1TF9A

Streptomyces griseus aminopeptidase complexed with p-iodo-l-phenylalanine
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
277
structure length
275
Chain Sequence
b'APDIPLANVKAHLTQLSTIAANNGGNRAHGRPGYKASVDYVKAKLDAAGYTTTLQQFTSGGATGYNLIANWPGGDPNKVLMAGAHLDSVSSGAGINDNGSGSAAVLETALAVSRAGYQPDKHLRFAWWGAEELGLIGSKFYVNNLPSADRSKLAGYLNFDMIGSPNPGYFVYDDDPVIEKTFKNYFAGLNVPTEIETEGRSDHAPFKNVGVPVGGLFTGAGYTKSAAQAQKWGGTAGQAFDRCYHSSCDSLSNINDTALDRNSDAAAHAIWTLSS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aminopeptidase
publication title Binding of inhibitory aromatic amino acids to Streptomyces griseus aminopeptidase.
pubmed doi rcsb
molecule tags Hydrolase
total genus 108
structure length 275
sequence length 277
ec nomenclature ec 3.4.11.24: Aminopeptidase S.
pdb deposition date 2004-05-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 1tf9A00
1VIXA 4P6YA 4OC5A 4OC2A 1CPXA 3B3WA 1TF9A 2GREA 4R76A 3SJFA 3IWWA 2XEGA 3KHZA 5K8PA 1XBUA 4OMEA 4A37A 3KHXA 2ZEGA 4TNUA 4EWTA 4OIDA 3WT4A 1LOKA 1TF8A 2J9AA 1TXRA 3TC8A 4ZY0A 2FVGA 3PRTA 3FMCA 4DJLA 4MHZA 2AFZA 3LWUA 4Q7AA 3BI1A 5LYLA 3GB0A 4MCPA 1ARLA 3CPXA 4DYOA 4YU9A 3WABA 2Q43A 2GLFA 4JYWA 2BCOA 3SJEA 3FH4A 1KWMA 2F7VA 4F9VA 2PRQA 3V38A 1Y0RA 3FX6A 2XEIA 2ABZA 3PBEA 2PJ6A 5CPAA 1CX8A 4P4JA 4ONWA 2V8DA 2ZEPA 3KI9A 3KQZA 4MXUA 4OC3A 4ZY1A 4R8FA 3VATA 4NGPA 2CTBA 7CPAA 4A39A 1XFOA 2POKA 5JM6A 3WC5A 2PCUA 2XEFA 5HXDA 3CPAA 2WZNA 2ZEDA 2C6CA 3PB7X 5K8NA 4UEZA 1TKHA 3FEEA 4IAVA 1DE4C 4OIWA 1ELLP 2QJ8A 3D4UA 4FUUA 3KASA 2CTCA 3S9LA 3D7DA 4OC4A 1CP7A 4MCQA 3IIBA 1DTDA 1Z5RA 4UF4A 4CPAA 2PJ5A 5THWA 3KZWA 2HC9A 1F2OA 3JRUA 4MHNA 2Q51A 4OC0A 6CPAA 1LCPA 1LANA 3KQXA 3B2YA 4GM5A 4NGTA 1YW4A 2IQ6A 4NGQA 1CG2A 3S9NA 2PVVA 4NFRA 3WC7A 5LRKA 1LAPA 3ISZA 4X8IA 3MRUA 4PXCA 2PE3A 3FVLA 2AFXA 3D7HA 2ZEFA 1XJOA 2V8HA 4MMOA 3IJ3A 4NGNA 2WYRA 1R43A 3IEHA 3NH4A 1M4LA 1IGBA 3N5FA 1TKFA 2ZELA 5ELYA 4AXVA 5LYFA 1YMEA 1Y0YA 5I4MA 1ZLIA 2EK9A 2V8VA 1FNOA 2PJ8A 3I1UA 4WJBA 2F8HA 1JQGA 2PIZA 4X3RA 1TKJA 3SI2A 3B7IA 3VARA 2ZOGA 3DGVA 2ZOFA 2PJ4A 1Y7EA 1RTQA 4PPZA 2PJBA 3GLJA 3KR5A 2CF4A 2PJCA 2V77A 3TX8A 2C6PA 3KR4A 2AFMA 2IJZA 5LRGA 3WC6A 4UIAA 2O4HA 1PCAA 5K8MA 5K8OA 2NYQA 5LYIA 4ZX8A 3MN8A 2BOAA 1ZG9A 4OC1A 4NGSA 2ZENA 2ZEMA 2QVPA 2JEWA 5F09A 4IK2A 1EE3P 2RFHA 3H8EA 1ARMA 1CPSA 8CPAA 2GLJA 2C6GA 2ZEHA 2PJ0A 1ZG7A 4G1PA 1BLLE 2ZEOA 4F8ZA 3KL9A 3SI1A 4EFDA 4NJQA 1QQ9A 5HVHA 5J1QA 2HB6A 3V7ZA 3ISXA 1NSAA 4P4DA 1H8LA 3FECA 3S9MA 2Q4ZA 4P4EA 4MHPA 1BPNA 2O53A 4B6ZA 2I3CA 4DUKA 3B3CA 4K3NA 3H8FA 4NGMA 3NH5A 3NH8A 3SJXA 4OKOA 4A94A 3PBBA 4H2KA 2PIYA 4UEEA 2AFSA 3B3SA 1IY7A 4P4FA 3HLPA 2PJ1A 2JBKA 3H8GA 1HDUA 4ZY2A 2PJ3A 3HUVA 3NFZA 3VH9A 1Z2LA 2IMOA 1ZG8A 3PB8X 4RUHA 3D7FA 4O23A 3PFEA 1YW6A 1F57A 4X2TA 3QNVA 3B35A 5JH9A 2EWBA 5D29A 5HVGA 1OBRA 2PJAA 1CP6A 1GYTA 3DLJA 4FWUA 3PEIA 2NSMA 3PFOA 3NA6A 1BPMA 1PYTB 2V8GA 1R3NA 5DS0A 4KSIA 1XMBA 4IHMA 1UWYA 4PXEA 4A38A 2DEAA 3KGQA 3IO1A 2JBJA 1XRYA 3FJUA 3BI0A 4MHYA 1QMUA 1YLOA 4PQAA 3D66A 4P10A 3RZAA 2RB7A 3GUXA 4EMEA 3FF3A 1AYEA 3K9TA 3T8WA 1YSJA 3D7GA 4FBEA 4P45A 4W9YA 2AFOA 1Z8LA 3K2KA 2C1CA 2AFWA 4MRIA 3RBUA 3BXMA 3D68A 3PB4X 4YWYA 4UIBA 3CT9A 4LQGA 4TWEA 3B3TA 3PB6X 4R7MA 1VGYA 1AMPA 5D8NA 4P4IA 5JGFA 3SI0A 1ZLHA 4F9UA 2CIJA 3FEDA 4WWVA 2BO9A 2QYVA 2OR4A 1VHOA 3SJGA 2ANPA 4Z65A 4BD9A 1HDQA 5LYDA 4MCSA 1F2PA 2PVWA 4JZ0A 3PB9X 1CBXA 2G9DA 4ZX9A 4P4BA 2VL1A 1FT7A 3IFEA 5LRJA 4ZYQA 4ZI6A 3D67A 4PXBA 2AFUA 2PJ2A 5CBMA 1ELMP 4P44A 2GU2A 1LAMA 1BAVA 3LMSA 4NGRA 3L2NA 4FAIA 2OOTA 1VHEA 4UEFA 2ZEEA 2EK8A 1LFWA 4R6TA 5HVFA 2PJ7A 3IC1A 3B3VA 2PJ9A 5IB9A 3CDXA 1HEEA 3RAMA 3BHXA 1Q7LA 4MCRA 4OP4A 2XEJA 4NJRA 4PXDA
chains in the Genus database with same CATH superfamily
1VIXA 4BBHA 4P6YA 4R87A 1Z4RA 4OC5A 4OC2A 4XNHC 5EMIA 1CPXA 3B3WA 1PUAA 1TF9A 2GREA 3D2MA 4R76A 4R3KA 3SJFA 3IWWA 2ATRA 2XEGA 3FBUA 1I1DA 3KHZA 5K8PA 5KTAA 2B4DA 4A32A 4C2XA 1XBUA 4M6IA 2VQYA 4OMEA 4A37A 3KHXA 4UWJA 2ZEGA 4TNUA 3ZJ0A 4EWTA 4OIDA 1RO5A 2YNCA 4JJXA 3WT4A 1LOKA 4UCNA 1TF8A 2Q0YA 1S5KA 4MFJA 2J9AA 1YREA 2OB0A 4KZTA 4MI4A 1TXRA 2VZYA 2OZUA 1M4IA 2FL4A 4LUAA 3TC8A 3QAHA 2FVGA 3PRTA 4ZY0A 3FMCA 4IUSA 4DJLA 2I79A 4MHZA 2AFZA 1IB1E 4RS2A 3LWUA 2FXFA 1J4JA 2QECA 4GS4A 4H6UA 4YRHA 4Q7AA 3BI1A 4KOWA 1IOIA 4CAEA 3GB0A 4MCPA 5LYLA 1ARLA 3CPXA 4DYOA 4YU9A 1RXTA 2CXAA 3WABA 2Q43A 2GLFA 4JYWA 2FIAA 5G20A 2BCOA 3SJEA 3FH4A 2REFA 3R95A 1UFHA 1KWMA 5HMNA 2F7VA 4R9MA 2PRQA 4F9VA 1YX0A 3V38A 2PDOA 2EO8A 1IICA 4HNWB 3R96A 2PC1A 1Y0RA 3FX6A 2XEIA 1BO4A 3CZXA 2ODFA 4B14A 1Z8WA 3LD2A 2ZW7A 2ABZA 3PBEA 5E96A 3W6XA 2PJ6A 4ZGYB 4KUAA 2PR8A 4KOXA 5CPAA 1CX8A 5J8CA 3FNCA 4E2AA 2JLMA 4P4JA 4ONWA 4A30A 5C88A 3BJ8A 4II9A 2V8DA 2ZEPA 3KI9A 3RYOA 2KCWA 2A4NA 3KQZA 4KLWA 4MXUA 2CNSA 1PU9A 4OC3A 4ZY1A 4R8FA 1WK4A 1QSTA 3VATA 4NGPA 2F5IA 2BEIA 4HNYB 2CTBA 3TO9A 3PP9A 4A39A 4CAVA 7CPAA 3IU1A 1XFOA 4OADA 5AG5A 2POKA 5JM6A 3WC5A 4Q38A 2PCUA 2XEFA 4DNCA 3F5BA 2P6FA 2EBJA 5HXDA 3CPAA 4IF5A 2WZNA 4LX9A 2ZEDA 2Z3MA 2C6CA 3PB7X 4C2YA 4KVME 4CAXA 4KVOE 5K8NA 2Q04A 2B3VA 4H6ZA 1IIDA 4UEZA 2Z3PA 3DSBA 3TO6A 1TKHA 2FS5A 2J8RA 2R98A 4YFJA 2PR1A 5IX3A 2EUIA 2Q7SA 3FEEA 4IAVA 2R8VA 1K4JA 1S7NA 4MFLA 4BINA 1DE4C 4OIWA 1ELLP 2QJ8A 3D4UA 4KOSA 4AG9A 4FUUA 4PV6A 3KASA 2CTCA 2REEA 1MJ9A 4MBUA 3D7DA 3S9LA 4OC4A 1CP7A 4MCQA 3IIBA 1IU8A 1DTDA 1Z5RA 3R9GA 4UF4A 3CXQA 4CPAA 4CRYB 2PJ5A 4E0AA 5THWA 3KZWA 2HC9A 4QUSA 2CY2A 1F2OA 2FT0A 3JRUA 2Q51A 3K9UA 4MHNA 2HUZA 3N7ZA 4LQ6A 1P0HA 4OC0A 6CPAA 4A33A 1LCPA 2BSWA 5G21A 1S7KA 5HH1A 3T9YA 1LANA 3KQXA 3B2YA 1QSRA 4GM5A 4NGTA 4MFKA 3GY9A 1YW4A 2IQ6A 3TE4A 4PSWA 4NSQA 4NGQA 1CG2A 3S9NA 2G3TA 2PVVA 4KLVA 1NE9A 4NFRA 3SXOA 4B10A 4U5YA 3EC4A 3B8GA 4AVAA 5H86A 2FSRA 3WC7A 4F0YA 5LRKA 1LAPA 2H5MA 1AUGA 3ISZA 4B11A 3FYNA 3D8PA 1S60A 4ZBGA 2NMTA 3BJ7A 4X8IA 3MRUA 4PXCA 2PE3A 3FVLA 2AFXA 2VZZA 2Z11A 3D7HA 2ZEFA 1XJOA 2V8HA 4CGLA 1YR0A 2Y0MA 4MMOA 3IJ3A 4NGNA 1S7FA 1Z9UA 2WYRA 4KUBA 2ZW6A 5F47A 1R43A 1X12A 3IWGA 4F0XA 5KTDA 2QIRA 2Z0ZA 3FIXA 2YGWA 3IEHA 5A28A 3NH4A 1M4LA 1IGBA 1FY7A 3JUWA 4UA3A 2B4BA 1TKFA 2P6EA 2ZELA 3N5FA 5ELYA 1MJAA 4AXVA 2CNTA 5LYFA 1YMEA 1Y0YA 5I4MA 4F6AA 3LACA 4MFQA 1MK4A 1YLEA 3MGDA 4OLLA 2FCKA 1ZLIA 2EK9A 3G8WA 1WWZA 1FNOA 2PJ8A 2V8VA 3I1UA 4WJBA 2WSAA 4J3GA 1OZPA 2B4DB 2F8HA 1JQGA 2PIZA 3IGRA 4QB9A 4RN7A 4X3RA 1TKJA 3TTHA 3SI2A 3C26A 2WPWA 4XPKA 1XOVA 3B7IA 5JQ4A 3VARA 4QBJA 3TFYA 2ZOGA 4A31A 3DGVA 3FRMA 2ZOFA 2PJ4A 1Y7EA 1RTQA 2FIWA 1JWQA 4PPZA 4CYQA 2BUEA 2PJBA 3GLJA 3KR5A 2CF4A 2PJCA 2V77A 3EO4A 2Z3OA 4JD6A 3TO7A 3TX8A 4E8OA 2C6PA 3KR4A 4NXYA 3DDDA 4R3LA 4KS9A 2AFMA 4GXHA 2YNCC 4BMHA 2WPXA 2IJZA 5LRGA 3WC6A 4UIAA 4PK2A 1N71A 1GHEA 2O4HA 4PSXA 1PCAA 5K8MA 5K8OA 5F49A 2NYQA 5LYIA 4ZX8A 1YVKA 3I3GA 3MN8A 2BOAA 1ZG9A 3D2PA 4NEXA 4NGSA 4OC1A 2ZENA 2ZEMA 2QVPA 2JEWA 3D3SA 4UFWA 4C68A 5F09A 2B5GA 1Y7RA 1Z8XA 5DWMA 1VKCA 5G22A 3TCVA 4IK2A 1EE3P 2DXQA 2RFHA 3H8EA 1ARMA 3OWCA 1CPSA 8CPAA 2GLJA 4QVTA 5IV0A 2DPTA 2C6GA 2ZEHA 2PJ0A 3PGPA 1ZG7A 3PZJA 4JWPA 1B6BA 1BLLE 4G1PA 2ZEOA 4F8ZA 1M44A 3KL9A 2ZXVA 3SI1A 4AG7A 1X10A 4UFXA 3CXPA 4CAWA 4EFDA 1Q2CA 1Y9WA 4NJQA 2I00A 1XMTA 1QQ9A 1YQEA 1U6MA 5HVHA 1S3ZA 3VWEA 2HB6A 5J1QA 3V7ZA 3ISXA 1NSAA 4P4DA 3SXNA 1H8LA 2Z10A 3FECA 3S9MA 5IB0A 2GFQA 2Q4ZA 3NE8A 5EBVA 3W91A 2O28A 4M3SA 4KSAA 4CYPA 2Z3LA 4JXQA 4P4EA 2VBQA 4MHPA 4Q36A 3V8IA 1BPNA 2GANA 2O53A 1MJBA 4B6ZA 2I3CA 3NE7A 4MY3A 4I49A 5EC4A 4AVBA 4MY0A 4DUKA 2Q4YA 4L8AA 2PSWA 3B3CA 3GKRA 5ISVA 5JPHA 4K3NA 3QB8A 3H8FA 1Z4EA 4M85A 4EVYA 4NGMA 3NH5A 4B5PA 3NH8A 3SJXA 4OKOA 1ZO0A 3G3SA 4HPSA 4A94A 3PBBA 4H2KA 2AE6A 2PIYA 4UEEA 3R9EA 1XE4A 2AFSA 4CAFA 3B3SA 1IY7A 4P4FA 4A95A 5AG7A 4CGOA 5GCNA 3HLPA 2PJ1A 1XIXA 5DWNA 3S6GA 2JBKA 4A2ZA 3DNSA 1A2ZA 2PQ8A 4UFVA 3H8GA 1HDUA 3KKWA 4X5KA 1KUVA 2Z3KA 1Y9KA 1B87A 2JDCA 4ZY2A 2PJ3A 3HUVA 3NFZA 1YVOA 3VH9A 4KSFA 2R7HA 4B12A 5H84A 2OZHA 4M6GA 1Z2LA 3RO0A 2ARHA 2IMOA 1ZG8A 3PB8X 4RUHA 3D7FA 4O23A 3PFEA 1YW6A 1F57A 2CNMA 1QSNA 3DR6A 3B35A 3QNVA 4FD5A 4X2TA 1Q2YA 1V0CA 3P2HA 4B5PB 5JH9A 2EWBA 5D29A 1M4DA 5HVGA 1IYKA 1OBRA 2PJAA 3H5ZA 5F46A 3I9SA 1CP6A 1Q2DA 1GYTA 3DLJA 4FWUA 2VXKA 3PEIA 4KOYA 4ORFA 2NSMA 3R9FA 3PFOA 2K5TA 3NA6A 1L0CA 1P4NA 2EVNA 3LODA 1BPMA 1PYTB 4FD7A 4M6HA 1M4GA 4PK3A 3E0KA 2V8GA 1KUYA 2DF5A 4NF1A 1R3NA 5DS0A 1I12A 2J8MA 4C7IA 3S6KA 1IOFA 1XMBA 2HQYA 2YNEA 4KSIA 2ZPAA 4IHMA 4UCMA 5AG6A 5J8FA 2HV2A 4JLYA 1IYLA 1CM0A 1UWYA 4MFPA 4NCZA 4PXEA 4A38A 3IWEA 2DEAA 3KGQA 4KOTA 2IL4A 3IO1A 2JBJA 1LRZA 1XRYA 3FJUA 3BI0A 3GYAA 4MHDA 2X7BA 1QMUA 1YLOA 3EY5A 4MHYA 4PQAA 2P0WA 3R1KA 3D66A 2J8NA 4P10A 1QSMA 3RZAA 2RB7A 1KUXA 2VI7A 3FF3A 3GUXA 4EMEA 1AYEA 1NMTA 4RI1A 1SQHA 3K9TA 2D4OA 4FD6A 3T8WA 3GIUA 1XF8A 1YSJA 1S7LA 3D7GA 4FBEA 4P45A 4W9YA 2AFOA 3JTKA 5A27A 1Z8LA 3S6HA 1BOBA 2P6GA 2C1CA 2GIVA 2AFWA 3FXTA 3K2KA 4MJ8A 3RNZA 4MRIA 5AG4A 2VEZA 4CGMA 3RBUA 5C82A 3BXMA 3D68A 3PB4X 4YWYA 4UIBA 2DPSA 3CT9A 4LQGA 3EXNA 4CGPA 4TWEA 2B3UA 3H4QA 4KORA 3B3TA 3PB6X 4R7MA 1VGYA 1AMPA 5D8NA 1Z8TA 4P4IA 2R1IA 5JGFA 2WUUA 3CXSA 4XPDB 1I21A 3JVNA 4K30A 3SI0A 3BLNA 1ZLHA 4F9UA 5G1ZA 3W6SA 2C27A 2CIJA 3F8KA 3FEDA 4WWVA 3VWDA 2BO9A 3UY5A 4FD4A 4Y49B 2Z3NA 2QYVA 2OR4A 3QAYA 4KOUA 4B13A 1VHOA 3SJGA 2ANPA 4HNXB 4C2ZA 3TOBA 4BD9A 4Z65A 2D4PA 3IU2A 1HDQA 2ZW5A 5LYDA 2OH1A 4U9YA 1VHSA 2BL1A 3S6FA 4MCSA 1F2PA 2PVWA 4JZ0A 5AGEA 3PB9X 3TOAA 4CYOA 1CBXA 4KOVA 2G9DA 4ZX9A 4P4BA 2VL1A 1FT7A 3IFEA 4JXRA 4XPDC 5LRJA 4ZYQA 5KTCA 2B5GB 4ZI6A 2B58A 4L89A 4R57A 3D67A 3DR8A 4U9ZA 4CGNA 4PXBA 2OZGA 4OAEA 4AB7A 2AFUA 1R57A 4MFZA 1YGHA 3SHPA 3WR7A 4UCPA 3ZZIA 2AJ6A 2JEVA 2PJ2A 2Q4VA 2YNDA 3P2FA 5CBMA 1ELMP 1XEBA 4P44A 1QSOA 3F0AA 4Y49C 2GU2A 4CYNA 1LAMA 1BAVA 3LMSA 4NGRA 2JDDA 3L2NA 5F48A 2OOTA 1VHEA 4C7HA 4FAIA 3FB3A 1YK3A 4UEFA 2ZEEA 2EK8A 3TT2A 4KVXA 2OU2A 2QMLA 4YGOA 4AVCA 4XNHB 1LFWA 2RC4A 4R6TA 1TIQA 2GE3A 3T90A 3EFAA 5HVFA 1M1DA 2PRBA 2Q7BA 5FVJA 2PJ7A 2G3AA 3IC1A 1NSLA 3B3VA 2G0BA 1CJWA 2PJ9A 4UBRA 5CNPA 4B5OA 3A9LA 1ON0A 3CDXA 1HEEA 1KZFA 5I0CA 5BWAB 5IB9A 4H89A 2ZW4A 4UWIA 3RAMA 3BHXA 4HKFA 1Q7LA 4MCRA 4OP4A 4ONUA 2XEJA 4XPLA 2FE7A 4NJRA 4PXDA 4CRZB 2Q44A 4CS0B 4QC6A
chains in the Genus database with same CATH topology
1VIXA 4P6YA 4OC5A 4OC2A 1CPXA 3B3WA 1TF9A 2GREA 4R76A 3SJFA 3IWWA 2XEGA 3KHZA 5K8PA 1XBUA 4OMEA 4A37A 3KHXA 2ZEGA 4TNUA 4EWTA 4OIDA 3WT4A 1LOKA 1TF8A 2J9AA 1TXRA 3TC8A 4ZY0A 2FVGA 3PRTA 3FMCA 4DJLA 4MHZA 2AFZA 3LWUA 4Q7AA 3BI1A 5LYLA 3GB0A 4MCPA 1ARLA 3CPXA 4DYOA 4YU9A 3WABA 2Q43A 2GLFA 4JYWA 2BCOA 3SJEA 3FH4A 1KWMA 2F7VA 4F9VA 2PRQA 3V38A 1Y0RA 3FX6A 2XEIA 2ABZA 3PBEA 2PJ6A 5CPAA 1CX8A 4P4JA 4ONWA 2V8DA 2ZEPA 3KI9A 3KQZA 4MXUA 4OC3A 4ZY1A 4R8FA 3VATA 4NGPA 2CTBA 7CPAA 4A39A 1XFOA 2POKA 5JM6A 3WC5A 2PCUA 2XEFA 5HXDA 3CPAA 2WZNA 2ZEDA 2C6CA 3PB7X 5K8NA 4UEZA 1TKHA 3FEEA 4IAVA 1DE4C 4OIWA 1ELLP 2QJ8A 3D4UA 4FUUA 3KASA 2CTCA 3S9LA 3D7DA 4OC4A 1CP7A 4MCQA 3IIBA 1DTDA 1Z5RA 4UF4A 4CPAA 2PJ5A 5THWA 3KZWA 2HC9A 1F2OA 3JRUA 4MHNA 2Q51A 4OC0A 6CPAA 1LCPA 1LANA 3KQXA 3B2YA 4GM5A 4NGTA 1YW4A 2IQ6A 4NGQA 1CG2A 3S9NA 2PVVA 4NFRA 3WC7A 5LRKA 1LAPA 3ISZA 4X8IA 3MRUA 4PXCA 2PE3A 3FVLA 2AFXA 3D7HA 2ZEFA 1XJOA 2V8HA 4MMOA 3IJ3A 4NGNA 2WYRA 1R43A 3IEHA 3NH4A 1M4LA 1IGBA 3N5FA 1TKFA 2ZELA 5ELYA 4AXVA 5LYFA 1YMEA 1Y0YA 5I4MA 1ZLIA 2EK9A 2V8VA 1FNOA 2PJ8A 3I1UA 4WJBA 2F8HA 1JQGA 2PIZA 4X3RA 1TKJA 3SI2A 3B7IA 3VARA 2ZOGA 3DGVA 2ZOFA 2PJ4A 1Y7EA 1RTQA 4PPZA 2PJBA 3GLJA 3KR5A 2CF4A 2PJCA 2V77A 3TX8A 2C6PA 3KR4A 2AFMA 2IJZA 5LRGA 3WC6A 4UIAA 2O4HA 1PCAA 5K8MA 5K8OA 2NYQA 5LYIA 4ZX8A 3MN8A 2BOAA 1ZG9A 4OC1A 4NGSA 2ZENA 2ZEMA 2QVPA 2JEWA 5F09A 4IK2A 1EE3P 2RFHA 3H8EA 1ARMA 1CPSA 8CPAA 2GLJA 2C6GA 2ZEHA 2PJ0A 1ZG7A 4G1PA 1BLLE 2ZEOA 4F8ZA 3KL9A 3SI1A 4EFDA 4NJQA 1QQ9A 5HVHA 5J1QA 2HB6A 3V7ZA 3ISXA 1NSAA 4P4DA 1H8LA 3FECA 3S9MA 2Q4ZA 4P4EA 4MHPA 1BPNA 2O53A 4B6ZA 2I3CA 4DUKA 3B3CA 4K3NA 3H8FA 4NGMA 3NH5A 3NH8A 3SJXA 4OKOA 4A94A 3PBBA 4H2KA 2PIYA 4UEEA 2AFSA 3B3SA 1IY7A 4P4FA 3HLPA 2PJ1A 2JBKA 3H8GA 1HDUA 4ZY2A 2PJ3A 3HUVA 3NFZA 3VH9A 1Z2LA 2IMOA 1ZG8A 3PB8X 4RUHA 3D7FA 4O23A 3PFEA 1YW6A 1F57A 4X2TA 3QNVA 3B35A 5JH9A 2EWBA 5D29A 5HVGA 1OBRA 2PJAA 1CP6A 1GYTA 3DLJA 4FWUA 3PEIA 2NSMA 3PFOA 3NA6A 1BPMA 1PYTB 2V8GA 1R3NA 5DS0A 4KSIA 1XMBA 4IHMA 1UWYA 4PXEA 4A38A 2DEAA 3KGQA 3IO1A 2JBJA 1XRYA 3FJUA 3BI0A 4MHYA 1QMUA 1YLOA 4PQAA 3D66A 4P10A 3RZAA 2RB7A 3GUXA 4EMEA 3FF3A 1AYEA 3K9TA 3T8WA 1YSJA 3D7GA 4FBEA 4P45A 4W9YA 2AFOA 1Z8LA 3K2KA 2C1CA 2AFWA 4MRIA 3RBUA 3BXMA 3D68A 3PB4X 4YWYA 4UIBA 3CT9A 4LQGA 4TWEA 3B3TA 3PB6X 4R7MA 1VGYA 1AMPA 5D8NA 4P4IA 5JGFA 3SI0A 1ZLHA 4F9UA 2CIJA 3FEDA 4WWVA 2BO9A 2QYVA 2OR4A 1VHOA 3SJGA 2ANPA 4Z65A 4BD9A 1HDQA 5LYDA 4MCSA 1F2PA 2PVWA 4JZ0A 3PB9X 1CBXA 2G9DA 4ZX9A 4P4BA 2VL1A 1FT7A 3IFEA 5LRJA 4ZYQA 4ZI6A 3D67A 4PXBA 2AFUA 2PJ2A 5CBMA 1ELMP 4P44A 2GU2A 1LAMA 1BAVA 3LMSA 4NGRA 3L2NA 4FAIA 2OOTA 1VHEA 4UEFA 2ZEEA 2EK8A 1LFWA 4R6TA 5HVFA 2PJ7A 3IC1A 3B3VA 2PJ9A 5IB9A 3CDXA 1HEEA 3RAMA 3BHXA 1Q7LA 4MCRA 4OP4A 2XEJA 4NJRA 4PXDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VIX A;  4P6Y A;  4OC5 A;  4OC2 A;  1CPX A;  3B3W A;  1TF9 A;  2GRE A;  4R76 A;  3SJF A;  3IWW A;  2XEG A;  3KHZ A;  5K8P A;  1XBU A;  4OME A;  4A37 A;  3KHX A;  2ZEG A;  4TNU A;  4EWT A;  4OID A;  3WT4 A;  1LOK A;  1TF8 A;  2J9A A;  1TXR A;  3TC8 A;  4ZY0 A;  2FVG A;  3PRT A;  3FMC A;  4DJL A;  4MHZ A;  2AFZ A;  3LWU A;  4Q7A A;  3BI1 A;  5LYL A;  3GB0 A;  4MCP A;  1ARL A;  3CPX A;  4DYO A;  4YU9 A;  3WAB A;  2Q43 A;  2GLF A;  4JYW A;  2BCO A;  3SJE A;  3FH4 A;  1KWM A;  2F7V A;  4F9V A;  2PRQ A;  3V38 A;  1Y0R A;  3FX6 A;  2XEI A;  2ABZ A;  3PBE A;  2PJ6 A;  5CPA A;  1CX8 A;  4P4J A;  4ONW A;  2V8D A;  2ZEP A;  3KI9 A;  3KQZ A;  4MXU A;  4OC3 A;  4ZY1 A;  4R8F A;  3VAT A;  4NGP A;  2CTB A;  7CPA A;  4A39 A;  1XFO A;  2POK A;  5JM6 A;  3WC5 A;  2PCU A;  2XEF A;  5HXD A;  3CPA A;  2WZN A;  2ZED A;  2C6C A;  3PB7 X;  5K8N A;  4UEZ A;  1TKH A;  3FEE A;  4IAV A;  1DE4 C;  4OIW A;  1ELL P;  2QJ8 A;  3D4U A;  4FUU A;  3KAS A;  2CTC A;  3S9L A;  3D7D A;  4OC4 A;  1CP7 A;  4MCQ A;  3IIB A;  1DTD A;  1Z5R A;  4UF4 A;  4CPA A;  2PJ5 A;  5THW A;  3KZW A;  2HC9 A;  1F2O A;  3JRU A;  4MHN A;  2Q51 A;  4OC0 A;  6CPA A;  1LCP A;  1LAN A;  3KQX A;  3B2Y A;  4GM5 A;  4NGT A;  1YW4 A;  2IQ6 A;  4NGQ A;  1CG2 A;  3S9N A;  2PVV A;  4NFR A;  3WC7 A;  5LRK A;  1LAP A;  3ISZ A;  4X8I A;  3MRU A;  4PXC A;  2PE3 A;  3FVL A;  2AFX A;  3D7H A;  2ZEF A;  1XJO A;  2V8H A;  4MMO A;  3IJ3 A;  4NGN A;  2WYR A;  1R43 A;  3IEH A;  3NH4 A;  1M4L A;  1IGB A;  3N5F A;  1TKF A;  2ZEL A;  5ELY A;  4AXV A;  5LYF A;  1YME A;  1Y0Y A;  5I4M A;  1ZLI A;  2EK9 A;  2V8V A;  1FNO A;  2PJ8 A;  3I1U A;  4WJB A;  2F8H A;  1JQG A;  2PIZ A;  4X3R A;  1TKJ A;  3SI2 A;  3B7I A;  3VAR A;  2ZOG A;  3DGV A;  2ZOF A;  2PJ4 A;  1Y7E A;  1RTQ A;  4PPZ A;  2PJB A;  3GLJ A;  3KR5 A;  2CF4 A;  2PJC A;  2V77 A;  3TX8 A;  2C6P A;  3KR4 A;  2AFM A;  2IJZ A;  5LRG A;  3WC6 A;  4UIA A;  2O4H A;  1PCA A;  5K8M A;  5K8O A;  2NYQ A;  5LYI A;  4ZX8 A;  3MN8 A;  2BOA A;  1ZG9 A;  4OC1 A;  4NGS A;  2ZEN A;  2ZEM A;  2QVP A;  2JEW A;  5F09 A;  4IK2 A;  1EE3 P;  2RFH A;  3H8E A;  1ARM A;  1CPS A;  8CPA A;  2GLJ A;  2C6G A;  2ZEH A;  2PJ0 A;  1ZG7 A;  4G1P A;  1BLL E;  2ZEO A;  4F8Z A;  3KL9 A;  3SI1 A;  4EFD A;  4NJQ A;  1QQ9 A;  5HVH A;  5J1Q A;  2HB6 A;  3V7Z A;  3ISX A;  1NSA A;  4P4D A;  1H8L A;  3FEC A;  3S9M A;  2Q4Z A;  4P4E A;  4MHP A;  1BPN A;  2O53 A;  4B6Z A;  2I3C A;  4DUK A;  3B3C A;  4K3N A;  3H8F A;  4NGM A;  3NH5 A;  3NH8 A;  3SJX A;  4OKO A;  4A94 A;  3PBB A;  4H2K A;  2PIY A;  4UEE A;  2AFS A;  3B3S A;  1IY7 A;  4P4F A;  3HLP A;  2PJ1 A;  2JBK A;  3H8G A;  1HDU A;  4ZY2 A;  2PJ3 A;  3HUV A;  3NFZ A;  3VH9 A;  1Z2L A;  2IMO A;  1ZG8 A;  3PB8 X;  4RUH A;  3D7F A;  4O23 A;  3PFE A;  1YW6 A;  1F57 A;  4X2T A;  3QNV A;  3B35 A;  5JH9 A;  2EWB A;  5D29 A;  5HVG A;  1OBR A;  2PJA A;  1CP6 A;  1GYT A;  3DLJ A;  4FWU A;  3PEI A;  2NSM A;  3PFO A;  3NA6 A;  1BPM A;  1PYT B;  2V8G A;  1R3N A;  5DS0 A;  4KSI A;  1XMB A;  4IHM A;  1UWY A;  4PXE A;  4A38 A;  2DEA A;  3KGQ A;  3IO1 A;  2JBJ A;  1XRY A;  3FJU A;  3BI0 A;  4MHY A;  1QMU A;  1YLO A;  4PQA A;  3D66 A;  4P10 A;  3RZA A;  2RB7 A;  3GUX A;  4EME A;  3FF3 A;  1AYE A;  3K9T A;  3T8W A;  1YSJ A;  3D7G A;  4FBE A;  4P45 A;  4W9Y A;  2AFO A;  1Z8L A;  3K2K A;  2C1C A;  2AFW A;  4MRI A;  3RBU A;  3BXM A;  3D68 A;  3PB4 X;  4YWY A;  4UIB A;  3CT9 A;  4LQG A;  4TWE A;  3B3T A;  3PB6 X;  4R7M A;  1VGY A;  1AMP A;  5D8N A;  4P4I A;  5JGF A;  3SI0 A;  1ZLH A;  4F9U A;  2CIJ A;  3FED A;  4WWV A;  2BO9 A;  2QYV A;  2OR4 A;  1VHO A;  3SJG A;  2ANP A;  4Z65 A;  4BD9 A;  1HDQ A;  5LYD A;  4MCS A;  1F2P A;  2PVW A;  4JZ0 A;  3PB9 X;  1CBX A;  2G9D A;  4ZX9 A;  4P4B A;  2VL1 A;  1FT7 A;  3IFE A;  5LRJ A;  4ZYQ A;  4ZI6 A;  3D67 A;  4PXB A;  2AFU A;  2PJ2 A;  5CBM A;  1ELM P;  4P44 A;  2GU2 A;  1LAM A;  1BAV A;  3LMS A;  4NGR A;  3L2N A;  4FAI A;  2OOT A;  1VHE A;  4UEF A;  2ZEE A;  2EK8 A;  1LFW A;  4R6T A;  5HVF A;  2PJ7 A;  3IC1 A;  3B3V A;  2PJ9 A;  5IB9 A;  3CDX A;  1HEE A;  3RAM A;  3BHX A;  1Q7L A;  4MCR A;  4OP4 A;  2XEJ A;  4NJR A;  4PXD A; 
#chains in the Genus database with same CATH topology
 1VIX A;  4BBH A;  4P6Y A;  4R87 A;  1Z4R A;  4OC5 A;  4OC2 A;  4XNH C;  5EMI A;  1CPX A;  3B3W A;  1PUA A;  1TF9 A;  2GRE A;  3D2M A;  4R76 A;  4R3K A;  3SJF A;  3IWW A;  2ATR A;  2XEG A;  3FBU A;  1I1D A;  3KHZ A;  5K8P A;  5KTA A;  2B4D A;  4A32 A;  4C2X A;  1XBU A;  4M6I A;  2VQY A;  4OME A;  4A37 A;  3KHX A;  4UWJ A;  2ZEG A;  4TNU A;  3ZJ0 A;  4EWT A;  4OID A;  1RO5 A;  2YNC A;  4JJX A;  3WT4 A;  1LOK A;  4UCN A;  1TF8 A;  2Q0Y A;  1S5K A;  4MFJ A;  2J9A A;  1YRE A;  2OB0 A;  4KZT A;  4MI4 A;  1TXR A;  2VZY A;  2OZU A;  1M4I A;  2FL4 A;  4LUA A;  3TC8 A;  3QAH A;  2FVG A;  3PRT A;  4ZY0 A;  3FMC A;  4IUS A;  4DJL A;  2I79 A;  4MHZ A;  2AFZ A;  1IB1 E;  4RS2 A;  3LWU A;  2FXF A;  1J4J A;  2QEC A;  4GS4 A;  4H6U A;  4YRH A;  4Q7A A;  3BI1 A;  4KOW A;  1IOI A;  4CAE A;  3GB0 A;  4MCP A;  5LYL A;  1ARL A;  3CPX A;  4DYO A;  4YU9 A;  1RXT A;  2CXA A;  3WAB A;  2Q43 A;  2GLF A;  4JYW A;  2FIA A;  5G20 A;  2BCO A;  3SJE A;  3FH4 A;  2REF A;  3R95 A;  1UFH A;  1KWM A;  5HMN A;  2F7V A;  4R9M A;  2PRQ A;  4F9V A;  1YX0 A;  3V38 A;  2PDO A;  2EO8 A;  1IIC A;  4HNW B;  3R96 A;  2PC1 A;  1Y0R A;  3FX6 A;  2XEI A;  1BO4 A;  3CZX A;  2ODF A;  4B14 A;  1Z8W A;  3LD2 A;  2ZW7 A;  2ABZ A;  3PBE A;  5E96 A;  3W6X A;  2PJ6 A;  4ZGY B;  4KUA A;  2PR8 A;  4KOX A;  5CPA A;  1CX8 A;  5J8C A;  3FNC A;  4E2A A;  2JLM A;  4P4J A;  4ONW A;  4A30 A;  5C88 A;  3BJ8 A;  4II9 A;  2V8D A;  2ZEP A;  3KI9 A;  3RYO A;  2KCW A;  2A4N A;  3KQZ A;  4KLW A;  4MXU A;  2CNS A;  1PU9 A;  4OC3 A;  4ZY1 A;  4R8F A;  1WK4 A;  1QST A;  3VAT A;  4NGP A;  2F5I A;  2BEI A;  4HNY B;  2CTB A;  3TO9 A;  3PP9 A;  4A39 A;  4CAV A;  7CPA A;  3IU1 A;  1XFO A;  4OAD A;  5AG5 A;  2POK A;  5JM6 A;  3WC5 A;  4Q38 A;  2PCU A;  2XEF A;  4DNC A;  3F5B A;  2P6F A;  2EBJ A;  5HXD A;  3CPA A;  4IF5 A;  2WZN A;  4LX9 A;  2ZED A;  2Z3M A;  2C6C A;  3PB7 X;  4C2Y A;  4KVM E;  4CAX A;  4KVO E;  5K8N A;  2Q04 A;  2B3V A;  4H6Z A;  1IID A;  4UEZ A;  2Z3P A;  3DSB A;  3TO6 A;  1TKH A;  2FS5 A;  2J8R A;  2R98 A;  4YFJ A;  2PR1 A;  5IX3 A;  2EUI A;  2Q7S A;  3FEE A;  4IAV A;  2R8V A;  1K4J A;  1S7N A;  4MFL A;  4BIN A;  1DE4 C;  4OIW A;  1ELL P;  2QJ8 A;  3D4U A;  4KOS A;  4AG9 A;  4FUU A;  4PV6 A;  3KAS A;  2CTC A;  2REE A;  1MJ9 A;  4MBU A;  3D7D A;  3S9L A;  4OC4 A;  1CP7 A;  4MCQ A;  3IIB A;  1IU8 A;  1DTD A;  1Z5R A;  3R9G A;  4UF4 A;  3CXQ A;  4CPA A;  4CRY B;  2PJ5 A;  4E0A A;  5THW A;  3KZW A;  2HC9 A;  4QUS A;  2CY2 A;  1F2O A;  2FT0 A;  3JRU A;  2Q51 A;  3K9U A;  4MHN A;  2HUZ A;  3N7Z A;  4LQ6 A;  1P0H A;  4OC0 A;  6CPA A;  4A33 A;  1LCP A;  2BSW A;  5G21 A;  1S7K A;  5HH1 A;  3T9Y A;  1LAN A;  3KQX A;  3B2Y A;  1QSR A;  4GM5 A;  4NGT A;  4MFK A;  3GY9 A;  1YW4 A;  2IQ6 A;  3TE4 A;  4PSW A;  4NSQ A;  4NGQ A;  1CG2 A;  3S9N A;  2G3T A;  2PVV A;  4KLV A;  1NE9 A;  4NFR A;  3SXO A;  4B10 A;  4U5Y A;  3EC4 A;  3B8G A;  4AVA A;  5H86 A;  2FSR A;  3WC7 A;  4F0Y A;  5LRK A;  1LAP A;  2H5M A;  1AUG A;  3ISZ A;  4B11 A;  3FYN A;  3D8P A;  1S60 A;  4ZBG A;  2NMT A;  3BJ7 A;  4X8I A;  3MRU A;  4PXC A;  2PE3 A;  3FVL A;  2AFX A;  2VZZ A;  2Z11 A;  3D7H A;  2ZEF A;  1XJO A;  2V8H A;  4CGL A;  1YR0 A;  2Y0M A;  4MMO A;  3IJ3 A;  4NGN A;  1S7F A;  1Z9U A;  2WYR A;  4KUB A;  2ZW6 A;  5F47 A;  1R43 A;  1X12 A;  3IWG A;  4F0X A;  5KTD A;  2QIR A;  2Z0Z A;  3FIX A;  2YGW A;  3IEH A;  5A28 A;  3NH4 A;  1M4L A;  1IGB A;  1FY7 A;  3JUW A;  4UA3 A;  2B4B A;  1TKF A;  2P6E A;  2ZEL A;  3N5F A;  5ELY A;  1MJA A;  4AXV A;  2CNT A;  5LYF A;  1YME A;  1Y0Y A;  5I4M A;  4F6A A;  3LAC A;  4MFQ A;  1MK4 A;  1YLE A;  3MGD A;  4OLL A;  2FCK A;  1ZLI A;  2EK9 A;  3G8W A;  1WWZ A;  1FNO A;  2PJ8 A;  2V8V A;  3I1U A;  4WJB A;  2WSA A;  4J3G A;  1OZP A;  2B4D B;  2F8H A;  1JQG A;  2PIZ A;  3IGR A;  4QB9 A;  4RN7 A;  4X3R A;  1TKJ A;  3TTH A;  3SI2 A;  3C26 A;  2WPW A;  4XPK A;  1XOV A;  3B7I A;  5JQ4 A;  3VAR A;  4QBJ A;  3TFY A;  2ZOG A;  4A31 A;  3DGV A;  3FRM A;  2ZOF A;  2PJ4 A;  1Y7E A;  1RTQ A;  2FIW A;  1JWQ A;  4PPZ A;  4CYQ A;  2BUE A;  2PJB A;  3GLJ A;  3KR5 A;  2CF4 A;  2PJC A;  2V77 A;  3EO4 A;  2Z3O A;  4JD6 A;  3TO7 A;  3TX8 A;  4E8O A;  2C6P A;  3KR4 A;  4NXY A;  3DDD A;  4R3L A;  4KS9 A;  2AFM A;  4GXH A;  2YNC C;  4BMH A;  2WPX A;  2IJZ A;  5LRG A;  3WC6 A;  4UIA A;  4PK2 A;  1N71 A;  1GHE A;  2O4H A;  4PSX A;  1PCA A;  5K8M A;  5K8O A;  5F49 A;  2NYQ A;  5LYI A;  4ZX8 A;  1YVK A;  3I3G A;  3MN8 A;  2BOA A;  1ZG9 A;  3D2P A;  4NEX A;  4NGS A;  4OC1 A;  2ZEN A;  2ZEM A;  2QVP A;  2JEW A;  3D3S A;  4UFW A;  4C68 A;  5F09 A;  2B5G A;  1Y7R A;  1Z8X A;  5DWM A;  1VKC A;  5G22 A;  3TCV A;  4IK2 A;  1EE3 P;  2DXQ A;  2RFH A;  3H8E A;  1ARM A;  3OWC A;  1CPS A;  8CPA A;  2GLJ A;  4QVT A;  5IV0 A;  2DPT A;  2C6G A;  2ZEH A;  2PJ0 A;  3PGP A;  1ZG7 A;  3PZJ A;  4JWP A;  1B6B A;  1BLL E;  4G1P A;  2ZEO A;  4F8Z A;  1M44 A;  3KL9 A;  2ZXV A;  3SI1 A;  4AG7 A;  1X10 A;  4UFX A;  3CXP A;  4CAW A;  4EFD A;  1Q2C A;  1Y9W A;  4NJQ A;  2I00 A;  1XMT A;  1QQ9 A;  1YQE A;  1U6M A;  5HVH A;  1S3Z A;  3VWE A;  2HB6 A;  5J1Q A;  3V7Z A;  3ISX A;  1NSA A;  4P4D A;  3SXN A;  1H8L A;  2Z10 A;  3FEC A;  3S9M A;  5IB0 A;  2GFQ A;  2Q4Z A;  3NE8 A;  5EBV A;  3W91 A;  2O28 A;  4M3S A;  4KSA A;  4CYP A;  2Z3L A;  4JXQ A;  4P4E A;  2VBQ A;  4MHP A;  4Q36 A;  3V8I A;  1BPN A;  2GAN A;  2O53 A;  1MJB A;  4B6Z A;  2I3C A;  3NE7 A;  4MY3 A;  4I49 A;  5EC4 A;  4AVB A;  4MY0 A;  4DUK A;  2Q4Y A;  4L8A A;  2PSW A;  3B3C A;  3GKR A;  5ISV A;  5JPH A;  4K3N A;  3QB8 A;  3H8F A;  1Z4E A;  4M85 A;  4EVY A;  4NGM A;  3NH5 A;  4B5P A;  3NH8 A;  3SJX A;  4OKO A;  1ZO0 A;  3G3S A;  4HPS A;  4A94 A;  3PBB A;  4H2K A;  2AE6 A;  2PIY A;  4UEE A;  3R9E A;  1XE4 A;  2AFS A;  4CAF A;  3B3S A;  1IY7 A;  4P4F A;  4A95 A;  5AG7 A;  4CGO A;  5GCN A;  3HLP A;  2PJ1 A;  1XIX A;  5DWN A;  3S6G A;  2JBK A;  4A2Z A;  3DNS A;  1A2Z A;  2PQ8 A;  4UFV A;  3H8G A;  1HDU A;  3KKW A;  4X5K A;  1KUV A;  2Z3K A;  1Y9K A;  1B87 A;  2JDC A;  4ZY2 A;  2PJ3 A;  3HUV A;  3NFZ A;  1YVO A;  3VH9 A;  4KSF A;  2R7H A;  4B12 A;  5H84 A;  2OZH A;  4M6G A;  1Z2L A;  3RO0 A;  2ARH A;  2IMO A;  1ZG8 A;  3PB8 X;  4RUH A;  3D7F A;  4O23 A;  3PFE A;  1YW6 A;  1F57 A;  2CNM A;  1QSN A;  3DR6 A;  3B35 A;  3QNV A;  4FD5 A;  4X2T A;  1Q2Y A;  1V0C A;  3P2H A;  4B5P B;  5JH9 A;  2EWB A;  5D29 A;  1M4D A;  5HVG A;  1IYK A;  1OBR A;  2PJA A;  3H5Z A;  5F46 A;  3I9S A;  1CP6 A;  1Q2D A;  1GYT A;  3DLJ A;  4FWU A;  2VXK A;  3PEI A;  4KOY A;  4ORF A;  2NSM A;  3R9F A;  3PFO A;  2K5T A;  3NA6 A;  1L0C A;  1P4N A;  2EVN A;  3LOD A;  1BPM A;  1PYT B;  4FD7 A;  4M6H A;  1M4G A;  4PK3 A;  3E0K A;  2V8G A;  1KUY A;  2DF5 A;  4NF1 A;  1R3N A;  5DS0 A;  1I12 A;  2J8M A;  4C7I A;  3S6K A;  1IOF A;  1XMB A;  2HQY A;  2YNE A;  4KSI A;  2ZPA A;  4IHM A;  4UCM A;  5AG6 A;  5J8F A;  2HV2 A;  4JLY A;  1IYL A;  1CM0 A;  1UWY A;  4MFP A;  4NCZ A;  4PXE A;  4A38 A;  3IWE A;  2DEA A;  3KGQ A;  4KOT A;  2IL4 A;  3IO1 A;  2JBJ A;  1LRZ A;  1XRY A;  3FJU A;  3BI0 A;  3GYA A;  4MHD A;  2X7B A;  1QMU A;  1YLO A;  3EY5 A;  4MHY A;  4PQA A;  2P0W A;  3R1K A;  3D66 A;  2J8N A;  4P10 A;  1QSM A;  3RZA A;  2RB7 A;  1KUX A;  2VI7 A;  3FF3 A;  3GUX A;  4EME A;  1AYE A;  1NMT A;  4RI1 A;  1SQH A;  3K9T A;  2D4O A;  4FD6 A;  3T8W A;  3GIU A;  1XF8 A;  1YSJ A;  1S7L A;  3D7G A;  4FBE A;  4P45 A;  4W9Y A;  2AFO A;  3JTK A;  5A27 A;  1Z8L A;  3S6H A;  1BOB A;  2P6G A;  2C1C A;  2GIV A;  2AFW A;  3FXT A;  3K2K A;  4MJ8 A;  3RNZ A;  4MRI A;  5AG4 A;  2VEZ A;  4CGM A;  3RBU A;  5C82 A;  3BXM A;  3D68 A;  3PB4 X;  4YWY A;  4UIB A;  2DPS A;  3CT9 A;  4LQG A;  3EXN A;  4CGP A;  4TWE A;  2B3U A;  3H4Q A;  4KOR A;  3B3T A;  3PB6 X;  4R7M A;  1VGY A;  1AMP A;  5D8N A;  1Z8T A;  4P4I A;  2R1I A;  5JGF A;  2WUU A;  3CXS A;  4XPD B;  1I21 A;  3JVN A;  4K30 A;  3SI0 A;  3BLN A;  1ZLH A;  4F9U A;  5G1Z A;  3W6S A;  2C27 A;  2CIJ A;  3F8K A;  3FED A;  4WWV A;  3VWD A;  2BO9 A;  3UY5 A;  4FD4 A;  4Y49 B;  2Z3N A;  2QYV A;  2OR4 A;  3QAY A;  4KOU A;  4B13 A;  1VHO A;  3SJG A;  2ANP A;  4HNX B;  4C2Z A;  3TOB A;  4BD9 A;  4Z65 A;  2D4P A;  3IU2 A;  1HDQ A;  2ZW5 A;  5LYD A;  2OH1 A;  4U9Y A;  1VHS A;  2BL1 A;  3S6F A;  4MCS A;  1F2P A;  2PVW A;  4JZ0 A;  5AGE A;  3PB9 X;  3TOA A;  4CYO A;  1CBX A;  4KOV A;  2G9D A;  4ZX9 A;  4P4B A;  2VL1 A;  1FT7 A;  3IFE A;  4JXR A;  4XPD C;  5LRJ A;  4ZYQ A;  5KTC A;  2B5G B;  4ZI6 A;  2B58 A;  4L89 A;  4R57 A;  3D67 A;  3DR8 A;  4U9Z A;  4CGN A;  4PXB A;  2OZG A;  4OAE A;  4AB7 A;  2AFU A;  1R57 A;  4MFZ A;  1YGH A;  3SHP A;  3WR7 A;  4UCP A;  3ZZI A;  2AJ6 A;  2JEV A;  2PJ2 A;  2Q4V A;  2YND A;  3P2F A;  5CBM A;  1ELM P;  1XEB A;  4P44 A;  1QSO A;  3F0A A;  4Y49 C;  2GU2 A;  4CYN A;  1LAM A;  1BAV A;  3LMS A;  4NGR A;  2JDD A;  3L2N A;  5F48 A;  2OOT A;  1VHE A;  4C7H A;  4FAI A;  3FB3 A;  1YK3 A;  4UEF A;  2ZEE A;  2EK8 A;  3TT2 A;  4KVX A;  2OU2 A;  2QML A;  4YGO A;  4AVC A;  4XNH B;  1LFW A;  2RC4 A;  4R6T A;  1TIQ A;  2GE3 A;  3T90 A;  3EFA A;  5HVF A;  1M1D A;  2PRB A;  2Q7B A;  5FVJ A;  2PJ7 A;  2G3A A;  3IC1 A;  1NSL A;  3B3V A;  2G0B A;  1CJW A;  2PJ9 A;  4UBR A;  5CNP A;  4B5O A;  3A9L A;  1ON0 A;  3CDX A;  1HEE A;  1KZF A;  5I0C A;  5BWA B;  5IB9 A;  4H89 A;  2ZW4 A;  4UWI A;  3RAM A;  3BHX A;  4HKF A;  1Q7L A;  4MCR A;  4OP4 A;  4ONU A;  2XEJ A;  4XPL A;  2FE7 A;  4NJR A;  4PXD A;  4CRZ B;  2Q44 A;  4CS0 B;  4QC6 A; 
#chains in the Genus database with same CATH homology
 1VIX A;  4P6Y A;  4OC5 A;  4OC2 A;  1CPX A;  3B3W A;  1TF9 A;  2GRE A;  4R76 A;  3SJF A;  3IWW A;  2XEG A;  3KHZ A;  5K8P A;  1XBU A;  4OME A;  4A37 A;  3KHX A;  2ZEG A;  4TNU A;  4EWT A;  4OID A;  3WT4 A;  1LOK A;  1TF8 A;  2J9A A;  1TXR A;  3TC8 A;  4ZY0 A;  2FVG A;  3PRT A;  3FMC A;  4DJL A;  4MHZ A;  2AFZ A;  3LWU A;  4Q7A A;  3BI1 A;  5LYL A;  3GB0 A;  4MCP A;  1ARL A;  3CPX A;  4DYO A;  4YU9 A;  3WAB A;  2Q43 A;  2GLF A;  4JYW A;  2BCO A;  3SJE A;  3FH4 A;  1KWM A;  2F7V A;  4F9V A;  2PRQ A;  3V38 A;  1Y0R A;  3FX6 A;  2XEI A;  2ABZ A;  3PBE A;  2PJ6 A;  5CPA A;  1CX8 A;  4P4J A;  4ONW A;  2V8D A;  2ZEP A;  3KI9 A;  3KQZ A;  4MXU A;  4OC3 A;  4ZY1 A;  4R8F A;  3VAT A;  4NGP A;  2CTB A;  7CPA A;  4A39 A;  1XFO A;  2POK A;  5JM6 A;  3WC5 A;  2PCU A;  2XEF A;  5HXD A;  3CPA A;  2WZN A;  2ZED A;  2C6C A;  3PB7 X;  5K8N A;  4UEZ A;  1TKH A;  3FEE A;  4IAV A;  1DE4 C;  4OIW A;  1ELL P;  2QJ8 A;  3D4U A;  4FUU A;  3KAS A;  2CTC A;  3S9L A;  3D7D A;  4OC4 A;  1CP7 A;  4MCQ A;  3IIB A;  1DTD A;  1Z5R A;  4UF4 A;  4CPA A;  2PJ5 A;  5THW A;  3KZW A;  2HC9 A;  1F2O A;  3JRU A;  4MHN A;  2Q51 A;  4OC0 A;  6CPA A;  1LCP A;  1LAN A;  3KQX A;  3B2Y A;  4GM5 A;  4NGT A;  1YW4 A;  2IQ6 A;  4NGQ A;  1CG2 A;  3S9N A;  2PVV A;  4NFR A;  3WC7 A;  5LRK A;  1LAP A;  3ISZ A;  4X8I A;  3MRU A;  4PXC A;  2PE3 A;  3FVL A;  2AFX A;  3D7H A;  2ZEF A;  1XJO A;  2V8H A;  4MMO A;  3IJ3 A;  4NGN A;  2WYR A;  1R43 A;  3IEH A;  3NH4 A;  1M4L A;  1IGB A;  3N5F A;  1TKF A;  2ZEL A;  5ELY A;  4AXV A;  5LYF A;  1YME A;  1Y0Y A;  5I4M A;  1ZLI A;  2EK9 A;  2V8V A;  1FNO A;  2PJ8 A;  3I1U A;  4WJB A;  2F8H A;  1JQG A;  2PIZ A;  4X3R A;  1TKJ A;  3SI2 A;  3B7I A;  3VAR A;  2ZOG A;  3DGV A;  2ZOF A;  2PJ4 A;  1Y7E A;  1RTQ A;  4PPZ A;  2PJB A;  3GLJ A;  3KR5 A;  2CF4 A;  2PJC A;  2V77 A;  3TX8 A;  2C6P A;  3KR4 A;  2AFM A;  2IJZ A;  5LRG A;  3WC6 A;  4UIA A;  2O4H A;  1PCA A;  5K8M A;  5K8O A;  2NYQ A;  5LYI A;  4ZX8 A;  3MN8 A;  2BOA A;  1ZG9 A;  4OC1 A;  4NGS A;  2ZEN A;  2ZEM A;  2QVP A;  2JEW A;  5F09 A;  4IK2 A;  1EE3 P;  2RFH A;  3H8E A;  1ARM A;  1CPS A;  8CPA A;  2GLJ A;  2C6G A;  2ZEH A;  2PJ0 A;  1ZG7 A;  4G1P A;  1BLL E;  2ZEO A;  4F8Z A;  3KL9 A;  3SI1 A;  4EFD A;  4NJQ A;  1QQ9 A;  5HVH A;  5J1Q A;  2HB6 A;  3V7Z A;  3ISX A;  1NSA A;  4P4D A;  1H8L A;  3FEC A;  3S9M A;  2Q4Z A;  4P4E A;  4MHP A;  1BPN A;  2O53 A;  4B6Z A;  2I3C A;  4DUK A;  3B3C A;  4K3N A;  3H8F A;  4NGM A;  3NH5 A;  3NH8 A;  3SJX A;  4OKO A;  4A94 A;  3PBB A;  4H2K A;  2PIY A;  4UEE A;  2AFS A;  3B3S A;  1IY7 A;  4P4F A;  3HLP A;  2PJ1 A;  2JBK A;  3H8G A;  1HDU A;  4ZY2 A;  2PJ3 A;  3HUV A;  3NFZ A;  3VH9 A;  1Z2L A;  2IMO A;  1ZG8 A;  3PB8 X;  4RUH A;  3D7F A;  4O23 A;  3PFE A;  1YW6 A;  1F57 A;  4X2T A;  3QNV A;  3B35 A;  5JH9 A;  2EWB A;  5D29 A;  5HVG A;  1OBR A;  2PJA A;  1CP6 A;  1GYT A;  3DLJ A;  4FWU A;  3PEI A;  2NSM A;  3PFO A;  3NA6 A;  1BPM A;  1PYT B;  2V8G A;  1R3N A;  5DS0 A;  4KSI A;  1XMB A;  4IHM A;  1UWY A;  4PXE A;  4A38 A;  2DEA A;  3KGQ A;  3IO1 A;  2JBJ A;  1XRY A;  3FJU A;  3BI0 A;  4MHY A;  1QMU A;  1YLO A;  4PQA A;  3D66 A;  4P10 A;  3RZA A;  2RB7 A;  3GUX A;  4EME A;  3FF3 A;  1AYE A;  3K9T A;  3T8W A;  1YSJ A;  3D7G A;  4FBE A;  4P45 A;  4W9Y A;  2AFO A;  1Z8L A;  3K2K A;  2C1C A;  2AFW A;  4MRI A;  3RBU A;  3BXM A;  3D68 A;  3PB4 X;  4YWY A;  4UIB A;  3CT9 A;  4LQG A;  4TWE A;  3B3T A;  3PB6 X;  4R7M A;  1VGY A;  1AMP A;  5D8N A;  4P4I A;  5JGF A;  3SI0 A;  1ZLH A;  4F9U A;  2CIJ A;  3FED A;  4WWV A;  2BO9 A;  2QYV A;  2OR4 A;  1VHO A;  3SJG A;  2ANP A;  4Z65 A;  4BD9 A;  1HDQ A;  5LYD A;  4MCS A;  1F2P A;  2PVW A;  4JZ0 A;  3PB9 X;  1CBX A;  2G9D A;  4ZX9 A;  4P4B A;  2VL1 A;  1FT7 A;  3IFE A;  5LRJ A;  4ZYQ A;  4ZI6 A;  3D67 A;  4PXB A;  2AFU A;  2PJ2 A;  5CBM A;  1ELM P;  4P44 A;  2GU2 A;  1LAM A;  1BAV A;  3LMS A;  4NGR A;  3L2N A;  4FAI A;  2OOT A;  1VHE A;  4UEF A;  2ZEE A;  2EK8 A;  1LFW A;  4R6T A;  5HVF A;  2PJ7 A;  3IC1 A;  3B3V A;  2PJ9 A;  5IB9 A;  3CDX A;  1HEE A;  3RAM A;  3BHX A;  1Q7L A;  4MCR A;  4OP4 A;  2XEJ A;  4NJR A;  4PXD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...