2FIAA

The crystal structure of the acetyltransferase from enterococcus faecalis
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
157
structure length
157
Chain Sequence
MKIRVADEKELPMILQFLTEVKAYMDVVGITQWTKDYPSQGDIQEDITKKRLYLLVHEEMIFSMATFCMEQEQDFVWLKRFATSPNYIAKGYGSLLFHELEKRAVWEGRRKMYAQTNHTNHRMIRFFESKGFTKIHESLQMNRLDFGSFYLYVKELE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of the acetyltransferase from Enterococcus faecalis
rcsb
source organism Enterococcus faecalis
molecule tags Transferase
molecule keywords acetyltransferase
total genus 47
structure length 157
sequence length 157
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-12-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 2fiaA00
1BO4A 3TO9A 4AVCA 4PK3A 5GCNA 3UY5A 3SXNA 2R7HA 2VQYA 5CNPA 4F6AA 3R9FA 1P4NA 3CXPA 4AG9A 1P0HA 1XE4A 4NF1A 3R96A 3TCVA 4HKFA 1YR0A 5HMNA 4XNHC 4R87A 1MJBA 1CJWA 1RXTA 2PR8A 3GY9A 4OLLA 5E96A 4YGOA 1NMTA 4QBJA 3CXQA 1Q2YA 2I00A 4NEXA 1M4IA 2B3VA 2PDOA 1Z4RA 2HV2A 4F0YA 3IWGA 4MI4A 4PSWA 1QSRA 2B4DA 3EY5A 2VZZA 3ZZIA 1GHEA 3NE7A 4KVOE 3SHPA 3D2PA 4AB7A 2R98A 1IICA 3T9YA 1QSMA 1KUYA 4KORA 2JEVA 4YRHA 3BLNA 3F0AA 1QSNA 5EBVA 4OADA 1Y9WA 2J8RA 2PQ8A 3JVNA 3S6FA 4KOVA 4H6UA 2PR1A 4BMHA 2PRBA 1IB1E 4JXQA 4U5YA 3OWCA 2Z0ZA 1I21A 3LODA 4ORFA 3W91A 2O28A 4KVXA 2VI7A 1Y7RA 3R9EA 2Q7BA 4MJ8A 3CXSA 4CAWA 3W6XA 2P6FA 4JXRA 2FE7A 4E8OA 1IYKA 2J8NA 1L0CA 4KOYA 3VWDA 1Q2CA 4MHDA 3R9GA 1YX0A 3VWEA 2Q44A 2FXFA 4JWPA 4R9MA 2REEA 1WWZA 4RS2A 2QIRA 2OZHA 3S6HA 5KTAA 4QC6A 4E0AA 5F46A 5IV0A 3DDDA 4PK2A 2CNSA 5F49A 1QSTA 2QMLA 1YVKA 5C88A 1S5KA 4MBUA 1ON0A 2Y0MA 1YREA 3R1KA 3S6GA 5KTCA 2ZPAA 2PSWA 4FD4A 4KOWA 3FXTA 2VXKA 4UWJA 1IYLA 2GANA 4L8AA 5H84A 2QECA 1B6BA 2K5TA 4KLVA 3H4QA 3SXOA 2Q04A 1NSLA 5J8FA 3D3SA 3I3GA 4HNWB 2G3TA 3BJ7A 1M4DA 5DWMA 2VEZA 4R3LA 1MK4A 4EVYA 4LUAA 4KOXA 4XPLA 3TOAA 4IF5A 2VBQA 3DSBA 2P0WA 2Q0YA 1I1DA 3GKRA 4UBRA 4R3KA 2VZYA 4MY3A 3WR7A 1WK4A 3EO4A 2EVNA 5HH1A 4M3SA 4B5OA 2BL1A 4KOUA 1Y9KA 2ATRA 1S7FA 2Z11A 4LX9A 3DR6A 2B5GB 4Y49B 4KZTA 2ARHA 1KUXA 3PGPA 5J8CA 4II9A 2WPXA 2GE3A 1Q2DA 1CM0A 4UA3A 2EUIA 2ZW7A 2Z10A 4CS0B 3FBUA 4JLYA 5H86A 1M4GA 5FVJA 3DNSA 3P2FA 4JD6A 3LD2A 3FRMA 3G3SA 2REFA 4CAVA 3B8GA 5I0CA 2X7BA 2P6EA 4XPDC 1FY7A 1Z9UA 5F48A 3EXNA 4HNXB 4NXYA 4PSXA 1V0CA 4H89A 3RYOA 3TOBA 2FL4A 1XMTA 4L89A 3KKWA 3BJ8A 3TTHA 4HNYB 4OAEA 3PZJA 4XPDB 2F5IA 4R57A 1K4JA 4ZBGA 1KZFA 4FD7A 3FIXA 3D2MA 4E2AA 3S6KA 4CRZB 2FIAA 4U9YA 4J3GA 4QUSA 3QAHA 5IX3A 2B3UA 3MGDA 3JUWA 3F8KA 3IGRA 2FCKA 2D4PA 4I49A 2IL4A 3FB3A 1TIQA 2OB0A 4JJXA 3TE4A 3FNCA 2I79A 1MJ9A 4Y49C 2CNTA 1LRZA 4DNCA 3ZJ0A 4QB9A 4K30A 3V8IA 2R1IA 1YVOA 1S7NA 3TO7A 4B5PA 3D8PA 4U9ZA 5EC4A 1Z4EA 2H5MA 2FSRA 5ISVA 2RC4A 1SQHA 4PV6A 3R95A 3EFAA 3EC4A 4KOTA 4UWIA 2OU2A 2BUEA 3C26A 1YK3A 3T90A 4NSQA 4AVBA 5IB0A 2PC1A 1XF8A 3F5BA 2Q4VA 4B5PB 1S3ZA 4KOSA 1N71A 4MY0A 1R57A 3P2HA 3TO6A 3QB8A 2AE6A 1I12A 2BEIA 2HQYA 2G0BA 4AG7A 2JDDA 3G8WA 1VHSA 1J4JA 1VKCA 4ONUA 1YGHA 2OZUA 1KUVA 1S7KA 2JDCA 4FD6A 3TT2A 3I9SA 4CAXA 2B4DB 2OZGA 1NE9A 1S7LA 4H6ZA 2KCWA 2ZXVA 4KVME 5DWNA 1RO5A 2ZW6A 5F47A 4RI1A 3K9UA 4GS4A 1XIXA 2AJ6A 1B87A 2FT0A 3N7ZA 1MJAA 5JQ4A 4NCZA 1PU9A 2Q4YA 4KUBA 1YLEA 2B4BA 2GIVA 3TFYA 3DR8A 3GYAA 1M44A 3E0KA 4XPKA 2CNMA 1U6MA 2J8MA 4FD5A 4YFJA 4IUSA 2B58A 1XEBA 3FYNA 2BSWA 4X5KA 4KUAA 2HUZA 2D4OA 2ZW4A 2WPWA 2OH1A 2G3AA 2A4NA 3W6SA 4KLWA 2FIWA 2ZW5A 2NMTA 4AVAA 3PP9A 4CRYB 1IIDA 1S60A 2P6GA 2FS5A 2R8VA 2JLMA 4M85A 5JPHA 2CY2A 2DXQA 5KTDA 1QSOA 5C82A 4QVTA 1BOBA 1M1DA 1PUAA 4XNHB 1OZPA 2C27A 2B5GA 1UFHA
chains in the Genus database with same CATH superfamily
1BO4A 3TO9A 4AVCA 3I1UA 4K3NA 4PK3A 2VL1A 5GCNA 3SXNA 3UY5A 2R7HA 2VQYA 5CNPA 4F6AA 1EE3P 3R9FA 1P4NA 3CXPA 5LRKA 4AG9A 2ZOGA 5K8PA 4MMOA 4OP4A 1P0HA 1XE4A 1TF9A 1JWQA 3B3SA 4HKFA 4NF1A 3R96A 3TCVA 1YR0A 2QVPA 5HMNA 1TKFA 2EO8A 1R3NA 4XNHC 1YSJA 2V8GA 4R87A 4A2ZA 1MJBA 1LAMA 1CJWA 3GUXA 1RXTA 2PR8A 3GY9A 3IEHA 4CGMA 4OLLA 5E96A 4YGOA 1NMTA 3FVLA 4QBJA 1XFOA 1ELMP 3CXQA 1H8LA 3NH8A 1Q2YA 2I3CA 2I00A 3GLJA 4MFZA 4NEXA 1M4IA 2B3VA 4UCMA 3ISZA 2PDOA 3PFOA 5J8FA 1Z4RA 2HV2A 4CGOA 2BOAA 4F0YA 5LYLA 3IWGA 1YLOA 5G1ZA 4MI4A 4PSWA 2AFOA 1JQGA 2AFWA 2CTCA 4B12A 4OKOA 4P10A 1QSRA 2B4DA 1AYEA 3EY5A 2VZZA 3ZZIA 1GHEA 2PIYA 3NE7A 3RAMA 4OC1A 3WABA 4KVOE 3SHPA 1IU8A 4DUKA 4UF4A 3D2PA 4AB7A 2R98A 1IICA 1Z8WA 3T9YA 1QSMA 4MFLA 4NGRA 1KUYA 4KORA 4BBHA 2F8HA 2JEVA 4F0XA 2JEWA 3BLNA 3F0AA 4YRHA 1QSNA 5EBVA 4OADA 1Y9WA 5THWA 2J8RA 4EMEA 2PQ8A 3JVNA 4NGNA 2EBJA 2JBJA 4OIDA 2C1CA 1A2ZA 3S6FA 2PJ1A 2ZEDA 2BO9A 4KOVA 3PBBA 4H6UA 2PR1A 4UIAA 3B7IA 4NGSA 4BMHA 3SJGA 2YNEA 4HPSA 4OC2A 1IOIA 1KWMA 4WWVA 2V77A 4B10A 4CYPA 2PRBA 1IB1E 1PCAA 3KI9A 4JXQA 4U5YA 4X8IA 5AGEA 1ELLP 3OWCA 3FF3A 2Z0ZA 1I21A 3LODA 4ORFA 2ANPA 5BWAB 1QQ9A 3W91A 2O28A 4KVXA 2VI7A 1Y7RA 3R9EA 5AG6A 2Q7BA 1YW6A 3KR5A 4MJ8A 3B3WA 3CXSA 4P6YA 3W6XA 4CAWA 2P6FA 4JXRA 4MHZA 2FE7A 4WJBA 4E8OA 2J8NA 1IYKA 1L0CA 4KOYA 3VWDA 1LANA 1AMPA 1Q2CA 1BLLE 4ZY2A 4MHDA 3R9GA 3H5ZA 1YX0A 3NH4A 3VWEA 4P44A 2Q44A 4A31A 3FEEA 2FXFA 3ISXA 3IO1A 4JWPA 1F2OA 4R9MA 2REEA 2C6CA 3CDXA 3H8GA 1WWZA 4RS2A 2QIRA 2OZHA 3K2KA 2Z3NA 4LQGA 3JTKA 4Q38A 3S6HA 5KTAA 5J1QA 4QC6A 4E0AA 5F46A 5IV0A 3DDDA 4PK2A 2CNSA 1XJOA 1QSTA 2QMLA 2ZEHA 1YVKA 5F49A 5C88A 1M4LA 4P4EA 1S5KA 4W9YA 4MBUA 3CPAA 4BINA 1ON0A 2Y0MA 1YREA 3R1KA 3S6GA 2G9DA 5G21A 2XEFA 2ZENA 3IJ3A 5I4MA 5EMIA 2ZPAA 5KTCA 4IK2A 1TF8A 2ABZA 5HVGA 2PSWA 2PJCA 1CG2A 3GB0A 2O53A 3TC8A 4FD4A 4KOWA 3FXTA 3FX6A 1XOVA 2CF4A 1RTQA 2VXKA 4UWJA 2PJ5A 1IYLA 2GANA 1IY7A 4A37A 4L8AA 5H84A 2DPSA 2QECA 1ZG8A 1B6BA 2K5TA 4MCQA 1ZO0A 2DEAA 2ZEFA 4A33A 3S9LA 4KLVA 4MFPA 4CGNA 2YNCA 3H4QA 2RFHA 3SXOA 2Q51A 2Q04A 4UIBA 2ZEOA 4RN7A 4X2TA 3IWEA 1NSLA 4M6GA 1BAVA 1XRYA 3D3SA 3I3GA 4HNWB 4CGPA 2G3TA 3BJ7A 4C2ZA 1M4DA 4EFDA 2Z3PA 5DWMA 4OC5A 2VEZA 3RBUA 2EK9A 4R3LA 2AFMA 2EK8A 3NH5A 3NE8A 1MK4A 3IC1A 4FWUA 3SI1A 3SI0A 4EVYA 4LUAA 4ZGYB 1XBUA 4KOXA 4KS9A 4JZ0A 2DF5A 4XPLA 3KQZA 3TOAA 4C7IA 4P4JA 1OBRA 2O4HA 4IF5A 2VBQA 3DSBA 2P0WA 3FMCA 2AFUA 2Q0YA 4AXVA 3KGQA 4MCRA 1I1DA 2V8VA 2YGWA 3GKRA 4X3RA 4UBRA 1IGBA 4R3KA 2VZYA 3LMSA 4MY3A 4C2XA 1AUGA 3D66A 3WR7A 4B11A 2OOTA 3WT4A 3PBEA 1WK4A 5LYDA 4DJLA 3EO4A 2EVNA 5HH1A 5HVHA 4M3SA 2XEGA 4ZX8A 4B5OA 4PQAA 3D7DA 4P4IA 2BL1A 4KOUA 3HUVA 4C7HA 1Y9KA 2ATRA 2Z3OA 1S7FA 2Z11A 2GLJA 4CPAA 4LX9A 3DR6A 2B5GB 4MHPA 4FUUA 4Y49B 1YMEA 4OIWA 4UCPA 4KZTA 2BCOA 3D67A 2ARHA 5G22A 3MN8A 1KUXA 4LQ6A 4MRIA 1ZLHA 3PGPA 2Q7SA 4CAFA 4NGPA 1LAPA 5J8CA 2XEIA 5D29A 4II9A 1VIXA 1ZG7A 4UEEA 2GU2A 2WPXA 2GE3A 1Q2DA 4B14A 1CM0A 4M6IA 4UA3A 2EUIA 2ZW7A 2Z10A 4CS0B 2ZEGA 3FBUA 4JLYA 3PB8X 2GLFA 2PJ4A 4GM5A 1M4GA 5FVJA 5H86A 5CBMA 2CIJA 3DNSA 3DLJA 3P2FA 3IIBA 4UEZA 5AG5A 5JM6A 3BI1A 1CP7A 3LD2A 4JD6A 1TXRA 3FRMA 3G3SA 2PVWA 4KSFA 4NJRA 4CYQA 2REFA 3PFEA 4CAVA 2QJ8A 3B8GA 3KZWA 3WC7A 4CYOA 5I0CA 2NSMA 2P6EA 2X7BA 5ELYA 4XPDC 4R76A 1FY7A 3L2NA 3BI0A 4P4FA 3V38A 1F2PA 4ZX9A 1Z9UA 3D7HA 5F48A 3NA6A 3EXNA 4HNXB 4YU9A 1FT7A 4NXYA 4PSXA 3H8EA 5D8NA 2CXAA 5AG7A 5HXDA 4UFXA 1V0CA 1VGYA 4F9UA 3LWUA 4H89A 3RYOA 3TOBA 2ZEMA 3RZAA 2FL4A 1HDQA 1XMTA 3D4UA 4L89A 4UEFA 3KKWA 3CZXA 1TKJA 3BJ8A 2DPTA 3TTHA 3QNVA 4PXEA 4HNYB 3FJUA 4OAEA 4PPZA 3MRUA 3PZJA 2F5IA 4XPDB 4GXHA 3IU1A 3CPXA 4R57A 1K4JA 2ZOFA 4ZBGA 1KZFA 4FD7A 3FIXA 3D2MA 2NYQA 2Z3LA 3B3VA 1LOKA 4E2AA 5LRGA 4C2YA 3S6KA 4TWEA 3IWWA 3SJFA 4CRZB 5CPAA 2FIAA 4U9YA 4J3GA 2C6GA 5JGFA 1R43A 2CTBA 4MFQA 3JRUA 2YNDA 3A9LA 3QAHA 4QUSA 4UFVA 4Z65A 5IX3A 2B3UA 2F7VA 1CPXA 3GIUA 2PJ7A 4KSIA 2AFZA 3IU2A 3JUWA 1HDUA 3F8KA 3MGDA 3SI2A 4OC0A 4B13A 3IGRA 2Q4ZA 2J9AA 2PJ2A 4OC4A 2FCKA 2D4PA 4I49A 4MCSA 1CBXA 2IL4A 3FB3A 1TIQA 2IJZA 4OC3A 5F09A 5K8OA 2OB0A 4JJXA 3TE4A 3K9TA 2Z3MA 4OMEA 3PB4X 3FNCA 3KR4A 4PXDA 2I79A 1MJ9A 3DGVA 2AFSA 1LRZA 2CNTA 3PB9X 4Y49C 4DNCA 4Q7AA 3V7ZA 2GFQA 1QMUA 5AG4A 3ZJ0A 1Q7LA 4FBEA 2ZELA 4QB9A 4K30A 2V8DA 1ZG9A 3V8IA 2R1IA 1Z8LA 4O23A 1DE4C 3T8WA 1Z8XA 1YVOA 2PVVA 1S7NA 5A28A 3TO7A 3B3TA 3RNZA 1YQEA 3D8PA 4U9ZA 5EC4A 4B5PA 1Z4EA 4H2KA 2H5MA 3D68A 3QAYA 2FSRA 4P4BA 1Z8TA 4R8FA 4BD9A 5ISVA 3KASA 3N5FA 4NFRA 2PJBA 2RC4A 4YWYA 1SQHA 4EWTA 4PV6A 3R95A 3EFAA 2WYRA 5LRJA 3EC4A 4KOTA 2EWBA 4MHNA 2IMOA 4UWIA 2OU2A 2BUEA 3C26A 1NSAA 3PB6X 1YK3A 3TX8A 3T90A 1X12A 4NSQA 4AVBA 1Y0RA 2PCUA 4ZI6A 4NGTA 3KHZA 1VHOA 2PC1A 1XF8A 2OR4A 2V8HA 3F5BA 2Q4VA 5IB0A 4B5PB 1S3ZA 1GYTA 1PYTB 4KOSA 3LACA 4R7MA 1N71A 4MY0A 1R57A 2WUUA 4P45A 3P2HA 3NFZA 4ONWA 3B35A 2Z3KA 3TO6A 3KL9A 3QB8A 3S9NA 5JH9A 5LYFA 2AE6A 4NGMA 1Y7EA 4UCNA 1I12A 3S9MA 2BEIA 3WC6A 2HQYA 2Q43A 2G0BA 4AG7A 2JDDA 4MHYA 3G8WA 1VHSA 2PJ3A 2PE3A 1Z5RA 1VHEA 4NGQA 4P4DA 2HB6A 1J4JA 2PJ6A 1VKCA 4ONUA 1YGHA 4R6TA 3SJXA 2OZUA 1KUVA 1F57A 4MXUA 1S7KA 2PJ0A 2JDCA 4PXCA 4FD6A 3IFEA 5A27A 3TT2A 8CPAA 3I9SA 4G1PA 7CPAA 4IAVA 6CPAA 2QYVA 1UWYA 4CAXA 4CAEA 4C68A 1HEEA 1XMBA 2B4DB 2WZNA 2JBKA 4Q36A 2OZGA 3RO0A 4A94A 1NE9A 1S7LA 1CPSA 4H6ZA 2RB7A 2KCWA 2ZXVA 3B3CA 4FAIA 3KQXA 4KVME 4CGLA 4F8ZA 3PB7X 1BPNA 2ZEEA 1LFWA 3HLPA 5DWNA 1RO5A 2YNCC 2ZW6A 2PJAA 5F47A 2WSAA 4RI1A 5IB9A 4PXBA 3D7FA 3K9UA 4GS4A 1XIXA 2AJ6A 2IQ6A 1B87A 2FT0A 1ZLIA 2PIZA 2PJ8A 3H8FA 4TNUA 1Z2LA 1ARLA 3FECA 3N7ZA 1MJAA 2POKA 5JQ4A 1BPMA 4NCZA 2AFXA 3KHXA 1PU9A 3FH4A 3PRTA 2Q4YA 4KUBA 1YLEA 4CYNA 2B4BA 2GIVA 3D7GA 3TFYA 3DR8A 2HC9A 4UFWA 4ZYQA 3GYAA 1M44A 3E0KA 5K8MA 2PRQA 4XPKA 1ARMA 4ZY1A 4MFJA 2CNMA 1YW4A 1U6MA 2J8MA 4FD5A 4B6ZA 4YFJA 4IUSA 2B58A 4IHMA 2ODFA 1XEBA 3FYNA 2BSWA 4NJQA 4X5KA 3B2YA 4KUAA 3BXMA 1FNOA 5HVFA 3VH9A 3WC5A 4A30A 2HUZA 2D4OA 2ZW4A 3VATA 4MFKA 4A32A 5K8NA 1DTDA 2WPWA 4F9VA 1LCPA 2OH1A 2G3AA 2A4NA 3W6SA 4KLWA 2FIWA 2PJ9A 2ZW5A 2NMTA 5DS0A 3PP9A 4AVAA 4CRYB 4RUHA 1IIDA 1S60A 2P6GA 1TKHA 2FS5A 2R8VA 2FVGA 2JLMA 1CX8A 2ZEPA 5LYIA 3SJEA 4M85A 4A95A 5JPHA 1IOFA 4ZY0A 4DYOA 2CY2A 1X10A 2DXQA 3BHXA 3CT9A 3FEDA 4MCPA 1Y0YA 5KTDA 4JYWA 1QSOA 2GREA 5C82A 3PEIA 3VARA 4QVTA 2C6PA 4M6HA 1BOBA 1M1DA 4A38A 1PUAA 5G20A 4XNHB 1CP6A 1OZPA 2XEJA 4KSAA 2C27A 2B5GA 4A39A 1UFHA
chains in the Genus database with same CATH topology
1BO4A 3TO9A 4AVCA 4PK3A 5GCNA 3UY5A 3SXNA 2R7HA 2VQYA 5CNPA 4F6AA 3R9FA 1P4NA 3CXPA 4AG9A 1P0HA 1XE4A 4NF1A 3R96A 3TCVA 4HKFA 1YR0A 5HMNA 4XNHC 4A2ZA 4R87A 1MJBA 1CJWA 1RXTA 2PR8A 3GY9A 4CGMA 4OLLA 5E96A 4YGOA 1NMTA 4QBJA 3CXQA 1Q2YA 2I00A 4MFZA 4NEXA 1M4IA 2B3VA 4UCMA 2PDOA 1Z4RA 2HV2A 4CGOA 4F0YA 3IWGA 5G1ZA 4MI4A 4PSWA 4B12A 1QSRA 2B4DA 3EY5A 2VZZA 3ZZIA 1GHEA 3NE7A 4KVOE 3SHPA 3D2PA 4AB7A 2R98A 1IICA 3T9YA 1QSMA 4MFLA 1KUYA 4KORA 4BBHA 2JEVA 4F0XA 4YRHA 3BLNA 3F0AA 1QSNA 5EBVA 4OADA 1Y9WA 2J8RA 2PQ8A 3JVNA 3S6FA 4KOVA 4H6UA 2PR1A 4BMHA 2YNEA 4B10A 4CYPA 2PRBA 1IB1E 4JXQA 4U5YA 5AGEA 3OWCA 2Z0ZA 1I21A 3LODA 4ORFA 5BWAB 3W91A 2O28A 4KVXA 2VI7A 1Y7RA 3R9EA 5AG6A 2Q7BA 4MJ8A 3CXSA 4CAWA 3W6XA 2P6FA 4JXRA 2FE7A 4E8OA 1IYKA 2J8NA 1L0CA 4KOYA 3VWDA 1Q2CA 4MHDA 3R9GA 3H5ZA 1YX0A 3VWEA 2Q44A 4A31A 2FXFA 4JWPA 4R9MA 2REEA 1WWZA 4RS2A 2QIRA 2OZHA 2Z3NA 3JTKA 4Q38A 3S6HA 5KTAA 4QC6A 4E0AA 5F46A 5IV0A 3DDDA 4PK2A 2CNSA 5F49A 1QSTA 2QMLA 1YVKA 5C88A 1S5KA 4MBUA 1ON0A 2Y0MA 1YREA 3R1KA 3S6GA 5G21A 5KTCA 2ZPAA 2PSWA 4FD4A 4KOWA 3FXTA 2VXKA 4UWJA 1IYLA 2GANA 4L8AA 5H84A 2DPSA 2QECA 1B6BA 2K5TA 1ZO0A 4A33A 4KLVA 4MFPA 4CGNA 2YNCA 3H4QA 3SXOA 2Q04A 3IWEA 1NSLA 5J8FA 3D3SA 4CGPA 3I3GA 4HNWB 2G3TA 3BJ7A 4C2ZA 1M4DA 2Z3PA 5DWMA 2VEZA 4R3LA 1MK4A 4EVYA 4LUAA 4ZGYB 4KOXA 4KS9A 4XPLA 3TOAA 4C7IA 4IF5A 2VBQA 3DSBA 2P0WA 2Q0YA 1I1DA 2YGWA 3GKRA 4UBRA 4R3KA 2VZYA 4MY3A 4C2XA 3WR7A 4B11A 1WK4A 3EO4A 2EVNA 5HH1A 4M3SA 4B5OA 2BL1A 4KOUA 4C7HA 1Y9KA 2ATRA 2Z3OA 1S7FA 2Z11A 4LX9A 3DR6A 2B5GB 4Y49B 4UCPA 4KZTA 2ARHA 5G22A 1KUXA 3PGPA 4CAFA 5J8CA 4II9A 2WPXA 2GE3A 1Q2DA 4B14A 1CM0A 4UA3A 2EUIA 2ZW7A 2Z10A 4CS0B 3FBUA 4JLYA 5H86A 1M4GA 5FVJA 3DNSA 3P2FA 5AG5A 4JD6A 3LD2A 3FRMA 3G3SA 4KSFA 4CYQA 2REFA 4CAVA 3B8GA 4CYOA 5I0CA 2X7BA 2P6EA 4XPDC 1FY7A 1Z9UA 5F48A 3EXNA 4HNXB 4NXYA 4PSXA 2CXAA 5AG7A 4UFXA 1V0CA 4H89A 3RYOA 3TOBA 2FL4A 1XMTA 4L89A 3KKWA 3BJ8A 2DPTA 3TTHA 4HNYB 4OAEA 3PZJA 4XPDB 2F5IA 3IU1A 4R57A 1K4JA 4ZBGA 1KZFA 4FD7A 3FIXA 3D2MA 2Z3LA 4E2AA 4C2YA 3S6KA 4CRZB 2FIAA 4U9YA 4J3GA 4MFQA 4QUSA 2YNDA 3A9LA 3QAHA 4UFVA 5IX3A 2B3UA 3IU2A 3JUWA 3MGDA 3F8KA 4B13A 3IGRA 2FCKA 2D4PA 4I49A 2IL4A 3FB3A 1TIQA 2OB0A 4JJXA 3TE4A 2Z3MA 3FNCA 2I79A 1MJ9A 4Y49C 2CNTA 1LRZA 4DNCA 5AG4A 3ZJ0A 4QB9A 4K30A 3V8IA 2R1IA 1YVOA 5A28A 1S7NA 3TO7A 4B5PA 3D8PA 4U9ZA 5EC4A 1Z4EA 2H5MA 2FSRA 5ISVA 2RC4A 1SQHA 4PV6A 3R95A 3EFAA 3EC4A 4KOTA 4UWIA 2OU2A 2BUEA 3C26A 1YK3A 3T90A 4NSQA 4AVBA 5IB0A 2PC1A 1XF8A 3F5BA 2Q4VA 4B5PB 1S3ZA 4KOSA 1N71A 4MY0A 1R57A 2WUUA 3P2HA 3TO6A 2Z3KA 3QB8A 2AE6A 4UCNA 1I12A 2BEIA 2HQYA 2G0BA 4AG7A 2JDDA 3G8WA 1VHSA 1J4JA 1VKCA 4ONUA 1YGHA 2OZUA 1KUVA 1S7KA 2JDCA 4FD6A 5A27A 3TT2A 3I9SA 4CAXA 4CAEA 4C68A 2B4DB 4Q36A 2OZGA 1NE9A 1S7LA 4H6ZA 2KCWA 2ZXVA 4CGLA 4KVME 5DWNA 1RO5A 2YNCC 2ZW6A 5F47A 2WSAA 4RI1A 3K9UA 4GS4A 1XIXA 2AJ6A 1B87A 2FT0A 3N7ZA 1MJAA 5JQ4A 4NCZA 1PU9A 2Q4YA 4KUBA 1YLEA 4CYNA 2B4BA 2GIVA 3TFYA 3DR8A 4UFWA 3GYAA 1M44A 3E0KA 4XPKA 4MFJA 2CNMA 1U6MA 2J8MA 4FD5A 4YFJA 4IUSA 2B58A 1XEBA 3FYNA 2BSWA 4X5KA 4KUAA 4A30A 2HUZA 2D4OA 2ZW4A 4MFKA 4A32A 2WPWA 2OH1A 2G3AA 2A4NA 3W6SA 4KLWA 2FIWA 2ZW5A 2NMTA 4AVAA 3PP9A 4CRYB 1IIDA 1S60A 2P6GA 2FS5A 2R8VA 2JLMA 4A95A 4M85A 5JPHA 2CY2A 2DXQA 5KTDA 1QSOA 5C82A 4QVTA 1BOBA 1M1DA 1PUAA 5G20A 4XNHB 1OZPA 4KSAA 2C27A 2B5GA 1UFHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BO4 A;  3TO9 A;  4AVC A;  4PK3 A;  5GCN A;  3UY5 A;  3SXN A;  2R7H A;  2VQY A;  5CNP A;  4F6A A;  3R9F A;  1P4N A;  3CXP A;  4AG9 A;  1P0H A;  1XE4 A;  4NF1 A;  3R96 A;  3TCV A;  4HKF A;  1YR0 A;  5HMN A;  4XNH C;  4R87 A;  1MJB A;  1CJW A;  1RXT A;  2PR8 A;  3GY9 A;  4OLL A;  5E96 A;  4YGO A;  1NMT A;  4QBJ A;  3CXQ A;  1Q2Y A;  2I00 A;  4NEX A;  1M4I A;  2B3V A;  2PDO A;  1Z4R A;  2HV2 A;  4F0Y A;  3IWG A;  4MI4 A;  4PSW A;  1QSR A;  2B4D A;  3EY5 A;  2VZZ A;  3ZZI A;  1GHE A;  3NE7 A;  4KVO E;  3SHP A;  3D2P A;  4AB7 A;  2R98 A;  1IIC A;  3T9Y A;  1QSM A;  1KUY A;  4KOR A;  2JEV A;  4YRH A;  3BLN A;  3F0A A;  1QSN A;  5EBV A;  4OAD A;  1Y9W A;  2J8R A;  2PQ8 A;  3JVN A;  3S6F A;  4KOV A;  4H6U A;  2PR1 A;  4BMH A;  2PRB A;  1IB1 E;  4JXQ A;  4U5Y A;  3OWC A;  2Z0Z A;  1I21 A;  3LOD A;  4ORF A;  3W91 A;  2O28 A;  4KVX A;  2VI7 A;  1Y7R A;  3R9E A;  2Q7B A;  4MJ8 A;  3CXS A;  4CAW A;  3W6X A;  2P6F A;  4JXR A;  2FE7 A;  4E8O A;  1IYK A;  2J8N A;  1L0C A;  4KOY A;  3VWD A;  1Q2C A;  4MHD A;  3R9G A;  1YX0 A;  3VWE A;  2Q44 A;  2FXF A;  4JWP A;  4R9M A;  2REE A;  1WWZ A;  4RS2 A;  2QIR A;  2OZH A;  3S6H A;  5KTA A;  4QC6 A;  4E0A A;  5F46 A;  5IV0 A;  3DDD A;  4PK2 A;  2CNS A;  5F49 A;  1QST A;  2QML A;  1YVK A;  5C88 A;  1S5K A;  4MBU A;  1ON0 A;  2Y0M A;  1YRE A;  3R1K A;  3S6G A;  5KTC A;  2ZPA A;  2PSW A;  4FD4 A;  4KOW A;  3FXT A;  2VXK A;  4UWJ A;  1IYL A;  2GAN A;  4L8A A;  5H84 A;  2QEC A;  1B6B A;  2K5T A;  4KLV A;  3H4Q A;  3SXO A;  2Q04 A;  1NSL A;  5J8F A;  3D3S A;  3I3G A;  4HNW B;  2G3T A;  3BJ7 A;  1M4D A;  5DWM A;  2VEZ A;  4R3L A;  1MK4 A;  4EVY A;  4LUA A;  4KOX A;  4XPL A;  3TOA A;  4IF5 A;  2VBQ A;  3DSB A;  2P0W A;  2Q0Y A;  1I1D A;  3GKR A;  4UBR A;  4R3K A;  2VZY A;  4MY3 A;  3WR7 A;  1WK4 A;  3EO4 A;  2EVN A;  5HH1 A;  4M3S A;  4B5O A;  2BL1 A;  4KOU A;  1Y9K A;  2ATR A;  1S7F A;  2Z11 A;  4LX9 A;  3DR6 A;  2B5G B;  4Y49 B;  4KZT A;  2ARH A;  1KUX A;  3PGP A;  5J8C A;  4II9 A;  2WPX A;  2GE3 A;  1Q2D A;  1CM0 A;  4UA3 A;  2EUI A;  2ZW7 A;  2Z10 A;  4CS0 B;  3FBU A;  4JLY A;  5H86 A;  1M4G A;  5FVJ A;  3DNS A;  3P2F A;  4JD6 A;  3LD2 A;  3FRM A;  3G3S A;  2REF A;  4CAV A;  3B8G A;  5I0C A;  2X7B A;  2P6E A;  4XPD C;  1FY7 A;  1Z9U A;  5F48 A;  3EXN A;  4HNX B;  4NXY A;  4PSX A;  1V0C A;  4H89 A;  3RYO A;  3TOB A;  2FL4 A;  1XMT A;  4L89 A;  3KKW A;  3BJ8 A;  3TTH A;  4HNY B;  4OAE A;  3PZJ A;  4XPD B;  2F5I A;  4R57 A;  1K4J A;  4ZBG A;  1KZF A;  4FD7 A;  3FIX A;  3D2M A;  4E2A A;  3S6K A;  4CRZ B;  2FIA A;  4U9Y A;  4J3G A;  4QUS A;  3QAH A;  5IX3 A;  2B3U A;  3MGD A;  3JUW A;  3F8K A;  3IGR A;  2FCK A;  2D4P A;  4I49 A;  2IL4 A;  3FB3 A;  1TIQ A;  2OB0 A;  4JJX A;  3TE4 A;  3FNC A;  2I79 A;  1MJ9 A;  4Y49 C;  2CNT A;  1LRZ A;  4DNC A;  3ZJ0 A;  4QB9 A;  4K30 A;  3V8I A;  2R1I A;  1YVO A;  1S7N A;  3TO7 A;  4B5P A;  3D8P A;  4U9Z A;  5EC4 A;  1Z4E A;  2H5M A;  2FSR A;  5ISV A;  2RC4 A;  1SQH A;  4PV6 A;  3R95 A;  3EFA A;  3EC4 A;  4KOT A;  4UWI A;  2OU2 A;  2BUE A;  3C26 A;  1YK3 A;  3T90 A;  4NSQ A;  4AVB A;  5IB0 A;  2PC1 A;  1XF8 A;  3F5B A;  2Q4V A;  4B5P B;  1S3Z A;  4KOS A;  1N71 A;  4MY0 A;  1R57 A;  3P2H A;  3TO6 A;  3QB8 A;  2AE6 A;  1I12 A;  2BEI A;  2HQY A;  2G0B A;  4AG7 A;  2JDD A;  3G8W A;  1VHS A;  1J4J A;  1VKC A;  4ONU A;  1YGH A;  2OZU A;  1KUV A;  1S7K A;  2JDC A;  4FD6 A;  3TT2 A;  3I9S A;  4CAX A;  2B4D B;  2OZG A;  1NE9 A;  1S7L A;  4H6Z A;  2KCW A;  2ZXV A;  4KVM E;  5DWN A;  1RO5 A;  2ZW6 A;  5F47 A;  4RI1 A;  3K9U A;  4GS4 A;  1XIX A;  2AJ6 A;  1B87 A;  2FT0 A;  3N7Z A;  1MJA A;  5JQ4 A;  4NCZ A;  1PU9 A;  2Q4Y A;  4KUB A;  1YLE A;  2B4B A;  2GIV A;  3TFY A;  3DR8 A;  3GYA A;  1M44 A;  3E0K A;  4XPK A;  2CNM A;  1U6M A;  2J8M A;  4FD5 A;  4YFJ A;  4IUS A;  2B58 A;  1XEB A;  3FYN A;  2BSW A;  4X5K A;  4KUA A;  2HUZ A;  2D4O A;  2ZW4 A;  2WPW A;  2OH1 A;  2G3A A;  2A4N A;  3W6S A;  4KLW A;  2FIW A;  2ZW5 A;  2NMT A;  4AVA A;  3PP9 A;  4CRY B;  1IID A;  1S60 A;  2P6G A;  2FS5 A;  2R8V A;  2JLM A;  4M85 A;  5JPH A;  2CY2 A;  2DXQ A;  5KTD A;  1QSO A;  5C82 A;  4QVT A;  1BOB A;  1M1D A;  1PUA A;  4XNH B;  1OZP A;  2C27 A;  2B5G A;  1UFH A; 
#chains in the Genus database with same CATH topology
 1BO4 A;  3TO9 A;  4AVC A;  3I1U A;  4K3N A;  4PK3 A;  2VL1 A;  5GCN A;  3SXN A;  3UY5 A;  2R7H A;  2VQY A;  5CNP A;  4F6A A;  1EE3 P;  3R9F A;  1P4N A;  3CXP A;  5LRK A;  4AG9 A;  2ZOG A;  5K8P A;  4MMO A;  4OP4 A;  1P0H A;  1XE4 A;  1TF9 A;  1JWQ A;  3B3S A;  4HKF A;  4NF1 A;  3R96 A;  3TCV A;  1YR0 A;  2QVP A;  5HMN A;  1TKF A;  2EO8 A;  1R3N A;  4XNH C;  1YSJ A;  2V8G A;  4R87 A;  4A2Z A;  1MJB A;  1LAM A;  1CJW A;  3GUX A;  1RXT A;  2PR8 A;  3GY9 A;  3IEH A;  4CGM A;  4OLL A;  5E96 A;  4YGO A;  1NMT A;  3FVL A;  4QBJ A;  1XFO A;  1ELM P;  3CXQ A;  1H8L A;  3NH8 A;  1Q2Y A;  2I3C A;  2I00 A;  3GLJ A;  4MFZ A;  4NEX A;  1M4I A;  2B3V A;  4UCM A;  3ISZ A;  2PDO A;  3PFO A;  5J8F A;  1Z4R A;  2HV2 A;  4CGO A;  2BOA A;  4F0Y A;  5LYL A;  3IWG A;  1YLO A;  5G1Z A;  4MI4 A;  4PSW A;  2AFO A;  1JQG A;  2AFW A;  2CTC A;  4B12 A;  4OKO A;  4P10 A;  1QSR A;  2B4D A;  1AYE A;  3EY5 A;  2VZZ A;  3ZZI A;  1GHE A;  2PIY A;  3NE7 A;  3RAM A;  4OC1 A;  3WAB A;  4KVO E;  3SHP A;  1IU8 A;  4DUK A;  4UF4 A;  3D2P A;  4AB7 A;  2R98 A;  1IIC A;  1Z8W A;  3T9Y A;  1QSM A;  4MFL A;  4NGR A;  1KUY A;  4KOR A;  4BBH A;  2F8H A;  2JEV A;  4F0X A;  2JEW A;  3BLN A;  3F0A A;  4YRH A;  1QSN A;  5EBV A;  4OAD A;  1Y9W A;  5THW A;  2J8R A;  4EME A;  2PQ8 A;  3JVN A;  4NGN A;  2EBJ A;  2JBJ A;  4OID A;  2C1C A;  1A2Z A;  3S6F A;  2PJ1 A;  2ZED A;  2BO9 A;  4KOV A;  3PBB A;  4H6U A;  2PR1 A;  4UIA A;  3B7I A;  4NGS A;  4BMH A;  3SJG A;  2YNE A;  4HPS A;  4OC2 A;  1IOI A;  1KWM A;  4WWV A;  2V77 A;  4B10 A;  4CYP A;  2PRB A;  1IB1 E;  1PCA A;  3KI9 A;  4JXQ A;  4U5Y A;  4X8I A;  5AGE A;  1ELL P;  3OWC A;  3FF3 A;  2Z0Z A;  1I21 A;  3LOD A;  4ORF A;  2ANP A;  5BWA B;  1QQ9 A;  3W91 A;  2O28 A;  4KVX A;  2VI7 A;  1Y7R A;  3R9E A;  5AG6 A;  2Q7B A;  1YW6 A;  3KR5 A;  4MJ8 A;  3B3W A;  3CXS A;  4P6Y A;  3W6X A;  4CAW A;  2P6F A;  4JXR A;  4MHZ A;  2FE7 A;  4WJB A;  4E8O A;  2J8N A;  1IYK A;  1L0C A;  4KOY A;  3VWD A;  1LAN A;  1AMP A;  1Q2C A;  1BLL E;  4ZY2 A;  4MHD A;  3R9G A;  3H5Z A;  1YX0 A;  3NH4 A;  3VWE A;  4P44 A;  2Q44 A;  4A31 A;  3FEE A;  2FXF A;  3ISX A;  3IO1 A;  4JWP A;  1F2O A;  4R9M A;  2REE A;  2C6C A;  3CDX A;  3H8G A;  1WWZ A;  4RS2 A;  2QIR A;  2OZH A;  3K2K A;  2Z3N A;  4LQG A;  3JTK A;  4Q38 A;  3S6H A;  5KTA A;  5J1Q A;  4QC6 A;  4E0A A;  5F46 A;  5IV0 A;  3DDD A;  4PK2 A;  2CNS A;  1XJO A;  1QST A;  2QML A;  2ZEH A;  1YVK A;  5F49 A;  5C88 A;  1M4L A;  4P4E A;  1S5K A;  4W9Y A;  4MBU A;  3CPA A;  4BIN A;  1ON0 A;  2Y0M A;  1YRE A;  3R1K A;  3S6G A;  2G9D A;  5G21 A;  2XEF A;  2ZEN A;  3IJ3 A;  5I4M A;  5EMI A;  2ZPA A;  5KTC A;  4IK2 A;  1TF8 A;  2ABZ A;  5HVG A;  2PSW A;  2PJC A;  1CG2 A;  3GB0 A;  2O53 A;  3TC8 A;  4FD4 A;  4KOW A;  3FXT A;  3FX6 A;  1XOV A;  2CF4 A;  1RTQ A;  2VXK A;  4UWJ A;  2PJ5 A;  1IYL A;  2GAN A;  1IY7 A;  4A37 A;  4L8A A;  5H84 A;  2DPS A;  2QEC A;  1ZG8 A;  1B6B A;  2K5T A;  4MCQ A;  1ZO0 A;  2DEA A;  2ZEF A;  4A33 A;  3S9L A;  4KLV A;  4MFP A;  4CGN A;  2YNC A;  3H4Q A;  2RFH A;  3SXO A;  2Q51 A;  2Q04 A;  4UIB A;  2ZEO A;  4RN7 A;  4X2T A;  3IWE A;  1NSL A;  4M6G A;  1BAV A;  1XRY A;  3D3S A;  3I3G A;  4HNW B;  4CGP A;  2G3T A;  3BJ7 A;  4C2Z A;  1M4D A;  4EFD A;  2Z3P A;  5DWM A;  4OC5 A;  2VEZ A;  3RBU A;  2EK9 A;  4R3L A;  2AFM A;  2EK8 A;  3NH5 A;  3NE8 A;  1MK4 A;  3IC1 A;  4FWU A;  3SI1 A;  3SI0 A;  4EVY A;  4LUA A;  4ZGY B;  1XBU A;  4KOX A;  4KS9 A;  4JZ0 A;  2DF5 A;  4XPL A;  3KQZ A;  3TOA A;  4C7I A;  4P4J A;  1OBR A;  2O4H A;  4IF5 A;  2VBQ A;  3DSB A;  2P0W A;  3FMC A;  2AFU A;  2Q0Y A;  4AXV A;  3KGQ A;  4MCR A;  1I1D A;  2V8V A;  2YGW A;  3GKR A;  4X3R A;  4UBR A;  1IGB A;  4R3K A;  2VZY A;  3LMS A;  4MY3 A;  4C2X A;  1AUG A;  3D66 A;  3WR7 A;  4B11 A;  2OOT A;  3WT4 A;  3PBE A;  1WK4 A;  5LYD A;  4DJL A;  3EO4 A;  2EVN A;  5HH1 A;  5HVH A;  4M3S A;  2XEG A;  4ZX8 A;  4B5O A;  4PQA A;  3D7D A;  4P4I A;  2BL1 A;  4KOU A;  3HUV A;  4C7H A;  1Y9K A;  2ATR A;  2Z3O A;  1S7F A;  2Z11 A;  2GLJ A;  4CPA A;  4LX9 A;  3DR6 A;  2B5G B;  4MHP A;  4FUU A;  4Y49 B;  1YME A;  4OIW A;  4UCP A;  4KZT A;  2BCO A;  3D67 A;  2ARH A;  5G22 A;  3MN8 A;  1KUX A;  4LQ6 A;  4MRI A;  1ZLH A;  3PGP A;  2Q7S A;  4CAF A;  4NGP A;  1LAP A;  5J8C A;  2XEI A;  5D29 A;  4II9 A;  1VIX A;  1ZG7 A;  4UEE A;  2GU2 A;  2WPX A;  2GE3 A;  1Q2D A;  4B14 A;  1CM0 A;  4M6I A;  4UA3 A;  2EUI A;  2ZW7 A;  2Z10 A;  4CS0 B;  2ZEG A;  3FBU A;  4JLY A;  3PB8 X;  2GLF A;  2PJ4 A;  4GM5 A;  1M4G A;  5FVJ A;  5H86 A;  5CBM A;  2CIJ A;  3DNS A;  3DLJ A;  3P2F A;  3IIB A;  4UEZ A;  5AG5 A;  5JM6 A;  3BI1 A;  1CP7 A;  3LD2 A;  4JD6 A;  1TXR A;  3FRM A;  3G3S A;  2PVW A;  4KSF A;  4NJR A;  4CYQ A;  2REF A;  3PFE A;  4CAV A;  2QJ8 A;  3B8G A;  3KZW A;  3WC7 A;  4CYO A;  5I0C A;  2NSM A;  2P6E A;  2X7B A;  5ELY A;  4XPD C;  4R76 A;  1FY7 A;  3L2N A;  3BI0 A;  4P4F A;  3V38 A;  1F2P A;  4ZX9 A;  1Z9U A;  3D7H A;  5F48 A;  3NA6 A;  3EXN A;  4HNX B;  4YU9 A;  1FT7 A;  4NXY A;  4PSX A;  3H8E A;  5D8N A;  2CXA A;  5AG7 A;  5HXD A;  4UFX A;  1V0C A;  1VGY A;  4F9U A;  3LWU A;  4H89 A;  3RYO A;  3TOB A;  2ZEM A;  3RZA A;  2FL4 A;  1HDQ A;  1XMT A;  3D4U A;  4L89 A;  4UEF A;  3KKW A;  3CZX A;  1TKJ A;  3BJ8 A;  2DPT A;  3TTH A;  3QNV A;  4PXE A;  4HNY B;  3FJU A;  4OAE A;  4PPZ A;  3MRU A;  3PZJ A;  2F5I A;  4XPD B;  4GXH A;  3IU1 A;  3CPX A;  4R57 A;  1K4J A;  2ZOF A;  4ZBG A;  1KZF A;  4FD7 A;  3FIX A;  3D2M A;  2NYQ A;  2Z3L A;  3B3V A;  1LOK A;  4E2A A;  5LRG A;  4C2Y A;  3S6K A;  4TWE A;  3IWW A;  3SJF A;  4CRZ B;  5CPA A;  2FIA A;  4U9Y A;  4J3G A;  2C6G A;  5JGF A;  1R43 A;  2CTB A;  4MFQ A;  3JRU A;  2YND A;  3A9L A;  3QAH A;  4QUS A;  4UFV A;  4Z65 A;  5IX3 A;  2B3U A;  2F7V A;  1CPX A;  3GIU A;  2PJ7 A;  4KSI A;  2AFZ A;  3IU2 A;  3JUW A;  1HDU A;  3F8K A;  3MGD A;  3SI2 A;  4OC0 A;  4B13 A;  3IGR A;  2Q4Z A;  2J9A A;  2PJ2 A;  4OC4 A;  2FCK A;  2D4P A;  4I49 A;  4MCS A;  1CBX A;  2IL4 A;  3FB3 A;  1TIQ A;  2IJZ A;  4OC3 A;  5F09 A;  5K8O A;  2OB0 A;  4JJX A;  3TE4 A;  3K9T A;  2Z3M A;  4OME A;  3PB4 X;  3FNC A;  3KR4 A;  4PXD A;  2I79 A;  1MJ9 A;  3DGV A;  2AFS A;  1LRZ A;  2CNT A;  3PB9 X;  4Y49 C;  4DNC A;  4Q7A A;  3V7Z A;  2GFQ A;  1QMU A;  5AG4 A;  3ZJ0 A;  1Q7L A;  4FBE A;  2ZEL A;  4QB9 A;  4K30 A;  2V8D A;  1ZG9 A;  3V8I A;  2R1I A;  1Z8L A;  4O23 A;  1DE4 C;  3T8W A;  1Z8X A;  1YVO A;  2PVV A;  1S7N A;  5A28 A;  3TO7 A;  3B3T A;  3RNZ A;  1YQE A;  3D8P A;  4U9Z A;  5EC4 A;  4B5P A;  1Z4E A;  4H2K A;  2H5M A;  3D68 A;  3QAY A;  2FSR A;  4P4B A;  1Z8T A;  4R8F A;  4BD9 A;  5ISV A;  3KAS A;  3N5F A;  4NFR A;  2PJB A;  2RC4 A;  4YWY A;  1SQH A;  4EWT A;  4PV6 A;  3R95 A;  3EFA A;  2WYR A;  5LRJ A;  3EC4 A;  4KOT A;  2EWB A;  4MHN A;  2IMO A;  4UWI A;  2OU2 A;  2BUE A;  3C26 A;  1NSA A;  3PB6 X;  1YK3 A;  3TX8 A;  3T90 A;  1X12 A;  4NSQ A;  4AVB A;  1Y0R A;  2PCU A;  4ZI6 A;  4NGT A;  3KHZ A;  1VHO A;  2PC1 A;  1XF8 A;  2OR4 A;  2V8H A;  3F5B A;  2Q4V A;  5IB0 A;  4B5P B;  1S3Z A;  1GYT A;  1PYT B;  4KOS A;  3LAC A;  4R7M A;  1N71 A;  4MY0 A;  1R57 A;  2WUU A;  4P45 A;  3P2H A;  3NFZ A;  4ONW A;  3B35 A;  2Z3K A;  3TO6 A;  3KL9 A;  3QB8 A;  3S9N A;  5JH9 A;  5LYF A;  2AE6 A;  4NGM A;  1Y7E A;  4UCN A;  1I12 A;  3S9M A;  2BEI A;  3WC6 A;  2HQY A;  2Q43 A;  2G0B A;  4AG7 A;  2JDD A;  4MHY A;  3G8W A;  1VHS A;  2PJ3 A;  2PE3 A;  1Z5R A;  1VHE A;  4NGQ A;  4P4D A;  2HB6 A;  1J4J A;  2PJ6 A;  1VKC A;  4ONU A;  1YGH A;  4R6T A;  3SJX A;  2OZU A;  1KUV A;  1F57 A;  4MXU A;  1S7K A;  2PJ0 A;  2JDC A;  4PXC A;  4FD6 A;  3IFE A;  5A27 A;  3TT2 A;  8CPA A;  3I9S A;  4G1P A;  7CPA A;  4IAV A;  6CPA A;  2QYV A;  1UWY A;  4CAX A;  4CAE A;  4C68 A;  1HEE A;  1XMB A;  2B4D B;  2WZN A;  2JBK A;  4Q36 A;  2OZG A;  3RO0 A;  4A94 A;  1NE9 A;  1S7L A;  1CPS A;  4H6Z A;  2RB7 A;  2KCW A;  2ZXV A;  3B3C A;  4FAI A;  3KQX A;  4KVM E;  4CGL A;  4F8Z A;  3PB7 X;  1BPN A;  2ZEE A;  1LFW A;  3HLP A;  5DWN A;  1RO5 A;  2YNC C;  2ZW6 A;  2PJA A;  5F47 A;  2WSA A;  4RI1 A;  5IB9 A;  4PXB A;  3D7F A;  3K9U A;  4GS4 A;  1XIX A;  2AJ6 A;  2IQ6 A;  1B87 A;  2FT0 A;  1ZLI A;  2PIZ A;  2PJ8 A;  3H8F A;  4TNU A;  1Z2L A;  1ARL A;  3FEC A;  3N7Z A;  1MJA A;  2POK A;  5JQ4 A;  1BPM A;  4NCZ A;  2AFX A;  3KHX A;  1PU9 A;  3FH4 A;  3PRT A;  2Q4Y A;  4KUB A;  1YLE A;  4CYN A;  2B4B A;  2GIV A;  3D7G A;  3TFY A;  3DR8 A;  2HC9 A;  4UFW A;  4ZYQ A;  3GYA A;  1M44 A;  3E0K A;  5K8M A;  2PRQ A;  4XPK A;  1ARM A;  4ZY1 A;  4MFJ A;  2CNM A;  1YW4 A;  1U6M A;  2J8M A;  4FD5 A;  4B6Z A;  4YFJ A;  4IUS A;  2B58 A;  4IHM A;  2ODF A;  1XEB A;  3FYN A;  2BSW A;  4NJQ A;  4X5K A;  3B2Y A;  4KUA A;  3BXM A;  1FNO A;  5HVF A;  3VH9 A;  3WC5 A;  4A30 A;  2HUZ A;  2D4O A;  2ZW4 A;  3VAT A;  4MFK A;  4A32 A;  5K8N A;  1DTD A;  2WPW A;  4F9V A;  1LCP A;  2OH1 A;  2G3A A;  2A4N A;  3W6S A;  4KLW A;  2FIW A;  2PJ9 A;  2ZW5 A;  2NMT A;  5DS0 A;  3PP9 A;  4AVA A;  4CRY B;  4RUH A;  1IID A;  1S60 A;  2P6G A;  1TKH A;  2FS5 A;  2R8V A;  2FVG A;  2JLM A;  1CX8 A;  2ZEP A;  5LYI A;  3SJE A;  4M85 A;  4A95 A;  5JPH A;  1IOF A;  4ZY0 A;  4DYO A;  2CY2 A;  1X10 A;  2DXQ A;  3BHX A;  3CT9 A;  3FED A;  4MCP A;  1Y0Y A;  5KTD A;  4JYW A;  1QSO A;  2GRE A;  5C82 A;  3PEI A;  3VAR A;  4QVT A;  2C6P A;  4M6H A;  1BOB A;  1M1D A;  4A38 A;  1PUA A;  5G20 A;  4XNH B;  1CP6 A;  1OZP A;  2XEJ A;  4KSA A;  2C27 A;  2B5G A;  4A39 A;  1UFH A; 
#chains in the Genus database with same CATH homology
 1BO4 A;  3TO9 A;  4AVC A;  4PK3 A;  5GCN A;  3UY5 A;  3SXN A;  2R7H A;  2VQY A;  5CNP A;  4F6A A;  3R9F A;  1P4N A;  3CXP A;  4AG9 A;  1P0H A;  1XE4 A;  4NF1 A;  3R96 A;  3TCV A;  4HKF A;  1YR0 A;  5HMN A;  4XNH C;  4A2Z A;  4R87 A;  1MJB A;  1CJW A;  1RXT A;  2PR8 A;  3GY9 A;  4CGM A;  4OLL A;  5E96 A;  4YGO A;  1NMT A;  4QBJ A;  3CXQ A;  1Q2Y A;  2I00 A;  4MFZ A;  4NEX A;  1M4I A;  2B3V A;  4UCM A;  2PDO A;  1Z4R A;  2HV2 A;  4CGO A;  4F0Y A;  3IWG A;  5G1Z A;  4MI4 A;  4PSW A;  4B12 A;  1QSR A;  2B4D A;  3EY5 A;  2VZZ A;  3ZZI A;  1GHE A;  3NE7 A;  4KVO E;  3SHP A;  3D2P A;  4AB7 A;  2R98 A;  1IIC A;  3T9Y A;  1QSM A;  4MFL A;  1KUY A;  4KOR A;  4BBH A;  2JEV A;  4F0X A;  4YRH A;  3BLN A;  3F0A A;  1QSN A;  5EBV A;  4OAD A;  1Y9W A;  2J8R A;  2PQ8 A;  3JVN A;  3S6F A;  4KOV A;  4H6U A;  2PR1 A;  4BMH A;  2YNE A;  4B10 A;  4CYP A;  2PRB A;  1IB1 E;  4JXQ A;  4U5Y A;  5AGE A;  3OWC A;  2Z0Z A;  1I21 A;  3LOD A;  4ORF A;  5BWA B;  3W91 A;  2O28 A;  4KVX A;  2VI7 A;  1Y7R A;  3R9E A;  5AG6 A;  2Q7B A;  4MJ8 A;  3CXS A;  4CAW A;  3W6X A;  2P6F A;  4JXR A;  2FE7 A;  4E8O A;  1IYK A;  2J8N A;  1L0C A;  4KOY A;  3VWD A;  1Q2C A;  4MHD A;  3R9G A;  3H5Z A;  1YX0 A;  3VWE A;  2Q44 A;  4A31 A;  2FXF A;  4JWP A;  4R9M A;  2REE A;  1WWZ A;  4RS2 A;  2QIR A;  2OZH A;  2Z3N A;  3JTK A;  4Q38 A;  3S6H A;  5KTA A;  4QC6 A;  4E0A A;  5F46 A;  5IV0 A;  3DDD A;  4PK2 A;  2CNS A;  5F49 A;  1QST A;  2QML A;  1YVK A;  5C88 A;  1S5K A;  4MBU A;  1ON0 A;  2Y0M A;  1YRE A;  3R1K A;  3S6G A;  5G21 A;  5KTC A;  2ZPA A;  2PSW A;  4FD4 A;  4KOW A;  3FXT A;  2VXK A;  4UWJ A;  1IYL A;  2GAN A;  4L8A A;  5H84 A;  2DPS A;  2QEC A;  1B6B A;  2K5T A;  1ZO0 A;  4A33 A;  4KLV A;  4MFP A;  4CGN A;  2YNC A;  3H4Q A;  3SXO A;  2Q04 A;  3IWE A;  1NSL A;  5J8F A;  3D3S A;  4CGP A;  3I3G A;  4HNW B;  2G3T A;  3BJ7 A;  4C2Z A;  1M4D A;  2Z3P A;  5DWM A;  2VEZ A;  4R3L A;  1MK4 A;  4EVY A;  4LUA A;  4ZGY B;  4KOX A;  4KS9 A;  4XPL A;  3TOA A;  4C7I A;  4IF5 A;  2VBQ A;  3DSB A;  2P0W A;  2Q0Y A;  1I1D A;  2YGW A;  3GKR A;  4UBR A;  4R3K A;  2VZY A;  4MY3 A;  4C2X A;  3WR7 A;  4B11 A;  1WK4 A;  3EO4 A;  2EVN A;  5HH1 A;  4M3S A;  4B5O A;  2BL1 A;  4KOU A;  4C7H A;  1Y9K A;  2ATR A;  2Z3O A;  1S7F A;  2Z11 A;  4LX9 A;  3DR6 A;  2B5G B;  4Y49 B;  4UCP A;  4KZT A;  2ARH A;  5G22 A;  1KUX A;  3PGP A;  4CAF A;  5J8C A;  4II9 A;  2WPX A;  2GE3 A;  1Q2D A;  4B14 A;  1CM0 A;  4UA3 A;  2EUI A;  2ZW7 A;  2Z10 A;  4CS0 B;  3FBU A;  4JLY A;  5H86 A;  1M4G A;  5FVJ A;  3DNS A;  3P2F A;  5AG5 A;  4JD6 A;  3LD2 A;  3FRM A;  3G3S A;  4KSF A;  4CYQ A;  2REF A;  4CAV A;  3B8G A;  4CYO A;  5I0C A;  2X7B A;  2P6E A;  4XPD C;  1FY7 A;  1Z9U A;  5F48 A;  3EXN A;  4HNX B;  4NXY A;  4PSX A;  2CXA A;  5AG7 A;  4UFX A;  1V0C A;  4H89 A;  3RYO A;  3TOB A;  2FL4 A;  1XMT A;  4L89 A;  3KKW A;  3BJ8 A;  2DPT A;  3TTH A;  4HNY B;  4OAE A;  3PZJ A;  4XPD B;  2F5I A;  3IU1 A;  4R57 A;  1K4J A;  4ZBG A;  1KZF A;  4FD7 A;  3FIX A;  3D2M A;  2Z3L A;  4E2A A;  4C2Y A;  3S6K A;  4CRZ B;  2FIA A;  4U9Y A;  4J3G A;  4MFQ A;  4QUS A;  2YND A;  3A9L A;  3QAH A;  4UFV A;  5IX3 A;  2B3U A;  3IU2 A;  3JUW A;  3MGD A;  3F8K A;  4B13 A;  3IGR A;  2FCK A;  2D4P A;  4I49 A;  2IL4 A;  3FB3 A;  1TIQ A;  2OB0 A;  4JJX A;  3TE4 A;  2Z3M A;  3FNC A;  2I79 A;  1MJ9 A;  4Y49 C;  2CNT A;  1LRZ A;  4DNC A;  5AG4 A;  3ZJ0 A;  4QB9 A;  4K30 A;  3V8I A;  2R1I A;  1YVO A;  5A28 A;  1S7N A;  3TO7 A;  4B5P A;  3D8P A;  4U9Z A;  5EC4 A;  1Z4E A;  2H5M A;  2FSR A;  5ISV A;  2RC4 A;  1SQH A;  4PV6 A;  3R95 A;  3EFA A;  3EC4 A;  4KOT A;  4UWI A;  2OU2 A;  2BUE A;  3C26 A;  1YK3 A;  3T90 A;  4NSQ A;  4AVB A;  5IB0 A;  2PC1 A;  1XF8 A;  3F5B A;  2Q4V A;  4B5P B;  1S3Z A;  4KOS A;  1N71 A;  4MY0 A;  1R57 A;  2WUU A;  3P2H A;  3TO6 A;  2Z3K A;  3QB8 A;  2AE6 A;  4UCN A;  1I12 A;  2BEI A;  2HQY A;  2G0B A;  4AG7 A;  2JDD A;  3G8W A;  1VHS A;  1J4J A;  1VKC A;  4ONU A;  1YGH A;  2OZU A;  1KUV A;  1S7K A;  2JDC A;  4FD6 A;  5A27 A;  3TT2 A;  3I9S A;  4CAX A;  4CAE A;  4C68 A;  2B4D B;  4Q36 A;  2OZG A;  1NE9 A;  1S7L A;  4H6Z A;  2KCW A;  2ZXV A;  4CGL A;  4KVM E;  5DWN A;  1RO5 A;  2YNC C;  2ZW6 A;  5F47 A;  2WSA A;  4RI1 A;  3K9U A;  4GS4 A;  1XIX A;  2AJ6 A;  1B87 A;  2FT0 A;  3N7Z A;  1MJA A;  5JQ4 A;  4NCZ A;  1PU9 A;  2Q4Y A;  4KUB A;  1YLE A;  4CYN A;  2B4B A;  2GIV A;  3TFY A;  3DR8 A;  4UFW A;  3GYA A;  1M44 A;  3E0K A;  4XPK A;  4MFJ A;  2CNM A;  1U6M A;  2J8M A;  4FD5 A;  4YFJ A;  4IUS A;  2B58 A;  1XEB A;  3FYN A;  2BSW A;  4X5K A;  4KUA A;  4A30 A;  2HUZ A;  2D4O A;  2ZW4 A;  4MFK A;  4A32 A;  2WPW A;  2OH1 A;  2G3A A;  2A4N A;  3W6S A;  4KLW A;  2FIW A;  2ZW5 A;  2NMT A;  4AVA A;  3PP9 A;  4CRY B;  1IID A;  1S60 A;  2P6G A;  2FS5 A;  2R8V A;  2JLM A;  4A95 A;  4M85 A;  5JPH A;  2CY2 A;  2DXQ A;  5KTD A;  1QSO A;  5C82 A;  4QVT A;  1BOB A;  1M1D A;  1PUA A;  5G20 A;  4XNH B;  1OZP A;  4KSA A;  2C27 A;  2B5G A;  1UFH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...