A;  1BPN A;  1M4D A;  4R57 A;  5ELY A;  2ATR A;  2JEW A;  5DWM A;  4P4J A;  5HVF A;  2Q7S A;  5KTA A;  5K8N A;  4PSW A;  1QSR A;  2OU2 A;  3FB3 A;  4KOS A;  5AG4 A;  2PJ3 A;  1ZG7 A;  2CNT A;  2PJ0 A;  3IIB A;  4CYP A;  4KOW A;  4P4E A;  1XIX A;  1FY7 A;  1TF9 A;  4TWE A;  1YX0 A;  3TO6 A;  4CGM A;  3KL9 A;  2QJ8 A;  2AE6 A;  3S9N A;  4GM5 A;  4W9Y A;  5HVG A;  2ZXV A;  2EWB A;  4IHM A;  5I4M A;  5K8P A;  4HKF A;  3KI9 A;  3H8G A;  4H6Z A;  2P6G A;  1Z8L A;  5K8O A;  5LYF A;  1Y9W A;  2Z10 A;  5IV0 A;  4L89 A;  3S9L A;  2FSR A;  3OWC A;  1XE4 A;  2ARH A;  2Z3L A;  1YRE A;  5F49 A;  1Y0Y A;  4H89 A;  4B11 A;  2Z3O A;  1A2Z A;  5KTC A;  3LOD A;  3BHX A;  4M6I A;  1YVO A;  4KSF A;  1VHE A;  1MK4 A;  4OC4 A;  4PXE A;  3H5Z A;  3JRU A;  1QQ9 A;  2HUZ A;  5THW A;  1PU9 A;  4K30 A;  4ONU A;  2BUE A;  3UY5 A;  2G3A A;  1RTQ A;  4MFP A;  3D2M A;  4R9M A;  2ZEE A;  4M85 A;  1YGH A;  4MFQ A;  5C88 A;  2ZW6 A;  4U5Y A;  4A39 A;  2I00 A;  1L0C A;  2J8M A;  3G3S A;  4NGM A;  2FIW A;  5IX3 A;  2JEV A;  2B5G A;  4C2Y A;  1DE4 C;  4PXC A;  5ISV A;  4MY3 A;  4CYO A;  1LFW A;  3EO4 A;  4UCN A;  3WC7 A;  2VXK A;  4B5P B;  2B4D A;  2R1I A;  4PV6 A;  2OR4 A;  4HNW B;  4MFK A;  3N7Z A;  2HC9 A;  1Z4R A;  2QIR A;  3FJU A;  2JBJ A;  3TOA A;  4RUH A;  2O4H A;  4LQ6 A;  2R8V A;  3A9L A;  2BO9 A;  4OC2 A;  4MXU A;  8CPA A;  2I3C A;  1VKC A;  3KZW A;  5A28 A;  2C6C A;  2WPX A;  4CAV A;  4GXH A;  2YGW A;  2Q44 A;  3D7F A;  2OB0 A;  3RO0 A;  1QSM A;  3PB8 X;  4CAF A;  3B2Y A;  3DGV A;  1Z9U A;  2Q43 A;  1JWQ A;  5K8M A;  3RNZ A;  2AFX A;  2PJA A;  3S9M A;  4UA3 A;  3PB6 X;  2CIJ A;  2FS5 A;  3B3S A;  3FBU A;  4IK2 A;  2IQ6 A;  3D4U A;  3PB7 X;  4MFL A;  4ORF A;  4PK2 A;  3PBE A;  4FD5 A;  4G1P A;  2GRE A;  4PXD A;  3SHP A;  3SI2 A;  5AGE A;  1YR0 A;  4JZ0 A;  1IYK A;  3FMC A;  3KR4 A;  4NGN A;  4P45 A;  5LYI A;  1VHO A;  3D7D A;  2CTB A;  5HMN A;  3S6H A;  1HDU A;  1QST A;  3CDX A;  1ARM A;  2ANP A;  4P10 A;  1S60 A;  1HEE A;  1TF8 A;  3B35 A;  4C68 A;  3SXO A;  2G3T A;  2QYV A;  1I12 A;  4KSA A;  2PC1 A;  2VZY A;  2EO8 A;  1Z8X A;  2PRQ A;  3B7I A;  5AG7 A;  3VH9 A;  4R3L A;  1YLO A;  2C27 A;  4M6H A;  2J8N A;  2F5I A;  4EWT A;  4CYN A;  2RC4 A;  1CPX A;  2XEF A;  3IO1 A;  2PRB A;  4C7I A;  1XRY A;  2Q4V A;  2Z3N A;  3LWU A;  4NJR A;  2PR8 A;  4JYW A;  1ZG8 A;  2Q4Z A;  4EVY A;  3CT9 A;  1FT7 A;  1CPS A;  3VWD A;  1X12 A;  4FAI A;  3C26 A;  3KQX A;  4R87 A;  1EE3 P;  3IWG A;  4A94 A;  1S5K A;  4LUA A;  4CGP A;  1DTD A;  3DR6 A;  3FF3 A;  5EMI A;  4NGQ A;  2PJ7 A;  2NSM A;  4F0Y A;  1YW4 A;  3IU1 A;  4CRZ B;  4Z65 A;  2RFH A;  4KLV A;  2OZH A;  1Z4E A;  4UBR A;  4ZYQ A;  4F6A A;  4ZGY B;  3B3W A;  3SI0 A;  5J8C A;  4ZY0 A;  3V38 A;  4OC3 A;  3PBB A;  5JPH A;  2PJ8 A;  1J4J A;  1FNO A;  1WWZ A;  1B6B A;  5IB0 A;  1TIQ A;  2DPS A;  3FED A;  1M44 A;  4RI1 A;  1UWY A;  3CXS A;  2ZW4 A;  1ELM P;  4J3G A;  5E96 A;  4OC5 A;  2PJ2 A;  2XEI A;  3I1U A;  1KZF A;  2BEI A;  2ZEH A;  3CZX A;  4H2K A;  4CS0 B;  1BLL E;  1LRZ A;  3FNC A;  2WPW A;  1YSJ A;  2EBJ A;  4YRH A;  4YWY A;  4MCQ A;  4CRY B;  2HV2 A;  2OZU A;  4BD9 A;  2X7B A;  5AG6 A;  3CXP A;  4KUB A;  3PZJ A;  1NE9 A;  5LRK A;  1GYT A;  3BJ7 A;  3IEH A;  1SQH A;  2ZEP A;  2PJ9 A;  3DLJ A;  3HLP A;  4UEF A;  3W6X A;  2HB6 A;  2IJZ A;  1MJ9 A;  3KHX A;  2VI7 A;  3R9F A;  2DF5 A;  1Z5R A;  4FUU A;  2Q0Y A;  3B3V A;  3R9G A;  2DPT A;  2Z3P A;  3B3T A;  4B6Z A;  1KUX A;  1KUV A;  5D29 A;  4MFJ A;  3KQZ A;  2I79 A;  3CPX A;  2V8V A;  2ZEL A;  4PPZ A;  2PSW A;  3PB9 X;  1ZG9 A;  4DYO A;  2PVW A;  2QML A;  2FVG A;  1GHE A;  4AVA A;  4A2Z A;  5KTD A;  1XMT A;  3KAS A;  4P4F A;  3TFY A;  2JLM A;  4HNX B;  4B12 A;  3P2F A;  3HUV A;  4IAV A;  5DS0 A;  3TC8 A;  2P6F A;  4KOT A;  3WAB A;  1Q2Y A;  3RBU A;  5LYD A;  2PR1 A;  3GKR A;  4AXV A;  4ZY1 A;  4H6U A;  4X8I A;  3LD2 A;  1LAM A;  4KS9 A;  1IY7 A;  5J1Q A;  4R8F A;  2Q7B A;  2ZOG A;  3FEE A;  4UCM A;  3V7Z A;  2R98 A;  4GS4 A;  4A37 A;  1IYL A;  1XF8 A;  5EC4 A;  4QC6 A;  1YQE A;  4DJL A;  1Y7R A;  1MJA A;  4FD4 A;  1CG2 A;  4UWJ A;  4WJB A;  2HQY A;  2Z3M A;  4CAX A;  2CNM A;  2F8H A;  1BOB A;  4FD7 A;  2VZZ A;  4I49 A;  2PE3 A;  4ONW A;  3QNV A;  3SJX A;  2JBK A;  3NH4 A;  3S6G A;  4RN7 A;  1R43 A;  1PUA A;  2DXQ A;  2B58 A;  4F0X A;  4MMO A;  2PJB A;  2FL4 A;  4EME A;  4NF1 A;  2CNS A;  1HDQ A;  1Y9K A;  4XNH B;  2NYQ A;  3D2P A;  1CX8 A;  2AFM A;  2J8R A;  5DWN A;  1ZO0 A;  3K9T A;  3QB8 A;  2FXF A;  4PQA A;  3SXN A;  4AG9 A;  3BI0 A;  2V8H A;  4JXR A;  1LAP A;  1YW6 A;  2POK A;  1I1D A;  2DEA A;  4K3N A;  4L8A A;  4MHY A;  2PJ5 A;  4XPD C;  5G21 A;  1LCP A;  4KZT A;  2Y0M A;  2ZPA A;  4TNU A;  4YGO A;  1XEB A;  3PRT A;  1QSO A;  4MCS A;  3T90 A;  4CYQ A;  4X5K A;  1IOI A;  5H84 A;  2PVV A;  1TKF A;  2RB7 A;  4EFD A;  1QSN A;  5HXD A;  1ZLH A;  2F7V A;  3SJE A;  5HH1 A;  2JDD A;  1KWM A;  3IFE A;  4MCP A;  4QUS A;  4KSI A;  4XPK A;  4CGN A;  2AFO A;  5CPA A;  5EBV A;  1S7N A;  4QB9 A;  5G22 A;  4OC0 A;  3RYO A;  2PCU A;  3D7H A;  2A4N A;  2J9A A;  2BL1 A;  1M1D A;  2VEZ A;  1S7L A;  2ZW5 A;  1XJO A;  1IIC A;  3TTH A;  3NFZ A;  4OKO A;  1M4G A;  2Z3K A;  5GCN A;  2GE3 A;  4A95 A;  2ZEO A;  2ZEM A;  3LMS A;  5J8F A;  4NGP A;  2PJ4 A;  1CJW A;  4C2X A;  4A31 A;  4O23 A;  1N71 A;  5JGF A;  3FXT A;  5I0C A;  4F9V A;  4NXY A;  4OP4 A;  3SI1 A;  3V8I A;  3PP9 A;  2KCW A;  2PJ6 A;  4IF5 A;  2GLF A;  1VGY A;  3L2N A;  5A27 A;  4UEZ A;  1Y7E A;  3BJ8 A;  5G20 A;  2Z0Z A;  3F5B A;  4MCR A;  4NEX A;  2PDO A;  1IOF A;  4NGR A;  4X3R A;  3FRM A;  4YU9 A;  3WT4 A;  2ZED A;  4MHN A;  1S7K A;  2O53 A;  2QEC A;  1AYE A;  4KOY A;  4P4I A;  3EC4 A;  2D4O A;  3TT2 A;  1S7F A;  2V77 A;  4OAD A;  4E0A A;  1NSA A;  3BLN A;  7CPA A;  4HNY B;  3F0A A;  3I9S A;  4AVC A;  2AFU A;  3MGD A;  3NE7 A;  4HPS A;  1RO5 A;  4KLW A;  3IJ3 A;  3KHZ A;  1CP6 A;  3NH8 A;  5CNP A;  5F48 A;  4AG7 A;  1OZP A;  2BSW A;  1YME A;  3F8K A;  4BIN A;  4BBH A;  4QVT A;  4II9 A;  3T8W A;  1F57 A;  2G9D A;  4JLY A;  4NCZ A;  1UFH A;  3DDD A;  3WC5 A;  4DNC A;  4F9U A;  2AFZ A;  2YNC C;  3BXM A;  4P44 A;  4ZX8 A;  4R76 A;  4PSX A;  2EK8 A;  3SJG A;  1YLE A;  2IL4 A;  4Q36 A;  4KOR A;  4MHP A;  2VBQ A;  3FVL A;  4CAE A;  4JWP A;  1PYT B;  2V8D A;  2ZEN A;  3QAH A;  3W91 A;  3KKW A;  3NH5 A;  1Y0R A;  2GAN A;  1R57 A;  3NE8 A;  5D8N A;  4CPA A;  4Q38 A;  4X2T A;  3IGR A;  1CBX A;  2P0W A;  1XFO A;  4XPL A;  2BOA A;  4KVX A;  1WK4 A;  4B10 A;  4KOX A;  3D68 A;  4P6Y A;  3EY5 A;  1BPM A;  3D8P A;  4ZX9 A;  3GYA A;  4C2Z A;  2FT0 A;  3R95 A;  2NMT A;  1ARL A;  3FYN A;  2ABZ A;  1Q2D A;  2EUI A;  3B8G A;  4P4D A;  4A33 A;  3JTK A;  2WYR A;  3GUX A;  4A32 A;  3GLJ A;  4OID A;  4AB7 A;  2REF A;  5JH9 A;  2H5M A;  1K4J A;  1AMP A;  2O28 A;  2ODF A;  2Q4Y A;  3N5F A;  2YNE A;  1IID A;  3KGQ A;  4YFJ A;  1VIX A;  3GB0 A;  3FH4 A;  3R1K A;  4Y49 C;  3EXN A;  4RS2 A;  3FEC A;  1LOK A;  4QBJ A;  1B87 A;  1LAN A;  3SJF A;  4U9Z A;  3K2K A;  2GLJ A;  4MI4 A;  1M4I A;  2XEG A;  4ZY2 A;  2VL1 A;  4P4B A;  2B3U A;  2CF4 A;  3I3G A;  4Y49 B;  5LRJ A;  3TO7 A;  4ZI6 A;  4KVO E;  2B3V A;  2C1C A;  1P0H A;  2QVP A;  5FVJ A;  1IB1 E;  5BWA B;  3D67 A;  3RZA A;  2OH1 A;  5AG5 A;  4KVM E;  5HVH A;  3D7G A;  3GIU A;  1BAV A;  2ZEG A;  4JXQ A;  4E2A A;  3PFO A;  2JDC A;  3T9Y A;  1U6M A;  1P4N A;  2CXA A;  3W6S A;  4C7H A;  3G8W A;  4WWV A;  4UFV A;  3WR7 A;  1XBU A;  1F2P A;  4R7M A;  3PGP A;  1R3N A;  2EVN A;  3KR5 A;  5G1Z A;  3IWE A;  3H8F A;  4BMH A;  3LAC A;  3CXQ A;  4UWI A;  2FCK A;  3DSB A;  4E8O A;  1S3Z A;  1YVK A;  2WSA A;  3GY9 A;  3ZJ0 A;  2Q04 A;  1AUG A;  1TKJ A;  4B14 A;  4ZBG A;  3PFE A;  4PXB A;  2G0B A;  4Q7A A;  1PCA A;  3TO9 A;  3H8E A;  3IWW A;  5CBM A;  2AJ6 A;  4LQG A;  4MRI A;  3D66 A;  2OOT A;  3TOB A;  4B5O A;  4MY0 A;  1TKH A;  3B3C A;  3WC6 A;  4R6T A;  2VQY A;  4DUK A;  3JUW A;  3TX8 A;  5F47 A;  3EFA A;  1Q2C A;  3VWE A;  1ELL P;  2PQ8 A;  5JQ4 A;  1X10 A;  2YND A;  6CPA A;  1XOV A;  1H8L A;  3K9U A;  4IUS A;  1I21 A;  2ZW7 A;  3D3S A;  3ISX A;  1NMT A;  4KOU A;  5LRG A;  2Q51 A;  2B5G B;  3CPA A;  3QAY A;  1IU8 A;  4UCP A;  5JM6 A;  2D4P A;  1NSL A;  4JJX A;  3FIX A;  2B4D B;  2R7H A;  4B5P A;  1RXT A;  2FE7 A;  4FBE A;  2C6G A;  2V8G A;  4PK3 A;  2CY2 A;  2K5T A;  4UIA A;  2PIY A;  3BI1 A;  2ZEF A;  4OLL A;  1Z8W A;  2BCO A;  2GU2 A;  4NGT A;  1QMU A;  2EK9 A;  2REE A;  4NSQ A;  4UIB A;  1JQG A;  3RAM A;  4OME A;  4OC1 A;  4R3K A;  5IB9 A;  1OBR A;  2PJ1 A;  3TE4 A;  1VHS A;  3R96 A;  5H86 A; 
#chains in the Genus database with same CATH homology
 1IGB A;  1XMB A;  4MHZ A;  1TXR A;  4OIW A;  3FX6 A;  5F09 A;  3PEI A;  2ZOF A;  2WZN A;  2AFS A;  3VAT A;  4NGS A;  3VAR A;  1ZLI A;  3PB4 X;  2C6P A;  5LYL A;  2XEJ A;  4NJQ A;  1M4L A;  3IC1 A;  4FWU A;  4UEE A;  1F2O A;  3ISZ A;  3MN8 A;  2CTC A;  4F8Z A;  1Q7L A;  2AFW A;  1Z2L A;  2PIZ A;  4UF4 A;  3MRU A;  1CP7 A;  4NFR A;  4A38 A;  2IMO A;  2PJC A;  3NA6 A;  1BPN A;  5ELY A;  2JEW A;  4P4J A;  5HVF A;  5K8N A;  2PJ3 A;  1ZG7 A;  2PJ0 A;  3IIB A;  4P4E A;  4TWE A;  1TF9 A;  3KL9 A;  2QJ8 A;  3S9N A;  4GM5 A;  4W9Y A;  5HVG A;  2EWB A;  4IHM A;  5I4M A;  3KI9 A;  3H8G A;  1Z8L A;  5K8O A;  5LYF A;  3S9L A;  1Y0Y A;  3BHX A;  1VHE A;  4OC4 A;  4PXE A;  3JRU A;  1QQ9 A;  5THW A;  1RTQ A;  2ZEE A;  4A39 A;  4NGM A;  1DE4 C;  4PXC A;  1LFW A;  3WC7 A;  2OR4 A;  2HC9 A;  3FJU A;  2JBJ A;  4RUH A;  2O4H A;  2BO9 A;  4OC2 A;  4MXU A;  8CPA A;  2I3C A;  3KZW A;  2C6C A;  3D7F A;  3PB8 X;  3B2Y A;  3DGV A;  2Q43 A;  5K8M A;  2AFX A;  2PJA A;  3S9M A;  3PB6 X;  2CIJ A;  3B3S A;  4IK2 A;  2IQ6 A;  3D4U A;  3PB7 X;  4PXD A;  3PBE A;  4G1P A;  2GRE A;  3SI2 A;  4JZ0 A;  3FMC A;  3KR4 A;  4P45 A;  4NGN A;  5LYI A;  1VHO A;  3D7D A;  2CTB A;  1HDU A;  3CDX A;  1ARM A;  2ANP A;  4P10 A;  1HEE A;  1TF8 A;  3B35 A;  2QYV A;  2PRQ A;  3B7I A;  3VH9 A;  1YLO A;  4EWT A;  1CPX A;  2XEF A;  3IO1 A;  1XRY A;  3LWU A;  4NJR A;  4JYW A;  1ZG8 A;  2Q4Z A;  4FAI A;  3CT9 A;  1FT7 A;  1CPS A;  3KQX A;  4A94 A;  1EE3 P;  1DTD A;  3FF3 A;  4NGQ A;  2PJ7 A;  2NSM A;  1YW4 A;  4Z65 A;  2RFH A;  4ZYQ A;  3B3W A;  3SI0 A;  4ZY0 A;  3V38 A;  4OC3 A;  3PBB A;  2PJ8 A;  1FNO A;  3FED A;  1UWY A;  1ELM P;  4OC5 A;  2PJ2 A;  2XEI A;  3I1U A;  2ZEH A;  4H2K A;  1BLL E;  1YSJ A;  4YWY A;  4MCQ A;  4BD9 A;  5LRK A;  1GYT A;  3IEH A;  2ZEP A;  2PJ9 A;  3DLJ A;  3HLP A;  4UEF A;  2HB6 A;  2IJZ A;  3KHX A;  1Z5R A;  4FUU A;  3B3V A;  3B3T A;  4B6Z A;  5D29 A;  3KQZ A;  4PPZ A;  3CPX A;  2V8V A;  2ZEL A;  3PB9 X;  1ZG9 A;  4DYO A;  2PVW A;  2FVG A;  3KAS A;  4P4F A;  3HUV A;  4IAV A;  5DS0 A;  3TC8 A;  3WAB A;  3RBU A;  5LYD A;  4AXV A;  4ZY1 A;  4X8I A;  1LAM A;  1IY7 A;  5J1Q A;  4R8F A;  2ZOG A;  3FEE A;  3V7Z A;  4A37 A;  4DJL A;  1CG2 A;  4WJB A;  2F8H A;  2PE3 A;  4ONW A;  3QNV A;  3SJX A;  2JBK A;  3NH4 A;  1R43 A;  4MMO A;  2PJB A;  4EME A;  1HDQ A;  2NYQ A;  1CX8 A;  2AFM A;  3K9T A;  4PQA A;  3BI0 A;  2V8H A;  4FBE A;  1LAP A;  1YW6 A;  2POK A;  4K3N A;  2DEA A;  4MHY A;  5K8P A;  2PJ5 A;  1LCP A;  4TNU A;  3PRT A;  4MCS A;  4EFD A;  2PVV A;  1TKF A;  2RB7 A;  5HXD A;  1ZLH A;  2F7V A;  3SJE A;  1KWM A;  3IFE A;  4MCP A;  4KSI A;  2AFO A;  5CPA A;  4OC0 A;  2PCU A;  3D7H A;  2J9A A;  1XJO A;  3NFZ A;  4OKO A;  2ZEO A;  2ZEM A;  3LMS A;  4NGP A;  2PJ4 A;  4O23 A;  5JGF A;  4F9V A;  4OP4 A;  3SI1 A;  2PJ6 A;  2GLF A;  1VGY A;  3L2N A;  4UEZ A;  1Y7E A;  4MCR A;  4NGR A;  4X3R A;  4YU9 A;  3WT4 A;  2ZED A;  4MHN A;  2O53 A;  4P4I A;  1AYE A;  2V77 A;  1NSA A;  7CPA A;  2AFU A;  3IJ3 A;  3KHZ A;  1CP6 A;  3NH8 A;  1YME A;  3T8W A;  1F57 A;  2G9D A;  3WC5 A;  4F9U A;  2AFZ A;  3BXM A;  4P44 A;  4ZX8 A;  4R76 A;  2EK8 A;  3SJG A;  4MHP A;  3FVL A;  1PYT B;  2V8D A;  2ZEN A;  3NH5 A;  1Y0R A;  5D8N A;  4CPA A;  4X2T A;  1CBX A;  1XFO A;  2BOA A;  3D68 A;  4P6Y A;  1BPM A;  4ZX9 A;  1ARL A;  2ABZ A;  4P4D A;  2WYR A;  3GUX A;  3GLJ A;  4OID A;  5JH9 A;  3N5F A;  1AMP A;  3KGQ A;  1VIX A;  3GB0 A;  3FH4 A;  3FEC A;  1LOK A;  1LAN A;  3SJF A;  3K2K A;  2GLJ A;  2XEG A;  4ZY2 A;  2VL1 A;  4P4B A;  2CF4 A;  5LRJ A;  4ZI6 A;  2C1C A;  2QVP A;  3D67 A;  3RZA A;  5HVH A;  3D7G A;  1BAV A;  2ZEG A;  3PFO A;  4WWV A;  1XBU A;  1F2P A;  4R7M A;  1R3N A;  3KR5 A;  3H8F A;  1TKJ A;  3PFE A;  4PXB A;  4Q7A A;  1PCA A;  3H8E A;  3IWW A;  5CBM A;  4LQG A;  4MRI A;  3D66 A;  2OOT A;  1TKH A;  3B3C A;  3WC6 A;  4R6T A;  4DUK A;  3TX8 A;  1ELL P;  6CPA A;  1H8L A;  3ISX A;  5LRG A;  2Q51 A;  3CPA A;  5JM6 A;  2C6G A;  2V8G A;  4UIA A;  2PIY A;  3BI1 A;  2ZEF A;  4NGT A;  2GU2 A;  2BCO A;  1QMU A;  2EK9 A;  4UIB A;  1JQG A;  3RAM A;  4OME A;  4OC1 A;  5IB9 A;  1OBR A;  2PJ1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...