3EXNA

Crystal structure of acetyltransferase from thermus thermophilus hb8
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
154
structure length
154
Chain Sequence
MHVLTLDLAPVTPKDAPLLHRVFHLSPSYFALIGMELPTLEDVVRDLQTLEVDPRRRAFLLFLGQEPVGYLDAKLGYPEAEDATLSLLLIREDHQGRGLGRQALERFAAGLDGVRRLYAVVYGHNPKAKAFFQAQGFRYVKDGGPTLTWYVRPL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Probable acetyltransferase
publication title Crystal structure of acetyltransferase from Thermus thermophilus HB8
rcsb
source organism Thermus thermophilus
total genus 44
structure length 154
sequence length 154
ec nomenclature
pdb deposition date 2008-10-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 3exnA00
1XIXA 4UA3A 3T90A 2AE6A 1YVKA 3VWDA 3H4QA 4QC6A 1K4JA 2X7BA 2Q04A 2Z10A 1YLEA 1MJ9A 2VQYA 4L8AA 3TOBA 4BMHA 4JD6A 4YFJA 2PSWA 5E96A 4OAEA 1IB1E 1P0HA 2BUEA 3EO4A 2OH1A 1Q2CA 3TO6A 1XE4A 4XPLA 4R87A 1N71A 4ORFA 2VZYA 3S6KA 3TT2A 2VZZA 1S3ZA 4RI1A 2B3VA 2F5IA 1S7LA 1MJAA 4MY3A 4PK3A 5F48A 2I00A 4R57A 5EC4A 4H6ZA 4QBJA 4XPKA 3K9UA 2B4DB 4U9YA 4RS2A 2Q4YA 5DWMA 5IB0A 2Z11A 4R9MA 4KLWA 4E2AA 1J4JA 3VWEA 1LRZA 3FXTA 1M4IA 1KUYA 4FD4A 3JVNA 3LD2A 3T9YA 3DSBA 3W6XA 2FIAA 2Q7BA 3S6HA 4CRYB 2WPWA 5F47A 2FL4A 4FD6A 3PGPA 2J8MA 1QSNA 2FS5A 5C82A 4DNCA 4GS4A 5IV0A 4H6UA 5HH1A 5JPHA 2OZGA 4R3KA 3EC4A 1S7KA 4IUSA 4XNHC 3TO7A 2Y0MA 3TOAA 2P6FA 1Z4EA 2OZUA 3QB8A 4CAVA 1KUVA 1L0CA 3JUWA 1PUAA 1S7FA 2CY2A 1Z4RA 3F0AA 1Q2DA 4NF1A 4PSXA 3R9GA 1FY7A 2P6GA 5H86A 2R7HA 1IYKA 3NE7A 3DR6A 4L89A 4UWIA 3FNCA 2OB0A 4KOSA 4JXRA 3TCVA 5KTCA 4EVYA 3CXQA 4AVAA 4ONUA 5F49A 2FSRA 3GYAA 2HUZA 4AB7A 4OLLA 3D2MA 2ZPAA 5F46A 4KUBA 4NSQA 2FT0A 4CRZB 1S7NA 2PRBA 1M1DA 4B5OA 3TFYA 1IIDA 2PDOA 4H89A 1BO4A 1RO5A 2IL4A 2REFA 2FCKA 4Y49B 4MY0A 3BJ7A 4B5PA 2B4DA 2C27A 4HNWB 3WR7A 2O28A 2Q44A 3D2PA 1M4DA 5I0CA 1VHSA 3DDDA 3TE4A 3ZZIA 2EUIA 2A4NA 1P4NA 3MGDA 2QMLA 3W6SA 4AVCA 5HMNA 1YVOA 3KKWA 2PC1A 2QIRA 2Z0ZA 2PR1A 2B5GA 4PK2A 3V8IA 4MHDA 3I3GA 4I49A 2FE7A 3C26A 1Z9UA 1YGHA 5CNPA 3GKRA 1IYLA 1UFHA 2EVNA 2R1IA 2FIWA 3W91A 1GHEA 1S5KA 4CS0B 1PU9A 2ZW5A 2ATRA 4LX9A 4XPDB 1BOBA 4QVTA 3LODA 2G3TA 3IGRA 1MJBA 1Y9KA 2K5TA 2G0BA 1U6MA 2CNMA 2DXQA 3CXSA 4JLYA 2WPXA 2KCWA 2RC4A 4U9ZA 1MK4A 3G8WA 4HNXB 3N7ZA 3BLNA 4KOWA 4K30A 4LUAA 1Q2YA 5C88A 3FB3A 2QECA 4HKFA 1QSMA 2JLMA 1Y7RA 2GE3A 5GCNA 4F0YA 2P0WA 2NMTA 4IF5A 1VKCA 3EXNA 3F5BA 3TO9A 2OU2A 1B87A 2R8VA 3P2FA 4PV6A 3EY5A 4II9A 3PZJA 4J3GA 2Q4VA 2ZXVA 1XF8A 4R3LA 1NE9A 3CXPA 2ZW7A 2AJ6A 4FD7A 2B3UA 4KORA 4ZBGA 3B8GA 1WWZA 1NSLA 4KZTA 4MBUA 4AVBA 4PSWA 3D8PA 3R9EA 1S60A 1NMTA 2J8NA 1YR0A 3FIXA 2B58A 3R95A 3R9FA 2B4BA 1RXTA 4E8OA 3P2HA 4F6AA 2PQ8A 4KVME 5JQ4A 2VXKA 5H84A 1CJWA 3D3SA 4KOUA 4KOTA 5ISVA 4AG7A 4XNHB 1YX0A 3I9SA 5DWNA 1I12A 1XMTA 3OWCA 4FD5A 2BL1A 2BSWA 4XPDC 4E0AA 3E0KA 3SHPA 2J8RA 2HQYA 3FYNA 2ZW6A 4UWJA 4CAXA 1QSRA 1I21A 3F8KA 2ARHA 1QSOA 2Q0YA 3SXNA 4HNYB 2I79A 5IX3A 4YRHA 2OZHA 3TTHA 1V0CA 1Y9WA 4QUSA 2VBQA 3BJ8A 1QSTA 1TIQA 4KOXA 4M3SA 4B5PB 4UBRA 2HV2A 3PP9A 3R1KA 2JDDA 4KLVA 1KUXA 1YREA 2H5MA 3S6FA 2PR8A 4AG9A 2D4OA 2REEA 4KVXA 1SQHA 1YK3A 1B6BA 4MI4A 4MJ8A 4KUAA 4KOYA 2FXFA 4JJXA 4NCZA 4X5KA 4YGOA 2G3AA 2B5GB 4M85A 5KTDA 2VI7A 5J8FA 2GIVA 4U5YA 3ZJ0A 5KTAA 4OADA 3DR8A 4KVOE 1IICA 3QAHA 1ON0A 1KZFA 5EBVA 5J8CA 3FRMA 3R96A 1CM0A 3DNSA 4Y49C 1WK4A 3S6GA 2VEZA 1OZPA 1M4GA 3EFAA 3GY9A 4CAWA 4JXQA 4JWPA 2JDCA 2R98A 2BEIA 4QB9A 1I1DA 2JEVA 2D4PA 4KOVA 3SXOA 1M44A 1XEBA 3IWGA 2P6EA 5FVJA 2CNSA 3G3SA 1R57A 2CNTA 4NEXA 3RYOA 4NXYA 3FBUA 2ZW4A 2GANA 3UY5A
chains in the Genus database with same CATH superfamily
3KI9A 3PB4X 1XIXA 1VGYA 1ZLHA 3KQXA 1ELLP 2ZENA 4UA3A 3D7DA 1PCAA 1Y0YA 3PB7X 2ZOFA 4R8FA 4W9YA 3T90A 2PIYA 2AE6A 1IU8A 1YVKA 3VWDA 4CGOA 4M6IA 2J9AA 1X12A 4KSAA 5THWA 4MFZA 3B35A 3H4QA 4QC6A 4ZY2A 1K4JA 2X7BA 2Q04A 2Z10A 1YLEA 3PEIA 1MJ9A 2VQYA 4L8AA 1Z8WA 2GLJA 3TOBA 4BMHA 1Y7EA 4JD6A 4YFJA 2PSWA 5E96A 4A2ZA 4EFDA 4OAEA 1IB1E 5G1ZA 2C6CA 2EK9A 1P0HA 4MHPA 2CXAA 3DGVA 2BUEA 3EO4A 1TXRA 1H8LA 1TKJA 2I3CA 3KZWA 2OH1A 1Q2CA 3TO6A 1XE4A 5EMIA 1HDUA 2Z3KA 4CGMA 3IWWA 2Q7SA 4XPLA 3JRUA 4R87A 1N71A 4ZY0A 2V8GA 4ORFA 4EWTA 2VZYA 3S6KA 1YW4A 3TT2A 2VZZA 1S3ZA 3GB0A 4RI1A 4NGMA 2B3VA 1QMUA 2F5IA 3WC6A 1LCPA 2BOAA 1S7LA 1XBUA 1MJAA 4MY3A 2WZNA 4PK3A 2XEGA 5F48A 2I00A 4R57A 1HDQA 2CIJA 2PJBA 2YNDA 3IU1A 4ONWA 5EC4A 5HVHA 1DTDA 1YW6A 4OP4A 4H6ZA 4KS9A 5J1QA 4QBJA 4XPKA 3K9UA 2PCUA 2B4DB 2O4HA 1IY7A 1XOVA 4U9YA 4RS2A 2Z3LA 2Q4YA 4NJQA 5DWMA 4C2XA 5IB0A 3BI0A 2CF4A 2YNEA 2DF5A 2Z11A 4R9MA 3KR4A 2AFSA 4KLWA 4C68A 3FX6A 3PBEA 4PXBA 4AXVA 4LQ6A 4YU9A 4E2AA 4JYWA 2PJCA 1J4JA 1GYTA 3NH4A 5A28A 3VWEA 1LRZA 3FXTA 2Z3PA 1M4IA 1BPNA 4P4EA 1KUYA 4FD4A 4ZI6A 4MCRA 2QVPA 3JVNA 4UIBA 4P45A 3WC7A 1X10A 3LD2A 2PE3A 3T9YA 2GFQA 3DSBA 3W6XA 2ZEFA 4GXHA 2FIAA 2Q7BA 1Z8XA 4IHMA 3S6HA 1ZO0A 3B2YA 4CRYB 2WPWA 5F47A 4CYPA 3RZAA 2FL4A 3IJ3A 4FD6A 3PGPA 4P44A 5G20A 2J8MA 1QSNA 3IWEA 2GU2A 2PJ0A 2FS5A 4GM5A 4OC5A 4A38A 4DNCA 4F9UA 5C82A 4JZ0A 1BPMA 1XMBA 3D4UA 3SJGA 4GS4A 4B10A 2F8HA 5IV0A 4DUKA 2PJAA 4MCQA 2PJ8A 5F09A 4H6UA 1XJOA 3K9TA 5DS0A 2OZGA 4Q38A 5HH1A 4C7IA 5JPHA 3SJFA 3RO0A 2Q51A 4R3KA 3EC4A 3SI2A 1S7KA 3MN8A 4IUSA 4XNHC 3TO7A 3S9LA 4P6YA 2Y0MA 4UCPA 4O23A 2P6FA 3TOAA 1Z4EA 2OZUA 1UWYA 3QB8A 5G21A 3VATA 4C2ZA 1CX8A 4CAVA 3S9MA 3WT4A 1KUVA 1L0CA 3B3CA 3JUWA 1PUAA 1S7FA 2CY2A 3ISXA 1Z4RA 1Z5RA 5D29A 3KASA 3F0AA 1F2OA 3KR5A 3HUVA 1Q2DA 4NF1A 4BD9A 2PRQA 4PSXA 5JH9A 3R9GA 1FY7A 2P6GA 5H86A 1XRYA 3D68A 2R7HA 4MFQA 8CPAA 2OR4A 4FBEA 4G1PA 1IYKA 3NE7A 4DYOA 4MHZA 3DR6A 2AFZA 5K8OA 3GUXA 4L89A 4UWIA 2ZEEA 4X3RA 3B3VA 3FNCA 4YWYA 4P4FA 3GIUA 2OB0A 4A39A 4CYQA 4KOSA 4JXRA 2QJ8A 3TCVA 5KTCA 4EVYA 3CXQA 4AVAA 3H5ZA 3PRTA 2AFXA 1IOIA 4ONUA 5F49A 4HPSA 5HVFA 4TNUA 4CPAA 2PJ6A 2FSRA 3GYAA 4UF4A 2HUZA 4X2TA 3RBUA 4ZYQA 4OKOA 4AB7A 4OLLA 3D2MA 3KQZA 4UEZA 2ZPAA 4M6HA 2VL1A 5F46A 3RNZA 4CGPA 4F9VA 3D7FA 4KUBA 1BLLE 4NSQA 2FT0A 3D66A 2ZEGA 1VIXA 1S7NA 1TF8A 4UEEA 4CRZB 2PRBA 3NE8A 2ZELA 3RAMA 1M1DA 3WABA 4B5OA 3TFYA 1IIDA 2PDOA 4H89A 2HB6A 2GREA 4A94A 3GLJA 4MMOA 2WYRA 1BO4A 2Z3NA 4NJRA 4A37A 2V8HA 4CAFA 1RO5A 3H8GA 5ELYA 3VH9A 2IL4A 2REFA 4P4DA 4P4JA 5BWAB 2JEWA 1JWQA 2FCKA 4Y49B 4B13A 1ARLA 4MY0A 1Y0RA 3BJ7A 4C2YA 4B5PA 3FH4A 2B4DA 4ZGYB 1ELMP 5K8PA 2C27A 4HNWB 3SJXA 2ZEPA 3WR7A 2O28A 2Q44A 2F7VA 3SI0A 1PYTB 3D2PA 1ZG9A 3WC5A 1M4DA 5I0CA 1VHSA 4B14A 1XFOA 3DDDA 5G22A 3TE4A 3ZZIA 3QAYA 2EUIA 3PFEA 2A4NA 1P4NA 4KSFA 3MGDA 2BCOA 2QMLA 5LYIA 1IGBA 3W6SA 4AVCA 5HMNA 4A95A 1YVOA 3NH8A 4MFPA 3KKWA 2PC1A 2V8VA 3JTKA 1AMPA 2EK8A 2QIRA 2WUUA 3IFEA 2ZEHA 2Z0ZA 2PR1A 5HXDA 2B5GA 4NGRA 4FWUA 2PJ4A 4PK2A 3V8IA 4MHDA 4Z65A 3I3GA 1YQEA 4I49A 2FE7A 3C26A 4F0XA 1Z8LA 2POKA 1Z9UA 1LAPA 1YGHA 3GKRA 5CNPA 1IYLA 2JBJA 3B3SA 4NGQA 3H8EA 4MHNA 1KWMA 4R7MA 1UFHA 4OC0A 2EVNA 2FIWA 2R1IA 1LOKA 1GHEA 3W91A 1S5KA 4CS0B 2PVVA 1PU9A 4PXDA 2ZW5A 2ATRA 2ANPA 2ODFA 3FECA 4LX9A 1BOBA 4QVTA 4XPDB 2OOTA 1M4LA 2ZEDA 2DPTA 4UFXA 3LODA 2G3TA 3IGRA 1MJBA 4IAVA 1Y9KA 5LYLA 2K5TA 4Q36A 2G0BA 2ZEMA 1U6MA 2CNMA 2PJ5A 2DXQA 3CXSA 4PXCA 4JLYA 2WPXA 3PB8X 2AFUA 2KCWA 2RFHA 4MCSA 2RC4A 4U9ZA 1MK4A 2DEAA 3G8WA 4HNXB 1EE3P 3N7ZA 3HLPA 3B3TA 3BLNA 2IJZA 2XEFA 1IOFA 3KL9A 3LMSA 4KOWA 1CBXA 1CP6A 4K30A 2PJ3A 4LUAA 5D8NA 1R3NA 1Q2YA 4MFJA 5C88A 3FB3A 1JQGA 2QECA 4HKFA 3PBBA 4PPZA 1QSMA 2EO8A 2JLMA 1Y7RA 3FEEA 4CYNA 2GE3A 5GCNA 4F0YA 2P0WA 2NMTA 3CZXA 1RTQA 4IF5A 1VKCA 3EXNA 4EMEA 4CYOA 3F5BA 3TO9A 2OU2A 2C1CA 1B87A 1FT7A 2R8VA 3P2FA 3EY5A 3BI1A 4PV6A 3TC8A 4II9A 3PZJA 4OC1A 4J3GA 5LRGA 2Q4VA 4Q7AA 4UIAA 2WSAA 4MCPA 2ZXVA 1CPSA 1XF8A 4R3LA 1NE9A 3CXPA 5IB9A 3IC1A 3N5FA 3K2KA 2ZW7A 2AJ6A 3S9NA 4FD7A 2B3UA 4KORA 3FVLA 3CPAA 4M6GA 4ZBGA 5K8NA 2Q4ZA 3B8GA 3CDXA 1WWZA 1NSLA 4MFLA 1ARMA 4KZTA 2YGWA 4MBUA 4AVBA 4PSWA 3D8PA 3R9EA 1S60A 2C6GA 4DJLA 2J8NA 1NMTA 5I4MA 1LFWA 2CTCA 3CPXA 4ZX9A 1TF9A 5LRJA 3FEDA 1YR0A 1Z8TA 4MRIA 1CG2A 3FIXA 4B11A 2B58A 3IU2A 2O53A 3R95A 2GLFA 3R9FA 7CPAA 4FAIA 2Z3OA 2PJ1A 2IMOA 4ZY1A 3A9LA 3FJUA 2B4BA 4FUUA 1RXTA 2AFOA 4E8OA 3P2HA 1Z2LA 4F6AA 2PQ8A 4KVME 5JQ4A 2VXKA 4CGLA 5H84A 3TX8A 5JM6A 1CJWA 2YNCA 4X8IA 3D3SA 4KOUA 1F57A 4WWVA 5AGEA 4KSIA 4KOTA 5ISVA 3LACA 3QNVA 4AG7A 3IIBA 2EWBA 4XNHB 1YMEA 1YX0A 3I9SA 5DWNA 3PB6X 1TKFA 1I12A 1XMTA 2G9DA 3B3WA 3OWCA 2XEJA 4FD5A 2XEIA 2BL1A 2BSWA 4XPDC 4E0AA 3E0KA 4MFKA 4P4BA 2NYQA 1FNOA 3LWUA 3SHPA 2J8RA 1F2PA 2DPSA 2HQYA 2ZW6A 3FYNA 4UWJA 1OBRA 1QSRA 4CAXA 4P4IA 2PJ7A 2V8DA 1I21A 3F8KA 2HC9A 3FF3A 2ARHA 1QSOA 2Q0YA 3PFOA 4OIWA 1CPXA 2C6PA 3SXNA 4ZX8A 4NFRA 3CT9A 3IEHA 4HNYB 2I79A 4OC4A 4BBHA 1ZLIA 4YRHA 5IX3A 2V77A 2OZHA 2CTBA 3TTHA 1V0CA 1Y9WA 4A30A 5K8MA 4QUSA 4MXUA 2VBQA 3BJ8A 2FVGA 2IQ6A 4TWEA 1QSTA 5A27A 4NGTA 2PJ2A 1TIQA 3I1UA 4P10A 4CGNA 5LYFA 3B7IA 4UFWA 5AG5A 4KOXA 1VHOA 4LQGA 1TKHA 4NGNA 4M3SA 3UY5A 1ZG7A 1CP7A 4UBRA 2HV2A 4B5PB 3PP9A 3R1KA 3NA6A 2JDDA 1LANA 4PXEA 4KLVA 4A32A 1KUXA 1YREA 2H5MA 4IK2A 3S6FA 2PR8A 4AG9A 2D4OA 2REEA 1YLOA 3H8FA 3FMCA 3KHZA 4A33A 3VARA 4KVXA 1BAVA 2NSMA 1SQHA 1YK3A 2PIZA 1B6BA 4MI4A 2Z3MA 4PQAA 3L2NA 4OC2A 4MJ8A 4KUAA 4KOYA 2FXFA 2JBKA 1A2ZA 4JJXA 4NCZA 4CAEA 3SJEA 3BXMA 4X5KA 4MHYA 1HEEA 4YGOA 2G3AA 4F8ZA 2B5GB 4M85A 1LAMA 5AG4A 5KTDA 2VI7A 3BHXA 2AFWA 5J8FA 2GIVA 6CPAA 3ISZA 1AUGA 3PB9X 4U5YA 3ZJ0A 5KTAA 3IO1A 4OADA 3DR8A 4WJBA 5AG6A 1AYEA 1IICA 4KVOE 3QAHA 1ZG8A 1ON0A 1KZFA 5EBVA 4B6ZA 2AFMA 4RN7A 2EBJA 3KGQA 4H2KA 4UFVA 1Q7LA 5J8CA 1YSJA 3D7GA 3FRMA 4NGSA 3R96A 4RUHA 4A31A 1VHEA 4OC3A 1CM0A 3DNSA 1NSAA 4Y49C 4C7HA 1WK4A 2ZOGA 4OIDA 2QYVA 3S6GA 2VEZA 3KHXA 1OZPA 4B12A 4UCNA 2PJ9A 1DE4C 1QQ9A 5CPAA 1M4GA 2PVWA 3EFAA 5JGFA 2ABZA 3GY9A 4JXQA 3D7HA 4JWPA 3V7ZA 3MRUA 3DLJA 4CAWA 2YNCC 2ZEOA 2RB7A 4R76A 5CBMA 2JDCA 5LYDA 5AG7A 2BO9A 2Q43A 2R98A 3D67A 2BEIA 4QB9A 4R6TA 3T8WA 5HVGA 1I1DA 4UCMA 2JEVA 2D4PA 4KOVA 4UEFA 1M44A 1XEBA 3SXOA 3SI1A 3V38A 3IWGA 2P6EA 5FVJA 2CNSA 3G3SA 4NGPA 1R57A 2CNTA 4NEXA 4BINA 3RYOA 4K3NA 5LRKA 3NH5A 3NFZA 4NXYA 3FBUA 2ZW4A 2GANA 4OMEA 1R43A
chains in the Genus database with same CATH topology
1XIXA 4UA3A 3T90A 2AE6A 1YVKA 3VWDA 4CGOA 4KSAA 4MFZA 3H4QA 4QC6A 1K4JA 2X7BA 2Q04A 2Z10A 1YLEA 1MJ9A 2VQYA 4L8AA 3TOBA 4BMHA 4JD6A 4YFJA 2PSWA 5E96A 4A2ZA 4OAEA 1IB1E 5G1ZA 1P0HA 2CXAA 2BUEA 3EO4A 2OH1A 1Q2CA 3TO6A 1XE4A 2Z3KA 4CGMA 4XPLA 4R87A 1N71A 4ORFA 2VZYA 3S6KA 3TT2A 2VZZA 1S3ZA 4RI1A 2B3VA 2F5IA 1S7LA 1MJAA 4MY3A 4PK3A 5F48A 2I00A 4R57A 2YNDA 3IU1A 5EC4A 4H6ZA 4KS9A 4QBJA 4XPKA 3K9UA 2B4DB 4U9YA 4RS2A 2Z3LA 2Q4YA 5DWMA 4C2XA 5IB0A 2YNEA 2Z11A 4R9MA 4KLWA 4C68A 4E2AA 1J4JA 5A28A 3VWEA 1LRZA 3FXTA 2Z3PA 1M4IA 1KUYA 4FD4A 3JVNA 3LD2A 3T9YA 3DSBA 3W6XA 2FIAA 2Q7BA 3S6HA 1ZO0A 4CRYB 2WPWA 5F47A 4CYPA 2FL4A 4FD6A 3PGPA 5G20A 2J8MA 1QSNA 3IWEA 2FS5A 5C82A 4DNCA 4B10A 4GS4A 5IV0A 4H6UA 4C7IA 5HH1A 5JPHA 2OZGA 4Q38A 4R3KA 3EC4A 1S7KA 4IUSA 4XNHC 3TO7A 2Y0MA 4UCPA 3TOAA 2P6FA 1Z4EA 2OZUA 5G21A 3QB8A 4C2ZA 4CAVA 1KUVA 1L0CA 3JUWA 1PUAA 1S7FA 2CY2A 1Z4RA 3F0AA 1Q2DA 4NF1A 4PSXA 3R9GA 1FY7A 2P6GA 5H86A 2R7HA 4MFQA 1IYKA 3NE7A 3DR6A 4L89A 4UWIA 3FNCA 2OB0A 4CYQA 4KOSA 4JXRA 3TCVA 5KTCA 4EVYA 3CXQA 4AVAA 3H5ZA 4ONUA 5F49A 2FSRA 3GYAA 2HUZA 4AB7A 4OLLA 3D2MA 2ZPAA 5F46A 4CGPA 4KUBA 4NSQA 2FT0A 4CRZB 1S7NA 2PRBA 1M1DA 4B5OA 3TFYA 1IIDA 2PDOA 4H89A 1BO4A 2Z3NA 4CAFA 1RO5A 2IL4A 2REFA 5BWAB 2FCKA 4Y49B 4B13A 4MY0A 3BJ7A 4C2YA 4B5PA 2B4DA 4ZGYB 2C27A 4HNWB 3WR7A 2O28A 2Q44A 3D2PA 1M4DA 5I0CA 1VHSA 4B14A 3DDDA 5G22A 3TE4A 3ZZIA 2EUIA 2A4NA 1P4NA 4KSFA 3MGDA 2QMLA 3W6SA 4AVCA 5HMNA 4A95A 1YVOA 4MFPA 3KKWA 2PC1A 3JTKA 2WUUA 2QIRA 2Z0ZA 2PR1A 2B5GA 4PK2A 3V8IA 4MHDA 3I3GA 4I49A 2FE7A 3C26A 4F0XA 1Z9UA 1YGHA 5CNPA 3GKRA 1IYLA 1UFHA 2EVNA 2R1IA 2FIWA 3W91A 1GHEA 1S5KA 4CS0B 1PU9A 2ZW5A 2ATRA 4LX9A 4XPDB 1BOBA 4QVTA 2DPTA 4UFXA 3LODA 2G3TA 3IGRA 1MJBA 1Y9KA 2K5TA 4Q36A 2G0BA 1U6MA 2CNMA 2DXQA 3CXSA 4JLYA 2WPXA 2KCWA 2RC4A 4U9ZA 1MK4A 3G8WA 4HNXB 3N7ZA 3BLNA 4KOWA 4K30A 4LUAA 1Q2YA 4MFJA 5C88A 3FB3A 2QECA 4HKFA 1QSMA 2JLMA 1Y7RA 4CYNA 2GE3A 5GCNA 4F0YA 2P0WA 2NMTA 4IF5A 1VKCA 3EXNA 4CYOA 3F5BA 3TO9A 2OU2A 1B87A 2R8VA 3P2FA 4PV6A 3EY5A 4II9A 3PZJA 4J3GA 2Q4VA 2WSAA 2ZXVA 1XF8A 4R3LA 1NE9A 3CXPA 2ZW7A 2AJ6A 4FD7A 2B3UA 4KORA 4ZBGA 3B8GA 1WWZA 1NSLA 4MFLA 4KZTA 2YGWA 4MBUA 4AVBA 4PSWA 3D8PA 3R9EA 1S60A 1NMTA 2J8NA 4B11A 1YR0A 3FIXA 2B58A 3IU2A 3R95A 3R9FA 2Z3OA 3A9LA 2B4BA 1RXTA 4E8OA 3P2HA 4F6AA 2PQ8A 4KVME 5JQ4A 2VXKA 4CGLA 5H84A 1CJWA 2YNCA 3D3SA 4KOUA 5AGEA 4KOTA 5ISVA 4AG7A 4XNHB 1YX0A 3I9SA 5DWNA 1I12A 1XMTA 3OWCA 4FD5A 2BL1A 2BSWA 4XPDC 4E0AA 3E0KA 4MFKA 3SHPA 2J8RA 2DPSA 2HQYA 3FYNA 2ZW6A 4UWJA 4CAXA 1QSRA 1I21A 3F8KA 2ARHA 1QSOA 2Q0YA 3SXNA 4HNYB 2I79A 5IX3A 4BBHA 4YRHA 2OZHA 3TTHA 1V0CA 1Y9WA 4A30A 4QUSA 2VBQA 3BJ8A 1QSTA 5A27A 1TIQA 4CGNA 4UFWA 5AG5A 4KOXA 4M3SA 4B5PB 4UBRA 2HV2A 3PP9A 3R1KA 2JDDA 4KLVA 4A32A 1KUXA 1YREA 2H5MA 3S6FA 2PR8A 4AG9A 2D4OA 2REEA 4A33A 4KVXA 1SQHA 1YK3A 1B6BA 4MI4A 2Z3MA 4MJ8A 4KUAA 4KOYA 2FXFA 4JJXA 4NCZA 4CAEA 4X5KA 4YGOA 2G3AA 2B5GB 4M85A 5AG4A 5KTDA 2VI7A 5J8FA 2GIVA 4U5YA 3ZJ0A 5KTAA 4OADA 3DR8A 5AG6A 4KVOE 1IICA 3QAHA 1ON0A 1KZFA 5EBVA 4UFVA 5J8CA 3FRMA 3R96A 4A31A 1CM0A 3DNSA 4C7HA 4Y49C 1WK4A 3S6GA 2VEZA 1OZPA 4B12A 4UCNA 1M4GA 3EFAA 3GY9A 4CAWA 4JXQA 4JWPA 2YNCC 2JDCA 5AG7A 2R98A 2BEIA 4QB9A 1I1DA 4UCMA 2JEVA 2D4PA 4KOVA 3SXOA 1M44A 1XEBA 3IWGA 2P6EA 5FVJA 2CNSA 3G3SA 1R57A 2CNTA 4NEXA 3RYOA 4NXYA 3FBUA 2ZW4A 2GANA 3UY5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XIX A;  4UA3 A;  3T90 A;  2AE6 A;  1YVK A;  3VWD A;  3H4Q A;  4QC6 A;  1K4J A;  2X7B A;  2Q04 A;  2Z10 A;  1YLE A;  1MJ9 A;  2VQY A;  4L8A A;  3TOB A;  4BMH A;  4JD6 A;  4YFJ A;  2PSW A;  5E96 A;  4OAE A;  1IB1 E;  1P0H A;  2BUE A;  3EO4 A;  2OH1 A;  1Q2C A;  3TO6 A;  1XE4 A;  4XPL A;  4R87 A;  1N71 A;  4ORF A;  2VZY A;  3S6K A;  3TT2 A;  2VZZ A;  1S3Z A;  4RI1 A;  2B3V A;  2F5I A;  1S7L A;  1MJA A;  4MY3 A;  4PK3 A;  5F48 A;  2I00 A;  4R57 A;  5EC4 A;  4H6Z A;  4QBJ A;  4XPK A;  3K9U A;  2B4D B;  4U9Y A;  4RS2 A;  2Q4Y A;  5DWM A;  5IB0 A;  2Z11 A;  4R9M A;  4KLW A;  4E2A A;  1J4J A;  3VWE A;  1LRZ A;  3FXT A;  1M4I A;  1KUY A;  4FD4 A;  3JVN A;  3LD2 A;  3T9Y A;  3DSB A;  3W6X A;  2FIA A;  2Q7B A;  3S6H A;  4CRY B;  2WPW A;  5F47 A;  2FL4 A;  4FD6 A;  3PGP A;  2J8M A;  1QSN A;  2FS5 A;  5C82 A;  4DNC A;  4GS4 A;  5IV0 A;  4H6U A;  5HH1 A;  5JPH A;  2OZG A;  4R3K A;  3EC4 A;  1S7K A;  4IUS A;  4XNH C;  3TO7 A;  2Y0M A;  3TOA A;  2P6F A;  1Z4E A;  2OZU A;  3QB8 A;  4CAV A;  1KUV A;  1L0C A;  3JUW A;  1PUA A;  1S7F A;  2CY2 A;  1Z4R A;  3F0A A;  1Q2D A;  4NF1 A;  4PSX A;  3R9G A;  1FY7 A;  2P6G A;  5H86 A;  2R7H A;  1IYK A;  3NE7 A;  3DR6 A;  4L89 A;  4UWI A;  3FNC A;  2OB0 A;  4KOS A;  4JXR A;  3TCV A;  5KTC A;  4EVY A;  3CXQ A;  4AVA A;  4ONU A;  5F49 A;  2FSR A;  3GYA A;  2HUZ A;  4AB7 A;  4OLL A;  3D2M A;  2ZPA A;  5F46 A;  4KUB A;  4NSQ A;  2FT0 A;  4CRZ B;  1S7N A;  2PRB A;  1M1D A;  4B5O A;  3TFY A;  1IID A;  2PDO A;  4H89 A;  1BO4 A;  1RO5 A;  2IL4 A;  2REF A;  2FCK A;  4Y49 B;  4MY0 A;  3BJ7 A;  4B5P A;  2B4D A;  2C27 A;  4HNW B;  3WR7 A;  2O28 A;  2Q44 A;  3D2P A;  1M4D A;  5I0C A;  1VHS A;  3DDD A;  3TE4 A;  3ZZI A;  2EUI A;  2A4N A;  1P4N A;  3MGD A;  2QML A;  3W6S A;  4AVC A;  5HMN A;  1YVO A;  3KKW A;  2PC1 A;  2QIR A;  2Z0Z A;  2PR1 A;  2B5G A;  4PK2 A;  3V8I A;  4MHD A;  3I3G A;  4I49 A;  2FE7 A;  3C26 A;  1Z9U A;  1YGH A;  5CNP A;  3GKR A;  1IYL A;  1UFH A;  2EVN A;  2R1I A;  2FIW A;  3W91 A;  1GHE A;  1S5K A;  4CS0 B;  1PU9 A;  2ZW5 A;  2ATR A;  4LX9 A;  4XPD B;  1BOB A;  4QVT A;  3LOD A;  2G3T A;  3IGR A;  1MJB A;  1Y9K A;  2K5T A;  2G0B A;  1U6M A;  2CNM A;  2DXQ A;  3CXS A;  4JLY A;  2WPX A;  2KCW A;  2RC4 A;  4U9Z A;  1MK4 A;  3G8W A;  4HNX B;  3N7Z A;  3BLN A;  4KOW A;  4K30 A;  4LUA A;  1Q2Y A;  5C88 A;  3FB3 A;  2QEC A;  4HKF A;  1QSM A;  2JLM A;  1Y7R A;  2GE3 A;  5GCN A;  4F0Y A;  2P0W A;  2NMT A;  4IF5 A;  1VKC A;  3EXN A;  3F5B A;  3TO9 A;  2OU2 A;  1B87 A;  2R8V A;  3P2F A;  4PV6 A;  3EY5 A;  4II9 A;  3PZJ A;  4J3G A;  2Q4V A;  2ZXV A;  1XF8 A;  4R3L A;  1NE9 A;  3CXP A;  2ZW7 A;  2AJ6 A;  4FD7 A;  2B3U A;  4KOR A;  4ZBG A;  3B8G A;  1WWZ A;  1NSL A;  4KZT A;  4MBU A;  4AVB A;  4PSW A;  3D8P A;  3R9E A;  1S60 A;  1NMT A;  2J8N A;  1YR0 A;  3FIX A;  2B58 A;  3R95 A;  3R9F A;  2B4B A;  1RXT A;  4E8O A;  3P2H A;  4F6A A;  2PQ8 A;  4KVM E;  5JQ4 A;  2VXK A;  5H84 A;  1CJW A;  3D3S A;  4KOU A;  4KOT A;  5ISV A;  4AG7 A;  4XNH B;  1YX0 A;  3I9S A;  5DWN A;  1I12 A;  1XMT A;  3OWC A;  4FD5 A;  2BL1 A;  2BSW A;  4XPD C;  4E0A A;  3E0K A;  3SHP A;  2J8R A;  2HQY A;  3FYN A;  2ZW6 A;  4UWJ A;  4CAX A;  1QSR A;  1I21 A;  3F8K A;  2ARH A;  1QSO A;  2Q0Y A;  3SXN A;  4HNY B;  2I79 A;  5IX3 A;  4YRH A;  2OZH A;  3TTH A;  1V0C A;  1Y9W A;  4QUS A;  2VBQ A;  3BJ8 A;  1QST A;  1TIQ A;  4KOX A;  4M3S A;  4B5P B;  4UBR A;  2HV2 A;  3PP9 A;  3R1K A;  2JDD A;  4KLV A;  1KUX A;  1YRE A;  2H5M A;  3S6F A;  2PR8 A;  4AG9 A;  2D4O A;  2REE A;  4KVX A;  1SQH A;  1YK3 A;  1B6B A;  4MI4 A;  4MJ8 A;  4KUA A;  4KOY A;  2FXF A;  4JJX A;  4NCZ A;  4X5K A;  4YGO A;  2G3A A;  2B5G B;  4M85 A;  5KTD A;  2VI7 A;  5J8F A;  2GIV A;  4U5Y A;  3ZJ0 A;  5KTA A;  4OAD A;  3DR8 A;  4KVO E;  1IIC A;  3QAH A;  1ON0 A;  1KZF A;  5EBV A;  5J8C A;  3FRM A;  3R96 A;  1CM0 A;  3DNS A;  4Y49 C;  1WK4 A;  3S6G A;  2VEZ A;  1OZP A;  1M4G A;  3EFA A;  3GY9 A;  4CAW A;  4JXQ A;  4JWP A;  2JDC A;  2R98 A;  2BEI A;  4QB9 A;  1I1D A;  2JEV A;  2D4P A;  4KOV A;  3SXO A;  1M44 A;  1XEB A;  3IWG A;  2P6E A;  5FVJ A;  2CNS A;  3G3S A;  1R57 A;  2CNT A;  4NEX A;  3RYO A;  4NXY A;  3FBU A;  2ZW4 A;  2GAN A;  3UY5 A; 
#chains in the Genus database with same CATH topology
 3KI9 A;  3PB4 X;  1XIX A;  1VGY A;  1ZLH A;  3KQX A;  1ELL P;  2ZEN A;  4UA3 A;  3D7D A;  1PCA A;  1Y0Y A;  3PB7 X;  2ZOF A;  4R8F A;  4W9Y A;  3T90 A;  2PIY A;  2AE6 A;  1IU8 A;  1YVK A;  3VWD A;  4CGO A;  4M6I A;  2J9A A;  1X12 A;  4KSA A;  5THW A;  4MFZ A;  3B35 A;  3H4Q A;  4QC6 A;  4ZY2 A;  1K4J A;  2X7B A;  2Q04 A;  2Z10 A;  1YLE A;  3PEI A;  1MJ9 A;  2VQY A;  4L8A A;  1Z8W A;  2GLJ A;  3TOB A;  4BMH A;  1Y7E A;  4JD6 A;  4YFJ A;  2PSW A;  5E96 A;  4A2Z A;  4EFD A;  4OAE A;  1IB1 E;  5G1Z A;  2C6C A;  2EK9 A;  1P0H A;  4MHP A;  2CXA A;  3DGV A;  2BUE A;  3EO4 A;  1TXR A;  1H8L A;  1TKJ A;  2I3C A;  3KZW A;  2OH1 A;  1Q2C A;  3TO6 A;  1XE4 A;  5EMI A;  1HDU A;  2Z3K A;  4CGM A;  3IWW A;  2Q7S A;  4XPL A;  3JRU A;  4R87 A;  1N71 A;  4ZY0 A;  2V8G A;  4ORF A;  4EWT A;  2VZY A;  3S6K A;  1YW4 A;  3TT2 A;  2VZZ A;  1S3Z A;  3GB0 A;  4RI1 A;  4NGM A;  2B3V A;  1QMU A;  2F5I A;  3WC6 A;  1LCP A;  2BOA A;  1S7L A;  1XBU A;  1MJA A;  4MY3 A;  2WZN A;  4PK3 A;  2XEG A;  5F48 A;  2I00 A;  4R57 A;  1HDQ A;  2CIJ A;  2PJB A;  2YND A;  3IU1 A;  4ONW A;  5EC4 A;  5HVH A;  1DTD A;  1YW6 A;  4OP4 A;  4H6Z A;  4KS9 A;  5J1Q A;  4QBJ A;  4XPK A;  3K9U A;  2PCU A;  2B4D B;  2O4H A;  1IY7 A;  1XOV A;  4U9Y A;  4RS2 A;  2Z3L A;  2Q4Y A;  4NJQ A;  5DWM A;  4C2X A;  5IB0 A;  3BI0 A;  2CF4 A;  2YNE A;  2DF5 A;  2Z11 A;  4R9M A;  3KR4 A;  2AFS A;  4KLW A;  4C68 A;  3FX6 A;  3PBE A;  4PXB A;  4AXV A;  4LQ6 A;  4YU9 A;  4E2A A;  4JYW A;  2PJC A;  1J4J A;  1GYT A;  3NH4 A;  5A28 A;  3VWE A;  1LRZ A;  3FXT A;  2Z3P A;  1M4I A;  1BPN A;  4P4E A;  1KUY A;  4FD4 A;  4ZI6 A;  4MCR A;  2QVP A;  3JVN A;  4UIB A;  4P45 A;  3WC7 A;  1X10 A;  3LD2 A;  2PE3 A;  3T9Y A;  2GFQ A;  3DSB A;  3W6X A;  2ZEF A;  4GXH A;  2FIA A;  2Q7B A;  1Z8X A;  4IHM A;  3S6H A;  1ZO0 A;  3B2Y A;  4CRY B;  2WPW A;  5F47 A;  4CYP A;  3RZA A;  2FL4 A;  3IJ3 A;  4FD6 A;  3PGP A;  4P44 A;  5G20 A;  2J8M A;  1QSN A;  3IWE A;  2GU2 A;  2PJ0 A;  2FS5 A;  4GM5 A;  4OC5 A;  4A38 A;  4DNC A;  4F9U A;  5C82 A;  4JZ0 A;  1BPM A;  1XMB A;  3D4U A;  3SJG A;  4GS4 A;  4B10 A;  2F8H A;  5IV0 A;  4DUK A;  2PJA A;  4MCQ A;  2PJ8 A;  5F09 A;  4H6U A;  1XJO A;  3K9T A;  5DS0 A;  2OZG A;  4Q38 A;  5HH1 A;  4C7I A;  5JPH A;  3SJF A;  3RO0 A;  2Q51 A;  4R3K A;  3EC4 A;  3SI2 A;  1S7K A;  3MN8 A;  4IUS A;  4XNH C;  3TO7 A;  3S9L A;  4P6Y A;  2Y0M A;  4UCP A;  4O23 A;  2P6F A;  3TOA A;  1Z4E A;  2OZU A;  1UWY A;  3QB8 A;  5G21 A;  3VAT A;  4C2Z A;  1CX8 A;  4CAV A;  3S9M A;  3WT4 A;  1KUV A;  1L0C A;  3B3C A;  3JUW A;  1PUA A;  1S7F A;  2CY2 A;  3ISX A;  1Z4R A;  1Z5R A;  5D29 A;  3KAS A;  3F0A A;  1F2O A;  3KR5 A;  3HUV A;  1Q2D A;  4NF1 A;  4BD9 A;  2PRQ A;  4PSX A;  5JH9 A;  3R9G A;  1FY7 A;  2P6G A;  5H86 A;  1XRY A;  3D68 A;  2R7H A;  4MFQ A;  8CPA A;  2OR4 A;  4FBE A;  4G1P A;  1IYK A;  3NE7 A;  4DYO A;  4MHZ A;  3DR6 A;  2AFZ A;  5K8O A;  3GUX A;  4L89 A;  4UWI A;  2ZEE A;  4X3R A;  3B3V A;  3FNC A;  4YWY A;  4P4F A;  3GIU A;  2OB0 A;  4A39 A;  4CYQ A;  4KOS A;  4JXR A;  2QJ8 A;  3TCV A;  5KTC A;  4EVY A;  3CXQ A;  4AVA A;  3H5Z A;  3PRT A;  2AFX A;  1IOI A;  4ONU A;  5F49 A;  4HPS A;  5HVF A;  4TNU A;  4CPA A;  2PJ6 A;  2FSR A;  3GYA A;  4UF4 A;  2HUZ A;  4X2T A;  3RBU A;  4ZYQ A;  4OKO A;  4AB7 A;  4OLL A;  3D2M A;  3KQZ A;  4UEZ A;  2ZPA A;  4M6H A;  2VL1 A;  5F46 A;  3RNZ A;  4CGP A;  4F9V A;  3D7F A;  4KUB A;  1BLL E;  4NSQ A;  2FT0 A;  3D66 A;  2ZEG A;  1VIX A;  1S7N A;  1TF8 A;  4UEE A;  4CRZ B;  2PRB A;  3NE8 A;  2ZEL A;  3RAM A;  1M1D A;  3WAB A;  4B5O A;  3TFY A;  1IID A;  2PDO A;  4H89 A;  2HB6 A;  2GRE A;  4A94 A;  3GLJ A;  4MMO A;  2WYR A;  1BO4 A;  2Z3N A;  4NJR A;  4A37 A;  2V8H A;  4CAF A;  1RO5 A;  3H8G A;  5ELY A;  3VH9 A;  2IL4 A;  2REF A;  4P4D A;  4P4J A;  5BWA B;  2JEW A;  1JWQ A;  2FCK A;  4Y49 B;  4B13 A;  1ARL A;  4MY0 A;  1Y0R A;  3BJ7 A;  4C2Y A;  4B5P A;  3FH4 A;  2B4D A;  4ZGY B;  1ELM P;  5K8P A;  2C27 A;  4HNW B;  3SJX A;  2ZEP A;  3WR7 A;  2O28 A;  2Q44 A;  2F7V A;  3SI0 A;  1PYT B;  3D2P A;  1ZG9 A;  3WC5 A;  1M4D A;  5I0C A;  1VHS A;  4B14 A;  1XFO A;  3DDD A;  5G22 A;  3TE4 A;  3ZZI A;  3QAY A;  2EUI A;  3PFE A;  2A4N A;  1P4N A;  4KSF A;  3MGD A;  2BCO A;  2QML A;  5LYI A;  1IGB A;  3W6S A;  4AVC A;  5HMN A;  4A95 A;  1YVO A;  3NH8 A;  4MFP A;  3KKW A;  2PC1 A;  2V8V A;  3JTK A;  1AMP A;  2EK8 A;  2QIR A;  2WUU A;  3IFE A;  2ZEH A;  2Z0Z A;  2PR1 A;  5HXD A;  2B5G A;  4NGR A;  4FWU A;  2PJ4 A;  4PK2 A;  3V8I A;  4MHD A;  4Z65 A;  3I3G A;  1YQE A;  4I49 A;  2FE7 A;  3C26 A;  4F0X A;  1Z8L A;  2POK A;  1Z9U A;  1LAP A;  1YGH A;  3GKR A;  5CNP A;  1IYL A;  2JBJ A;  3B3S A;  4NGQ A;  3H8E A;  4MHN A;  1KWM A;  4R7M A;  1UFH A;  4OC0 A;  2EVN A;  2FIW A;  2R1I A;  1LOK A;  1GHE A;  3W91 A;  1S5K A;  4CS0 B;  2PVV A;  1PU9 A;  4PXD A;  2ZW5 A;  2ATR A;  2ANP A;  2ODF A;  3FEC A;  4LX9 A;  1BOB A;  4QVT A;  4XPD B;  2OOT A;  1M4L A;  2ZED A;  2DPT A;  4UFX A;  3LOD A;  2G3T A;  3IGR A;  1MJB A;  4IAV A;  1Y9K A;  5LYL A;  2K5T A;  4Q36 A;  2G0B A;  2ZEM A;  1U6M A;  2CNM A;  2PJ5 A;  2DXQ A;  3CXS A;  4PXC A;  4JLY A;  2WPX A;  3PB8 X;  2AFU A;  2KCW A;  2RFH A;  4MCS A;  2RC4 A;  4U9Z A;  1MK4 A;  2DEA A;  3G8W A;  4HNX B;  1EE3 P;  3N7Z A;  3HLP A;  3B3T A;  3BLN A;  2IJZ A;  2XEF A;  1IOF A;  3KL9 A;  3LMS A;  4KOW A;  1CBX A;  1CP6 A;  4K30 A;  2PJ3 A;  4LUA A;  5D8N A;  1R3N A;  1Q2Y A;  4MFJ A;  5C88 A;  3FB3 A;  1JQG A;  2QEC A;  4HKF A;  3PBB A;  4PPZ A;  1QSM A;  2EO8 A;  2JLM A;  1Y7R A;  3FEE A;  4CYN A;  2GE3 A;  5GCN A;  4F0Y A;  2P0W A;  2NMT A;  3CZX A;  1RTQ A;  4IF5 A;  1VKC A;  3EXN A;  4EME A;  4CYO A;  3F5B A;  3TO9 A;  2OU2 A;  2C1C A;  1B87 A;  1FT7 A;  2R8V A;  3P2F A;  3EY5 A;  3BI1 A;  4PV6 A;  3TC8 A;  4II9 A;  3PZJ A;  4OC1 A;  4J3G A;  5LRG A;  2Q4V A;  4Q7A A;  4UIA A;  2WSA A;  4MCP A;  2ZXV A;  1CPS A;  1XF8 A;  4R3L A;  1NE9 A;  3CXP A;  5IB9 A;  3IC1 A;  3N5F A;  3K2K A;  2ZW7 A;  2AJ6 A;  3S9N A;  4FD7 A;  2B3U A;  4KOR A;  3FVL A;  3CPA A;  4M6G A;  4ZBG A;  5K8N A;  2Q4Z A;  3B8G A;  3CDX A;  1WWZ A;  1NSL A;  4MFL A;  1ARM A;  4KZT A;  2YGW A;  4MBU A;  4AVB A;  4PSW A;  3D8P A;  3R9E A;  1S60 A;  2C6G A;  4DJL A;  2J8N A;  1NMT A;  5I4M A;  1LFW A;  2CTC A;  3CPX A;  4ZX9 A;  1TF9 A;  5LRJ A;  3FED A;  1YR0 A;  1Z8T A;  4MRI A;  1CG2 A;  3FIX A;  4B11 A;  2B58 A;  3IU2 A;  2O53 A;  3R95 A;  2GLF A;  3R9F A;  7CPA A;  4FAI A;  2Z3O A;  2PJ1 A;  2IMO A;  4ZY1 A;  3A9L A;  3FJU A;  2B4B A;  4FUU A;  1RXT A;  2AFO A;  4E8O A;  3P2H A;  1Z2L A;  4F6A A;  2PQ8 A;  4KVM E;  5JQ4 A;  2VXK A;  4CGL A;  5H84 A;  3TX8 A;  5JM6 A;  1CJW A;  2YNC A;  4X8I A;  3D3S A;  4KOU A;  1F57 A;  4WWV A;  5AGE A;  4KSI A;  4KOT A;  5ISV A;  3LAC A;  3QNV A;  4AG7 A;  3IIB A;  2EWB A;  4XNH B;  1YME A;  1YX0 A;  3I9S A;  5DWN A;  3PB6 X;  1TKF A;  1I12 A;  1XMT A;  2G9D A;  3B3W A;  3OWC A;  2XEJ A;  4FD5 A;  2XEI A;  2BL1 A;  2BSW A;  4XPD C;  4E0A A;  3E0K A;  4MFK A;  4P4B A;  2NYQ A;  1FNO A;  3LWU A;  3SHP A;  2J8R A;  1F2P A;  2DPS A;  2HQY A;  2ZW6 A;  3FYN A;  4UWJ A;  1OBR A;  1QSR A;  4CAX A;  4P4I A;  2PJ7 A;  2V8D A;  1I21 A;  3F8K A;  2HC9 A;  3FF3 A;  2ARH A;  1QSO A;  2Q0Y A;  3PFO A;  4OIW A;  1CPX A;  2C6P A;  3SXN A;  4ZX8 A;  4NFR A;  3CT9 A;  3IEH A;  4HNY B;  2I79 A;  4OC4 A;  4BBH A;  1ZLI A;  4YRH A;  5IX3 A;  2V77 A;  2OZH A;  2CTB A;  3TTH A;  1V0C A;  1Y9W A;  4A30 A;  5K8M A;  4QUS A;  4MXU A;  2VBQ A;  3BJ8 A;  2FVG A;  2IQ6 A;  4TWE A;  1QST A;  5A27 A;  4NGT A;  2PJ2 A;  1TIQ A;  3I1U A;  4P10 A;  4CGN A;  5LYF A;  3B7I A;  4UFW A;  5AG5 A;  4KOX A;  1VHO A;  4LQG A;  1TKH A;  4NGN A;  4M3S A;  3UY5 A;  1ZG7 A;  1CP7 A;  4UBR A;  2HV2 A;  4B5P B;  3PP9 A;  3R1K A;  3NA6 A;  2JDD A;  1LAN A;  4PXE A;  4KLV A;  4A32 A;  1KUX A;  1YRE A;  2H5M A;  4IK2 A;  3S6F A;  2PR8 A;  4AG9 A;  2D4O A;  2REE A;  1YLO A;  3H8F A;  3FMC A;  3KHZ A;  4A33 A;  3VAR A;  4KVX A;  1BAV A;  2NSM A;  1SQH A;  1YK3 A;  2PIZ A;  1B6B A;  4MI4 A;  2Z3M A;  4PQA A;  3L2N A;  4OC2 A;  4MJ8 A;  4KUA A;  4KOY A;  2FXF A;  2JBK A;  1A2Z A;  4JJX A;  4NCZ A;  4CAE A;  3SJE A;  3BXM A;  4X5K A;  4MHY A;  1HEE A;  4YGO A;  2G3A A;  4F8Z A;  2B5G B;  4M85 A;  1LAM A;  5AG4 A;  5KTD A;  2VI7 A;  3BHX A;  2AFW A;  5J8F A;  2GIV A;  6CPA A;  3ISZ A;  1AUG A;  3PB9 X;  4U5Y A;  3ZJ0 A;  5KTA A;  3IO1 A;  4OAD A;  3DR8 A;  4WJB A;  5AG6 A;  1AYE A;  1IIC A;  4KVO E;  3QAH A;  1ZG8 A;  1ON0 A;  1KZF A;  5EBV A;  4B6Z A;  2AFM A;  4RN7 A;  2EBJ A;  3KGQ A;  4H2K A;  4UFV A;  1Q7L A;  5J8C A;  1YSJ A;  3D7G A;  3FRM A;  4NGS A;  3R96 A;  4RUH A;  4A31 A;  1VHE A;  4OC3 A;  1CM0 A;  3DNS A;  1NSA A;  4Y49 C;  4C7H A;  1WK4 A;  2ZOG A;  4OID A;  2QYV A;  3S6G A;  2VEZ A;  3KHX A;  1OZP A;  4B12 A;  4UCN A;  2PJ9 A;  1DE4 C;  1QQ9 A;  5CPA A;  1M4G A;  2PVW A;  3EFA A;  5JGF A;  2ABZ A;  3GY9 A;  4JXQ A;  3D7H A;  4JWP A;  3V7Z A;  3MRU A;  3DLJ A;  4CAW A;  2YNC C;  2ZEO A;  2RB7 A;  4R76 A;  5CBM A;  2JDC A;  5LYD A;  5AG7 A;  2BO9 A;  2Q43 A;  2R98 A;  3D67 A;  2BEI A;  4QB9 A;  4R6T A;  3T8W A;  5HVG A;  1I1D A;  4UCM A;  2JEV A;  2D4P A;  4KOV A;  4UEF A;  1M44 A;  1XEB A;  3SXO A;  3SI1 A;  3V38 A;  3IWG A;  2P6E A;  5FVJ A;  2CNS A;  3G3S A;  4NGP A;  1R57 A;  2CNT A;  4NEX A;  4BIN A;  3RYO A;  4K3N A;  5LRK A;  3NH5 A;  3NFZ A;  4NXY A;  3FBU A;  2ZW4 A;  2GAN A;  4OME A;  1R43 A; 
#chains in the Genus database with same CATH homology
 1XIX A;  4UA3 A;  3T90 A;  2AE6 A;  1YVK A;  3VWD A;  4CGO A;  4KSA A;  4MFZ A;  3H4Q A;  4QC6 A;  1K4J A;  2X7B A;  2Q04 A;  2Z10 A;  1YLE A;  1MJ9 A;  2VQY A;  4L8A A;  3TOB A;  4BMH A;  4JD6 A;  4YFJ A;  2PSW A;  5E96 A;  4A2Z A;  4OAE A;  1IB1 E;  5G1Z A;  1P0H A;  2CXA A;  2BUE A;  3EO4 A;  2OH1 A;  1Q2C A;  3TO6 A;  1XE4 A;  2Z3K A;  4CGM A;  4XPL A;  4R87 A;  1N71 A;  4ORF A;  2VZY A;  3S6K A;  3TT2 A;  2VZZ A;  1S3Z A;  4RI1 A;  2B3V A;  2F5I A;  1S7L A;  1MJA A;  4MY3 A;  4PK3 A;  5F48 A;  2I00 A;  4R57 A;  2YND A;  3IU1 A;  5EC4 A;  4H6Z A;  4KS9 A;  4QBJ A;  4XPK A;  3K9U A;  2B4D B;  4U9Y A;  4RS2 A;  2Z3L A;  2Q4Y A;  5DWM A;  4C2X A;  5IB0 A;  2YNE A;  2Z11 A;  4R9M A;  4KLW A;  4C68 A;  4E2A A;  1J4J A;  5A28 A;  3VWE A;  1LRZ A;  3FXT A;  2Z3P A;  1M4I A;  1KUY A;  4FD4 A;  3JVN A;  3LD2 A;  3T9Y A;  3DSB A;  3W6X A;  2FIA A;  2Q7B A;  3S6H A;  1ZO0 A;  4CRY B;  2WPW A;  5F47 A;  4CYP A;  2FL4 A;  4FD6 A;  3PGP A;  5G20 A;  2J8M A;  1QSN A;  3IWE A;  2FS5 A;  5C82 A;  4DNC A;  4B10 A;  4GS4 A;  5IV0 A;  4H6U A;  4C7I A;  5HH1 A;  5JPH A;  2OZG A;  4Q38 A;  4R3K A;  3EC4 A;  1S7K A;  4IUS A;  4XNH C;  3TO7 A;  2Y0M A;  4UCP A;  3TOA A;  2P6F A;  1Z4E A;  2OZU A;  5G21 A;  3QB8 A;  4C2Z A;  4CAV A;  1KUV A;  1L0C A;  3JUW A;  1PUA A;  1S7F A;  2CY2 A;  1Z4R A;  3F0A A;  1Q2D A;  4NF1 A;  4PSX A;  3R9G A;  1FY7 A;  2P6G A;  5H86 A;  2R7H A;  4MFQ A;  1IYK A;  3NE7 A;  3DR6 A;  4L89 A;  4UWI A;  3FNC A;  2OB0 A;  4CYQ A;  4KOS A;  4JXR A;  3TCV A;  5KTC A;  4EVY A;  3CXQ A;  4AVA A;  3H5Z A;  4ONU A;  5F49 A;  2FSR A;  3GYA A;  2HUZ A;  4AB7 A;  4OLL A;  3D2M A;  2ZPA A;  5F46 A;  4CGP A;  4KUB A;  4NSQ A;  2FT0 A;  4CRZ B;  1S7N A;  2PRB A;  1M1D A;  4B5O A;  3TFY A;  1IID A;  2PDO A;  4H89 A;  1BO4 A;  2Z3N A;  4CAF A;  1RO5 A;  2IL4 A;  2REF A;  5BWA B;  2FCK A;  4Y49 B;  4B13 A;  4MY0 A;  3BJ7 A;  4C2Y A;  4B5P A;  2B4D A;  4ZGY B;  2C27 A;  4HNW B;  3WR7 A;  2O28 A;  2Q44 A;  3D2P A;  1M4D A;  5I0C A;  1VHS A;  4B14 A;  3DDD A;  5G22 A;  3TE4 A;  3ZZI A;  2EUI A;  2A4N A;  1P4N A;  4KSF A;  3MGD A;  2QML A;  3W6S A;  4AVC A;  5HMN A;  4A95 A;  1YVO A;  4MFP A;  3KKW A;  2PC1 A;  3JTK A;  2WUU A;  2QIR A;  2Z0Z A;  2PR1 A;  2B5G A;  4PK2 A;  3V8I A;  4MHD A;  3I3G A;  4I49 A;  2FE7 A;  3C26 A;  4F0X A;  1Z9U A;  1YGH A;  5CNP A;  3GKR A;  1IYL A;  1UFH A;  2EVN A;  2R1I A;  2FIW A;  3W91 A;  1GHE A;  1S5K A;  4CS0 B;  1PU9 A;  2ZW5 A;  2ATR A;  4LX9 A;  4XPD B;  1BOB A;  4QVT A;  2DPT A;  4UFX A;  3LOD A;  2G3T A;  3IGR A;  1MJB A;  1Y9K A;  2K5T A;  4Q36 A;  2G0B A;  1U6M A;  2CNM A;  2DXQ A;  3CXS A;  4JLY A;  2WPX A;  2KCW A;  2RC4 A;  4U9Z A;  1MK4 A;  3G8W A;  4HNX B;  3N7Z A;  3BLN A;  4KOW A;  4K30 A;  4LUA A;  1Q2Y A;  4MFJ A;  5C88 A;  3FB3 A;  2QEC A;  4HKF A;  1QSM A;  2JLM A;  1Y7R A;  4CYN A;  2GE3 A;  5GCN A;  4F0Y A;  2P0W A;  2NMT A;  4IF5 A;  1VKC A;  3EXN A;  4CYO A;  3F5B A;  3TO9 A;  2OU2 A;  1B87 A;  2R8V A;  3P2F A;  4PV6 A;  3EY5 A;  4II9 A;  3PZJ A;  4J3G A;  2Q4V A;  2WSA A;  2ZXV A;  1XF8 A;  4R3L A;  1NE9 A;  3CXP A;  2ZW7 A;  2AJ6 A;  4FD7 A;  2B3U A;  4KOR A;  4ZBG A;  3B8G A;  1WWZ A;  1NSL A;  4MFL A;  4KZT A;  2YGW A;  4MBU A;  4AVB A;  4PSW A;  3D8P A;  3R9E A;  1S60 A;  1NMT A;  2J8N A;  4B11 A;  1YR0 A;  3FIX A;  2B58 A;  3IU2 A;  3R95 A;  3R9F A;  2Z3O A;  3A9L A;  2B4B A;  1RXT A;  4E8O A;  3P2H A;  4F6A A;  2PQ8 A;  4KVM E;  5JQ4 A;  2VXK A;  4CGL A;  5H84 A;  1CJW A;  2YNC A;  3D3S A;  4KOU A;  5AGE A;  4KOT A;  5ISV A;  4AG7 A;  4XNH B;  1YX0 A;  3I9S A;  5DWN A;  1I12 A;  1XMT A;  3OWC A;  4FD5 A;  2BL1 A;  2BSW A;  4XPD C;  4E0A A;  3E0K A;  4MFK A;  3SHP A;  2J8R A;  2DPS A;  2HQY A;  3FYN A;  2ZW6 A;  4UWJ A;  4CAX A;  1QSR A;  1I21 A;  3F8K A;  2ARH A;  1QSO A;  2Q0Y A;  3SXN A;  4HNY B;  2I79 A;  5IX3 A;  4BBH A;  4YRH A;  2OZH A;  3TTH A;  1V0C A;  1Y9W A;  4A30 A;  4QUS A;  2VBQ A;  3BJ8 A;  1QST A;  5A27 A;  1TIQ A;  4CGN A;  4UFW A;  5AG5 A;  4KOX A;  4M3S A;  4B5P B;  4UBR A;  2HV2 A;  3PP9 A;  3R1K A;  2JDD A;  4KLV A;  4A32 A;  1KUX A;  1YRE A;  2H5M A;  3S6F A;  2PR8 A;  4AG9 A;  2D4O A;  2REE A;  4A33 A;  4KVX A;  1SQH A;  1YK3 A;  1B6B A;  4MI4 A;  2Z3M A;  4MJ8 A;  4KUA A;  4KOY A;  2FXF A;  4JJX A;  4NCZ A;  4CAE A;  4X5K A;  4YGO A;  2G3A A;  2B5G B;  4M85 A;  5AG4 A;  5KTD A;  2VI7 A;  5J8F A;  2GIV A;  4U5Y A;  3ZJ0 A;  5KTA A;  4OAD A;  3DR8 A;  5AG6 A;  4KVO E;  1IIC A;  3QAH A;  1ON0 A;  1KZF A;  5EBV A;  4UFV A;  5J8C A;  3FRM A;  3R96 A;  4A31 A;  1CM0 A;  3DNS A;  4C7H A;  4Y49 C;  1WK4 A;  3S6G A;  2VEZ A;  1OZP A;  4B12 A;  4UCN A;  1M4G A;  3EFA A;  3GY9 A;  4CAW A;  4JXQ A;  4JWP A;  2YNC C;  2JDC A;  5AG7 A;  2R98 A;  2BEI A;  4QB9 A;  1I1D A;  4UCM A;  2JEV A;  2D4P A;  4KOV A;  3SXO A;  1M44 A;  1XEB A;  3IWG A;  2P6E A;  5FVJ A;  2CNS A;  3G3S A;  1R57 A;  2CNT A;  4NEX A;  3RYO A;  4NXY A;  3FBU A;  2ZW4 A;  2GAN A;  3UY5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...