5G20A

Leishmania major n-myristoyltransferase in complex with a quinoline inhibitor (compound 19).
Total Genus 123
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
123
sequence length
411
structure length
411
Chain Sequence
AHAFWSTQPVPQTEDETEKIVFAGPMDEPKTVADIPEEPYPIASTFEWWTPNMEAADDIHAIYELLRDNYVEDDDSMFRFNYSEEFLQWALCPPNYIPDWHVAVRRKADKKLLAFIAGVPVTLRMGTPKYMKVKAQEKGEGEEAAKYDEPRHICEINFLCVHKQLREKRLAPILIKEATRRVNRTNVWQAVYTAGVLLPTPYASGQYFHRSLNPEKLVEIRFSGIPAQYQKFQNPMAMLKRNYQLPSAPKNSGLREMKPSDVPQVRRILMNYLDSFDVGPVFSDAEISHYLLPRDGVVFTYVVENDKKVTDFFSFYRIPSTVIGNSNYNLLNAAYVHYYAATSIPLHQLILDLLIVAHSRGFDVCNMVEILDNRSFVEQLKFGAGDGHLRYYFYNWAYPKIKPSQVALVML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords GLYCYLPEPTIDE N-TETRADECANOYLTRANSFERASE
publication title Structure-guided optimization of quinoline inhibitors of Plasmodium N-myristoyltransferase.
pubmed doi rcsb
source organism Leishmania major
total genus 123
structure length 411
sequence length 411
ec nomenclature ec 2.3.1.97: Glycylpeptide N-tetradecanoyltransferase.
pdb deposition date 2016-04-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01233 NMT Myristoyl-CoA:protein N-myristoyltransferase, N-terminal domain
A PF02799 NMT_C Myristoyl-CoA:protein N-myristoyltransferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.170 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 5g20A00
4A31A 5A27A 4CGOA 4B12A 2YNCC 3IWEA 4CAFA 4C2YA 5AG4A 3H5ZA 4CGMA 4C68A 2WSAA 4CGPA 5G20A 4A33A 2YNDA 4A2ZA 4C2ZA 4CGLA 4B13A 4UFXA 4UCPA 5G1ZA 5AG5A 5G22A 2YNEA 4C7HA 4CYQA 2WUUA 4UCNA 4B10A 4B11A 5A28A 4UCMA 4A95A 4BBHA 4CYNA 4CYOA 2YNCA 4UFVA 5AG7A 3IU2A 3JTKA 4A30A 4B14A 4C2XA 3IU1A 5G21A 4A32A 5AG6A 5AGEA 4CGNA 4CYPA 4C7IA 4CAEA 4UFWA
chains in the Genus database with same CATH superfamily
3VATA 3T9YA 3S9LA 1R3NA 3SJEA 4IUSA 1ZG7A 3D7HA 4KOVA 1F2PA 1Q2CA 1XOVA 5LYIA 4M6GA 2VI7A 4ZI6A 2Q4ZA 4PSWA 4HKFA 4UFXA 4XPDB 3RYOA 3VH9A 4GXHA 4KLVA 1TXRA 3BJ8A 5LYDA 1LAMA 3TO9A 4KVOE 2ZPAA 2EK9A 3NFZA 3GY9A 4HNWB 4NFRA 4NGRA 1XEBA 4R3KA 4NEXA 4ZGYB 3A9LA 3JTKA 5F09A 4A94A 4AVCA 1VKCA 2ZXVA 3GUXA 5JQ4A 5G21A 3PZJA 3CXQA 3FXTA 4JWPA 1PU9A 4P10A 5EMIA 4MI4A 4PK2A 4FD4A 5K8MA 1S7KA 2FS5A 1YVKA 2GREA 3D67A 2ZW7A 5IX3A 2CNSA 2ZW6A 5F49A 5KTCA 2F5IA 4KUAA 3PB4X 2ZEFA 5CPAA 4QBJA 2FXFA 2PJ8A 3SI2A 2ARHA 1VHOA 1YGHA 3LMSA 1M4DA 3H8FA 3R9GA 2FVGA 1WWZA 3E0KA 5KTAA 4KOXA 2G9DA 4UWJA 2ABZA 1FT7A 1LOKA 1YQEA 2PR1A 2JDDA 4FD7A 3D3SA 1LAPA 4CPAA 3ZZIA 1ZO0A 4QVTA 3KR4A 2OZHA 2C6PA 2GLFA 3FF3A 1YR0A 4CAWA 2VBQA 1N71A 2Z3OA 4MFQA 3FRMA 4X8IA 3NH4A 4KVME 4PXCA 2J8MA 3HLPA 5K8PA 3FVLA 2B3VA 3KI9A 5DS0A 4A39A 4A37A 3EC4A 2FE7A 5F46A 4ZBGA 4C2ZA 2CXAA 3FECA 2Q4VA 2ZW4A 1R57A 2B3UA 4KOUA 1MJ9A 4AG7A 2ZEPA 3LODA 2VZYA 2FIWA 2Z3MA 4G1PA 1HDUA 5F48A 4PXEA 4QC6A 2CTCA 4ZX9A 3LWUA 3K9UA 1YVOA 3BJ7A 2IMOA 1MJAA 1LCPA 1QSNA 1I21A 2ANPA 3B8GA 4JZ0A 4LQGA 1IU8A 4AVAA 4NGSA 2Q51A 3DNSA 2O53A 3BXMA 2AE6A 2EWBA 1ON0A 2GANA 3T8WA 2Y0MA 3D7DA 2DXQA 2V8VA 2CTBA 3IWEA 3JRUA 1Y7RA 4U9ZA 3TO7A 2C27A 2DF5A 1B6BA 3GB0A 3PGPA 3ISZA 4NSQA 4KORA 1Y0YA 4CGLA 1OBRA 1AUGA 3S6HA 4QB9A 4C7HA 2BUEA 2ZEGA 1YLOA 4NGNA 3TO6A 2EVNA 2G3AA 2HB6A 2RC4A 2V77A 4MBUA 4B11A 2ZW5A 3PB8X 4XPLA 2Q0YA 1S60A 2XEFA 4BMHA 1Y9WA 4NJQA 4Q7AA 1JWQA 4DYOA 2VZZA 5ISVA 1PYTB 3PFOA 1Z5RA 1IGBA 3G8WA 4YWYA 2VEZA 5D8NA 4GM5A 4CAEA 3RZAA 2PVWA 4QUSA 5I4MA 5K8OA 3EFAA 4P4FA 4II9A 4IHMA 1MK4A 3H5ZA 5H84A 3K2KA 4F9UA 3B3VA 2JEVA 4RUHA 5G20A 2NYQA 2NMTA 4A2ZA 1WK4A 1RO5A 2PCUA 4B13A 2JEWA 5AG5A 1KUVA 5G1ZA 5G22A 3I3GA 3FJUA 1IY7A 1MJBA 1Y0RA 1Y7EA 1XIXA 2B4DA 3MRUA 1CG2A 4JYWA 5HXDA 4MHYA 4Q36A 2AFZA 2AJ6A 3W6SA 1LRZA 3B2YA 1DE4C 3BLNA 3IU2A 1YK3A 2PVVA 3WC7A 1QSOA 3SI0A 1YMEA 1Z4RA 2FCKA 2CIJA 4EMEA 1P4NA 5IB9A 2B58A 3PP9A 1R43A 4CYPA 1NE9A 4UWIA 3D7GA 4OP4A 4PK3A 4UFWA 3S9NA 4J3GA 3DR6A 4MY3A 4ZY0A 2R98A 4CRZB 5I0CA 5H86A 3PB9X 1M44A 3LACA 3P2HA 4K30A 5CBMA 5FVJA 1CPSA 2H5MA 4MJ8A 4R6TA 3QB8A 1CBXA 1UFHA 1CX8A 2PSWA 5C82A 2P6FA 4Y49C 4KOSA 4FAIA 3SI1A 2ZEEA 2PQ8A 1TF8A 3CXPA 3KKWA 3S6GA 2X7BA 4BBHA 3TOAA 4CYOA 2ZEMA 2F8HA 4IF5A 5AG7A 4H6UA 4R76A 4B5PA 4DJLA 5IB0A 5J8FA 3G3SA 1ZLHA 5J8CA 4P44A 3BI0A 1NMTA 1H8LA 4OKOA 4MFLA 4ZY2A 4OADA 2OZUA 2B4DB 3VARA 2O4HA 4R8FA 3H8EA 5IV0A 2BL1A 4L89A 3IJ3A 3IWGA 4OAEA 2QMLA 2WZNA 4H6ZA 2P6GA 4F9VA 3RBUA 4YGOA 1XFOA 5LRGA 1CM0A 2FL4A 2K5TA 2I3CA 4UBRA 2JBJA 4Y49B 3KASA 4F0XA 2F7VA 1YW4A 3WABA 4KSIA 1ARLA 4P4BA 4MXUA 3CPAA 4UA3A 4A95A 2QECA 2PJ5A 4UFVA 4O23A 4MCQA 5LYFA 2XEGA 4EFDA 3PB6X 1KWMA 1M1DA 2R7HA 4PXDA 4P4DA 2NSMA 4KOYA 3TC8A 2Z3PA 4UIBA 1KZFA 2PJBA 2ZOFA 3BHXA 3KQXA 3FB3A 3RNZA 4P6YA 4B5OA 4RS2A 5C88A 3FBUA 4H2KA 1XJOA 2ZEDA 2IJZA 4FUUA 4RN7A 2CNMA 4TNUA 2PJ6A 4B5PB 4NJRA 4FBEA 4NGQA 5CNPA 4YU9A 2R1IA 4CRYB 1X12A 2J8NA 4M6HA 1B87A 2QYVA 1QMUA 3P2FA 4PSXA 5HVGA 1QSMA 4A38A 2WPXA 3FMCA 2OH1A 1LFWA 5GCNA 2Z10A 4B6ZA 4FWUA 5A28A 1VIXA 4P4EA 4X2TA 2P6EA 4IK2A 2PRQA 1Z4EA 1CJWA 2HC9A 1X10A 3JVNA 3W91A 2Q44A 2DPTA 4ZY1A 2GU2A 2PRBA 1XE4A 4R87A 3TT2A 1QSRA 4OC2A 1EE3P 4EVYA 1Z8LA 4YRHA 3TTHA 5J1QA 2J8RA 4ZYQA 2CY2A 4A31A 5JGFA 2G0BA 4KLWA 3R9EA 1I12A 2Z3KA 1PUAA 1HEEA 3H4QA 4KUBA 2AFXA 2YNDA 3LD2A 5LRKA 1IOIA 1TKJA 2ZEOA 2QIRA 3IC1A 2PJCA 2ZENA 4RI1A 2PDOA 4NGMA 4CYQA 1QSTA 2OR4A 4ORFA 2FT0A 1KUYA 3FH4A 4MFZA 5JM6A 3QNVA 1F2OA 1Q2DA 4MMOA 4CS0B 3B3WA 2C1CA 3IWWA 2EUIA 2FSRA 2PC1A 1U6MA 2EO8A 4NF1A 4MHNA 3WT4A 4CGNA 5BWAB 2HV2A 4XPKA 3IFEA 3PEIA 2R8VA 2PJ1A 5DWNA 1BPMA 2POKA 4KOWA 1Z9UA 4Q38A 2GE3A 1BOBA 3PRTA 3VWDA 4C68A 2REEA 2ZELA 4BINA 3ISXA 3S6FA 4I49A 2V8DA 2BOAA 1S5KA 4KVXA 1Y9KA 2DEAA 3SHPA 1CP6A 3H8GA 3GLJA 4MRIA 3SJXA 4B10A 2V8GA 4YFJA 3PFEA 3B7IA 2YGWA 4M3SA 4WWVA 3TOBA 4XNHC 2WYRA 4FD5A 2CNTA 2AFWA 4R57A 2I00A 2JBKA 5AGEA 2PIZA 3WC5A 2IQ6A 1HDQA 4MCRA 4TWEA 2D4PA 4P4JA 4WJBA 3KL9A 2BCOA 2VL1A 2VQYA 3C26A 3GYAA 2VXKA 4HPSA 2I79A 3CT9A 3KR5A 4U5YA 2WSAA 3TE4A 3NH5A 4JJXA 4E8OA 3GKRA 4JXQA 3K9TA 3B3TA 1VHEA 2ZEHA 1I1DA 3NE7A 4UCPA 1M4GA 2PR8A 3D4UA 3PB7X 4H89A 4ONWA 2Q4YA 1IB1E 2A4NA 1RTQA 2J9AA 4XNHB 2DPSA 4UEEA 3FEDA 1CP7A 1FY7A 2HUZA 2PJ3A 1BAVA 2Q43A 3FNCA 3I1UA 4NCZA 2RB7A 3D68A 1ELLP 2XEJA 4K3NA 2OOTA 3D2PA 1BPNA 4Z65A 3N7ZA 2GIVA 3CXSA 5A27A 1IYLA 2Q04A 1YW6A 4UEFA 2EK8A 4UF4A 3T90A 4CAFA 4CGOA 1ZG9A 1DTDA 7CPAA 3TFYA 1QQ9A 4U9YA 3ZJ0A 3IEHA 1XMTA 2XEIA 1S7NA 1M4LA 2HQYA 3FIXA 3KHXA 4KOTA 2GFQA 3SJFA 5EC4A 3CDXA 2AFMA 3UY5A 3DGVA 4MHDA 2C6GA 4AG9A 1PCAA 2YNCA 3FX6A 4A30A 5KTDA 1GYTA 1ZLIA 3EO4A 4PV6A 2V8HA 4ONUA 2G3TA 4A32A 1P0HA 5D29A 3GIUA 3B3SA 4C7IA 1TF9A 3TX8A 4KSFA 1NSAA 2Z11A 3DSBA 2BEIA 2Z0ZA 2B4BA 3EXNA 4M6IA 3V7ZA 2RFHA 1SQHA 2YNCC 4B12A 4KZTA 4C2YA 3D7FA 1YREA 4KS9A 3S9MA 3NH8A 3JUWA 4CGPA 3R1KA 4A33A 3IIBA 2Z3NA 1AMPA 3KGQA 4JXRA 1IICA 2WPWA 4R9MA 1YX0A 1F57A 4HNXB 4M85A 2YNEA 3DLJA 3FEEA 1TKFA 5LRJA 2CF4A 4HNYB 4OC4A 3V8IA 1GHEA 2ATRA 4BD9A 4AB7A 3W6XA 4X5KA 3B3CA 4MFJA 3TCVA 3KQZA 3VWEA 2GLJA 5HVHA 4MCPA 3SXOA 2KCWA 3BI1A 3D66A 3R9FA 1XBUA 1IIDA 1S3ZA 2PJ2A 4CAVA 3DDDA 3RAMA 4OIDA 4F6AA 4LUAA 5F47A 3R96A 5E96A 2QVPA 2JDCA 1TIQA 4F8ZA 5AG4A 3SXNA 4IAVA 3CZXA 2IL4A 1Q2YA 4CGMA 3L2NA 4E2AA 2REFA 2OZGA 1S7LA 4P45A 2PJAA 5HMNA 1OZPA 2PIYA 2Z3LA 3NA6A 1A2ZA 4E0AA 2B5GA 3NE8A 4PXBA 1YLEA 1BLLE 4MY0A 3I9SA 3WC6A 2OB0A 5JH9A 5K8NA 3IO1A 3FYNA 5HH1A 1XRYA 6CPAA 1FNOA 3F5BA 4B14A 3F0AA 1IOFA 4OC3A 1YSJA 4NGTA 4R7MA 3R95A 3IU1A 3RO0A 2BO9A 2EBJA 3DR8A 5DWMA 4OMEA 4DUKA 2AFSA 1V0CA 1IYKA 1VHSA 2P0WA 4LQ6A 2QJ8A 3SJGA 2C6CA 5THWA 1ELMP 1Z8WA 1L0CA 1Z8XA 4MFPA 4UEZA 4R3LA 2PJ4A 5EBVA 8CPAA 2D4OA 4MCSA 4L8AA 3IGRA 1Z8TA 1CPXA 4OLLA 4OC1A 2WUUA 1BO4A 1LANA 2FIAA 4UIAA 2AFOA 4UCNA 3KZWA 4FD6A 3PBEA 5JPHA 4UCMA 3WR7A 4CYNA 1JQGA 1AYEA 2B5GB 4PQAA 4AVBA 3QAHA 2Q7BA 4OIWA 4KSAA 1K4JA 3CPXA 4GS4A 3EY5A 1RXTA 1KUXA 5HVFA 4W9YA 2OU2A 4MFKA 1TKHA 1UWYA 5LYLA 4MHZA 4NGPA 4X3RA 1J4JA 4EWTA 4JD6A 1VGYA 2AFUA 2ODFA 2JLMA 3B35A 2BSWA 4P4IA 4CAXA 4DNCA 1S7FA 2ZOGA 3N5FA 4OC5A 2Q7SA 3F8KA 2PJ0A 3OWCA 3PBBA 1M4IA 1XF8A 4OC0A 4PPZA 4XPDC 2O28A 3V38A 3D2MA 3HUVA 1XMBA 2PE3A 4LX9A 4JLYA 3MN8A 4NXYA 5ELYA 1Q7LA 4C2XA 2PJ7A 1NSLA 4AXVA 1ARMA 1ZG8A 4F0YA 3KHZA 4ZX8A 5AG6A 3S6KA 2PJ9A 3D8PA 4MHPA 3QAYA 1Z2LA 3MGDA
chains in the Genus database with same CATH topology
3T9YA 4IUSA 4KOVA 1Q2CA 2VI7A 4PSWA 4HKFA 4UFXA 4XPDB 3RYOA 4KLVA 3BJ8A 3TO9A 4KVOE 2ZPAA 4HNWB 3GY9A 1XEBA 4R3KA 4NEXA 4ZGYB 3A9LA 3JTKA 4AVCA 1VKCA 2ZXVA 5JQ4A 5G21A 4JWPA 3CXQA 3FXTA 3PZJA 1PU9A 4MI4A 4PK2A 4FD4A 1S7KA 2FS5A 1YVKA 2ZW7A 5IX3A 2CNSA 2ZW6A 5F49A 5KTCA 2F5IA 4KUAA 4QBJA 2FXFA 2ARHA 1YGHA 1M4DA 3R9GA 1WWZA 3E0KA 5KTAA 4KOXA 4UWJA 2PR1A 2JDDA 4FD7A 3D3SA 3ZZIA 1ZO0A 4QVTA 2OZHA 1YR0A 4CAWA 2VBQA 1N71A 2Z3OA 4MFQA 3FRMA 4KVME 2J8MA 2B3VA 3EC4A 2FE7A 5F46A 4ZBGA 4C2ZA 2CXAA 2Q4VA 2ZW4A 1R57A 2B3UA 4KOUA 1MJ9A 4AG7A 3LODA 2VZYA 2FIWA 2Z3MA 5F48A 4QC6A 3K9UA 1YVOA 3BJ7A 1MJAA 3B8GA 1QSNA 1I21A 4AVAA 3DNSA 2AE6A 2GANA 1ON0A 2Y0MA 2DXQA 3IWEA 3TO7A 1Y7RA 4U9ZA 2C27A 1B6BA 3PGPA 4NSQA 4KORA 4CGLA 3S6HA 4QB9A 4C7HA 2BUEA 3TO6A 2EVNA 2G3AA 2RC4A 4MBUA 4B11A 2ZW5A 4XPLA 2Q0YA 1S60A 4BMHA 1Y9WA 5ISVA 2VZZA 3G8WA 2VEZA 4CAEA 4QUSA 3EFAA 4II9A 5H84A 1MK4A 3H5ZA 2JEVA 5G20A 2NMTA 4A2ZA 1WK4A 1RO5A 4B13A 5G1ZA 5AG5A 1KUVA 5G22A 3I3GA 1MJBA 1XIXA 2B4DA 4Q36A 2AJ6A 3W6SA 1LRZA 3BLNA 3IU2A 1YK3A 1QSOA 1Z4RA 2FCKA 1P4NA 2B58A 3PP9A 4CYPA 1NE9A 4UWIA 4UFWA 4PK3A 4J3GA 3DR6A 4MY3A 2R98A 4CRZB 5I0CA 5H86A 1M44A 3P2HA 4K30A 5FVJA 2H5MA 4MJ8A 3QB8A 1UFHA 2PSWA 5C82A 2P6FA 4Y49C 4KOSA 2PQ8A 3KKWA 3CXPA 3S6GA 2X7BA 4BBHA 3TOAA 4CYOA 4IF5A 5AG7A 4H6UA 4B5PA 5J8FA 5IB0A 3G3SA 5J8CA 1NMTA 4MFLA 4OADA 2OZUA 2B4DB 5IV0A 2BL1A 4L89A 3IWGA 4OAEA 2QMLA 4H6ZA 2P6GA 4YGOA 1CM0A 2FL4A 2K5TA 4UBRA 4Y49B 4F0XA 4UA3A 4A95A 2QECA 4UFVA 1M1DA 2R7HA 4KOYA 2Z3PA 1KZFA 3FB3A 4B5OA 4RS2A 5C88A 3FBUA 4B5PB 2CNMA 5CNPA 4CRYB 2R1IA 2J8NA 1B87A 3P2FA 1QSMA 2WPXA 2OH1A 5GCNA 2Z10A 5A28A 2P6EA 1Z4EA 1CJWA 3JVNA 3W91A 2Q44A 2DPTA 2PRBA 1XE4A 4R87A 3TT2A 1QSRA 4EVYA 4YRHA 3TTHA 2J8RA 2CY2A 4A31A 2G0BA 4KLWA 3R9EA 1I12A 2Z3KA 1PUAA 3H4QA 4KUBA 2YNDA 3LD2A 2QIRA 4RI1A 2PDOA 4CYQA 1QSTA 4ORFA 2FT0A 1KUYA 4MFZA 1Q2DA 4CS0B 2EUIA 2FSRA 2PC1A 1U6MA 4CGNA 4NF1A 5BWAB 2HV2A 4XPKA 2R8VA 5DWNA 4KOWA 1Z9UA 4Q38A 2GE3A 1BOBA 3VWDA 4C68A 2REEA 3S6FA 4I49A 1S5KA 4KVXA 1Y9KA 3SHPA 4B10A 4YFJA 2YGWA 4M3SA 3TOBA 4XNHC 4FD5A 2CNTA 4R57A 2I00A 5AGEA 2D4PA 2VQYA 3C26A 3GYAA 2VXKA 2I79A 4U5YA 2WSAA 3TE4A 4JJXA 4E8OA 3GKRA 4JXQA 1I1DA 3NE7A 4UCPA 1M4GA 2PR8A 4H89A 2Q4YA 1IB1E 2A4NA 4XNHB 2DPSA 1FY7A 2HUZA 3FNCA 4NCZA 3D2PA 3N7ZA 2GIVA 3CXSA 5A27A 1IYLA 2Q04A 4CGOA 3T90A 4CAFA 3TFYA 4U9YA 3ZJ0A 1XMTA 1S7NA 2HQYA 3FIXA 4KOTA 5EC4A 3UY5A 4MHDA 4AG9A 2YNCA 4A30A 5KTDA 3EO4A 4PV6A 4ONUA 2G3TA 4A32A 1P0HA 4C7IA 4KSFA 2Z11A 3DSBA 2BEIA 2Z0ZA 2B4BA 3EXNA 4B12A 1SQHA 2YNCC 4KZTA 4C2YA 1YREA 4KS9A 3JUWA 4CGPA 3R1KA 4A33A 2Z3NA 4JXRA 4R9MA 1IICA 2WPWA 1YX0A 4HNXB 4M85A 2YNEA 4HNYB 3V8IA 1GHEA 2ATRA 4AB7A 3W6XA 4X5KA 4MFJA 3TCVA 3VWEA 3SXOA 2KCWA 3R9FA 1IIDA 1S3ZA 4CAVA 3DDDA 4F6AA 4LUAA 5F47A 3R96A 5E96A 2JDCA 1TIQA 5AG4A 3SXNA 4E2AA 2IL4A 1Q2YA 4CGMA 2REFA 2OZGA 1S7LA 5HMNA 1OZPA 2Z3LA 4E0AA 2B5GA 1YLEA 4MY0A 3I9SA 2OB0A 5HH1A 3FYNA 3F5BA 4B14A 3F0AA 3R95A 3IU1A 5DWMA 3DR8A 1V0CA 1IYKA 1VHSA 2P0WA 1L0CA 4MFPA 4R3LA 5EBVA 2D4OA 4L8AA 3IGRA 4OLLA 2WUUA 1BO4A 2FIAA 4UCNA 4FD6A 5JPHA 4UCMA 3WR7A 4CYNA 2B5GB 4AVBA 3QAHA 2Q7BA 4KSAA 1K4JA 4GS4A 3EY5A 1RXTA 1KUXA 2OU2A 4MFKA 1J4JA 4JD6A 4CAXA 2JLMA 4DNCA 2BSWA 1S7FA 3F8KA 3OWCA 1M4IA 1XF8A 4XPDC 2O28A 3D2MA 4LX9A 4JLYA 4NXYA 4C2XA 1NSLA 4F0YA 3S6KA 5AG6A 3D8PA 4PSXA 3MGDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A31 A;  5A27 A;  4CGO A;  4B12 A;  2YNC C;  3IWE A;  4CAF A;  4C2Y A;  5AG4 A;  3H5Z A;  4CGM A;  4C68 A;  2WSA A;  4CGP A;  5G20 A;  4A33 A;  2YND A;  4A2Z A;  4C2Z A;  4CGL A;  4B13 A;  4UFX A;  4UCP A;  5G1Z A;  5AG5 A;  5G22 A;  2YNE A;  4C7H A;  4CYQ A;  2WUU A;  4UCN A;  4B10 A;  4B11 A;  5A28 A;  4UCM A;  4A95 A;  4BBH A;  4CYN A;  4CYO A;  2YNC A;  4UFV A;  5AG7 A;  3IU2 A;  3JTK A;  4A30 A;  4B14 A;  4C2X A;  3IU1 A;  5G21 A;  4A32 A;  5AG6 A;  5AGE A;  4CGN A;  4CYP A;  4C7I A;  4CAE A;  4UFW A; 
#chains in the Genus database with same CATH topology
 3VAT A;  3T9Y A;  3S9L A;  1R3N A;  3SJE A;  4IUS A;  1ZG7 A;  3D7H A;  4KOV A;  1F2P A;  1Q2C A;  1XOV A;  5LYI A;  4M6G A;  2VI7 A;  4ZI6 A;  2Q4Z A;  4PSW A;  4HKF A;  4UFX A;  4XPD B;  3RYO A;  3VH9 A;  4GXH A;  4KLV A;  1TXR A;  3BJ8 A;  5LYD A;  1LAM A;  3TO9 A;  4KVO E;  2ZPA A;  2EK9 A;  3NFZ A;  3GY9 A;  4HNW B;  4NFR A;  4NGR A;  1XEB A;  4R3K A;  4NEX A;  4ZGY B;  3A9L A;  3JTK A;  5F09 A;  4A94 A;  4AVC A;  1VKC A;  2ZXV A;  3GUX A;  5JQ4 A;  5G21 A;  3PZJ A;  3CXQ A;  3FXT A;  4JWP A;  1PU9 A;  4P10 A;  5EMI A;  4MI4 A;  4PK2 A;  4FD4 A;  5K8M A;  1S7K A;  2FS5 A;  1YVK A;  2GRE A;  3D67 A;  2ZW7 A;  5IX3 A;  2CNS A;  2ZW6 A;  5F49 A;  5KTC A;  2F5I A;  4KUA A;  3PB4 X;  2ZEF A;  5CPA A;  4QBJ A;  2FXF A;  2PJ8 A;  3SI2 A;  2ARH A;  1VHO A;  1YGH A;  3LMS A;  1M4D A;  3H8F A;  3R9G A;  2FVG A;  1WWZ A;  3E0K A;  5KTA A;  4KOX A;  2G9D A;  4UWJ A;  2ABZ A;  1FT7 A;  1LOK A;  1YQE A;  2PR1 A;  2JDD A;  4FD7 A;  3D3S A;  1LAP A;  4CPA A;  3ZZI A;  1ZO0 A;  4QVT A;  3KR4 A;  2OZH A;  2C6P A;  2GLF A;  3FF3 A;  1YR0 A;  4CAW A;  2VBQ A;  1N71 A;  2Z3O A;  4MFQ A;  3FRM A;  4X8I A;  3NH4 A;  4KVM E;  4PXC A;  2J8M A;  3HLP A;  5K8P A;  3FVL A;  2B3V A;  3KI9 A;  5DS0 A;  4A39 A;  4A37 A;  3EC4 A;  2FE7 A;  5F46 A;  4ZBG A;  4C2Z A;  2CXA A;  3FEC A;  2Q4V A;  2ZW4 A;  1R57 A;  2B3U A;  4KOU A;  1MJ9 A;  4AG7 A;  2ZEP A;  3LOD A;  2VZY A;  2FIW A;  2Z3M A;  4G1P A;  1HDU A;  5F48 A;  4PXE A;  4QC6 A;  2CTC A;  4ZX9 A;  3LWU A;  3K9U A;  1YVO A;  3BJ7 A;  2IMO A;  1MJA A;  1LCP A;  1QSN A;  1I21 A;  2ANP A;  3B8G A;  4JZ0 A;  4LQG A;  1IU8 A;  4AVA A;  4NGS A;  2Q51 A;  3DNS A;  2O53 A;  3BXM A;  2AE6 A;  2EWB A;  1ON0 A;  2GAN A;  3T8W A;  2Y0M A;  3D7D A;  2DXQ A;  2V8V A;  2CTB A;  3IWE A;  3JRU A;  1Y7R A;  4U9Z A;  3TO7 A;  2C27 A;  2DF5 A;  1B6B A;  3GB0 A;  3PGP A;  3ISZ A;  4NSQ A;  4KOR A;  1Y0Y A;  4CGL A;  1OBR A;  1AUG A;  3S6H A;  4QB9 A;  4C7H A;  2BUE A;  2ZEG A;  1YLO A;  4NGN A;  3TO6 A;  2EVN A;  2G3A A;  2HB6 A;  2RC4 A;  2V77 A;  4MBU A;  4B11 A;  2ZW5 A;  3PB8 X;  4XPL A;  2Q0Y A;  1S60 A;  2XEF A;  4BMH A;  1Y9W A;  4NJQ A;  4Q7A A;  1JWQ A;  4DYO A;  2VZZ A;  5ISV A;  1PYT B;  3PFO A;  1Z5R A;  1IGB A;  3G8W A;  4YWY A;  2VEZ A;  5D8N A;  4GM5 A;  4CAE A;  3RZA A;  2PVW A;  4QUS A;  5I4M A;  5K8O A;  3EFA A;  4P4F A;  4II9 A;  4IHM A;  1MK4 A;  3H5Z A;  5H84 A;  3K2K A;  4F9U A;  3B3V A;  2JEV A;  4RUH A;  5G20 A;  2NYQ A;  2NMT A;  4A2Z A;  1WK4 A;  1RO5 A;  2PCU A;  4B13 A;  2JEW A;  5AG5 A;  1KUV A;  5G1Z A;  5G22 A;  3I3G A;  3FJU A;  1IY7 A;  1MJB A;  1Y0R A;  1Y7E A;  1XIX A;  2B4D A;  3MRU A;  1CG2 A;  4JYW A;  5HXD A;  4MHY A;  4Q36 A;  2AFZ A;  2AJ6 A;  3W6S A;  1LRZ A;  3B2Y A;  1DE4 C;  3BLN A;  3IU2 A;  1YK3 A;  2PVV A;  3WC7 A;  1QSO A;  3SI0 A;  1YME A;  1Z4R A;  2FCK A;  2CIJ A;  4EME A;  1P4N A;  5IB9 A;  2B58 A;  3PP9 A;  1R43 A;  4CYP A;  1NE9 A;  4UWI A;  3D7G A;  4OP4 A;  4PK3 A;  4UFW A;  3S9N A;  4J3G A;  3DR6 A;  4MY3 A;  4ZY0 A;  2R98 A;  4CRZ B;  5I0C A;  5H86 A;  3PB9 X;  1M44 A;  3LAC A;  3P2H A;  4K30 A;  5CBM A;  5FVJ A;  1CPS A;  2H5M A;  4MJ8 A;  4R6T A;  3QB8 A;  1CBX A;  1UFH A;  1CX8 A;  2PSW A;  5C82 A;  2P6F A;  4Y49 C;  4KOS A;  4FAI A;  3SI1 A;  2ZEE A;  2PQ8 A;  1TF8 A;  3CXP A;  3KKW A;  3S6G A;  2X7B A;  4BBH A;  3TOA A;  4CYO A;  2ZEM A;  2F8H A;  4IF5 A;  5AG7 A;  4H6U A;  4R76 A;  4B5P A;  4DJL A;  5IB0 A;  5J8F A;  3G3S A;  1ZLH A;  5J8C A;  4P44 A;  3BI0 A;  1NMT A;  1H8L A;  4OKO A;  4MFL A;  4ZY2 A;  4OAD A;  2OZU A;  2B4D B;  3VAR A;  2O4H A;  4R8F A;  3H8E A;  5IV0 A;  2BL1 A;  4L89 A;  3IJ3 A;  3IWG A;  4OAE A;  2QML A;  2WZN A;  4H6Z A;  2P6G A;  4F9V A;  3RBU A;  4YGO A;  1XFO A;  5LRG A;  1CM0 A;  2FL4 A;  2K5T A;  2I3C A;  4UBR A;  2JBJ A;  4Y49 B;  3KAS A;  4F0X A;  2F7V A;  1YW4 A;  3WAB A;  4KSI A;  1ARL A;  4P4B A;  4MXU A;  3CPA A;  4UA3 A;  4A95 A;  2QEC A;  2PJ5 A;  4UFV A;  4O23 A;  4MCQ A;  5LYF A;  2XEG A;  4EFD A;  3PB6 X;  1KWM A;  1M1D A;  2R7H A;  4PXD A;  4P4D A;  2NSM A;  4KOY A;  3TC8 A;  2Z3P A;  4UIB A;  1KZF A;  2PJB A;  2ZOF A;  3BHX A;  3KQX A;  3FB3 A;  3RNZ A;  4P6Y A;  4B5O A;  4RS2 A;  5C88 A;  3FBU A;  4H2K A;  1XJO A;  2ZED A;  2IJZ A;  4FUU A;  4RN7 A;  2CNM A;  4TNU A;  2PJ6 A;  4B5P B;  4NJR A;  4FBE A;  4NGQ A;  5CNP A;  4YU9 A;  2R1I A;  4CRY B;  1X12 A;  2J8N A;  4M6H A;  1B87 A;  2QYV A;  1QMU A;  3P2F A;  4PSX A;  5HVG A;  1QSM A;  4A38 A;  2WPX A;  3FMC A;  2OH1 A;  1LFW A;  5GCN A;  2Z10 A;  4B6Z A;  4FWU A;  5A28 A;  1VIX A;  4P4E A;  4X2T A;  2P6E A;  4IK2 A;  2PRQ A;  1Z4E A;  1CJW A;  2HC9 A;  1X10 A;  3JVN A;  3W91 A;  2Q44 A;  2DPT A;  4ZY1 A;  2GU2 A;  2PRB A;  1XE4 A;  4R87 A;  3TT2 A;  1QSR A;  4OC2 A;  1EE3 P;  4EVY A;  1Z8L A;  4YRH A;  3TTH A;  5J1Q A;  2J8R A;  4ZYQ A;  2CY2 A;  4A31 A;  5JGF A;  2G0B A;  4KLW A;  3R9E A;  1I12 A;  2Z3K A;  1PUA A;  1HEE A;  3H4Q A;  4KUB A;  2AFX A;  2YND A;  3LD2 A;  5LRK A;  1IOI A;  1TKJ A;  2ZEO A;  2QIR A;  3IC1 A;  2PJC A;  2ZEN A;  4RI1 A;  2PDO A;  4NGM A;  4CYQ A;  1QST A;  2OR4 A;  4ORF A;  2FT0 A;  1KUY A;  3FH4 A;  4MFZ A;  5JM6 A;  3QNV A;  1F2O A;  1Q2D A;  4MMO A;  4CS0 B;  3B3W A;  2C1C A;  3IWW A;  2EUI A;  2FSR A;  2PC1 A;  1U6M A;  2EO8 A;  4NF1 A;  4MHN A;  3WT4 A;  4CGN A;  5BWA B;  2HV2 A;  4XPK A;  3IFE A;  3PEI A;  2R8V A;  2PJ1 A;  5DWN A;  1BPM A;  2POK A;  4KOW A;  1Z9U A;  4Q38 A;  2GE3 A;  1BOB A;  3PRT A;  3VWD A;  4C68 A;  2REE A;  2ZEL A;  4BIN A;  3ISX A;  3S6F A;  4I49 A;  2V8D A;  2BOA A;  1S5K A;  4KVX A;  1Y9K A;  2DEA A;  3SHP A;  1CP6 A;  3H8G A;  3GLJ A;  4MRI A;  3SJX A;  4B10 A;  2V8G A;  4YFJ A;  3PFE A;  3B7I A;  2YGW A;  4M3S A;  4WWV A;  3TOB A;  4XNH C;  2WYR A;  4FD5 A;  2CNT A;  2AFW A;  4R57 A;  2I00 A;  2JBK A;  5AGE A;  2PIZ A;  3WC5 A;  2IQ6 A;  1HDQ A;  4MCR A;  4TWE A;  2D4P A;  4P4J A;  4WJB A;  3KL9 A;  2BCO A;  2VL1 A;  2VQY A;  3C26 A;  3GYA A;  2VXK A;  4HPS A;  2I79 A;  3CT9 A;  3KR5 A;  4U5Y A;  2WSA A;  3TE4 A;  3NH5 A;  4JJX A;  4E8O A;  3GKR A;  4JXQ A;  3K9T A;  3B3T A;  1VHE A;  2ZEH A;  1I1D A;  3NE7 A;  4UCP A;  1M4G A;  2PR8 A;  3D4U A;  3PB7 X;  4H89 A;  4ONW A;  2Q4Y A;  1IB1 E;  2A4N A;  1RTQ A;  2J9A A;  4XNH B;  2DPS A;  4UEE A;  3FED A;  1CP7 A;  1FY7 A;  2HUZ A;  2PJ3 A;  1BAV A;  2Q43 A;  3FNC A;  3I1U A;  4NCZ A;  2RB7 A;  3D68 A;  1ELL P;  2XEJ A;  4K3N A;  2OOT A;  3D2P A;  1BPN A;  4Z65 A;  3N7Z A;  2GIV A;  3CXS A;  5A27 A;  1IYL A;  2Q04 A;  1YW6 A;  4UEF A;  2EK8 A;  4UF4 A;  3T90 A;  4CAF A;  4CGO A;  1ZG9 A;  1DTD A;  7CPA A;  3TFY A;  1QQ9 A;  4U9Y A;  3ZJ0 A;  3IEH A;  1XMT A;  2XEI A;  1S7N A;  1M4L A;  2HQY A;  3FIX A;  3KHX A;  4KOT A;  2GFQ A;  3SJF A;  5EC4 A;  3CDX A;  2AFM A;  3UY5 A;  3DGV A;  4MHD A;  2C6G A;  4AG9 A;  1PCA A;  2YNC A;  3FX6 A;  4A30 A;  5KTD A;  1GYT A;  1ZLI A;  3EO4 A;  4PV6 A;  2V8H A;  4ONU A;  2G3T A;  4A32 A;  1P0H A;  5D29 A;  3GIU A;  3B3S A;  4C7I A;  1TF9 A;  3TX8 A;  4KSF A;  1NSA A;  2Z11 A;  3DSB A;  2BEI A;  2Z0Z A;  2B4B A;  3EXN A;  4M6I A;  3V7Z A;  2RFH A;  1SQH A;  2YNC C;  4B12 A;  4KZT A;  4C2Y A;  3D7F A;  1YRE A;  4KS9 A;  3S9M A;  3NH8 A;  3JUW A;  4CGP A;  3R1K A;  4A33 A;  3IIB A;  2Z3N A;  1AMP A;  3KGQ A;  4JXR A;  1IIC A;  2WPW A;  4R9M A;  1YX0 A;  1F57 A;  4HNX B;  4M85 A;  2YNE A;  3DLJ A;  3FEE A;  1TKF A;  5LRJ A;  2CF4 A;  4HNY B;  4OC4 A;  3V8I A;  1GHE A;  2ATR A;  4BD9 A;  4AB7 A;  3W6X A;  4X5K A;  3B3C A;  4MFJ A;  3TCV A;  3KQZ A;  3VWE A;  2GLJ A;  5HVH A;  4MCP A;  3SXO A;  2KCW A;  3BI1 A;  3D66 A;  3R9F A;  1XBU A;  1IID A;  1S3Z A;  2PJ2 A;  4CAV A;  3DDD A;  3RAM A;  4OID A;  4F6A A;  4LUA A;  5F47 A;  3R96 A;  5E96 A;  2QVP A;  2JDC A;  1TIQ A;  4F8Z A;  5AG4 A;  3SXN A;  4IAV A;  3CZX A;  2IL4 A;  1Q2Y A;  4CGM A;  3L2N A;  4E2A A;  2REF A;  2OZG A;  1S7L A;  4P45 A;  2PJA A;  5HMN A;  1OZP A;  2PIY A;  2Z3L A;  3NA6 A;  1A2Z A;  4E0A A;  2B5G A;  3NE8 A;  4PXB A;  1YLE A;  1BLL E;  4MY0 A;  3I9S A;  3WC6 A;  2OB0 A;  5JH9 A;  5K8N A;  3IO1 A;  3FYN A;  5HH1 A;  1XRY A;  6CPA A;  1FNO A;  3F5B A;  4B14 A;  3F0A A;  1IOF A;  4OC3 A;  1YSJ A;  4NGT A;  4R7M A;  3R95 A;  3IU1 A;  3RO0 A;  2BO9 A;  2EBJ A;  3DR8 A;  5DWM A;  4OME A;  4DUK A;  2AFS A;  1V0C A;  1IYK A;  1VHS A;  2P0W A;  4LQ6 A;  2QJ8 A;  3SJG A;  2C6C A;  5THW A;  1ELM P;  1Z8W A;  1L0C A;  1Z8X A;  4MFP A;  4UEZ A;  4R3L A;  2PJ4 A;  5EBV A;  8CPA A;  2D4O A;  4MCS A;  4L8A A;  3IGR A;  1Z8T A;  1CPX A;  4OLL A;  4OC1 A;  2WUU A;  1BO4 A;  1LAN A;  2FIA A;  4UIA A;  2AFO A;  4UCN A;  3KZW A;  4FD6 A;  3PBE A;  5JPH A;  4UCM A;  3WR7 A;  4CYN A;  1JQG A;  1AYE A;  2B5G B;  4PQA A;  4AVB A;  3QAH A;  2Q7B A;  4OIW A;  4KSA A;  1K4J A;  3CPX A;  4GS4 A;  3EY5 A;  1RXT A;  1KUX A;  5HVF A;  4W9Y A;  2OU2 A;  4MFK A;  1TKH A;  1UWY A;  5LYL A;  4MHZ A;  4NGP A;  4X3R A;  1J4J A;  4EWT A;  4JD6 A;  1VGY A;  2AFU A;  2ODF A;  2JLM A;  3B35 A;  2BSW A;  4P4I A;  4CAX A;  4DNC A;  1S7F A;  2ZOG A;  3N5F A;  4OC5 A;  2Q7S A;  3F8K A;  2PJ0 A;  3OWC A;  3PBB A;  1M4I A;  1XF8 A;  4OC0 A;  4PPZ A;  4XPD C;  2O28 A;  3V38 A;  3D2M A;  3HUV A;  1XMB A;  2PE3 A;  4LX9 A;  4JLY A;  3MN8 A;  4NXY A;  5ELY A;  1Q7L A;  4C2X A;  2PJ7 A;  1NSL A;  4AXV A;  1ARM A;  1ZG8 A;  4F0Y A;  3KHZ A;  4ZX8 A;  5AG6 A;  3S6K A;  2PJ9 A;  3D8P A;  4MHP A;  3QAY A;  1Z2L A;  3MGD A; 
#chains in the Genus database with same CATH homology
 3T9Y A;  4IUS A;  4KOV A;  1Q2C A;  2VI7 A;  4PSW A;  4HKF A;  4UFX A;  4XPD B;  3RYO A;  4KLV A;  3BJ8 A;  3TO9 A;  4KVO E;  2ZPA A;  4HNW B;  3GY9 A;  1XEB A;  4R3K A;  4NEX A;  4ZGY B;  3A9L A;  3JTK A;  4AVC A;  1VKC A;  2ZXV A;  5JQ4 A;  5G21 A;  4JWP A;  3CXQ A;  3FXT A;  3PZJ A;  1PU9 A;  4MI4 A;  4PK2 A;  4FD4 A;  1S7K A;  2FS5 A;  1YVK A;  2ZW7 A;  5IX3 A;  2CNS A;  2ZW6 A;  5F49 A;  5KTC A;  2F5I A;  4KUA A;  4QBJ A;  2FXF A;  2ARH A;  1YGH A;  1M4D A;  3R9G A;  1WWZ A;  3E0K A;  5KTA A;  4KOX A;  4UWJ A;  2PR1 A;  2JDD A;  4FD7 A;  3D3S A;  3ZZI A;  1ZO0 A;  4QVT A;  2OZH A;  1YR0 A;  4CAW A;  2VBQ A;  1N71 A;  2Z3O A;  4MFQ A;  3FRM A;  4KVM E;  2J8M A;  2B3V A;  3EC4 A;  2FE7 A;  5F46 A;  4ZBG A;  4C2Z A;  2CXA A;  2Q4V A;  2ZW4 A;  1R57 A;  2B3U A;  4KOU A;  1MJ9 A;  4AG7 A;  3LOD A;  2VZY A;  2FIW A;  2Z3M A;  5F48 A;  4QC6 A;  3K9U A;  1YVO A;  3BJ7 A;  1MJA A;  3B8G A;  1QSN A;  1I21 A;  4AVA A;  3DNS A;  2AE6 A;  2GAN A;  1ON0 A;  2Y0M A;  2DXQ A;  3IWE A;  3TO7 A;  1Y7R A;  4U9Z A;  2C27 A;  1B6B A;  3PGP A;  4NSQ A;  4KOR A;  4CGL A;  3S6H A;  4QB9 A;  4C7H A;  2BUE A;  3TO6 A;  2EVN A;  2G3A A;  2RC4 A;  4MBU A;  4B11 A;  2ZW5 A;  4XPL A;  2Q0Y A;  1S60 A;  4BMH A;  1Y9W A;  5ISV A;  2VZZ A;  3G8W A;  2VEZ A;  4CAE A;  4QUS A;  3EFA A;  4II9 A;  5H84 A;  1MK4 A;  3H5Z A;  2JEV A;  5G20 A;  2NMT A;  4A2Z A;  1WK4 A;  1RO5 A;  4B13 A;  5G1Z A;  5AG5 A;  1KUV A;  5G22 A;  3I3G A;  1MJB A;  1XIX A;  2B4D A;  4Q36 A;  2AJ6 A;  3W6S A;  1LRZ A;  3BLN A;  3IU2 A;  1YK3 A;  1QSO A;  1Z4R A;  2FCK A;  1P4N A;  2B58 A;  3PP9 A;  4CYP A;  1NE9 A;  4UWI A;  4UFW A;  4PK3 A;  4J3G A;  3DR6 A;  4MY3 A;  2R98 A;  4CRZ B;  5I0C A;  5H86 A;  1M44 A;  3P2H A;  4K30 A;  5FVJ A;  2H5M A;  4MJ8 A;  3QB8 A;  1UFH A;  2PSW A;  5C82 A;  2P6F A;  4Y49 C;  4KOS A;  2PQ8 A;  3KKW A;  3CXP A;  3S6G A;  2X7B A;  4BBH A;  3TOA A;  4CYO A;  4IF5 A;  5AG7 A;  4H6U A;  4B5P A;  5J8F A;  5IB0 A;  3G3S A;  5J8C A;  1NMT A;  4MFL A;  4OAD A;  2OZU A;  2B4D B;  5IV0 A;  2BL1 A;  4L89 A;  3IWG A;  4OAE A;  2QML A;  4H6Z A;  2P6G A;  4YGO A;  1CM0 A;  2FL4 A;  2K5T A;  4UBR A;  4Y49 B;  4F0X A;  4UA3 A;  4A95 A;  2QEC A;  4UFV A;  1M1D A;  2R7H A;  4KOY A;  2Z3P A;  1KZF A;  3FB3 A;  4B5O A;  4RS2 A;  5C88 A;  3FBU A;  4B5P B;  2CNM A;  5CNP A;  4CRY B;  2R1I A;  2J8N A;  1B87 A;  3P2F A;  1QSM A;  2WPX A;  2OH1 A;  5GCN A;  2Z10 A;  5A28 A;  2P6E A;  1Z4E A;  1CJW A;  3JVN A;  3W91 A;  2Q44 A;  2DPT A;  2PRB A;  1XE4 A;  4R87 A;  3TT2 A;  1QSR A;  4EVY A;  4YRH A;  3TTH A;  2J8R A;  2CY2 A;  4A31 A;  2G0B A;  4KLW A;  3R9E A;  1I12 A;  2Z3K A;  1PUA A;  3H4Q A;  4KUB A;  2YND A;  3LD2 A;  2QIR A;  4RI1 A;  2PDO A;  4CYQ A;  1QST A;  4ORF A;  2FT0 A;  1KUY A;  4MFZ A;  1Q2D A;  4CS0 B;  2EUI A;  2FSR A;  2PC1 A;  1U6M A;  4CGN A;  4NF1 A;  5BWA B;  2HV2 A;  4XPK A;  2R8V A;  5DWN A;  4KOW A;  1Z9U A;  4Q38 A;  2GE3 A;  1BOB A;  3VWD A;  4C68 A;  2REE A;  3S6F A;  4I49 A;  1S5K A;  4KVX A;  1Y9K A;  3SHP A;  4B10 A;  4YFJ A;  2YGW A;  4M3S A;  3TOB A;  4XNH C;  4FD5 A;  2CNT A;  4R57 A;  2I00 A;  5AGE A;  2D4P A;  2VQY A;  3C26 A;  3GYA A;  2VXK A;  2I79 A;  4U5Y A;  2WSA A;  3TE4 A;  4JJX A;  4E8O A;  3GKR A;  4JXQ A;  1I1D A;  3NE7 A;  4UCP A;  1M4G A;  2PR8 A;  4H89 A;  2Q4Y A;  1IB1 E;  2A4N A;  4XNH B;  2DPS A;  1FY7 A;  2HUZ A;  3FNC A;  4NCZ A;  3D2P A;  3N7Z A;  2GIV A;  3CXS A;  5A27 A;  1IYL A;  2Q04 A;  4CGO A;  3T90 A;  4CAF A;  3TFY A;  4U9Y A;  3ZJ0 A;  1XMT A;  1S7N A;  2HQY A;  3FIX A;  4KOT A;  5EC4 A;  3UY5 A;  4MHD A;  4AG9 A;  2YNC A;  4A30 A;  5KTD A;  3EO4 A;  4PV6 A;  4ONU A;  2G3T A;  4A32 A;  1P0H A;  4C7I A;  4KSF A;  2Z11 A;  3DSB A;  2BEI A;  2Z0Z A;  2B4B A;  3EXN A;  4B12 A;  1SQH A;  2YNC C;  4KZT A;  4C2Y A;  1YRE A;  4KS9 A;  3JUW A;  4CGP A;  3R1K A;  4A33 A;  2Z3N A;  4JXR A;  4R9M A;  1IIC A;  2WPW A;  1YX0 A;  4HNX B;  4M85 A;  2YNE A;  4HNY B;  3V8I A;  1GHE A;  2ATR A;  4AB7 A;  3W6X A;  4X5K A;  4MFJ A;  3TCV A;  3VWE A;  3SXO A;  2KCW A;  3R9F A;  1IID A;  1S3Z A;  4CAV A;  3DDD A;  4F6A A;  4LUA A;  5F47 A;  3R96 A;  5E96 A;  2JDC A;  1TIQ A;  5AG4 A;  3SXN A;  4E2A A;  2IL4 A;  1Q2Y A;  4CGM A;  2REF A;  2OZG A;  1S7L A;  5HMN A;  1OZP A;  2Z3L A;  4E0A A;  2B5G A;  1YLE A;  4MY0 A;  3I9S A;  2OB0 A;  5HH1 A;  3FYN A;  3F5B A;  4B14 A;  3F0A A;  3R95 A;  3IU1 A;  5DWM A;  3DR8 A;  1V0C A;  1IYK A;  1VHS A;  2P0W A;  1L0C A;  4MFP A;  4R3L A;  5EBV A;  2D4O A;  4L8A A;  3IGR A;  4OLL A;  2WUU A;  1BO4 A;  2FIA A;  4UCN A;  4FD6 A;  5JPH A;  4UCM A;  3WR7 A;  4CYN A;  2B5G B;  4AVB A;  3QAH A;  2Q7B A;  4KSA A;  1K4J A;  4GS4 A;  3EY5 A;  1RXT A;  1KUX A;  2OU2 A;  4MFK A;  1J4J A;  4JD6 A;  4CAX A;  2JLM A;  4DNC A;  2BSW A;  1S7F A;  3F8K A;  3OWC A;  1M4I A;  1XF8 A;  4XPD C;  2O28 A;  3D2M A;  4LX9 A;  4JLY A;  4NXY A;  4C2X A;  1NSL A;  4F0Y A;  3S6K A;  5AG6 A;  3D8P A;  4PSX A;  3MGD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...