1TF9A

Streptomyces griseus aminopeptidase complexed with p-iodo-l-phenylalanine
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
277
structure length
275
Chain Sequence
APDIPLANVKAHLTQLSTIAANNGGNRAHGRPGYKASVDYVKAKLDAAGYTTTLQQFTSGGATGYNLIANWPGGDPNKVLMAGAHLDSVSSGAGINDNGSGSAAVLETALAVSRAGYQPDKHLRFAWWGAEELGLIGSKFYVNNLPSADRSKLAGYLNFDMIGSPNPGYFVYDDDPVIEKTFKNYFAGLNVPTEIETEGRSDHAPFKNVGVPVGGLFTGAGYTKSAAQAQKWGGTAGQAFDRCYHSSCDSLSNINDTALDRNSDAAAHAIWTLSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Aminopeptidase
publication title Binding of inhibitory aromatic amino acids to Streptomyces griseus aminopeptidase.
pubmed doi rcsb
total genus 108
structure length 275
sequence length 277
ec nomenclature ec 3.4.11.24: Aminopeptidase S.
pdb deposition date 2004-05-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 1tf9A00
4KSIA 2PJ3A 3RAMA 3ISZA 4P4DA 3PB8X 2G9DA 4R7MA 1CBXA 2V8GA 4FAIA 1XRYA 1JQGA 1XMBA 3LMSA 4UEEA 4P45A 2V8VA 3IJ3A 3JRUA 1YMEA 3K9TA 1LCPA 2ZOFA 1OBRA 4DYOA 4MRIA 3IWWA 2V77A 3SJGA 3SI2A 2C1CA 1XJOA 4A37A 3QNVA 3VH9A 1TKHA 2PJAA 4MCQA 4PXDA 4Z65A 2IQ6A 3TC8A 2GLFA 3TX8A 4FWUA 2RFHA 5J1QA 5D29A 2PJ8A 2PJBA 3IEHA 4OMEA 3FEEA 2PJ2A 4OIDA 3K2KA 8CPAA 2PJ0A 1M4LA 5LYLA 1IGBA 4MCSA 1CP6A 2EWBA 4NJRA 4O23A 4LQGA 4UIAA 2O53A 1TXRA 4G1PA 3B3WA 3D4UA 2HC9A 5LRKA 3KASA 5K8OA 3SJEA 3BHXA 4MHPA 1Y0YA 4ZX8A 4BD9A 3FEDA 3FECA 5HVGA 4EWTA 5JH9A 4Q7AA 3RBUA 2EK9A 1LOKA 2ZEGA 3D7GA 4PPZA 2JBKA 3IIBA 1Y0RA 4RUHA 1ELLP 3NH5A 4NGTA 3B3TA 1Z5RA 2EK8A 4PXBA 2WZNA 2FVGA 1Z2LA 2AFUA 1TF9A 1BAVA 3FF3A 1Q7LA 3HLPA 1CPXA 2POKA 2XEFA 2XEIA 3S9MA 3GUXA 1CG2A 2ZEEA 4FBEA 3B35A 4P44A 4PXEA 3CT9A 4ZY0A 3PBBA 3KR5A 1XFOA 2OR4A 1CPSA 3FVLA 4UEZA 4P4EA 1BPMA 3D68A 3KI9A 2PIZA 1CX8A 1IY7A 4PXCA 1LANA 2ANPA 1VIXA 3CPAA 2BCOA 4H2KA 2XEJA 4MHNA 2IMOA 2PIYA 4IHMA 5LYFA 1VGYA 1LAPA 4W9YA 4A94A 3RZAA 2J9AA 5K8NA 4NGNA 2O4HA 1R43A 1BPNA 4P4IA 3PBEA 2VL1A 3NA6A 2ZEMA 1HDQA 3NFZA 1AYEA 1TKJA 2GLJA 4ZY2A 3V7ZA 2PJ9A 3PFOA 1H8LA 1BLLE 3PB4X 6CPAA 5IB9A 5THWA 2XEGA 2NYQA 3CDXA 2QVPA 3CPXA 4R76A 1VHEA 2PCUA 4OC0A 4B6ZA 3B3CA 2AFZA 4ZY1A 3KGQA 7CPAA 4F9UA 2PJ5A 2PJ1A 2CIJA 2ZOGA 5F09A 3PB7X 1AMPA 2PJ6A 4IAVA 3D67A 2CTBA 3N5FA 4NJQA 2ZEPA 1YW4A 2V8HA 3KR4A 1YSJA 3KL9A 4NGPA 3WT4A 1Z8LA 3WC6A 2DEAA 4MHZA 3SJFA 4MHYA 3D7DA 2QJ8A 5LYDA 3NH4A 4OC1A 5HVHA 4OC2A 4DUKA 2PJCA 2ZEFA 4OIWA 2PJ4A 3PRTA 4X8IA 1TKFA 2AFXA 4F9VA 1GYTA 2WYRA 2ZELA 4UF4A 4WWVA 4P10A 2PJ7A 2PVWA 2ZENA 2RB7A 1CP7A 4GM5A 2JBJA 4P6YA 1F57A 4NGMA 2F7VA 3VATA 4OC5A 4ZYQA 1ZG7A 4K3NA 3I1UA 3ISXA 1NSAA 2CF4A 4UIBA 3S9LA 3H8EA 5LRGA 3L2NA 1FNOA 5HXDA 3BI0A 4ZX9A 5JGFA 4NFRA 1VHOA 1YLOA 3D7FA 1ZG9A 3SJXA 4MMOA 4X2TA 5LRJA 1PYTB 4JYWA 3KZWA 3FH4A 2PE3A 2C6GA 2JEWA 4NGRA 1PCAA 3KQXA 2Q51A 4TWEA 3B7IA 2GU2A 4TNUA 3KQZA 2IJZA 3IC1A 2AFMA 2V8DA 1F2OA 2CTCA 4X3RA 4EFDA 5LYIA 1TF8A 2QYVA 4UEFA 4R6TA 3DGVA 1QMUA 5ELYA 4P4BA 4IK2A 3FJUA 2C6PA 2Q4ZA 3D7HA 4FUUA 1HDUA 4NGQA 3B3SA 4MCPA 5HVFA 2AFSA 4A39A 2BOAA 3IFEA 1ARLA 2ZEHA 4CPAA 1ZLIA 2OOTA 2PRQA 3VARA 3DLJA 5I4MA 3B3VA 5CPAA 3SI1A 4F8ZA 2ZEDA 1DTDA 4AXVA 4OC3A 4JZ0A 3KHXA 4OP4A 3NH8A 1ELMP 4MXUA 1KWMA 4WJBA 4YWYA 5JM6A 4NGSA 3D66A 3H8GA 3S9NA 1YW6A 3WABA 4P4JA 5CBMA 3KHZA 3T8WA 3PB9X 3PEIA 3GB0A 1EE3P 1HEEA 2I3CA 2AFOA 4ZI6A 1LAMA 1DE4C 2ABZA 3LWUA 2ZEOA 2GREA 3H8FA 3PFEA 2Q43A 4DJLA 5K8MA 2HB6A 1FT7A 1XBUA 5K8PA 3PB6X 3BXMA 4MCRA 5D8NA 5DS0A 2PVVA 4PQAA 4R8FA 3FX6A 3SI0A 4YU9A 1R3NA 3IO1A 1ZG8A 3FMCA 1RTQA 1ARMA 3V38A 2NSMA 4OC4A 4EMEA 3BI1A 2F8HA 3HUVA 1ZLHA 2AFWA 4ONWA 1Y7EA 4OKOA 3MN8A 3MRUA 2BO9A 1LFWA 3WC7A 4A38A 3WC5A 4P4FA 1F2PA 1UWYA 1QQ9A 3GLJA 2C6CA 3B2YA
chains in the Genus database with same CATH superfamily
1BOBA 4JLYA 4B11A 4KSIA 2PJ3A 3TO7A 4R57A 3QAHA 1ZO0A 4F6AA 3RAMA 3ISZA 2Z3NA 4P4DA 2Z11A 3PB8X 2G9DA 4U9YA 4R7MA 4Q36A 1CBXA 4MY0A 2V8GA 4FAIA 4PK3A 2B5GB 4HKFA 1KUXA 4DNCA 1XRYA 1JQGA 1CJWA 1XMBA 5A28A 3LMSA 4UEEA 4P45A 2V8VA 1S7FA 3IJ3A 3JRUA 1YMEA 4JXRA 2PQ8A 3K9TA 4J3GA 1LCPA 2ZOFA 1OBRA 4DYOA 2DXQA 4MRIA 3IWWA 2B4BA 1XMTA 1MJAA 2V77A 3SJGA 5JQ4A 3SI2A 1K4JA 3EY5A 2C1CA 1XJOA 4XPDB 2FT0A 3LACA 3EFAA 4A37A 2FS5A 1S7LA 1MK4A 2FE7A 2JDDA 3QNVA 3IGRA 1TKHA 3VH9A 3JVNA 2PJAA 1M4GA 2YNCC 4KOXA 2Z3KA 4MCQA 3K9UA 3LODA 4KOTA 4KSAA 4PXDA 4Z65A 3F0AA 1YLEA 2IQ6A 3TC8A 2GLFA 3TX8A 4FWUA 5IB0A 2RFHA 3UY5A 4KOUA 5J1QA 4UBRA 3TE4A 3W91A 4LUAA 4F0XA 4A2ZA 5D29A 5C88A 2PJ8A 2PJBA 1IYKA 2Z3MA 3FRMA 3IEHA 3FEEA 4OMEA 4CAXA 4PV6A 3R96A 2PJ2A 4OIDA 3FNCA 1Z9UA 3K2KA 3H4QA 4UFVA 1FY7A 2PJ0A 4KOWA 2ZW4A 8CPAA 2HUZA 1M4LA 3SXOA 5LYLA 4CGPA 4QVTA 4KUAA 2Z3OA 1QSNA 2B3VA 1IGBA 4FD7A 1CP6A 2EWBA 4MCSA 4NJRA 4AVBA 4O23A 1CM0A 4LQGA 4RN7A 4UIAA 2O53A 1P4NA 1S7NA 1Z8WA 1TXRA 4G1PA 4AB7A 4M3SA 4NEXA 3B3WA 4A95A 2KCWA 3D4UA 4KOSA 2HC9A 2OH1A 4KVME 4MFKA 3W6XA 5LRKA 4JJXA 3KASA 4HNYB 5K8OA 1P0HA 3SJEA 4MFLA 4UWIA 3BHXA 4MHPA 1Y0YA 4ZX8A 4BD9A 3FEDA 4CAFA 4CGOA 2G0BA 3FECA 5HVGA 4HPSA 4EWTA 5JH9A 3NE8A 4Q7AA 4UCPA 3RBUA 1UFHA 2D4PA 2EK9A 5A27A 1LOKA 2ZEGA 3D7GA 4PPZA 5CNPA 5G20A 2JBKA 5AGEA 2R8VA 3IIBA 3N7ZA 1Y0RA 2Q44A 2Z3PA 3B8GA 4JD6A 4B5PA 4CYQA 4RUHA 1PU9A 3GY9A 1ELLP 3NH5A 4NGTA 4AVAA 4C2ZA 3B3TA 1Z5RA 4A32A 2EK8A 5G21A 4PXBA 2WZNA 3R95A 2P0WA 4CYOA 2FVGA 2Q4YA 1IOFA 1Z2LA 2FXFA 4NF1A 2AFUA 1TF9A 1BAVA 5EC4A 2VBQA 3FF3A 1Q7LA 3HLPA 1CPXA 2POKA 2XEFA 3P2HA 1YQEA 2Q7SA 2XEIA 4CRYB 2CNMA 2P6EA 3S9MA 3GUXA 2GANA 4UWJA 4XPLA 1CG2A 2ZEEA 4X5KA 4OAEA 2FL4A 4XNHB 4FBEA 3B35A 4P44A 4GXHA 2J8NA 4PXEA 3CT9A 4ZY0A 2X7BA 3PBBA 3PZJA 3KR5A 3S6GA 4BINA 1XFOA 4PK2A 4B14A 1BO4A 4MI4A 2OR4A 1CPSA 5C82A 3FVLA 2BSWA 4UEZA 4P4EA 1BPMA 3D68A 2AJ6A 3CXSA 1M4IA 4I49A 3D2PA 2ZPAA 3T90A 1IB1E 3KI9A 1KZFA 4JWPA 3SXNA 3S6KA 2PIZA 1CX8A 4QB9A 1X10A 1IY7A 4PXCA 4OADA 3SHPA 1LANA 4UA3A 3ZJ0A 2ANPA 3S6FA 4B13A 1VIXA 3CZXA 3CPAA 5GCNA 2P6FA 4CRZB 2P6GA 2BCOA 2B5GA 1LRZA 2XEJA 4H2KA 2IMOA 4MHNA 2PIYA 3I3GA 5KTDA 3WR7A 1QSRA 3G8WA 4IHMA 2PR1A 3RO0A 1VGYA 1LAPA 3VWDA 5LYFA 1Z8XA 4W9YA 4A94A 2ATRA 2JLMA 4L89A 3RZAA 4Y49B 2J9AA 5K8NA 4NGNA 1A2ZA 2O4HA 1R43A 1BPNA 2R7HA 5AG4A 4P4IA 1RXTA 3PBEA 2VL1A 3NA6A 2ZEMA 4IF5A 1HDQA 2K5TA 1S5KA 2CY2A 3JUWA 3NFZA 2Z3LA 1X12A 4Y49C 3CXQA 2DPSA 1AYEA 1TKJA 2GLJA 2G3TA 4ZY2A 3RNZA 2CNSA 3V7ZA 2PJ9A 3D3SA 3PFOA 2ZW6A 1H8LA 3FXTA 1BLLE 3PB4X 2ODFA 5F48A 4U5YA 4CS0B 1M44A 4CYPA 6CPAA 5IB9A 5THWA 2XEGA 2NYQA 4YRHA 1JWQA 4K30A 3DR8A 5EBVA 3CDXA 4LQ6A 4CGLA 1QSMA 2C27A 1Z4EA 3R9GA 2IL4A 2QVPA 3CPXA 4IUSA 1Y9WA 4R76A 1VHEA 2PCUA 4OC0A 4A31A 4B6ZA 2WUUA 1B87A 3W6SA 1L0CA 2AFZA 2FIWA 3B3CA 3MGDA 2D4OA 3KGQA 4NXYA 4FD6A 4R87A 4ZY1A 2OU2A 7CPAA 4F9UA 1TIQA 2PJ5A 2PJ1A 2CIJA 2PR8A 2ZOGA 3FIXA 3PB7X 5BWAB 5F09A 1AMPA 2PJ6A 4IAVA 2WPWA 3D67A 2CTBA 2HV2A 4CAVA 5J8CA 4E0AA 4KSFA 3N5FA 3D8PA 2VXKA 3C26A 3D2MA 1XEBA 4UFXA 1I12A 4NJQA 2ZXVA 2ZEPA 1YW4A 2V8HA 3KR4A 1YSJA 3KL9A 1M4DA 4NGPA 1NSLA 2B3UA 1KUVA 5HH1A 1YX0A 3WT4A 4AG7A 2FSRA 1XE4A 1Z8LA 2VZZA 5AG7A 4NCZA 4FD5A 4OLLA 3WC6A 2PDOA 4KLWA 3F5BA 2DEAA 2Z0ZA 4MHZA 3SJFA 4AVCA 2J8RA 4MHYA 3T9YA 4MFQA 3D7DA 2QJ8A 5LYDA 4MFZA 5FVJA 3NH4A 4OC1A 5HVHA 4OC2A 4DUKA 2PJCA 2ZEFA 4OIWA 2Q7BA 3P2FA 2QIRA 4H6ZA 2PJ4A 3PRTA 3V8IA 2AE6A 3BLNA 1RO5A 4X8IA 1TKFA 5KTAA 3FB3A 2AFXA 4ZBGA 1GYTA 4F9VA 2WYRA 1B6BA 4II9A 4KOYA 2WPXA 2ZELA 4NSQA 4UF4A 4WWVA 5G1ZA 4P10A 2PJ7A 1Q2CA 2NMTA 2PVWA 2RB7A 1CP7A 2ZENA 1VHSA 4GM5A 2JBJA 4P6YA 1F57A 2HQYA 5AG5A 4NGMA 2F7VA 2OZGA 4OC5A 3VATA 4KLVA 4R9MA 4F0YA 3VWEA 4ZYQA 4U9ZA 1ZG7A 4K3NA 4KS9A 4CGNA 1IIDA 3FBUA 5KTCA 3I1UA 1PUAA 2OB0A 4C68A 3ISXA 1NSAA 2CF4A 4UIBA 3S9LA 4HNWB 1U6MA 3H8EA 4KORA 5LRGA 5AG6A 4KVXA 3L2NA 1FNOA 1GHEA 2BL1A 5HXDA 2Z10A 3BI0A 4ZX9A 1VKCA 5JGFA 1Q2YA 1V0CA 4NFRA 2BEIA 2QECA 1VHOA 5F49A 1YLOA 3D7FA 4UFWA 1ZG9A 4CGMA 3SJXA 4MMOA 4X2TA 5LRJA 1PYTB 4C2XA 4JYWA 3KZWA 3FH4A 1Y9KA 2C6GA 2PE3A 4KOVA 4MFPA 5IV0A 2G3AA 2JEWA 4NGRA 1YGHA 1SQHA 2B4DA 1PCAA 3DR6A 1IYLA 1R57A 3KQXA 1XOVA 4KUBA 2Q51A 4TWEA 1NE9A 4GS4A 4E8OA 3B7IA 2GU2A 4KVOE 4B5OA 4ZGYB 3S6HA 4TNUA 3KQZA 2RC4A 3BJ8A 2IJZA 3IC1A 4MBUA 3R9EA 3PP9A 5HMNA 2AFMA 2V8DA 2ZW5A 4FD4A 1F2OA 1I21A 3IWEA 2CTCA 4HNXB 4X3RA 4M6GA 4EFDA 5LYIA 1TF8A 4LX9A 2QYVA 4UEFA 3R1KA 4R6TA 4A33A 3DGVA 2GIVA 4M6HA 3TCVA 1YREA 4R3LA 4BBHA 2Q0YA 2BUEA 4ORFA 4MJ8A 2JDCA 4H89A 1QMUA 2YNCA 5ELYA 4P4BA 4IK2A 3FJUA 2O28A 4C7HA 2C6PA 2A4NA 2Q4ZA 3D7HA 4UCMA 4R3KA 2YNEA 1YVKA 2JEVA 1ON0A 1Z8TA 4FUUA 3PGPA 1IICA 1MJ9A 2B58A 3OWCA 2Q4VA 2FCKA 1HDUA 3TT2A 4NGQA 2ARHA 3B3SA 4H6UA 4MCPA 2AFSA 5HVFA 5H84A 3EO4A 4A39A 3CXPA 5F46A 3GKRA 2BOAA 3IFEA 1S60A 1ARLA 2ZEHA 3G3SA 4MY3A 4MFJA 4CPAA 1ZLIA 2OOTA 2PRQA 3VARA 2WSAA 3DLJA 5I4MA 2EBJA 4QC6A 3TO9A 1WK4A 2REFA 4L8AA 3B3VA 5CPAA 3TTHA 2CXAA 3SI1A 3R9FA 4F8ZA 2ZEDA 2VQYA 1DTDA 4PSXA 4AXVA 2F5IA 3GIUA 4B12A 4OC3A 4RI1A 4EVYA 4JZ0A 4XPDC 3KHXA 3LD2A 4OP4A 3NE7A 3NH8A 1ELMP 4MXUA 1KWMA 4WJBA 4YWYA 4C7IA 4KZTA 4XPKA 2FIAA 3E0KA 2I00A 1Z4RA 1I1DA 2EVNA 5JM6A 4B10A 3IU1A 4NGSA 2YGWA 3EC4A 4M6IA 2EO8A 3BJ7A 3D66A 4A30A 3H8GA 2I79A 4AG9A 1MJBA 3S9NA 1YW6A 3WABA 4P4JA 4CYNA 5CBMA 1WWZA 2R98A 3KHZA 3T8WA 2OZHA 5E96A 2VZYA 2GE3A 3PB9X 4M85A 2REEA 2DF5A 3PEIA 3RYOA 2PRBA 3GB0A 1EE3P 1IU8A 1HEEA 3QB8A 1Y7RA 5F47A 3DDDA 2I3CA 3GYAA 2Y0MA 3KKWA 2AFOA 4ZI6A 4QBJA 5G22A 3TOBA 3A9LA 4BMHA 4CAEA 1YVOA 1LAMA 1DE4C 2ABZA 2OZUA 3LWUA 4JXQA 2ZEOA 2GREA 3H8FA 1OZPA 3PFEA 4YGOA 2VEZA 4RS2A 2Q43A 2PSWA 4DJLA 5K8MA 1S7KA 2QMLA 2GFQA 3TO6A 2HB6A 1FT7A 2Q04A 3IWGA 1XBUA 5K8PA 3PB6X 2CNTA 3BXMA 4B5PB 3IU2A 4MCRA 5D8NA 5DS0A 2PVVA 4YFJA 4PQAA 4R8FA 3FX6A 3SI0A 4YU9A 5EMIA 1R3NA 3IO1A 3QAYA 4UCNA 5JPHA 1ZG8A 3FMCA 1Q2DA 4E2AA 5IX3A 1RTQA 1QSOA 3I9SA 1ARMA 1IOIA 5ISVA 4Q38A 4PSWA 5I0CA 3V38A 3ZZIA 2NSMA 3TOAA 4OC4A 2R1IA 4EMEA 3BI1A 4C2YA 5DWNA 1J4JA 2F8HA 3JTKA 2ZW7A 2J8MA 3DSBA 3HUVA 1N71A 1ZLHA 2AFWA 4ONWA 1Y7EA 4OKOA 3MN8A 1XIXA 1KUYA 5DWMA 2H5MA 2VI7A 4ONUA 5H86A 3H5ZA 3MRUA 5J8FA 1QSTA 1AUGA 1YR0A 2BO9A 1LFWA 1XF8A 3DNSA 1S3ZA 3WC7A 4A38A 1YK3A 3WC5A 4P4FA 1F2PA 2PC1A 4CAWA 4QUSA 4MHDA 2EUIA 3EXNA 4XNHC 2YNDA 3FYNA 1M1DA 1NMTA 1QQ9A 1UWYA 3F8KA 2DPTA 3TFYA 3GLJA 2C6CA 3B2YA 2B4DB
chains in the Genus database with same CATH topology
4KSIA 2PJ3A 3RAMA 3ISZA 4P4DA 3PB8X 2G9DA 4R7MA 1CBXA 2V8GA 4FAIA 1XRYA 1JQGA 1XMBA 3LMSA 4UEEA 4P45A 2V8VA 3IJ3A 3JRUA 1YMEA 3K9TA 1LCPA 2ZOFA 1OBRA 4DYOA 4MRIA 3IWWA 2V77A 3SJGA 3SI2A 2C1CA 1XJOA 4A37A 3QNVA 3VH9A 1TKHA 2PJAA 4MCQA 4PXDA 4Z65A 2IQ6A 3TC8A 2GLFA 3TX8A 4FWUA 2RFHA 5J1QA 5D29A 2PJ8A 2PJBA 3IEHA 4OMEA 3FEEA 2PJ2A 4OIDA 3K2KA 8CPAA 2PJ0A 1M4LA 5LYLA 1IGBA 4MCSA 1CP6A 2EWBA 4NJRA 4O23A 4LQGA 4UIAA 2O53A 1TXRA 4G1PA 3B3WA 3D4UA 2HC9A 5LRKA 3KASA 5K8OA 3SJEA 3BHXA 4MHPA 1Y0YA 4ZX8A 4BD9A 3FEDA 3FECA 5HVGA 4EWTA 5JH9A 4Q7AA 3RBUA 2EK9A 1LOKA 2ZEGA 3D7GA 4PPZA 2JBKA 3IIBA 1Y0RA 4RUHA 1ELLP 3NH5A 4NGTA 3B3TA 1Z5RA 2EK8A 4PXBA 2WZNA 2FVGA 1Z2LA 2AFUA 1TF9A 1BAVA 3FF3A 1Q7LA 3HLPA 1CPXA 2POKA 2XEFA 2XEIA 3S9MA 3GUXA 1CG2A 2ZEEA 4FBEA 3B35A 4P44A 4PXEA 3CT9A 4ZY0A 3PBBA 3KR5A 1XFOA 2OR4A 1CPSA 3FVLA 4UEZA 4P4EA 1BPMA 3D68A 3KI9A 2PIZA 1CX8A 1IY7A 4PXCA 1LANA 2ANPA 1VIXA 3CPAA 2BCOA 4H2KA 2XEJA 4MHNA 2IMOA 2PIYA 4IHMA 5LYFA 1VGYA 1LAPA 4W9YA 4A94A 3RZAA 2J9AA 5K8NA 4NGNA 2O4HA 1R43A 1BPNA 4P4IA 3PBEA 2VL1A 3NA6A 2ZEMA 1HDQA 3NFZA 1AYEA 1TKJA 2GLJA 4ZY2A 3V7ZA 2PJ9A 3PFOA 1H8LA 1BLLE 3PB4X 6CPAA 5IB9A 5THWA 2XEGA 2NYQA 3CDXA 2QVPA 3CPXA 4R76A 1VHEA 2PCUA 4OC0A 4B6ZA 3B3CA 2AFZA 4ZY1A 3KGQA 7CPAA 4F9UA 2PJ5A 2PJ1A 2CIJA 2ZOGA 5F09A 3PB7X 1AMPA 2PJ6A 4IAVA 3D67A 2CTBA 3N5FA 4NJQA 2ZEPA 1YW4A 2V8HA 3KR4A 1YSJA 3KL9A 4NGPA 3WT4A 1Z8LA 3WC6A 2DEAA 4MHZA 3SJFA 4MHYA 3D7DA 2QJ8A 5LYDA 3NH4A 4OC1A 5HVHA 4OC2A 4DUKA 2PJCA 2ZEFA 4OIWA 2PJ4A 3PRTA 4X8IA 1TKFA 2AFXA 4F9VA 1GYTA 2WYRA 2ZELA 4UF4A 4WWVA 4P10A 2PJ7A 2PVWA 2ZENA 2RB7A 1CP7A 4GM5A 2JBJA 4P6YA 1F57A 4NGMA 2F7VA 3VATA 4OC5A 4ZYQA 1ZG7A 4K3NA 3I1UA 3ISXA 1NSAA 2CF4A 4UIBA 3S9LA 3H8EA 5LRGA 3L2NA 1FNOA 5HXDA 3BI0A 4ZX9A 5JGFA 4NFRA 1VHOA 1YLOA 3D7FA 1ZG9A 3SJXA 4MMOA 4X2TA 5LRJA 1PYTB 4JYWA 3KZWA 3FH4A 2PE3A 2C6GA 2JEWA 4NGRA 1PCAA 3KQXA 2Q51A 4TWEA 3B7IA 2GU2A 4TNUA 3KQZA 2IJZA 3IC1A 2AFMA 2V8DA 1F2OA 2CTCA 4X3RA 4EFDA 5LYIA 1TF8A 2QYVA 4UEFA 4R6TA 3DGVA 1QMUA 5ELYA 4P4BA 4IK2A 3FJUA 2C6PA 2Q4ZA 3D7HA 4FUUA 1HDUA 4NGQA 3B3SA 4MCPA 5HVFA 2AFSA 4A39A 2BOAA 3IFEA 1ARLA 2ZEHA 4CPAA 1ZLIA 2OOTA 2PRQA 3VARA 3DLJA 5I4MA 3B3VA 5CPAA 3SI1A 4F8ZA 2ZEDA 1DTDA 4AXVA 4OC3A 4JZ0A 3KHXA 4OP4A 3NH8A 1ELMP 4MXUA 1KWMA 4WJBA 4YWYA 5JM6A 4NGSA 3D66A 3H8GA 3S9NA 1YW6A 3WABA 4P4JA 5CBMA 3KHZA 3T8WA 3PB9X 3PEIA 3GB0A 1EE3P 1HEEA 2I3CA 2AFOA 4ZI6A 1LAMA 1DE4C 2ABZA 3LWUA 2ZEOA 2GREA 3H8FA 3PFEA 2Q43A 4DJLA 5K8MA 2HB6A 1FT7A 1XBUA 5K8PA 3PB6X 3BXMA 4MCRA 5D8NA 5DS0A 2PVVA 4PQAA 4R8FA 3FX6A 3SI0A 4YU9A 1R3NA 3IO1A 1ZG8A 3FMCA 1RTQA 1ARMA 3V38A 2NSMA 4OC4A 4EMEA 3BI1A 2F8HA 3HUVA 1ZLHA 2AFWA 4ONWA 1Y7EA 4OKOA 3MN8A 3MRUA 2BO9A 1LFWA 3WC7A 4A38A 3WC5A 4P4FA 1F2PA 1UWYA 1QQ9A 3GLJA 2C6CA 3B2YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KSI A;  2PJ3 A;  3RAM A;  3ISZ A;  4P4D A;  3PB8 X;  2G9D A;  4R7M A;  1CBX A;  2V8G A;  4FAI A;  1XRY A;  1JQG A;  1XMB A;  3LMS A;  4UEE A;  4P45 A;  2V8V A;  3IJ3 A;  3JRU A;  1YME A;  3K9T A;  1LCP A;  2ZOF A;  1OBR A;  4DYO A;  4MRI A;  3IWW A;  2V77 A;  3SJG A;  3SI2 A;  2C1C A;  1XJO A;  4A37 A;  3QNV A;  3VH9 A;  1TKH A;  2PJA A;  4MCQ A;  4PXD A;  4Z65 A;  2IQ6 A;  3TC8 A;  2GLF A;  3TX8 A;  4FWU A;  2RFH A;  5J1Q A;  5D29 A;  2PJ8 A;  2PJB A;  3IEH A;  4OME A;  3FEE A;  2PJ2 A;  4OID A;  3K2K A;  8CPA A;  2PJ0 A;  1M4L A;  5LYL A;  1IGB A;  4MCS A;  1CP6 A;  2EWB A;  4NJR A;  4O23 A;  4LQG A;  4UIA A;  2O53 A;  1TXR A;  4G1P A;  3B3W A;  3D4U A;  2HC9 A;  5LRK A;  3KAS A;  5K8O A;  3SJE A;  3BHX A;  4MHP A;  1Y0Y A;  4ZX8 A;  4BD9 A;  3FED A;  3FEC A;  5HVG A;  4EWT A;  5JH9 A;  4Q7A A;  3RBU A;  2EK9 A;  1LOK A;  2ZEG A;  3D7G A;  4PPZ A;  2JBK A;  3IIB A;  1Y0R A;  4RUH A;  1ELL P;  3NH5 A;  4NGT A;  3B3T A;  1Z5R A;  2EK8 A;  4PXB A;  2WZN A;  2FVG A;  1Z2L A;  2AFU A;  1TF9 A;  1BAV A;  3FF3 A;  1Q7L A;  3HLP A;  1CPX A;  2POK A;  2XEF A;  2XEI A;  3S9M A;  3GUX A;  1CG2 A;  2ZEE A;  4FBE A;  3B35 A;  4P44 A;  4PXE A;  3CT9 A;  4ZY0 A;  3PBB A;  3KR5 A;  1XFO A;  2OR4 A;  1CPS A;  3FVL A;  4UEZ A;  4P4E A;  1BPM A;  3D68 A;  3KI9 A;  2PIZ A;  1CX8 A;  1IY7 A;  4PXC A;  1LAN A;  2ANP A;  1VIX A;  3CPA A;  2BCO A;  4H2K A;  2XEJ A;  4MHN A;  2IMO A;  2PIY A;  4IHM A;  5LYF A;  1VGY A;  1LAP A;  4W9Y A;  4A94 A;  3RZA A;  2J9A A;  5K8N A;  4NGN A;  2O4H A;  1R43 A;  1BPN A;  4P4I A;  3PBE A;  2VL1 A;  3NA6 A;  2ZEM A;  1HDQ A;  3NFZ A;  1AYE A;  1TKJ A;  2GLJ A;  4ZY2 A;  3V7Z A;  2PJ9 A;  3PFO A;  1H8L A;  1BLL E;  3PB4 X;  6CPA A;  5IB9 A;  5THW A;  2XEG A;  2NYQ A;  3CDX A;  2QVP A;  3CPX A;  4R76 A;  1VHE A;  2PCU A;  4OC0 A;  4B6Z A;  3B3C A;  2AFZ A;  4ZY1 A;  3KGQ A;  7CPA A;  4F9U A;  2PJ5 A;  2PJ1 A;  2CIJ A;  2ZOG A;  5F09 A;  3PB7 X;  1AMP A;  2PJ6 A;  4IAV A;  3D67 A;  2CTB A;  3N5F A;  4NJQ A;  2ZEP A;  1YW4 A;  2V8H A;  3KR4 A;  1YSJ A;  3KL9 A;  4NGP A;  3WT4 A;  1Z8L A;  3WC6 A;  2DEA A;  4MHZ A;  3SJF A;  4MHY A;  3D7D A;  2QJ8 A;  5LYD A;  3NH4 A;  4OC1 A;  5HVH A;  4OC2 A;  4DUK A;  2PJC A;  2ZEF A;  4OIW A;  2PJ4 A;  3PRT A;  4X8I A;  1TKF A;  2AFX A;  4F9V A;  1GYT A;  2WYR A;  2ZEL A;  4UF4 A;  4WWV A;  4P10 A;  2PJ7 A;  2PVW A;  2ZEN A;  2RB7 A;  1CP7 A;  4GM5 A;  2JBJ A;  4P6Y A;  1F57 A;  4NGM A;  2F7V A;  3VAT A;  4OC5 A;  4ZYQ A;  1ZG7 A;  4K3N A;  3I1U A;  3ISX A;  1NSA A;  2CF4 A;  4UIB A;  3S9L A;  3H8E A;  5LRG A;  3L2N A;  1FNO A;  5HXD A;  3BI0 A;  4ZX9 A;  5JGF A;  4NFR A;  1VHO A;  1YLO A;  3D7F A;  1ZG9 A;  3SJX A;  4MMO A;  4X2T A;  5LRJ A;  1PYT B;  4JYW A;  3KZW A;  3FH4 A;  2PE3 A;  2C6G A;  2JEW A;  4NGR A;  1PCA A;  3KQX A;  2Q51 A;  4TWE A;  3B7I A;  2GU2 A;  4TNU A;  3KQZ A;  2IJZ A;  3IC1 A;  2AFM A;  2V8D A;  1F2O A;  2CTC A;  4X3R A;  4EFD A;  5LYI A;  1TF8 A;  2QYV A;  4UEF A;  4R6T A;  3DGV A;  1QMU A;  5ELY A;  4P4B A;  4IK2 A;  3FJU A;  2C6P A;  2Q4Z A;  3D7H A;  4FUU A;  1HDU A;  4NGQ A;  3B3S A;  4MCP A;  5HVF A;  2AFS A;  4A39 A;  2BOA A;  3IFE A;  1ARL A;  2ZEH A;  4CPA A;  1ZLI A;  2OOT A;  2PRQ A;  3VAR A;  3DLJ A;  5I4M A;  3B3V A;  5CPA A;  3SI1 A;  4F8Z A;  2ZED A;  1DTD A;  4AXV A;  4OC3 A;  4JZ0 A;  3KHX A;  4OP4 A;  3NH8 A;  1ELM P;  4MXU A;  1KWM A;  4WJB A;  4YWY A;  5JM6 A;  4NGS A;  3D66 A;  3H8G A;  3S9N A;  1YW6 A;  3WAB A;  4P4J A;  5CBM A;  3KHZ A;  3T8W A;  3PB9 X;  3PEI A;  3GB0 A;  1EE3 P;  1HEE A;  2I3C A;  2AFO A;  4ZI6 A;  1LAM A;  1DE4 C;  2ABZ A;  3LWU A;  2ZEO A;  2GRE A;  3H8F A;  3PFE A;  2Q43 A;  4DJL A;  5K8M A;  2HB6 A;  1FT7 A;  1XBU A;  5K8P A;  3PB6 X;  3BXM A;  4MCR A;  5D8N A;  5DS0 A;  2PVV A;  4PQA A;  4R8F A;  3FX6 A;  3SI0 A;  4YU9 A;  1R3N A;  3IO1 A;  1ZG8 A;  3FMC A;  1RTQ A;  1ARM A;  3V38 A;  2NSM A;  4OC4 A;  4EME A;  3BI1 A;  2F8H A;  3HUV A;  1ZLH A;  2AFW A;  4ONW A;  1Y7E A;  4OKO A;  3MN8 A;  3MRU A;  2BO9 A;  1LFW A;  3WC7 A;  4A38 A;  3WC5 A;  4P4F A;  1F2P A;  1UWY A;  1QQ9 A;  3GLJ A;  2C6C A;  3B2Y A; 
#chains in the Genus database with same CATH topology
 1BOB A;  4JLY A;  4B11 A;  4KSI A;  2PJ3 A;  3TO7 A;  4R57 A;  3QAH A;  1ZO0 A;  4F6A A;  3RAM A;  3ISZ A;  2Z3N A;  4P4D A;  2Z11 A;  3PB8 X;  2G9D A;  4U9Y A;  4R7M A;  4Q36 A;  1CBX A;  4MY0 A;  2V8G A;  4FAI A;  4PK3 A;  2B5G B;  4HKF A;  1KUX A;  4DNC A;  1XRY A;  1JQG A;  1CJW A;  1XMB A;  5A28 A;  3LMS A;  4UEE A;  4P45 A;  2V8V A;  1S7F A;  3IJ3 A;  3JRU A;  1YME A;  4JXR A;  2PQ8 A;  3K9T A;  4J3G A;  1LCP A;  2ZOF A;  1OBR A;  4DYO A;  2DXQ A;  4MRI A;  3IWW A;  2B4B A;  1XMT A;  1MJA A;  2V77 A;  3SJG A;  5JQ4 A;  3SI2 A;  1K4J A;  3EY5 A;  2C1C A;  1XJO A;  4XPD B;  2FT0 A;  3LAC A;  3EFA A;  4A37 A;  2FS5 A;  1S7L A;  1MK4 A;  2FE7 A;  2JDD A;  3QNV A;  3IGR A;  1TKH A;  3VH9 A;  3JVN A;  2PJA A;  1M4G A;  2YNC C;  4KOX A;  2Z3K A;  4MCQ A;  3K9U A;  3LOD A;  4KOT A;  4KSA A;  4PXD A;  4Z65 A;  3F0A A;  1YLE A;  2IQ6 A;  3TC8 A;  2GLF A;  3TX8 A;  4FWU A;  5IB0 A;  2RFH A;  3UY5 A;  4KOU A;  5J1Q A;  4UBR A;  3TE4 A;  3W91 A;  4LUA A;  4F0X A;  4A2Z A;  5D29 A;  5C88 A;  2PJ8 A;  2PJB A;  1IYK A;  2Z3M A;  3FRM A;  3IEH A;  3FEE A;  4OME A;  4CAX A;  4PV6 A;  3R96 A;  2PJ2 A;  4OID A;  3FNC A;  1Z9U A;  3K2K A;  3H4Q A;  4UFV A;  1FY7 A;  2PJ0 A;  4KOW A;  2ZW4 A;  8CPA A;  2HUZ A;  1M4L A;  3SXO A;  5LYL A;  4CGP A;  4QVT A;  4KUA A;  2Z3O A;  1QSN A;  2B3V A;  1IGB A;  4FD7 A;  1CP6 A;  2EWB A;  4MCS A;  4NJR A;  4AVB A;  4O23 A;  1CM0 A;  4LQG A;  4RN7 A;  4UIA A;  2O53 A;  1P4N A;  1S7N A;  1Z8W A;  1TXR A;  4G1P A;  4AB7 A;  4M3S A;  4NEX A;  3B3W A;  4A95 A;  2KCW A;  3D4U A;  4KOS A;  2HC9 A;  2OH1 A;  4KVM E;  4MFK A;  3W6X A;  5LRK A;  4JJX A;  3KAS A;  4HNY B;  5K8O A;  1P0H A;  3SJE A;  4MFL A;  4UWI A;  3BHX A;  4MHP A;  1Y0Y A;  4ZX8 A;  4BD9 A;  3FED A;  4CAF A;  4CGO A;  2G0B A;  3FEC A;  5HVG A;  4HPS A;  4EWT A;  5JH9 A;  3NE8 A;  4Q7A A;  4UCP A;  3RBU A;  1UFH A;  2D4P A;  2EK9 A;  5A27 A;  1LOK A;  2ZEG A;  3D7G A;  4PPZ A;  5CNP A;  5G20 A;  2JBK A;  5AGE A;  2R8V A;  3IIB A;  3N7Z A;  1Y0R A;  2Q44 A;  2Z3P A;  3B8G A;  4JD6 A;  4B5P A;  4CYQ A;  4RUH A;  1PU9 A;  3GY9 A;  1ELL P;  3NH5 A;  4NGT A;  4AVA A;  4C2Z A;  3B3T A;  1Z5R A;  4A32 A;  2EK8 A;  5G21 A;  4PXB A;  2WZN A;  3R95 A;  2P0W A;  4CYO A;  2FVG A;  2Q4Y A;  1IOF A;  1Z2L A;  2FXF A;  4NF1 A;  2AFU A;  1TF9 A;  1BAV A;  5EC4 A;  2VBQ A;  3FF3 A;  1Q7L A;  3HLP A;  1CPX A;  2POK A;  2XEF A;  3P2H A;  1YQE A;  2Q7S A;  2XEI A;  4CRY B;  2CNM A;  2P6E A;  3S9M A;  3GUX A;  2GAN A;  4UWJ A;  4XPL A;  1CG2 A;  2ZEE A;  4X5K A;  4OAE A;  2FL4 A;  4XNH B;  4FBE A;  3B35 A;  4P44 A;  4GXH A;  2J8N A;  4PXE A;  3CT9 A;  4ZY0 A;  2X7B A;  3PBB A;  3PZJ A;  3KR5 A;  3S6G A;  4BIN A;  1XFO A;  4PK2 A;  4B14 A;  1BO4 A;  4MI4 A;  2OR4 A;  1CPS A;  5C82 A;  3FVL A;  2BSW A;  4UEZ A;  4P4E A;  1BPM A;  3D68 A;  2AJ6 A;  3CXS A;  1M4I A;  4I49 A;  3D2P A;  2ZPA A;  3T90 A;  1IB1 E;  3KI9 A;  1KZF A;  4JWP A;  3SXN A;  3S6K A;  2PIZ A;  1CX8 A;  4QB9 A;  1X10 A;  1IY7 A;  4PXC A;  4OAD A;  3SHP A;  1LAN A;  4UA3 A;  3ZJ0 A;  2ANP A;  3S6F A;  4B13 A;  1VIX A;  3CZX A;  3CPA A;  5GCN A;  2P6F A;  4CRZ B;  2P6G A;  2BCO A;  2B5G A;  1LRZ A;  2XEJ A;  4H2K A;  2IMO A;  4MHN A;  2PIY A;  3I3G A;  5KTD A;  3WR7 A;  1QSR A;  3G8W A;  4IHM A;  2PR1 A;  3RO0 A;  1VGY A;  1LAP A;  3VWD A;  5LYF A;  1Z8X A;  4W9Y A;  4A94 A;  2ATR A;  2JLM A;  4L89 A;  3RZA A;  4Y49 B;  2J9A A;  5K8N A;  4NGN A;  1A2Z A;  2O4H A;  1R43 A;  1BPN A;  2R7H A;  5AG4 A;  4P4I A;  1RXT A;  3PBE A;  2VL1 A;  3NA6 A;  2ZEM A;  4IF5 A;  1HDQ A;  2K5T A;  1S5K A;  2CY2 A;  3JUW A;  3NFZ A;  2Z3L A;  1X12 A;  4Y49 C;  3CXQ A;  2DPS A;  1AYE A;  1TKJ A;  2GLJ A;  2G3T A;  4ZY2 A;  3RNZ A;  2CNS A;  3V7Z A;  2PJ9 A;  3D3S A;  3PFO A;  2ZW6 A;  1H8L A;  3FXT A;  1BLL E;  3PB4 X;  2ODF A;  5F48 A;  4U5Y A;  4CS0 B;  1M44 A;  4CYP A;  6CPA A;  5IB9 A;  5THW A;  2XEG A;  2NYQ A;  4YRH A;  1JWQ A;  4K30 A;  3DR8 A;  5EBV A;  3CDX A;  4LQ6 A;  4CGL A;  1QSM A;  2C27 A;  1Z4E A;  3R9G A;  2IL4 A;  2QVP A;  3CPX A;  4IUS A;  1Y9W A;  4R76 A;  1VHE A;  2PCU A;  4OC0 A;  4A31 A;  4B6Z A;  2WUU A;  1B87 A;  3W6S A;  1L0C A;  2AFZ A;  2FIW A;  3B3C A;  3MGD A;  2D4O A;  3KGQ A;  4NXY A;  4FD6 A;  4R87 A;  4ZY1 A;  2OU2 A;  7CPA A;  4F9U A;  1TIQ A;  2PJ5 A;  2PJ1 A;  2CIJ A;  2PR8 A;  2ZOG A;  3FIX A;  3PB7 X;  5BWA B;  5F09 A;  1AMP A;  2PJ6 A;  4IAV A;  2WPW A;  3D67 A;  2CTB A;  2HV2 A;  4CAV A;  5J8C A;  4E0A A;  4KSF A;  3N5F A;  3D8P A;  2VXK A;  3C26 A;  3D2M A;  1XEB A;  4UFX A;  1I12 A;  4NJQ A;  2ZXV A;  2ZEP A;  1YW4 A;  2V8H A;  3KR4 A;  1YSJ A;  3KL9 A;  1M4D A;  4NGP A;  1NSL A;  2B3U A;  1KUV A;  5HH1 A;  1YX0 A;  3WT4 A;  4AG7 A;  2FSR A;  1XE4 A;  1Z8L A;  2VZZ A;  5AG7 A;  4NCZ A;  4FD5 A;  4OLL A;  3WC6 A;  2PDO A;  4KLW A;  3F5B A;  2DEA A;  2Z0Z A;  4MHZ A;  3SJF A;  4AVC A;  2J8R A;  4MHY A;  3T9Y A;  4MFQ A;  3D7D A;  2QJ8 A;  5LYD A;  4MFZ A;  5FVJ A;  3NH4 A;  4OC1 A;  5HVH A;  4OC2 A;  4DUK A;  2PJC A;  2ZEF A;  4OIW A;  2Q7B A;  3P2F A;  2QIR A;  4H6Z A;  2PJ4 A;  3PRT A;  3V8I A;  2AE6 A;  3BLN A;  1RO5 A;  4X8I A;  1TKF A;  5KTA A;  3FB3 A;  2AFX A;  4ZBG A;  1GYT A;  4F9V A;  2WYR A;  1B6B A;  4II9 A;  4KOY A;  2WPX A;  2ZEL A;  4NSQ A;  4UF4 A;  4WWV A;  5G1Z A;  4P10 A;  2PJ7 A;  1Q2C A;  2NMT A;  2PVW A;  2RB7 A;  1CP7 A;  2ZEN A;  1VHS A;  4GM5 A;  2JBJ A;  4P6Y A;  1F57 A;  2HQY A;  5AG5 A;  4NGM A;  2F7V A;  2OZG A;  4OC5 A;  3VAT A;  4KLV A;  4R9M A;  4F0Y A;  3VWE A;  4ZYQ A;  4U9Z A;  1ZG7 A;  4K3N A;  4KS9 A;  4CGN A;  1IID A;  3FBU A;  5KTC A;  3I1U A;  1PUA A;  2OB0 A;  4C68 A;  3ISX A;  1NSA A;  2CF4 A;  4UIB A;  3S9L A;  4HNW B;  1U6M A;  3H8E A;  4KOR A;  5LRG A;  5AG6 A;  4KVX A;  3L2N A;  1FNO A;  1GHE A;  2BL1 A;  5HXD A;  2Z10 A;  3BI0 A;  4ZX9 A;  1VKC A;  5JGF A;  1Q2Y A;  1V0C A;  4NFR A;  2BEI A;  2QEC A;  1VHO A;  5F49 A;  1YLO A;  3D7F A;  4UFW A;  1ZG9 A;  4CGM A;  3SJX A;  4MMO A;  4X2T A;  5LRJ A;  1PYT B;  4C2X A;  4JYW A;  3KZW A;  3FH4 A;  1Y9K A;  2C6G A;  2PE3 A;  4KOV A;  4MFP A;  5IV0 A;  2G3A A;  2JEW A;  4NGR A;  1YGH A;  1SQH A;  2B4D A;  1PCA A;  3DR6 A;  1IYL A;  1R57 A;  3KQX A;  1XOV A;  4KUB A;  2Q51 A;  4TWE A;  1NE9 A;  4GS4 A;  4E8O A;  3B7I A;  2GU2 A;  4KVO E;  4B5O A;  4ZGY B;  3S6H A;  4TNU A;  3KQZ A;  2RC4 A;  3BJ8 A;  2IJZ A;  3IC1 A;  4MBU A;  3R9E A;  3PP9 A;  5HMN A;  2AFM A;  2V8D A;  2ZW5 A;  4FD4 A;  1F2O A;  1I21 A;  3IWE A;  2CTC A;  4HNX B;  4X3R A;  4M6G A;  4EFD A;  5LYI A;  1TF8 A;  4LX9 A;  2QYV A;  4UEF A;  3R1K A;  4R6T A;  4A33 A;  3DGV A;  2GIV A;  4M6H A;  3TCV A;  1YRE A;  4R3L A;  4BBH A;  2Q0Y A;  2BUE A;  4ORF A;  4MJ8 A;  2JDC A;  4H89 A;  1QMU A;  2YNC A;  5ELY A;  4P4B A;  4IK2 A;  3FJU A;  2O28 A;  4C7H A;  2C6P A;  2A4N A;  2Q4Z A;  3D7H A;  4UCM A;  4R3K A;  2YNE A;  1YVK A;  2JEV A;  1ON0 A;  1Z8T A;  4FUU A;  3PGP A;  1IIC A;  1MJ9 A;  2B58 A;  3OWC A;  2Q4V A;  2FCK A;  1HDU A;  3TT2 A;  4NGQ A;  2ARH A;  3B3S A;  4H6U A;  4MCP A;  2AFS A;  5HVF A;  5H84 A;  3EO4 A;  4A39 A;  3CXP A;  5F46 A;  3GKR A;  2BOA A;  3IFE A;  1S60 A;  1ARL A;  2ZEH A;  3G3S A;  4MY3 A;  4MFJ A;  4CPA A;  1ZLI A;  2OOT A;  2PRQ A;  3VAR A;  2WSA A;  3DLJ A;  5I4M A;  2EBJ A;  4QC6 A;  3TO9 A;  1WK4 A;  2REF A;  4L8A A;  3B3V A;  5CPA A;  3TTH A;  2CXA A;  3SI1 A;  3R9F A;  4F8Z A;  2ZED A;  2VQY A;  1DTD A;  4PSX A;  4AXV A;  2F5I A;  3GIU A;  4B12 A;  4OC3 A;  4RI1 A;  4EVY A;  4JZ0 A;  4XPD C;  3KHX A;  3LD2 A;  4OP4 A;  3NE7 A;  3NH8 A;  1ELM P;  4MXU A;  1KWM A;  4WJB A;  4YWY A;  4C7I A;  4KZT A;  4XPK A;  2FIA A;  3E0K A;  2I00 A;  1Z4R A;  1I1D A;  2EVN A;  5JM6 A;  4B10 A;  3IU1 A;  4NGS A;  2YGW A;  3EC4 A;  4M6I A;  2EO8 A;  3BJ7 A;  3D66 A;  4A30 A;  3H8G A;  2I79 A;  4AG9 A;  1MJB A;  3S9N A;  1YW6 A;  3WAB A;  4P4J A;  4CYN A;  5CBM A;  1WWZ A;  2R98 A;  3KHZ A;  3T8W A;  2OZH A;  5E96 A;  2VZY A;  2GE3 A;  3PB9 X;  4M85 A;  2REE A;  2DF5 A;  3PEI A;  3RYO A;  2PRB A;  3GB0 A;  1EE3 P;  1IU8 A;  1HEE A;  3QB8 A;  1Y7R A;  5F47 A;  3DDD A;  2I3C A;  3GYA A;  2Y0M A;  3KKW A;  2AFO A;  4ZI6 A;  4QBJ A;  5G22 A;  3TOB A;  3A9L A;  4BMH A;  4CAE A;  1YVO A;  1LAM A;  1DE4 C;  2ABZ A;  2OZU A;  3LWU A;  4JXQ A;  2ZEO A;  2GRE A;  3H8F A;  1OZP A;  3PFE A;  4YGO A;  2VEZ A;  4RS2 A;  2Q43 A;  2PSW A;  4DJL A;  5K8M A;  1S7K A;  2QML A;  2GFQ A;  3TO6 A;  2HB6 A;  1FT7 A;  2Q04 A;  3IWG A;  1XBU A;  5K8P A;  3PB6 X;  2CNT A;  3BXM A;  4B5P B;  3IU2 A;  4MCR A;  5D8N A;  5DS0 A;  2PVV A;  4YFJ A;  4PQA A;  4R8F A;  3FX6 A;  3SI0 A;  4YU9 A;  5EMI A;  1R3N A;  3IO1 A;  3QAY A;  4UCN A;  5JPH A;  1ZG8 A;  3FMC A;  1Q2D A;  4E2A A;  5IX3 A;  1RTQ A;  1QSO A;  3I9S A;  1ARM A;  1IOI A;  5ISV A;  4Q38 A;  4PSW A;  5I0C A;  3V38 A;  3ZZI A;  2NSM A;  3TOA A;  4OC4 A;  2R1I A;  4EME A;  3BI1 A;  4C2Y A;  5DWN A;  1J4J A;  2F8H A;  3JTK A;  2ZW7 A;  2J8M A;  3DSB A;  3HUV A;  1N71 A;  1ZLH A;  2AFW A;  4ONW A;  1Y7E A;  4OKO A;  3MN8 A;  1XIX A;  1KUY A;  5DWM A;  2H5M A;  2VI7 A;  4ONU A;  5H86 A;  3H5Z A;  3MRU A;  5J8F A;  1QST A;  1AUG A;  1YR0 A;  2BO9 A;  1LFW A;  1XF8 A;  3DNS A;  1S3Z A;  3WC7 A;  4A38 A;  1YK3 A;  3WC5 A;  4P4F A;  1F2P A;  2PC1 A;  4CAW A;  4QUS A;  4MHD A;  2EUI A;  3EXN A;  4XNH C;  2YND A;  3FYN A;  1M1D A;  1NMT A;  1QQ9 A;  1UWY A;  3F8K A;  2DPT A;  3TFY A;  3GLJ A;  2C6C A;  3B2Y A;  2B4D B; 
#chains in the Genus database with same CATH homology
 4KSI A;  2PJ3 A;  3RAM A;  3ISZ A;  4P4D A;  3PB8 X;  2G9D A;  4R7M A;  1CBX A;  2V8G A;  4FAI A;  1XRY A;  1JQG A;  1XMB A;  3LMS A;  4UEE A;  4P45 A;  2V8V A;  3IJ3 A;  3JRU A;  1YME A;  3K9T A;  1LCP A;  2ZOF A;  1OBR A;  4DYO A;  4MRI A;  3IWW A;  2V77 A;  3SJG A;  3SI2 A;  2C1C A;  1XJO A;  4A37 A;  3QNV A;  3VH9 A;  1TKH A;  2PJA A;  4MCQ A;  4PXD A;  4Z65 A;  2IQ6 A;  3TC8 A;  2GLF A;  3TX8 A;  4FWU A;  2RFH A;  5J1Q A;  5D29 A;  2PJ8 A;  2PJB A;  3IEH A;  4OME A;  3FEE A;  2PJ2 A;  4OID A;  3K2K A;  8CPA A;  2PJ0 A;  1M4L A;  5LYL A;  1IGB A;  4MCS A;  1CP6 A;  2EWB A;  4NJR A;  4O23 A;  4LQG A;  4UIA A;  2O53 A;  1TXR A;  4G1P A;  3B3W A;  3D4U A;  2HC9 A;  5LRK A;  3KAS A;  5K8O A;  3SJE A;  3BHX A;  4MHP A;  1Y0Y A;  4ZX8 A;  4BD9 A;  3FED A;  3FEC A;  5HVG A;  4EWT A;  5JH9 A;  4Q7A A;  3RBU A;  2EK9 A;  1LOK A;  2ZEG A;  3D7G A;  4PPZ A;  2JBK A;  3IIB A;  1Y0R A;  4RUH A;  1ELL P;  3NH5 A;  4NGT A;  3B3T A;  1Z5R A;  2EK8 A;  4PXB A;  2WZN A;  2FVG A;  1Z2L A;  2AFU A;  1TF9 A;  1BAV A;  3FF3 A;  1Q7L A;  3HLP A;  1CPX A;  2POK A;  2XEF A;  2XEI A;  3S9M A;  3GUX A;  1CG2 A;  2ZEE A;  4FBE A;  3B35 A;  4P44 A;  4PXE A;  3CT9 A;  4ZY0 A;  3PBB A;  3KR5 A;  1XFO A;  2OR4 A;  1CPS A;  3FVL A;  4UEZ A;  4P4E A;  1BPM A;  3D68 A;  3KI9 A;  2PIZ A;  1CX8 A;  1IY7 A;  4PXC A;  1LAN A;  2ANP A;  1VIX A;  3CPA A;  2BCO A;  4H2K A;  2XEJ A;  4MHN A;  2IMO A;  2PIY A;  4IHM A;  5LYF A;  1VGY A;  1LAP A;  4W9Y A;  4A94 A;  3RZA A;  2J9A A;  5K8N A;  4NGN A;  2O4H A;  1R43 A;  1BPN A;  4P4I A;  3PBE A;  2VL1 A;  3NA6 A;  2ZEM A;  1HDQ A;  3NFZ A;  1AYE A;  1TKJ A;  2GLJ A;  4ZY2 A;  3V7Z A;  2PJ9 A;  3PFO A;  1H8L A;  1BLL E;  3PB4 X;  6CPA A;  5IB9 A;  5THW A;  2XEG A;  2NYQ A;  3CDX A;  2QVP A;  3CPX A;  4R76 A;  1VHE A;  2PCU A;  4OC0 A;  4B6Z A;  3B3C A;  2AFZ A;  4ZY1 A;  3KGQ A;  7CPA A;  4F9U A;  2PJ5 A;  2PJ1 A;  2CIJ A;  2ZOG A;  5F09 A;  3PB7 X;  1AMP A;  2PJ6 A;  4IAV A;  3D67 A;  2CTB A;  3N5F A;  4NJQ A;  2ZEP A;  1YW4 A;  2V8H A;  3KR4 A;  1YSJ A;  3KL9 A;  4NGP A;  3WT4 A;  1Z8L A;  3WC6 A;  2DEA A;  4MHZ A;  3SJF A;  4MHY A;  3D7D A;  2QJ8 A;  5LYD A;  3NH4 A;  4OC1 A;  5HVH A;  4OC2 A;  4DUK A;  2PJC A;  2ZEF A;  4OIW A;  2PJ4 A;  3PRT A;  4X8I A;  1TKF A;  2AFX A;  4F9V A;  1GYT A;  2WYR A;  2ZEL A;  4UF4 A;  4WWV A;  4P10 A;  2PJ7 A;  2PVW A;  2ZEN A;  2RB7 A;  1CP7 A;  4GM5 A;  2JBJ A;  4P6Y A;  1F57 A;  4NGM A;  2F7V A;  3VAT A;  4OC5 A;  4ZYQ A;  1ZG7 A;  4K3N A;  3I1U A;  3ISX A;  1NSA A;  2CF4 A;  4UIB A;  3S9L A;  3H8E A;  5LRG A;  3L2N A;  1FNO A;  5HXD A;  3BI0 A;  4ZX9 A;  5JGF A;  4NFR A;  1VHO A;  1YLO A;  3D7F A;  1ZG9 A;  3SJX A;  4MMO A;  4X2T A;  5LRJ A;  1PYT B;  4JYW A;  3KZW A;  3FH4 A;  2PE3 A;  2C6G A;  2JEW A;  4NGR A;  1PCA A;  3KQX A;  2Q51 A;  4TWE A;  3B7I A;  2GU2 A;  4TNU A;  3KQZ A;  2IJZ A;  3IC1 A;  2AFM A;  2V8D A;  1F2O A;  2CTC A;  4X3R A;  4EFD A;  5LYI A;  1TF8 A;  2QYV A;  4UEF A;  4R6T A;  3DGV A;  1QMU A;  5ELY A;  4P4B A;  4IK2 A;  3FJU A;  2C6P A;  2Q4Z A;  3D7H A;  4FUU A;  1HDU A;  4NGQ A;  3B3S A;  4MCP A;  5HVF A;  2AFS A;  4A39 A;  2BOA A;  3IFE A;  1ARL A;  2ZEH A;  4CPA A;  1ZLI A;  2OOT A;  2PRQ A;  3VAR A;  3DLJ A;  5I4M A;  3B3V A;  5CPA A;  3SI1 A;  4F8Z A;  2ZED A;  1DTD A;  4AXV A;  4OC3 A;  4JZ0 A;  3KHX A;  4OP4 A;  3NH8 A;  1ELM P;  4MXU A;  1KWM A;  4WJB A;  4YWY A;  5JM6 A;  4NGS A;  3D66 A;  3H8G A;  3S9N A;  1YW6 A;  3WAB A;  4P4J A;  5CBM A;  3KHZ A;  3T8W A;  3PB9 X;  3PEI A;  3GB0 A;  1EE3 P;  1HEE A;  2I3C A;  2AFO A;  4ZI6 A;  1LAM A;  1DE4 C;  2ABZ A;  3LWU A;  2ZEO A;  2GRE A;  3H8F A;  3PFE A;  2Q43 A;  4DJL A;  5K8M A;  2HB6 A;  1FT7 A;  1XBU A;  5K8P A;  3PB6 X;  3BXM A;  4MCR A;  5D8N A;  5DS0 A;  2PVV A;  4PQA A;  4R8F A;  3FX6 A;  3SI0 A;  4YU9 A;  1R3N A;  3IO1 A;  1ZG8 A;  3FMC A;  1RTQ A;  1ARM A;  3V38 A;  2NSM A;  4OC4 A;  4EME A;  3BI1 A;  2F8H A;  3HUV A;  1ZLH A;  2AFW A;  4ONW A;  1Y7E A;  4OKO A;  3MN8 A;  3MRU A;  2BO9 A;  1LFW A;  3WC7 A;  4A38 A;  3WC5 A;  4P4F A;  1F2P A;  1UWY A;  1QQ9 A;  3GLJ A;  2C6C A;  3B2Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...