2FIAA

The crystal structure of the acetyltransferase from enterococcus faecalis
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
157
structure length
157
Chain Sequence
MKIRVADEKELPMILQFLTEVKAYMDVVGITQWTKDYPSQGDIQEDITKKRLYLLVHEEMIFSMATFCMEQEQDFVWLKRFATSPNYIAKGYGSLLFHELEKRAVWEGRRKMYAQTNHTNHRMIRFFESKGFTKIHESLQMNRLDFGSFYLYVKELE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords acetyltransferase
publication title The crystal structure of the acetyltransferase from Enterococcus faecalis
rcsb
source organism Enterococcus faecalis
total genus 47
structure length 157
sequence length 157
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-12-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 2fiaA00
4AVAA 4HNWB 1VKCA 3TO6A 3IGRA 3LODA 2R1IA 2FS5A 1I12A 4KUAA 1XMTA 4BMHA 2ATRA 2REFA 2B4DA 4AVCA 4CAVA 4XNHB 3V8IA 1CJWA 4ORFA 4QBJA 1YK3A 3D3SA 2H5MA 3PZJA 2BEIA 4XPLA 1QSTA 3NE7A 5EBVA 5HH1A 3FRMA 4KOXA 2CY2A 4IF5A 1P0HA 4CAWA 2P0WA 2P6FA 4B5PB 2REEA 1LRZA 2FE7A 4KLVA 2J8RA 5KTAA 3DR6A 4R9MA 3TFYA 1MJBA 4JJXA 5F47A 2VI7A 2GE3A 3C26A 5CNPA 2CNSA 1S7KA 5IB0A 3JUWA 4PK3A 3S6KA 2VEZA 4X5KA 4U9YA 3ZZIA 5GCNA 2O28A 4EVYA 3W6XA 2JLMA 2OZGA 4KZTA 5KTCA 5F46A 2D4PA 2ZW6A 5EC4A 3R9FA 4KOUA 5IX3A 5H86A 2VBQA 4KVOE 2G0BA 3SXNA 3S6FA 4I49A 4KOSA 2FT0A 3RYOA 3UY5A 2I79A 3H4QA 4GS4A 4CAXA 1MK4A 1S5KA 1YVOA 4IUSA 2B5GB 2D4OA 1I21A 1WWZA 1YGHA 4CRYB 3S6GA 4R3LA 2FSRA 4E0AA 2I00A 3TO7A 3TOAA 2HUZA 2OZHA 2BL1A 3BJ8A 1BOBA 3EC4A 3W6SA 2ZW4A 1J4JA 3DDDA 2JDCA 2Q7BA 4MJ8A 3G8WA 4M3SA 2Q44A 4R87A 3R9GA 3S6HA 1RO5A 3LD2A 2Z10A 2ZXVA 2HV2A 5J8CA 3G3SA 5F48A 4QB9A 4HNXB 2X7BA 4NCZA 3GKRA 1FY7A 4RI1A 4QVTA 2OU2A 2P6EA 3R9EA 5HMNA 1RXTA 1IIDA 1XEBA 4JXRA 5JPHA 1MJ9A 2B4DB 2VZYA 4H89A 1MJAA 2FIWA 3I9SA 4K30A 3T90A 2FL4A 3D2MA 1S60A 2AJ6A 4PSWA 4QUSA 4JLYA 3GYAA 4CS0B 4KOTA 1M4IA 4F6AA 4E2AA 4FD7A 3D2PA 2OB0A 2R98A 2JDDA 4FD6A 4H6UA 3B8GA 2BSWA 1P4NA 4JXQA 2EUIA 4NXYA 4NF1A 4ONUA 4KUBA 1GHEA 2WPWA 3PP9A 4J3GA 4PSXA 4F0YA 1XE4A 1VHSA 3QAHA 3TOBA 2A4NA 2VQYA 1M4GA 1TIQA 5KTDA 1ON0A 3FB3A 2G3AA 3SHPA 4OAEA 2PSWA 3R1KA 1S3ZA 2VXKA 3TO9A 4MHDA 2B4BA 1SQHA 4L89A 2EVNA 4KOWA 2BUEA 2G3TA 1M4DA 2GANA 3CXQA 5C88A 4H6ZA 3GY9A 4KORA 2KCWA 3ZJ0A 4FD4A 1I1DA 1KZFA 3IWGA 3MGDA 2NMTA 1UFHA 3CXSA 1IYKA 1M44A 4QC6A 3JVNA 1Q2YA 4AG9A 1YLEA 4UBRA 3F0AA 2PDOA 1KUVA 4PK2A 4KVXA 1CM0A 4CRZB 1Q2CA 2B58A 1M1DA 5C82A 4ZBGA 1U6MA 2Z0ZA 4PV6A 1XIXA 3DSBA 4MY3A 2ZPAA 4KOVA 3T9YA 4YFJA 3VWEA 2FCKA 3EXNA 1IB1E 3R95A 3TCVA 1YREA 2VZZA 4KVME 3WR7A 4M85A 4YRHA 4JWPA 5H84A 2Q4VA 5E96A 2F5IA 2GIVA 1BO4A 3KKWA 2IL4A 2J8MA 2Y0MA 2PR8A 2QECA 1OZPA 4AB7A 1QSNA 1Q2DA 1IYLA 3QB8A 2ZW7A 4KLWA 1Z4RA 4II9A 3PGPA 1QSOA 5JQ4A 4NSQA 2PRBA 1IICA 3P2FA 4B5PA 1S7LA 1Y7RA 3EO4A 3E0KA 2ARHA 4U9ZA 2B3VA 4DNCA 2AE6A 5FVJA 2PQ8A 4MY0A 4XPDC 1B87A 2QIRA 3OWCA 4UA3A 3TE4A 5ISVA 4MBUA 3TT2A 1XF8A 4MI4A 3W91A 2R7HA 4R3KA 4B5OA 1YR0A 4UWIA 2Q04A 4R57A 1QSMA 1N71A 3P2HA 1Y9KA 1KUXA 3F8KA 3TTHA 4E8OA 4L8AA 3EY5A 2PC1A 2PR1A 3K9UA 4HKFA 1L0CA 2Q4YA 1Z4EA 2R8VA 1V0CA 1Y9WA 5IV0A 1K4JA 5DWNA 4KOYA 4XPDB 1Z9UA 3EFAA 1B6BA 1WK4A 4NEXA 2C27A 1R57A 2Q0YA 3F5BA 4LX9A 2J8NA 4XPKA 4Y49C 4OADA 2B5GA 4JD6A 1PUAA 1NMTA 2Z11A 4RS2A 2HQYA 3VWDA 1PU9A 4AG7A 3R96A 2JEVA 3N7ZA 3FYNA 3FIXA 5J8FA 1YX0A 4AVBA 4YGOA 5DWMA 2WPXA 2K5TA 2CNTA 4HNYB 2OH1A 3BJ7A 3FBUA 4U5YA 4LUAA 2RC4A 3DR8A 1S7FA 2FIAA 1NSLA 1YVKA 4XNHC 2QMLA 1NE9A 4Y49B 1S7NA 2B3UA 2FXFA 1KUYA 2P6GA 3DNSA 3BLNA 2DXQA 2ZW5A 3FNCA 3SXOA 3I3GA 2CNMA 1QSRA 3CXPA 2OZUA 5F49A 4UWJA 4OLLA 3FXTA 4FD5A 3D8PA 5I0CA
chains in the Genus database with same CATH superfamily
4AVAA 4HNWB 1VKCA 1EE3P 2ZEMA 3IGRA 3LODA 3TO6A 2R1IA 4UEFA 2FS5A 4P6YA 4YWYA 1I12A 4KUAA 1X12A 1XMTA 3B3WA 4BMHA 2ATRA 1Z5RA 2REFA 2B4DA 1VHOA 1ZLIA 2VL1A 4AVCA 2Q7SA 4CAVA 4UIBA 4XNHB 3NFZA 4A38A 2DPTA 3V8IA 1CJWA 4ORFA 4QBJA 1YK3A 3D3SA 3BHXA 4C2XA 2H5MA 4MHPA 3MN8A 1UWYA 4M6IA 3PZJA 2BEIA 4XPLA 2CXAA 1QSTA 3NE7A 2WZNA 4MFLA 4P44A 5EBVA 5HH1A 3FRMA 4KOXA 4F9UA 2CY2A 3T8WA 4IF5A 5IB9A 2ZENA 1P0HA 4MFZA 2IQ6A 3BXMA 4IK2A 3SI0A 5JGFA 2BCOA 2BOAA 4BINA 4CAWA 4PPZA 2P0WA 1IOIA 2GLJA 2P6FA 4PXCA 3MRUA 4B5PB 4CAEA 2C6GA 2REEA 3B3CA 1LRZA 4AXVA 2FE7A 4KS9A 4KLVA 4ZY1A 6CPAA 4ZI6A 3BI1A 1ELMP 2J8RA 2QYVA 5KTAA 2XEGA 3S9NA 3DR6A 3NH5A 1KWMA 4FAIA 2J9AA 3FX6A 4R9MA 4A31A 3TFYA 1MJBA 4JJXA 5F47A 2VI7A 2GE3A 3C26A 3WT4A 5CNPA 3WC5A 2CNSA 1S7KA 5IB0A 4R6TA 2DPSA 2PRQA 3JUWA 4PK3A 3S6KA 5LYDA 2Z3KA 2VEZA 4F8ZA 4X5KA 4U9YA 3CZXA 1TXRA 3VH9A 3ZZIA 1ZO0A 3H5ZA 1ARLA 2CIJA 5GCNA 1Z8TA 3RAMA 1CBXA 2O28A 4EVYA 5ELYA 3W6XA 2JLMA 2Z3MA 2OZGA 2ZEEA 4KZTA 5KTCA 5F46A 2D4PA 2Z3NA 2ZW6A 3HUVA 5EC4A 3R9FA 4KOUA 4F0XA 5J1QA 5IX3A 3IJ3A 2VBQA 5H86A 4KVOE 2JEWA 4B10A 3GLJA 3D7FA 3PFOA 3KQZA 4NGTA 4NJRA 4X8IA 4IAVA 5LYLA 2DF5A 1VGYA 5LRJA 3PFEA 2G0BA 4OMEA 5G1ZA 5K8MA 4DYOA 3FVLA 2PJBA 2WSAA 4P4BA 3S6FA 4KSAA 3SXNA 4I49A 3K9TA 4KOSA 1A2ZA 5AG5A 3PRTA 2FT0A 5HVHA 4NGSA 4NJQA 2NSMA 4PXDA 2JBKA 3B3VA 3RYOA 4CAFA 3UY5A 2I79A 3H4QA 1BLLE 4GS4A 4R76A 4CAXA 1MK4A 1LANA 1S5KA 1YVOA 5A28A 4IUSA 2B5GB 2D4OA 1I21A 2PIZA 2ZEFA 3NE8A 4UEZA 5A27A 2YGWA 2AFXA 3DLJA 4MFPA 1OBRA 1WWZA 4EFDA 5LYFA 3B35A 5D29A 4CYQA 2V8DA 3RO0A 3H8GA 1YGHA 4CRYB 3S6GA 4R3LA 2FSRA 2POKA 1LOKA 1YQEA 4E0AA 2I00A 3TO7A 3TOAA 3BI0A 2HUZA 2OZHA 4NGNA 2BL1A 3BJ8A 1BOBA 4UCPA 3EC4A 3W6SA 4CGPA 2OR4A 3SJXA 2QVPA 3VATA 3S9LA 2PE3A 4GM5A 2ZW4A 4P4JA 3PEIA 1R3NA 2ABZA 1J4JA 1FNOA 2WUUA 3DDDA 3RBUA 2JDCA 1CP7A 2Q7BA 5AG4A 4MJ8A 3G8WA 4M3SA 1QQ9A 2Q44A 4LQ6A 4P4EA 3ISZA 4R87A 3R9GA 3S6HA 1BPNA 1RO5A 5LRKA 4MFQA 3LD2A 3IO1A 4B11A 3LWUA 2NYQA 2Z10A 2ZXVA 4A95A 2HV2A 4X3RA 5J8CA 3G3SA 2CTBA 2PJ3A 3PB4X 1IOFA 5F48A 4ZGYB 2GFQA 4G1PA 4QB9A 4HNXB 4JZ0A 1H8LA 5THWA 2X7BA 3FH4A 4FWUA 4NCZA 4UCMA 3GKRA 4A2ZA 1FY7A 3D66A 4ZX9A 4RI1A 3KHXA 4QVTA 3PBBA 3N5FA 3V7ZA 2OU2A 2P6EA 1Y0YA 4UEEA 3R9EA 1LAMA 3RNZA 5HMNA 2CTCA 1RXTA 4A32A 1IIDA 1NSAA 1XEBA 4JXRA 5JPHA 1JQGA 1MJ9A 2B4DB 3IEHA 4ZX8A 3FEDA 4ZY2A 2VZYA 4H89A 3WC7A 4TWEA 2PJ5A 1MJAA 4CYPA 4MHZA 1Z8WA 5HVGA 2FIWA 2JBJA 2O53A 2ZELA 3I9SA 3LMSA 4K30A 4OIWA 5JM6A 3T90A 2FL4A 1LFWA 3D2MA 2ODFA 1XRYA 1S60A 2AJ6A 4PSWA 2C1CA 4QUSA 4JLYA 2Q43A 3GYAA 1M4IA 1ZG7A 4KOTA 4OC2A 3SJEA 4CS0B 4F6AA 4E2AA 2V8VA 4FD7A 3D2PA 3K2KA 2OB0A 4W9YA 1XMBA 3WABA 2R98A 2JDDA 1ELLP 4FD6A 4H6UA 2V8HA 5F09A 4C2ZA 4RN7A 1F2OA 3B8GA 1ARMA 2BSWA 3D67A 4WWVA 3S9MA 3D7DA 1P4NA 1TKHA 3D4UA 2EWBA 4OC1A 1YLOA 2HC9A 3KZWA 2XEIA 3TC8A 4CYOA 4JXQA 2EUIA 4NXYA 1BPMA 4NF1A 4KUBA 1VIXA 4ONUA 5LYIA 3SJFA 1GHEA 2WPWA 1Z8LA 3PP9A 4J3GA 1DE4C 4OC3A 1F2PA 4PSXA 4F0YA 1XE4A 1VHSA 3QAHA 4NGQA 3TOBA 2A4NA 2F8HA 4PXEA 2VQYA 5G20A 4Q7AA 2V77A 2ZEGA 1M4GA 1TIQA 5KTDA 1ON0A 4MFJA 1CPSA 4H2KA 3FB3A 3KR4A 2G3AA 3IU1A 4MXUA 3I1UA 3SHPA 4OAEA 1IGBA 2PSWA 2F7VA 3NH8A 4JYWA 4OC4A 4F9VA 3R1KA 4MMOA 1ZLHA 1S3ZA 3FEEA 1R43A 1Q7LA 1YW6A 2VXKA 3TO9A 2EK8A 4MHDA 2B4BA 1JWQA 1SQHA 5AG6A 4L89A 5K8NA 1CP6A 2EVNA 3FJUA 1XJOA 4FUUA 4KOWA 4MFKA 2BUEA 2G3TA 1M4DA 4CGMA 2GANA 3CXQA 5C88A 2PJAA 4H6ZA 3B2YA 3GY9A 1TF9A 2KCWA 1AUGA 4KORA 4MCPA 3ZJ0A 4PQAA 4FD4A 1I1DA 1KZFA 2G9DA 2GLFA 2RB7A 2Q4ZA 2ZEHA 3IWGA 2ZEDA 3MGDA 3PB9X 4PXBA 4UFVA 4NFRA 2NMTA 5CBMA 4DUKA 4P4IA 1UFHA 3B3SA 1QMUA 3CXSA 5CPAA 1IYKA 2PIYA 1M44A 4QC6A 3CPAA 1YMEA 3D7HA 3GB0A 3JVNA 2I3CA 3IWEA 3SJGA 1Q2YA 2EO8A 4AG9A 1YLEA 2ZEPA 4UBRA 2PJ2A 2WYRA 3F0AA 4K3NA 2PDOA 3IWWA 1KUVA 4HPSA 4PK2A 4KSIA 2Q51A 3LACA 3PB8X 4UF4A 4KVXA 1CM0A 4C2YA 5G21A 4CRZB 4MHYA 1Q2CA 2B58A 1M1DA 4ZY0A 5C82A 4ZBGA 2AFMA 1U6MA 2AFWA 4A30A 2Z0ZA 2FVGA 4PV6A 1XIXA 4R8FA 2DEAA 3DSBA 4M6GA 4MY3A 4CYNA 3IFEA 2ZPAA 2EBJA 2PJCA 4KOVA 3B7IA 3T9YA 2PJ1A 4YFJA 3VWEA 2FCKA 3EXNA 1IB1E 4M6HA 3R95A 8CPAA 3TCVA 1YREA 2VZZA 4KVME 4NGMA 2C6PA 3WR7A 4M85A 1M4LA 4YRHA 4JWPA 1YW4A 5H84A 2Q4VA 3NH4A 5E96A 2F5IA 2GIVA 1BO4A 2IL4A 2J8MA 3KKWA 4P4DA 2Y0MA 2PR8A 5K8OA 2QECA 5G22A 1OZPA 2YNCA 4AB7A 1QSNA 1Q2DA 1IYLA 3QB8A 1LCPA 2ZW7A 4KLWA 4YU9A 1Z4RA 4II9A 4Z65A 2O4HA 3PGPA 1QSOA 5JQ4A 2PJ8A 1CX8A 4MCQA 3CDXA 2GU2A 4NSQA 2PRBA 1IICA 3QAYA 1X10A 1CG2A 1GYTA 3P2FA 2YNDA 4MCRA 1BAVA 2PJ7A 2YNEA 2V8GA 2IMOA 3PB7X 4UFWA 4Q38A 2XEFA 4B5PA 4MCSA 3FECA 1HEEA 1S7LA 1Y7RA 5D8NA 3EO4A 1HDUA 3E0KA 1RTQA 3KL9A 3CT9A 2ARHA 4U9ZA 3TX8A 4FBEA 2B3VA 5DS0A 4A39A 4OIDA 4DNCA 4ZYQA 3IU2A 2AE6A 2HB6A 5FVJA 2PQ8A 4MY0A 4XPDC 1ZG8A 2IJZA 1B87A 1AYEA 2QIRA 3OWCA 4BD9A 4UA3A 3TE4A 5ISVA 3B3TA 3KGQA 5HXDA 3SI1A 4MBUA 4LQGA 3TT2A 2PJ4A 1XF8A 4MI4A 3QNVA 3W91A 2R7HA 4MHNA 2AFZA 4R3KA 4B5OA 3L2NA 2Z3OA 1YR0A 4UWIA 1TKFA 2Q04A 4R57A 1QSMA 2AFSA 1N71A 3NA6A 3PB6X 3P2HA 4C68A 2ANPA 4UFXA 1Y9KA 2PJ9A 1KUXA 2ZEOA 3F8KA 3TTHA 4Q36A 4KSFA 4A94A 4E8OA 4L8AA 4B6ZA 2ZOGA 4A37A 3EY5A 5AG7A 3A9LA 2PCUA 2PC1A 3H8FA 5I4MA 1F57A 4X2TA 2PR1A 4WJBA 3K9UA 4HKFA 1XBUA 4TNUA 1L0CA 2Q4YA 1Z4EA 1IY7A 2PJ0A 2R8VA 1V0CA 1Y9WA 5IV0A 1K4JA 5DWNA 4KOYA 2PVVA 2CF4A 2PVWA 2ZOFA 3H8EA 4XPDB 1Z2LA 4C7HA 5BWAB 1Z9UA 3EFAA 4BBHA 1B6BA 3IC1A 2PJ6A 1WK4A 3RZAA 3ISXA 2C27A 2EK9A 4NEXA 4OC0A 1R57A 2Q0YA 3F5BA 4LX9A 4EMEA 2J8NA 3FF3A 4XPKA 3JRUA 4Y49C 5JH9A 1XFOA 4OADA 2B5GA 4JD6A 5HVFA 1PUAA 1NMTA 2Z11A 2AFUA 4RS2A 5K8PA 1FT7A 2HQYA 4NGRA 3D7GA 2RFHA 3KI9A 4O23A 3VWDA 1Y0RA 3CPXA 1PU9A 1Z8XA 4IHMA 4AG7A 3R96A 2JEVA 3JTKA 3N7ZA 4DJLA 4CGOA 2XEJA 2Z3LA 5AGEA 3FYNA 4P10A 3FIXA 1XOVA 4B13A 7CPAA 3V38A 4RUHA 1TKJA 5J8FA 3WC6A 4C7IA 4EWTA 4OC5A 1VHEA 3KASA 1YX0A 3IIBA 1DTDA 4AVBA 1YSJA 4ONWA 4YGOA 5DWMA 4CGLA 2WPXA 2K5TA 2CNTA 3KHZA 2OH1A 3DGVA 4HNYB 5EMIA 3SI2A 4R7MA 3GUXA 3BJ7A 3FBUA 4U5YA 4GXHA 1PYTB 3KR5A 4LUAA 2OOTA 3PBEA 2RC4A 3DR8A 1S7FA 2FIAA 1NSLA 3D68A 1YVKA 1TF8A 2C6CA 4XNHC 2QMLA 1NE9A 3GIUA 4P45A 2Z3PA 3FMCA 1HDQA 3KQXA 4Y49B 1S7NA 1ZG9A 2GREA 4OP4A 2B3UA 1LAPA 2BO9A 2FXFA 1KUYA 1PCAA 2YNCC 4OKOA 2P6GA 3VARA 3DNSA 3BLNA 4B14A 2DXQA 2ZW5A 3HLPA 3FNCA 4CGNA 3SXOA 5LRGA 2AFOA 3I3GA 2CNMA 4B12A 1QSRA 2QJ8A 3CXPA 4CPAA 2OZUA 5F49A 4NGPA 4UWJA 4OLLA 1IU8A 4UCNA 4P4FA 4UIAA 4MRIA 1AMPA 4A33A 3FXTA 4FD5A 1CPXA 1Y7EA 3D8PA 5I0CA
chains in the Genus database with same CATH topology
4AVAA 4HNWB 1VKCA 3TO6A 3IGRA 3LODA 2R1IA 2FS5A 1I12A 4KUAA 1XMTA 4BMHA 2ATRA 2REFA 2B4DA 4AVCA 4CAVA 4XNHB 2DPTA 3V8IA 1CJWA 4ORFA 4QBJA 1YK3A 3D3SA 4C2XA 2H5MA 3PZJA 2BEIA 4XPLA 2CXAA 1QSTA 3NE7A 4MFLA 5EBVA 5HH1A 3FRMA 4KOXA 2CY2A 4IF5A 1P0HA 4MFZA 4CAWA 2P0WA 2P6FA 4B5PB 4CAEA 2REEA 1LRZA 2FE7A 4KS9A 4KLVA 2J8RA 5KTAA 3DR6A 4R9MA 4A31A 3TFYA 1MJBA 4JJXA 5F47A 2VI7A 2GE3A 3C26A 5CNPA 2CNSA 1S7KA 5IB0A 2DPSA 3JUWA 4PK3A 3S6KA 2Z3KA 2VEZA 4X5KA 4U9YA 3ZZIA 1ZO0A 3H5ZA 5GCNA 2O28A 4EVYA 3W6XA 2JLMA 2Z3MA 2OZGA 4KZTA 5KTCA 5F46A 2D4PA 2Z3NA 2ZW6A 5EC4A 3R9FA 4KOUA 4F0XA 5IX3A 5H86A 2VBQA 4KVOE 4B10A 2G0BA 5G1ZA 3SXNA 2WSAA 3S6FA 4KSAA 4I49A 4KOSA 5AG5A 2FT0A 4CAFA 3RYOA 3UY5A 2I79A 3H4QA 4GS4A 4CAXA 1MK4A 1S5KA 1YVOA 4IUSA 2B5GB 2D4OA 1I21A 5A27A 2YGWA 4MFPA 1WWZA 4CYQA 1YGHA 4CRYB 3S6GA 4R3LA 2FSRA 4E0AA 2I00A 3TO7A 3TOAA 2HUZA 2OZHA 2BL1A 3BJ8A 1BOBA 4UCPA 3EC4A 3W6SA 4CGPA 2ZW4A 1J4JA 3DDDA 2WUUA 2JDCA 5AG4A 2Q7BA 4MJ8A 3G8WA 4M3SA 2Q44A 4R87A 3R9GA 3S6HA 1RO5A 4MFQA 3LD2A 4B11A 2Z10A 2ZXVA 4A95A 2HV2A 5J8CA 3G3SA 5F48A 4ZGYB 4QB9A 4HNXB 2X7BA 4NCZA 4UCMA 3GKRA 4A2ZA 1FY7A 4RI1A 4QVTA 2OU2A 2P6EA 3R9EA 5HMNA 4A32A 1RXTA 1IIDA 1XEBA 4JXRA 5JPHA 1MJ9A 2B4DB 2VZYA 4H89A 1MJAA 4CYPA 2FIWA 3I9SA 4K30A 3T90A 2FL4A 3D2MA 1S60A 2AJ6A 4PSWA 4QUSA 4JLYA 3GYAA 4CS0B 1M4IA 4KOTA 4F6AA 4E2AA 4FD7A 3D2PA 2OB0A 2R98A 2JDDA 4FD6A 4H6UA 4C2ZA 3B8GA 2BSWA 1P4NA 4CYOA 4JXQA 2EUIA 4NXYA 4NF1A 4ONUA 4KUBA 1GHEA 2WPWA 3PP9A 4J3GA 4PSXA 4F0YA 1XE4A 1VHSA 3QAHA 3TOBA 2A4NA 2VQYA 5G20A 1M4GA 1TIQA 5KTDA 1ON0A 4MFJA 3FB3A 2G3AA 3IU1A 3SHPA 4OAEA 2PSWA 3R1KA 1S3ZA 2VXKA 3TO9A 4MHDA 2B4BA 1SQHA 5AG6A 4L89A 2EVNA 4MFKA 4CGMA 4KOWA 2BUEA 2G3TA 1M4DA 2GANA 3CXQA 5C88A 4H6ZA 3GY9A 4KORA 2KCWA 3ZJ0A 4FD4A 1I1DA 1KZFA 3IWGA 4UFVA 3MGDA 4UFWA 2NMTA 1UFHA 3CXSA 1IYKA 1M44A 4QC6A 3JVNA 3IWEA 1Q2YA 4AG9A 1YLEA 4UBRA 3F0AA 2PDOA 1KUVA 4PK2A 4KVXA 1CM0A 4C2YA 5G21A 4CRZB 1Q2CA 2B58A 1M1DA 5C82A 4ZBGA 1U6MA 4A30A 2Z0ZA 4PV6A 1XIXA 3DSBA 4MY3A 4CYNA 2ZPAA 4KOVA 3T9YA 4YFJA 3VWEA 2FCKA 3EXNA 1IB1E 3R95A 3TCVA 1YREA 2VZZA 4KVME 3WR7A 4M85A 4YRHA 4JWPA 5H84A 2Q4VA 5E96A 2F5IA 2GIVA 1BO4A 3KKWA 2IL4A 2J8MA 2Y0MA 2PR8A 2QECA 5G22A 1OZPA 2YNCA 4AB7A 1QSNA 1Q2DA 1IYLA 3QB8A 2ZW7A 4KLWA 1Z4RA 4II9A 3PGPA 1QSOA 5JQ4A 4NSQA 2PRBA 1IICA 3P2FA 2YNDA 2YNEA 4Q38A 4B5PA 1S7LA 1Y7RA 3EO4A 3E0KA 2ARHA 4U9ZA 2B3VA 4DNCA 3IU2A 2AE6A 5FVJA 2PQ8A 4MY0A 4XPDC 1B87A 2QIRA 3OWCA 4UA3A 3TE4A 5ISVA 4MBUA 3TT2A 1XF8A 4MI4A 3W91A 2R7HA 4R3KA 4B5OA 2Z3OA 1YR0A 4UWIA 2Q04A 4R57A 1QSMA 1N71A 4C68A 3P2HA 4UFXA 1Y9KA 1KUXA 3F8KA 3TTHA 4Q36A 4KSFA 4E8OA 4L8AA 3EY5A 5AG7A 3A9LA 2PC1A 2PR1A 3K9UA 4HKFA 1L0CA 2Q4YA 1Z4EA 2R8VA 1V0CA 1Y9WA 5IV0A 1K4JA 5DWNA 4KOYA 4XPDB 5BWAB 4C7HA 1Z9UA 3EFAA 4BBHA 1B6BA 1WK4A 4NEXA 2C27A 1R57A 2Q0YA 3F5BA 4LX9A 2J8NA 4XPKA 4Y49C 4OADA 2B5GA 4JD6A 1PUAA 1NMTA 2Z11A 4RS2A 2HQYA 3VWDA 1PU9A 4AG7A 3R96A 2JEVA 3JTKA 3N7ZA 4CGOA 2Z3LA 5AGEA 3FYNA 4B13A 3FIXA 5J8FA 4C7IA 1YX0A 4AVBA 4YGOA 5DWMA 4CGLA 2WPXA 2K5TA 2CNTA 4HNYB 2OH1A 3BJ7A 3FBUA 4U5YA 4LUAA 2RC4A 3DR8A 1S7FA 2FIAA 1NSLA 1YVKA 4XNHC 2QMLA 1NE9A 2Z3PA 4Y49B 1S7NA 2B3UA 2FXFA 2YNCC 1KUYA 4B14A 5A28A 2P6GA 3DNSA 3BLNA 2DXQA 2ZW5A 3FNCA 4CGNA 3SXOA 3I3GA 2CNMA 4B12A 1QSRA 3CXPA 2OZUA 5F49A 4UWJA 4OLLA 4UCNA 4A33A 3FXTA 4FD5A 3D8PA 5I0CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4AVA A;  4HNW B;  1VKC A;  3TO6 A;  3IGR A;  3LOD A;  2R1I A;  2FS5 A;  1I12 A;  4KUA A;  1XMT A;  4BMH A;  2ATR A;  2REF A;  2B4D A;  4AVC A;  4CAV A;  4XNH B;  3V8I A;  1CJW A;  4ORF A;  4QBJ A;  1YK3 A;  3D3S A;  2H5M A;  3PZJ A;  2BEI A;  4XPL A;  1QST A;  3NE7 A;  5EBV A;  5HH1 A;  3FRM A;  4KOX A;  2CY2 A;  4IF5 A;  1P0H A;  4CAW A;  2P0W A;  2P6F A;  4B5P B;  2REE A;  1LRZ A;  2FE7 A;  4KLV A;  2J8R A;  5KTA A;  3DR6 A;  4R9M A;  3TFY A;  1MJB A;  4JJX A;  5F47 A;  2VI7 A;  2GE3 A;  3C26 A;  5CNP A;  2CNS A;  1S7K A;  5IB0 A;  3JUW A;  4PK3 A;  3S6K A;  2VEZ A;  4X5K A;  4U9Y A;  3ZZI A;  5GCN A;  2O28 A;  4EVY A;  3W6X A;  2JLM A;  2OZG A;  4KZT A;  5KTC A;  5F46 A;  2D4P A;  2ZW6 A;  5EC4 A;  3R9F A;  4KOU A;  5IX3 A;  5H86 A;  2VBQ A;  4KVO E;  2G0B A;  3SXN A;  3S6F A;  4I49 A;  4KOS A;  2FT0 A;  3RYO A;  3UY5 A;  2I79 A;  3H4Q A;  4GS4 A;  4CAX A;  1MK4 A;  1S5K A;  1YVO A;  4IUS A;  2B5G B;  2D4O A;  1I21 A;  1WWZ A;  1YGH A;  4CRY B;  3S6G A;  4R3L A;  2FSR A;  4E0A A;  2I00 A;  3TO7 A;  3TOA A;  2HUZ A;  2OZH A;  2BL1 A;  3BJ8 A;  1BOB A;  3EC4 A;  3W6S A;  2ZW4 A;  1J4J A;  3DDD A;  2JDC A;  2Q7B A;  4MJ8 A;  3G8W A;  4M3S A;  2Q44 A;  4R87 A;  3R9G A;  3S6H A;  1RO5 A;  3LD2 A;  2Z10 A;  2ZXV A;  2HV2 A;  5J8C A;  3G3S A;  5F48 A;  4QB9 A;  4HNX B;  2X7B A;  4NCZ A;  3GKR A;  1FY7 A;  4RI1 A;  4QVT A;  2OU2 A;  2P6E A;  3R9E A;  5HMN A;  1RXT A;  1IID A;  1XEB A;  4JXR A;  5JPH A;  1MJ9 A;  2B4D B;  2VZY A;  4H89 A;  1MJA A;  2FIW A;  3I9S A;  4K30 A;  3T90 A;  2FL4 A;  3D2M A;  1S60 A;  2AJ6 A;  4PSW A;  4QUS A;  4JLY A;  3GYA A;  4CS0 B;  4KOT A;  1M4I A;  4F6A A;  4E2A A;  4FD7 A;  3D2P A;  2OB0 A;  2R98 A;  2JDD A;  4FD6 A;  4H6U A;  3B8G A;  2BSW A;  1P4N A;  4JXQ A;  2EUI A;  4NXY A;  4NF1 A;  4ONU A;  4KUB A;  1GHE A;  2WPW A;  3PP9 A;  4J3G A;  4PSX A;  4F0Y A;  1XE4 A;  1VHS A;  3QAH A;  3TOB A;  2A4N A;  2VQY A;  1M4G A;  1TIQ A;  5KTD A;  1ON0 A;  3FB3 A;  2G3A A;  3SHP A;  4OAE A;  2PSW A;  3R1K A;  1S3Z A;  2VXK A;  3TO9 A;  4MHD A;  2B4B A;  1SQH A;  4L89 A;  2EVN A;  4KOW A;  2BUE A;  2G3T A;  1M4D A;  2GAN A;  3CXQ A;  5C88 A;  4H6Z A;  3GY9 A;  4KOR A;  2KCW A;  3ZJ0 A;  4FD4 A;  1I1D A;  1KZF A;  3IWG A;  3MGD A;  2NMT A;  1UFH A;  3CXS A;  1IYK A;  1M44 A;  4QC6 A;  3JVN A;  1Q2Y A;  4AG9 A;  1YLE A;  4UBR A;  3F0A A;  2PDO A;  1KUV A;  4PK2 A;  4KVX A;  1CM0 A;  4CRZ B;  1Q2C A;  2B58 A;  1M1D A;  5C82 A;  4ZBG A;  1U6M A;  2Z0Z A;  4PV6 A;  1XIX A;  3DSB A;  4MY3 A;  2ZPA A;  4KOV A;  3T9Y A;  4YFJ A;  3VWE A;  2FCK A;  3EXN A;  1IB1 E;  3R95 A;  3TCV A;  1YRE A;  2VZZ A;  4KVM E;  3WR7 A;  4M85 A;  4YRH A;  4JWP A;  5H84 A;  2Q4V A;  5E96 A;  2F5I A;  2GIV A;  1BO4 A;  3KKW A;  2IL4 A;  2J8M A;  2Y0M A;  2PR8 A;  2QEC A;  1OZP A;  4AB7 A;  1QSN A;  1Q2D A;  1IYL A;  3QB8 A;  2ZW7 A;  4KLW A;  1Z4R A;  4II9 A;  3PGP A;  1QSO A;  5JQ4 A;  4NSQ A;  2PRB A;  1IIC A;  3P2F A;  4B5P A;  1S7L A;  1Y7R A;  3EO4 A;  3E0K A;  2ARH A;  4U9Z A;  2B3V A;  4DNC A;  2AE6 A;  5FVJ A;  2PQ8 A;  4MY0 A;  4XPD C;  1B87 A;  2QIR A;  3OWC A;  4UA3 A;  3TE4 A;  5ISV A;  4MBU A;  3TT2 A;  1XF8 A;  4MI4 A;  3W91 A;  2R7H A;  4R3K A;  4B5O A;  1YR0 A;  4UWI A;  2Q04 A;  4R57 A;  1QSM A;  1N71 A;  3P2H A;  1Y9K A;  1KUX A;  3F8K A;  3TTH A;  4E8O A;  4L8A A;  3EY5 A;  2PC1 A;  2PR1 A;  3K9U A;  4HKF A;  1L0C A;  2Q4Y A;  1Z4E A;  2R8V A;  1V0C A;  1Y9W A;  5IV0 A;  1K4J A;  5DWN A;  4KOY A;  4XPD B;  1Z9U A;  3EFA A;  1B6B A;  1WK4 A;  4NEX A;  2C27 A;  1R57 A;  2Q0Y A;  3F5B A;  4LX9 A;  2J8N A;  4XPK A;  4Y49 C;  4OAD A;  2B5G A;  4JD6 A;  1PUA A;  1NMT A;  2Z11 A;  4RS2 A;  2HQY A;  3VWD A;  1PU9 A;  4AG7 A;  3R96 A;  2JEV A;  3N7Z A;  3FYN A;  3FIX A;  5J8F A;  1YX0 A;  4AVB A;  4YGO A;  5DWM A;  2WPX A;  2K5T A;  2CNT A;  4HNY B;  2OH1 A;  3BJ7 A;  3FBU A;  4U5Y A;  4LUA A;  2RC4 A;  3DR8 A;  1S7F A;  2FIA A;  1NSL A;  1YVK A;  4XNH C;  2QML A;  1NE9 A;  4Y49 B;  1S7N A;  2B3U A;  2FXF A;  1KUY A;  2P6G A;  3DNS A;  3BLN A;  2DXQ A;  2ZW5 A;  3FNC A;  3SXO A;  3I3G A;  2CNM A;  1QSR A;  3CXP A;  2OZU A;  5F49 A;  4UWJ A;  4OLL A;  3FXT A;  4FD5 A;  3D8P A;  5I0C A; 
#chains in the Genus database with same CATH topology
 4AVA A;  4HNW B;  1VKC A;  1EE3 P;  2ZEM A;  3IGR A;  3LOD A;  3TO6 A;  2R1I A;  4UEF A;  2FS5 A;  4P6Y A;  4YWY A;  1I12 A;  4KUA A;  1X12 A;  1XMT A;  3B3W A;  4BMH A;  2ATR A;  1Z5R A;  2REF A;  2B4D A;  1VHO A;  1ZLI A;  2VL1 A;  4AVC A;  2Q7S A;  4CAV A;  4UIB A;  4XNH B;  3NFZ A;  4A38 A;  2DPT A;  3V8I A;  1CJW A;  4ORF A;  4QBJ A;  1YK3 A;  3D3S A;  3BHX A;  4C2X A;  2H5M A;  4MHP A;  3MN8 A;  1UWY A;  4M6I A;  3PZJ A;  2BEI A;  4XPL A;  2CXA A;  1QST A;  3NE7 A;  2WZN A;  4MFL A;  4P44 A;  5EBV A;  5HH1 A;  3FRM A;  4KOX A;  4F9U A;  2CY2 A;  3T8W A;  4IF5 A;  5IB9 A;  2ZEN A;  1P0H A;  4MFZ A;  2IQ6 A;  3BXM A;  4IK2 A;  3SI0 A;  5JGF A;  2BCO A;  2BOA A;  4BIN A;  4CAW A;  4PPZ A;  2P0W A;  1IOI A;  2GLJ A;  2P6F A;  4PXC A;  3MRU A;  4B5P B;  4CAE A;  2C6G A;  2REE A;  3B3C A;  1LRZ A;  4AXV A;  2FE7 A;  4KS9 A;  4KLV A;  4ZY1 A;  6CPA A;  4ZI6 A;  3BI1 A;  1ELM P;  2J8R A;  2QYV A;  5KTA A;  2XEG A;  3S9N A;  3DR6 A;  3NH5 A;  1KWM A;  4FAI A;  2J9A A;  3FX6 A;  4R9M A;  4A31 A;  3TFY A;  1MJB A;  4JJX A;  5F47 A;  2VI7 A;  2GE3 A;  3C26 A;  3WT4 A;  5CNP A;  3WC5 A;  2CNS A;  1S7K A;  5IB0 A;  4R6T A;  2DPS A;  2PRQ A;  3JUW A;  4PK3 A;  3S6K A;  5LYD A;  2Z3K A;  2VEZ A;  4F8Z A;  4X5K A;  4U9Y A;  3CZX A;  1TXR A;  3VH9 A;  3ZZI A;  1ZO0 A;  3H5Z A;  1ARL A;  2CIJ A;  5GCN A;  1Z8T A;  3RAM A;  1CBX A;  2O28 A;  4EVY A;  5ELY A;  3W6X A;  2JLM A;  2Z3M A;  2OZG A;  2ZEE A;  4KZT A;  5KTC A;  5F46 A;  2D4P A;  2Z3N A;  2ZW6 A;  3HUV A;  5EC4 A;  3R9F A;  4KOU A;  4F0X A;  5J1Q A;  5IX3 A;  3IJ3 A;  2VBQ A;  5H86 A;  4KVO E;  2JEW A;  4B10 A;  3GLJ A;  3D7F A;  3PFO A;  3KQZ A;  4NGT A;  4NJR A;  4X8I A;  4IAV A;  5LYL A;  2DF5 A;  1VGY A;  5LRJ A;  3PFE A;  2G0B A;  4OME A;  5G1Z A;  5K8M A;  4DYO A;  3FVL A;  2PJB A;  2WSA A;  4P4B A;  3S6F A;  4KSA A;  3SXN A;  4I49 A;  3K9T A;  4KOS A;  1A2Z A;  5AG5 A;  3PRT A;  2FT0 A;  5HVH A;  4NGS A;  4NJQ A;  2NSM A;  4PXD A;  2JBK A;  3B3V A;  3RYO A;  4CAF A;  3UY5 A;  2I79 A;  3H4Q A;  1BLL E;  4GS4 A;  4R76 A;  4CAX A;  1MK4 A;  1LAN A;  1S5K A;  1YVO A;  5A28 A;  4IUS A;  2B5G B;  2D4O A;  1I21 A;  2PIZ A;  2ZEF A;  3NE8 A;  4UEZ A;  5A27 A;  2YGW A;  2AFX A;  3DLJ A;  4MFP A;  1OBR A;  1WWZ A;  4EFD A;  5LYF A;  3B35 A;  5D29 A;  4CYQ A;  2V8D A;  3RO0 A;  3H8G A;  1YGH A;  4CRY B;  3S6G A;  4R3L A;  2FSR A;  2POK A;  1LOK A;  1YQE A;  4E0A A;  2I00 A;  3TO7 A;  3TOA A;  3BI0 A;  2HUZ A;  2OZH A;  4NGN A;  2BL1 A;  3BJ8 A;  1BOB A;  4UCP A;  3EC4 A;  3W6S A;  4CGP A;  2OR4 A;  3SJX A;  2QVP A;  3VAT A;  3S9L A;  2PE3 A;  4GM5 A;  2ZW4 A;  4P4J A;  3PEI A;  1R3N A;  2ABZ A;  1J4J A;  1FNO A;  2WUU A;  3DDD A;  3RBU A;  2JDC A;  1CP7 A;  2Q7B A;  5AG4 A;  4MJ8 A;  3G8W A;  4M3S A;  1QQ9 A;  2Q44 A;  4LQ6 A;  4P4E A;  3ISZ A;  4R87 A;  3R9G A;  3S6H A;  1BPN A;  1RO5 A;  5LRK A;  4MFQ A;  3LD2 A;  3IO1 A;  4B11 A;  3LWU A;  2NYQ A;  2Z10 A;  2ZXV A;  4A95 A;  2HV2 A;  4X3R A;  5J8C A;  3G3S A;  2CTB A;  2PJ3 A;  3PB4 X;  1IOF A;  5F48 A;  4ZGY B;  2GFQ A;  4G1P A;  4QB9 A;  4HNX B;  4JZ0 A;  1H8L A;  5THW A;  2X7B A;  3FH4 A;  4FWU A;  4NCZ A;  4UCM A;  3GKR A;  4A2Z A;  1FY7 A;  3D66 A;  4ZX9 A;  4RI1 A;  3KHX A;  4QVT A;  3PBB A;  3N5F A;  3V7Z A;  2OU2 A;  2P6E A;  1Y0Y A;  4UEE A;  3R9E A;  1LAM A;  3RNZ A;  5HMN A;  2CTC A;  1RXT A;  4A32 A;  1IID A;  1NSA A;  1XEB A;  4JXR A;  5JPH A;  1JQG A;  1MJ9 A;  2B4D B;  3IEH A;  4ZX8 A;  3FED A;  4ZY2 A;  2VZY A;  4H89 A;  3WC7 A;  4TWE A;  2PJ5 A;  1MJA A;  4CYP A;  4MHZ A;  1Z8W A;  5HVG A;  2FIW A;  2JBJ A;  2O53 A;  2ZEL A;  3I9S A;  3LMS A;  4K30 A;  4OIW A;  5JM6 A;  3T90 A;  2FL4 A;  1LFW A;  3D2M A;  2ODF A;  1XRY A;  1S60 A;  2AJ6 A;  4PSW A;  2C1C A;  4QUS A;  4JLY A;  2Q43 A;  3GYA A;  1M4I A;  1ZG7 A;  4KOT A;  4OC2 A;  3SJE A;  4CS0 B;  4F6A A;  4E2A A;  2V8V A;  4FD7 A;  3D2P A;  3K2K A;  2OB0 A;  4W9Y A;  1XMB A;  3WAB A;  2R98 A;  2JDD A;  1ELL P;  4FD6 A;  4H6U A;  2V8H A;  5F09 A;  4C2Z A;  4RN7 A;  1F2O A;  3B8G A;  1ARM A;  2BSW A;  3D67 A;  4WWV A;  3S9M A;  3D7D A;  1P4N A;  1TKH A;  3D4U A;  2EWB A;  4OC1 A;  1YLO A;  2HC9 A;  3KZW A;  2XEI A;  3TC8 A;  4CYO A;  4JXQ A;  2EUI A;  4NXY A;  1BPM A;  4NF1 A;  4KUB A;  1VIX A;  4ONU A;  5LYI A;  3SJF A;  1GHE A;  2WPW A;  1Z8L A;  3PP9 A;  4J3G A;  1DE4 C;  4OC3 A;  1F2P A;  4PSX A;  4F0Y A;  1XE4 A;  1VHS A;  3QAH A;  4NGQ A;  3TOB A;  2A4N A;  2F8H A;  4PXE A;  2VQY A;  5G20 A;  4Q7A A;  2V77 A;  2ZEG A;  1M4G A;  1TIQ A;  5KTD A;  1ON0 A;  4MFJ A;  1CPS A;  4H2K A;  3FB3 A;  3KR4 A;  2G3A A;  3IU1 A;  4MXU A;  3I1U A;  3SHP A;  4OAE A;  1IGB A;  2PSW A;  2F7V A;  3NH8 A;  4JYW A;  4OC4 A;  4F9V A;  3R1K A;  4MMO A;  1ZLH A;  1S3Z A;  3FEE A;  1R43 A;  1Q7L A;  1YW6 A;  2VXK A;  3TO9 A;  2EK8 A;  4MHD A;  2B4B A;  1JWQ A;  1SQH A;  5AG6 A;  4L89 A;  5K8N A;  1CP6 A;  2EVN A;  3FJU A;  1XJO A;  4FUU A;  4KOW A;  4MFK A;  2BUE A;  2G3T A;  1M4D A;  4CGM A;  2GAN A;  3CXQ A;  5C88 A;  2PJA A;  4H6Z A;  3B2Y A;  3GY9 A;  1TF9 A;  2KCW A;  1AUG A;  4KOR A;  4MCP A;  3ZJ0 A;  4PQA A;  4FD4 A;  1I1D A;  1KZF A;  2G9D A;  2GLF A;  2RB7 A;  2Q4Z A;  2ZEH A;  3IWG A;  2ZED A;  3MGD A;  3PB9 X;  4PXB A;  4UFV A;  4NFR A;  2NMT A;  5CBM A;  4DUK A;  4P4I A;  1UFH A;  3B3S A;  1QMU A;  3CXS A;  5CPA A;  1IYK A;  2PIY A;  1M44 A;  4QC6 A;  3CPA A;  1YME A;  3D7H A;  3GB0 A;  3JVN A;  2I3C A;  3IWE A;  3SJG A;  1Q2Y A;  2EO8 A;  4AG9 A;  1YLE A;  2ZEP A;  4UBR A;  2PJ2 A;  2WYR A;  3F0A A;  4K3N A;  2PDO A;  3IWW A;  1KUV A;  4HPS A;  4PK2 A;  4KSI A;  2Q51 A;  3LAC A;  3PB8 X;  4UF4 A;  4KVX A;  1CM0 A;  4C2Y A;  5G21 A;  4CRZ B;  4MHY A;  1Q2C A;  2B58 A;  1M1D A;  4ZY0 A;  5C82 A;  4ZBG A;  2AFM A;  1U6M A;  2AFW A;  4A30 A;  2Z0Z A;  2FVG A;  4PV6 A;  1XIX A;  4R8F A;  2DEA A;  3DSB A;  4M6G A;  4MY3 A;  4CYN A;  3IFE A;  2ZPA A;  2EBJ A;  2PJC A;  4KOV A;  3B7I A;  3T9Y A;  2PJ1 A;  4YFJ A;  3VWE A;  2FCK A;  3EXN A;  1IB1 E;  4M6H A;  3R95 A;  8CPA A;  3TCV A;  1YRE A;  2VZZ A;  4KVM E;  4NGM A;  2C6P A;  3WR7 A;  4M85 A;  1M4L A;  4YRH A;  4JWP A;  1YW4 A;  5H84 A;  2Q4V A;  3NH4 A;  5E96 A;  2F5I A;  2GIV A;  1BO4 A;  2IL4 A;  2J8M A;  3KKW A;  4P4D A;  2Y0M A;  2PR8 A;  5K8O A;  2QEC A;  5G22 A;  1OZP A;  2YNC A;  4AB7 A;  1QSN A;  1Q2D A;  1IYL A;  3QB8 A;  1LCP A;  2ZW7 A;  4KLW A;  4YU9 A;  1Z4R A;  4II9 A;  4Z65 A;  2O4H A;  3PGP A;  1QSO A;  5JQ4 A;  2PJ8 A;  1CX8 A;  4MCQ A;  3CDX A;  2GU2 A;  4NSQ A;  2PRB A;  1IIC A;  3QAY A;  1X10 A;  1CG2 A;  1GYT A;  3P2F A;  2YND A;  4MCR A;  1BAV A;  2PJ7 A;  2YNE A;  2V8G A;  2IMO A;  3PB7 X;  4UFW A;  4Q38 A;  2XEF A;  4B5P A;  4MCS A;  3FEC A;  1HEE A;  1S7L A;  1Y7R A;  5D8N A;  3EO4 A;  1HDU A;  3E0K A;  1RTQ A;  3KL9 A;  3CT9 A;  2ARH A;  4U9Z A;  3TX8 A;  4FBE A;  2B3V A;  5DS0 A;  4A39 A;  4OID A;  4DNC A;  4ZYQ A;  3IU2 A;  2AE6 A;  2HB6 A;  5FVJ A;  2PQ8 A;  4MY0 A;  4XPD C;  1ZG8 A;  2IJZ A;  1B87 A;  1AYE A;  2QIR A;  3OWC A;  4BD9 A;  4UA3 A;  3TE4 A;  5ISV A;  3B3T A;  3KGQ A;  5HXD A;  3SI1 A;  4MBU A;  4LQG A;  3TT2 A;  2PJ4 A;  1XF8 A;  4MI4 A;  3QNV A;  3W91 A;  2R7H A;  4MHN A;  2AFZ A;  4R3K A;  4B5O A;  3L2N A;  2Z3O A;  1YR0 A;  4UWI A;  1TKF A;  2Q04 A;  4R57 A;  1QSM A;  2AFS A;  1N71 A;  3NA6 A;  3PB6 X;  3P2H A;  4C68 A;  2ANP A;  4UFX A;  1Y9K A;  2PJ9 A;  1KUX A;  2ZEO A;  3F8K A;  3TTH A;  4Q36 A;  4KSF A;  4A94 A;  4E8O A;  4L8A A;  4B6Z A;  2ZOG A;  4A37 A;  3EY5 A;  5AG7 A;  3A9L A;  2PCU A;  2PC1 A;  3H8F A;  5I4M A;  1F57 A;  4X2T A;  2PR1 A;  4WJB A;  3K9U A;  4HKF A;  1XBU A;  4TNU A;  1L0C A;  2Q4Y A;  1Z4E A;  1IY7 A;  2PJ0 A;  2R8V A;  1V0C A;  1Y9W A;  5IV0 A;  1K4J A;  5DWN A;  4KOY A;  2PVV A;  2CF4 A;  2PVW A;  2ZOF A;  3H8E A;  4XPD B;  1Z2L A;  4C7H A;  5BWA B;  1Z9U A;  3EFA A;  4BBH A;  1B6B A;  3IC1 A;  2PJ6 A;  1WK4 A;  3RZA A;  3ISX A;  2C27 A;  2EK9 A;  4NEX A;  4OC0 A;  1R57 A;  2Q0Y A;  3F5B A;  4LX9 A;  4EME A;  2J8N A;  3FF3 A;  4XPK A;  3JRU A;  4Y49 C;  5JH9 A;  1XFO A;  4OAD A;  2B5G A;  4JD6 A;  5HVF A;  1PUA A;  1NMT A;  2Z11 A;  2AFU A;  4RS2 A;  5K8P A;  1FT7 A;  2HQY A;  4NGR A;  3D7G A;  2RFH A;  3KI9 A;  4O23 A;  3VWD A;  1Y0R A;  3CPX A;  1PU9 A;  1Z8X A;  4IHM A;  4AG7 A;  3R96 A;  2JEV A;  3JTK A;  3N7Z A;  4DJL A;  4CGO A;  2XEJ A;  2Z3L A;  5AGE A;  3FYN A;  4P10 A;  3FIX A;  1XOV A;  4B13 A;  7CPA A;  3V38 A;  4RUH A;  1TKJ A;  5J8F A;  3WC6 A;  4C7I A;  4EWT A;  4OC5 A;  1VHE A;  3KAS A;  1YX0 A;  3IIB A;  1DTD A;  4AVB A;  1YSJ A;  4ONW A;  4YGO A;  5DWM A;  4CGL A;  2WPX A;  2K5T A;  2CNT A;  3KHZ A;  2OH1 A;  3DGV A;  4HNY B;  5EMI A;  3SI2 A;  4R7M A;  3GUX A;  3BJ7 A;  3FBU A;  4U5Y A;  4GXH A;  1PYT B;  3KR5 A;  4LUA A;  2OOT A;  3PBE A;  2RC4 A;  3DR8 A;  1S7F A;  2FIA A;  1NSL A;  3D68 A;  1YVK A;  1TF8 A;  2C6C A;  4XNH C;  2QML A;  1NE9 A;  3GIU A;  4P45 A;  2Z3P A;  3FMC A;  1HDQ A;  3KQX A;  4Y49 B;  1S7N A;  1ZG9 A;  2GRE A;  4OP4 A;  2B3U A;  1LAP A;  2BO9 A;  2FXF A;  1KUY A;  1PCA A;  2YNC C;  4OKO A;  2P6G A;  3VAR A;  3DNS A;  3BLN A;  4B14 A;  2DXQ A;  2ZW5 A;  3HLP A;  3FNC A;  4CGN A;  3SXO A;  5LRG A;  2AFO A;  3I3G A;  2CNM A;  4B12 A;  1QSR A;  2QJ8 A;  3CXP A;  4CPA A;  2OZU A;  5F49 A;  4NGP A;  4UWJ A;  4OLL A;  1IU8 A;  4UCN A;  4P4F A;  4UIA A;  4MRI A;  1AMP A;  4A33 A;  3FXT A;  4FD5 A;  1CPX A;  1Y7E A;  3D8P A;  5I0C A; 
#chains in the Genus database with same CATH homology
 4AVA A;  4HNW B;  1VKC A;  3TO6 A;  3IGR A;  3LOD A;  2R1I A;  2FS5 A;  1I12 A;  4KUA A;  1XMT A;  4BMH A;  2ATR A;  2REF A;  2B4D A;  4AVC A;  4CAV A;  4XNH B;  2DPT A;  3V8I A;  1CJW A;  4ORF A;  4QBJ A;  1YK3 A;  3D3S A;  4C2X A;  2H5M A;  3PZJ A;  2BEI A;  4XPL A;  2CXA A;  1QST A;  3NE7 A;  4MFL A;  5EBV A;  5HH1 A;  3FRM A;  4KOX A;  2CY2 A;  4IF5 A;  1P0H A;  4MFZ A;  4CAW A;  2P0W A;  2P6F A;  4B5P B;  4CAE A;  2REE A;  1LRZ A;  2FE7 A;  4KS9 A;  4KLV A;  2J8R A;  5KTA A;  3DR6 A;  4R9M A;  4A31 A;  3TFY A;  1MJB A;  4JJX A;  5F47 A;  2VI7 A;  2GE3 A;  3C26 A;  5CNP A;  2CNS A;  1S7K A;  5IB0 A;  2DPS A;  3JUW A;  4PK3 A;  3S6K A;  2Z3K A;  2VEZ A;  4X5K A;  4U9Y A;  3ZZI A;  1ZO0 A;  3H5Z A;  5GCN A;  2O28 A;  4EVY A;  3W6X A;  2JLM A;  2Z3M A;  2OZG A;  4KZT A;  5KTC A;  5F46 A;  2D4P A;  2Z3N A;  2ZW6 A;  5EC4 A;  3R9F A;  4KOU A;  4F0X A;  5IX3 A;  5H86 A;  2VBQ A;  4KVO E;  4B10 A;  2G0B A;  5G1Z A;  3SXN A;  2WSA A;  3S6F A;  4KSA A;  4I49 A;  4KOS A;  5AG5 A;  2FT0 A;  4CAF A;  3RYO A;  3UY5 A;  2I79 A;  3H4Q A;  4GS4 A;  4CAX A;  1MK4 A;  1S5K A;  1YVO A;  4IUS A;  2B5G B;  2D4O A;  1I21 A;  5A27 A;  2YGW A;  4MFP A;  1WWZ A;  4CYQ A;  1YGH A;  4CRY B;  3S6G A;  4R3L A;  2FSR A;  4E0A A;  2I00 A;  3TO7 A;  3TOA A;  2HUZ A;  2OZH A;  2BL1 A;  3BJ8 A;  1BOB A;  4UCP A;  3EC4 A;  3W6S A;  4CGP A;  2ZW4 A;  1J4J A;  3DDD A;  2WUU A;  2JDC A;  5AG4 A;  2Q7B A;  4MJ8 A;  3G8W A;  4M3S A;  2Q44 A;  4R87 A;  3R9G A;  3S6H A;  1RO5 A;  4MFQ A;  3LD2 A;  4B11 A;  2Z10 A;  2ZXV A;  4A95 A;  2HV2 A;  5J8C A;  3G3S A;  5F48 A;  4ZGY B;  4QB9 A;  4HNX B;  2X7B A;  4NCZ A;  4UCM A;  3GKR A;  4A2Z A;  1FY7 A;  4RI1 A;  4QVT A;  2OU2 A;  2P6E A;  3R9E A;  5HMN A;  4A32 A;  1RXT A;  1IID A;  1XEB A;  4JXR A;  5JPH A;  1MJ9 A;  2B4D B;  2VZY A;  4H89 A;  1MJA A;  4CYP A;  2FIW A;  3I9S A;  4K30 A;  3T90 A;  2FL4 A;  3D2M A;  1S60 A;  2AJ6 A;  4PSW A;  4QUS A;  4JLY A;  3GYA A;  4CS0 B;  1M4I A;  4KOT A;  4F6A A;  4E2A A;  4FD7 A;  3D2P A;  2OB0 A;  2R98 A;  2JDD A;  4FD6 A;  4H6U A;  4C2Z A;  3B8G A;  2BSW A;  1P4N A;  4CYO A;  4JXQ A;  2EUI A;  4NXY A;  4NF1 A;  4ONU A;  4KUB A;  1GHE A;  2WPW A;  3PP9 A;  4J3G A;  4PSX A;  4F0Y A;  1XE4 A;  1VHS A;  3QAH A;  3TOB A;  2A4N A;  2VQY A;  5G20 A;  1M4G A;  1TIQ A;  5KTD A;  1ON0 A;  4MFJ A;  3FB3 A;  2G3A A;  3IU1 A;  3SHP A;  4OAE A;  2PSW A;  3R1K A;  1S3Z A;  2VXK A;  3TO9 A;  4MHD A;  2B4B A;  1SQH A;  5AG6 A;  4L89 A;  2EVN A;  4MFK A;  4CGM A;  4KOW A;  2BUE A;  2G3T A;  1M4D A;  2GAN A;  3CXQ A;  5C88 A;  4H6Z A;  3GY9 A;  4KOR A;  2KCW A;  3ZJ0 A;  4FD4 A;  1I1D A;  1KZF A;  3IWG A;  4UFV A;  3MGD A;  4UFW A;  2NMT A;  1UFH A;  3CXS A;  1IYK A;  1M44 A;  4QC6 A;  3JVN A;  3IWE A;  1Q2Y A;  4AG9 A;  1YLE A;  4UBR A;  3F0A A;  2PDO A;  1KUV A;  4PK2 A;  4KVX A;  1CM0 A;  4C2Y A;  5G21 A;  4CRZ B;  1Q2C A;  2B58 A;  1M1D A;  5C82 A;  4ZBG A;  1U6M A;  4A30 A;  2Z0Z A;  4PV6 A;  1XIX A;  3DSB A;  4MY3 A;  4CYN A;  2ZPA A;  4KOV A;  3T9Y A;  4YFJ A;  3VWE A;  2FCK A;  3EXN A;  1IB1 E;  3R95 A;  3TCV A;  1YRE A;  2VZZ A;  4KVM E;  3WR7 A;  4M85 A;  4YRH A;  4JWP A;  5H84 A;  2Q4V A;  5E96 A;  2F5I A;  2GIV A;  1BO4 A;  3KKW A;  2IL4 A;  2J8M A;  2Y0M A;  2PR8 A;  2QEC A;  5G22 A;  1OZP A;  2YNC A;  4AB7 A;  1QSN A;  1Q2D A;  1IYL A;  3QB8 A;  2ZW7 A;  4KLW A;  1Z4R A;  4II9 A;  3PGP A;  1QSO A;  5JQ4 A;  4NSQ A;  2PRB A;  1IIC A;  3P2F A;  2YND A;  2YNE A;  4Q38 A;  4B5P A;  1S7L A;  1Y7R A;  3EO4 A;  3E0K A;  2ARH A;  4U9Z A;  2B3V A;  4DNC A;  3IU2 A;  2AE6 A;  5FVJ A;  2PQ8 A;  4MY0 A;  4XPD C;  1B87 A;  2QIR A;  3OWC A;  4UA3 A;  3TE4 A;  5ISV A;  4MBU A;  3TT2 A;  1XF8 A;  4MI4 A;  3W91 A;  2R7H A;  4R3K A;  4B5O A;  2Z3O A;  1YR0 A;  4UWI A;  2Q04 A;  4R57 A;  1QSM A;  1N71 A;  4C68 A;  3P2H A;  4UFX A;  1Y9K A;  1KUX A;  3F8K A;  3TTH A;  4Q36 A;  4KSF A;  4E8O A;  4L8A A;  3EY5 A;  5AG7 A;  3A9L A;  2PC1 A;  2PR1 A;  3K9U A;  4HKF A;  1L0C A;  2Q4Y A;  1Z4E A;  2R8V A;  1V0C A;  1Y9W A;  5IV0 A;  1K4J A;  5DWN A;  4KOY A;  4XPD B;  5BWA B;  4C7H A;  1Z9U A;  3EFA A;  4BBH A;  1B6B A;  1WK4 A;  4NEX A;  2C27 A;  1R57 A;  2Q0Y A;  3F5B A;  4LX9 A;  2J8N A;  4XPK A;  4Y49 C;  4OAD A;  2B5G A;  4JD6 A;  1PUA A;  1NMT A;  2Z11 A;  4RS2 A;  2HQY A;  3VWD A;  1PU9 A;  4AG7 A;  3R96 A;  2JEV A;  3JTK A;  3N7Z A;  4CGO A;  2Z3L A;  5AGE A;  3FYN A;  4B13 A;  3FIX A;  5J8F A;  4C7I A;  1YX0 A;  4AVB A;  4YGO A;  5DWM A;  4CGL A;  2WPX A;  2K5T A;  2CNT A;  4HNY B;  2OH1 A;  3BJ7 A;  3FBU A;  4U5Y A;  4LUA A;  2RC4 A;  3DR8 A;  1S7F A;  2FIA A;  1NSL A;  1YVK A;  4XNH C;  2QML A;  1NE9 A;  2Z3P A;  4Y49 B;  1S7N A;  2B3U A;  2FXF A;  2YNC C;  1KUY A;  4B14 A;  5A28 A;  2P6G A;  3DNS A;  3BLN A;  2DXQ A;  2ZW5 A;  3FNC A;  4CGN A;  3SXO A;  3I3G A;  2CNM A;  4B12 A;  1QSR A;  3CXP A;  2OZU A;  5F49 A;  4UWJ A;  4OLL A;  4UCN A;  4A33 A;  3FXT A;  4FD5 A;  3D8P A;  5I0C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...