4H6UA

Tubulin acetyltransferase mutant
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
187
structure length
165
Chain Sequence
SFTMDFPYDLNALFPERISVLDSNLSAGRKAHGRPDPLPQVTTVIDELGKNRHHLYLLKDGEGGRGVIVGFLKVGYKKLFLLDQRGAHLETEPLCVLAFYVTETLQRHGYGSELFDFMLKHKQVEPAQMAYDRPSPKFLSFLEKRYDLRNSVPQVNNFVVFAGFF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Alpha-tubulin N-acetyltransferase
publication title Crystal structures of tubulin acetyltransferase reveal a conserved catalytic core and the plasticity of the essential N terminus.
pubmed doi rcsb
source organism Danio rerio
total genus 36
structure length 165
sequence length 187
chains with identical sequence B
ec nomenclature ec 2.3.1.108: Alpha-tubulin N-acetyltransferase.
pdb deposition date 2012-09-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05301 Acetyltransf_16 GNAT acetyltransferase, Mec-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4h6uA00
4OADA 2OZHA 3VWEA 4ORFA 3NE7A 2EUIA 3FIXA 4B5PA 4PV6A 2Y0MA 3CXQA 1V0CA 2WPWA 5FVJA 4JWPA 4B5PB 3VWDA 2CNMA 2HUZA 4MHDA 2O28A 1KZFA 1QSOA 2VQYA 1M44A 2J8MA 4KOXA 5F47A 4UWJA 2PSWA 1IIDA 4F6AA 4L8AA 2VEZA 4JXQA 4JXRA 4BMHA 2QIRA 3PP9A 1WWZA 1NMTA 2Z10A 4XNHC 4CS0B 3GY9A 1KUXA 3ZZIA 1S60A 2D4PA 3DR8A 3R9FA 1SQHA 1S3ZA 1YLEA 1FY7A 4II9A 1XEBA 4KOUA 4R9MA 1J4JA 3MGDA 2JDDA 4XPDC 2ZW6A 2EVNA 4CAWA 3I9SA 1ON0A 1MK4A 5C82A 2CNTA 4KZTA 1MJBA 1UFHA 4MJ8A 4KORA 2R98A 4UA3A 1Z4EA 4OAEA 4M85A 4AVBA 2ZW7A 5F49A 3D2MA 3QAHA 3DR6A 1S7NA 2OZGA 4H89A 3W91A 2I79A 3SXNA 1GHEA 4AB7A 2VZZA 4ZBGA 1S5KA 5KTAA 3S6FA 1S7FA 2ZW5A 3FBUA 1S7LA 4CAXA 2OU2A 1B87A 3LD2A 2JEVA 4MY0A 4KLVA 2CNSA 3FNCA 3JUWA 4CRYB 3TTHA 3TFYA 3BJ8A 1XMTA 3DSBA 3CXPA 2Z11A 2D4OA 4H6ZA 4MI4A 2DXQA 1IB1E 4PK3A 4DNCA 4YRHA 3S6KA 2GIVA 2OB0A 4KOTA 4YGOA 3P2FA 1MJAA 5HMNA 1XE4A 1Y9WA 4L89A 3PZJA 4CRZB 2G3TA 3UY5A 2BUEA 1U6MA 2FSRA 1YVKA 4K30A 2AJ6A 4QB9A 2R1IA 4XPKA 2Z0ZA 4OLLA 4RS2A 4CAVA 1YVOA 2HV2A 2FCKA 5JQ4A 2FE7A 2PR1A 3TCVA 3C26A 2B3UA 4QVTA 3S6GA 3EO4A 4PSXA 2NMTA 4M3SA 3G8WA 3F0AA 2OZUA 4KOVA 3PGPA 3S6HA 2QECA 4EVYA 3F8KA 3QB8A 4U9YA 5C88A 4IUSA 2QMLA 4R57A 1R57A 4HNYB 3ZJ0A 4E0AA 5I0CA 4YFJA 3BJ7A 4KOSA 2I00A 4AVCA 3FB3A 4U5YA 3R9EA 1XF8A 3TO7A 1Q2CA 3EC4A 1P4NA 2ARHA 1M4IA 3SHPA 4IF5A 3TT2A 4QC6A 2GANA 5ISVA 4KVME 5H86A 3TO9A 3K9UA 1QSNA 5EC4A 4ONUA 4R3LA 4I49A 1VKCA 3GYAA 4E2AA 1RO5A 2VXKA 5H84A 5KTDA 3N7ZA 1YR0A 4U9ZA 2JLMA 2X7BA 4RI1A 2WPXA 4Y49B 1K4JA 3CXSA 2JDCA 2P6FA 2FIWA 3R96A 4FD7A 3FXTA 4NEXA 3V8IA 2B4BA 3IGRA 1S7KA 2B4DB 4KVOE 3E0KA 3TOAA 4HNWB 2ZXVA 4FD5A 2Q0YA 2KCWA 2C27A 4KOWA 4J3GA 2G3AA 4LUAA 3BLNA 2Q4VA 3RYOA 2PR8A 2Q04A 2B3VA 2K5TA 4JLYA 2R8VA 1IYKA 2BEIA 2FT0A 2PC1A 3EFAA 5JPHA 2IL4A 1I12A 3KKWA 4KVXA 1IYLA 2CY2A 3B8GA 4B5OA 1M4GA 4JD6A 3G3SA 4AVAA 1Q2YA 4AG9A 2B5GA 4UBRA 4GS4A 4HKFA 2Q44A 2ATRA 1BOBA 2FL4A 5F48A 5CNPA 5F46A 3D3SA 5E96A 1I1DA 2B58A 2B5GB 5HH1A 4XPLA 2BSWA 1YX0A 4PK2A 3OWCA 4FD4A 1OZPA 4KOYA 4QBJA 4MY3A 1NSLA 3WR7A 4H6UA 3DNSA 5DWMA 1LRZA 2P6EA 4LX9A 4E8OA 2PRBA 1MJ9A 5EBVA 1RXTA 3H4QA 3TOBA 2J8NA 2GE3A 1Y9KA 1CJWA 4JJXA 2VBQA 5IV0A 4NF1A 3JVNA 2Q7BA 2REEA 3R95A 2PQ8A 1Z4RA 3D2PA 3T9YA 1M4DA 1IICA 3IWGA 1PU9A 4R87A 3SXOA 1NE9A 1WK4A 5DWNA 5KTCA 1CM0A 1KUYA 4HNXB 4QUSA 5J8CA 3DDDA 5GCNA 2J8RA 3W6SA 3FRMA 4FD6A 1Q2DA 4Y49C 1QSMA 2F5IA 1M1DA 3EY5A 1B6BA 3R1KA 1YREA 3I3GA 1I21A 2P0WA 2P6GA 1Y7RA 2FIAA 2B4DA 4XNHB 5IX3A 4NSQA 4NXYA 4PSWA 2H5MA 1YK3A 2OH1A 2BL1A 1VHSA 2RC4A 3GKRA 1N71A 4R3KA 1TIQA 4XPDB 4AG7A 3R9GA 2FXFA 4KUAA 2HQYA 2FS5A 2G0BA 5J8FA 2R7HA 4UWIA 1XIXA 3P2HA 4F0YA 3W6XA 4KLWA 1Z9UA 1YGHA 3EXNA 4KUBA 2Q4YA 1P0HA 2VI7A 3FYNA 4MBUA 3TO6A 5IB0A 2PDOA 3F5BA 2VZYA 3T90A 1BO4A 4NCZA 4X5KA 1QSRA 1PUAA 1KUVA 2ZPAA 1L0CA 2ZW4A 3TE4A 2AE6A 1QSTA 3D8PA 3LODA 2A4NA 2REFA
chains in the Genus database with same CATH superfamily
4OADA 2OZHA 4OC2A 2ZEOA 2PJ7A 3VWEA 4ORFA 3NE7A 3NH4A 2EUIA 2IQ6A 4A30A 1AYEA 1AMPA 2EBJA 3FEEA 3FIXA 4MHYA 3GB0A 4B5PA 4NJRA 4PV6A 2Y0MA 2GLFA 3HUVA 3BXMA 3CXQA 3MN8A 3BHXA 4EMEA 1V0CA 5HXDA 4Q36A 3B35A 2WPWA 1CG2A 4UEZA 2XEIA 5FVJA 3PEIA 2CXAA 2AFZA 1ZG8A 3PB8X 5J1QA 4JWPA 3B3CA 1TKJA 4B5PB 1HDUA 3VWDA 2CNMA 1LAMA 2HUZA 4W9YA 5DS0A 5LRGA 4MHDA 3D4UA 2O28A 2WUUA 1KZFA 2F7VA 4F8ZA 1QSOA 2AFWA 2VQYA 2PJ3A 1M44A 2J8MA 4KOXA 5F47A 4UWJA 2PSWA 4RUHA 4OMEA 3H8EA 2V8HA 1IIDA 2JBJA 2C6CA 4F6AA 4C68A 4L8AA 2VEZA 5A28A 3L2NA 4A33A 3IIBA 4JXQA 4KSFA 1XFOA 4A38A 5ELYA 4ZGYB 4JXRA 4CYPA 4BMHA 4F9UA 2QIRA 3PP9A 1WWZA 3LACA 2BO9A 1NMTA 2Z10A 4CPAA 1YQEA 4GM5A 4XNHC 4CS0B 3GY9A 1KUXA 3ZZIA 1S60A 3V38A 2D4PA 3DR8A 4CYNA 3R9FA 2Q7SA 1SQHA 1S3ZA 1YLEA 4UIAA 1XJOA 3RAMA 3SI0A 4Q7AA 1FY7A 4II9A 3GIUA 1Y0YA 1XEBA 3JRUA 4KOUA 4R9MA 2BOAA 1J4JA 4NJQA 4CGPA 3MGDA 2QVPA 4OC1A 2JDDA 1R3NA 4XPDC 2ZW6A 3KR4A 4AXVA 2EVNA 4MFZA 3SI2A 4MCSA 4ONWA 4CAWA 3I9SA 3ISXA 3FEDA 1ON0A 1MK4A 5C82A 5AGEA 2CNTA 4KZTA 4MCPA 4B12A 1CPSA 1MJBA 1UFHA 4OC3A 4MJ8A 1FNOA 2V8VA 4B10A 4KORA 2R98A 1YW6A 5G21A 4A32A 4UA3A 2EK9A 1Z4EA 3BI1A 4M85A 4OAEA 2ZW7A 4AVBA 2EK8A 3WABA 4RN7A 3IJ3A 3D2MA 3KHZA 3QAHA 3DR6A 5F49A 4DJLA 3KQXA 1S7NA 5K8PA 4P10A 2NSMA 2OZGA 1IOFA 4UFXA 1F57A 4H89A 1ZG9A 3W91A 2I79A 3SXNA 1GHEA 3LWUA 2VZZA 4AB7A 2AFOA 4ZBGA 1S5KA 5KTAA 4OP4A 3S6FA 1S7FA 2ZW5A 4OC5A 3FBUA 3VARA 1S7LA 4CAXA 2Z3NA 4ZY0A 2OU2A 1NSAA 1B87A 2PJAA 2V8DA 1ELLP 2JEVA 3LD2A 4MY0A 4KLVA 2XEFA 3WC5A 5CBMA 2CNSA 3FNCA 3FF3A 5LRKA 3JUWA 3SJXA 4CRYB 3JTKA 3KR5A 3TTHA 1VHOA 2PJ6A 4P4EA 2ANPA 4G1PA 3TFYA 3BJ8A 1XMTA 3DSBA 3B2YA 1IU8A 2EO8A 4ZI6A 4MCQA 3FH4A 2PJ9A 3QAYA 3H8GA 1Z8XA 4A2ZA 1BAVA 1H8LA 3CXPA 2Z11A 2DPSA 4P4FA 2CTBA 2D4OA 4H6ZA 4MI4A 3V7ZA 2DXQA 1CP6A 1IB1E 4PK3A 4DNCA 1ZLIA 4YRHA 3D7GA 3IEHA 3S6KA 4CYOA 2GIVA 2ZOGA 2PJBA 3WC7A 1YSJA 2ZOFA 4B13A 2OB0A 3TC8A 4KOTA 2CTCA 4YGOA 3P2FA 1MJAA 5HMNA 2Q43A 4BBHA 3B3TA 1XE4A 4DYOA 1Y9WA 4L89A 1ELMP 3KHXA 1Q7LA 3K9TA 3PZJA 4CRZB 3KZWA 4F9VA 2XEJA 4CGLA 2G3TA 2AFXA 2BUEA 3UY5A 1U6MA 3KQZA 2FSRA 2Z3LA 1YVKA 1Y7EA 2GREA 3D66A 4K30A 4ZYQA 5LRJA 3IU2A 2AJ6A 2RB7A 2ZEEA 4QB9A 3B7IA 2R1IA 3IU1A 4Q38A 4XPKA 3RZAA 4CAFA 2PE3A 3CT9A 2Z0ZA 4OLLA 2IJZA 4RS2A 4CAVA 1YVOA 2HV2A 2FCKA 5EMIA 5JQ4A 2AFUA 2FE7A 2PR1A 3TCVA 3C26A 2B3UA 2Z3OA 4PXEA 4QVTA 3S6GA 3EO4A 2I3CA 4PSXA 2NMTA 4M3SA 3G8WA 4DUKA 4IHMA 1RTQA 3F0AA 5AG5A 3SJGA 3NH5A 4ZX9A 2YNCA 2OZUA 4KOVA 3PGPA 3S6HA 3KASA 2VL1A 2WSAA 2QECA 5AG6A 4K3NA 5G1ZA 5THWA 2Z3MA 2PCUA 3PB6X 4B11A 1BPNA 1ZG7A 4WWVA 4EVYA 3F8KA 3QB8A 5A27A 1Z2LA 4U9YA 5C88A 4UCNA 4IUSA 2QMLA 2PJ4A 4R57A 1R57A 4HNYB 3ZJ0A 4E0AA 5I0CA 4JZ0A 2OOTA 4YFJA 3BJ7A 1PYTB 4KOSA 3PFOA 2I00A 4AVCA 4NFRA 3FB3A 4U5YA 2PJ1A 2Q51A 4YWYA 3R9EA 1XF8A 3TO7A 1JWQA 1TKHA 1Z8TA 4FUUA 1Q2CA 3EC4A 2ZENA 2WYRA 1P4NA 3QNVA 2ARHA 1M4IA 2RFHA 1LFWA 1XMBA 3FMCA 4MHNA 3SHPA 2ZEFA 2ZEPA 4IF5A 2QJ8A 3TT2A 4QC6A 2GANA 4ZX8A 4KVME 5H86A 2QYVA 5ISVA 3TO9A 4B6ZA 1F2OA 2ZELA 3DLJA 4LQ6A 3NA6A 3K9UA 4OIWA 1QSNA 4C2ZA 5EC4A 4ONUA 4R3LA 1VKCA 3GYAA 3CPAA 4I49A 3RBUA 1RO5A 4A37A 1VHEA 4OC4A 4A31A 4FAIA 2AFMA 4NGMA 2VXKA 1KWMA 5H84A 5LYDA 5KTDA 4CGNA 1CP7A 4MMOA 3FX6A 1UWYA 3N7ZA 4M6HA 1YR0A 4U9ZA 2JLMA 2X7BA 4MHPA 4PQAA 5K8MA 1DTDA 1IGBA 4PXBA 4RI1A 7CPAA 3RNZA 4R7MA 2WPXA 4A95A 1EE3P 4ZY2A 4Y49B 1R43A 5JH9A 1K4JA 4Z65A 2HC9A 3PRTA 3CXSA 2JDCA 5JGFA 1QQ9A 2P6FA 4F0XA 2FIWA 2PIYA 4WJBA 3R96A 1TF8A 4UEEA 4FD7A 3FXTA 4NEXA 3V8IA 2FVGA 2PJCA 2B4BA 2Q4ZA 3D67A 3IGRA 4OIDA 2WZNA 1S7KA 2B4DB 3B3VA 4P4DA 4KVOE 2GLJA 3K2KA 1LOKA 3E0KA 3S9NA 3TOAA 1JQGA 4MFKA 4HNWB 3VATA 5IB9A 4B14A 3PB4X 2ZXVA 4UF4A 4FD5A 2Q0YA 2YNDA 4KSIA 2HB6A 6CPAA 2KCWA 2C27A 1BPMA 4J3GA 2G3AA 4KOWA 3BLNA 4LUAA 4OKOA 2Q4VA 4MFPA 3RYOA 2PR8A 2Q04A 2PVWA 4OC0A 2ABZA 1OBRA 1XRYA 4BD9A 2B3VA 2DEAA 5HVFA 5LYFA 1M4LA 1YLOA 2K5TA 3PBBA 4JLYA 3KI9A 2R8VA 4PXDA 1IYKA 4FWUA 2BEIA 2IMOA 3VH9A 2FT0A 2PC1A 3EFAA 4P4JA 1XOVA 3GLJA 3FVLA 5LYIA 4FBEA 3ISZA 3S9MA 5JPHA 2IL4A 1I12A 1YMEA 3D7HA 3KKWA 3IWEA 4KVXA 1IYLA 2CY2A 3B8GA 4MRIA 2PRQA 4B5OA 4H2KA 5K8NA 4R6TA 4P4IA 3KGQA 3LMSA 1FT7A 1M4GA 2Z3KA 3IO1A 4JD6A 4CAEA 3G3SA 4AVAA 4EFDA 1Q2YA 4AG9A 2B5GA 1TXRA 2YNEA 4UBRA 3A9LA 4GS4A 4HKFA 5G22A 2G9DA 4UFWA 5AG4A 4P45A 2Q44A 2JEWA 2ATRA 1BOBA 2FL4A 1F2PA 4NGQA 3PB9X 4CGOA 2ZEMA 5F48A 5CNPA 5F46A 3D3SA 5E96A 1BLLE 4NGTA 3S9LA 3WC6A 1I1DA 1HEEA 2B58A 2B5GB 2PJ2A 4TWEA 5HH1A 4XPLA 2BSWA 1YX0A 4PK2A 3OWCA 4FD4A 1OZPA 1Y0RA 4KOYA 3TX8A 4QBJA 1CX8A 4MY3A 4A39A 2YNCC 2ODFA 1LAPA 2O53A 1NSLA 2XEGA 2YGWA 3RO0A 3SJEA 3WR7A 2J9AA 4H6UA 3B3WA 1IOIA 3DNSA 4X8IA 5DWMA 2PIZA 5I4MA 3N5FA 5K8OA 1GYTA 1LRZA 1Z8LA 1XBUA 2P6EA 4LX9A 4ZY1A 8CPAA 4NGSA 4E8OA 2PRBA 1MJ9A 2ZEDA 1RXTA 4MFJA 5EBVA 3H4QA 3TOBA 5HVGA 1LCPA 2J8NA 2GE3A 1Y9KA 1YW4A 2NYQA 1CJWA 1HDQA 4JYWA 4MFQA 4JJXA 1AUGA 4R8FA 2VBQA 4E2AA 1ARLA 2PJ8A 4NF1A 3JVNA 2Q7BA 5IV0A 1CBXA 4NGNA 2REEA 2GU2A 3R95A 2GFQA 2PQ8A 1Z4RA 3D2PA 3T9YA 1DE4C 1M4DA 2ZEGA 4IK2A 3CPXA 1IICA 4LQGA 3IWGA 1PU9A 1ZLHA 4R87A 4TNUA 1QMUA 4C2YA 3SXOA 4P44A 1NE9A 4MCRA 1WK4A 2F8HA 4GXHA 5DWNA 1CM0A 1TKFA 5KTCA 1KUYA 3NE8A 3H5ZA 4HNXB 3DDDA 4QUSA 4HPSA 2J8RA 4X2TA 5GCNA 5J8CA 3W6SA 3FRMA 3T8WA 4FD6A 2Z3PA 1Q2DA 4Y49C 1QSMA 2F5IA 2CF4A 4MHZA 4KS9A 1X10A 1M1DA 2V8GA 3EY5A 1B6BA 1VIXA 1PCAA 1CPXA 2PJ5A 3R1KA 4C7HA 1YREA 3I3GA 3FECA 1I21A 1ZO0A 1X12A 3IFEA 4MXUA 2C1CA 2P0WA 3D7DA 4UEFA 2P6GA 1Y7RA 3PBEA 2FIAA 2B4DA 2DPTA 3HLPA 4XNHB 5IX3A 2PJ0A 4NSQA 1A2ZA 4NXYA 2AFSA 4PSWA 1ARMA 3I1UA 2H5MA 4CGMA 4UIBA 4CYQA 1YK3A 4KSAA 2OH1A 3CZXA 2BL1A 1VHSA 2RC4A 3GKRA 4M6GA 4UCMA 3SJFA 1N71A 1IY7A 2POKA 4R3KA 5G20A 1TIQA 5JM6A 4XPDB 4AG7A 3H8FA 3R9GA 2FXFA 5LYLA 5CPAA 2JBKA 3NFZA 5AG7A 4KUAA 2HQYA 2FS5A 3IC1A 4MFLA 5D8NA 1Z5RA 2G0BA 3PFEA 5J8FA 2R7HA 3WT4A 3CDXA 3BI0A 4UWIA 1TF9A 1XIXA 2DF5A 4UFVA 4UCPA 4P6YA 3P2HA 5BWAB 4F0YA 3W6XA 4KLWA 3GUXA 1Z9UA 1YGHA 3EXNA 2C6GA 4KUBA 2Q4YA 1LANA 1VGYA 1P0HA 2VI7A 3FYNA 4MBUA 4A94A 2OR4A 2EWBA 2C6PA 3DGVA 3TO6A 4O23A 3SI1A 2BCOA 2PVVA 5IB0A 2PDOA 4PPZA 2O4HA 3PB7X 4R76A 4P4BA 4X3RA 3F5BA 2VZYA 4NGRA 4PXCA 3T90A 3D68A 5D29A 1BO4A 4NCZA 4X5KA 3B3SA 3KL9A 2CIJA 1QSRA 2ZEHA 3FJUA 1PUAA 5F09A 2V77A 1KUVA 2ZPAA 4YU9A 5HVHA 4C7IA 1Z8WA 3IWWA 1L0CA 4IAVA 2ZW4A 4C2XA 3TE4A 3D7FA 2AE6A 3NH8A 1QSTA 4M6IA 3D8PA 3LODA 4EWTA 2A4NA 3MRUA 2REFA 4NGPA 4BINA
chains in the Genus database with same CATH topology
4OADA 2OZHA 3VWEA 4ORFA 3NE7A 2EUIA 4A30A 3FIXA 4B5PA 4PV6A 2Y0MA 3CXQA 1V0CA 4Q36A 2WPWA 5FVJA 2CXAA 4JWPA 4B5PB 3VWDA 2CNMA 2HUZA 4MHDA 2O28A 2WUUA 1KZFA 1QSOA 2VQYA 1M44A 2J8MA 4KOXA 5F47A 4UWJA 2PSWA 1IIDA 4F6AA 4C68A 4L8AA 2VEZA 5A28A 4A33A 4JXQA 4KSFA 4ZGYB 4JXRA 4CYPA 4BMHA 2QIRA 3PP9A 1WWZA 1NMTA 2Z10A 4XNHC 4CS0B 3GY9A 1KUXA 3ZZIA 1S60A 2D4PA 3DR8A 4CYNA 3R9FA 1SQHA 1S3ZA 1YLEA 1FY7A 4II9A 1XEBA 4KOUA 4R9MA 1J4JA 4CGPA 3MGDA 2JDDA 4XPDC 2ZW6A 2EVNA 4MFZA 4CAWA 3I9SA 1ON0A 1MK4A 5C82A 5AGEA 2CNTA 4KZTA 4B12A 1MJBA 1UFHA 4MJ8A 4B10A 4KORA 2R98A 5G21A 4A32A 4UA3A 1Z4EA 4OAEA 4M85A 4AVBA 2ZW7A 5F49A 3D2MA 3QAHA 3DR6A 1S7NA 2OZGA 4UFXA 4H89A 3W91A 2I79A 3SXNA 1GHEA 4AB7A 2VZZA 4ZBGA 1S5KA 5KTAA 3S6FA 1S7FA 2ZW5A 3FBUA 1S7LA 4CAXA 2Z3NA 2OU2A 1B87A 3LD2A 2JEVA 4MY0A 4KLVA 2CNSA 3FNCA 3JUWA 4CRYB 3JTKA 3TTHA 3TFYA 3BJ8A 1XMTA 3DSBA 4A2ZA 3CXPA 2Z11A 2DPSA 2D4OA 4H6ZA 4MI4A 2DXQA 1IB1E 4PK3A 4DNCA 4YRHA 3S6KA 4CYOA 2GIVA 4B13A 2OB0A 4KOTA 4YGOA 3P2FA 1MJAA 5HMNA 4BBHA 1XE4A 1Y9WA 4L89A 3PZJA 4CRZB 4CGLA 2G3TA 3UY5A 2BUEA 1U6MA 2FSRA 2Z3LA 1YVKA 4K30A 3IU2A 2AJ6A 4QB9A 2R1IA 3IU1A 4Q38A 4XPKA 4CAFA 2Z0ZA 4OLLA 4RS2A 4CAVA 1YVOA 2HV2A 2FCKA 5JQ4A 2FE7A 2PR1A 3TCVA 3C26A 2B3UA 2Z3OA 4QVTA 3S6GA 3EO4A 4PSXA 2NMTA 4M3SA 3G8WA 3F0AA 5AG5A 2YNCA 2OZUA 4KOVA 3PGPA 3S6HA 2WSAA 2QECA 5AG6A 5G1ZA 2Z3MA 4B11A 4EVYA 3F8KA 3QB8A 5A27A 4U9YA 5C88A 4UCNA 4IUSA 2QMLA 4R57A 1R57A 4HNYB 3ZJ0A 4E0AA 5I0CA 4YFJA 3BJ7A 4KOSA 2I00A 4AVCA 3FB3A 4U5YA 3R9EA 1XF8A 3TO7A 1Q2CA 3EC4A 1P4NA 2ARHA 1M4IA 3SHPA 4IF5A 3TT2A 4QC6A 2GANA 5ISVA 4KVME 5H86A 3TO9A 3K9UA 1QSNA 4C2ZA 5EC4A 4ONUA 4R3LA 4I49A 1VKCA 3GYAA 4E2AA 1RO5A 4A31A 2VXKA 5H84A 5KTDA 4CGNA 3N7ZA 1YR0A 4U9ZA 2JLMA 2X7BA 4RI1A 4A95A 2WPXA 4Y49B 1K4JA 3CXSA 2JDCA 2P6FA 4F0XA 2FIWA 3R96A 4FD7A 3FXTA 4NEXA 3V8IA 2B4BA 3IGRA 1S7KA 2B4DB 4KVOE 3E0KA 3TOAA 4MFKA 4HNWB 4B14A 2ZXVA 4FD5A 2Q0YA 2YNDA 2KCWA 2C27A 4KOWA 4J3GA 2G3AA 4LUAA 3BLNA 2Q4VA 4MFPA 3RYOA 2PR8A 2Q04A 2B3VA 2K5TA 4JLYA 2R8VA 1IYKA 2BEIA 2FT0A 2PC1A 3EFAA 5JPHA 2IL4A 1I12A 3KKWA 3IWEA 4KVXA 1IYLA 2CY2A 3B8GA 4B5OA 1M4GA 2Z3KA 4JD6A 4CAEA 3G3SA 4AVAA 1Q2YA 4AG9A 2B5GA 2YNEA 4UBRA 3A9LA 4GS4A 4HKFA 5G22A 4UFWA 5AG4A 2Q44A 2ATRA 1BOBA 2FL4A 4CGOA 5F48A 5CNPA 5F46A 3D3SA 5E96A 1I1DA 2B58A 2B5GB 5HH1A 4XPLA 2BSWA 1YX0A 4PK2A 3OWCA 4FD4A 1OZPA 4KOYA 4QBJA 4MY3A 2YNCC 1NSLA 2YGWA 3WR7A 4H6UA 3DNSA 5DWMA 1LRZA 2P6EA 4LX9A 4E8OA 2PRBA 1MJ9A 5EBVA 1RXTA 4MFJA 3H4QA 3TOBA 2J8NA 2GE3A 1Y9KA 1CJWA 4MFQA 4JJXA 2VBQA 5IV0A 4NF1A 3JVNA 2Q7BA 2REEA 3R95A 2PQ8A 1Z4RA 3D2PA 3T9YA 1M4DA 1IICA 3IWGA 1PU9A 4R87A 4C2YA 3SXOA 1NE9A 1WK4A 5DWNA 5KTCA 1CM0A 1KUYA 4HNXB 3H5ZA 4QUSA 3DDDA 5GCNA 5J8CA 2J8RA 3W6SA 3FRMA 4FD6A 2Z3PA 1Q2DA 4Y49C 1QSMA 2F5IA 4KS9A 1M1DA 3EY5A 1B6BA 3R1KA 4C7HA 1YREA 3I3GA 1I21A 1ZO0A 2P0WA 2P6GA 1Y7RA 2FIAA 2B4DA 2DPTA 4XNHB 5IX3A 4NSQA 4NXYA 4PSWA 4CGMA 4CYQA 2H5MA 1YK3A 4KSAA 2OH1A 2BL1A 1VHSA 2RC4A 3GKRA 4UCMA 1N71A 4R3KA 5G20A 1TIQA 4XPDB 4AG7A 3R9GA 2FXFA 5AG7A 4KUAA 2HQYA 2FS5A 4MFLA 2G0BA 5J8FA 2R7HA 4UWIA 1XIXA 4UFVA 4UCPA 3P2HA 5BWAB 4F0YA 3W6XA 4KLWA 1Z9UA 1YGHA 3EXNA 4KUBA 2Q4YA 1P0HA 2VI7A 3FYNA 4MBUA 3TO6A 5IB0A 2PDOA 3F5BA 2VZYA 3T90A 1BO4A 4NCZA 4X5KA 1QSRA 1PUAA 1KUVA 2ZPAA 4C7IA 1L0CA 4C2XA 2ZW4A 3TE4A 2AE6A 1QSTA 3D8PA 3LODA 2A4NA 2REFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OAD A;  2OZH A;  3VWE A;  4ORF A;  3NE7 A;  2EUI A;  3FIX A;  4B5P A;  4PV6 A;  2Y0M A;  3CXQ A;  1V0C A;  2WPW A;  5FVJ A;  4JWP A;  4B5P B;  3VWD A;  2CNM A;  2HUZ A;  4MHD A;  2O28 A;  1KZF A;  1QSO A;  2VQY A;  1M44 A;  2J8M A;  4KOX A;  5F47 A;  4UWJ A;  2PSW A;  1IID A;  4F6A A;  4L8A A;  2VEZ A;  4JXQ A;  4JXR A;  4BMH A;  2QIR A;  3PP9 A;  1WWZ A;  1NMT A;  2Z10 A;  4XNH C;  4CS0 B;  3GY9 A;  1KUX A;  3ZZI A;  1S60 A;  2D4P A;  3DR8 A;  3R9F A;  1SQH A;  1S3Z A;  1YLE A;  1FY7 A;  4II9 A;  1XEB A;  4KOU A;  4R9M A;  1J4J A;  3MGD A;  2JDD A;  4XPD C;  2ZW6 A;  2EVN A;  4CAW A;  3I9S A;  1ON0 A;  1MK4 A;  5C82 A;  2CNT A;  4KZT A;  1MJB A;  1UFH A;  4MJ8 A;  4KOR A;  2R98 A;  4UA3 A;  1Z4E A;  4OAE A;  4M85 A;  4AVB A;  2ZW7 A;  5F49 A;  3D2M A;  3QAH A;  3DR6 A;  1S7N A;  2OZG A;  4H89 A;  3W91 A;  2I79 A;  3SXN A;  1GHE A;  4AB7 A;  2VZZ A;  4ZBG A;  1S5K A;  5KTA A;  3S6F A;  1S7F A;  2ZW5 A;  3FBU A;  1S7L A;  4CAX A;  2OU2 A;  1B87 A;  3LD2 A;  2JEV A;  4MY0 A;  4KLV A;  2CNS A;  3FNC A;  3JUW A;  4CRY B;  3TTH A;  3TFY A;  3BJ8 A;  1XMT A;  3DSB A;  3CXP A;  2Z11 A;  2D4O A;  4H6Z A;  4MI4 A;  2DXQ A;  1IB1 E;  4PK3 A;  4DNC A;  4YRH A;  3S6K A;  2GIV A;  2OB0 A;  4KOT A;  4YGO A;  3P2F A;  1MJA A;  5HMN A;  1XE4 A;  1Y9W A;  4L89 A;  3PZJ A;  4CRZ B;  2G3T A;  3UY5 A;  2BUE A;  1U6M A;  2FSR A;  1YVK A;  4K30 A;  2AJ6 A;  4QB9 A;  2R1I A;  4XPK A;  2Z0Z A;  4OLL A;  4RS2 A;  4CAV A;  1YVO A;  2HV2 A;  2FCK A;  5JQ4 A;  2FE7 A;  2PR1 A;  3TCV A;  3C26 A;  2B3U A;  4QVT A;  3S6G A;  3EO4 A;  4PSX A;  2NMT A;  4M3S A;  3G8W A;  3F0A A;  2OZU A;  4KOV A;  3PGP A;  3S6H A;  2QEC A;  4EVY A;  3F8K A;  3QB8 A;  4U9Y A;  5C88 A;  4IUS A;  2QML A;  4R57 A;  1R57 A;  4HNY B;  3ZJ0 A;  4E0A A;  5I0C A;  4YFJ A;  3BJ7 A;  4KOS A;  2I00 A;  4AVC A;  3FB3 A;  4U5Y A;  3R9E A;  1XF8 A;  3TO7 A;  1Q2C A;  3EC4 A;  1P4N A;  2ARH A;  1M4I A;  3SHP A;  4IF5 A;  3TT2 A;  4QC6 A;  2GAN A;  5ISV A;  4KVM E;  5H86 A;  3TO9 A;  3K9U A;  1QSN A;  5EC4 A;  4ONU A;  4R3L A;  4I49 A;  1VKC A;  3GYA A;  4E2A A;  1RO5 A;  2VXK A;  5H84 A;  5KTD A;  3N7Z A;  1YR0 A;  4U9Z A;  2JLM A;  2X7B A;  4RI1 A;  2WPX A;  4Y49 B;  1K4J A;  3CXS A;  2JDC A;  2P6F A;  2FIW A;  3R96 A;  4FD7 A;  3FXT A;  4NEX A;  3V8I A;  2B4B A;  3IGR A;  1S7K A;  2B4D B;  4KVO E;  3E0K A;  3TOA A;  4HNW B;  2ZXV A;  4FD5 A;  2Q0Y A;  2KCW A;  2C27 A;  4KOW A;  4J3G A;  2G3A A;  4LUA A;  3BLN A;  2Q4V A;  3RYO A;  2PR8 A;  2Q04 A;  2B3V A;  2K5T A;  4JLY A;  2R8V A;  1IYK A;  2BEI A;  2FT0 A;  2PC1 A;  3EFA A;  5JPH A;  2IL4 A;  1I12 A;  3KKW A;  4KVX A;  1IYL A;  2CY2 A;  3B8G A;  4B5O A;  1M4G A;  4JD6 A;  3G3S A;  4AVA A;  1Q2Y A;  4AG9 A;  2B5G A;  4UBR A;  4GS4 A;  4HKF A;  2Q44 A;  2ATR A;  1BOB A;  2FL4 A;  5F48 A;  5CNP A;  5F46 A;  3D3S A;  5E96 A;  1I1D A;  2B58 A;  2B5G B;  5HH1 A;  4XPL A;  2BSW A;  1YX0 A;  4PK2 A;  3OWC A;  4FD4 A;  1OZP A;  4KOY A;  4QBJ A;  4MY3 A;  1NSL A;  3WR7 A;  4H6U A;  3DNS A;  5DWM A;  1LRZ A;  2P6E A;  4LX9 A;  4E8O A;  2PRB A;  1MJ9 A;  5EBV A;  1RXT A;  3H4Q A;  3TOB A;  2J8N A;  2GE3 A;  1Y9K A;  1CJW A;  4JJX A;  2VBQ A;  5IV0 A;  4NF1 A;  3JVN A;  2Q7B A;  2REE A;  3R95 A;  2PQ8 A;  1Z4R A;  3D2P A;  3T9Y A;  1M4D A;  1IIC A;  3IWG A;  1PU9 A;  4R87 A;  3SXO A;  1NE9 A;  1WK4 A;  5DWN A;  5KTC A;  1CM0 A;  1KUY A;  4HNX B;  4QUS A;  5J8C A;  3DDD A;  5GCN A;  2J8R A;  3W6S A;  3FRM A;  4FD6 A;  1Q2D A;  4Y49 C;  1QSM A;  2F5I A;  1M1D A;  3EY5 A;  1B6B A;  3R1K A;  1YRE A;  3I3G A;  1I21 A;  2P0W A;  2P6G A;  1Y7R A;  2FIA A;  2B4D A;  4XNH B;  5IX3 A;  4NSQ A;  4NXY A;  4PSW A;  2H5M A;  1YK3 A;  2OH1 A;  2BL1 A;  1VHS A;  2RC4 A;  3GKR A;  1N71 A;  4R3K A;  1TIQ A;  4XPD B;  4AG7 A;  3R9G A;  2FXF A;  4KUA A;  2HQY A;  2FS5 A;  2G0B A;  5J8F A;  2R7H A;  4UWI A;  1XIX A;  3P2H A;  4F0Y A;  3W6X A;  4KLW A;  1Z9U A;  1YGH A;  3EXN A;  4KUB A;  2Q4Y A;  1P0H A;  2VI7 A;  3FYN A;  4MBU A;  3TO6 A;  5IB0 A;  2PDO A;  3F5B A;  2VZY A;  3T90 A;  1BO4 A;  4NCZ A;  4X5K A;  1QSR A;  1PUA A;  1KUV A;  2ZPA A;  1L0C A;  2ZW4 A;  3TE4 A;  2AE6 A;  1QST A;  3D8P A;  3LOD A;  2A4N A;  2REF A; 
#chains in the Genus database with same CATH topology
 4OAD A;  2OZH A;  4OC2 A;  2ZEO A;  2PJ7 A;  3VWE A;  4ORF A;  3NE7 A;  3NH4 A;  2EUI A;  2IQ6 A;  4A30 A;  1AYE A;  1AMP A;  2EBJ A;  3FEE A;  3FIX A;  4MHY A;  3GB0 A;  4B5P A;  4NJR A;  4PV6 A;  2Y0M A;  2GLF A;  3HUV A;  3BXM A;  3CXQ A;  3MN8 A;  3BHX A;  4EME A;  1V0C A;  5HXD A;  4Q36 A;  3B35 A;  2WPW A;  1CG2 A;  4UEZ A;  2XEI A;  5FVJ A;  3PEI A;  2CXA A;  2AFZ A;  1ZG8 A;  3PB8 X;  5J1Q A;  4JWP A;  3B3C A;  1TKJ A;  4B5P B;  1HDU A;  3VWD A;  2CNM A;  1LAM A;  2HUZ A;  4W9Y A;  5DS0 A;  5LRG A;  4MHD A;  3D4U A;  2O28 A;  2WUU A;  1KZF A;  2F7V A;  4F8Z A;  1QSO A;  2AFW A;  2VQY A;  2PJ3 A;  1M44 A;  2J8M A;  4KOX A;  5F47 A;  4UWJ A;  2PSW A;  4RUH A;  4OME A;  3H8E A;  2V8H A;  1IID A;  2JBJ A;  2C6C A;  4F6A A;  4C68 A;  4L8A A;  2VEZ A;  5A28 A;  3L2N A;  4A33 A;  3IIB A;  4JXQ A;  4KSF A;  1XFO A;  4A38 A;  5ELY A;  4ZGY B;  4JXR A;  4CYP A;  4BMH A;  4F9U A;  2QIR A;  3PP9 A;  1WWZ A;  3LAC A;  2BO9 A;  1NMT A;  2Z10 A;  4CPA A;  1YQE A;  4GM5 A;  4XNH C;  4CS0 B;  3GY9 A;  1KUX A;  3ZZI A;  1S60 A;  3V38 A;  2D4P A;  3DR8 A;  4CYN A;  3R9F A;  2Q7S A;  1SQH A;  1S3Z A;  1YLE A;  4UIA A;  1XJO A;  3RAM A;  3SI0 A;  4Q7A A;  1FY7 A;  4II9 A;  3GIU A;  1Y0Y A;  1XEB A;  3JRU A;  4KOU A;  4R9M A;  2BOA A;  1J4J A;  4NJQ A;  4CGP A;  3MGD A;  2QVP A;  4OC1 A;  2JDD A;  1R3N A;  4XPD C;  2ZW6 A;  3KR4 A;  4AXV A;  2EVN A;  4MFZ A;  3SI2 A;  4MCS A;  4ONW A;  4CAW A;  3I9S A;  3ISX A;  3FED A;  1ON0 A;  1MK4 A;  5C82 A;  5AGE A;  2CNT A;  4KZT A;  4MCP A;  4B12 A;  1CPS A;  1MJB A;  1UFH A;  4OC3 A;  4MJ8 A;  1FNO A;  2V8V A;  4B10 A;  4KOR A;  2R98 A;  1YW6 A;  5G21 A;  4A32 A;  4UA3 A;  2EK9 A;  1Z4E A;  3BI1 A;  4M85 A;  4OAE A;  2ZW7 A;  4AVB A;  2EK8 A;  3WAB A;  4RN7 A;  3IJ3 A;  3D2M A;  3KHZ A;  3QAH A;  3DR6 A;  5F49 A;  4DJL A;  3KQX A;  1S7N A;  5K8P A;  4P10 A;  2NSM A;  2OZG A;  1IOF A;  4UFX A;  1F57 A;  4H89 A;  1ZG9 A;  3W91 A;  2I79 A;  3SXN A;  1GHE A;  3LWU A;  2VZZ A;  4AB7 A;  2AFO A;  4ZBG A;  1S5K A;  5KTA A;  4OP4 A;  3S6F A;  1S7F A;  2ZW5 A;  4OC5 A;  3FBU A;  3VAR A;  1S7L A;  4CAX A;  2Z3N A;  4ZY0 A;  2OU2 A;  1NSA A;  1B87 A;  2PJA A;  2V8D A;  1ELL P;  2JEV A;  3LD2 A;  4MY0 A;  4KLV A;  2XEF A;  3WC5 A;  5CBM A;  2CNS A;  3FNC A;  3FF3 A;  5LRK A;  3JUW A;  3SJX A;  4CRY B;  3JTK A;  3KR5 A;  3TTH A;  1VHO A;  2PJ6 A;  4P4E A;  2ANP A;  4G1P A;  3TFY A;  3BJ8 A;  1XMT A;  3DSB A;  3B2Y A;  1IU8 A;  2EO8 A;  4ZI6 A;  4MCQ A;  3FH4 A;  2PJ9 A;  3QAY A;  3H8G A;  1Z8X A;  4A2Z A;  1BAV A;  1H8L A;  3CXP A;  2Z11 A;  2DPS A;  4P4F A;  2CTB A;  2D4O A;  4H6Z A;  4MI4 A;  3V7Z A;  2DXQ A;  1CP6 A;  1IB1 E;  4PK3 A;  4DNC A;  1ZLI A;  4YRH A;  3D7G A;  3IEH A;  3S6K A;  4CYO A;  2GIV A;  2ZOG A;  2PJB A;  3WC7 A;  1YSJ A;  2ZOF A;  4B13 A;  2OB0 A;  3TC8 A;  4KOT A;  2CTC A;  4YGO A;  3P2F A;  1MJA A;  5HMN A;  2Q43 A;  4BBH A;  3B3T A;  1XE4 A;  4DYO A;  1Y9W A;  4L89 A;  1ELM P;  3KHX A;  1Q7L A;  3K9T A;  3PZJ A;  4CRZ B;  3KZW A;  4F9V A;  2XEJ A;  4CGL A;  2G3T A;  2AFX A;  2BUE A;  3UY5 A;  1U6M A;  3KQZ A;  2FSR A;  2Z3L A;  1YVK A;  1Y7E A;  2GRE A;  3D66 A;  4K30 A;  4ZYQ A;  5LRJ A;  3IU2 A;  2AJ6 A;  2RB7 A;  2ZEE A;  4QB9 A;  3B7I A;  2R1I A;  3IU1 A;  4Q38 A;  4XPK A;  3RZA A;  4CAF A;  2PE3 A;  3CT9 A;  2Z0Z A;  4OLL A;  2IJZ A;  4RS2 A;  4CAV A;  1YVO A;  2HV2 A;  2FCK A;  5EMI A;  5JQ4 A;  2AFU A;  2FE7 A;  2PR1 A;  3TCV A;  3C26 A;  2B3U A;  2Z3O A;  4PXE A;  4QVT A;  3S6G A;  3EO4 A;  2I3C A;  4PSX A;  2NMT A;  4M3S A;  3G8W A;  4DUK A;  4IHM A;  1RTQ A;  3F0A A;  5AG5 A;  3SJG A;  3NH5 A;  4ZX9 A;  2YNC A;  2OZU A;  4KOV A;  3PGP A;  3S6H A;  3KAS A;  2VL1 A;  2WSA A;  2QEC A;  5AG6 A;  4K3N A;  5G1Z A;  5THW A;  2Z3M A;  2PCU A;  3PB6 X;  4B11 A;  1BPN A;  1ZG7 A;  4WWV A;  4EVY A;  3F8K A;  3QB8 A;  5A27 A;  1Z2L A;  4U9Y A;  5C88 A;  4UCN A;  4IUS A;  2QML A;  2PJ4 A;  4R57 A;  1R57 A;  4HNY B;  3ZJ0 A;  4E0A A;  5I0C A;  4JZ0 A;  2OOT A;  4YFJ A;  3BJ7 A;  1PYT B;  4KOS A;  3PFO A;  2I00 A;  4AVC A;  4NFR A;  3FB3 A;  4U5Y A;  2PJ1 A;  2Q51 A;  4YWY A;  3R9E A;  1XF8 A;  3TO7 A;  1JWQ A;  1TKH A;  1Z8T A;  4FUU A;  1Q2C A;  3EC4 A;  2ZEN A;  2WYR A;  1P4N A;  3QNV A;  2ARH A;  1M4I A;  2RFH A;  1LFW A;  1XMB A;  3FMC A;  4MHN A;  3SHP A;  2ZEF A;  2ZEP A;  4IF5 A;  2QJ8 A;  3TT2 A;  4QC6 A;  2GAN A;  4ZX8 A;  4KVM E;  5H86 A;  2QYV A;  5ISV A;  3TO9 A;  4B6Z A;  1F2O A;  2ZEL A;  3DLJ A;  4LQ6 A;  3NA6 A;  3K9U A;  4OIW A;  1QSN A;  4C2Z A;  5EC4 A;  4ONU A;  4R3L A;  1VKC A;  3GYA A;  3CPA A;  4I49 A;  3RBU A;  1RO5 A;  4A37 A;  1VHE A;  4OC4 A;  4A31 A;  4FAI A;  2AFM A;  4NGM A;  2VXK A;  1KWM A;  5H84 A;  5LYD A;  5KTD A;  4CGN A;  1CP7 A;  4MMO A;  3FX6 A;  1UWY A;  3N7Z A;  4M6H A;  1YR0 A;  4U9Z A;  2JLM A;  2X7B A;  4MHP A;  4PQA A;  5K8M A;  1DTD A;  1IGB A;  4PXB A;  4RI1 A;  7CPA A;  3RNZ A;  4R7M A;  2WPX A;  4A95 A;  1EE3 P;  4ZY2 A;  4Y49 B;  1R43 A;  5JH9 A;  1K4J A;  4Z65 A;  2HC9 A;  3PRT A;  3CXS A;  2JDC A;  5JGF A;  1QQ9 A;  2P6F A;  4F0X A;  2FIW A;  2PIY A;  4WJB A;  3R96 A;  1TF8 A;  4UEE A;  4FD7 A;  3FXT A;  4NEX A;  3V8I A;  2FVG A;  2PJC A;  2B4B A;  2Q4Z A;  3D67 A;  3IGR A;  4OID A;  2WZN A;  1S7K A;  2B4D B;  3B3V A;  4P4D A;  4KVO E;  2GLJ A;  3K2K A;  1LOK A;  3E0K A;  3S9N A;  3TOA A;  1JQG A;  4MFK A;  4HNW B;  3VAT A;  5IB9 A;  4B14 A;  3PB4 X;  2ZXV A;  4UF4 A;  4FD5 A;  2Q0Y A;  2YND A;  4KSI A;  2HB6 A;  6CPA A;  2KCW A;  2C27 A;  1BPM A;  4J3G A;  2G3A A;  4KOW A;  3BLN A;  4LUA A;  4OKO A;  2Q4V A;  4MFP A;  3RYO A;  2PR8 A;  2Q04 A;  2PVW A;  4OC0 A;  2ABZ A;  1OBR A;  1XRY A;  4BD9 A;  2B3V A;  2DEA A;  5HVF A;  5LYF A;  1M4L A;  1YLO A;  2K5T A;  3PBB A;  4JLY A;  3KI9 A;  2R8V A;  4PXD A;  1IYK A;  4FWU A;  2BEI A;  2IMO A;  3VH9 A;  2FT0 A;  2PC1 A;  3EFA A;  4P4J A;  1XOV A;  3GLJ A;  3FVL A;  5LYI A;  4FBE A;  3ISZ A;  3S9M A;  5JPH A;  2IL4 A;  1I12 A;  1YME A;  3D7H A;  3KKW A;  3IWE A;  4KVX A;  1IYL A;  2CY2 A;  3B8G A;  4MRI A;  2PRQ A;  4B5O A;  4H2K A;  5K8N A;  4R6T A;  4P4I A;  3KGQ A;  3LMS A;  1FT7 A;  1M4G A;  2Z3K A;  3IO1 A;  4JD6 A;  4CAE A;  3G3S A;  4AVA A;  4EFD A;  1Q2Y A;  4AG9 A;  2B5G A;  1TXR A;  2YNE A;  4UBR A;  3A9L A;  4GS4 A;  4HKF A;  5G22 A;  2G9D A;  4UFW A;  5AG4 A;  4P45 A;  2Q44 A;  2JEW A;  2ATR A;  1BOB A;  2FL4 A;  1F2P A;  4NGQ A;  3PB9 X;  4CGO A;  2ZEM A;  5F48 A;  5CNP A;  5F46 A;  3D3S A;  5E96 A;  1BLL E;  4NGT A;  3S9L A;  3WC6 A;  1I1D A;  1HEE A;  2B58 A;  2B5G B;  2PJ2 A;  4TWE A;  5HH1 A;  4XPL A;  2BSW A;  1YX0 A;  4PK2 A;  3OWC A;  4FD4 A;  1OZP A;  1Y0R A;  4KOY A;  3TX8 A;  4QBJ A;  1CX8 A;  4MY3 A;  4A39 A;  2YNC C;  2ODF A;  1LAP A;  2O53 A;  1NSL A;  2XEG A;  2YGW A;  3RO0 A;  3SJE A;  3WR7 A;  2J9A A;  4H6U A;  3B3W A;  1IOI A;  3DNS A;  4X8I A;  5DWM A;  2PIZ A;  5I4M A;  3N5F A;  5K8O A;  1GYT A;  1LRZ A;  1Z8L A;  1XBU A;  2P6E A;  4LX9 A;  4ZY1 A;  8CPA A;  4NGS A;  4E8O A;  2PRB A;  1MJ9 A;  2ZED A;  1RXT A;  4MFJ A;  5EBV A;  3H4Q A;  3TOB A;  5HVG A;  1LCP A;  2J8N A;  2GE3 A;  1Y9K A;  1YW4 A;  2NYQ A;  1CJW A;  1HDQ A;  4JYW A;  4MFQ A;  4JJX A;  1AUG A;  4R8F A;  2VBQ A;  4E2A A;  1ARL A;  2PJ8 A;  4NF1 A;  3JVN A;  2Q7B A;  5IV0 A;  1CBX A;  4NGN A;  2REE A;  2GU2 A;  3R95 A;  2GFQ A;  2PQ8 A;  1Z4R A;  3D2P A;  3T9Y A;  1DE4 C;  1M4D A;  2ZEG A;  4IK2 A;  3CPX A;  1IIC A;  4LQG A;  3IWG A;  1PU9 A;  1ZLH A;  4R87 A;  4TNU A;  1QMU A;  4C2Y A;  3SXO A;  4P44 A;  1NE9 A;  4MCR A;  1WK4 A;  2F8H A;  4GXH A;  5DWN A;  1CM0 A;  1TKF A;  5KTC A;  1KUY A;  3NE8 A;  3H5Z A;  4HNX B;  3DDD A;  4QUS A;  4HPS A;  2J8R A;  4X2T A;  5GCN A;  5J8C A;  3W6S A;  3FRM A;  3T8W A;  4FD6 A;  2Z3P A;  1Q2D A;  4Y49 C;  1QSM A;  2F5I A;  2CF4 A;  4MHZ A;  4KS9 A;  1X10 A;  1M1D A;  2V8G A;  3EY5 A;  1B6B A;  1VIX A;  1PCA A;  1CPX A;  2PJ5 A;  3R1K A;  4C7H A;  1YRE A;  3I3G A;  3FEC A;  1I21 A;  1ZO0 A;  1X12 A;  3IFE A;  4MXU A;  2C1C A;  2P0W A;  3D7D A;  4UEF A;  2P6G A;  1Y7R A;  3PBE A;  2FIA A;  2B4D A;  2DPT A;  3HLP A;  4XNH B;  5IX3 A;  2PJ0 A;  4NSQ A;  1A2Z A;  4NXY A;  2AFS A;  4PSW A;  1ARM A;  3I1U A;  2H5M A;  4CGM A;  4UIB A;  4CYQ A;  1YK3 A;  4KSA A;  2OH1 A;  3CZX A;  2BL1 A;  1VHS A;  2RC4 A;  3GKR A;  4M6G A;  4UCM A;  3SJF A;  1N71 A;  1IY7 A;  2POK A;  4R3K A;  5G20 A;  1TIQ A;  5JM6 A;  4XPD B;  4AG7 A;  3H8F A;  3R9G A;  2FXF A;  5LYL A;  5CPA A;  2JBK A;  3NFZ A;  5AG7 A;  4KUA A;  2HQY A;  2FS5 A;  3IC1 A;  4MFL A;  5D8N A;  1Z5R A;  2G0B A;  3PFE A;  5J8F A;  2R7H A;  3WT4 A;  3CDX A;  3BI0 A;  4UWI A;  1TF9 A;  1XIX A;  2DF5 A;  4UFV A;  4UCP A;  4P6Y A;  3P2H A;  5BWA B;  4F0Y A;  3W6X A;  4KLW A;  3GUX A;  1Z9U A;  1YGH A;  3EXN A;  2C6G A;  4KUB A;  2Q4Y A;  1LAN A;  1VGY A;  1P0H A;  2VI7 A;  3FYN A;  4MBU A;  4A94 A;  2OR4 A;  2EWB A;  2C6P A;  3DGV A;  3TO6 A;  4O23 A;  3SI1 A;  2BCO A;  2PVV A;  5IB0 A;  2PDO A;  4PPZ A;  2O4H A;  3PB7 X;  4R76 A;  4P4B A;  4X3R A;  3F5B A;  2VZY A;  4NGR A;  4PXC A;  3T90 A;  3D68 A;  5D29 A;  1BO4 A;  4NCZ A;  4X5K A;  3B3S A;  3KL9 A;  2CIJ A;  1QSR A;  2ZEH A;  3FJU A;  1PUA A;  5F09 A;  2V77 A;  1KUV A;  2ZPA A;  4YU9 A;  5HVH A;  4C7I A;  1Z8W A;  3IWW A;  1L0C A;  4IAV A;  2ZW4 A;  4C2X A;  3TE4 A;  3D7F A;  2AE6 A;  3NH8 A;  1QST A;  4M6I A;  3D8P A;  3LOD A;  4EWT A;  2A4N A;  3MRU A;  2REF A;  4NGP A;  4BIN A; 
#chains in the Genus database with same CATH homology
 4OAD A;  2OZH A;  3VWE A;  4ORF A;  3NE7 A;  2EUI A;  4A30 A;  3FIX A;  4B5P A;  4PV6 A;  2Y0M A;  3CXQ A;  1V0C A;  4Q36 A;  2WPW A;  5FVJ A;  2CXA A;  4JWP A;  4B5P B;  3VWD A;  2CNM A;  2HUZ A;  4MHD A;  2O28 A;  2WUU A;  1KZF A;  1QSO A;  2VQY A;  1M44 A;  2J8M A;  4KOX A;  5F47 A;  4UWJ A;  2PSW A;  1IID A;  4F6A A;  4C68 A;  4L8A A;  2VEZ A;  5A28 A;  4A33 A;  4JXQ A;  4KSF A;  4ZGY B;  4JXR A;  4CYP A;  4BMH A;  2QIR A;  3PP9 A;  1WWZ A;  1NMT A;  2Z10 A;  4XNH C;  4CS0 B;  3GY9 A;  1KUX A;  3ZZI A;  1S60 A;  2D4P A;  3DR8 A;  4CYN A;  3R9F A;  1SQH A;  1S3Z A;  1YLE A;  1FY7 A;  4II9 A;  1XEB A;  4KOU A;  4R9M A;  1J4J A;  4CGP A;  3MGD A;  2JDD A;  4XPD C;  2ZW6 A;  2EVN A;  4MFZ A;  4CAW A;  3I9S A;  1ON0 A;  1MK4 A;  5C82 A;  5AGE A;  2CNT A;  4KZT A;  4B12 A;  1MJB A;  1UFH A;  4MJ8 A;  4B10 A;  4KOR A;  2R98 A;  5G21 A;  4A32 A;  4UA3 A;  1Z4E A;  4OAE A;  4M85 A;  4AVB A;  2ZW7 A;  5F49 A;  3D2M A;  3QAH A;  3DR6 A;  1S7N A;  2OZG A;  4UFX A;  4H89 A;  3W91 A;  2I79 A;  3SXN A;  1GHE A;  4AB7 A;  2VZZ A;  4ZBG A;  1S5K A;  5KTA A;  3S6F A;  1S7F A;  2ZW5 A;  3FBU A;  1S7L A;  4CAX A;  2Z3N A;  2OU2 A;  1B87 A;  3LD2 A;  2JEV A;  4MY0 A;  4KLV A;  2CNS A;  3FNC A;  3JUW A;  4CRY B;  3JTK A;  3TTH A;  3TFY A;  3BJ8 A;  1XMT A;  3DSB A;  4A2Z A;  3CXP A;  2Z11 A;  2DPS A;  2D4O A;  4H6Z A;  4MI4 A;  2DXQ A;  1IB1 E;  4PK3 A;  4DNC A;  4YRH A;  3S6K A;  4CYO A;  2GIV A;  4B13 A;  2OB0 A;  4KOT A;  4YGO A;  3P2F A;  1MJA A;  5HMN A;  4BBH A;  1XE4 A;  1Y9W A;  4L89 A;  3PZJ A;  4CRZ B;  4CGL A;  2G3T A;  3UY5 A;  2BUE A;  1U6M A;  2FSR A;  2Z3L A;  1YVK A;  4K30 A;  3IU2 A;  2AJ6 A;  4QB9 A;  2R1I A;  3IU1 A;  4Q38 A;  4XPK A;  4CAF A;  2Z0Z A;  4OLL A;  4RS2 A;  4CAV A;  1YVO A;  2HV2 A;  2FCK A;  5JQ4 A;  2FE7 A;  2PR1 A;  3TCV A;  3C26 A;  2B3U A;  2Z3O A;  4QVT A;  3S6G A;  3EO4 A;  4PSX A;  2NMT A;  4M3S A;  3G8W A;  3F0A A;  5AG5 A;  2YNC A;  2OZU A;  4KOV A;  3PGP A;  3S6H A;  2WSA A;  2QEC A;  5AG6 A;  5G1Z A;  2Z3M A;  4B11 A;  4EVY A;  3F8K A;  3QB8 A;  5A27 A;  4U9Y A;  5C88 A;  4UCN A;  4IUS A;  2QML A;  4R57 A;  1R57 A;  4HNY B;  3ZJ0 A;  4E0A A;  5I0C A;  4YFJ A;  3BJ7 A;  4KOS A;  2I00 A;  4AVC A;  3FB3 A;  4U5Y A;  3R9E A;  1XF8 A;  3TO7 A;  1Q2C A;  3EC4 A;  1P4N A;  2ARH A;  1M4I A;  3SHP A;  4IF5 A;  3TT2 A;  4QC6 A;  2GAN A;  5ISV A;  4KVM E;  5H86 A;  3TO9 A;  3K9U A;  1QSN A;  4C2Z A;  5EC4 A;  4ONU A;  4R3L A;  4I49 A;  1VKC A;  3GYA A;  4E2A A;  1RO5 A;  4A31 A;  2VXK A;  5H84 A;  5KTD A;  4CGN A;  3N7Z A;  1YR0 A;  4U9Z A;  2JLM A;  2X7B A;  4RI1 A;  4A95 A;  2WPX A;  4Y49 B;  1K4J A;  3CXS A;  2JDC A;  2P6F A;  4F0X A;  2FIW A;  3R96 A;  4FD7 A;  3FXT A;  4NEX A;  3V8I A;  2B4B A;  3IGR A;  1S7K A;  2B4D B;  4KVO E;  3E0K A;  3TOA A;  4MFK A;  4HNW B;  4B14 A;  2ZXV A;  4FD5 A;  2Q0Y A;  2YND A;  2KCW A;  2C27 A;  4KOW A;  4J3G A;  2G3A A;  4LUA A;  3BLN A;  2Q4V A;  4MFP A;  3RYO A;  2PR8 A;  2Q04 A;  2B3V A;  2K5T A;  4JLY A;  2R8V A;  1IYK A;  2BEI A;  2FT0 A;  2PC1 A;  3EFA A;  5JPH A;  2IL4 A;  1I12 A;  3KKW A;  3IWE A;  4KVX A;  1IYL A;  2CY2 A;  3B8G A;  4B5O A;  1M4G A;  2Z3K A;  4JD6 A;  4CAE A;  3G3S A;  4AVA A;  1Q2Y A;  4AG9 A;  2B5G A;  2YNE A;  4UBR A;  3A9L A;  4GS4 A;  4HKF A;  5G22 A;  4UFW A;  5AG4 A;  2Q44 A;  2ATR A;  1BOB A;  2FL4 A;  4CGO A;  5F48 A;  5CNP A;  5F46 A;  3D3S A;  5E96 A;  1I1D A;  2B58 A;  2B5G B;  5HH1 A;  4XPL A;  2BSW A;  1YX0 A;  4PK2 A;  3OWC A;  4FD4 A;  1OZP A;  4KOY A;  4QBJ A;  4MY3 A;  2YNC C;  1NSL A;  2YGW A;  3WR7 A;  4H6U A;  3DNS A;  5DWM A;  1LRZ A;  2P6E A;  4LX9 A;  4E8O A;  2PRB A;  1MJ9 A;  5EBV A;  1RXT A;  4MFJ A;  3H4Q A;  3TOB A;  2J8N A;  2GE3 A;  1Y9K A;  1CJW A;  4MFQ A;  4JJX A;  2VBQ A;  5IV0 A;  4NF1 A;  3JVN A;  2Q7B A;  2REE A;  3R95 A;  2PQ8 A;  1Z4R A;  3D2P A;  3T9Y A;  1M4D A;  1IIC A;  3IWG A;  1PU9 A;  4R87 A;  4C2Y A;  3SXO A;  1NE9 A;  1WK4 A;  5DWN A;  5KTC A;  1CM0 A;  1KUY A;  4HNX B;  3H5Z A;  4QUS A;  3DDD A;  5GCN A;  5J8C A;  2J8R A;  3W6S A;  3FRM A;  4FD6 A;  2Z3P A;  1Q2D A;  4Y49 C;  1QSM A;  2F5I A;  4KS9 A;  1M1D A;  3EY5 A;  1B6B A;  3R1K A;  4C7H A;  1YRE A;  3I3G A;  1I21 A;  1ZO0 A;  2P0W A;  2P6G A;  1Y7R A;  2FIA A;  2B4D A;  2DPT A;  4XNH B;  5IX3 A;  4NSQ A;  4NXY A;  4PSW A;  4CGM A;  4CYQ A;  2H5M A;  1YK3 A;  4KSA A;  2OH1 A;  2BL1 A;  1VHS A;  2RC4 A;  3GKR A;  4UCM A;  1N71 A;  4R3K A;  5G20 A;  1TIQ A;  4XPD B;  4AG7 A;  3R9G A;  2FXF A;  5AG7 A;  4KUA A;  2HQY A;  2FS5 A;  4MFL A;  2G0B A;  5J8F A;  2R7H A;  4UWI A;  1XIX A;  4UFV A;  4UCP A;  3P2H A;  5BWA B;  4F0Y A;  3W6X A;  4KLW A;  1Z9U A;  1YGH A;  3EXN A;  4KUB A;  2Q4Y A;  1P0H A;  2VI7 A;  3FYN A;  4MBU A;  3TO6 A;  5IB0 A;  2PDO A;  3F5B A;  2VZY A;  3T90 A;  1BO4 A;  4NCZ A;  4X5K A;  1QSR A;  1PUA A;  1KUV A;  2ZPA A;  4C7I A;  1L0C A;  4C2X A;  2ZW4 A;  3TE4 A;  2AE6 A;  1QST A;  3D8P A;  3LOD A;  2A4N A;  2REF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...