2FIAA

The crystal structure of the acetyltransferase from enterococcus faecalis
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
157
structure length
157
Chain Sequence
MKIRVADEKELPMILQFLTEVKAYMDVVGITQWTKDYPSQGDIQEDITKKRLYLLVHEEMIFSMATFCMEQEQDFVWLKRFATSPNYIAKGYGSLLFHELEKRAVWEGRRKMYAQTNHTNHRMIRFFESKGFTKIHESLQMNRLDFGSFYLYVKELE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords acetyltransferase
publication title The crystal structure of the acetyltransferase from Enterococcus faecalis
rcsb
source organism Enterococcus faecalis
molecule tags Transferase
total genus 47
structure length 157
sequence length 157
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-12-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 2fiaA00
2HQYA 2VZZA 4J3GA 2G0BA 2HUZA 1L0CA 2I00A 2B4DA 4IF5A 5KTCA 4NCZA 3VWEA 3S6KA 5F47A 2AJ6A 2R98A 4PV6A 4QB9A 5E96A 4QUSA 5GCNA 1MK4A 1BO4A 2C27A 1S5KA 5F49A 2JDDA 1N71A 3PZJA 2JDCA 1XF8A 1IICA 1PU9A 3D2PA 2FCKA 3EXNA 5IX3A 2B4BA 1WK4A 4KVME 2OH1A 2ZW6A 4AVCA 5KTAA 3LODA 4NEXA 2JEVA 1B87A 3R95A 4CRYB 4U5YA 2Z11A 4U9ZA 1NMTA 1IB1E 1S7FA 2G3TA 3FXTA 4IUSA 4FD4A 4PK3A 5JQ4A 3TO9A 1ON0A 1YGHA 1Y7RA 2CNMA 3GY9A 4KOSA 2PR8A 1XEBA 2ZW7A 5C88A 2VBQA 4XPDC 3H4QA 3EC4A 4GS4A 1S60A 4KUBA 2ZW4A 2Q04A 1Z9UA 2ARHA 3R1KA 4MY3A 3FBUA 1QSOA 3F0AA 2REFA 4YFJA 3SXOA 1NE9A 1P4NA 4K30A 1PUAA 2AE6A 3SHPA 2GE3A 5DWMA 5J8FA 3FYNA 4E8OA 1RXTA 3IGRA 1IYLA 5HH1A 3G3SA 4PK2A 3UY5A 4R9MA 5H86A 4MBUA 4AB7A 2F5IA 4KVOE 4KOVA 3EO4A 5DWNA 5F48A 1KUVA 5CNPA 2KCWA 2FS5A 2HV2A 3G8WA 4NSQA 1Q2CA 4B5PB 3TT2A 2P0WA 1QSTA 2X7BA 3DR6A 1SQHA 1VKCA 2VXKA 1K4JA 4KVXA 3W6SA 3FB3A 3PP9A 4I49A 3R9FA 5KTDA 1Y9WA 4XPLA 2ZXVA 4QBJA 4H6UA 3ZJ0A 2B5GB 4AVBA 1CM0A 5FVJA 2J8RA 2OU2A 3R96A 3TTHA 1KUXA 2RC4A 2ATRA 3KKWA 4KLVA 1M4DA 1YLEA 1MJ9A 3LD2A 1B6BA 5HMNA 3GKRA 4KOYA 3W91A 1WWZA 2R1IA 2R8VA 4XPDB 4X5KA 4KLWA 3JUWA 4MI4A 3JVNA 4ONUA 1Y9KA 4B5PA 4KOWA 2OZHA 4JXQA 4R87A 1YVOA 2PQ8A 1YREA 3R9GA 4U9YA 2GANA 1R57A 1IYKA 2Q4VA 2BL1A 3EY5A 1VHSA 4ORFA 4DNCA 2CNTA 4UWJA 1QSMA 1U6MA 2VI7A 1I1DA 2QIRA 4Y49C 2JLMA 3PGPA 4AVAA 5EBVA 1YVKA 5C82A 4L8AA 3S6FA 4RS2A 1YR0A 5IB0A 2FXFA 1LRZA 2OZUA 4FD6A 4JWPA 2NMTA 4ZBGA 3NE7A 4UBRA 3S6GA 3S6HA 3R9EA 2BUEA 3OWCA 2EUIA 1I12A 4YGOA 2Q0YA 4KOXA 1YK3A 3V8IA 2B3UA 4KZTA 4II9A 3FRMA 3QAHA 3CXQA 4RI1A 3TOAA 3BJ7A 4JLYA 2I79A 2DXQA 2OZGA 2P6GA 2B3VA 3DR8A 2REEA 3K9UA 5I0CA 3DDDA 4QVTA 2P6EA 4F0YA 4E0AA 4F6AA 4UA3A 1CJWA 4XNHC 1QSRA 3P2FA 4UWIA 5ISVA 2H5MA 4H6ZA 3D8PA 2BEIA 3WR7A 2WPWA 4KOTA 1M1DA 5F46A 2EVNA 5EC4A 4EVYA 3TO7A 3FIXA 4KOUA 2IL4A 1V0CA 4LUAA 1QSNA 3T90A 4H89A 2GIVA 3TFYA 1J4JA 1OZPA 4M85A 4Y49B 3MGDA 2D4PA 2PRBA 4FD5A 4OLLA 2CY2A 3TOBA 2Q44A 3VWDA 3N7ZA 4NXYA 4JJXA 3F5BA 4CS0B 1I21A 3QB8A 4KORA 4MJ8A 2R7HA 4HNWB 1NSLA 4PSWA 3TE4A 2ZW5A 2FT0A 1TIQA 4JD6A 2O28A 2OB0A 3BJ8A 3CXPA 2A4NA 2WPXA 1M4GA 1S3ZA 1UFHA 4CAVA 2CNSA 3RYOA 2B5GA 4NF1A 4OAEA 4R3KA 2Q7BA 1KUYA 1XE4A 1Z4EA 4MY0A 3I9SA 3CXSA 4QC6A 5J8CA 1RO5A 2D4OA 2PDOA 2Z0ZA 2FIAA 3T9YA 3D2MA 4OADA 1P0HA 3BLNA 3F8KA 2Z10A 3DSBA 1M4IA 2J8NA 4FD7A 2PSWA 1GHEA 4CAWA 4R3LA 3D3SA 4XNHB 2Q4YA 4M3SA 1MJBA 1S7NA 1YX0A 1Z4RA 3W6XA 1FY7A 1Q2DA 1MJAA 3C26A 2QECA 5H84A 2FIWA 1S7KA 2Y0MA 4B5OA 2FE7A 2VQYA 4HKFA 3B8GA 4HNXB 2ZPAA 1S7LA 1XMTA 2FL4A 2G3AA 1IIDA 2FSRA 4BMHA 2B4DB 3GYAA 2PC1A 2VZYA 3ZZIA 4PSXA 1BOBA 3SXNA 2B58A 4AG7A 2J8MA 5JPHA 2BSWA 4CRZB 4CAXA 4HNYB 4AG9A 3TCVA 4JXRA 1KZFA 4XPKA 1M44A 1Q2YA 3E0KA 3IWGA 5IV0A 1XIXA 4MHDA 2QMLA 4LX9A 3I3GA 3TO6A 4L89A 2P6FA 2PR1A 4YRHA 3EFAA 2K5TA 2VEZA 4E2AA 3P2HA 4KUAA 3DNSA 3FNCA 4R57A
chains in the Genus database with same CATH superfamily
2HQYA 3NFZA 2VZZA 1YSJA 2Z3PA 4J3GA 4MFZA 1ARMA 3KR5A 4P4DA 2G0BA 5G1ZA 2HUZA 1L0CA 2I00A 2B4DA 2PJ6A 3A9LA 3MRUA 4IF5A 4C68A 5KTCA 4NCZA 3VWEA 3IC1A 4MCQA 2AFMA 3S6KA 4UIBA 5F47A 4BD9A 2PJ2A 2AJ6A 2R98A 4PV6A 2CTCA 4QB9A 1F2PA 4HPSA 5E96A 1Y0YA 4QUSA 5GCNA 1MK4A 2DEAA 1BO4A 1LAPA 4P45A 4RUHA 3B3TA 2C27A 1S5KA 5F49A 2JDDA 3KR4A 1N71A 3LMSA 4ZI6A 3PZJA 2JDCA 1XF8A 1IICA 1TXRA 2XEFA 1PU9A 1XMBA 2ABZA 2IMOA 3D2PA 2ZENA 2FCKA 3EXNA 4R6TA 5AG7A 5IX3A 1CP6A 5JM6A 2B4BA 1WK4A 4KVME 2OH1A 3H8FA 2ZW6A 3DGVA 4AVCA 1Y0RA 5KTAA 3LODA 4MHPA 3RAMA 4NEXA 3CZXA 2JEVA 2XEJA 4P4BA 4A37A 1B87A 4MFQA 3R95A 2NYQA 1YMEA 3PB4X 4CRYB 1IGBA 4U5YA 2AFUA 3IFEA 4NJQA 2Z11A 4U9ZA 1JWQA 1NMTA 1IB1E 1CPSA 1S7FA 4NGNA 2G3TA 4DUKA 3FXTA 4PXEA 4IUSA 2OR4A 2ZEFA 1HDUA 4FD4A 2I3CA 4PK3A 5JQ4A 2WUUA 1ON0A 2VL1A 3TO9A 1M4LA 1YGHA 1Y7RA 4IK2A 4X3RA 2CNMA 3GY9A 4KOSA 2PR8A 1XEBA 2ZW7A 5C88A 2VBQA 4EWTA 4XPDC 3H4QA 4OC5A 3EC4A 4GS4A 1S60A 4KUBA 4ZYQA 2ODFA 2Q04A 2ZW4A 3UY5A 1Z9UA 2ARHA 1YW4A 2PVWA 3NH8A 4B13A 3R1KA 4JZ0A 5LYDA 4ZGYB 4MY3A 3FBUA 1QSOA 1BLLE 4F8ZA 3F0AA 3GIUA 3IU1A 4MFKA 2ZELA 2REFA 4YFJA 2GLFA 2PIZA 3SXOA 1NE9A 1DE4C 2PE3A 3GB0A 1P4NA 4K30A 4PXCA 1PUAA 2AE6A 4OIDA 3SHPA 2GE3A 5JH9A 4OMEA 3WT4A 2PJ9A 2PJ4A 5DWMA 5LYLA 4KSAA 3RO0A 2XEIA 5J8FA 3FYNA 4R7MA 4E8OA 5A27A 3NH4A 1LCPA 1RXTA 1LFWA 4YU9A 3IGRA 4P4IA 1IYLA 4MFPA 5F09A 3IWWA 4MFLA 3G3SA 5HH1A 4A30A 4PK2A 4FUUA 1Z5RA 4R9MA 4UEZA 5H86A 3KI9A 4MBUA 3PB6X 3S9MA 4AB7A 2F5IA 3FX6A 4KVOE 4KOVA 3EO4A 5DWNA 2RB7A 4CAEA 5F48A 1TKFA 1KUVA 5CNPA 2KCWA 5LRGA 3VATA 1VHOA 4NGTA 3PBEA 3H8GA 2FS5A 3N5FA 2HV2A 3G8WA 4NSQA 1Q2CA 4B5PB 1LOKA 4ZY2A 3TT2A 1VHEA 1YLOA 2NSMA 6CPAA 2P0WA 1QSTA 1XBUA 2X7BA 3DR6A 3PRTA 1YW6A 1SQHA 4UCNA 2HB6A 3BI1A 5K8OA 1VKCA 2VXKA 1K4JA 4KVXA 4PQAA 3SJXA 3H8EA 3IJ3A 2EWBA 4GM5A 4UFXA 3W6SA 2QYVA 3FB3A 3PP9A 3L2NA 4I49A 5IB9A 3R9FA 4X2TA 1Y9WA 5KTDA 2PJCA 3JTKA 3SJEA 4Q36A 5K8NA 3VH9A 4XPLA 1Y7EA 2ZEOA 2ZXVA 4QBJA 1ARLA 2PVVA 4BINA 7CPAA 5J1QA 4H6UA 3D7FA 3ZJ0A 4CGPA 2B5GB 4AVBA 1CM0A 5FVJA 2J8RA 5JGFA 2PJBA 2OU2A 4O23A 3R96A 3TTHA 1KUXA 2RC4A 1IOFA 3SJFA 3LACA 1TKHA 2ATRA 3KKWA 3GUXA 4KLVA 1M4DA 1X12A 1MJ9A 1YLEA 2BO9A 4MCPA 4NGRA 4CPAA 1QMUA 2PJ8A 3LD2A 3QNVA 2V8HA 1B6BA 5HMNA 3NH5A 3WC6A 3GKRA 2DPTA 5LRJA 2PJ0A 2PJAA 1CBXA 1GYTA 4KOYA 4OC1A 4MHZA 3W91A 4TNUA 1WWZA 2YNDA 2R1IA 2R8VA 4MHYA 4XPDB 3IWEA 4OP4A 2AFXA 4H2KA 4X5KA 4KLWA 3JUWA 4MI4A 3JVNA 4ONUA 5K8MA 3KQXA 4EFDA 2Q4ZA 3SI2A 2V77A 1Y9KA 4GXHA 4ZX8A 4B5PA 4C2ZA 4CYQA 4KOWA 5I4MA 1HEEA 2O53A 1Q7LA 4F9VA 2OZHA 4B11A 1YQEA 4IHMA 1AUGA 1Z8LA 4R8FA 4C2YA 3BXMA 2O4HA 2YGWA 4M6HA 3D67A 2ZOFA 4JXQA 1YVOA 2PJ3A 2PQ8A 4R87A 5LYIA 4CYNA 4LQ6A 2ZEMA 1YREA 2DF5A 3R9GA 4U9YA 5G20A 2EK9A 2GANA 1R57A 3WC7A 1RTQA 1IYKA 5DS0A 2C6PA 2F8HA 2Q4VA 1Z8XA 2BL1A 3EY5A 4A2ZA 1IY7A 1VHSA 4ORFA 4MHNA 4KSIA 5HXDA 2JEWA 5HVHA 4ZX9A 4DNCA 3WABA 2GREA 1IU8A 2CNTA 4UWJA 2ZEDA 1QSMA 1U6MA 2VI7A 3WC5A 1FNOA 3HUVA 3RNZA 1I1DA 2QIRA 3KHZA 3D4UA 2JLMA 4Y49C 5HVGA 3PGPA 1Z2LA 4AVAA 5EBVA 1YVKA 4C2XA 5C82A 2QJ8A 1XOVA 4L8AA 1OBRA 3S6FA 4A31A 4RS2A 3CDXA 1YR0A 2PJ5A 3TC8A 5IB0A 2FXFA 3KL9A 2WZNA 3HLPA 1LRZA 2OZUA 4FD6A 4MXUA 4JWPA 4PXBA 2NMTA 2QVPA 4OC3A 2DPSA 3RZAA 4MCRA 5BWAB 4ZBGA 2OOTA 2V8DA 3NE7A 4UBRA 5THWA 2GLJA 3S6GA 3S6HA 3QAYA 1CP7A 2ZEGA 2BUEA 3R9EA 3OWCA 4OC2A 5CBMA 2EUIA 1I12A 2G9DA 2CTBA 4B14A 4UIAA 4NGQA 4YGOA 2Q0YA 4KOXA 3S9LA 1YK3A 3V8IA 3PFEA 2B3UA 4KZTA 4UFWA 3LWUA 4II9A 3FRMA 1ZO0A 4CAFA 3D7HA 3FJUA 3QAHA 3RBUA 2JBJA 3T8WA 4A95A 3CXQA 3KASA 4YWYA 1TKJA 4Q38A 4RI1A 3TOAA 3BJ7A 3K2KA 1FT7A 4JLYA 5K8PA 2ANPA 1ELLP 2I79A 2ZEHA 3PBBA 4G1PA 3PB9X 4RN7A 3FEEA 2DXQA 3K9TA 4B10A 2OZGA 2AFSA 2P6GA 2PJ7A 2B3VA 3DR8A 2BOAA 2REEA 4NGPA 4B6ZA 3K9UA 4OC0A 2Z3LA 3IEHA 1IOIA 5I0CA 3DDDA 4MFJA 4LQGA 4QVTA 1ZLHA 4PPZA 2P6EA 1CX8A 4C7HA 4F0YA 3FMCA 4E0AA 4F6AA 4UA3A 3B3CA 4MCSA 1CJWA 4XNHC 1QSRA 3P2FA 4IAVA 4UWIA 1LAMA 2CIJA 3B2YA 4UCMA 4WJBA 4EMEA 5ISVA 2H5MA 4H6ZA 3D8PA 2BEIA 3SJGA 5EMIA 4P10A 1Z8WA 2HC9A 2EK8A 2YNCA 5ELYA 2AFZA 2F7VA 1R3NA 4K3NA 4UFVA 4CGNA 3WR7A 2WPWA 2ZEEA 3B35A 4KOTA 5AG6A 1M1DA 2EBJA 2IQ6A 5F46A 2EVNA 4OIWA 2PRQA 5EC4A 1KWMA 2Z3OA 3IU2A 4EVYA 3TO7A 3FIXA 4UEFA 4KOUA 2IL4A 1BPNA 4C7IA 1V0CA 4LUAA 1QSNA 3T90A 2Q43A 1QQ9A 4H89A 3FECA 3V7ZA 4A94A 2GIVA 3TFYA 1J4JA 3D66A 5G22A 4CYOA 5AG4A 1OZPA 3MN8A 4MMOA 3DLJA 4M85A 4Y49B 3B3WA 3MGDA 3NE8A 4OKOA 3FEDA 1A2ZA 2D4PA 2ZOGA 5D8NA 1ZLIA 3SI0A 1ELMP 2V8GA 2PRBA 4FD5A 4OLLA 4F9UA 2CY2A 3TOBA 2Q44A 3VWDA 3N7ZA 4NXYA 4NJRA 2C6CA 3F5BA 4JJXA 4P4JA 4PXDA 4CS0B 1I21A 1DTDA 3D7GA 3QB8A 4DYOA 4P44A 4X8IA 5HVFA 4JYWA 3KZWA 4KORA 3FF3A 4MJ8A 2R7HA 4HNWB 1NSLA 4PSWA 3S9NA 3TE4A 2Z3KA 2ZW5A 2FT0A 2POKA 1H8LA 1TIQA 3FH4A 4M6GA 1CPXA 2FVGA 4JD6A 2O28A 2OB0A 3BHXA 3ISXA 1XFOA 4MRIA 3BJ8A 3CXPA 3VARA 2A4NA 1LANA 2GFQA 2WPXA 4FAIA 1M4GA 2AFWA 4OC4A 2V8VA 1S3ZA 1UFHA 3B3VA 4CAVA 2CNSA 4CYPA 2Q51A 3RYOA 2B5GA 4NF1A 4CGMA 1VIXA 4OAEA 1EE3P 4R3KA 4Q7AA 3CPXA 2Q7BA 1KUYA 1XE4A 1PCAA 1Z4EA 2YNEA 3KGQA 5A28A 2ZEPA 4MY0A 4BBHA 3I9SA 3CXSA 4QC6A 5J8CA 4KSFA 3JRUA 1RO5A 3B3SA 1TF9A 2D4OA 2PDOA 3FVLA 4WWVA 2Z3MA 2Z0ZA 3I1UA 2FIAA 1VGYA 3D2MA 3GLJA 4OADA 3T9YA 8CPAA 5D29A 1P0HA 3BLNA 3F8KA 2EO8A 2Z10A 3DSBA 3KHXA 4KS9A 4UEEA 4CGOA 3PEIA 3CPAA 3D7DA 3KQZA 1M4IA 2BCOA 2IJZA 2J8NA 2WYRA 4FD7A 2PSWA 1GHEA 3NA6A 4CAWA 2PIYA 2CXAA 4A33A 4R3LA 3D3SA 4XNHB 4TWEA 4AXVA 5AG5A 2C6GA 2Q4YA 4M3SA 4P4EA 3IIBA 2J9AA 1MJBA 1S7NA 1YX0A 1Z4RA 3W6XA 3SI1A 1FY7A 1ZG8A 2PCUA 4B12A 1Q2DA 1MJAA 3C26A 4NGMA 1TF8A 4ONWA 2QECA 5H84A 1XJOA 2FIWA 3PB8X 4NGSA 1S7KA 2Y0MA 4B5OA 3CT9A 5LYFA 2FE7A 2VQYA 4HKFA 3B8GA 3H5ZA 4FWUA 4HNXB 1AMPA 2ZPAA 1XRYA 1X10A 1S7LA 1XMTA 2AFOA 3PFOA 4F0XA 2FL4A 2G3AA 1IIDA 4NFRA 2FSRA 3D68A 4BMHA 1ZG7A 2B4DB 2XEGA 3GYAA 2PC1A 2VZYA 3ZZIA 2Z3NA 4PSXA 5CPAA 1BOBA 4FBEA 3SXNA 5AGEA 2B58A 2GU2A 4P6YA 3ISZA 4AG7A 2JBKA 1F2OA 2J8MA 4R76A 4UF4A 4UCPA 1HDQA 3IO1A 4A38A 1BAVA 4Z65A 5JPHA 2BSWA 2PJ1A 4CRZB 4CAXA 1BPMA 2CF4A 4HNYB 1UWYA 1PYTB 4AG9A 4CGLA 1Z8TA 3TCVA 4JXRA 4A39A 1KZFA 4ZY1A 3BI0A 1F57A 4XPKA 3PB7X 2RFHA 4M6IA 1ZG9A 4DJLA 1M44A 3B7IA 2YNCC 1Q2YA 1NSAA 4P4FA 3E0KA 3IWGA 5G21A 2Q7SA 1R43A 5IV0A 1XIXA 4MHDA 1CG2A 5LRKA 2QMLA 4ZY0A 1AYEA 2C1CA 3I3GA 4LX9A 4A32A 3TO6A 4L89A 2P6FA 2PR1A 4YRHA 3EFAA 2K5TA 2VEZA 4E2AA 1JQGA 2WSAA 3P2HA 4KUAA 4W9YA 3DNSA 3V38A 3FNCA 3TX8A 4R57A
chains in the Genus database with same CATH topology
2HQYA 2VZZA 2Z3PA 4J3GA 4MFZA 5G1ZA 2G0BA 2HUZA 1L0CA 2I00A 2B4DA 3A9LA 4C68A 4IF5A 5KTCA 4NCZA 3VWEA 3S6KA 5F47A 2AJ6A 2R98A 4PV6A 4QB9A 5E96A 4QUSA 5GCNA 1MK4A 1BO4A 2C27A 1S5KA 5F49A 2JDDA 1N71A 3PZJA 2JDCA 1XF8A 1IICA 1PU9A 3D2PA 5AG7A 2FCKA 3EXNA 5IX3A 2B4BA 1WK4A 4KVME 2OH1A 2ZW6A 4AVCA 5KTAA 3LODA 4NEXA 2JEVA 1B87A 4MFQA 3R95A 4CRYB 4U5YA 2Z11A 4U9ZA 1NMTA 1IB1E 1S7FA 2G3TA 3FXTA 4IUSA 4FD4A 4PK3A 5JQ4A 2WUUA 1ON0A 3TO9A 1YGHA 1Y7RA 2CNMA 3GY9A 4KOSA 2PR8A 1XEBA 2ZW7A 5C88A 2VBQA 4XPDC 3H4QA 3EC4A 4GS4A 1S60A 4KUBA 2ZW4A 2Q04A 1Z9UA 2ARHA 4B13A 3R1KA 4ZGYB 4MY3A 3FBUA 1QSOA 3F0AA 3IU1A 4MFKA 2REFA 4YFJA 3SXOA 1NE9A 1P4NA 4K30A 1PUAA 2AE6A 3SHPA 2GE3A 5DWMA 4KSAA 5J8FA 3FYNA 4E8OA 5A27A 1RXTA 3IGRA 1IYLA 4MFPA 4MFLA 5HH1A 3G3SA 4A30A 4PK2A 3UY5A 4R9MA 5H86A 4MBUA 4AB7A 2F5IA 4KVOE 4KOVA 3EO4A 5DWNA 4CAEA 5F48A 1KUVA 5CNPA 2KCWA 2FS5A 2HV2A 3G8WA 4NSQA 1Q2CA 4B5PB 3TT2A 2P0WA 1QSTA 2X7BA 3DR6A 1SQHA 4UCNA 1VKCA 2VXKA 1K4JA 4KVXA 4UFXA 3W6SA 3FB3A 3PP9A 4I49A 3R9FA 5KTDA 1Y9WA 3JTKA 4Q36A 4XPLA 2ZXVA 4QBJA 4H6UA 3ZJ0A 4CGPA 2B5GB 4AVBA 1CM0A 5FVJA 2J8RA 2OU2A 3R96A 3TTHA 1KUXA 2RC4A 2ATRA 3KKWA 4KLVA 1M4DA 1YLEA 1MJ9A 3LD2A 1B6BA 5HMNA 3GKRA 2DPTA 4KOYA 3W91A 1WWZA 2YNDA 2R1IA 2R8VA 4XPDB 3IWEA 4X5KA 4KLWA 3JUWA 4MI4A 3JVNA 4ONUA 1Y9KA 4B5PA 4C2ZA 4CYQA 4KOWA 2OZHA 4B11A 4C2YA 2YGWA 4JXQA 4R87A 1YVOA 2PQ8A 4CYNA 1YREA 3R9GA 4U9YA 5G20A 2GANA 1R57A 1IYKA 2Q4VA 2BL1A 3EY5A 4A2ZA 1VHSA 4ORFA 4DNCA 2CNTA 4UWJA 1QSMA 1U6MA 2VI7A 1I1DA 2QIRA 4Y49C 2JLMA 3PGPA 4AVAA 5EBVA 1YVKA 4C2XA 5C82A 4L8AA 3S6FA 4A31A 4RS2A 1YR0A 5IB0A 2FXFA 1LRZA 2OZUA 4FD6A 4JWPA 2NMTA 2DPSA 5BWAB 4ZBGA 3NE7A 4UBRA 3S6GA 3S6HA 3R9EA 2BUEA 3OWCA 2EUIA 1I12A 4B14A 4YGOA 2Q0YA 4KOXA 1YK3A 3V8IA 2B3UA 4KZTA 4UFWA 4II9A 3FRMA 1ZO0A 4CAFA 3QAHA 4A95A 3CXQA 4Q38A 4RI1A 3TOAA 3BJ7A 4JLYA 2I79A 2DXQA 4B10A 2OZGA 2P6GA 2B3VA 3DR8A 2REEA 3K9UA 2Z3LA 5I0CA 3DDDA 4MFJA 4QVTA 2P6EA 4C7HA 4F0YA 4E0AA 4F6AA 4UA3A 1CJWA 4XNHC 1QSRA 3P2FA 4UWIA 5ISVA 4UCMA 2H5MA 4H6ZA 3D8PA 2BEIA 2YNCA 4CGNA 4UFVA 3WR7A 2WPWA 4KOTA 5AG6A 1M1DA 5F46A 2EVNA 5EC4A 2Z3OA 3IU2A 4EVYA 3TO7A 3FIXA 4KOUA 2IL4A 4C7IA 1V0CA 4LUAA 1QSNA 3T90A 4H89A 2GIVA 3TFYA 1J4JA 5G22A 4CYOA 5AG4A 1OZPA 4M85A 4Y49B 3MGDA 2D4PA 2PRBA 4FD5A 4OLLA 2CY2A 3TOBA 2Q44A 3VWDA 3N7ZA 4NXYA 4JJXA 3F5BA 4CS0B 1I21A 3QB8A 4KORA 4MJ8A 2R7HA 4HNWB 1NSLA 4PSWA 3TE4A 2Z3KA 2ZW5A 2FT0A 1TIQA 4JD6A 2O28A 2OB0A 3BJ8A 3CXPA 2A4NA 2WPXA 1M4GA 1S3ZA 1UFHA 4CAVA 2CNSA 4CYPA 3RYOA 2B5GA 4NF1A 4CGMA 4OAEA 4R3KA 2Q7BA 1KUYA 1XE4A 1Z4EA 2YNEA 5A28A 4MY0A 4BBHA 3I9SA 3CXSA 4QC6A 5J8CA 4KSFA 1RO5A 2D4OA 2PDOA 2Z3MA 2Z0ZA 2FIAA 3T9YA 3D2MA 4OADA 1P0HA 3BLNA 3F8KA 2Z10A 3DSBA 4KS9A 4CGOA 1M4IA 2J8NA 4FD7A 2PSWA 1GHEA 4CAWA 2CXAA 4A33A 4R3LA 3D3SA 4XNHB 5AG5A 2Q4YA 4M3SA 1MJBA 1S7NA 1YX0A 1Z4RA 3W6XA 1FY7A 4B12A 1Q2DA 1MJAA 3C26A 2QECA 5H84A 2FIWA 1S7KA 2Y0MA 4B5OA 2FE7A 2VQYA 4HKFA 3B8GA 3H5ZA 4HNXB 2ZPAA 1S7LA 1XMTA 4F0XA 2FL4A 2G3AA 1IIDA 2FSRA 4BMHA 2B4DB 3GYAA 2PC1A 2VZYA 3ZZIA 2Z3NA 4PSXA 1BOBA 3SXNA 5AGEA 2B58A 4AG7A 2J8MA 4UCPA 5JPHA 2BSWA 4CRZB 4CAXA 4HNYB 4AG9A 4CGLA 3TCVA 4JXRA 1KZFA 4XPKA 1M44A 2YNCC 1Q2YA 3E0KA 3IWGA 5G21A 5IV0A 1XIXA 4MHDA 2QMLA 4LX9A 4A32A 3I3GA 3TO6A 4L89A 2P6FA 2PR1A 4YRHA 3EFAA 2K5TA 2VEZA 4E2AA 2WSAA 3P2HA 4KUAA 3DNSA 3FNCA 4R57A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HQY A;  2VZZ A;  4J3G A;  2G0B A;  2HUZ A;  1L0C A;  2I00 A;  2B4D A;  4IF5 A;  5KTC A;  4NCZ A;  3VWE A;  3S6K A;  5F47 A;  2AJ6 A;  2R98 A;  4PV6 A;  4QB9 A;  5E96 A;  4QUS A;  5GCN A;  1MK4 A;  1BO4 A;  2C27 A;  1S5K A;  5F49 A;  2JDD A;  1N71 A;  3PZJ A;  2JDC A;  1XF8 A;  1IIC A;  1PU9 A;  3D2P A;  2FCK A;  3EXN A;  5IX3 A;  2B4B A;  1WK4 A;  4KVM E;  2OH1 A;  2ZW6 A;  4AVC A;  5KTA A;  3LOD A;  4NEX A;  2JEV A;  1B87 A;  3R95 A;  4CRY B;  4U5Y A;  2Z11 A;  4U9Z A;  1NMT A;  1IB1 E;  1S7F A;  2G3T A;  3FXT A;  4IUS A;  4FD4 A;  4PK3 A;  5JQ4 A;  3TO9 A;  1ON0 A;  1YGH A;  1Y7R A;  2CNM A;  3GY9 A;  4KOS A;  2PR8 A;  1XEB A;  2ZW7 A;  5C88 A;  2VBQ A;  4XPD C;  3H4Q A;  3EC4 A;  4GS4 A;  1S60 A;  4KUB A;  2ZW4 A;  2Q04 A;  1Z9U A;  2ARH A;  3R1K A;  4MY3 A;  3FBU A;  1QSO A;  3F0A A;  2REF A;  4YFJ A;  3SXO A;  1NE9 A;  1P4N A;  4K30 A;  1PUA A;  2AE6 A;  3SHP A;  2GE3 A;  5DWM A;  5J8F A;  3FYN A;  4E8O A;  1RXT A;  3IGR A;  1IYL A;  5HH1 A;  3G3S A;  4PK2 A;  3UY5 A;  4R9M A;  5H86 A;  4MBU A;  4AB7 A;  2F5I A;  4KVO E;  4KOV A;  3EO4 A;  5DWN A;  5F48 A;  1KUV A;  5CNP A;  2KCW A;  2FS5 A;  2HV2 A;  3G8W A;  4NSQ A;  1Q2C A;  4B5P B;  3TT2 A;  2P0W A;  1QST A;  2X7B A;  3DR6 A;  1SQH A;  1VKC A;  2VXK A;  1K4J A;  4KVX A;  3W6S A;  3FB3 A;  3PP9 A;  4I49 A;  3R9F A;  5KTD A;  1Y9W A;  4XPL A;  2ZXV A;  4QBJ A;  4H6U A;  3ZJ0 A;  2B5G B;  4AVB A;  1CM0 A;  5FVJ A;  2J8R A;  2OU2 A;  3R96 A;  3TTH A;  1KUX A;  2RC4 A;  2ATR A;  3KKW A;  4KLV A;  1M4D A;  1YLE A;  1MJ9 A;  3LD2 A;  1B6B A;  5HMN A;  3GKR A;  4KOY A;  3W91 A;  1WWZ A;  2R1I A;  2R8V A;  4XPD B;  4X5K A;  4KLW A;  3JUW A;  4MI4 A;  3JVN A;  4ONU A;  1Y9K A;  4B5P A;  4KOW A;  2OZH A;  4JXQ A;  4R87 A;  1YVO A;  2PQ8 A;  1YRE A;  3R9G A;  4U9Y A;  2GAN A;  1R57 A;  1IYK A;  2Q4V A;  2BL1 A;  3EY5 A;  1VHS A;  4ORF A;  4DNC A;  2CNT A;  4UWJ A;  1QSM A;  1U6M A;  2VI7 A;  1I1D A;  2QIR A;  4Y49 C;  2JLM A;  3PGP A;  4AVA A;  5EBV A;  1YVK A;  5C82 A;  4L8A A;  3S6F A;  4RS2 A;  1YR0 A;  5IB0 A;  2FXF A;  1LRZ A;  2OZU A;  4FD6 A;  4JWP A;  2NMT A;  4ZBG A;  3NE7 A;  4UBR A;  3S6G A;  3S6H A;  3R9E A;  2BUE A;  3OWC A;  2EUI A;  1I12 A;  4YGO A;  2Q0Y A;  4KOX A;  1YK3 A;  3V8I A;  2B3U A;  4KZT A;  4II9 A;  3FRM A;  3QAH A;  3CXQ A;  4RI1 A;  3TOA A;  3BJ7 A;  4JLY A;  2I79 A;  2DXQ A;  2OZG A;  2P6G A;  2B3V A;  3DR8 A;  2REE A;  3K9U A;  5I0C A;  3DDD A;  4QVT A;  2P6E A;  4F0Y A;  4E0A A;  4F6A A;  4UA3 A;  1CJW A;  4XNH C;  1QSR A;  3P2F A;  4UWI A;  5ISV A;  2H5M A;  4H6Z A;  3D8P A;  2BEI A;  3WR7 A;  2WPW A;  4KOT A;  1M1D A;  5F46 A;  2EVN A;  5EC4 A;  4EVY A;  3TO7 A;  3FIX A;  4KOU A;  2IL4 A;  1V0C A;  4LUA A;  1QSN A;  3T90 A;  4H89 A;  2GIV A;  3TFY A;  1J4J A;  1OZP A;  4M85 A;  4Y49 B;  3MGD A;  2D4P A;  2PRB A;  4FD5 A;  4OLL A;  2CY2 A;  3TOB A;  2Q44 A;  3VWD A;  3N7Z A;  4NXY A;  4JJX A;  3F5B A;  4CS0 B;  1I21 A;  3QB8 A;  4KOR A;  4MJ8 A;  2R7H A;  4HNW B;  1NSL A;  4PSW A;  3TE4 A;  2ZW5 A;  2FT0 A;  1TIQ A;  4JD6 A;  2O28 A;  2OB0 A;  3BJ8 A;  3CXP A;  2A4N A;  2WPX A;  1M4G A;  1S3Z A;  1UFH A;  4CAV A;  2CNS A;  3RYO A;  2B5G A;  4NF1 A;  4OAE A;  4R3K A;  2Q7B A;  1KUY A;  1XE4 A;  1Z4E A;  4MY0 A;  3I9S A;  3CXS A;  4QC6 A;  5J8C A;  1RO5 A;  2D4O A;  2PDO A;  2Z0Z A;  2FIA A;  3T9Y A;  3D2M A;  4OAD A;  1P0H A;  3BLN A;  3F8K A;  2Z10 A;  3DSB A;  1M4I A;  2J8N A;  4FD7 A;  2PSW A;  1GHE A;  4CAW A;  4R3L A;  3D3S A;  4XNH B;  2Q4Y A;  4M3S A;  1MJB A;  1S7N A;  1YX0 A;  1Z4R A;  3W6X A;  1FY7 A;  1Q2D A;  1MJA A;  3C26 A;  2QEC A;  5H84 A;  2FIW A;  1S7K A;  2Y0M A;  4B5O A;  2FE7 A;  2VQY A;  4HKF A;  3B8G A;  4HNX B;  2ZPA A;  1S7L A;  1XMT A;  2FL4 A;  2G3A A;  1IID A;  2FSR A;  4BMH A;  2B4D B;  3GYA A;  2PC1 A;  2VZY A;  3ZZI A;  4PSX A;  1BOB A;  3SXN A;  2B58 A;  4AG7 A;  2J8M A;  5JPH A;  2BSW A;  4CRZ B;  4CAX A;  4HNY B;  4AG9 A;  3TCV A;  4JXR A;  1KZF A;  4XPK A;  1M44 A;  1Q2Y A;  3E0K A;  3IWG A;  5IV0 A;  1XIX A;  4MHD A;  2QML A;  4LX9 A;  3I3G A;  3TO6 A;  4L89 A;  2P6F A;  2PR1 A;  4YRH A;  3EFA A;  2K5T A;  2VEZ A;  4E2A A;  3P2H A;  4KUA A;  3DNS A;  3FNC A;  4R57 A; 
#chains in the Genus database with same CATH topology
 2HQY A;  3NFZ A;  2VZZ A;  1YSJ A;  2Z3P A;  4J3G A;  4MFZ A;  1ARM A;  3KR5 A;  4P4D A;  2G0B A;  5G1Z A;  2HUZ A;  1L0C A;  2I00 A;  2B4D A;  2PJ6 A;  3A9L A;  3MRU A;  4IF5 A;  4C68 A;  5KTC A;  4NCZ A;  3VWE A;  3IC1 A;  4MCQ A;  2AFM A;  3S6K A;  4UIB A;  5F47 A;  4BD9 A;  2PJ2 A;  2AJ6 A;  2R98 A;  4PV6 A;  2CTC A;  4QB9 A;  1F2P A;  4HPS A;  5E96 A;  1Y0Y A;  4QUS A;  5GCN A;  1MK4 A;  2DEA A;  1BO4 A;  1LAP A;  4P45 A;  4RUH A;  3B3T A;  2C27 A;  1S5K A;  5F49 A;  2JDD A;  3KR4 A;  1N71 A;  3LMS A;  4ZI6 A;  3PZJ A;  2JDC A;  1XF8 A;  1IIC A;  1TXR A;  2XEF A;  1PU9 A;  1XMB A;  2ABZ A;  2IMO A;  3D2P A;  2ZEN A;  2FCK A;  3EXN A;  4R6T A;  5AG7 A;  5IX3 A;  1CP6 A;  5JM6 A;  2B4B A;  1WK4 A;  4KVM E;  2OH1 A;  3H8F A;  2ZW6 A;  3DGV A;  4AVC A;  1Y0R A;  5KTA A;  3LOD A;  4MHP A;  3RAM A;  4NEX A;  3CZX A;  2JEV A;  2XEJ A;  4P4B A;  4A37 A;  1B87 A;  4MFQ A;  3R95 A;  2NYQ A;  1YME A;  3PB4 X;  4CRY B;  1IGB A;  4U5Y A;  2AFU A;  3IFE A;  4NJQ A;  2Z11 A;  4U9Z A;  1JWQ A;  1NMT A;  1IB1 E;  1CPS A;  1S7F A;  4NGN A;  2G3T A;  4DUK A;  3FXT A;  4PXE A;  4IUS A;  2OR4 A;  2ZEF A;  1HDU A;  4FD4 A;  2I3C A;  4PK3 A;  5JQ4 A;  2WUU A;  1ON0 A;  2VL1 A;  3TO9 A;  1M4L A;  1YGH A;  1Y7R A;  4IK2 A;  4X3R A;  2CNM A;  3GY9 A;  4KOS A;  2PR8 A;  1XEB A;  2ZW7 A;  5C88 A;  2VBQ A;  4EWT A;  4XPD C;  3H4Q A;  4OC5 A;  3EC4 A;  4GS4 A;  1S60 A;  4KUB A;  4ZYQ A;  2ODF A;  2Q04 A;  2ZW4 A;  3UY5 A;  1Z9U A;  2ARH A;  1YW4 A;  2PVW A;  3NH8 A;  4B13 A;  3R1K A;  4JZ0 A;  5LYD A;  4ZGY B;  4MY3 A;  3FBU A;  1QSO A;  1BLL E;  4F8Z A;  3F0A A;  3GIU A;  3IU1 A;  4MFK A;  2ZEL A;  2REF A;  4YFJ A;  2GLF A;  2PIZ A;  3SXO A;  1NE9 A;  1DE4 C;  2PE3 A;  3GB0 A;  1P4N A;  4K30 A;  4PXC A;  1PUA A;  2AE6 A;  4OID A;  3SHP A;  2GE3 A;  5JH9 A;  4OME A;  3WT4 A;  2PJ9 A;  2PJ4 A;  5DWM A;  5LYL A;  4KSA A;  3RO0 A;  2XEI A;  5J8F A;  3FYN A;  4R7M A;  4E8O A;  5A27 A;  3NH4 A;  1LCP A;  1RXT A;  1LFW A;  4YU9 A;  3IGR A;  4P4I A;  1IYL A;  4MFP A;  5F09 A;  3IWW A;  4MFL A;  3G3S A;  5HH1 A;  4A30 A;  4PK2 A;  4FUU A;  1Z5R A;  4R9M A;  4UEZ A;  5H86 A;  3KI9 A;  4MBU A;  3PB6 X;  3S9M A;  4AB7 A;  2F5I A;  3FX6 A;  4KVO E;  4KOV A;  3EO4 A;  5DWN A;  2RB7 A;  4CAE A;  5F48 A;  1TKF A;  1KUV A;  5CNP A;  2KCW A;  5LRG A;  3VAT A;  1VHO A;  4NGT A;  3PBE A;  3H8G A;  2FS5 A;  3N5F A;  2HV2 A;  3G8W A;  4NSQ A;  1Q2C A;  4B5P B;  1LOK A;  4ZY2 A;  3TT2 A;  1VHE A;  1YLO A;  2NSM A;  6CPA A;  2P0W A;  1QST A;  1XBU A;  2X7B A;  3DR6 A;  3PRT A;  1YW6 A;  1SQH A;  4UCN A;  2HB6 A;  3BI1 A;  5K8O A;  1VKC A;  2VXK A;  1K4J A;  4KVX A;  4PQA A;  3SJX A;  3H8E A;  3IJ3 A;  2EWB A;  4GM5 A;  4UFX A;  3W6S A;  2QYV A;  3FB3 A;  3PP9 A;  3L2N A;  4I49 A;  5IB9 A;  3R9F A;  4X2T A;  1Y9W A;  5KTD A;  2PJC A;  3JTK A;  3SJE A;  4Q36 A;  5K8N A;  3VH9 A;  4XPL A;  1Y7E A;  2ZEO A;  2ZXV A;  4QBJ A;  1ARL A;  2PVV A;  4BIN A;  7CPA A;  5J1Q A;  4H6U A;  3D7F A;  3ZJ0 A;  4CGP A;  2B5G B;  4AVB A;  1CM0 A;  5FVJ A;  2J8R A;  5JGF A;  2PJB A;  2OU2 A;  4O23 A;  3R96 A;  3TTH A;  1KUX A;  2RC4 A;  1IOF A;  3SJF A;  3LAC A;  1TKH A;  2ATR A;  3KKW A;  3GUX A;  4KLV A;  1M4D A;  1X12 A;  1MJ9 A;  1YLE A;  2BO9 A;  4MCP A;  4NGR A;  4CPA A;  1QMU A;  2PJ8 A;  3LD2 A;  3QNV A;  2V8H A;  1B6B A;  5HMN A;  3NH5 A;  3WC6 A;  3GKR A;  2DPT A;  5LRJ A;  2PJ0 A;  2PJA A;  1CBX A;  1GYT A;  4KOY A;  4OC1 A;  4MHZ A;  3W91 A;  4TNU A;  1WWZ A;  2YND A;  2R1I A;  2R8V A;  4MHY A;  4XPD B;  3IWE A;  4OP4 A;  2AFX A;  4H2K A;  4X5K A;  4KLW A;  3JUW A;  4MI4 A;  3JVN A;  4ONU A;  5K8M A;  3KQX A;  4EFD A;  2Q4Z A;  3SI2 A;  2V77 A;  1Y9K A;  4GXH A;  4ZX8 A;  4B5P A;  4C2Z A;  4CYQ A;  4KOW A;  5I4M A;  1HEE A;  2O53 A;  1Q7L A;  4F9V A;  2OZH A;  4B11 A;  1YQE A;  4IHM A;  1AUG A;  1Z8L A;  4R8F A;  4C2Y A;  3BXM A;  2O4H A;  2YGW A;  4M6H A;  3D67 A;  2ZOF A;  4JXQ A;  1YVO A;  2PJ3 A;  2PQ8 A;  4R87 A;  5LYI A;  4CYN A;  4LQ6 A;  2ZEM A;  1YRE A;  2DF5 A;  3R9G A;  4U9Y A;  5G20 A;  2EK9 A;  2GAN A;  1R57 A;  3WC7 A;  1RTQ A;  1IYK A;  5DS0 A;  2C6P A;  2F8H A;  2Q4V A;  1Z8X A;  2BL1 A;  3EY5 A;  4A2Z A;  1IY7 A;  1VHS A;  4ORF A;  4MHN A;  4KSI A;  5HXD A;  2JEW A;  5HVH A;  4ZX9 A;  4DNC A;  3WAB A;  2GRE A;  1IU8 A;  2CNT A;  4UWJ A;  2ZED A;  1QSM A;  1U6M A;  2VI7 A;  3WC5 A;  1FNO A;  3HUV A;  3RNZ A;  1I1D A;  2QIR A;  3KHZ A;  3D4U A;  2JLM A;  4Y49 C;  5HVG A;  3PGP A;  1Z2L A;  4AVA A;  5EBV A;  1YVK A;  4C2X A;  5C82 A;  2QJ8 A;  1XOV A;  4L8A A;  1OBR A;  3S6F A;  4A31 A;  4RS2 A;  3CDX A;  1YR0 A;  2PJ5 A;  3TC8 A;  5IB0 A;  2FXF A;  3KL9 A;  2WZN A;  3HLP A;  1LRZ A;  2OZU A;  4FD6 A;  4MXU A;  4JWP A;  4PXB A;  2NMT A;  2QVP A;  4OC3 A;  2DPS A;  3RZA A;  4MCR A;  5BWA B;  4ZBG A;  2OOT A;  2V8D A;  3NE7 A;  4UBR A;  5THW A;  2GLJ A;  3S6G A;  3S6H A;  3QAY A;  1CP7 A;  2ZEG A;  2BUE A;  3R9E A;  3OWC A;  4OC2 A;  5CBM A;  2EUI A;  1I12 A;  2G9D A;  2CTB A;  4B14 A;  4UIA A;  4NGQ A;  4YGO A;  2Q0Y A;  4KOX A;  3S9L A;  1YK3 A;  3V8I A;  3PFE A;  2B3U A;  4KZT A;  4UFW A;  3LWU A;  4II9 A;  3FRM A;  1ZO0 A;  4CAF A;  3D7H A;  3FJU A;  3QAH A;  3RBU A;  2JBJ A;  3T8W A;  4A95 A;  3CXQ A;  3KAS A;  4YWY A;  1TKJ A;  4Q38 A;  4RI1 A;  3TOA A;  3BJ7 A;  3K2K A;  1FT7 A;  4JLY A;  5K8P A;  2ANP A;  1ELL P;  2I79 A;  2ZEH A;  3PBB A;  4G1P A;  3PB9 X;  4RN7 A;  3FEE A;  2DXQ A;  3K9T A;  4B10 A;  2OZG A;  2AFS A;  2P6G A;  2PJ7 A;  2B3V A;  3DR8 A;  2BOA A;  2REE A;  4NGP A;  4B6Z A;  3K9U A;  4OC0 A;  2Z3L A;  3IEH A;  1IOI A;  5I0C A;  3DDD A;  4MFJ A;  4LQG A;  4QVT A;  1ZLH A;  4PPZ A;  2P6E A;  1CX8 A;  4C7H A;  4F0Y A;  3FMC A;  4E0A A;  4F6A A;  4UA3 A;  3B3C A;  4MCS A;  1CJW A;  4XNH C;  1QSR A;  3P2F A;  4IAV A;  4UWI A;  1LAM A;  2CIJ A;  3B2Y A;  4UCM A;  4WJB A;  4EME A;  5ISV A;  2H5M A;  4H6Z A;  3D8P A;  2BEI A;  3SJG A;  5EMI A;  4P10 A;  1Z8W A;  2HC9 A;  2EK8 A;  2YNC A;  5ELY A;  2AFZ A;  2F7V A;  1R3N A;  4K3N A;  4UFV A;  4CGN A;  3WR7 A;  2WPW A;  2ZEE A;  3B35 A;  4KOT A;  5AG6 A;  1M1D A;  2EBJ A;  2IQ6 A;  5F46 A;  2EVN A;  4OIW A;  2PRQ A;  5EC4 A;  1KWM A;  2Z3O A;  3IU2 A;  4EVY A;  3TO7 A;  3FIX A;  4UEF A;  4KOU A;  2IL4 A;  1BPN A;  4C7I A;  1V0C A;  4LUA A;  1QSN A;  3T90 A;  2Q43 A;  1QQ9 A;  4H89 A;  3FEC A;  3V7Z A;  4A94 A;  2GIV A;  3TFY A;  1J4J A;  3D66 A;  5G22 A;  4CYO A;  5AG4 A;  1OZP A;  3MN8 A;  4MMO A;  3DLJ A;  4M85 A;  4Y49 B;  3B3W A;  3MGD A;  3NE8 A;  4OKO A;  3FED A;  1A2Z A;  2D4P A;  2ZOG A;  5D8N A;  1ZLI A;  3SI0 A;  1ELM P;  2V8G A;  2PRB A;  4FD5 A;  4OLL A;  4F9U A;  2CY2 A;  3TOB A;  2Q44 A;  3VWD A;  3N7Z A;  4NXY A;  4NJR A;  2C6C A;  3F5B A;  4JJX A;  4P4J A;  4PXD A;  4CS0 B;  1I21 A;  1DTD A;  3D7G A;  3QB8 A;  4DYO A;  4P44 A;  4X8I A;  5HVF A;  4JYW A;  3KZW A;  4KOR A;  3FF3 A;  4MJ8 A;  2R7H A;  4HNW B;  1NSL A;  4PSW A;  3S9N A;  3TE4 A;  2Z3K A;  2ZW5 A;  2FT0 A;  2POK A;  1H8L A;  1TIQ A;  3FH4 A;  4M6G A;  1CPX A;  2FVG A;  4JD6 A;  2O28 A;  2OB0 A;  3BHX A;  3ISX A;  1XFO A;  4MRI A;  3BJ8 A;  3CXP A;  3VAR A;  2A4N A;  1LAN A;  2GFQ A;  2WPX A;  4FAI A;  1M4G A;  2AFW A;  4OC4 A;  2V8V A;  1S3Z A;  1UFH A;  3B3V A;  4CAV A;  2CNS A;  4CYP A;  2Q51 A;  3RYO A;  2B5G A;  4NF1 A;  4CGM A;  1VIX A;  4OAE A;  1EE3 P;  4R3K A;  4Q7A A;  3CPX A;  2Q7B A;  1KUY A;  1XE4 A;  1PCA A;  1Z4E A;  2YNE A;  3KGQ A;  5A28 A;  2ZEP A;  4MY0 A;  4BBH A;  3I9S A;  3CXS A;  4QC6 A;  5J8C A;  4KSF A;  3JRU A;  1RO5 A;  3B3S A;  1TF9 A;  2D4O A;  2PDO A;  3FVL A;  4WWV A;  2Z3M A;  2Z0Z A;  3I1U A;  2FIA A;  1VGY A;  3D2M A;  3GLJ A;  4OAD A;  3T9Y A;  8CPA A;  5D29 A;  1P0H A;  3BLN A;  3F8K A;  2EO8 A;  2Z10 A;  3DSB A;  3KHX A;  4KS9 A;  4UEE A;  4CGO A;  3PEI A;  3CPA A;  3D7D A;  3KQZ A;  1M4I A;  2BCO A;  2IJZ A;  2J8N A;  2WYR A;  4FD7 A;  2PSW A;  1GHE A;  3NA6 A;  4CAW A;  2PIY A;  2CXA A;  4A33 A;  4R3L A;  3D3S A;  4XNH B;  4TWE A;  4AXV A;  5AG5 A;  2C6G A;  2Q4Y A;  4M3S A;  4P4E A;  3IIB A;  2J9A A;  1MJB A;  1S7N A;  1YX0 A;  1Z4R A;  3W6X A;  3SI1 A;  1FY7 A;  1ZG8 A;  2PCU A;  4B12 A;  1Q2D A;  1MJA A;  3C26 A;  4NGM A;  1TF8 A;  4ONW A;  2QEC A;  5H84 A;  1XJO A;  2FIW A;  3PB8 X;  4NGS A;  1S7K A;  2Y0M A;  4B5O A;  3CT9 A;  5LYF A;  2FE7 A;  2VQY A;  4HKF A;  3B8G A;  3H5Z A;  4FWU A;  4HNX B;  1AMP A;  2ZPA A;  1XRY A;  1X10 A;  1S7L A;  1XMT A;  2AFO A;  3PFO A;  4F0X A;  2FL4 A;  2G3A A;  1IID A;  4NFR A;  2FSR A;  3D68 A;  4BMH A;  1ZG7 A;  2B4D B;  2XEG A;  3GYA A;  2PC1 A;  2VZY A;  3ZZI A;  2Z3N A;  4PSX A;  5CPA A;  1BOB A;  4FBE A;  3SXN A;  5AGE A;  2B58 A;  2GU2 A;  4P6Y A;  3ISZ A;  4AG7 A;  2JBK A;  1F2O A;  2J8M A;  4R76 A;  4UF4 A;  4UCP A;  1HDQ A;  3IO1 A;  4A38 A;  1BAV A;  4Z65 A;  5JPH A;  2BSW A;  2PJ1 A;  4CRZ B;  4CAX A;  1BPM A;  2CF4 A;  4HNY B;  1UWY A;  1PYT B;  4AG9 A;  4CGL A;  1Z8T A;  3TCV A;  4JXR A;  4A39 A;  1KZF A;  4ZY1 A;  3BI0 A;  1F57 A;  4XPK A;  3PB7 X;  2RFH A;  4M6I A;  1ZG9 A;  4DJL A;  1M44 A;  3B7I A;  2YNC C;  1Q2Y A;  1NSA A;  4P4F A;  3E0K A;  3IWG A;  5G21 A;  2Q7S A;  1R43 A;  5IV0 A;  1XIX A;  4MHD A;  1CG2 A;  5LRK A;  2QML A;  4ZY0 A;  1AYE A;  2C1C A;  3I3G A;  4LX9 A;  4A32 A;  3TO6 A;  4L89 A;  2P6F A;  2PR1 A;  4YRH A;  3EFA A;  2K5T A;  2VEZ A;  4E2A A;  1JQG A;  2WSA A;  3P2H A;  4KUA A;  4W9Y A;  3DNS A;  3V38 A;  3FNC A;  3TX8 A;  4R57 A; 
#chains in the Genus database with same CATH homology
 2HQY A;  2VZZ A;  2Z3P A;  4J3G A;  4MFZ A;  5G1Z A;  2G0B A;  2HUZ A;  1L0C A;  2I00 A;  2B4D A;  3A9L A;  4C68 A;  4IF5 A;  5KTC A;  4NCZ A;  3VWE A;  3S6K A;  5F47 A;  2AJ6 A;  2R98 A;  4PV6 A;  4QB9 A;  5E96 A;  4QUS A;  5GCN A;  1MK4 A;  1BO4 A;  2C27 A;  1S5K A;  5F49 A;  2JDD A;  1N71 A;  3PZJ A;  2JDC A;  1XF8 A;  1IIC A;  1PU9 A;  3D2P A;  5AG7 A;  2FCK A;  3EXN A;  5IX3 A;  2B4B A;  1WK4 A;  4KVM E;  2OH1 A;  2ZW6 A;  4AVC A;  5KTA A;  3LOD A;  4NEX A;  2JEV A;  1B87 A;  4MFQ A;  3R95 A;  4CRY B;  4U5Y A;  2Z11 A;  4U9Z A;  1NMT A;  1IB1 E;  1S7F A;  2G3T A;  3FXT A;  4IUS A;  4FD4 A;  4PK3 A;  5JQ4 A;  2WUU A;  1ON0 A;  3TO9 A;  1YGH A;  1Y7R A;  2CNM A;  3GY9 A;  4KOS A;  2PR8 A;  1XEB A;  2ZW7 A;  5C88 A;  2VBQ A;  4XPD C;  3H4Q A;  3EC4 A;  4GS4 A;  1S60 A;  4KUB A;  2ZW4 A;  2Q04 A;  1Z9U A;  2ARH A;  4B13 A;  3R1K A;  4ZGY B;  4MY3 A;  3FBU A;  1QSO A;  3F0A A;  3IU1 A;  4MFK A;  2REF A;  4YFJ A;  3SXO A;  1NE9 A;  1P4N A;  4K30 A;  1PUA A;  2AE6 A;  3SHP A;  2GE3 A;  5DWM A;  4KSA A;  5J8F A;  3FYN A;  4E8O A;  5A27 A;  1RXT A;  3IGR A;  1IYL A;  4MFP A;  4MFL A;  5HH1 A;  3G3S A;  4A30 A;  4PK2 A;  3UY5 A;  4R9M A;  5H86 A;  4MBU A;  4AB7 A;  2F5I A;  4KVO E;  4KOV A;  3EO4 A;  5DWN A;  4CAE A;  5F48 A;  1KUV A;  5CNP A;  2KCW A;  2FS5 A;  2HV2 A;  3G8W A;  4NSQ A;  1Q2C A;  4B5P B;  3TT2 A;  2P0W A;  1QST A;  2X7B A;  3DR6 A;  1SQH A;  4UCN A;  1VKC A;  2VXK A;  1K4J A;  4KVX A;  4UFX A;  3W6S A;  3FB3 A;  3PP9 A;  4I49 A;  3R9F A;  5KTD A;  1Y9W A;  3JTK A;  4Q36 A;  4XPL A;  2ZXV A;  4QBJ A;  4H6U A;  3ZJ0 A;  4CGP A;  2B5G B;  4AVB A;  1CM0 A;  5FVJ A;  2J8R A;  2OU2 A;  3R96 A;  3TTH A;  1KUX A;  2RC4 A;  2ATR A;  3KKW A;  4KLV A;  1M4D A;  1YLE A;  1MJ9 A;  3LD2 A;  1B6B A;  5HMN A;  3GKR A;  2DPT A;  4KOY A;  3W91 A;  1WWZ A;  2YND A;  2R1I A;  2R8V A;  4XPD B;  3IWE A;  4X5K A;  4KLW A;  3JUW A;  4MI4 A;  3JVN A;  4ONU A;  1Y9K A;  4B5P A;  4C2Z A;  4CYQ A;  4KOW A;  2OZH A;  4B11 A;  4C2Y A;  2YGW A;  4JXQ A;  4R87 A;  1YVO A;  2PQ8 A;  4CYN A;  1YRE A;  3R9G A;  4U9Y A;  5G20 A;  2GAN A;  1R57 A;  1IYK A;  2Q4V A;  2BL1 A;  3EY5 A;  4A2Z A;  1VHS A;  4ORF A;  4DNC A;  2CNT A;  4UWJ A;  1QSM A;  1U6M A;  2VI7 A;  1I1D A;  2QIR A;  4Y49 C;  2JLM A;  3PGP A;  4AVA A;  5EBV A;  1YVK A;  4C2X A;  5C82 A;  4L8A A;  3S6F A;  4A31 A;  4RS2 A;  1YR0 A;  5IB0 A;  2FXF A;  1LRZ A;  2OZU A;  4FD6 A;  4JWP A;  2NMT A;  2DPS A;  5BWA B;  4ZBG A;  3NE7 A;  4UBR A;  3S6G A;  3S6H A;  3R9E A;  2BUE A;  3OWC A;  2EUI A;  1I12 A;  4B14 A;  4YGO A;  2Q0Y A;  4KOX A;  1YK3 A;  3V8I A;  2B3U A;  4KZT A;  4UFW A;  4II9 A;  3FRM A;  1ZO0 A;  4CAF A;  3QAH A;  4A95 A;  3CXQ A;  4Q38 A;  4RI1 A;  3TOA A;  3BJ7 A;  4JLY A;  2I79 A;  2DXQ A;  4B10 A;  2OZG A;  2P6G A;  2B3V A;  3DR8 A;  2REE A;  3K9U A;  2Z3L A;  5I0C A;  3DDD A;  4MFJ A;  4QVT A;  2P6E A;  4C7H A;  4F0Y A;  4E0A A;  4F6A A;  4UA3 A;  1CJW A;  4XNH C;  1QSR A;  3P2F A;  4UWI A;  5ISV A;  4UCM A;  2H5M A;  4H6Z A;  3D8P A;  2BEI A;  2YNC A;  4CGN A;  4UFV A;  3WR7 A;  2WPW A;  4KOT A;  5AG6 A;  1M1D A;  5F46 A;  2EVN A;  5EC4 A;  2Z3O A;  3IU2 A;  4EVY A;  3TO7 A;  3FIX A;  4KOU A;  2IL4 A;  4C7I A;  1V0C A;  4LUA A;  1QSN A;  3T90 A;  4H89 A;  2GIV A;  3TFY A;  1J4J A;  5G22 A;  4CYO A;  5AG4 A;  1OZP A;  4M85 A;  4Y49 B;  3MGD A;  2D4P A;  2PRB A;  4FD5 A;  4OLL A;  2CY2 A;  3TOB A;  2Q44 A;  3VWD A;  3N7Z A;  4NXY A;  4JJX A;  3F5B A;  4CS0 B;  1I21 A;  3QB8 A;  4KOR A;  4MJ8 A;  2R7H A;  4HNW B;  1NSL A;  4PSW A;  3TE4 A;  2Z3K A;  2ZW5 A;  2FT0 A;  1TIQ A;  4JD6 A;  2O28 A;  2OB0 A;  3BJ8 A;  3CXP A;  2A4N A;  2WPX A;  1M4G A;  1S3Z A;  1UFH A;  4CAV A;  2CNS A;  4CYP A;  3RYO A;  2B5G A;  4NF1 A;  4CGM A;  4OAE A;  4R3K A;  2Q7B A;  1KUY A;  1XE4 A;  1Z4E A;  2YNE A;  5A28 A;  4MY0 A;  4BBH A;  3I9S A;  3CXS A;  4QC6 A;  5J8C A;  4KSF A;  1RO5 A;  2D4O A;  2PDO A;  2Z3M A;  2Z0Z A;  2FIA A;  3T9Y A;  3D2M A;  4OAD A;  1P0H A;  3BLN A;  3F8K A;  2Z10 A;  3DSB A;  4KS9 A;  4CGO A;  1M4I A;  2J8N A;  4FD7 A;  2PSW A;  1GHE A;  4CAW A;  2CXA A;  4A33 A;  4R3L A;  3D3S A;  4XNH B;  5AG5 A;  2Q4Y A;  4M3S A;  1MJB A;  1S7N A;  1YX0 A;  1Z4R A;  3W6X A;  1FY7 A;  4B12 A;  1Q2D A;  1MJA A;  3C26 A;  2QEC A;  5H84 A;  2FIW A;  1S7K A;  2Y0M A;  4B5O A;  2FE7 A;  2VQY A;  4HKF A;  3B8G A;  3H5Z A;  4HNX B;  2ZPA A;  1S7L A;  1XMT A;  4F0X A;  2FL4 A;  2G3A A;  1IID A;  2FSR A;  4BMH A;  2B4D B;  3GYA A;  2PC1 A;  2VZY A;  3ZZI A;  2Z3N A;  4PSX A;  1BOB A;  3SXN A;  5AGE A;  2B58 A;  4AG7 A;  2J8M A;  4UCP A;  5JPH A;  2BSW A;  4CRZ B;  4CAX A;  4HNY B;  4AG9 A;  4CGL A;  3TCV A;  4JXR A;  1KZF A;  4XPK A;  1M44 A;  2YNC C;  1Q2Y A;  3E0K A;  3IWG A;  5G21 A;  5IV0 A;  1XIX A;  4MHD A;  2QML A;  4LX9 A;  4A32 A;  3I3G A;  3TO6 A;  4L89 A;  2P6F A;  2PR1 A;  4YRH A;  3EFA A;  2K5T A;  2VEZ A;  4E2A A;  2WSA A;  3P2H A;  4KUA A;  3DNS A;  3FNC A;  4R57 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...