2FIAA

The crystal structure of the acetyltransferase from enterococcus faecalis
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
157
structure length
157
Chain Sequence
MKIRVADEKELPMILQFLTEVKAYMDVVGITQWTKDYPSQGDIQEDITKKRLYLLVHEEMIFSMATFCMEQEQDFVWLKRFATSPNYIAKGYGSLLFHELEKRAVWEGRRKMYAQTNHTNHRMIRFFESKGFTKIHESLQMNRLDFGSFYLYVKELE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of the acetyltransferase from Enterococcus faecalis
rcsb
source organism Enterococcus faecalis
molecule tags Transferase
molecule keywords acetyltransferase
total genus 47
structure length 157
sequence length 157
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-12-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 2fiaA00
2PR1A 3EFAA 5I0CA 4H6ZA 2PRBA 2PC1A 1GHEA 2Q0YA 1QSOA 1IIDA 1J4JA 2F5IA 1Y7RA 3PGPA 4AG9A 4QB9A 3EY5A 4HNWB 3FRMA 3FB3A 4KOTA 4FD4A 1WK4A 2VXKA 4FD7A 2ZW6A 1QSTA 3S6KA 2ZW4A 2OZUA 2A4NA 3K9UA 4YGOA 3T9YA 4L8AA 1MJAA 1CM0A 5KTDA 2B4DA 4YFJA 3DDDA 3CXQA 1S7FA 3TO9A 5FVJA 4HNXB 4KVOE 4JLYA 1IB1E 1YREA 3P2FA 1OZPA 2FSRA 2CY2A 5F48A 2AJ6A 2AE6A 2Q04A 2HQYA 1IYKA 3DSBA 3OWCA 4H89A 2ZXVA 5KTAA 3S6FA 1Q2YA 4NEXA 4J3GA 2Z10A 3EO4A 4I49A 2GE3A 5IX3A 3WR7A 4KUBA 3R96A 3TTHA 2EVNA 2ATRA 4LUAA 5E96A 1YX0A 3F0AA 3W91A 2PQ8A 1FY7A 4XNHB 4UBRA 3DNSA 1Z4EA 4XPDB 5KTCA 3B8GA 4QUSA 4Y49C 4KOWA 1MJBA 4ZBGA 3ZJ0A 1P0HA 3BJ7A 4B5OA 3N7ZA 3R9FA 2B3VA 4KLWA 2B58A 1S7LA 5ISVA 1M4IA 1YK3A 1QSMA 2P6GA 3R9EA 3D2MA 4JWPA 3CXPA 1KUYA 2HV2A 2QMLA 2X7BA 2I79A 1N71A 4KORA 5DWMA 2J8RA 3IGRA 2JDDA 4PK3A 2JDCA 4AB7A 1V0CA 4NXYA 3E0KA 3FBUA 4PSXA 1KZFA 1LRZA 5C88A 4MHDA 3TOBA 4MY0A 4CAXA 2FE7A 4PV6A 2HUZA 4R57A 1S7KA 1MJ9A 4KVXA 3SXNA 4KOSA 2P6EA 1Q2DA 4KOUA 3W6XA 3TT2A 2I00A 3QAHA 2P6FA 2R1IA 3TE4A 1R57A 2QECA 2CNSA 4IUSA 4RI1A 3FYNA 2G0BA 2J8MA 2Z0ZA 2G3AA 3D3SA 1K4JA 1KUXA 4E8OA 4KLVA 1Z9UA 2KCWA 1M1DA 4UWJA 3SXOA 1S3ZA 4MJ8A 2Z11A 1RXTA 3GY9A 4QBJA 2OH1A 2NMTA 2GIVA 4KOYA 3TOAA 1VHSA 1QSRA 4H6UA 1PUAA 1L0CA 2DXQA 1B87A 3DR8A 1Y9WA 4LX9A 1YGHA 1Z4RA 1XMTA 4U9ZA 5GCNA 1QSNA 5CNPA 4UA3A 2Q4YA 1BOBA 2VI7A 3EC4A 1S7NA 2BUEA 5JPHA 2Y0MA 3TO6A 4U5YA 4AVAA 2ZW5A 4IF5A 2Q44A 2H5MA 5J8CA 4E0AA 2VEZA 2VZYA 4YRHA 4ORFA 1I21A 4HNYB 4R3LA 1UFHA 2B4DB 2D4OA 1B6BA 2VQYA 4F6AA 4KZTA 1CJWA 2BSWA 4KVME 3V8IA 1VKCA 2P0WA 1YR0A 3MGDA 3F8KA 1TIQA 4FD5A 3BLNA 5F47A 5H86A 1NMTA 2CNMA 2PR8A 2GANA 2FT0A 4DNCA 4GS4A 4KUAA 4OADA 2WPWA 2R98A 3RYOA 2Q4VA 1M44A 4AVBA 2REFA 5DWNA 2VBQA 2FCKA 1NE9A 3FNCA 2ZW7A 2D4PA 4PK2A 1YVKA 3JUWA 4II9A 3PZJA 3R1KA 3C26A 2OZGA 2B5GA 4PSWA 4CRYB 5EC4A 2EUIA 5IB0A 2OU2A 2R7HA 4M3SA 3R9GA 4QC6A 2B4BA 4X5KA 2FL4A 1PU9A 5HMNA 3VWDA 5C82A 3TO7A 4UWIA 3I9SA 1IYLA 2FIWA 2K5TA 1U6MA 2R8VA 3TFYA 2FXFA 3ZZIA 2C27A 2O28A 2CNTA 4FD6A 1S60A 2JEVA 2ARHA 3KKWA 4AG7A 2VZZA 4B5PB 5F46A 3UY5A 3PP9A 4NSQA 3I3GA 2JLMA 4NF1A 1YVOA 1XEBA 1YLEA 4R9MA 1Q2CA 3FIXA 4F0YA 4AVCA 1SQHA 3H4QA 4QVTA 1MK4A 1M4DA 4CRZB 4BMHA 4XPLA 4E2AA 1I1DA 5JQ4A 4KOVA 4OAEA 4CAVA 3R95A 3W6SA 3DR6A 3CXSA 1RO5A 4R3KA 2G3TA 1XIXA 3IWGA 4MBUA 1ON0A 1BO4A 3QB8A 4M85A 3GKRA 4HKFA 3LD2A 3JVNA 4CAWA 3T90A 4K30A 2Q7BA 3S6GA 3P2HA 2BL1A 3BJ8A 1NSLA 3GYAA 4JXQA 4L89A 4XPKA 4XNHC 2RC4A 1I12A 4MI4A 2REEA 4ONUA 3SHPA 2IL4A 1Y9KA 4JXRA 1XF8A 3TCVA 2FS5A 2B5GB 1XE4A 3FXTA 5H84A 5HH1A 4EVYA 2PSWA 4NCZA 2OZHA 3F5BA 2J8NA 4OLLA 4MY3A 5J8FA 4KOXA 2B3UA 3NE7A 5F49A 4CS0B 5IV0A 3VWEA 4R87A 2WPXA 3EXNA 3S6HA 4U9YA 2PDOA 3D2PA 4B5PA 4XPDC 3G8WA 4Y49B 1WWZA 3D8PA 1IICA 1M4GA 2BEIA 2FIAA 5EBVA 4RS2A 4JD6A 1S5KA 2ZPAA 3G3SA 1KUVA 4JJXA 2OB0A 2QIRA 1P4NA 3LODA
chains in the Genus database with same CATH superfamily
2PR1A 3EFAA 5I0CA 4H6ZA 1Z8WA 2PRBA 3PB9X 4JZ0A 2CTCA 2PC1A 3CZXA 1GHEA 2Q0YA 1YMEA 2YNCC 1QSOA 1IIDA 3B3VA 4NJQA 6CPAA 2NYQA 1IY7A 3RO0A 2Q7SA 1J4JA 2F5IA 4P4DA 4CAFA 1IOIA 1Y7RA 2GU2A 2ZENA 5AG5A 4UEEA 3PGPA 4A32A 4AG9A 4QB9A 2ODFA 2PVWA 3EY5A 3PBEA 1XBUA 4HNWB 2JEWA 3FB3A 3FRMA 4GXHA 3PRTA 4KOTA 4FD4A 1WK4A 2VXKA 4UIAA 1Q7LA 5K8NA 2ZEEA 4FD7A 2ZW6A 1QSTA 4IHMA 2YNCA 2EK8A 3PFEA 8CPAA 4JYWA 1Z2LA 4RUHA 3D7FA 3S6KA 3H8GA 5A28A 2ZW4A 1RTQA 2OZUA 3IC1A 4MHZA 4PPZA 4MMOA 1TF9A 2A4NA 1F2OA 3K9UA 4ZY2A 1ZG8A 3RBUA 5LYLA 4YGOA 4B14A 2PJ2A 3T9YA 4L8AA 4ZY0A 1MJAA 1CM0A 4NGNA 3BI0A 4X8IA 4BBHA 5KTDA 2B4DA 4ONWA 4YFJA 3DDDA 3CXQA 1S7FA 3TO9A 1BAVA 3PB4X 4LQGA 3ISZA 5FVJA 2PJ9A 4G1PA 3D4UA 4HNXB 2BO9A 4CGNA 2WYRA 4KVOE 4P4IA 2ZEGA 4JLYA 1IB1E 1YREA 3P2FA 1OZPA 2AFMA 1YW6A 4MFQA 2FSRA 3V38A 5D8NA 2CY2A 5F48A 2Q4ZA 4DUKA 2AJ6A 4NGMA 2AE6A 2Q04A 2HQYA 1IYKA 2PIZA 3DSBA 2ZEOA 2ABZA 2C1CA 3IO1A 3SJFA 4F9UA 3NH8A 2GREA 1XFOA 3FJUA 3OWCA 4H89A 1ZLHA 2ZXVA 5CPAA 4A94A 4CYQA 3H5ZA 1XMBA 5KTAA 1PCAA 3B35A 3S6FA 1CG2A 3KR4A 3WC5A 3FF3A 4ZY1A 3LWUA 1Q2YA 4OC3A 3VH9A 1CPSA 3MN8A 4KSIA 4J3GA 1HEEA 2Z10A 3EO4A 3N5FA 2XEIA 2GE3A 2ZOGA 4I49A 1QQ9A 3H8EA 4UIBA 5IX3A 3WR7A 5LRKA 4KUBA 3R96A 3TTHA 4CGOA 2EVNA 1YQEA 2ATRA 5HVGA 2ZEHA 3BI1A 4O23A 1XOVA 4A95A 4LUAA 3IWWA 5E96A 1YX0A 1CPXA 2ZOFA 3PB8X 1R3NA 3F0AA 2C6CA 2PQ8A 3W91A 1FY7A 4Q7AA 4XNHB 5AG4A 4UBRA 3DNSA 1Z4EA 4NGSA 1X12A 4XPDB 5KTCA 3B8GA 4QUSA 3GB0A 4B13A 4Y49C 4KOWA 5J1QA 4OKOA 1MJBA 1Z8LA 3IEHA 4HPSA 4ZBGA 2QYVA 4GM5A 2G9DA 4UCPA 2PCUA 3ZJ0A 1JWQA 2PIYA 4K3NA 1P0HA 3BJ7A 1Y0YA 2O53A 4B5OA 3N7ZA 3R9FA 2B3VA 3D7HA 4KLWA 4WJBA 5JGFA 2B58A 5HXDA 1S7LA 5ISVA 3IU2A 1M4IA 1YK3A 1QSMA 2P6GA 3FMCA 4UCMA 2WZNA 4M6HA 4NFRA 3R9EA 2CIJA 3D2MA 3SI2A 4NGTA 4NJRA 3WABA 2F8HA 4JWPA 3CXPA 1KUYA 2HV2A 2QMLA 2X7BA 2I79A 4F0XA 4OC2A 1N71A 4FAIA 3H8FA 4KORA 5DWMA 3ISXA 4MXUA 4R8FA 4F8ZA 3SI1A 2JBJA 2J8RA 3IGRA 1H8LA 2JDDA 4PK3A 2JDCA 4MRIA 4UEZA 1V0CA 1YSJA 2PJCA 3E0KA 4NXYA 3FBUA 4AB7A 4PSXA 1KZFA 3D66A 1LRZA 1BLLE 3HLPA 4P45A 5C88A 4MHDA 2NSMA 3TOBA 4MY0A 4CAXA 2FE7A 4PV6A 3L2NA 4WWVA 4KSFA 3IJ3A 2HUZA 4R57A 1S7KA 3QAYA 4X2TA 1MJ9A 3KZWA 4CYNA 4KVXA 3SXNA 4P44A 5CBMA 5K8MA 4ZGYB 2XEJA 4KOSA 4MHYA 1DTDA 4OC5A 2P6EA 2PVVA 3PB6X 1Q2DA 3IWEA 4KOUA 3W6XA 1CP6A 2F7VA 3SI0A 4B12A 3TT2A 4A39A 3PFOA 2I00A 1F57A 3QAHA 2P6FA 5DS0A 2R1IA 3TE4A 1R57A 2QECA 2PJ0A 2Q43A 4MFPA 3VATA 4B10A 5LYFA 4A31A 2CNSA 4CAEA 3BHXA 4IUSA 4RI1A 3FYNA 2G0BA 1TKHA 1HDQA 2EWBA 4C68A 5BWAB 5G21A 1VHEA 4MCQA 2HB6A 2BOAA 2Q51A 5IB9A 2J8MA 4FBEA 4M6GA 1UWYA 2Z0ZA 2G3AA 3QNVA 4PXEA 3D3SA 1K4JA 2V77A 1KUXA 3WT4A 4E8OA 4KLVA 4KS9A 3KQZA 3RAMA 1Z9UA 2PJ6A 4R6TA 3WC6A 2KCWA 1M1DA 1QMUA 4UWJA 3SXOA 1S3ZA 3B3SA 4MJ8A 2Z11A 4IK2A 1RXTA 5LRJA 2V8DA 3GY9A 5LRGA 4FWUA 4QBJA 5F09A 2OH1A 2NMTA 4BINA 1BPMA 2C6PA 2GIVA 2ANPA 4KOYA 4P4EA 3TOAA 2PJ1A 3LACA 3PB7X 1VHSA 1QSRA 4H6UA 1PUAA 1L0CA 2DXQA 3TC8A 1B87A 4MHPA 3DR8A 1Y9WA 4LX9A 2V8HA 5HVHA 1YGHA 1Z4RA 5EMIA 1XMTA 4U9ZA 5GCNA 4OIDA 2PE3A 1QSNA 5CNPA 4UA3A 2Q4YA 1BOBA 2VI7A 3LMSA 2PJ5A 3EC4A 1S7NA 2BUEA 5JPHA 2PJBA 2Z3MA 1X10A 2C6GA 2Y0MA 3IIBA 4TNUA 4UFXA 2AFOA 5AG7A 2BCOA 3TO6A 3JTKA 4C7HA 4U5YA 3FH4A 4OIWA 2EK9A 4AVAA 1LOKA 2ZW5A 4OC4A 4OC1A 4EWTA 3KQXA 1TXRA 5JM6A 4ZYQA 4UF4A 4IF5A 7CPAA 2Q44A 2H5MA 5A27A 3RNZA 1VHOA 4CPAA 5J8CA 4ZX8A 4E0AA 2VEZA 2VZYA 4YRHA 4ORFA 1I21A 4HNYB 3FX6A 4R3LA 1UFHA 2B4DB 2D4OA 1B6BA 2VQYA 4PQAA 4F6AA 4KZTA 1CJWA 2BSWA 4KVME 3V8IA 1HDUA 3B3TA 1VKCA 2P0WA 1YR0A 3FEEA 4A38A 1LFWA 3MGDA 1A2ZA 2PJ7A 3D67A 3F8KA 1CBXA 1TIQA 4FD5A 3BLNA 3SJEA 2ZEFA 5D29A 4LQ6A 5F47A 3TX8A 4MCSA 5H86A 4A30A 1NMTA 3FECA 3IU1A 2VL1A 2CNMA 1IOFA 2GANA 2PR8A 2FT0A 4DNCA 4PXCA 4GS4A 4KUAA 4Q38A 4OADA 2WPWA 3JRUA 2R98A 3RYOA 2Q4VA 1M44A 2DEAA 4AVBA 2REFA 4MCRA 3B3CA 5AG6A 5DWNA 2VBQA 2FCKA 1NE9A 3FNCA 5K8PA 2DPTA 1LANA 3CPAA 3K9TA 2ZW7A 4PXBA 2D4PA 4PK2A 2RB7A 1YVKA 3JUWA 4II9A 3PZJA 3R1KA 4YU9A 4EMEA 3C26A 2PRQA 2OZGA 1Z5RA 2B5GA 2CF4A 4PSWA 1LCPA 2YNDA 4P4BA 1CP7A 4CRYB 5EC4A 2EUIA 5IB0A 5G20A 3KHXA 5K8OA 1YW4A 2OU2A 2R7HA 4M3SA 4PXDA 3T8WA 4CGLA 3B7IA 2GFQA 2IQ6A 3GIUA 2Z3OA 3R9GA 2IJZA 4QC6A 4F9VA 2B4BA 4X5KA 4KSAA 2FL4A 1PU9A 4BD9A 2AFSA 2ZEMA 3DGVA 5HMNA 3V7ZA 3VWDA 4MHNA 5C82A 5G22A 3GLJA 3TO7A 1VIXA 2QVPA 4B6ZA 4C2YA 3PEIA 4UWIA 3I9SA 1IYLA 2FIWA 4W9YA 4UFWA 3GUXA 2ZELA 4CYPA 2YNEA 2K5TA 4UCNA 4B11A 1OBRA 1U6MA 3D68A 3KGQA 2R8VA 1Z8TA 2FXFA 3TFYA 3CDXA 3ZZIA 1ELMP 2C27A 2O28A 2OOTA 2CNTA 4FD6A 3I1UA 4ZX9A 1S60A 2JEVA 2ARHA 3KKWA 4MFZA 4AG7A 3CT9A 1PYTB 2VZZA 4FUUA 4B5PB 4CGMA 4CYOA 3UY5A 5F46A 3PP9A 4NSQA 3FVLA 3I3GA 4R7MA 3KR5A 2JLMA 1ZG9A 1YVOA 1XJOA 4NF1A 1XEBA 1YLEA 2I3CA 4R9MA 1Q2CA 4A33A 3FIXA 4F0YA 4AVCA 1SQHA 3H4QA 4P4JA 3B2YA 2O4HA 4QVTA 4EFDA 1MK4A 1M4DA 4CRZB 3RZAA 4XPLA 2JBKA 3A9LA 4H2KA 4BMHA 1I1DA 4E2AA 5JQ4A 4KOVA 4MFJA 4OAEA 1TKJA 1M4LA 4CAVA 3R95A 1LAMA 3W6SA 3DR6A 1Z8XA 2EO8A 4UFVA 3D7GA 4AXVA 4Q36A 1VGYA 3CXSA 1RO5A 2V8VA 5HVFA 1GYTA 2Z3PA 3KL9A 4R3KA 2G3TA 1XIXA 3IWGA 3SJXA 3KASA 4MBUA 1FT7A 2POKA 2PJAA 4MCPA 4CGPA 1ON0A 1BO4A 2AFXA 3QB8A 2AFUA 5LYIA 4M85A 3S9MA 3NFZA 1ELLP 4TWEA 3GKRA 4HKFA 3NE8A 3BXMA 3LD2A 2Z3LA 3JVNA 4A37A 4CAWA 3T90A 4K30A 3IFEA 2Q7BA 2AFZA 2CXAA 3P2HA 3S6GA 3NA6A 2BL1A 3BJ8A 2DF5A 4NGRA 4Z65A 1IU8A 5G1ZA 1ARMA 2GLFA 3GYAA 4JXQA 4L89A 1NSLA 3D7DA 4XNHC 4XPKA 2FVGA 3S9NA 2RC4A 2ZEDA 1I12A 2RFHA 2WUUA 4MI4A 2OR4A 3PBBA 4M6IA 1XRYA 2REEA 3DLJA 3MRUA 4ONUA 3SHPA 2ZEPA 4OC0A 2IL4A 1Y9KA 4NGPA 2XEFA 4JXRA 1XF8A 1NSAA 3CPXA 5ELYA 3VARA 3TCVA 1AMPA 1KWMA 2CTBA 2FS5A 5JH9A 2EBJA 2B5GB 1BPNA 1XE4A 1R43A 3FXTA 4UEFA 4MFKA 5H84A 4DJLA 2DPSA 3HUVA 1DE4C 3S9LA 5HH1A 4P10A 4EVYA 1Y0RA 2PSWA 4OP4A 4NCZA 1AUGA 2OZHA 3F5BA 2J8NA 3WC7A 4C2ZA 3KHZA 4C7IA 4OLLA 4MY3A 5J8FA 4KOXA 4C2XA 2B3UA 1Y7EA 2Z3KA 4ZI6A 2YGWA 3NE7A 4YWYA 2V8GA 4P4FA 4DYOA 2XEGA 3KI9A 1ZLIA 5F49A 4X3RA 4CS0B 5IV0A 3VWEA 4IAVA 4R87A 5AGEA 2WPXA 3EXNA 1FNOA 1F2PA 4MFLA 1IGBA 1ZO0A 5THWA 1EE3P 2PJ3A 1JQGA 3NH5A 2QJ8A 4U9YA 3S6HA 1CX8A 1TF8A 2PDOA 2WSAA 3B3WA 3D2PA 4R76A 1AYEA 4B5PA 4OMEA 1LAPA 2Z3NA 4A2ZA 4XPDC 3G8WA 2PJ4A 5I4MA 4Y49B 1WWZA 1YLOA 3D8PA 1IICA 1M4GA 2BEIA 2FIAA 5EBVA 4RS2A 1ARLA 4JD6A 1S5KA 2J9AA 4P6YA 2ZPAA 3G3SA 3FEDA 1KUVA 5LYDA 4JJXA 2PJ8A 3K2KA 2HC9A 2OB0A 2AFWA 3SJGA 4RN7A 1ZG7A 2QIRA 1P4NA 2GLJA 1TKFA 4NGQA 3NH4A 2IMOA 4NEXA 3LODA
chains in the Genus database with same CATH topology
2PR1A 3EFAA 5I0CA 4H6ZA 2PRBA 2PC1A 1GHEA 2Q0YA 2YNCC 1QSOA 1IIDA 1J4JA 2F5IA 4CAFA 1Y7RA 5AG5A 4A32A 3PGPA 4AG9A 4QB9A 3EY5A 4HNWB 3FRMA 3FB3A 4KOTA 4FD4A 1WK4A 2VXKA 4FD7A 2ZW6A 1QSTA 2YNCA 3S6KA 5A28A 2ZW4A 2OZUA 2A4NA 3K9UA 4YGOA 4B14A 3T9YA 4L8AA 1MJAA 1CM0A 4BBHA 5KTDA 2B4DA 4YFJA 3DDDA 3CXQA 1S7FA 3TO9A 5FVJA 4HNXB 4CGNA 4KVOE 4JLYA 1IB1E 1YREA 3P2FA 1OZPA 4MFQA 2FSRA 2CY2A 5F48A 2AJ6A 2AE6A 2Q04A 2HQYA 1IYKA 3DSBA 3OWCA 4H89A 2ZXVA 4CYQA 3H5ZA 5KTAA 3S6FA 1Q2YA 4NEXA 4J3GA 2Z10A 3EO4A 4I49A 2GE3A 5IX3A 3WR7A 4KUBA 3R96A 3TTHA 4CGOA 2EVNA 2ATRA 4A95A 4LUAA 5E96A 1YX0A 3F0AA 3W91A 2PQ8A 1FY7A 5AG4A 4XNHB 4UBRA 3DNSA 1Z4EA 4XPDB 5KTCA 3B8GA 4QUSA 4B13A 4Y49C 4KOWA 1MJBA 4ZBGA 4UCPA 3ZJ0A 1P0HA 3BJ7A 4B5OA 3N7ZA 3R9FA 2B3VA 4KLWA 2B58A 1S7LA 5ISVA 3IU2A 1M4IA 1YK3A 1QSMA 2P6GA 4UCMA 3R9EA 3D2MA 4JWPA 3CXPA 1KUYA 2HV2A 2QMLA 2X7BA 2I79A 4F0XA 1N71A 4KORA 5DWMA 2J8RA 3IGRA 2JDDA 4PK3A 2JDCA 4AB7A 1V0CA 4NXYA 3E0KA 3FBUA 4PSXA 1KZFA 1LRZA 5C88A 4MHDA 3TOBA 4MY0A 4CAXA 2FE7A 4PV6A 4KSFA 2HUZA 4R57A 1S7KA 4CYNA 1MJ9A 4KVXA 3SXNA 4ZGYB 4KOSA 2P6EA 1Q2DA 3IWEA 4KOUA 3W6XA 4B12A 3TT2A 2I00A 3QAHA 2P6FA 2R1IA 3TE4A 1R57A 2QECA 4MFPA 4B10A 4A31A 2CNSA 4CAEA 4IUSA 4RI1A 3FYNA 2G0BA 4C68A 5BWAB 5G21A 2J8MA 2Z0ZA 2G3AA 3D3SA 1K4JA 1KUXA 4E8OA 4KLVA 4KS9A 1Z9UA 2KCWA 1M1DA 4UWJA 3SXOA 1S3ZA 4MJ8A 2Z11A 1RXTA 3GY9A 4QBJA 2OH1A 2NMTA 2GIVA 4KOYA 3TOAA 4H6UA 1VHSA 1QSRA 1PUAA 1L0CA 2DXQA 1B87A 3DR8A 1Y9WA 4LX9A 1YGHA 1Z4RA 1XMTA 4U9ZA 5GCNA 1QSNA 5CNPA 4UA3A 2Q4YA 1BOBA 2VI7A 3EC4A 1S7NA 2BUEA 5JPHA 2Z3MA 2Y0MA 4UFXA 5AG7A 3TO6A 3JTKA 4C7HA 4U5YA 4AVAA 2ZW5A 4IF5A 2Q44A 2H5MA 5A27A 5J8CA 4E0AA 2VEZA 2VZYA 4YRHA 4ORFA 1I21A 4HNYB 4R3LA 1UFHA 2B4DB 2D4OA 1B6BA 2VQYA 4F6AA 4KZTA 1CJWA 2BSWA 4KVME 3V8IA 1VKCA 2P0WA 1YR0A 3MGDA 3F8KA 1TIQA 4FD5A 3BLNA 5F47A 5H86A 4A30A 1NMTA 3IU1A 2CNMA 2PR8A 2GANA 2FT0A 4DNCA 4GS4A 4KUAA 4Q38A 4OADA 2WPWA 2R98A 3RYOA 2Q4VA 1M44A 4AVBA 2REFA 5DWNA 5AG6A 2VBQA 2FCKA 1NE9A 3FNCA 2DPTA 2ZW7A 2D4PA 4PK2A 1YVKA 3JUWA 4II9A 3PZJA 3R1KA 3C26A 2OZGA 2B5GA 4PSWA 2YNDA 4CRYB 5EC4A 2EUIA 5IB0A 5G20A 2OU2A 2R7HA 4M3SA 4CGLA 3R9GA 2Z3OA 4QC6A 2B4BA 4X5KA 4KSAA 2FL4A 1PU9A 5HMNA 3VWDA 5C82A 5G22A 3TO7A 4C2YA 4UWIA 3I9SA 1IYLA 2FIWA 4UFWA 4CYPA 2YNEA 2K5TA 4UCNA 4B11A 1U6MA 2R8VA 3TFYA 2FXFA 3ZZIA 2C27A 2O28A 2CNTA 4FD6A 1S60A 2JEVA 2ARHA 3KKWA 4MFZA 4AG7A 2VZZA 4B5PB 4CGMA 4CYOA 5F46A 3UY5A 3PP9A 4NSQA 3I3GA 2JLMA 1YVOA 4NF1A 1XEBA 1YLEA 4R9MA 1Q2CA 4A33A 3FIXA 4F0YA 4AVCA 1SQHA 3H4QA 4QVTA 1MK4A 1M4DA 4CRZB 4BMHA 4XPLA 3A9LA 4E2AA 1I1DA 5JQ4A 4KOVA 4MFJA 4OAEA 4CAVA 3R95A 3W6SA 3DR6A 4UFVA 4Q36A 3CXSA 1RO5A 2Z3PA 4R3KA 2G3TA 1XIXA 3IWGA 4MBUA 4CGPA 1ON0A 1BO4A 3QB8A 4M85A 3GKRA 4HKFA 3LD2A 2Z3LA 3JVNA 4CAWA 3T90A 4K30A 2Q7BA 2CXAA 3P2HA 3S6GA 2BL1A 3BJ8A 5G1ZA 1NSLA 3GYAA 4JXQA 4L89A 4XPKA 4XNHC 2RC4A 1I12A 2WUUA 4MI4A 2REEA 4ONUA 3SHPA 2IL4A 1Y9KA 4JXRA 1XF8A 3TCVA 2FS5A 2B5GB 1XE4A 3FXTA 5H84A 4MFKA 2DPSA 5HH1A 4EVYA 2PSWA 4NCZA 2OZHA 3F5BA 2J8NA 4C2ZA 4C7IA 4OLLA 4MY3A 5J8FA 4KOXA 4C2XA 2B3UA 2Z3KA 2YGWA 3NE7A 5F49A 4CS0B 5IV0A 3VWEA 4R87A 5AGEA 2WPXA 3EXNA 4MFLA 1ZO0A 3S6HA 4U9YA 2WSAA 2PDOA 3D2PA 4B5PA 2Z3NA 4A2ZA 4XPDC 3G8WA 4Y49B 1WWZA 3D8PA 1IICA 1M4GA 2BEIA 2FIAA 5EBVA 4RS2A 4JD6A 1S5KA 2ZPAA 3G3SA 1KUVA 4JJXA 2OB0A 2QIRA 1P4NA 3LODA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PR1 A;  3EFA A;  5I0C A;  4H6Z A;  2PRB A;  2PC1 A;  1GHE A;  2Q0Y A;  1QSO A;  1IID A;  1J4J A;  2F5I A;  1Y7R A;  3PGP A;  4AG9 A;  4QB9 A;  3EY5 A;  4HNW B;  3FRM A;  3FB3 A;  4KOT A;  4FD4 A;  1WK4 A;  2VXK A;  4FD7 A;  2ZW6 A;  1QST A;  3S6K A;  2ZW4 A;  2OZU A;  2A4N A;  3K9U A;  4YGO A;  3T9Y A;  4L8A A;  1MJA A;  1CM0 A;  5KTD A;  2B4D A;  4YFJ A;  3DDD A;  3CXQ A;  1S7F A;  3TO9 A;  5FVJ A;  4HNX B;  4KVO E;  4JLY A;  1IB1 E;  1YRE A;  3P2F A;  1OZP A;  2FSR A;  2CY2 A;  5F48 A;  2AJ6 A;  2AE6 A;  2Q04 A;  2HQY A;  1IYK A;  3DSB A;  3OWC A;  4H89 A;  2ZXV A;  5KTA A;  3S6F A;  1Q2Y A;  4NEX A;  4J3G A;  2Z10 A;  3EO4 A;  4I49 A;  2GE3 A;  5IX3 A;  3WR7 A;  4KUB A;  3R96 A;  3TTH A;  2EVN A;  2ATR A;  4LUA A;  5E96 A;  1YX0 A;  3F0A A;  3W91 A;  2PQ8 A;  1FY7 A;  4XNH B;  4UBR A;  3DNS A;  1Z4E A;  4XPD B;  5KTC A;  3B8G A;  4QUS A;  4Y49 C;  4KOW A;  1MJB A;  4ZBG A;  3ZJ0 A;  1P0H A;  3BJ7 A;  4B5O A;  3N7Z A;  3R9F A;  2B3V A;  4KLW A;  2B58 A;  1S7L A;  5ISV A;  1M4I A;  1YK3 A;  1QSM A;  2P6G A;  3R9E A;  3D2M A;  4JWP A;  3CXP A;  1KUY A;  2HV2 A;  2QML A;  2X7B A;  2I79 A;  1N71 A;  4KOR A;  5DWM A;  2J8R A;  3IGR A;  2JDD A;  4PK3 A;  2JDC A;  4AB7 A;  1V0C A;  4NXY A;  3E0K A;  3FBU A;  4PSX A;  1KZF A;  1LRZ A;  5C88 A;  4MHD A;  3TOB A;  4MY0 A;  4CAX A;  2FE7 A;  4PV6 A;  2HUZ A;  4R57 A;  1S7K A;  1MJ9 A;  4KVX A;  3SXN A;  4KOS A;  2P6E A;  1Q2D A;  4KOU A;  3W6X A;  3TT2 A;  2I00 A;  3QAH A;  2P6F A;  2R1I A;  3TE4 A;  1R57 A;  2QEC A;  2CNS A;  4IUS A;  4RI1 A;  3FYN A;  2G0B A;  2J8M A;  2Z0Z A;  2G3A A;  3D3S A;  1K4J A;  1KUX A;  4E8O A;  4KLV A;  1Z9U A;  2KCW A;  1M1D A;  4UWJ A;  3SXO A;  1S3Z A;  4MJ8 A;  2Z11 A;  1RXT A;  3GY9 A;  4QBJ A;  2OH1 A;  2NMT A;  2GIV A;  4KOY A;  3TOA A;  1VHS A;  1QSR A;  4H6U A;  1PUA A;  1L0C A;  2DXQ A;  1B87 A;  3DR8 A;  1Y9W A;  4LX9 A;  1YGH A;  1Z4R A;  1XMT A;  4U9Z A;  5GCN A;  1QSN A;  5CNP A;  4UA3 A;  2Q4Y A;  1BOB A;  2VI7 A;  3EC4 A;  1S7N A;  2BUE A;  5JPH A;  2Y0M A;  3TO6 A;  4U5Y A;  4AVA A;  2ZW5 A;  4IF5 A;  2Q44 A;  2H5M A;  5J8C A;  4E0A A;  2VEZ A;  2VZY A;  4YRH A;  4ORF A;  1I21 A;  4HNY B;  4R3L A;  1UFH A;  2B4D B;  2D4O A;  1B6B A;  2VQY A;  4F6A A;  4KZT A;  1CJW A;  2BSW A;  4KVM E;  3V8I A;  1VKC A;  2P0W A;  1YR0 A;  3MGD A;  3F8K A;  1TIQ A;  4FD5 A;  3BLN A;  5F47 A;  5H86 A;  1NMT A;  2CNM A;  2PR8 A;  2GAN A;  2FT0 A;  4DNC A;  4GS4 A;  4KUA A;  4OAD A;  2WPW A;  2R98 A;  3RYO A;  2Q4V A;  1M44 A;  4AVB A;  2REF A;  5DWN A;  2VBQ A;  2FCK A;  1NE9 A;  3FNC A;  2ZW7 A;  2D4P A;  4PK2 A;  1YVK A;  3JUW A;  4II9 A;  3PZJ A;  3R1K A;  3C26 A;  2OZG A;  2B5G A;  4PSW A;  4CRY B;  5EC4 A;  2EUI A;  5IB0 A;  2OU2 A;  2R7H A;  4M3S A;  3R9G A;  4QC6 A;  2B4B A;  4X5K A;  2FL4 A;  1PU9 A;  5HMN A;  3VWD A;  5C82 A;  3TO7 A;  4UWI A;  3I9S A;  1IYL A;  2FIW A;  2K5T A;  1U6M A;  2R8V A;  3TFY A;  2FXF A;  3ZZI A;  2C27 A;  2O28 A;  2CNT A;  4FD6 A;  1S60 A;  2JEV A;  2ARH A;  3KKW A;  4AG7 A;  2VZZ A;  4B5P B;  5F46 A;  3UY5 A;  3PP9 A;  4NSQ A;  3I3G A;  2JLM A;  4NF1 A;  1YVO A;  1XEB A;  1YLE A;  4R9M A;  1Q2C A;  3FIX A;  4F0Y A;  4AVC A;  1SQH A;  3H4Q A;  4QVT A;  1MK4 A;  1M4D A;  4CRZ B;  4BMH A;  4XPL A;  4E2A A;  1I1D A;  5JQ4 A;  4KOV A;  4OAE A;  4CAV A;  3R95 A;  3W6S A;  3DR6 A;  3CXS A;  1RO5 A;  4R3K A;  2G3T A;  1XIX A;  3IWG A;  4MBU A;  1ON0 A;  1BO4 A;  3QB8 A;  4M85 A;  3GKR A;  4HKF A;  3LD2 A;  3JVN A;  4CAW A;  3T90 A;  4K30 A;  2Q7B A;  3S6G A;  3P2H A;  2BL1 A;  3BJ8 A;  1NSL A;  3GYA A;  4JXQ A;  4L89 A;  4XPK A;  4XNH C;  2RC4 A;  1I12 A;  4MI4 A;  2REE A;  4ONU A;  3SHP A;  2IL4 A;  1Y9K A;  4JXR A;  1XF8 A;  3TCV A;  2FS5 A;  2B5G B;  1XE4 A;  3FXT A;  5H84 A;  5HH1 A;  4EVY A;  2PSW A;  4NCZ A;  2OZH A;  3F5B A;  2J8N A;  4OLL A;  4MY3 A;  5J8F A;  4KOX A;  2B3U A;  3NE7 A;  5F49 A;  4CS0 B;  5IV0 A;  3VWE A;  4R87 A;  2WPX A;  3EXN A;  3S6H A;  4U9Y A;  2PDO A;  3D2P A;  4B5P A;  4XPD C;  3G8W A;  4Y49 B;  1WWZ A;  3D8P A;  1IIC A;  1M4G A;  2BEI A;  2FIA A;  5EBV A;  4RS2 A;  4JD6 A;  1S5K A;  2ZPA A;  3G3S A;  1KUV A;  4JJX A;  2OB0 A;  2QIR A;  1P4N A;  3LOD A; 
#chains in the Genus database with same CATH topology
 2PR1 A;  3EFA A;  5I0C A;  4H6Z A;  1Z8W A;  2PRB A;  3PB9 X;  4JZ0 A;  2CTC A;  2PC1 A;  3CZX A;  1GHE A;  2Q0Y A;  1YME A;  2YNC C;  1QSO A;  1IID A;  3B3V A;  4NJQ A;  6CPA A;  2NYQ A;  1IY7 A;  3RO0 A;  2Q7S A;  1J4J A;  2F5I A;  4P4D A;  4CAF A;  1IOI A;  1Y7R A;  2GU2 A;  2ZEN A;  5AG5 A;  4UEE A;  3PGP A;  4A32 A;  4AG9 A;  4QB9 A;  2ODF A;  2PVW A;  3EY5 A;  3PBE A;  1XBU A;  4HNW B;  2JEW A;  3FB3 A;  3FRM A;  4GXH A;  3PRT A;  4KOT A;  4FD4 A;  1WK4 A;  2VXK A;  4UIA A;  1Q7L A;  5K8N A;  2ZEE A;  4FD7 A;  2ZW6 A;  1QST A;  4IHM A;  2YNC A;  2EK8 A;  3PFE A;  8CPA A;  4JYW A;  1Z2L A;  4RUH A;  3D7F A;  3S6K A;  3H8G A;  5A28 A;  2ZW4 A;  1RTQ A;  2OZU A;  3IC1 A;  4MHZ A;  4PPZ A;  4MMO A;  1TF9 A;  2A4N A;  1F2O A;  3K9U A;  4ZY2 A;  1ZG8 A;  3RBU A;  5LYL A;  4YGO A;  4B14 A;  2PJ2 A;  3T9Y A;  4L8A A;  4ZY0 A;  1MJA A;  1CM0 A;  4NGN A;  3BI0 A;  4X8I A;  4BBH A;  5KTD A;  2B4D A;  4ONW A;  4YFJ A;  3DDD A;  3CXQ A;  1S7F A;  3TO9 A;  1BAV A;  3PB4 X;  4LQG A;  3ISZ A;  5FVJ A;  2PJ9 A;  4G1P A;  3D4U A;  4HNX B;  2BO9 A;  4CGN A;  2WYR A;  4KVO E;  4P4I A;  2ZEG A;  4JLY A;  1IB1 E;  1YRE A;  3P2F A;  1OZP A;  2AFM A;  1YW6 A;  4MFQ A;  2FSR A;  3V38 A;  5D8N A;  2CY2 A;  5F48 A;  2Q4Z A;  4DUK A;  2AJ6 A;  4NGM A;  2AE6 A;  2Q04 A;  2HQY A;  1IYK A;  2PIZ A;  3DSB A;  2ZEO A;  2ABZ A;  2C1C A;  3IO1 A;  3SJF A;  4F9U A;  3NH8 A;  2GRE A;  1XFO A;  3FJU A;  3OWC A;  4H89 A;  1ZLH A;  2ZXV A;  5CPA A;  4A94 A;  4CYQ A;  3H5Z A;  1XMB A;  5KTA A;  1PCA A;  3B35 A;  3S6F A;  1CG2 A;  3KR4 A;  3WC5 A;  3FF3 A;  4ZY1 A;  3LWU A;  1Q2Y A;  4OC3 A;  3VH9 A;  1CPS A;  3MN8 A;  4KSI A;  4J3G A;  1HEE A;  2Z10 A;  3EO4 A;  3N5F A;  2XEI A;  2GE3 A;  2ZOG A;  4I49 A;  1QQ9 A;  3H8E A;  4UIB A;  5IX3 A;  3WR7 A;  5LRK A;  4KUB A;  3R96 A;  3TTH A;  4CGO A;  2EVN A;  1YQE A;  2ATR A;  5HVG A;  2ZEH A;  3BI1 A;  4O23 A;  1XOV A;  4A95 A;  4LUA A;  3IWW A;  5E96 A;  1YX0 A;  1CPX A;  2ZOF A;  3PB8 X;  1R3N A;  3F0A A;  2C6C A;  2PQ8 A;  3W91 A;  1FY7 A;  4Q7A A;  4XNH B;  5AG4 A;  4UBR A;  3DNS A;  1Z4E A;  4NGS A;  1X12 A;  4XPD B;  5KTC A;  3B8G A;  4QUS A;  3GB0 A;  4B13 A;  4Y49 C;  4KOW A;  5J1Q A;  4OKO A;  1MJB A;  1Z8L A;  3IEH A;  4HPS A;  4ZBG A;  2QYV A;  4GM5 A;  2G9D A;  4UCP A;  2PCU A;  3ZJ0 A;  1JWQ A;  2PIY A;  4K3N A;  1P0H A;  3BJ7 A;  1Y0Y A;  2O53 A;  4B5O A;  3N7Z A;  3R9F A;  2B3V A;  3D7H A;  4KLW A;  4WJB A;  5JGF A;  2B58 A;  5HXD A;  1S7L A;  5ISV A;  3IU2 A;  1M4I A;  1YK3 A;  1QSM A;  2P6G A;  3FMC A;  4UCM A;  2WZN A;  4M6H A;  4NFR A;  3R9E A;  2CIJ A;  3D2M A;  3SI2 A;  4NGT A;  4NJR A;  3WAB A;  2F8H A;  4JWP A;  3CXP A;  1KUY A;  2HV2 A;  2QML A;  2X7B A;  2I79 A;  4F0X A;  4OC2 A;  1N71 A;  4FAI A;  3H8F A;  4KOR A;  5DWM A;  3ISX A;  4MXU A;  4R8F A;  4F8Z A;  3SI1 A;  2JBJ A;  2J8R A;  3IGR A;  1H8L A;  2JDD A;  4PK3 A;  2JDC A;  4MRI A;  4UEZ A;  1V0C A;  1YSJ A;  2PJC A;  3E0K A;  4NXY A;  3FBU A;  4AB7 A;  4PSX A;  1KZF A;  3D66 A;  1LRZ A;  1BLL E;  3HLP A;  4P45 A;  5C88 A;  4MHD A;  2NSM A;  3TOB A;  4MY0 A;  4CAX A;  2FE7 A;  4PV6 A;  3L2N A;  4WWV A;  4KSF A;  3IJ3 A;  2HUZ A;  4R57 A;  1S7K A;  3QAY A;  4X2T A;  1MJ9 A;  3KZW A;  4CYN A;  4KVX A;  3SXN A;  4P44 A;  5CBM A;  5K8M A;  4ZGY B;  2XEJ A;  4KOS A;  4MHY A;  1DTD A;  4OC5 A;  2P6E A;  2PVV A;  3PB6 X;  1Q2D A;  3IWE A;  4KOU A;  3W6X A;  1CP6 A;  2F7V A;  3SI0 A;  4B12 A;  3TT2 A;  4A39 A;  3PFO A;  2I00 A;  1F57 A;  3QAH A;  2P6F A;  5DS0 A;  2R1I A;  3TE4 A;  1R57 A;  2QEC A;  2PJ0 A;  2Q43 A;  4MFP A;  3VAT A;  4B10 A;  5LYF A;  4A31 A;  2CNS A;  4CAE A;  3BHX A;  4IUS A;  4RI1 A;  3FYN A;  2G0B A;  1TKH A;  1HDQ A;  2EWB A;  4C68 A;  5BWA B;  5G21 A;  1VHE A;  4MCQ A;  2HB6 A;  2BOA A;  2Q51 A;  5IB9 A;  2J8M A;  4FBE A;  4M6G A;  1UWY A;  2Z0Z A;  2G3A A;  3QNV A;  4PXE A;  3D3S A;  1K4J A;  2V77 A;  1KUX A;  3WT4 A;  4E8O A;  4KLV A;  4KS9 A;  3KQZ A;  3RAM A;  1Z9U A;  2PJ6 A;  4R6T A;  3WC6 A;  2KCW A;  1M1D A;  1QMU A;  4UWJ A;  3SXO A;  1S3Z A;  3B3S A;  4MJ8 A;  2Z11 A;  4IK2 A;  1RXT A;  5LRJ A;  2V8D A;  3GY9 A;  5LRG A;  4FWU A;  4QBJ A;  5F09 A;  2OH1 A;  2NMT A;  4BIN A;  1BPM A;  2C6P A;  2GIV A;  2ANP A;  4KOY A;  4P4E A;  3TOA A;  2PJ1 A;  3LAC A;  3PB7 X;  1VHS A;  1QSR A;  4H6U A;  1PUA A;  1L0C A;  2DXQ A;  3TC8 A;  1B87 A;  4MHP A;  3DR8 A;  1Y9W A;  4LX9 A;  2V8H A;  5HVH A;  1YGH A;  1Z4R A;  5EMI A;  1XMT A;  4U9Z A;  5GCN A;  4OID A;  2PE3 A;  1QSN A;  5CNP A;  4UA3 A;  2Q4Y A;  1BOB A;  2VI7 A;  3LMS A;  2PJ5 A;  3EC4 A;  1S7N A;  2BUE A;  5JPH A;  2PJB A;  2Z3M A;  1X10 A;  2C6G A;  2Y0M A;  3IIB A;  4TNU A;  4UFX A;  2AFO A;  5AG7 A;  2BCO A;  3TO6 A;  3JTK A;  4C7H A;  4U5Y A;  3FH4 A;  4OIW A;  2EK9 A;  4AVA A;  1LOK A;  2ZW5 A;  4OC4 A;  4OC1 A;  4EWT A;  3KQX A;  1TXR A;  5JM6 A;  4ZYQ A;  4UF4 A;  4IF5 A;  7CPA A;  2Q44 A;  2H5M A;  5A27 A;  3RNZ A;  1VHO A;  4CPA A;  5J8C A;  4ZX8 A;  4E0A A;  2VEZ A;  2VZY A;  4YRH A;  4ORF A;  1I21 A;  4HNY B;  3FX6 A;  4R3L A;  1UFH A;  2B4D B;  2D4O A;  1B6B A;  2VQY A;  4PQA A;  4F6A A;  4KZT A;  1CJW A;  2BSW A;  4KVM E;  3V8I A;  1HDU A;  3B3T A;  1VKC A;  2P0W A;  1YR0 A;  3FEE A;  4A38 A;  1LFW A;  3MGD A;  1A2Z A;  2PJ7 A;  3D67 A;  3F8K A;  1CBX A;  1TIQ A;  4FD5 A;  3BLN A;  3SJE A;  2ZEF A;  5D29 A;  4LQ6 A;  5F47 A;  3TX8 A;  4MCS A;  5H86 A;  4A30 A;  1NMT A;  3FEC A;  3IU1 A;  2VL1 A;  2CNM A;  1IOF A;  2GAN A;  2PR8 A;  2FT0 A;  4DNC A;  4PXC A;  4GS4 A;  4KUA A;  4Q38 A;  4OAD A;  2WPW A;  3JRU A;  2R98 A;  3RYO A;  2Q4V A;  1M44 A;  2DEA A;  4AVB A;  2REF A;  4MCR A;  3B3C A;  5AG6 A;  5DWN A;  2VBQ A;  2FCK A;  1NE9 A;  3FNC A;  5K8P A;  2DPT A;  1LAN A;  3CPA A;  3K9T A;  2ZW7 A;  4PXB A;  2D4P A;  4PK2 A;  2RB7 A;  1YVK A;  3JUW A;  4II9 A;  3PZJ A;  3R1K A;  4YU9 A;  4EME A;  3C26 A;  2PRQ A;  2OZG A;  1Z5R A;  2B5G A;  2CF4 A;  4PSW A;  1LCP A;  2YND A;  4P4B A;  1CP7 A;  4CRY B;  5EC4 A;  2EUI A;  5IB0 A;  5G20 A;  3KHX A;  5K8O A;  1YW4 A;  2OU2 A;  2R7H A;  4M3S A;  4PXD A;  3T8W A;  4CGL A;  3B7I A;  2GFQ A;  2IQ6 A;  3GIU A;  2Z3O A;  3R9G A;  2IJZ A;  4QC6 A;  4F9V A;  2B4B A;  4X5K A;  4KSA A;  2FL4 A;  1PU9 A;  4BD9 A;  2AFS A;  2ZEM A;  3DGV A;  5HMN A;  3V7Z A;  3VWD A;  4MHN A;  5C82 A;  5G22 A;  3GLJ A;  3TO7 A;  1VIX A;  2QVP A;  4B6Z A;  4C2Y A;  3PEI A;  4UWI A;  3I9S A;  1IYL A;  2FIW A;  4W9Y A;  4UFW A;  3GUX A;  2ZEL A;  4CYP A;  2YNE A;  2K5T A;  4UCN A;  4B11 A;  1OBR A;  1U6M A;  3D68 A;  3KGQ A;  2R8V A;  1Z8T A;  2FXF A;  3TFY A;  3CDX A;  3ZZI A;  1ELM P;  2C27 A;  2O28 A;  2OOT A;  2CNT A;  4FD6 A;  3I1U A;  4ZX9 A;  1S60 A;  2JEV A;  2ARH A;  3KKW A;  4MFZ A;  4AG7 A;  3CT9 A;  1PYT B;  2VZZ A;  4FUU A;  4B5P B;  4CGM A;  4CYO A;  3UY5 A;  5F46 A;  3PP9 A;  4NSQ A;  3FVL A;  3I3G A;  4R7M A;  3KR5 A;  2JLM A;  1ZG9 A;  1YVO A;  1XJO A;  4NF1 A;  1XEB A;  1YLE A;  2I3C A;  4R9M A;  1Q2C A;  4A33 A;  3FIX A;  4F0Y A;  4AVC A;  1SQH A;  3H4Q A;  4P4J A;  3B2Y A;  2O4H A;  4QVT A;  4EFD A;  1MK4 A;  1M4D A;  4CRZ B;  3RZA A;  4XPL A;  2JBK A;  3A9L A;  4H2K A;  4BMH A;  1I1D A;  4E2A A;  5JQ4 A;  4KOV A;  4MFJ A;  4OAE A;  1TKJ A;  1M4L A;  4CAV A;  3R95 A;  1LAM A;  3W6S A;  3DR6 A;  1Z8X A;  2EO8 A;  4UFV A;  3D7G A;  4AXV A;  4Q36 A;  1VGY A;  3CXS A;  1RO5 A;  2V8V A;  5HVF A;  1GYT A;  2Z3P A;  3KL9 A;  4R3K A;  2G3T A;  1XIX A;  3IWG A;  3SJX A;  3KAS A;  4MBU A;  1FT7 A;  2POK A;  2PJA A;  4MCP A;  4CGP A;  1ON0 A;  1BO4 A;  2AFX A;  3QB8 A;  2AFU A;  5LYI A;  4M85 A;  3S9M A;  3NFZ A;  1ELL P;  4TWE A;  3GKR A;  4HKF A;  3NE8 A;  3BXM A;  3LD2 A;  2Z3L A;  3JVN A;  4A37 A;  4CAW A;  3T90 A;  4K30 A;  3IFE A;  2Q7B A;  2AFZ A;  2CXA A;  3P2H A;  3S6G A;  3NA6 A;  2BL1 A;  3BJ8 A;  2DF5 A;  4NGR A;  4Z65 A;  1IU8 A;  5G1Z A;  1ARM A;  2GLF A;  3GYA A;  4JXQ A;  4L89 A;  1NSL A;  3D7D A;  4XNH C;  4XPK A;  2FVG A;  3S9N A;  2RC4 A;  2ZED A;  1I12 A;  2RFH A;  2WUU A;  4MI4 A;  2OR4 A;  3PBB A;  4M6I A;  1XRY A;  2REE A;  3DLJ A;  3MRU A;  4ONU A;  3SHP A;  2ZEP A;  4OC0 A;  2IL4 A;  1Y9K A;  4NGP A;  2XEF A;  4JXR A;  1XF8 A;  1NSA A;  3CPX A;  5ELY A;  3VAR A;  3TCV A;  1AMP A;  1KWM A;  2CTB A;  2FS5 A;  5JH9 A;  2EBJ A;  2B5G B;  1BPN A;  1XE4 A;  1R43 A;  3FXT A;  4UEF A;  4MFK A;  5H84 A;  4DJL A;  2DPS A;  3HUV A;  1DE4 C;  3S9L A;  5HH1 A;  4P10 A;  4EVY A;  1Y0R A;  2PSW A;  4OP4 A;  4NCZ A;  1AUG A;  2OZH A;  3F5B A;  2J8N A;  3WC7 A;  4C2Z A;  3KHZ A;  4C7I A;  4OLL A;  4MY3 A;  5J8F A;  4KOX A;  4C2X A;  2B3U A;  1Y7E A;  2Z3K A;  4ZI6 A;  2YGW A;  3NE7 A;  4YWY A;  2V8G A;  4P4F A;  4DYO A;  2XEG A;  3KI9 A;  1ZLI A;  5F49 A;  4X3R A;  4CS0 B;  5IV0 A;  3VWE A;  4IAV A;  4R87 A;  5AGE A;  2WPX A;  3EXN A;  1FNO A;  1F2P A;  4MFL A;  1IGB A;  1ZO0 A;  5THW A;  1EE3 P;  2PJ3 A;  1JQG A;  3NH5 A;  2QJ8 A;  4U9Y A;  3S6H A;  1CX8 A;  1TF8 A;  2PDO A;  2WSA A;  3B3W A;  3D2P A;  4R76 A;  1AYE A;  4B5P A;  4OME A;  1LAP A;  2Z3N A;  4A2Z A;  4XPD C;  3G8W A;  2PJ4 A;  5I4M A;  4Y49 B;  1WWZ A;  1YLO A;  3D8P A;  1IIC A;  1M4G A;  2BEI A;  2FIA A;  5EBV A;  4RS2 A;  1ARL A;  4JD6 A;  1S5K A;  2J9A A;  4P6Y A;  2ZPA A;  3G3S A;  3FED A;  1KUV A;  5LYD A;  4JJX A;  2PJ8 A;  3K2K A;  2HC9 A;  2OB0 A;  2AFW A;  3SJG A;  4RN7 A;  1ZG7 A;  2QIR A;  1P4N A;  2GLJ A;  1TKF A;  4NGQ A;  3NH4 A;  2IMO A;  4NEX A;  3LOD A; 
#chains in the Genus database with same CATH homology
 2PR1 A;  3EFA A;  5I0C A;  4H6Z A;  2PRB A;  2PC1 A;  1GHE A;  2Q0Y A;  2YNC C;  1QSO A;  1IID A;  1J4J A;  2F5I A;  4CAF A;  1Y7R A;  5AG5 A;  4A32 A;  3PGP A;  4AG9 A;  4QB9 A;  3EY5 A;  4HNW B;  3FRM A;  3FB3 A;  4KOT A;  4FD4 A;  1WK4 A;  2VXK A;  4FD7 A;  2ZW6 A;  1QST A;  2YNC A;  3S6K A;  5A28 A;  2ZW4 A;  2OZU A;  2A4N A;  3K9U A;  4YGO A;  4B14 A;  3T9Y A;  4L8A A;  1MJA A;  1CM0 A;  4BBH A;  5KTD A;  2B4D A;  4YFJ A;  3DDD A;  3CXQ A;  1S7F A;  3TO9 A;  5FVJ A;  4HNX B;  4CGN A;  4KVO E;  4JLY A;  1IB1 E;  1YRE A;  3P2F A;  1OZP A;  4MFQ A;  2FSR A;  2CY2 A;  5F48 A;  2AJ6 A;  2AE6 A;  2Q04 A;  2HQY A;  1IYK A;  3DSB A;  3OWC A;  4H89 A;  2ZXV A;  4CYQ A;  3H5Z A;  5KTA A;  3S6F A;  1Q2Y A;  4NEX A;  4J3G A;  2Z10 A;  3EO4 A;  4I49 A;  2GE3 A;  5IX3 A;  3WR7 A;  4KUB A;  3R96 A;  3TTH A;  4CGO A;  2EVN A;  2ATR A;  4A95 A;  4LUA A;  5E96 A;  1YX0 A;  3F0A A;  3W91 A;  2PQ8 A;  1FY7 A;  5AG4 A;  4XNH B;  4UBR A;  3DNS A;  1Z4E A;  4XPD B;  5KTC A;  3B8G A;  4QUS A;  4B13 A;  4Y49 C;  4KOW A;  1MJB A;  4ZBG A;  4UCP A;  3ZJ0 A;  1P0H A;  3BJ7 A;  4B5O A;  3N7Z A;  3R9F A;  2B3V A;  4KLW A;  2B58 A;  1S7L A;  5ISV A;  3IU2 A;  1M4I A;  1YK3 A;  1QSM A;  2P6G A;  4UCM A;  3R9E A;  3D2M A;  4JWP A;  3CXP A;  1KUY A;  2HV2 A;  2QML A;  2X7B A;  2I79 A;  4F0X A;  1N71 A;  4KOR A;  5DWM A;  2J8R A;  3IGR A;  2JDD A;  4PK3 A;  2JDC A;  4AB7 A;  1V0C A;  4NXY A;  3E0K A;  3FBU A;  4PSX A;  1KZF A;  1LRZ A;  5C88 A;  4MHD A;  3TOB A;  4MY0 A;  4CAX A;  2FE7 A;  4PV6 A;  4KSF A;  2HUZ A;  4R57 A;  1S7K A;  4CYN A;  1MJ9 A;  4KVX A;  3SXN A;  4ZGY B;  4KOS A;  2P6E A;  1Q2D A;  3IWE A;  4KOU A;  3W6X A;  4B12 A;  3TT2 A;  2I00 A;  3QAH A;  2P6F A;  2R1I A;  3TE4 A;  1R57 A;  2QEC A;  4MFP A;  4B10 A;  4A31 A;  2CNS A;  4CAE A;  4IUS A;  4RI1 A;  3FYN A;  2G0B A;  4C68 A;  5BWA B;  5G21 A;  2J8M A;  2Z0Z A;  2G3A A;  3D3S A;  1K4J A;  1KUX A;  4E8O A;  4KLV A;  4KS9 A;  1Z9U A;  2KCW A;  1M1D A;  4UWJ A;  3SXO A;  1S3Z A;  4MJ8 A;  2Z11 A;  1RXT A;  3GY9 A;  4QBJ A;  2OH1 A;  2NMT A;  2GIV A;  4KOY A;  3TOA A;  4H6U A;  1VHS A;  1QSR A;  1PUA A;  1L0C A;  2DXQ A;  1B87 A;  3DR8 A;  1Y9W A;  4LX9 A;  1YGH A;  1Z4R A;  1XMT A;  4U9Z A;  5GCN A;  1QSN A;  5CNP A;  4UA3 A;  2Q4Y A;  1BOB A;  2VI7 A;  3EC4 A;  1S7N A;  2BUE A;  5JPH A;  2Z3M A;  2Y0M A;  4UFX A;  5AG7 A;  3TO6 A;  3JTK A;  4C7H A;  4U5Y A;  4AVA A;  2ZW5 A;  4IF5 A;  2Q44 A;  2H5M A;  5A27 A;  5J8C A;  4E0A A;  2VEZ A;  2VZY A;  4YRH A;  4ORF A;  1I21 A;  4HNY B;  4R3L A;  1UFH A;  2B4D B;  2D4O A;  1B6B A;  2VQY A;  4F6A A;  4KZT A;  1CJW A;  2BSW A;  4KVM E;  3V8I A;  1VKC A;  2P0W A;  1YR0 A;  3MGD A;  3F8K A;  1TIQ A;  4FD5 A;  3BLN A;  5F47 A;  5H86 A;  4A30 A;  1NMT A;  3IU1 A;  2CNM A;  2PR8 A;  2GAN A;  2FT0 A;  4DNC A;  4GS4 A;  4KUA A;  4Q38 A;  4OAD A;  2WPW A;  2R98 A;  3RYO A;  2Q4V A;  1M44 A;  4AVB A;  2REF A;  5DWN A;  5AG6 A;  2VBQ A;  2FCK A;  1NE9 A;  3FNC A;  2DPT A;  2ZW7 A;  2D4P A;  4PK2 A;  1YVK A;  3JUW A;  4II9 A;  3PZJ A;  3R1K A;  3C26 A;  2OZG A;  2B5G A;  4PSW A;  2YND A;  4CRY B;  5EC4 A;  2EUI A;  5IB0 A;  5G20 A;  2OU2 A;  2R7H A;  4M3S A;  4CGL A;  3R9G A;  2Z3O A;  4QC6 A;  2B4B A;  4X5K A;  4KSA A;  2FL4 A;  1PU9 A;  5HMN A;  3VWD A;  5C82 A;  5G22 A;  3TO7 A;  4C2Y A;  4UWI A;  3I9S A;  1IYL A;  2FIW A;  4UFW A;  4CYP A;  2YNE A;  2K5T A;  4UCN A;  4B11 A;  1U6M A;  2R8V A;  3TFY A;  2FXF A;  3ZZI A;  2C27 A;  2O28 A;  2CNT A;  4FD6 A;  1S60 A;  2JEV A;  2ARH A;  3KKW A;  4MFZ A;  4AG7 A;  2VZZ A;  4B5P B;  4CGM A;  4CYO A;  5F46 A;  3UY5 A;  3PP9 A;  4NSQ A;  3I3G A;  2JLM A;  1YVO A;  4NF1 A;  1XEB A;  1YLE A;  4R9M A;  1Q2C A;  4A33 A;  3FIX A;  4F0Y A;  4AVC A;  1SQH A;  3H4Q A;  4QVT A;  1MK4 A;  1M4D A;  4CRZ B;  4BMH A;  4XPL A;  3A9L A;  4E2A A;  1I1D A;  5JQ4 A;  4KOV A;  4MFJ A;  4OAE A;  4CAV A;  3R95 A;  3W6S A;  3DR6 A;  4UFV A;  4Q36 A;  3CXS A;  1RO5 A;  2Z3P A;  4R3K A;  2G3T A;  1XIX A;  3IWG A;  4MBU A;  4CGP A;  1ON0 A;  1BO4 A;  3QB8 A;  4M85 A;  3GKR A;  4HKF A;  3LD2 A;  2Z3L A;  3JVN A;  4CAW A;  3T90 A;  4K30 A;  2Q7B A;  2CXA A;  3P2H A;  3S6G A;  2BL1 A;  3BJ8 A;  5G1Z A;  1NSL A;  3GYA A;  4JXQ A;  4L89 A;  4XPK A;  4XNH C;  2RC4 A;  1I12 A;  2WUU A;  4MI4 A;  2REE A;  4ONU A;  3SHP A;  2IL4 A;  1Y9K A;  4JXR A;  1XF8 A;  3TCV A;  2FS5 A;  2B5G B;  1XE4 A;  3FXT A;  5H84 A;  4MFK A;  2DPS A;  5HH1 A;  4EVY A;  2PSW A;  4NCZ A;  2OZH A;  3F5B A;  2J8N A;  4C2Z A;  4C7I A;  4OLL A;  4MY3 A;  5J8F A;  4KOX A;  4C2X A;  2B3U A;  2Z3K A;  2YGW A;  3NE7 A;  5F49 A;  4CS0 B;  5IV0 A;  3VWE A;  4R87 A;  5AGE A;  2WPX A;  3EXN A;  4MFL A;  1ZO0 A;  3S6H A;  4U9Y A;  2WSA A;  2PDO A;  3D2P A;  4B5P A;  2Z3N A;  4A2Z A;  4XPD C;  3G8W A;  4Y49 B;  1WWZ A;  3D8P A;  1IIC A;  1M4G A;  2BEI A;  2FIA A;  5EBV A;  4RS2 A;  4JD6 A;  1S5K A;  2ZPA A;  3G3S A;  1KUV A;  4JJX A;  2OB0 A;  2QIR A;  1P4N A;  3LOD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...