3EXNA

Crystal structure of acetyltransferase from thermus thermophilus hb8
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
154
structure length
154
Chain Sequence
MHVLTLDLAPVTPKDAPLLHRVFHLSPSYFALIGMELPTLEDVVRDLQTLEVDPRRRAFLLFLGQEPVGYLDAKLGYPEAEDATLSLLLIREDHQGRGLGRQALERFAAGLDGVRRLYAVVYGHNPKAKAFFQAQGFRYVKDGGPTLTWYVRPL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of acetyltransferase from Thermus thermophilus HB8
rcsb
source organism Thermus thermophilus
molecule tags Transferase
molecule keywords Probable acetyltransferase
total genus 44
structure length 154
sequence length 154
ec nomenclature
pdb deposition date 2008-10-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 3exnA00
3GKRA 4AVAA 1S3ZA 1N71A 2BEIA 4KUBA 1YLEA 2ZW4A 4KVXA 1S7FA 1M4IA 3EY5A 1I21A 1WWZA 1Q2CA 1YR0A 4J3GA 3FBUA 4F0YA 1M4DA 4UBRA 2GIVA 1V0CA 4CS0B 2VXKA 3JUWA 4KZTA 1YVKA 5J8CA 4E8OA 3D2PA 2AJ6A 2NMTA 4YFJA 1B6BA 3GY9A 5DWMA 4H89A 2OZHA 1Y9KA 4KORA 4KOUA 2OB0A 1NMTA 1IICA 3KKWA 2H5MA 4XPDC 1P4NA 2R7HA 3NE7A 2X7BA 2CY2A 5I0CA 4XPLA 3SHPA 3S6FA 2P6GA 5HMNA 3R1KA 3R96A 4JWPA 3UY5A 3FIXA 4HNYB 5IV0A 2AE6A 2ZW5A 5FVJA 3P2FA 1J4JA 4KOYA 1M4GA 2HQYA 1P0HA 2OH1A 3S6KA 3EC4A 2QMLA 4PK3A 4KOVA 4M3SA 4HKFA 3PGPA 4MY3A 3FRMA 1I12A 3F8KA 4AVCA 2JDCA 3B8GA 4GS4A 2B3VA 1YX0A 2JLMA 3EXNA 1YREA 2Z10A 2I79A 2DXQA 2D4OA 4AG7A 1ON0A 3SXNA 2B5GB 1QSOA 5F47A 4UWIA 5E96A 5F46A 4YRHA 1KUYA 4XNHB 4MI4A 4M85A 2Q7BA 4DNCA 1K4JA 2P0WA 4JLYA 4ORFA 4II9A 3S6GA 3K9UA 2B3UA 1IYLA 2FE7A 4R3KA 5EC4A 3TT2A 1PUAA 1VKCA 2BSWA 4U9YA 3GYAA 1XIXA 1Z9UA 3TOAA 2G3TA 4CAVA 5H86A 4KOTA 1IYKA 5C88A 4QVTA 5KTAA 3OWCA 2ZW6A 2QIRA 3SXOA 2I00A 4L89A 3QB8A 3IWGA 2CNSA 2B58A 3R9EA 2CNMA 4UA3A 1QSNA 4QUSA 2Z0ZA 5J8FA 4CRYB 5IX3A 2P6FA 5C82A 1YVOA 2B4BA 4AB7A 2PSWA 4B5OA 1BO4A 2GANA 3TO6A 1KUXA 4KOSA 1OZPA 1S60A 2FIWA 5H84A 2C27A 4JD6A 2EUIA 3CXPA 4HNWB 2F5IA 4JJXA 4NF1A 3IGRA 3QAHA 4Y49C 3G3SA 4U9ZA 1BOBA 2EVNA 4KVOE 4KUAA 4X5KA 2OZGA 4NEXA 3TCVA 2FS5A 4KVME 2Q0YA 3DSBA 2HUZA 1R57A 2B4DB 3ZJ0A 3S6HA 3N7ZA 2D4PA 1MK4A 2FSRA 4H6ZA 4R57A 1IB1E 2J8MA 2IL4A 2P6EA 4R9MA 2BL1A 3P2HA 2O28A 3W6SA 2K5TA 4EVYA 1WK4A 4AVBA 2G3AA 1Y9WA 2B4DA 2VI7A 4JXQA 4B5PA 2RC4A 4NCZA 3ZZIA 3I9SA 4MY0A 3VWEA 4KLWA 5ISVA 2WPXA 3BLNA 2VZZA 3DR6A 2JEVA 4UWJA 3LD2A 3F0AA 4CRZB 2Q4VA 3LODA 4PV6A 1XF8A 4ONUA 1RXTA 4QC6A 5KTDA 4K30A 3BJ8A 1M44A 3TOBA 4XPKA 2A4NA 4H6UA 5CNPA 4KOWA 2PQ8A 1FY7A 1Z4EA 1XMTA 2Z11A 5JQ4A 4JXRA 3R9FA 4NXYA 4LX9A 4PSWA 2FL4A 4CAXA 3TE4A 4KLVA 3W6XA 4NSQA 4B5PB 4XNHC 4Y49B 3JVNA 4F6AA 2OZUA 4E0AA 2J8NA 4LUAA 4PSXA 1YGHA 5KTCA 3MGDA 3BJ7A 1S5KA 2FT0A 2PR8A 3T90A 2Q44A 2WPWA 2ZXVA 2R8VA 3DDDA 4AG9A 2FCKA 3E0KA 4IF5A 3CXQA 1L0CA 2G0BA 1SQHA 3TFYA 1UFHA 3PP9A 2CNTA 3EO4A 2VEZA 2ATRA 2ARHA 3FXTA 3TO7A 1QSTA 2FIAA 2R1IA 3T9YA 4U5YA 1M1DA 2REEA 4ZBGA 1CM0A 4QB9A 4FD5A 3F5BA 2PRBA 3W91A 1PU9A 4E2AA 3C26A 4MBUA 3DR8A 4FD7A 1RO5A 3CXSA 4RI1A 2FXFA 4I49A 5GCNA 4FD6A 4L8AA 4PK2A 4MJ8A 3D3SA 4HNXB 1YK3A 5F49A 3RYOA 1NE9A 2VBQA 1QSMA 2REFA 4R3LA 4YGOA 3R9GA 1NSLA 3FB3A 1KUVA 3V8IA 1Y7RA 1Z4RA 4R87A 4OADA 4OLLA 2Y0MA 4IUSA 1S7KA 2R98A 3EFAA 3FNCA 2PDOA 5EBVA 2VQYA 2J8RA 3G8WA 4BMHA 1S7LA 2JDDA 2VZYA 1B87A 5HH1A 3H4QA 2Q04A 2QECA 1I1DA 1Q2DA 1U6MA 1MJAA 1Q2YA 1LRZA 1KZFA 2HV2A 4MHDA 2ZW7A 4QBJA 3FYNA 2GE3A 4KOXA 1VHSA 3D8PA 3VWDA 1TIQA 5F48A 3WR7A 1CJWA 2ZPAA 4RS2A 3DNSA 3R95A 2BUEA 4CAWA 4XPDB 4FD4A 5IB0A 1GHEA 1MJBA 1IIDA 2PR1A 5JPHA 2PC1A 1XE4A 1QSRA 2B5GA 3I3GA 1XEBA 1MJ9A 5DWNA 3D2MA 3PZJA 4OAEA 1S7NA 2Q4YA 3TTHA 2OU2A 2KCWA 3TO9A
chains in the Genus database with same CATH superfamily
4R6TA 3GKRA 4AVAA 1S3ZA 3NE8A 1N71A 3JRUA 3A9LA 2BEIA 2PE3A 4KUBA 4IK2A 2G9DA 5K8OA 4PXDA 2CTCA 1YLEA 3WT4A 4O23A 2ZW4A 4KVXA 4UEZA 1CPXA 1S7FA 1M4IA 3DGVA 1TF8A 2ZEDA 3EY5A 1I21A 1WWZA 3IWWA 4F8ZA 2BOAA 3D67A 1Q2CA 4B10A 1YR0A 4J3GA 5K8MA 4UF4A 3FBUA 4BD9A 4C2YA 4EWTA 1HDQA 4F0YA 1M4DA 3D4UA 4UBRA 2GIVA 1V0CA 4PXBA 4CS0B 2VXKA 3JUWA 4KZTA 1YVKA 4MFKA 1AUGA 3BI1A 4E8OA 3I1UA 5J8CA 2PJAA 3PFOA 3D2PA 2O53A 4A95A 2AJ6A 3KZWA 2NMTA 1ZO0A 4YFJA 1B6BA 3GY9A 2PJ8A 1IOIA 2CIJA 5DWMA 4H89A 2OZHA 1Y9KA 1QQ9A 3ISZA 1RTQA 1TF9A 4KORA 4KOUA 1HEEA 2OB0A 1NMTA 3PB9X 1IICA 3KKWA 3K9TA 4PXCA 3CPXA 2H5MA 1YQEA 4MHNA 4XPDC 1P4NA 4R7MA 4NGRA 2R7HA 1R43A 3NE7A 2X7BA 2CY2A 5F09A 3VH9A 3S9LA 4GM5A 4XPLA 4PQAA 5I0CA 4A33A 3SHPA 3S6FA 2P6GA 5HMNA 4MFJA 2C6PA 3R1KA 4UCPA 3R96A 5LYDA 4JWPA 3UY5A 4C2ZA 3FIXA 4HNYB 5IV0A 2AE6A 2ZW5A 1KWMA 4EMEA 5FVJA 3H8EA 3P2FA 1J4JA 4CGLA 1PCAA 4F9UA 4KOYA 4CYNA 1M4GA 3PB7X 3B3TA 4Q38A 2HQYA 2BO9A 5HXDA 1P0HA 2OH1A 3S6KA 4A37A 2CF4A 3EC4A 2PJ0A 5JH9A 1NSAA 1Q7LA 2QMLA 4NGMA 4PK3A 4KOVA 4A31A 4M3SA 4MMOA 2YNCC 3GUXA 5HVFA 4HKFA 2C6GA 2ZEOA 1Z8LA 3PGPA 2HC9A 4MY3A 4NGPA 4UCNA 3RAMA 1YW6A 4WWVA 3FRMA 1I12A 3F8KA 2ZEHA 4B6ZA 4AVCA 5G20A 4W9YA 2JDCA 3IU2A 5CPAA 2WSAA 3B8GA 1VGYA 3B3CA 1M4LA 4GS4A 3IWEA 2B3VA 1YX0A 4OIDA 2JLMA 3EXNA 4MCSA 4NGNA 4R76A 2QYVA 1YREA 1Z8XA 2I79A 2Z10A 1F2PA 2DXQA 4R8FA 4TWEA 3D7GA 2D4OA 4AG7A 1ON0A 3SXNA 2B5GB 1QSOA 2CXAA 3HUVA 3KHXA 5F47A 5LYLA 4UWIA 4KS9A 4FWUA 4JZ0A 2PJ9A 2HB6A 2PJ1A 3VATA 4A39A 5E96A 2V8DA 5ELYA 5F46A 4MFLA 1ZG9A 4YRHA 2PRQA 1KUYA 2GLJA 4IAVA 4XNHB 4MI4A 2IQ6A 4M85A 4UFVA 2IJZA 2Q7BA 2IMOA 4MCPA 4DNCA 4DYOA 4Z65A 5CBMA 1K4JA 3B3WA 2P0WA 4TNUA 5AG5A 4JLYA 4ORFA 4II9A 2Q51A 4OP4A 4UIBA 3KASA 5JM6A 3S6GA 4LQ6A 5HVGA 1Z8TA 3K9UA 3B3VA 2B3UA 1IYLA 2FE7A 4R3KA 5EC4A 4BINA 3TT2A 3TC8A 4CYPA 1PUAA 1VKCA 3D7FA 2BSWA 4U9YA 3GYAA 1XIXA 4MFZA 1Z9UA 3TOAA 2G3TA 2V77A 4G1PA 4CAVA 4P4IA 1Z5RA 3KQZA 5H86A 4KOTA 1IYKA 5C88A 3KR5A 4QVTA 5KTAA 3OWCA 4P44A 2ZW6A 2QIRA 2GLFA 3KI9A 3SXOA 4P4EA 2I00A 4KSFA 4L89A 3QB8A 1H8LA 2PJ7A 3IWGA 2CNSA 4JYWA 4B11A 2B58A 3R9EA 2PIZA 3T8WA 1GYTA 5I4MA 2CTBA 2CNMA 3GIUA 1QSNA 1X12A 4UA3A 1Z2LA 4QUSA 4K3NA 5BWAB 2Z0ZA 1ZG8A 2YNEA 5J8FA 4CRYB 5IX3A 4NJQA 4PPZA 4P4FA 4OC3A 1ARMA 2P6FA 5G21A 5C82A 1VHEA 1YVOA 2B4BA 4MFPA 4AB7A 4C68A 2PSWA 4RUHA 4B5OA 1YSJA 1BO4A 1TKJA 2GANA 1KUXA 3FJUA 1OZPA 1XFOA 1IY7A 3FX6A 4KOSA 4MFQA 3SJFA 1S60A 2FIWA 1ZLHA 5H84A 2C27A 4C7IA 2RB7A 4JD6A 2EUIA 3IIBA 3CXPA 3NFZA 4HNWB 3S9MA 4UEFA 2F5IA 4JJXA 3TX8A 4NF1A 3IGRA 2ZELA 3QAHA 2Q43A 4Y49C 4B13A 3G3SA 3IU1A 4U9ZA 1BOBA 2EVNA 4A38A 3KR4A 4KVOE 4B12A 4DJLA 3N5FA 4Q7AA 4KUAA 5D29A 2OR4A 2EBJA 3NH5A 3FF3A 2OZGA 4X5KA 4NEXA 1DE4C 2I3CA 3IJ3A 4P45A 2FS5A 4KVME 3TCVA 4CGOA 2Q0YA 1LAMA 3DSBA 1CBXA 2HUZA 3CT9A 3PB6X 3FMCA 2EK8A 5LRGA 4NFRA 2AFSA 3FEDA 3VARA 4A94A 3SI0A 1R57A 4OC0A 2B4DB 1QMUA 3LWUA 3S6HA 3N7ZA 3ZJ0A 2D4PA 6CPAA 2FSRA 1MK4A 2AFXA 4H6ZA 4R57A 4FAIA 1IB1E 1F57A 3K2KA 2AFUA 5J1QA 2J8MA 4P6YA 4KSAA 4PXEA 2IL4A 4HPSA 2P6EA 4H2KA 2XEFA 3ISXA 2V8HA 4R9MA 2V8GA 4YWYA 2OOTA 2BL1A 3FH4A 2O28A 3IFEA 3P2HA 3W6SA 3D68A 2K5TA 4EVYA 1TXRA 2QJ8A 1WK4A 4AVBA 2G3AA 2PJ4A 1Y9WA 2B4DA 2VI7A 2Z3OA 4JXQA 2JEWA 4B5PA 1Z8WA 2RC4A 2PVWA 1VIXA 3QNVA 4NCZA 4OMEA 3ZZIA 2AFWA 3I9SA 4MY0A 4LQGA 3VWEA 4ZY1A 4KLWA 5LRJA 4M6GA 5ISVA 2WPXA 5LYIA 1FT7A 1Y0YA 1YMEA 3BLNA 4KSIA 2VZZA 2GREA 2ABZA 3DR6A 4CAFA 2AFMA 2JEVA 2F7VA 4UWJA 3LD2A 3F0AA 4NGSA 4CRZB 2Q4VA 3LODA 4OC5A 4PV6A 3QAYA 4P10A 2AFZA 1XF8A 4ONUA 1RXTA 1XRYA 2V8VA 2YNDA 4FUUA 4QC6A 5KTDA 4K30A 1ELMP 3CPAA 3BJ8A 4A2ZA 1M44A 3TOBA 1LAPA 4XPKA 2A4NA 3D7HA 4H6UA 3FVLA 5CNPA 4KOWA 4OC4A 4CPAA 2DPTA 4MHZA 3SJGA 1FNOA 2PQ8A 1FY7A 3PBBA 1XJOA 3RBUA 3TO6A 3MRUA 1PYTB 3IEHA 3RO0A 3RNZA 1Z4EA 1XMTA 4UIAA 2Z11A 4F9VA 3WC7A 2PJ5A 4P4JA 5JQ4A 3PFEA 4JXRA 3R9FA 4ZGYB 1CP7A 4NXYA 2J9AA 1AMPA 4LX9A 4UEEA 4PSWA 3KHZA 2ZEMA 2BCOA 2FL4A 4CAXA 3PEIA 3LMSA 1EE3P 2PJCA 3NH8A 3SI2A 2JBJA 4KLVA 4MCRA 4CYQA 1TKFA 2PVVA 1LANA 4MHPA 1LOKA 5HVHA 1UWYA 1XBUA 4NSQA 3W6XA 4B5PB 4XNHC 3JTKA 4Y49B 3JVNA 5LRKA 4F6AA 2WUUA 2OZUA 3PB8X 4MXUA 4E0AA 2J8NA 4LUAA 4PSXA 1YGHA 4DUKA 5KTCA 3MGDA 3BJ7A 1S5KA 2Z3PA 2FT0A 1YW4A 2PCUA 2PR8A 3T90A 1DTDA 2Q44A 2VL1A 2WPWA 2R8VA 2XEJA 2ZXVA 4ZY0A 1XMBA 2QVPA 3DDDA 4X2TA 2PJ6A 4AG9A 5LYFA 2FCKA 5K8NA 1ELLP 3E0KA 1JWQA 4IF5A 2RFHA 3CXQA 2POKA 1L0CA 1CG2A 2G0BA 1SQHA 3TFYA 2GU2A 4A30A 3HLPA 4MHYA 2F8HA 1UFHA 3PP9A 4OKOA 2CNTA 3EO4A 2VEZA 2ATRA 2ARHA 4MCQA 3FXTA 3TO7A 1QSTA 2FIAA 2PIYA 2R1IA 3T9YA 2ZEGA 3KL9A 4NGQA 3WC6A 2ZOFA 4F0XA 4GXHA 5D8NA 5AGEA 3H8GA 2C1CA 3TE4A 3RZAA 4U5YA 4OC2A 1M1DA 2REEA 4ZBGA 1CM0A 4ZX8A 4QB9A 4ZYQA 2XEIA 4ONWA 3D66A 4FD5A 3F5BA 3WC5A 2PRBA 3V7ZA 3W91A 1PU9A 4E2AA 4EFDA 1IGBA 3C26A 4CYOA 4ZY2A 2WYRA 4NGTA 4MBUA 2ZOGA 3D7DA 3DR8A 7CPAA 1LCPA 4FD7A 1RO5A 3CXSA 3DLJA 4RI1A 2FXFA 1ZG7A 4I49A 5GCNA 2Z3KA 2ZEPA 4FD6A 1IOFA 4L8AA 4PK2A 2EK9A 1IU8A 4AXVA 1AYEA 4MRIA 1OBRA 3B7IA 2EO8A 3D3SA 4HNXB 4MJ8A 4OC1A 1YK3A 4CAEA 5F49A 3IC1A 3RYOA 2Z3LA 4RN7A 1Y0RA 1NE9A 2VBQA 1QSMA 4P4BA 2REFA 3FECA 4OIWA 4YU9A 4R3LA 4YGOA 3FEEA 2WZNA 3R9GA 1NSLA 3FB3A 2ZEEA 1KUVA 4CGMA 5IB9A 5G1ZA 3V8IA 1CX8A 1Y7RA 1Z4RA 4R87A 4OADA 5JGFA 4OLLA 2Y0MA 5THWA 2PJBA 3BXMA 3WABA 2YGWA 1TKHA 4Q36A 4IUSA 1CP6A 1S7KA 2R98A 3MN8A 4M6IA 5A27A 4IHMA 3PRTA 3EFAA 3GB0A 3FNCA 2PDOA 5EBVA 2VQYA 3KQXA 3NA6A 3PBEA 2J8RA 3G8WA 2O4HA 4X3RA 4BMHA 1S7LA 5DS0A 2JDDA 3L2NA 2VZYA 5AG6A 2ZEFA 1B87A 5HH1A 3H4QA 2Q04A 4UFWA 1BPMA 2QECA 1ZLIA 3H5ZA 1I1DA 2C6CA 1LFWA 2FVGA 1A2ZA 1Q2DA 5AG7A 1U6MA 1MJAA 1Q2YA 2Q4ZA 2YNCA 2EWBA 1LRZA 1KZFA 4CGNA 3IO1A 2HV2A 2PJ2A 3V38A 4CGPA 3LACA 4MHDA 2ZW7A 4QBJA 3FYNA 3SJXA 3GLJA 4NJRA 2GFQA 2Z3MA 5K8PA 2GE3A 2DF5A 4KOXA 1VHSA 2ZENA 3D8PA 1TIQA 3VWDA 2DPSA 5F48A 4ZI6A 4BBHA 5A28A 1BLLE 1JQGA 4WJBA 1CJWA 1CPSA 1VHOA 4UFXA 1F2OA 2Z3NA 3WR7A 2Q7SA 4C2XA 2ZPAA 3PB4X 3B3SA 2NYQA 4RS2A 3DNSA 2AFOA 3R95A 1X10A 3NH4A 2BUEA 1YLOA 2JBKA 4XPDB 4FD4A 3KGQA 4CAWA 4M6HA 3H8FA 4B14A 8CPAA 5IB0A 1GHEA 1MJBA 3SI1A 1IIDA 2PR1A 3B2YA 5JPHA 4UCMA 1XOVA 3CDXA 2PC1A 1BAVA 1QSRA 1XE4A 2B5GA 3I3GA 4A32A 2DEAA 3BHXA 4ZX9A 5AG4A 1ARLA 1XEBA 1MJ9A 2PJ3A 5DWNA 1Y7EA 1R3NA 3D2MA 3SJEA 3PZJA 4OAEA 4C7HA 4FBEA 5EMIA 1S7NA 2NSMA 3B35A 2Q4YA 3TTHA 2OU2A 3CZXA 4X8IA 2KCWA 2ODFA 3BI0A 5G22A 4P4DA 3S9NA 1HDUA 3TO9A 1BPNA 2XEGA 2ANPA
chains in the Genus database with same CATH topology
3GKRA 4AVAA 1S3ZA 1N71A 3A9LA 2BEIA 4KUBA 1YLEA 2ZW4A 4KVXA 1S7FA 1M4IA 3EY5A 1I21A 1WWZA 1Q2CA 4B10A 1YR0A 4J3GA 3FBUA 4C2YA 4F0YA 1M4DA 4UBRA 2GIVA 1V0CA 4CS0B 2VXKA 3JUWA 4KZTA 1YVKA 4MFKA 5J8CA 4E8OA 3D2PA 4A95A 2AJ6A 2NMTA 1ZO0A 4YFJA 1B6BA 3GY9A 5DWMA 4H89A 2OZHA 1Y9KA 4KORA 4KOUA 2OB0A 1NMTA 1IICA 3KKWA 2H5MA 4XPDC 1P4NA 2R7HA 3NE7A 2X7BA 2CY2A 5I0CA 4XPLA 4A33A 3SHPA 3S6FA 2P6GA 5HMNA 4MFJA 3R1KA 4UCPA 3R96A 4JWPA 3UY5A 4C2ZA 3FIXA 4HNYB 5IV0A 2AE6A 2ZW5A 5FVJA 3P2FA 1J4JA 4CGLA 4KOYA 4CYNA 1M4GA 4Q38A 2HQYA 1P0HA 2OH1A 3S6KA 3EC4A 2QMLA 4PK3A 4KOVA 4A31A 4M3SA 2YNCC 4HKFA 3PGPA 4MY3A 4UCNA 3FRMA 1I12A 3F8KA 4AVCA 5G20A 2JDCA 3IU2A 2WSAA 3B8GA 4GS4A 3IWEA 2B3VA 1YX0A 2JLMA 3EXNA 1YREA 2Z10A 2I79A 2DXQA 2D4OA 4AG7A 1ON0A 3SXNA 2B5GB 1QSOA 2CXAA 5F47A 4UWIA 4KS9A 5E96A 5F46A 4MFLA 4YRHA 1KUYA 4XNHB 4MI4A 4M85A 4UFVA 2Q7BA 4DNCA 1K4JA 2P0WA 5AG5A 4JLYA 4ORFA 4II9A 3S6GA 3K9UA 2B3UA 1IYLA 2FE7A 4R3KA 5EC4A 3TT2A 4CYPA 1PUAA 1VKCA 2BSWA 4U9YA 3GYAA 1XIXA 4MFZA 1Z9UA 3TOAA 2G3TA 4CAVA 5H86A 4KOTA 1IYKA 5C88A 4QVTA 5KTAA 3OWCA 2ZW6A 2QIRA 3SXOA 2I00A 4KSFA 4L89A 3QB8A 3IWGA 4B11A 2CNSA 2B58A 3R9EA 2CNMA 4UA3A 1QSNA 4QUSA 5BWAB 2Z0ZA 2YNEA 5J8FA 4CRYB 5IX3A 2P6FA 5C82A 5G21A 1YVOA 2B4BA 4MFPA 4AB7A 4C68A 2PSWA 4B5OA 1BO4A 2GANA 4MFQA 1KUXA 4KOSA 1OZPA 3TO6A 1S60A 2FIWA 5H84A 2C27A 4C7IA 4JD6A 2EUIA 3CXPA 4HNWB 2F5IA 4JJXA 4NF1A 3IGRA 3QAHA 4Y49C 4B13A 3G3SA 3IU1A 4U9ZA 1BOBA 2EVNA 4KVOE 4B12A 4KUAA 4X5KA 2OZGA 4NEXA 3TCVA 2FS5A 4KVME 4CGOA 2Q0YA 3DSBA 2HUZA 1R57A 2B4DB 3ZJ0A 3S6HA 3N7ZA 2D4PA 1MK4A 2FSRA 4H6ZA 4R57A 1IB1E 2J8MA 4KSAA 2IL4A 2P6EA 4R9MA 4A32A 2BL1A 3P2HA 2O28A 3W6SA 2K5TA 4EVYA 1WK4A 4AVBA 2G3AA 1Y9WA 2B4DA 2VI7A 2Z3OA 4JXQA 4B5PA 2RC4A 4NCZA 3ZZIA 3I9SA 4MY0A 3VWEA 4KLWA 5ISVA 2WPXA 3BLNA 2VZZA 3DR6A 4CAFA 2JEVA 4UWJA 3LD2A 3F0AA 4CRZB 2Q4VA 3LODA 4PV6A 1XF8A 4ONUA 1RXTA 2YNDA 4QC6A 5KTDA 4K30A 3BJ8A 4A2ZA 1M44A 3TOBA 4XPKA 2A4NA 4H6UA 5CNPA 4KOWA 2DPTA 2PQ8A 1FY7A 1Z4EA 1XMTA 2Z11A 5JQ4A 4JXRA 3R9FA 4ZGYB 4NXYA 4LX9A 4PSWA 2FL4A 4CAXA 3TE4A 4CYQA 4KLVA 3W6XA 4NSQA 4B5PB 4XNHC 3JTKA 4Y49B 3JVNA 4F6AA 2WUUA 2OZUA 4E0AA 2J8NA 4LUAA 4PSXA 1YGHA 5KTCA 3MGDA 3BJ7A 1S5KA 2Z3PA 2FT0A 2PR8A 3T90A 2Q44A 2WPWA 2ZXVA 2R8VA 3DDDA 4AG9A 2FCKA 3E0KA 4IF5A 3CXQA 1L0CA 2G0BA 1SQHA 3TFYA 4A30A 1UFHA 3PP9A 2CNTA 3EO4A 2VEZA 2ATRA 2ARHA 3FXTA 3TO7A 1QSTA 2FIAA 2R1IA 3T9YA 4F0XA 5AGEA 4U5YA 1M1DA 2REEA 4ZBGA 1CM0A 4QB9A 4FD5A 3F5BA 2PRBA 3W91A 1PU9A 4E2AA 3C26A 4CYOA 4MBUA 3DR8A 4FD7A 1RO5A 3CXSA 4RI1A 2FXFA 4I49A 5GCNA 2Z3KA 4FD6A 4L8AA 4PK2A 4MJ8A 3D3SA 4HNXB 4CAEA 1YK3A 5F49A 3RYOA 2Z3LA 1NE9A 2VBQA 1QSMA 2REFA 4R3LA 4YGOA 3R9GA 1NSLA 3FB3A 1KUVA 4CGMA 5G1ZA 3V8IA 1Y7RA 1Z4RA 4R87A 4OADA 4OLLA 2Y0MA 2YGWA 4Q36A 4IUSA 1S7KA 2R98A 5A27A 3EFAA 3FNCA 2PDOA 5EBVA 2VQYA 2J8RA 3G8WA 4BMHA 1S7LA 2JDDA 2VZYA 5AG6A 1B87A 5HH1A 3H4QA 2Q04A 4UFWA 2QECA 3H5ZA 1I1DA 5AG7A 1Q2DA 1U6MA 1MJAA 1Q2YA 2YNCA 4CGNA 1LRZA 1KZFA 2HV2A 4CGPA 4MHDA 2ZW7A 4QBJA 3FYNA 2Z3MA 2GE3A 4KOXA 1VHSA 3D8PA 3VWDA 1TIQA 2DPSA 5F48A 4BBHA 5A28A 3WR7A 1CJWA 4UFXA 2Z3NA 4C2XA 2ZPAA 4RS2A 3DNSA 3R95A 2BUEA 4CAWA 4XPDB 4FD4A 4B14A 5IB0A 1GHEA 1MJBA 1IIDA 2PR1A 5JPHA 4UCMA 2PC1A 1XE4A 1QSRA 2B5GA 3I3GA 5AG4A 1XEBA 1MJ9A 5DWNA 3D2MA 4C7HA 3PZJA 4OAEA 1S7NA 2Q4YA 3TTHA 2OU2A 2KCWA 5G22A 3TO9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GKR A;  4AVA A;  1S3Z A;  1N71 A;  2BEI A;  4KUB A;  1YLE A;  2ZW4 A;  4KVX A;  1S7F A;  1M4I A;  3EY5 A;  1I21 A;  1WWZ A;  1Q2C A;  1YR0 A;  4J3G A;  3FBU A;  4F0Y A;  1M4D A;  4UBR A;  2GIV A;  1V0C A;  4CS0 B;  2VXK A;  3JUW A;  4KZT A;  1YVK A;  5J8C A;  4E8O A;  3D2P A;  2AJ6 A;  2NMT A;  4YFJ A;  1B6B A;  3GY9 A;  5DWM A;  4H89 A;  2OZH A;  1Y9K A;  4KOR A;  4KOU A;  2OB0 A;  1NMT A;  1IIC A;  3KKW A;  2H5M A;  4XPD C;  1P4N A;  2R7H A;  3NE7 A;  2X7B A;  2CY2 A;  5I0C A;  4XPL A;  3SHP A;  3S6F A;  2P6G A;  5HMN A;  3R1K A;  3R96 A;  4JWP A;  3UY5 A;  3FIX A;  4HNY B;  5IV0 A;  2AE6 A;  2ZW5 A;  5FVJ A;  3P2F A;  1J4J A;  4KOY A;  1M4G A;  2HQY A;  1P0H A;  2OH1 A;  3S6K A;  3EC4 A;  2QML A;  4PK3 A;  4KOV A;  4M3S A;  4HKF A;  3PGP A;  4MY3 A;  3FRM A;  1I12 A;  3F8K A;  4AVC A;  2JDC A;  3B8G A;  4GS4 A;  2B3V A;  1YX0 A;  2JLM A;  3EXN A;  1YRE A;  2Z10 A;  2I79 A;  2DXQ A;  2D4O A;  4AG7 A;  1ON0 A;  3SXN A;  2B5G B;  1QSO A;  5F47 A;  4UWI A;  5E96 A;  5F46 A;  4YRH A;  1KUY A;  4XNH B;  4MI4 A;  4M85 A;  2Q7B A;  4DNC A;  1K4J A;  2P0W A;  4JLY A;  4ORF A;  4II9 A;  3S6G A;  3K9U A;  2B3U A;  1IYL A;  2FE7 A;  4R3K A;  5EC4 A;  3TT2 A;  1PUA A;  1VKC A;  2BSW A;  4U9Y A;  3GYA A;  1XIX A;  1Z9U A;  3TOA A;  2G3T A;  4CAV A;  5H86 A;  4KOT A;  1IYK A;  5C88 A;  4QVT A;  5KTA A;  3OWC A;  2ZW6 A;  2QIR A;  3SXO A;  2I00 A;  4L89 A;  3QB8 A;  3IWG A;  2CNS A;  2B58 A;  3R9E A;  2CNM A;  4UA3 A;  1QSN A;  4QUS A;  2Z0Z A;  5J8F A;  4CRY B;  5IX3 A;  2P6F A;  5C82 A;  1YVO A;  2B4B A;  4AB7 A;  2PSW A;  4B5O A;  1BO4 A;  2GAN A;  3TO6 A;  1KUX A;  4KOS A;  1OZP A;  1S60 A;  2FIW A;  5H84 A;  2C27 A;  4JD6 A;  2EUI A;  3CXP A;  4HNW B;  2F5I A;  4JJX A;  4NF1 A;  3IGR A;  3QAH A;  4Y49 C;  3G3S A;  4U9Z A;  1BOB A;  2EVN A;  4KVO E;  4KUA A;  4X5K A;  2OZG A;  4NEX A;  3TCV A;  2FS5 A;  4KVM E;  2Q0Y A;  3DSB A;  2HUZ A;  1R57 A;  2B4D B;  3ZJ0 A;  3S6H A;  3N7Z A;  2D4P A;  1MK4 A;  2FSR A;  4H6Z A;  4R57 A;  1IB1 E;  2J8M A;  2IL4 A;  2P6E A;  4R9M A;  2BL1 A;  3P2H A;  2O28 A;  3W6S A;  2K5T A;  4EVY A;  1WK4 A;  4AVB A;  2G3A A;  1Y9W A;  2B4D A;  2VI7 A;  4JXQ A;  4B5P A;  2RC4 A;  4NCZ A;  3ZZI A;  3I9S A;  4MY0 A;  3VWE A;  4KLW A;  5ISV A;  2WPX A;  3BLN A;  2VZZ A;  3DR6 A;  2JEV A;  4UWJ A;  3LD2 A;  3F0A A;  4CRZ B;  2Q4V A;  3LOD A;  4PV6 A;  1XF8 A;  4ONU A;  1RXT A;  4QC6 A;  5KTD A;  4K30 A;  3BJ8 A;  1M44 A;  3TOB A;  4XPK A;  2A4N A;  4H6U A;  5CNP A;  4KOW A;  2PQ8 A;  1FY7 A;  1Z4E A;  1XMT A;  2Z11 A;  5JQ4 A;  4JXR A;  3R9F A;  4NXY A;  4LX9 A;  4PSW A;  2FL4 A;  4CAX A;  3TE4 A;  4KLV A;  3W6X A;  4NSQ A;  4B5P B;  4XNH C;  4Y49 B;  3JVN A;  4F6A A;  2OZU A;  4E0A A;  2J8N A;  4LUA A;  4PSX A;  1YGH A;  5KTC A;  3MGD A;  3BJ7 A;  1S5K A;  2FT0 A;  2PR8 A;  3T90 A;  2Q44 A;  2WPW A;  2ZXV A;  2R8V A;  3DDD A;  4AG9 A;  2FCK A;  3E0K A;  4IF5 A;  3CXQ A;  1L0C A;  2G0B A;  1SQH A;  3TFY A;  1UFH A;  3PP9 A;  2CNT A;  3EO4 A;  2VEZ A;  2ATR A;  2ARH A;  3FXT A;  3TO7 A;  1QST A;  2FIA A;  2R1I A;  3T9Y A;  4U5Y A;  1M1D A;  2REE A;  4ZBG A;  1CM0 A;  4QB9 A;  4FD5 A;  3F5B A;  2PRB A;  3W91 A;  1PU9 A;  4E2A A;  3C26 A;  4MBU A;  3DR8 A;  4FD7 A;  1RO5 A;  3CXS A;  4RI1 A;  2FXF A;  4I49 A;  5GCN A;  4FD6 A;  4L8A A;  4PK2 A;  4MJ8 A;  3D3S A;  4HNX B;  1YK3 A;  5F49 A;  3RYO A;  1NE9 A;  2VBQ A;  1QSM A;  2REF A;  4R3L A;  4YGO A;  3R9G A;  1NSL A;  3FB3 A;  1KUV A;  3V8I A;  1Y7R A;  1Z4R A;  4R87 A;  4OAD A;  4OLL A;  2Y0M A;  4IUS A;  1S7K A;  2R98 A;  3EFA A;  3FNC A;  2PDO A;  5EBV A;  2VQY A;  2J8R A;  3G8W A;  4BMH A;  1S7L A;  2JDD A;  2VZY A;  1B87 A;  5HH1 A;  3H4Q A;  2Q04 A;  2QEC A;  1I1D A;  1Q2D A;  1U6M A;  1MJA A;  1Q2Y A;  1LRZ A;  1KZF A;  2HV2 A;  4MHD A;  2ZW7 A;  4QBJ A;  3FYN A;  2GE3 A;  4KOX A;  1VHS A;  3D8P A;  3VWD A;  1TIQ A;  5F48 A;  3WR7 A;  1CJW A;  2ZPA A;  4RS2 A;  3DNS A;  3R95 A;  2BUE A;  4CAW A;  4XPD B;  4FD4 A;  5IB0 A;  1GHE A;  1MJB A;  1IID A;  2PR1 A;  5JPH A;  2PC1 A;  1XE4 A;  1QSR A;  2B5G A;  3I3G A;  1XEB A;  1MJ9 A;  5DWN A;  3D2M A;  3PZJ A;  4OAE A;  1S7N A;  2Q4Y A;  3TTH A;  2OU2 A;  2KCW A;  3TO9 A; 
#chains in the Genus database with same CATH topology
 4R6T A;  3GKR A;  4AVA A;  1S3Z A;  3NE8 A;  1N71 A;  3JRU A;  3A9L A;  2BEI A;  2PE3 A;  4KUB A;  4IK2 A;  2G9D A;  5K8O A;  4PXD A;  2CTC A;  1YLE A;  3WT4 A;  4O23 A;  2ZW4 A;  4KVX A;  4UEZ A;  1CPX A;  1S7F A;  1M4I A;  3DGV A;  1TF8 A;  2ZED A;  3EY5 A;  1I21 A;  1WWZ A;  3IWW A;  4F8Z A;  2BOA A;  3D67 A;  1Q2C A;  4B10 A;  1YR0 A;  4J3G A;  5K8M A;  4UF4 A;  3FBU A;  4BD9 A;  4C2Y A;  4EWT A;  1HDQ A;  4F0Y A;  1M4D A;  3D4U A;  4UBR A;  2GIV A;  1V0C A;  4PXB A;  4CS0 B;  2VXK A;  3JUW A;  4KZT A;  1YVK A;  4MFK A;  1AUG A;  3BI1 A;  4E8O A;  3I1U A;  5J8C A;  2PJA A;  3PFO A;  3D2P A;  2O53 A;  4A95 A;  2AJ6 A;  3KZW A;  2NMT A;  1ZO0 A;  4YFJ A;  1B6B A;  3GY9 A;  2PJ8 A;  1IOI A;  2CIJ A;  5DWM A;  4H89 A;  2OZH A;  1Y9K A;  1QQ9 A;  3ISZ A;  1RTQ A;  1TF9 A;  4KOR A;  4KOU A;  1HEE A;  2OB0 A;  1NMT A;  3PB9 X;  1IIC A;  3KKW A;  3K9T A;  4PXC A;  3CPX A;  2H5M A;  1YQE A;  4MHN A;  4XPD C;  1P4N A;  4R7M A;  4NGR A;  2R7H A;  1R43 A;  3NE7 A;  2X7B A;  2CY2 A;  5F09 A;  3VH9 A;  3S9L A;  4GM5 A;  4XPL A;  4PQA A;  5I0C A;  4A33 A;  3SHP A;  3S6F A;  2P6G A;  5HMN A;  4MFJ A;  2C6P A;  3R1K A;  4UCP A;  3R96 A;  5LYD A;  4JWP A;  3UY5 A;  4C2Z A;  3FIX A;  4HNY B;  5IV0 A;  2AE6 A;  2ZW5 A;  1KWM A;  4EME A;  5FVJ A;  3H8E A;  3P2F A;  1J4J A;  4CGL A;  1PCA A;  4F9U A;  4KOY A;  4CYN A;  1M4G A;  3PB7 X;  3B3T A;  4Q38 A;  2HQY A;  2BO9 A;  5HXD A;  1P0H A;  2OH1 A;  3S6K A;  4A37 A;  2CF4 A;  3EC4 A;  2PJ0 A;  5JH9 A;  1NSA A;  1Q7L A;  2QML A;  4NGM A;  4PK3 A;  4KOV A;  4A31 A;  4M3S A;  4MMO A;  2YNC C;  3GUX A;  5HVF A;  4HKF A;  2C6G A;  2ZEO A;  1Z8L A;  3PGP A;  2HC9 A;  4MY3 A;  4NGP A;  4UCN A;  3RAM A;  1YW6 A;  4WWV A;  3FRM A;  1I12 A;  3F8K A;  2ZEH A;  4B6Z A;  4AVC A;  5G20 A;  4W9Y A;  2JDC A;  3IU2 A;  5CPA A;  2WSA A;  3B8G A;  1VGY A;  3B3C A;  1M4L A;  4GS4 A;  3IWE A;  2B3V A;  1YX0 A;  4OID A;  2JLM A;  3EXN A;  4MCS A;  4NGN A;  4R76 A;  2QYV A;  1YRE A;  1Z8X A;  2I79 A;  2Z10 A;  1F2P A;  2DXQ A;  4R8F A;  4TWE A;  3D7G A;  2D4O A;  4AG7 A;  1ON0 A;  3SXN A;  2B5G B;  1QSO A;  2CXA A;  3HUV A;  3KHX A;  5F47 A;  5LYL A;  4UWI A;  4KS9 A;  4FWU A;  4JZ0 A;  2PJ9 A;  2HB6 A;  2PJ1 A;  3VAT A;  4A39 A;  5E96 A;  2V8D A;  5ELY A;  5F46 A;  4MFL A;  1ZG9 A;  4YRH A;  2PRQ A;  1KUY A;  2GLJ A;  4IAV A;  4XNH B;  4MI4 A;  2IQ6 A;  4M85 A;  4UFV A;  2IJZ A;  2Q7B A;  2IMO A;  4MCP A;  4DNC A;  4DYO A;  4Z65 A;  5CBM A;  1K4J A;  3B3W A;  2P0W A;  4TNU A;  5AG5 A;  4JLY A;  4ORF A;  4II9 A;  2Q51 A;  4OP4 A;  4UIB A;  3KAS A;  5JM6 A;  3S6G A;  4LQ6 A;  5HVG A;  1Z8T A;  3K9U A;  3B3V A;  2B3U A;  1IYL A;  2FE7 A;  4R3K A;  5EC4 A;  4BIN A;  3TT2 A;  3TC8 A;  4CYP A;  1PUA A;  1VKC A;  3D7F A;  2BSW A;  4U9Y A;  3GYA A;  1XIX A;  4MFZ A;  1Z9U A;  3TOA A;  2G3T A;  2V77 A;  4G1P A;  4CAV A;  4P4I A;  1Z5R A;  3KQZ A;  5H86 A;  4KOT A;  1IYK A;  5C88 A;  3KR5 A;  4QVT A;  5KTA A;  3OWC A;  4P44 A;  2ZW6 A;  2QIR A;  2GLF A;  3KI9 A;  3SXO A;  4P4E A;  2I00 A;  4KSF A;  4L89 A;  3QB8 A;  1H8L A;  2PJ7 A;  3IWG A;  2CNS A;  4JYW A;  4B11 A;  2B58 A;  3R9E A;  2PIZ A;  3T8W A;  1GYT A;  5I4M A;  2CTB A;  2CNM A;  3GIU A;  1QSN A;  1X12 A;  4UA3 A;  1Z2L A;  4QUS A;  4K3N A;  5BWA B;  2Z0Z A;  1ZG8 A;  2YNE A;  5J8F A;  4CRY B;  5IX3 A;  4NJQ A;  4PPZ A;  4P4F A;  4OC3 A;  1ARM A;  2P6F A;  5G21 A;  5C82 A;  1VHE A;  1YVO A;  2B4B A;  4MFP A;  4AB7 A;  4C68 A;  2PSW A;  4RUH A;  4B5O A;  1YSJ A;  1BO4 A;  1TKJ A;  2GAN A;  1KUX A;  3FJU A;  1OZP A;  1XFO A;  1IY7 A;  3FX6 A;  4KOS A;  4MFQ A;  3SJF A;  1S60 A;  2FIW A;  1ZLH A;  5H84 A;  2C27 A;  4C7I A;  2RB7 A;  4JD6 A;  2EUI A;  3IIB A;  3CXP A;  3NFZ A;  4HNW B;  3S9M A;  4UEF A;  2F5I A;  4JJX A;  3TX8 A;  4NF1 A;  3IGR A;  2ZEL A;  3QAH A;  2Q43 A;  4Y49 C;  4B13 A;  3G3S A;  3IU1 A;  4U9Z A;  1BOB A;  2EVN A;  4A38 A;  3KR4 A;  4KVO E;  4B12 A;  4DJL A;  3N5F A;  4Q7A A;  4KUA A;  5D29 A;  2OR4 A;  2EBJ A;  3NH5 A;  3FF3 A;  2OZG A;  4X5K A;  4NEX A;  1DE4 C;  2I3C A;  3IJ3 A;  4P45 A;  2FS5 A;  4KVM E;  3TCV A;  4CGO A;  2Q0Y A;  1LAM A;  3DSB A;  1CBX A;  2HUZ A;  3CT9 A;  3PB6 X;  3FMC A;  2EK8 A;  5LRG A;  4NFR A;  2AFS A;  3FED A;  3VAR A;  4A94 A;  3SI0 A;  1R57 A;  4OC0 A;  2B4D B;  1QMU A;  3LWU A;  3S6H A;  3N7Z A;  3ZJ0 A;  2D4P A;  6CPA A;  2FSR A;  1MK4 A;  2AFX A;  4H6Z A;  4R57 A;  4FAI A;  1IB1 E;  1F57 A;  3K2K A;  2AFU A;  5J1Q A;  2J8M A;  4P6Y A;  4KSA A;  4PXE A;  2IL4 A;  4HPS A;  2P6E A;  4H2K A;  2XEF A;  3ISX A;  2V8H A;  4R9M A;  2V8G A;  4YWY A;  2OOT A;  2BL1 A;  3FH4 A;  2O28 A;  3IFE A;  3P2H A;  3W6S A;  3D68 A;  2K5T A;  4EVY A;  1TXR A;  2QJ8 A;  1WK4 A;  4AVB A;  2G3A A;  2PJ4 A;  1Y9W A;  2B4D A;  2VI7 A;  2Z3O A;  4JXQ A;  2JEW A;  4B5P A;  1Z8W A;  2RC4 A;  2PVW A;  1VIX A;  3QNV A;  4NCZ A;  4OME A;  3ZZI A;  2AFW A;  3I9S A;  4MY0 A;  4LQG A;  3VWE A;  4ZY1 A;  4KLW A;  5LRJ A;  4M6G A;  5ISV A;  2WPX A;  5LYI A;  1FT7 A;  1Y0Y A;  1YME A;  3BLN A;  4KSI A;  2VZZ A;  2GRE A;  2ABZ A;  3DR6 A;  4CAF A;  2AFM A;  2JEV A;  2F7V A;  4UWJ A;  3LD2 A;  3F0A A;  4NGS A;  4CRZ B;  2Q4V A;  3LOD A;  4OC5 A;  4PV6 A;  3QAY A;  4P10 A;  2AFZ A;  1XF8 A;  4ONU A;  1RXT A;  1XRY A;  2V8V A;  2YND A;  4FUU A;  4QC6 A;  5KTD A;  4K30 A;  1ELM P;  3CPA A;  3BJ8 A;  4A2Z A;  1M44 A;  3TOB A;  1LAP A;  4XPK A;  2A4N A;  3D7H A;  4H6U A;  3FVL A;  5CNP A;  4KOW A;  4OC4 A;  4CPA A;  2DPT A;  4MHZ A;  3SJG A;  1FNO A;  2PQ8 A;  1FY7 A;  3PBB A;  1XJO A;  3RBU A;  3TO6 A;  3MRU A;  1PYT B;  3IEH A;  3RO0 A;  3RNZ A;  1Z4E A;  1XMT A;  4UIA A;  2Z11 A;  4F9V A;  3WC7 A;  2PJ5 A;  4P4J A;  5JQ4 A;  3PFE A;  4JXR A;  3R9F A;  4ZGY B;  1CP7 A;  4NXY A;  2J9A A;  1AMP A;  4LX9 A;  4UEE A;  4PSW A;  3KHZ A;  2ZEM A;  2BCO A;  2FL4 A;  4CAX A;  3PEI A;  3LMS A;  1EE3 P;  2PJC A;  3NH8 A;  3SI2 A;  2JBJ A;  4KLV A;  4MCR A;  4CYQ A;  1TKF A;  2PVV A;  1LAN A;  4MHP A;  1LOK A;  5HVH A;  1UWY A;  1XBU A;  4NSQ A;  3W6X A;  4B5P B;  4XNH C;  3JTK A;  4Y49 B;  3JVN A;  5LRK A;  4F6A A;  2WUU A;  2OZU A;  3PB8 X;  4MXU A;  4E0A A;  2J8N A;  4LUA A;  4PSX A;  1YGH A;  4DUK A;  5KTC A;  3MGD A;  3BJ7 A;  1S5K A;  2Z3P A;  2FT0 A;  1YW4 A;  2PCU A;  2PR8 A;  3T90 A;  1DTD A;  2Q44 A;  2VL1 A;  2WPW A;  2R8V A;  2XEJ A;  2ZXV A;  4ZY0 A;  1XMB A;  2QVP A;  3DDD A;  4X2T A;  2PJ6 A;  4AG9 A;  5LYF A;  2FCK A;  5K8N A;  1ELL P;  3E0K A;  1JWQ A;  4IF5 A;  2RFH A;  3CXQ A;  2POK A;  1L0C A;  1CG2 A;  2G0B A;  1SQH A;  3TFY A;  2GU2 A;  4A30 A;  3HLP A;  4MHY A;  2F8H A;  1UFH A;  3PP9 A;  4OKO A;  2CNT A;  3EO4 A;  2VEZ A;  2ATR A;  2ARH A;  4MCQ A;  3FXT A;  3TO7 A;  1QST A;  2FIA A;  2PIY A;  2R1I A;  3T9Y A;  2ZEG A;  3KL9 A;  4NGQ A;  3WC6 A;  2ZOF A;  4F0X A;  4GXH A;  5D8N A;  5AGE A;  3H8G A;  2C1C A;  3TE4 A;  3RZA A;  4U5Y A;  4OC2 A;  1M1D A;  2REE A;  4ZBG A;  1CM0 A;  4ZX8 A;  4QB9 A;  4ZYQ A;  2XEI A;  4ONW A;  3D66 A;  4FD5 A;  3F5B A;  3WC5 A;  2PRB A;  3V7Z A;  3W91 A;  1PU9 A;  4E2A A;  4EFD A;  1IGB A;  3C26 A;  4CYO A;  4ZY2 A;  2WYR A;  4NGT A;  4MBU A;  2ZOG A;  3D7D A;  3DR8 A;  7CPA A;  1LCP A;  4FD7 A;  1RO5 A;  3CXS A;  3DLJ A;  4RI1 A;  2FXF A;  1ZG7 A;  4I49 A;  5GCN A;  2Z3K A;  2ZEP A;  4FD6 A;  1IOF A;  4L8A A;  4PK2 A;  2EK9 A;  1IU8 A;  4AXV A;  1AYE A;  4MRI A;  1OBR A;  3B7I A;  2EO8 A;  3D3S A;  4HNX B;  4MJ8 A;  4OC1 A;  1YK3 A;  4CAE A;  5F49 A;  3IC1 A;  3RYO A;  2Z3L A;  4RN7 A;  1Y0R A;  1NE9 A;  2VBQ A;  1QSM A;  4P4B A;  2REF A;  3FEC A;  4OIW A;  4YU9 A;  4R3L A;  4YGO A;  3FEE A;  2WZN A;  3R9G A;  1NSL A;  3FB3 A;  2ZEE A;  1KUV A;  4CGM A;  5IB9 A;  5G1Z A;  3V8I A;  1CX8 A;  1Y7R A;  1Z4R A;  4R87 A;  4OAD A;  5JGF A;  4OLL A;  2Y0M A;  5THW A;  2PJB A;  3BXM A;  3WAB A;  2YGW A;  1TKH A;  4Q36 A;  4IUS A;  1CP6 A;  1S7K A;  2R98 A;  3MN8 A;  4M6I A;  5A27 A;  4IHM A;  3PRT A;  3EFA A;  3GB0 A;  3FNC A;  2PDO A;  5EBV A;  2VQY A;  3KQX A;  3NA6 A;  3PBE A;  2J8R A;  3G8W A;  2O4H A;  4X3R A;  4BMH A;  1S7L A;  5DS0 A;  2JDD A;  3L2N A;  2VZY A;  5AG6 A;  2ZEF A;  1B87 A;  5HH1 A;  3H4Q A;  2Q04 A;  4UFW A;  1BPM A;  2QEC A;  1ZLI A;  3H5Z A;  1I1D A;  2C6C A;  1LFW A;  2FVG A;  1A2Z A;  1Q2D A;  5AG7 A;  1U6M A;  1MJA A;  1Q2Y A;  2Q4Z A;  2YNC A;  2EWB A;  1LRZ A;  1KZF A;  4CGN A;  3IO1 A;  2HV2 A;  2PJ2 A;  3V38 A;  4CGP A;  3LAC A;  4MHD A;  2ZW7 A;  4QBJ A;  3FYN A;  3SJX A;  3GLJ A;  4NJR A;  2GFQ A;  2Z3M A;  5K8P A;  2GE3 A;  2DF5 A;  4KOX A;  1VHS A;  2ZEN A;  3D8P A;  1TIQ A;  3VWD A;  2DPS A;  5F48 A;  4ZI6 A;  4BBH A;  5A28 A;  1BLL E;  1JQG A;  4WJB A;  1CJW A;  1CPS A;  1VHO A;  4UFX A;  1F2O A;  2Z3N A;  3WR7 A;  2Q7S A;  4C2X A;  2ZPA A;  3PB4 X;  3B3S A;  2NYQ A;  4RS2 A;  3DNS A;  2AFO A;  3R95 A;  1X10 A;  3NH4 A;  2BUE A;  1YLO A;  2JBK A;  4XPD B;  4FD4 A;  3KGQ A;  4CAW A;  4M6H A;  3H8F A;  4B14 A;  8CPA A;  5IB0 A;  1GHE A;  1MJB A;  3SI1 A;  1IID A;  2PR1 A;  3B2Y A;  5JPH A;  4UCM A;  1XOV A;  3CDX A;  2PC1 A;  1BAV A;  1QSR A;  1XE4 A;  2B5G A;  3I3G A;  4A32 A;  2DEA A;  3BHX A;  4ZX9 A;  5AG4 A;  1ARL A;  1XEB A;  1MJ9 A;  2PJ3 A;  5DWN A;  1Y7E A;  1R3N A;  3D2M A;  3SJE A;  3PZJ A;  4OAE A;  4C7H A;  4FBE A;  5EMI A;  1S7N A;  2NSM A;  3B35 A;  2Q4Y A;  3TTH A;  2OU2 A;  3CZX A;  4X8I A;  2KCW A;  2ODF A;  3BI0 A;  5G22 A;  4P4D A;  3S9N A;  1HDU A;  3TO9 A;  1BPN A;  2XEG A;  2ANP A; 
#chains in the Genus database with same CATH homology
 3GKR A;  4AVA A;  1S3Z A;  1N71 A;  3A9L A;  2BEI A;  4KUB A;  1YLE A;  2ZW4 A;  4KVX A;  1S7F A;  1M4I A;  3EY5 A;  1I21 A;  1WWZ A;  1Q2C A;  4B10 A;  1YR0 A;  4J3G A;  3FBU A;  4C2Y A;  4F0Y A;  1M4D A;  4UBR A;  2GIV A;  1V0C A;  4CS0 B;  2VXK A;  3JUW A;  4KZT A;  1YVK A;  4MFK A;  5J8C A;  4E8O A;  3D2P A;  4A95 A;  2AJ6 A;  2NMT A;  1ZO0 A;  4YFJ A;  1B6B A;  3GY9 A;  5DWM A;  4H89 A;  2OZH A;  1Y9K A;  4KOR A;  4KOU A;  2OB0 A;  1NMT A;  1IIC A;  3KKW A;  2H5M A;  4XPD C;  1P4N A;  2R7H A;  3NE7 A;  2X7B A;  2CY2 A;  5I0C A;  4XPL A;  4A33 A;  3SHP A;  3S6F A;  2P6G A;  5HMN A;  4MFJ A;  3R1K A;  4UCP A;  3R96 A;  4JWP A;  3UY5 A;  4C2Z A;  3FIX A;  4HNY B;  5IV0 A;  2AE6 A;  2ZW5 A;  5FVJ A;  3P2F A;  1J4J A;  4CGL A;  4KOY A;  4CYN A;  1M4G A;  4Q38 A;  2HQY A;  1P0H A;  2OH1 A;  3S6K A;  3EC4 A;  2QML A;  4PK3 A;  4KOV A;  4A31 A;  4M3S A;  2YNC C;  4HKF A;  3PGP A;  4MY3 A;  4UCN A;  3FRM A;  1I12 A;  3F8K A;  4AVC A;  5G20 A;  2JDC A;  3IU2 A;  2WSA A;  3B8G A;  4GS4 A;  3IWE A;  2B3V A;  1YX0 A;  2JLM A;  3EXN A;  1YRE A;  2Z10 A;  2I79 A;  2DXQ A;  2D4O A;  4AG7 A;  1ON0 A;  3SXN A;  2B5G B;  1QSO A;  2CXA A;  5F47 A;  4UWI A;  4KS9 A;  5E96 A;  5F46 A;  4MFL A;  4YRH A;  1KUY A;  4XNH B;  4MI4 A;  4M85 A;  4UFV A;  2Q7B A;  4DNC A;  1K4J A;  2P0W A;  5AG5 A;  4JLY A;  4ORF A;  4II9 A;  3S6G A;  3K9U A;  2B3U A;  1IYL A;  2FE7 A;  4R3K A;  5EC4 A;  3TT2 A;  4CYP A;  1PUA A;  1VKC A;  2BSW A;  4U9Y A;  3GYA A;  1XIX A;  4MFZ A;  1Z9U A;  3TOA A;  2G3T A;  4CAV A;  5H86 A;  4KOT A;  1IYK A;  5C88 A;  4QVT A;  5KTA A;  3OWC A;  2ZW6 A;  2QIR A;  3SXO A;  2I00 A;  4KSF A;  4L89 A;  3QB8 A;  3IWG A;  4B11 A;  2CNS A;  2B58 A;  3R9E A;  2CNM A;  4UA3 A;  1QSN A;  4QUS A;  5BWA B;  2Z0Z A;  2YNE A;  5J8F A;  4CRY B;  5IX3 A;  2P6F A;  5C82 A;  5G21 A;  1YVO A;  2B4B A;  4MFP A;  4AB7 A;  4C68 A;  2PSW A;  4B5O A;  1BO4 A;  2GAN A;  4MFQ A;  1KUX A;  4KOS A;  1OZP A;  3TO6 A;  1S60 A;  2FIW A;  5H84 A;  2C27 A;  4C7I A;  4JD6 A;  2EUI A;  3CXP A;  4HNW B;  2F5I A;  4JJX A;  4NF1 A;  3IGR A;  3QAH A;  4Y49 C;  4B13 A;  3G3S A;  3IU1 A;  4U9Z A;  1BOB A;  2EVN A;  4KVO E;  4B12 A;  4KUA A;  4X5K A;  2OZG A;  4NEX A;  3TCV A;  2FS5 A;  4KVM E;  4CGO A;  2Q0Y A;  3DSB A;  2HUZ A;  1R57 A;  2B4D B;  3ZJ0 A;  3S6H A;  3N7Z A;  2D4P A;  1MK4 A;  2FSR A;  4H6Z A;  4R57 A;  1IB1 E;  2J8M A;  4KSA A;  2IL4 A;  2P6E A;  4R9M A;  4A32 A;  2BL1 A;  3P2H A;  2O28 A;  3W6S A;  2K5T A;  4EVY A;  1WK4 A;  4AVB A;  2G3A A;  1Y9W A;  2B4D A;  2VI7 A;  2Z3O A;  4JXQ A;  4B5P A;  2RC4 A;  4NCZ A;  3ZZI A;  3I9S A;  4MY0 A;  3VWE A;  4KLW A;  5ISV A;  2WPX A;  3BLN A;  2VZZ A;  3DR6 A;  4CAF A;  2JEV A;  4UWJ A;  3LD2 A;  3F0A A;  4CRZ B;  2Q4V A;  3LOD A;  4PV6 A;  1XF8 A;  4ONU A;  1RXT A;  2YND A;  4QC6 A;  5KTD A;  4K30 A;  3BJ8 A;  4A2Z A;  1M44 A;  3TOB A;  4XPK A;  2A4N A;  4H6U A;  5CNP A;  4KOW A;  2DPT A;  2PQ8 A;  1FY7 A;  1Z4E A;  1XMT A;  2Z11 A;  5JQ4 A;  4JXR A;  3R9F A;  4ZGY B;  4NXY A;  4LX9 A;  4PSW A;  2FL4 A;  4CAX A;  3TE4 A;  4CYQ A;  4KLV A;  3W6X A;  4NSQ A;  4B5P B;  4XNH C;  3JTK A;  4Y49 B;  3JVN A;  4F6A A;  2WUU A;  2OZU A;  4E0A A;  2J8N A;  4LUA A;  4PSX A;  1YGH A;  5KTC A;  3MGD A;  3BJ7 A;  1S5K A;  2Z3P A;  2FT0 A;  2PR8 A;  3T90 A;  2Q44 A;  2WPW A;  2ZXV A;  2R8V A;  3DDD A;  4AG9 A;  2FCK A;  3E0K A;  4IF5 A;  3CXQ A;  1L0C A;  2G0B A;  1SQH A;  3TFY A;  4A30 A;  1UFH A;  3PP9 A;  2CNT A;  3EO4 A;  2VEZ A;  2ATR A;  2ARH A;  3FXT A;  3TO7 A;  1QST A;  2FIA A;  2R1I A;  3T9Y A;  4F0X A;  5AGE A;  4U5Y A;  1M1D A;  2REE A;  4ZBG A;  1CM0 A;  4QB9 A;  4FD5 A;  3F5B A;  2PRB A;  3W91 A;  1PU9 A;  4E2A A;  3C26 A;  4CYO A;  4MBU A;  3DR8 A;  4FD7 A;  1RO5 A;  3CXS A;  4RI1 A;  2FXF A;  4I49 A;  5GCN A;  2Z3K A;  4FD6 A;  4L8A A;  4PK2 A;  4MJ8 A;  3D3S A;  4HNX B;  4CAE A;  1YK3 A;  5F49 A;  3RYO A;  2Z3L A;  1NE9 A;  2VBQ A;  1QSM A;  2REF A;  4R3L A;  4YGO A;  3R9G A;  1NSL A;  3FB3 A;  1KUV A;  4CGM A;  5G1Z A;  3V8I A;  1Y7R A;  1Z4R A;  4R87 A;  4OAD A;  4OLL A;  2Y0M A;  2YGW A;  4Q36 A;  4IUS A;  1S7K A;  2R98 A;  5A27 A;  3EFA A;  3FNC A;  2PDO A;  5EBV A;  2VQY A;  2J8R A;  3G8W A;  4BMH A;  1S7L A;  2JDD A;  2VZY A;  5AG6 A;  1B87 A;  5HH1 A;  3H4Q A;  2Q04 A;  4UFW A;  2QEC A;  3H5Z A;  1I1D A;  5AG7 A;  1Q2D A;  1U6M A;  1MJA A;  1Q2Y A;  2YNC A;  4CGN A;  1LRZ A;  1KZF A;  2HV2 A;  4CGP A;  4MHD A;  2ZW7 A;  4QBJ A;  3FYN A;  2Z3M A;  2GE3 A;  4KOX A;  1VHS A;  3D8P A;  3VWD A;  1TIQ A;  2DPS A;  5F48 A;  4BBH A;  5A28 A;  3WR7 A;  1CJW A;  4UFX A;  2Z3N A;  4C2X A;  2ZPA A;  4RS2 A;  3DNS A;  3R95 A;  2BUE A;  4CAW A;  4XPD B;  4FD4 A;  4B14 A;  5IB0 A;  1GHE A;  1MJB A;  1IID A;  2PR1 A;  5JPH A;  4UCM A;  2PC1 A;  1XE4 A;  1QSR A;  2B5G A;  3I3G A;  5AG4 A;  1XEB A;  1MJ9 A;  5DWN A;  3D2M A;  4C7H A;  3PZJ A;  4OAE A;  1S7N A;  2Q4Y A;  3TTH A;  2OU2 A;  2KCW A;  5G22 A;  3TO9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...