3EXNA

Crystal structure of acetyltransferase from thermus thermophilus hb8
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
154
structure length
154
Chain Sequence
b'MHVLTLDLAPVTPKDAPLLHRVFHLSPSYFALIGMELPTLEDVVRDLQTLEVDPRRRAFLLFLGQEPVGYLDAKLGYPEAEDATLSLLLIREDHQGRGLGRQALERFAAGLDGVRRLYAVVYGHNPKAKAFFQAQGFRYVKDGGPTLTWYVRPL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Probable acetyltransferase
publication title Crystal structure of acetyltransferase from Thermus thermophilus HB8
rcsb
source organism Thermus thermophilus
molecule tags Transferase
total genus 44
structure length 154
sequence length 154
ec nomenclature
pdb deposition date 2008-10-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 3exnA00
1Y9KA 2BSWA 1KZFA 4FD5A 2D4PA 4L8AA 1Z4RA 3SXNA 1IB1E 2VBQA 4UBRA 4AB7A 1TIQA 5F47A 4B5PB 1Z4EA 2GANA 5GCNA 4Y49C 1PUAA 2DXQA 1BO4A 1VKCA 4NCZA 1WWZA 2OU2A 3EFAA 3W6XA 1BOBA 3P2HA 2Q44A 3LD2A 2J8RA 1Y7RA 3D2MA 3FB3A 4F6AA 2CNTA 1M4IA 3TOBA 4GS4A 2J8MA 2EUIA 3DNSA 4KOVA 2RC4A 3EY5A 4EVYA 2ATRA 4KOUA 3H4QA 1KUVA 4R9MA 4KOWA 4KUAA 2IL4A 1J4JA 4MY3A 3EXNA 2B4DA 4CRYB 1I12A 1P4NA 3R95A 5KTCA 1NSLA 4XNHB 4KOSA 3R96A 1R57A 1MK4A 3G3SA 1XF8A 2D4OA 1M4GA 1YLEA 4HNWB 2GIVA 3T90A 1YVKA 2B4BA 4RI1A 4FD7A 1MJ9A 1K4JA 5JPHA 4I49A 4R3LA 2REFA 3D2PA 4CS0B 1V0CA 2NMTA 2P6EA 3KKWA 4MBUA 5DWNA 3MGDA 1OZPA 2EVNA 2VEZA 2Q04A 2WPXA 2FL4A 1Q2DA 1IIDA 1GHEA 3I3GA 3BJ8A 4J3GA 3W6SA 4PK3A 4E2AA 3EC4A 4UWJA 4PV6A 3S6FA 4H89A 2BUEA 2QECA 3SHPA 1KUYA 2AE6A 2CNMA 2R7HA 2OH1A 4KVME 1SQHA 3TOAA 2JDDA 4R3KA 2K5TA 2G0BA 1N71A 3QB8A 2B5GA 1QSNA 2GE3A 2Z11A 4H6ZA 2G3AA 2BEIA 3TO9A 2R1IA 5C88A 1S7LA 2HV2A 4XPKA 3I9SA 1YGHA 2Z0ZA 2ZXVA 4PSWA 4XPLA 1QSOA 1NMTA 2B4DB 2VI7A 4KORA 4ORFA 4OAEA 2FE7A 4XPDC 2AJ6A 2Z10A 4CRZB 2HQYA 1B6BA 4U9ZA 4JLYA 4QBJA 2VZZA 4KOYA 2P6GA 2O28A 3FIXA 5F48A 3CXPA 4B5OA 4XNHC 1YK3A 3FYNA 1S3ZA 4QUSA 1U6MA 2B3UA 4YFJA 4QC6A 4FD6A 5IB0A 4XPDB 3JUWA 2G3TA 5DWMA 4QB9A 2VXKA 2J8NA 3CXQA 3R9FA 2OZGA 3VWEA 5IV0A 4HKFA 3V8IA 2F5IA 1XIXA 3T9YA 3RYOA 2C27A 2ZW6A 4ZBGA 1M44A 2X7BA 1S7KA 1YR0A 4CAXA 1MJAA 4OADA 2BL1A 2I00A 4E8OA 2OB0A 3FBUA 1P0HA 4X5KA 3P2FA 4B5PA 4AVCA 4NEXA 3C26A 4RS2A 2OZHA 5H84A 3PGPA 2H5MA 2OZUA 4PK2A 1S5KA 1RO5A 2B5GB 3F8KA 3IWGA 4IF5A 2PC1A 3CXSA 1MJBA 1Q2YA 4ONUA 3K9UA 2ZW5A 4YGOA 2VQYA 4R57A 3B8GA 5E96A 3GY9A 4DNCA 2FT0A 2FS5A 2ARHA 4MI4A 5FVJA 4HNXB 1QSTA 1M4DA 1IYKA 4FD4A 1IICA 3VWDA 2FSRA 1QSRA 4MY0A 3D8PA 4KLVA 4L89A 4CAVA 4QVTA 3ZZIA 3EO4A 1PU9A 3BLNA 3FNCA 2Q4YA 3DR8A 3TT2A 1KUXA 4KVOE 2ZW7A 4H6UA 1B87A 1IYLA 3OWCA 3E0KA 4IUSA 2ZPAA 3TO7A 2QIRA 3GKRA 3TO6A 3F0AA 5J8FA 3F5BA 1I1DA 2Q0YA 1XE4A 1M1DA 3GYAA 5EC4A 4PSXA 4JJXA 2R98A 2CY2A 5CNPA 4AVAA 3PP9A 3TFYA 5JQ4A 4U9YA 3D3SA 4AG7A 2B3VA 2QMLA 4JXRA 2ZW4A 4JWPA 4KOTA 4AVBA 3DSBA 3FRMA 2REEA 4HNYB 4KOXA 2Q4VA 2CNSA 3IGRA 2A4NA 5C82A 4M3SA 4NSQA 1Y9WA 2Q7BA 3BJ7A 3WR7A 5EBVA 1ON0A 4KUBA 3W91A 4AG9A 4F0YA 1I21A 1CJWA 4NXYA 2PSWA 5I0CA 2JEVA 1LRZA 2PR8A 4Y49B 3TTHA 5H86A 5J8CA 3NE7A 4MJ8A 2FXFA 4KZTA 2P0WA 2KCWA 1YX0A 1XEBA 4KLWA 4BMHA 3DR6A 2B58A 4CAWA 3S6KA 1YREA 2Y0MA 2HUZA 5IX3A 2P6FA 5F46A 5KTDA 3JVNA 5HH1A 4LX9A 4YRHA 1FY7A 3FXTA 2PR1A 2JDCA 2FIWA 1S60A 5HMNA 3ZJ0A 4OLLA 3R1KA 3TCVA 4U5YA 3R9EA 2FCKA 1XMTA 3SXOA 3UY5A 1VHSA 2PDOA 4JD6A 1L0CA 3LODA 3TE4A 3N7ZA 4M85A 1Z9UA 4LUAA 1YVOA 4UWIA 3QAHA 2PRBA 2JLMA 2WPWA 4UA3A 2R8VA 1Q2CA 4KVXA 1S7FA 1NE9A 4K30A 4R87A 1S7NA 5KTAA 4MHDA 1UFHA 4II9A 1RXTA 1WK4A 5ISVA 3S6HA 2FIAA 3R9GA 3DDDA 2PQ8A 4JXQA 4E0AA 3S6GA 3PZJA 1QSMA 4NF1A 2VZYA 3G8WA 1CM0A 2I79A 5F49A
chains in the Genus database with same CATH superfamily
1Y9KA 2BSWA 3SJGA 1KZFA 3PBEA 4FD5A 4G1PA 4K3NA 2D4PA 4P4FA 1A2ZA 2J9AA 1DE4C 4L8AA 1Z4RA 4Q7AA 3SXNA 1IB1E 2VBQA 4R8FA 4UBRA 4AB7A 5LYLA 1TIQA 4A38A 2XEFA 4EMEA 5I4MA 4MFZA 5F47A 1LCPA 1Z4EA 2GANA 4B5PB 1AMPA 4A2ZA 4FAIA 4A30A 5GCNA 4Y49C 2AFMA 3WT4A 2Q7SA 4F0XA 4BBHA 2AFUA 2NSMA 4A94A 2PJAA 3VARA 2YNDA 3PFOA 1PUAA 2DXQA 1BO4A 3RZAA 1VKCA 1ARMA 4NCZA 3T8WA 3PB7X 2PJ3A 1WWZA 2OU2A 3JTKA 3EFAA 3WC6A 2JEWA 3W6XA 4O23A 2AFOA 4DUKA 4X8IA 4F9VA 2DEAA 4IK2A 4C7HA 3SI2A 1BOBA 3P2HA 2Q44A 3LD2A 1BLLE 2J8RA 1Y7RA 2O53A 3D2MA 4KSAA 4X2TA 1YW6A 2Q51A 3FB3A 4F6AA 2CNTA 1M4IA 3TOBA 4ONWA 5DS0A 1R43A 4A33A 4GS4A 2CTCA 2J8MA 2EUIA 1LAPA 3DNSA 2WUUA 4KOVA 2RC4A 3EY5A 4EVYA 4KSFA 4PXDA 2ATRA 4KOUA 3H4QA 1KUVA 2BO9A 2G9DA 4KOWA 4R9MA 3D7DA 2IL4A 4KUAA 4MMOA 4DJLA 1J4JA 5J1QA 4MY3A 2EK9A 7CPAA 4NGMA 4DYOA 3EXNA 2B4DA 3B3VA 4MCSA 4CRYB 1I12A 2V8DA 4M6GA 1P4NA 4UEZA 3R95A 1NSLA 1Y7EA 4XNHB 5K8PA 4KOSA 2DPTA 4NGSA 5KTCA 3R96A 1JWQA 1MK4A 1R57A 5BWAB 2PE3A 3G3SA 2C6GA 1XF8A 1PYTB 4P44A 2D4OA 1M4GA 4Q36A 1YLEA 4HNWB 1Q7LA 2GIVA 2ZEPA 3T90A 1YVKA 2B4BA 5JH9A 4RI1A 4FD7A 3QNVA 5LRJA 4MHZA 3JRUA 3MRUA 2WZNA 1MJ9A 1K4JA 4B14A 5JPHA 1BPMA 1YW4A 4I49A 4OMEA 2EWBA 4C68A 4R3LA 3BHXA 4FWUA 2REFA 3D2PA 4CS0B 1V0CA 1H8LA 3D66A 2NMTA 4CGPA 2PJ2A 3B3WA 2P6EA 3D4UA 3KKWA 1BAVA 4MBUA 5DWNA 3MGDA 4ZX8A 3SI0A 1OZPA 1Z8LA 3RNZA 2EVNA 3FECA 3PFEA 5LYDA 2VEZA 2Q04A 2WPXA 2PIYA 2FL4A 4PXBA 2JBKA 3KZWA 5F09A 1Q2DA 3IIBA 4C2YA 1IIDA 1GHEA 3I3GA 4C7IA 3BJ8A 2ZEMA 4J3GA 3W6SA 3SI1A 2IQ6A 3RAMA 1YMEA 2V8HA 4PK3A 4M6IA 4UEFA 4E2AA 3LMSA 3EC4A 5K8MA 1ZLIA 4UWJA 4A37A 3CDXA 4PV6A 3S6FA 2V8GA 3FEDA 4H89A 4P4IA 2BUEA 2QECA 2WSAA 3SHPA 1KUYA 2VL1A 2AE6A 3DLJA 1F2OA 3IWWA 1LANA 4KSIA 2C1CA 1FT7A 3IC1A 4XPLA 4OKOA 5G20A 4UF4A 4NGPA 2PJCA 2ZOFA 2CNMA 2AFWA 2R7HA 4UIAA 2OH1A 5AG4A 4KVME 2PRQA 3GLJA 1SQHA 2YNCA 4NGNA 1Z2LA 3D67A 5HVFA 3TOAA 2JDDA 3FEEA 4R3KA 5D29A 4CGOA 2CTBA 2K5TA 3IJ3A 1CG2A 3IEHA 2G0BA 1N71A 3N5FA 3QB8A 3B7IA 4A95A 4TWEA 3B3CA 5AGEA 2B5GA 4R76A 1QSNA 2GE3A 2Z11A 2RB7A 4RUHA 4H6ZA 3KL9A 4B11A 3IFEA 2G3AA 1LFWA 3FJUA 2BEIA 3TO9A 4OC2A 2R1IA 2ZEGA 5C88A 4OIWA 1S7LA 2Z3OA 2HV2A 4XPKA 1CP7A 3I9SA 4ZI6A 1VHOA 5CBMA 1YGHA 2Z0ZA 2V8VA 2ZXVA 3BI0A 3PB6X 1QSOA 3L2NA 4NGRA 4PSWA 4WJBA 1NMTA 2B4DB 2AFZA 3PB8X 2VI7A 1ELMP 4KORA 4ORFA 4MRIA 1OBRA 1NSAA 4OAEA 2FE7A 2EK8A 4XPDC 2AJ6A 2GREA 2Z10A 4CRZB 1XBUA 2HQYA 3TX8A 1B6BA 1TF9A 2QVPA 4U9ZA 2Q43A 1VIXA 4JLYA 4MHYA 4QBJA 3H8EA 2BOAA 1PCAA 3D68A 3GIUA 1QMUA 4MCPA 2VZZA 2V77A 3CT9A 2RFHA 1VHEA 4KOYA 2P6GA 2O28A 3FIXA 5F48A 2Z3PA 3CXPA 3KGQA 4A39A 4XNHC 2PJ4A 4B5OA 1XJOA 3S9MA 1YK3A 5ELYA 4TNUA 2CF4A 5HVGA 4IHMA 3FYNA 1S3ZA 4QUSA 2Z3MA 1DTDA 1U6MA 3IWEA 2B3UA 3ISXA 4YFJA 4QC6A 2O4HA 4FD6A 5IB0A 4XPDB 5LYIA 3JUWA 2G3TA 5DWMA 4QB9A 2VXKA 3VATA 4UCNA 2J8NA 2HC9A 3H8FA 3V7ZA 1TF8A 3CXQA 1TXRA 3R9FA 2OZGA 4ZGYB 3PB9X 4OC1A 4P4DA 3V8IA 2GLJA 3VWEA 3B3TA 4NGTA 1XMBA 5IV0A 2PVWA 5HXDA 2AFSA 1TKHA 3BI1A 2F5IA 1XIXA 2Q4ZA 3D7GA 4HKFA 2NYQA 2C27A 3RYOA 3T9YA 1CP6A 2PJ7A 3B2YA 3BXMA 2ZW6A 4ZBGA 1M44A 2X7BA 1S7KA 3RBUA 4A32A 1YR0A 2ABZA 1MJAA 3NE8A 2OR4A 4OADA 2FVGA 4CAXA 3WC7A 2BL1A 4YWYA 1R3NA 2I00A 4E8OA 1UWYA 2OB0A 3FBUA 1P0HA 4P45A 4X5KA 4ZYQA 1IY7A 3P2FA 3SJFA 4ZY1A 5JM6A 1KWMA 4B5PA 4AVCA 2POKA 2EBJA 2PJ5A 4NEXA 2CXAA 3C26A 4RS2A 1QQ9A 2OZHA 4P4BA 5H84A 3PGPA 2H5MA 1IGBA 2OZUA 1ZLHA 3PBBA 3NH8A 4PPZA 4PK2A 1S5KA 1RO5A 2B5GB 5G21A 4B13A 3F8KA 3IWGA 4MFJA 5THWA 2PVVA 4IF5A 2GLFA 1LAMA 2PC1A 1MJBA 3CXSA 2QJ8A 1Q2YA 4HPSA 2ZEOA 2C6PA 4MFQA 4ONUA 3K9UA 4OIDA 4UEEA 2ZW5A 4YGOA 2XEGA 5AG5A 2VQYA 4R57A 3K9TA 3B8GA 5E96A 3GY9A 4CPAA 3FH4A 3GB0A 4DNCA 2FT0A 2FS5A 2ARHA 4MI4A 5FVJA 1YLOA 2AFXA 4HNXB 1YSJA 1QSTA 1M4DA 1IYKA 4BINA 4FD4A 1IICA 4OP4A 3VWDA 1IOIA 4NJRA 2FSRA 3K2KA 1IOFA 1QSRA 4MY0A 4Q38A 3D8PA 4BD9A 2GFQA 1ZG8A 4KLVA 4L89A 3PRTA 2I3CA 1HDQA 3NH4A 4NFRA 4QVTA 4CAVA 3ZZIA 3EO4A 1PU9A 2EO8A 2PIZA 5A27A 3BLNA 4KS9A 1Z8WA 1Z8TA 3FNCA 2Q4YA 3DR8A 3TT2A 1KUXA 2YGWA 4KVOE 2ZW7A 5G22A 3KHXA 4CYOA 4F8ZA 4CGNA 4H6UA 1B87A 1IYLA 3OWCA 2CIJA 2PJ6A 1ZO0A 4B10A 4CGMA 1XRYA 3D7FA 3E0KA 3GUXA 3IO1A 4IUSA 2F7VA 2ZENA 2ZPAA 3NFZA 3TO7A 5K8NA 1BPNA 4CYPA 1FNOA 5IB9A 2QIRA 3GKRA 3KR4A 3F0AA 3TO6A 3F5BA 5J8FA 1I1DA 3KHZA 2Q0YA 1XE4A 1GYTA 1M1DA 3GYAA 3NH5A 3WC5A 4R7MA 5EC4A 3B3SA 4ZX9A 3RO0A 4Z65A 4OC0A 3PB4X 4PXEA 4F9UA 1LOKA 4PSXA 3NA6A 5AG7A 2GU2A 4JJXA 2PJBA 2R98A 3H8GA 2PJ8A 4NGQA 3SJEA 2CY2A 2PJ1A 3PEIA 4GXHA 5CNPA 4AVAA 1AUGA 4UFWA 2Z3LA 1YQEA 1TKFA 3PP9A 4PXCA 3KQXA 3TFYA 3B35A 4LQGA 4U9YA 5JQ4A 3D3SA 4FUUA 4AG7A 2ZEFA 2B3VA 2QMLA 2QYVA 3FX6A 4JXRA 2ZW4A 4JWPA 4KOTA 4OC4A 4AVBA 1TKJA 2F8HA 3DSBA 3FRMA 3TC8A 2REEA 4HNYB 4KOXA 5AG6A 2Q4VA 3KQZA 2CNSA 3IGRA 2PJ9A 3FVLA 3S9LA 6CPAA 2PCUA 2A4NA 4P4JA 5C82A 4M3SA 4NSQA 1Y9WA 2Q7BA 1XFOA 3BJ7A 3WR7A 2HB6A 4P6YA 4B12A 1CPXA 4EFDA 4CYNA 5EBVA 1HDUA 4CAEA 3D7HA 1ON0A 3FF3A 3LACA 2YNCC 4A31A 1ARLA 1XOVA 4KUBA 3FMCA 3W91A 4AG9A 4F0YA 8CPAA 1I21A 1CJWA 4NXYA 1CX8A 1HEEA 2PSWA 5I0CA 3H5ZA 4CGLA 4P4EA 4IAVA 2JEVA 1LRZA 3CPXA 4MFPA 5EMIA 2PR8A 1IU8A 4Y49B 3TTHA 4MCQA 1X10A 2PJ0A 5H86A 3SJXA 5J8CA 3I1UA 3NE7A 4MJ8A 2FXFA 4OC3A 4KZTA 4MHPA 2P0WA 2WYRA 1Z8XA 2KCWA 2ZEEA 4UFXA 1YX0A 3HLPA 3KASA 4JZ0A 2DF5A 1CBXA 1ZG9A 2OOTA 3VH9A 1XEBA 4MFLA 4KLWA 4BMHA 4MCRA 3DR6A 3KI9A 3QAYA 4OC5A 4M6HA 4JYWA 2B58A 3MN8A 4CAWA 3S6KA 1ELLP 1YREA 2Y0MA 2HUZA 5IX3A 4C2XA 2P6FA 1X12A 3LWUA 4W9YA 5F46A 3ISZA 5KTDA 3S9NA 4C2ZA 3JVNA 5HH1A 2ZEHA 2ZEDA 4LX9A 4YRHA 1FY7A 3CPAA 3IU1A 3FXTA 2PR1A 2JDCA 2FIWA 1S60A 5HMNA 5LRGA 3ZJ0A 2ANPA 2BCOA 3R1KA 4OLLA 2C6CA 3TCVA 4AXVA 1F2PA 4U5YA 5D8NA 3R9EA 2FCKA 1XMTA 3SXOA 3UY5A 1Y0YA 1VHSA 2PDOA 4JD6A 4P10A 1L0CA 3LODA 3TE4A 1Y0RA 2XEJA 3WABA 3N7ZA 2IMOA 4M85A 1EE3P 1Z9UA 4B6ZA 4LUAA 4ZY2A 1YVOA 4UWIA 1Z5RA 3QAHA 5JGFA 2PRBA 4MHNA 2ZELA 5G1ZA 3IU2A 4RN7A 4CAFA 2JLMA 2ZOGA 5LRKA 5CPAA 2WPWA 4UA3A 4UCPA 1F57A 2R8VA 1Q2CA 4UCMA 4KVXA 4YU9A 1S7FA 1M4LA 1NE9A 3DGVA 4NJQA 4K30A 4R87A 5A28A 1S7NA 5KTAA 4MFKA 1UFHA 4MHDA 4EWTA 4X3RA 4II9A 1VGYA 1RXTA 1WK4A 5ISVA 3S6HA 2IJZA 2FIAA 2DPSA 2JBJA 4MXUA 4GM5A 3V38A 4PQAA 3R9GA 3CZXA 2PQ8A 3DDDA 4JXQA 4LQ6A 3A9LA 4R6TA 4FBEA 1RTQA 2Z3KA 5K8OA 4WWVA 4H2KA 4UIBA 3S6GA 3PZJA 2XEIA 4CYQA 4E0AA 4ZY0A 5HVHA 2ODFA 1JQGA 4UFVA 1QSMA 3HUVA 1ZG7A 1AYEA 4NF1A 2VZYA 3G8WA 1CM0A 1CPSA 2YNEA 5LYFA 2I79A 2Z3NA 5F49A 3KR5A
chains in the Genus database with same CATH topology
1Y9KA 2BSWA 1KZFA 4FD5A 2D4PA 4L8AA 1Z4RA 3SXNA 1IB1E 2VBQA 4UBRA 4AB7A 1TIQA 4MFZA 5F47A 4B5PB 1Z4EA 2GANA 4A2ZA 4A30A 5GCNA 4Y49C 4F0XA 4BBHA 2YNDA 1PUAA 2DXQA 1BO4A 1VKCA 4NCZA 1WWZA 2OU2A 3JTKA 3EFAA 3W6XA 4C7HA 1BOBA 3P2HA 2Q44A 3LD2A 4KSAA 2J8RA 1Y7RA 3D2MA 3FB3A 4F6AA 2CNTA 1M4IA 3TOBA 4A33A 4GS4A 2J8MA 2EUIA 3DNSA 2WUUA 4KOVA 2RC4A 3EY5A 4EVYA 4KSFA 2ATRA 4KOUA 3H4QA 1KUVA 4R9MA 4KOWA 4KUAA 2IL4A 1J4JA 4MY3A 3EXNA 2B4DA 4CRYB 1I12A 1P4NA 3R95A 5KTCA 1NSLA 4XNHB 4KOSA 2DPTA 3R96A 1R57A 1MK4A 5BWAB 3G3SA 1XF8A 2D4OA 1M4GA 4Q36A 1YLEA 4HNWB 2GIVA 3T90A 1YVKA 2B4BA 4RI1A 4FD7A 1MJ9A 1K4JA 4B14A 5JPHA 4I49A 4C68A 4R3LA 2REFA 3D2PA 4CS0B 1V0CA 2NMTA 4CGPA 2P6EA 3KKWA 4MBUA 5DWNA 3MGDA 1OZPA 2EVNA 2VEZA 2Q04A 2WPXA 2FL4A 1Q2DA 4C2YA 1IIDA 1GHEA 3I3GA 4C7IA 3BJ8A 4J3GA 3W6SA 4PK3A 4E2AA 3EC4A 4UWJA 4PV6A 3S6FA 4H89A 2BUEA 2QECA 2WSAA 3SHPA 1KUYA 2AE6A 5G20A 2CNMA 2R7HA 2OH1A 5AG4A 4KVME 1SQHA 2YNCA 3TOAA 2JDDA 4R3KA 4CGOA 2K5TA 4A95A 2G0BA 1N71A 3QB8A 5AGEA 2B5GA 1QSNA 2GE3A 2Z11A 4H6ZA 4B11A 2G3AA 2BEIA 3TO9A 2R1IA 5C88A 1S7LA 2Z3OA 2HV2A 4XPKA 3I9SA 1YGHA 2Z0ZA 2ZXVA 4PSWA 4XPLA 1QSOA 1NMTA 2B4DB 2VI7A 4KORA 4ORFA 4OAEA 2FE7A 4XPDC 2AJ6A 2Z10A 4CRZB 2HQYA 1B6BA 4U9ZA 4JLYA 4QBJA 2VZZA 4KOYA 2P6GA 2O28A 3FIXA 5F48A 2Z3PA 3CXPA 4B5OA 4XNHC 1YK3A 3FYNA 1S3ZA 4QUSA 2Z3MA 1U6MA 3IWEA 2B3UA 4YFJA 4QC6A 4FD6A 5IB0A 4XPDB 3JUWA 2G3TA 5DWMA 4QB9A 2VXKA 4UCNA 2J8NA 3CXQA 3R9FA 2OZGA 4ZGYB 3VWEA 5IV0A 4HKFA 3V8IA 2F5IA 1XIXA 3T9YA 3RYOA 2C27A 2ZW6A 4ZBGA 1M44A 2X7BA 1S7KA 4A32A 1YR0A 4CAXA 1MJAA 4OADA 2BL1A 2I00A 4E8OA 2OB0A 3FBUA 1P0HA 4X5KA 3P2FA 4B5PA 4AVCA 4NEXA 2CXAA 3C26A 4RS2A 2OZHA 5H84A 3PGPA 2H5MA 2OZUA 4PK2A 1S5KA 1RO5A 2B5GB 5G21A 4B13A 3F8KA 3IWGA 4MFJA 4IF5A 2PC1A 3CXSA 1MJBA 1Q2YA 4MFQA 4ONUA 3K9UA 2ZW5A 4YGOA 5AG5A 2VQYA 4R57A 3B8GA 5E96A 3GY9A 4DNCA 2FT0A 2FS5A 2ARHA 4MI4A 5FVJA 4HNXB 1QSTA 1M4DA 1IYKA 4FD4A 1IICA 3VWDA 4Q38A 2FSRA 1QSRA 4MY0A 3D8PA 4KLVA 4L89A 4CAVA 4QVTA 3ZZIA 3EO4A 1PU9A 5A27A 3BLNA 4KS9A 3FNCA 2Q4YA 3DR8A 3TT2A 1KUXA 2YGWA 4KVOE 2ZW7A 5G22A 4CYOA 4CGNA 4H6UA 1B87A 1IYLA 3OWCA 4B10A 1ZO0A 4CGMA 3E0KA 4IUSA 2ZPAA 3TO7A 4CYPA 2QIRA 3GKRA 3TO6A 3F0AA 5J8FA 3F5BA 1I1DA 2Q0YA 1XE4A 1M1DA 3GYAA 5EC4A 4PSXA 5AG7A 4JJXA 2R98A 2CY2A 5CNPA 4AVAA 4UFWA 2Z3LA 3PP9A 3TFYA 5JQ4A 4U9YA 3D3SA 4AG7A 2B3VA 2QMLA 4JXRA 2ZW4A 4JWPA 4KOTA 4AVBA 3DSBA 3FRMA 2REEA 4HNYB 4KOXA 5AG6A 2Q4VA 2CNSA 3IGRA 2A4NA 5C82A 4M3SA 4NSQA 1Y9WA 2Q7BA 3BJ7A 3WR7A 4B12A 4CYNA 5EBVA 4CAEA 1ON0A 2YNCC 4A31A 4KUBA 3W91A 4AG9A 4F0YA 1I21A 1CJWA 4NXYA 2PSWA 5I0CA 3H5ZA 4CGLA 2JEVA 1LRZA 4MFPA 2PR8A 4Y49B 3TTHA 5H86A 5J8CA 3NE7A 4MJ8A 2FXFA 4KZTA 2P0WA 2KCWA 4UFXA 1YX0A 1XEBA 4MFLA 4KLWA 4BMHA 3DR6A 2B58A 4CAWA 3S6KA 1YREA 2Y0MA 2HUZA 5IX3A 4C2XA 2P6FA 5F46A 5KTDA 4C2ZA 3JVNA 5HH1A 4LX9A 4YRHA 1FY7A 3IU1A 3FXTA 2PR1A 2JDCA 2FIWA 1S60A 5HMNA 3ZJ0A 4OLLA 3R1KA 3TCVA 4U5YA 3R9EA 2FCKA 1XMTA 3SXOA 3UY5A 1VHSA 2PDOA 4JD6A 1L0CA 3LODA 3TE4A 3N7ZA 4M85A 1Z9UA 4LUAA 1YVOA 4UWIA 3QAHA 2PRBA 5G1ZA 3IU2A 4CAFA 2JLMA 2WPWA 4UA3A 4UCPA 2R8VA 1Q2CA 4UCMA 4KVXA 1S7FA 5A28A 1NE9A 4K30A 4R87A 1S7NA 5KTAA 4MFKA 1UFHA 4MHDA 4II9A 1RXTA 1WK4A 5ISVA 3S6HA 2FIAA 2DPSA 3R9GA 3DDDA 2PQ8A 4JXQA 3A9LA 2Z3KA 4E0AA 4CYQA 3S6GA 3PZJA 4UFVA 1QSMA 4NF1A 2VZYA 3G8WA 1CM0A 2YNEA 2I79A 2Z3NA 5F49A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Y9K A;  2BSW A;  1KZF A;  4FD5 A;  2D4P A;  4L8A A;  1Z4R A;  3SXN A;  1IB1 E;  2VBQ A;  4UBR A;  4AB7 A;  1TIQ A;  5F47 A;  4B5P B;  1Z4E A;  2GAN A;  5GCN A;  4Y49 C;  1PUA A;  2DXQ A;  1BO4 A;  1VKC A;  4NCZ A;  1WWZ A;  2OU2 A;  3EFA A;  3W6X A;  1BOB A;  3P2H A;  2Q44 A;  3LD2 A;  2J8R A;  1Y7R A;  3D2M A;  3FB3 A;  4F6A A;  2CNT A;  1M4I A;  3TOB A;  4GS4 A;  2J8M A;  2EUI A;  3DNS A;  4KOV A;  2RC4 A;  3EY5 A;  4EVY A;  2ATR A;  4KOU A;  3H4Q A;  1KUV A;  4R9M A;  4KOW A;  4KUA A;  2IL4 A;  1J4J A;  4MY3 A;  3EXN A;  2B4D A;  4CRY B;  1I12 A;  1P4N A;  3R95 A;  5KTC A;  1NSL A;  4XNH B;  4KOS A;  3R96 A;  1R57 A;  1MK4 A;  3G3S A;  1XF8 A;  2D4O A;  1M4G A;  1YLE A;  4HNW B;  2GIV A;  3T90 A;  1YVK A;  2B4B A;  4RI1 A;  4FD7 A;  1MJ9 A;  1K4J A;  5JPH A;  4I49 A;  4R3L A;  2REF A;  3D2P A;  4CS0 B;  1V0C A;  2NMT A;  2P6E A;  3KKW A;  4MBU A;  5DWN A;  3MGD A;  1OZP A;  2EVN A;  2VEZ A;  2Q04 A;  2WPX A;  2FL4 A;  1Q2D A;  1IID A;  1GHE A;  3I3G A;  3BJ8 A;  4J3G A;  3W6S A;  4PK3 A;  4E2A A;  3EC4 A;  4UWJ A;  4PV6 A;  3S6F A;  4H89 A;  2BUE A;  2QEC A;  3SHP A;  1KUY A;  2AE6 A;  2CNM A;  2R7H A;  2OH1 A;  4KVM E;  1SQH A;  3TOA A;  2JDD A;  4R3K A;  2K5T A;  2G0B A;  1N71 A;  3QB8 A;  2B5G A;  1QSN A;  2GE3 A;  2Z11 A;  4H6Z A;  2G3A A;  2BEI A;  3TO9 A;  2R1I A;  5C88 A;  1S7L A;  2HV2 A;  4XPK A;  3I9S A;  1YGH A;  2Z0Z A;  2ZXV A;  4PSW A;  4XPL A;  1QSO A;  1NMT A;  2B4D B;  2VI7 A;  4KOR A;  4ORF A;  4OAE A;  2FE7 A;  4XPD C;  2AJ6 A;  2Z10 A;  4CRZ B;  2HQY A;  1B6B A;  4U9Z A;  4JLY A;  4QBJ A;  2VZZ A;  4KOY A;  2P6G A;  2O28 A;  3FIX A;  5F48 A;  3CXP A;  4B5O A;  4XNH C;  1YK3 A;  3FYN A;  1S3Z A;  4QUS A;  1U6M A;  2B3U A;  4YFJ A;  4QC6 A;  4FD6 A;  5IB0 A;  4XPD B;  3JUW A;  2G3T A;  5DWM A;  4QB9 A;  2VXK A;  2J8N A;  3CXQ A;  3R9F A;  2OZG A;  3VWE A;  5IV0 A;  4HKF A;  3V8I A;  2F5I A;  1XIX A;  3T9Y A;  3RYO A;  2C27 A;  2ZW6 A;  4ZBG A;  1M44 A;  2X7B A;  1S7K A;  1YR0 A;  4CAX A;  1MJA A;  4OAD A;  2BL1 A;  2I00 A;  4E8O A;  2OB0 A;  3FBU A;  1P0H A;  4X5K A;  3P2F A;  4B5P A;  4AVC A;  4NEX A;  3C26 A;  4RS2 A;  2OZH A;  5H84 A;  3PGP A;  2H5M A;  2OZU A;  4PK2 A;  1S5K A;  1RO5 A;  2B5G B;  3F8K A;  3IWG A;  4IF5 A;  2PC1 A;  3CXS A;  1MJB A;  1Q2Y A;  4ONU A;  3K9U A;  2ZW5 A;  4YGO A;  2VQY A;  4R57 A;  3B8G A;  5E96 A;  3GY9 A;  4DNC A;  2FT0 A;  2FS5 A;  2ARH A;  4MI4 A;  5FVJ A;  4HNX B;  1QST A;  1M4D A;  1IYK A;  4FD4 A;  1IIC A;  3VWD A;  2FSR A;  1QSR A;  4MY0 A;  3D8P A;  4KLV A;  4L89 A;  4CAV A;  4QVT A;  3ZZI A;  3EO4 A;  1PU9 A;  3BLN A;  3FNC A;  2Q4Y A;  3DR8 A;  3TT2 A;  1KUX A;  4KVO E;  2ZW7 A;  4H6U A;  1B87 A;  1IYL A;  3OWC A;  3E0K A;  4IUS A;  2ZPA A;  3TO7 A;  2QIR A;  3GKR A;  3TO6 A;  3F0A A;  5J8F A;  3F5B A;  1I1D A;  2Q0Y A;  1XE4 A;  1M1D A;  3GYA A;  5EC4 A;  4PSX A;  4JJX A;  2R98 A;  2CY2 A;  5CNP A;  4AVA A;  3PP9 A;  3TFY A;  5JQ4 A;  4U9Y A;  3D3S A;  4AG7 A;  2B3V A;  2QML A;  4JXR A;  2ZW4 A;  4JWP A;  4KOT A;  4AVB A;  3DSB A;  3FRM A;  2REE A;  4HNY B;  4KOX A;  2Q4V A;  2CNS A;  3IGR A;  2A4N A;  5C82 A;  4M3S A;  4NSQ A;  1Y9W A;  2Q7B A;  3BJ7 A;  3WR7 A;  5EBV A;  1ON0 A;  4KUB A;  3W91 A;  4AG9 A;  4F0Y A;  1I21 A;  1CJW A;  4NXY A;  2PSW A;  5I0C A;  2JEV A;  1LRZ A;  2PR8 A;  4Y49 B;  3TTH A;  5H86 A;  5J8C A;  3NE7 A;  4MJ8 A;  2FXF A;  4KZT A;  2P0W A;  2KCW A;  1YX0 A;  1XEB A;  4KLW A;  4BMH A;  3DR6 A;  2B58 A;  4CAW A;  3S6K A;  1YRE A;  2Y0M A;  2HUZ A;  5IX3 A;  2P6F A;  5F46 A;  5KTD A;  3JVN A;  5HH1 A;  4LX9 A;  4YRH A;  1FY7 A;  3FXT A;  2PR1 A;  2JDC A;  2FIW A;  1S60 A;  5HMN A;  3ZJ0 A;  4OLL A;  3R1K A;  3TCV A;  4U5Y A;  3R9E A;  2FCK A;  1XMT A;  3SXO A;  3UY5 A;  1VHS A;  2PDO A;  4JD6 A;  1L0C A;  3LOD A;  3TE4 A;  3N7Z A;  4M85 A;  1Z9U A;  4LUA A;  1YVO A;  4UWI A;  3QAH A;  2PRB A;  2JLM A;  2WPW A;  4UA3 A;  2R8V A;  1Q2C A;  4KVX A;  1S7F A;  1NE9 A;  4K30 A;  4R87 A;  1S7N A;  5KTA A;  4MHD A;  1UFH A;  4II9 A;  1RXT A;  1WK4 A;  5ISV A;  3S6H A;  2FIA A;  3R9G A;  3DDD A;  2PQ8 A;  4JXQ A;  4E0A A;  3S6G A;  3PZJ A;  1QSM A;  4NF1 A;  2VZY A;  3G8W A;  1CM0 A;  2I79 A;  5F49 A; 
#chains in the Genus database with same CATH topology
 1Y9K A;  2BSW A;  3SJG A;  1KZF A;  3PBE A;  4FD5 A;  4G1P A;  4K3N A;  2D4P A;  4P4F A;  1A2Z A;  2J9A A;  1DE4 C;  4L8A A;  1Z4R A;  4Q7A A;  3SXN A;  1IB1 E;  2VBQ A;  4R8F A;  4UBR A;  4AB7 A;  5LYL A;  1TIQ A;  4A38 A;  2XEF A;  4EME A;  5I4M A;  4MFZ A;  5F47 A;  1LCP A;  1Z4E A;  2GAN A;  4B5P B;  1AMP A;  4A2Z A;  4FAI A;  4A30 A;  5GCN A;  4Y49 C;  2AFM A;  3WT4 A;  2Q7S A;  4F0X A;  4BBH A;  2AFU A;  2NSM A;  4A94 A;  2PJA A;  3VAR A;  2YND A;  3PFO A;  1PUA A;  2DXQ A;  1BO4 A;  3RZA A;  1VKC A;  1ARM A;  4NCZ A;  3T8W A;  3PB7 X;  2PJ3 A;  1WWZ A;  2OU2 A;  3JTK A;  3EFA A;  3WC6 A;  2JEW A;  3W6X A;  4O23 A;  2AFO A;  4DUK A;  4X8I A;  4F9V A;  2DEA A;  4IK2 A;  4C7H A;  3SI2 A;  1BOB A;  3P2H A;  2Q44 A;  3LD2 A;  1BLL E;  2J8R A;  1Y7R A;  2O53 A;  3D2M A;  4KSA A;  4X2T A;  1YW6 A;  2Q51 A;  3FB3 A;  4F6A A;  2CNT A;  1M4I A;  3TOB A;  4ONW A;  5DS0 A;  1R43 A;  4A33 A;  4GS4 A;  2CTC A;  2J8M A;  2EUI A;  1LAP A;  3DNS A;  2WUU A;  4KOV A;  2RC4 A;  3EY5 A;  4EVY A;  4KSF A;  4PXD A;  2ATR A;  4KOU A;  3H4Q A;  1KUV A;  2BO9 A;  2G9D A;  4KOW A;  4R9M A;  3D7D A;  2IL4 A;  4KUA A;  4MMO A;  4DJL A;  1J4J A;  5J1Q A;  4MY3 A;  2EK9 A;  7CPA A;  4NGM A;  4DYO A;  3EXN A;  2B4D A;  3B3V A;  4MCS A;  4CRY B;  1I12 A;  2V8D A;  4M6G A;  1P4N A;  4UEZ A;  3R95 A;  1NSL A;  1Y7E A;  4XNH B;  5K8P A;  4KOS A;  2DPT A;  4NGS A;  5KTC A;  3R96 A;  1JWQ A;  1MK4 A;  1R57 A;  5BWA B;  2PE3 A;  3G3S A;  2C6G A;  1XF8 A;  1PYT B;  4P44 A;  2D4O A;  1M4G A;  4Q36 A;  1YLE A;  4HNW B;  1Q7L A;  2GIV A;  2ZEP A;  3T90 A;  1YVK A;  2B4B A;  5JH9 A;  4RI1 A;  4FD7 A;  3QNV A;  5LRJ A;  4MHZ A;  3JRU A;  3MRU A;  2WZN A;  1MJ9 A;  1K4J A;  4B14 A;  5JPH A;  1BPM A;  1YW4 A;  4I49 A;  4OME A;  2EWB A;  4C68 A;  4R3L A;  3BHX A;  4FWU A;  2REF A;  3D2P A;  4CS0 B;  1V0C A;  1H8L A;  3D66 A;  2NMT A;  4CGP A;  2PJ2 A;  3B3W A;  2P6E A;  3D4U A;  3KKW A;  1BAV A;  4MBU A;  5DWN A;  3MGD A;  4ZX8 A;  3SI0 A;  1OZP A;  1Z8L A;  3RNZ A;  2EVN A;  3FEC A;  3PFE A;  5LYD A;  2VEZ A;  2Q04 A;  2WPX A;  2PIY A;  2FL4 A;  4PXB A;  2JBK A;  3KZW A;  5F09 A;  1Q2D A;  3IIB A;  4C2Y A;  1IID A;  1GHE A;  3I3G A;  4C7I A;  3BJ8 A;  2ZEM A;  4J3G A;  3W6S A;  3SI1 A;  2IQ6 A;  3RAM A;  1YME A;  2V8H A;  4PK3 A;  4M6I A;  4UEF A;  4E2A A;  3LMS A;  3EC4 A;  5K8M A;  1ZLI A;  4UWJ A;  4A37 A;  3CDX A;  4PV6 A;  3S6F A;  2V8G A;  3FED A;  4H89 A;  4P4I A;  2BUE A;  2QEC A;  2WSA A;  3SHP A;  1KUY A;  2VL1 A;  2AE6 A;  3DLJ A;  1F2O A;  3IWW A;  1LAN A;  4KSI A;  2C1C A;  1FT7 A;  3IC1 A;  4XPL A;  4OKO A;  5G20 A;  4UF4 A;  4NGP A;  2PJC A;  2ZOF A;  2CNM A;  2AFW A;  2R7H A;  4UIA A;  2OH1 A;  5AG4 A;  4KVM E;  2PRQ A;  3GLJ A;  1SQH A;  2YNC A;  4NGN A;  1Z2L A;  3D67 A;  5HVF A;  3TOA A;  2JDD A;  3FEE A;  4R3K A;  5D29 A;  4CGO A;  2CTB A;  2K5T A;  3IJ3 A;  1CG2 A;  3IEH A;  2G0B A;  1N71 A;  3N5F A;  3QB8 A;  3B7I A;  4A95 A;  4TWE A;  3B3C A;  5AGE A;  2B5G A;  4R76 A;  1QSN A;  2GE3 A;  2Z11 A;  2RB7 A;  4RUH A;  4H6Z A;  3KL9 A;  4B11 A;  3IFE A;  2G3A A;  1LFW A;  3FJU A;  2BEI A;  3TO9 A;  4OC2 A;  2R1I A;  2ZEG A;  5C88 A;  4OIW A;  1S7L A;  2Z3O A;  2HV2 A;  4XPK A;  1CP7 A;  3I9S A;  4ZI6 A;  1VHO A;  5CBM A;  1YGH A;  2Z0Z A;  2V8V A;  2ZXV A;  3BI0 A;  3PB6 X;  1QSO A;  3L2N A;  4NGR A;  4PSW A;  4WJB A;  1NMT A;  2B4D B;  2AFZ A;  3PB8 X;  2VI7 A;  1ELM P;  4KOR A;  4ORF A;  4MRI A;  1OBR A;  1NSA A;  4OAE A;  2FE7 A;  2EK8 A;  4XPD C;  2AJ6 A;  2GRE A;  2Z10 A;  4CRZ B;  1XBU A;  2HQY A;  3TX8 A;  1B6B A;  1TF9 A;  2QVP A;  4U9Z A;  2Q43 A;  1VIX A;  4JLY A;  4MHY A;  4QBJ A;  3H8E A;  2BOA A;  1PCA A;  3D68 A;  3GIU A;  1QMU A;  4MCP A;  2VZZ A;  2V77 A;  3CT9 A;  2RFH A;  1VHE A;  4KOY A;  2P6G A;  2O28 A;  3FIX A;  5F48 A;  2Z3P A;  3CXP A;  3KGQ A;  4A39 A;  4XNH C;  2PJ4 A;  4B5O A;  1XJO A;  3S9M A;  1YK3 A;  5ELY A;  4TNU A;  2CF4 A;  5HVG A;  4IHM A;  3FYN A;  1S3Z A;  4QUS A;  2Z3M A;  1DTD A;  1U6M A;  3IWE A;  2B3U A;  3ISX A;  4YFJ A;  4QC6 A;  2O4H A;  4FD6 A;  5IB0 A;  4XPD B;  5LYI A;  3JUW A;  2G3T A;  5DWM A;  4QB9 A;  2VXK A;  3VAT A;  4UCN A;  2J8N A;  2HC9 A;  3H8F A;  3V7Z A;  1TF8 A;  3CXQ A;  1TXR A;  3R9F A;  2OZG A;  4ZGY B;  3PB9 X;  4OC1 A;  4P4D A;  3V8I A;  2GLJ A;  3VWE A;  3B3T A;  4NGT A;  1XMB A;  5IV0 A;  2PVW A;  5HXD A;  2AFS A;  1TKH A;  3BI1 A;  2F5I A;  1XIX A;  2Q4Z A;  3D7G A;  4HKF A;  2NYQ A;  2C27 A;  3RYO A;  3T9Y A;  1CP6 A;  2PJ7 A;  3B2Y A;  3BXM A;  2ZW6 A;  4ZBG A;  1M44 A;  2X7B A;  1S7K A;  3RBU A;  4A32 A;  1YR0 A;  2ABZ A;  1MJA A;  3NE8 A;  2OR4 A;  4OAD A;  2FVG A;  4CAX A;  3WC7 A;  2BL1 A;  4YWY A;  1R3N A;  2I00 A;  4E8O A;  1UWY A;  2OB0 A;  3FBU A;  1P0H A;  4P45 A;  4X5K A;  4ZYQ A;  1IY7 A;  3P2F A;  3SJF A;  4ZY1 A;  5JM6 A;  1KWM A;  4B5P A;  4AVC A;  2POK A;  2EBJ A;  2PJ5 A;  4NEX A;  2CXA A;  3C26 A;  4RS2 A;  1QQ9 A;  2OZH A;  4P4B A;  5H84 A;  3PGP A;  2H5M A;  1IGB A;  2OZU A;  1ZLH A;  3PBB A;  3NH8 A;  4PPZ A;  4PK2 A;  1S5K A;  1RO5 A;  2B5G B;  5G21 A;  4B13 A;  3F8K A;  3IWG A;  4MFJ A;  5THW A;  2PVV A;  4IF5 A;  2GLF A;  1LAM A;  2PC1 A;  1MJB A;  3CXS A;  2QJ8 A;  1Q2Y A;  4HPS A;  2ZEO A;  2C6P A;  4MFQ A;  4ONU A;  3K9U A;  4OID A;  4UEE A;  2ZW5 A;  4YGO A;  2XEG A;  5AG5 A;  2VQY A;  4R57 A;  3K9T A;  3B8G A;  5E96 A;  3GY9 A;  4CPA A;  3FH4 A;  3GB0 A;  4DNC A;  2FT0 A;  2FS5 A;  2ARH A;  4MI4 A;  5FVJ A;  1YLO A;  2AFX A;  4HNX B;  1YSJ A;  1QST A;  1M4D A;  1IYK A;  4BIN A;  4FD4 A;  1IIC A;  4OP4 A;  3VWD A;  1IOI A;  4NJR A;  2FSR A;  3K2K A;  1IOF A;  1QSR A;  4MY0 A;  4Q38 A;  3D8P A;  4BD9 A;  2GFQ A;  1ZG8 A;  4KLV A;  4L89 A;  3PRT A;  2I3C A;  1HDQ A;  3NH4 A;  4NFR A;  4QVT A;  4CAV A;  3ZZI A;  3EO4 A;  1PU9 A;  2EO8 A;  2PIZ A;  5A27 A;  3BLN A;  4KS9 A;  1Z8W A;  1Z8T A;  3FNC A;  2Q4Y A;  3DR8 A;  3TT2 A;  1KUX A;  2YGW A;  4KVO E;  2ZW7 A;  5G22 A;  3KHX A;  4CYO A;  4F8Z A;  4CGN A;  4H6U A;  1B87 A;  1IYL A;  3OWC A;  2CIJ A;  2PJ6 A;  1ZO0 A;  4B10 A;  4CGM A;  1XRY A;  3D7F A;  3E0K A;  3GUX A;  3IO1 A;  4IUS A;  2F7V A;  2ZEN A;  2ZPA A;  3NFZ A;  3TO7 A;  5K8N A;  1BPN A;  4CYP A;  1FNO A;  5IB9 A;  2QIR A;  3GKR A;  3KR4 A;  3F0A A;  3TO6 A;  3F5B A;  5J8F A;  1I1D A;  3KHZ A;  2Q0Y A;  1XE4 A;  1GYT A;  1M1D A;  3GYA A;  3NH5 A;  3WC5 A;  4R7M A;  5EC4 A;  3B3S A;  4ZX9 A;  3RO0 A;  4Z65 A;  4OC0 A;  3PB4 X;  4PXE A;  4F9U A;  1LOK A;  4PSX A;  3NA6 A;  5AG7 A;  2GU2 A;  4JJX A;  2PJB A;  2R98 A;  3H8G A;  2PJ8 A;  4NGQ A;  3SJE A;  2CY2 A;  2PJ1 A;  3PEI A;  4GXH A;  5CNP A;  4AVA A;  1AUG A;  4UFW A;  2Z3L A;  1YQE A;  1TKF A;  3PP9 A;  4PXC A;  3KQX A;  3TFY A;  3B35 A;  4LQG A;  4U9Y A;  5JQ4 A;  3D3S A;  4FUU A;  4AG7 A;  2ZEF A;  2B3V A;  2QML A;  2QYV A;  3FX6 A;  4JXR A;  2ZW4 A;  4JWP A;  4KOT A;  4OC4 A;  4AVB A;  1TKJ A;  2F8H A;  3DSB A;  3FRM A;  3TC8 A;  2REE A;  4HNY B;  4KOX A;  5AG6 A;  2Q4V A;  3KQZ A;  2CNS A;  3IGR A;  2PJ9 A;  3FVL A;  3S9L A;  6CPA A;  2PCU A;  2A4N A;  4P4J A;  5C82 A;  4M3S A;  4NSQ A;  1Y9W A;  2Q7B A;  1XFO A;  3BJ7 A;  3WR7 A;  2HB6 A;  4P6Y A;  4B12 A;  1CPX A;  4EFD A;  4CYN A;  5EBV A;  1HDU A;  4CAE A;  3D7H A;  1ON0 A;  3FF3 A;  3LAC A;  2YNC C;  4A31 A;  1ARL A;  1XOV A;  4KUB A;  3FMC A;  3W91 A;  4AG9 A;  4F0Y A;  8CPA A;  1I21 A;  1CJW A;  4NXY A;  1CX8 A;  1HEE A;  2PSW A;  5I0C A;  3H5Z A;  4CGL A;  4P4E A;  4IAV A;  2JEV A;  1LRZ A;  3CPX A;  4MFP A;  5EMI A;  2PR8 A;  1IU8 A;  4Y49 B;  3TTH A;  4MCQ A;  1X10 A;  2PJ0 A;  5H86 A;  3SJX A;  5J8C A;  3I1U A;  3NE7 A;  4MJ8 A;  2FXF A;  4OC3 A;  4KZT A;  4MHP A;  2P0W A;  2WYR A;  1Z8X A;  2KCW A;  2ZEE A;  4UFX A;  1YX0 A;  3HLP A;  3KAS A;  4JZ0 A;  2DF5 A;  1CBX A;  1ZG9 A;  2OOT A;  3VH9 A;  1XEB A;  4MFL A;  4KLW A;  4BMH A;  4MCR A;  3DR6 A;  3KI9 A;  3QAY A;  4OC5 A;  4M6H A;  4JYW A;  2B58 A;  3MN8 A;  4CAW A;  3S6K A;  1ELL P;  1YRE A;  2Y0M A;  2HUZ A;  5IX3 A;  4C2X A;  2P6F A;  1X12 A;  3LWU A;  4W9Y A;  5F46 A;  3ISZ A;  5KTD A;  3S9N A;  4C2Z A;  3JVN A;  5HH1 A;  2ZEH A;  2ZED A;  4LX9 A;  4YRH A;  1FY7 A;  3CPA A;  3IU1 A;  3FXT A;  2PR1 A;  2JDC A;  2FIW A;  1S60 A;  5HMN A;  5LRG A;  3ZJ0 A;  2ANP A;  2BCO A;  3R1K A;  4OLL A;  2C6C A;  3TCV A;  4AXV A;  1F2P A;  4U5Y A;  5D8N A;  3R9E A;  2FCK A;  1XMT A;  3SXO A;  3UY5 A;  1Y0Y A;  1VHS A;  2PDO A;  4JD6 A;  4P10 A;  1L0C A;  3LOD A;  3TE4 A;  1Y0R A;  2XEJ A;  3WAB A;  3N7Z A;  2IMO A;  4M85 A;  1EE3 P;  1Z9U A;  4B6Z A;  4LUA A;  4ZY2 A;  1YVO A;  4UWI A;  1Z5R A;  3QAH A;  5JGF A;  2PRB A;  4MHN A;  2ZEL A;  5G1Z A;  3IU2 A;  4RN7 A;  4CAF A;  2JLM A;  2ZOG A;  5LRK A;  5CPA A;  2WPW A;  4UA3 A;  4UCP A;  1F57 A;  2R8V A;  1Q2C A;  4UCM A;  4KVX A;  4YU9 A;  1S7F A;  1M4L A;  1NE9 A;  3DGV A;  4NJQ A;  4K30 A;  4R87 A;  5A28 A;  1S7N A;  5KTA A;  4MFK A;  1UFH A;  4MHD A;  4EWT A;  4X3R A;  4II9 A;  1VGY A;  1RXT A;  1WK4 A;  5ISV A;  3S6H A;  2IJZ A;  2FIA A;  2DPS A;  2JBJ A;  4MXU A;  4GM5 A;  3V38 A;  4PQA A;  3R9G A;  3CZX A;  2PQ8 A;  3DDD A;  4JXQ A;  4LQ6 A;  3A9L A;  4R6T A;  4FBE A;  1RTQ A;  2Z3K A;  5K8O A;  4WWV A;  4H2K A;  4UIB A;  3S6G A;  3PZJ A;  2XEI A;  4CYQ A;  4E0A A;  4ZY0 A;  5HVH A;  2ODF A;  1JQG A;  4UFV A;  1QSM A;  3HUV A;  1ZG7 A;  1AYE A;  4NF1 A;  2VZY A;  3G8W A;  1CM0 A;  1CPS A;  2YNE A;  5LYF A;  2I79 A;  2Z3N A;  5F49 A;  3KR5 A; 
#chains in the Genus database with same CATH homology
 1Y9K A;  2BSW A;  1KZF A;  4FD5 A;  2D4P A;  4L8A A;  1Z4R A;  3SXN A;  1IB1 E;  2VBQ A;  4UBR A;  4AB7 A;  1TIQ A;  4MFZ A;  5F47 A;  4B5P B;  1Z4E A;  2GAN A;  4A2Z A;  4A30 A;  5GCN A;  4Y49 C;  4F0X A;  4BBH A;  2YND A;  1PUA A;  2DXQ A;  1BO4 A;  1VKC A;  4NCZ A;  1WWZ A;  2OU2 A;  3JTK A;  3EFA A;  3W6X A;  4C7H A;  1BOB A;  3P2H A;  2Q44 A;  3LD2 A;  4KSA A;  2J8R A;  1Y7R A;  3D2M A;  3FB3 A;  4F6A A;  2CNT A;  1M4I A;  3TOB A;  4A33 A;  4GS4 A;  2J8M A;  2EUI A;  3DNS A;  2WUU A;  4KOV A;  2RC4 A;  3EY5 A;  4EVY A;  4KSF A;  2ATR A;  4KOU A;  3H4Q A;  1KUV A;  4R9M A;  4KOW A;  4KUA A;  2IL4 A;  1J4J A;  4MY3 A;  3EXN A;  2B4D A;  4CRY B;  1I12 A;  1P4N A;  3R95 A;  5KTC A;  1NSL A;  4XNH B;  4KOS A;  2DPT A;  3R96 A;  1R57 A;  1MK4 A;  5BWA B;  3G3S A;  1XF8 A;  2D4O A;  1M4G A;  4Q36 A;  1YLE A;  4HNW B;  2GIV A;  3T90 A;  1YVK A;  2B4B A;  4RI1 A;  4FD7 A;  1MJ9 A;  1K4J A;  4B14 A;  5JPH A;  4I49 A;  4C68 A;  4R3L A;  2REF A;  3D2P A;  4CS0 B;  1V0C A;  2NMT A;  4CGP A;  2P6E A;  3KKW A;  4MBU A;  5DWN A;  3MGD A;  1OZP A;  2EVN A;  2VEZ A;  2Q04 A;  2WPX A;  2FL4 A;  1Q2D A;  4C2Y A;  1IID A;  1GHE A;  3I3G A;  4C7I A;  3BJ8 A;  4J3G A;  3W6S A;  4PK3 A;  4E2A A;  3EC4 A;  4UWJ A;  4PV6 A;  3S6F A;  4H89 A;  2BUE A;  2QEC A;  2WSA A;  3SHP A;  1KUY A;  2AE6 A;  5G20 A;  2CNM A;  2R7H A;  2OH1 A;  5AG4 A;  4KVM E;  1SQH A;  2YNC A;  3TOA A;  2JDD A;  4R3K A;  4CGO A;  2K5T A;  4A95 A;  2G0B A;  1N71 A;  3QB8 A;  5AGE A;  2B5G A;  1QSN A;  2GE3 A;  2Z11 A;  4H6Z A;  4B11 A;  2G3A A;  2BEI A;  3TO9 A;  2R1I A;  5C88 A;  1S7L A;  2Z3O A;  2HV2 A;  4XPK A;  3I9S A;  1YGH A;  2Z0Z A;  2ZXV A;  4PSW A;  4XPL A;  1QSO A;  1NMT A;  2B4D B;  2VI7 A;  4KOR A;  4ORF A;  4OAE A;  2FE7 A;  4XPD C;  2AJ6 A;  2Z10 A;  4CRZ B;  2HQY A;  1B6B A;  4U9Z A;  4JLY A;  4QBJ A;  2VZZ A;  4KOY A;  2P6G A;  2O28 A;  3FIX A;  5F48 A;  2Z3P A;  3CXP A;  4B5O A;  4XNH C;  1YK3 A;  3FYN A;  1S3Z A;  4QUS A;  2Z3M A;  1U6M A;  3IWE A;  2B3U A;  4YFJ A;  4QC6 A;  4FD6 A;  5IB0 A;  4XPD B;  3JUW A;  2G3T A;  5DWM A;  4QB9 A;  2VXK A;  4UCN A;  2J8N A;  3CXQ A;  3R9F A;  2OZG A;  4ZGY B;  3VWE A;  5IV0 A;  4HKF A;  3V8I A;  2F5I A;  1XIX A;  3T9Y A;  3RYO A;  2C27 A;  2ZW6 A;  4ZBG A;  1M44 A;  2X7B A;  1S7K A;  4A32 A;  1YR0 A;  4CAX A;  1MJA A;  4OAD A;  2BL1 A;  2I00 A;  4E8O A;  2OB0 A;  3FBU A;  1P0H A;  4X5K A;  3P2F A;  4B5P A;  4AVC A;  4NEX A;  2CXA A;  3C26 A;  4RS2 A;  2OZH A;  5H84 A;  3PGP A;  2H5M A;  2OZU A;  4PK2 A;  1S5K A;  1RO5 A;  2B5G B;  5G21 A;  4B13 A;  3F8K A;  3IWG A;  4MFJ A;  4IF5 A;  2PC1 A;  3CXS A;  1MJB A;  1Q2Y A;  4MFQ A;  4ONU A;  3K9U A;  2ZW5 A;  4YGO A;  5AG5 A;  2VQY A;  4R57 A;  3B8G A;  5E96 A;  3GY9 A;  4DNC A;  2FT0 A;  2FS5 A;  2ARH A;  4MI4 A;  5FVJ A;  4HNX B;  1QST A;  1M4D A;  1IYK A;  4FD4 A;  1IIC A;  3VWD A;  4Q38 A;  2FSR A;  1QSR A;  4MY0 A;  3D8P A;  4KLV A;  4L89 A;  4CAV A;  4QVT A;  3ZZI A;  3EO4 A;  1PU9 A;  5A27 A;  3BLN A;  4KS9 A;  3FNC A;  2Q4Y A;  3DR8 A;  3TT2 A;  1KUX A;  2YGW A;  4KVO E;  2ZW7 A;  5G22 A;  4CYO A;  4CGN A;  4H6U A;  1B87 A;  1IYL A;  3OWC A;  4B10 A;  1ZO0 A;  4CGM A;  3E0K A;  4IUS A;  2ZPA A;  3TO7 A;  4CYP A;  2QIR A;  3GKR A;  3TO6 A;  3F0A A;  5J8F A;  3F5B A;  1I1D A;  2Q0Y A;  1XE4 A;  1M1D A;  3GYA A;  5EC4 A;  4PSX A;  5AG7 A;  4JJX A;  2R98 A;  2CY2 A;  5CNP A;  4AVA A;  4UFW A;  2Z3L A;  3PP9 A;  3TFY A;  5JQ4 A;  4U9Y A;  3D3S A;  4AG7 A;  2B3V A;  2QML A;  4JXR A;  2ZW4 A;  4JWP A;  4KOT A;  4AVB A;  3DSB A;  3FRM A;  2REE A;  4HNY B;  4KOX A;  5AG6 A;  2Q4V A;  2CNS A;  3IGR A;  2A4N A;  5C82 A;  4M3S A;  4NSQ A;  1Y9W A;  2Q7B A;  3BJ7 A;  3WR7 A;  4B12 A;  4CYN A;  5EBV A;  4CAE A;  1ON0 A;  2YNC C;  4A31 A;  4KUB A;  3W91 A;  4AG9 A;  4F0Y A;  1I21 A;  1CJW A;  4NXY A;  2PSW A;  5I0C A;  3H5Z A;  4CGL A;  2JEV A;  1LRZ A;  4MFP A;  2PR8 A;  4Y49 B;  3TTH A;  5H86 A;  5J8C A;  3NE7 A;  4MJ8 A;  2FXF A;  4KZT A;  2P0W A;  2KCW A;  4UFX A;  1YX0 A;  1XEB A;  4MFL A;  4KLW A;  4BMH A;  3DR6 A;  2B58 A;  4CAW A;  3S6K A;  1YRE A;  2Y0M A;  2HUZ A;  5IX3 A;  4C2X A;  2P6F A;  5F46 A;  5KTD A;  4C2Z A;  3JVN A;  5HH1 A;  4LX9 A;  4YRH A;  1FY7 A;  3IU1 A;  3FXT A;  2PR1 A;  2JDC A;  2FIW A;  1S60 A;  5HMN A;  3ZJ0 A;  4OLL A;  3R1K A;  3TCV A;  4U5Y A;  3R9E A;  2FCK A;  1XMT A;  3SXO A;  3UY5 A;  1VHS A;  2PDO A;  4JD6 A;  1L0C A;  3LOD A;  3TE4 A;  3N7Z A;  4M85 A;  1Z9U A;  4LUA A;  1YVO A;  4UWI A;  3QAH A;  2PRB A;  5G1Z A;  3IU2 A;  4CAF A;  2JLM A;  2WPW A;  4UA3 A;  4UCP A;  2R8V A;  1Q2C A;  4UCM A;  4KVX A;  1S7F A;  5A28 A;  1NE9 A;  4K30 A;  4R87 A;  1S7N A;  5KTA A;  4MFK A;  1UFH A;  4MHD A;  4II9 A;  1RXT A;  1WK4 A;  5ISV A;  3S6H A;  2FIA A;  2DPS A;  3R9G A;  3DDD A;  2PQ8 A;  4JXQ A;  3A9L A;  2Z3K A;  4E0A A;  4CYQ A;  3S6G A;  3PZJ A;  4UFV A;  1QSM A;  4NF1 A;  2VZY A;  3G8W A;  1CM0 A;  2YNE A;  2I79 A;  2Z3N A;  5F49 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...