4H6UA

Tubulin acetyltransferase mutant
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
187
structure length
165
Chain Sequence
SFTMDFPYDLNALFPERISVLDSNLSAGRKAHGRPDPLPQVTTVIDELGKNRHHLYLLKDGEGGRGVIVGFLKVGYKKLFLLDQRGAHLETEPLCVLAFYVTETLQRHGYGSELFDFMLKHKQVEPAQMAYDRPSPKFLSFLEKRYDLRNSVPQVNNFVVFAGFF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of tubulin acetyltransferase reveal a conserved catalytic core and the plasticity of the essential N terminus.
pubmed doi rcsb
source organism Danio rerio
molecule tags Transferase
molecule keywords Alpha-tubulin N-acetyltransferase
total genus 36
structure length 165
sequence length 187
chains with identical sequence B
ec nomenclature ec 2.3.1.108: Alpha-tubulin N-acetyltransferase.
pdb deposition date 2012-09-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05301 Acetyltransf_16 GNAT acetyltransferase, Mec-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4h6uA00
4PSXA 1MJAA 4FD7A 3W91A 4NXYA 2WPXA 4B5PA 1XF8A 2BL1A 2J8NA 1SQHA 2Q04A 2R98A 4UBRA 1WK4A 2B58A 4HKFA 3ZJ0A 1PUAA 2QIRA 4CAXA 4HNXB 2R7HA 4AVAA 2FSRA 1M4IA 2REFA 4L89A 1XMTA 2J8RA 3D2MA 4R3LA 2P0WA 2JLMA 4CAWA 1YLEA 1YX0A 2FIWA 1S60A 2JDCA 3DR8A 4JXQA 2B5GA 1YK3A 3RYOA 2Y0MA 1VKCA 3TT2A 3EC4A 1B87A 1IYLA 4FD6A 5IX3A 1M44A 5KTCA 2AJ6A 1CM0A 4X5KA 5F48A 5JQ4A 3DNSA 2CY2A 3SHPA 3E0KA 5CNPA 2B5GB 1GHEA 4PK3A 1QSOA 2BSWA 3R95A 1NE9A 3TO7A 2GIVA 1LRZA 3R96A 2Q7BA 1M4DA 2Q4VA 2VQYA 2K5TA 4UWJA 3R9FA 5H86A 2BUEA 3D2PA 3V8IA 3VWEA 3W6XA 2Z0ZA 2RC4A 1S7FA 5IB0A 2R1IA 1Z4RA 3N7ZA 1XEBA 2B4DB 1R57A 4QUSA 4KOWA 4PK2A 2AE6A 2QMLA 2BEIA 3R1KA 3IGRA 4B5PB 4KUBA 4MJ8A 1K4JA 4L8AA 1BO4A 2OZUA 2I00A 3S6KA 4U9ZA 2B3VA 4CS0B 4UA3A 4AG9A 5C82A 5JPHA 1OZPA 2ATRA 3OWCA 3FIXA 5ISVA 3KKWA 1YREA 3PGPA 5J8CA 4IF5A 4JWPA 4F0YA 1KUYA 3W6SA 1BOBA 4YRHA 1V0CA 3S6HA 2D4PA 2HUZA 2EVNA 4XNHC 5DWMA 3MGDA 1QSNA 4KZTA 4LUAA 2OU2A 4K30A 3DDDA 3JUWA 5KTAA 3UY5A 4HNWB 2A4NA 4BMHA 2H5MA 3TOAA 4JLYA 4NSQA 3TO9A 2CNTA 1VHSA 4H6ZA 4R87A 2FE7A 3DSBA 1TIQA 1KZFA 1RO5A 1YVOA 1Q2CA 4MI4A 5IV0A 3EXNA 2J8MA 3BLNA 3TTHA 2F5IA 3F5BA 2B3UA 2PDOA 3S6GA 1UFHA 3B8GA 4R9MA 3TO6A 1QSRA 4I49A 4OAEA 2KCWA 2IL4A 4KVME 2CNSA 2Q44A 3TCVA 1QSTA 1I21A 3FBUA 2ARHA 2ZW5A 4IUSA 4NEXA 1KUXA 4KUAA 2B4DA 3FRMA 4KORA 2ZPAA 4J3GA 4KOXA 3SXOA 2NMTA 1RXTA 4OLLA 4MBUA 3K9UA 4EVYA 3TFYA 5EBVA 4PV6A 2B4BA 3G8WA 4ORFA 1N71A 2O28A 1IYKA 3CXPA 4E8OA 2D4OA 2JDDA 3EFAA 3SXNA 3F8KA 3JVNA 1B6BA 2FS5A 1NSLA 3DR6A 3T9YA 4JD6A 3GYAA 4U9YA 4QC6A 4RI1A 4RS2A 3VWDA 4YFJA 1P4NA 4JJXA 1YGHA 2FCKA 4DNCA 3I3GA 4H89A 3FYNA 4XNHB 4UWIA 4JXRA 2P6FA 3S6FA 3R9GA 1Z9UA 2G0BA 1Y9KA 2G3TA 2VZYA 2ZXVA 3CXSA 1Q2DA 3CXQA 3FXTA 1IB1E 4NCZA 3WR7A 2Z10A 2ZW4A 3IWGA 4MY3A 4KLWA 4KVXA 2PC1A 3FB3A 5F46A 4LX9A 3ZZIA 1I12A 4R57A 2ZW7A 4MY0A 4CAVA 1Q2YA 1Z4EA 5C88A 4PSWA 4AB7A 4Y49B 2OB0A 1L0CA 2PR1A 4KVOE 2P6GA 1S7LA 4AG7A 1KUVA 3EY5A 1U6MA 4AVBA 2R8VA 1J4JA 3LD2A 1S7KA 3NE7A 2PR8A 4HNYB 2WPWA 4KOSA 2QECA 3QB8A 1M4GA 3BJ7A 4KOVA 3C26A 4ZBGA 2I79A 5F49A 2DXQA 1YR0A 3LODA 4QBJA 2VZZA 1WWZA 4M3SA 1S3ZA 2PQ8A 3QAHA 5HMNA 2OZHA 2FT0A 2C27A 4H6UA 4KLVA 4XPLA 1Y7RA 4CRZB 2VI7A 1S7NA 2VEZA 4AVCA 4E2AA 4E0AA 2PSWA 1Y9WA 3H4QA 1YVKA 4KOYA 3T90A 2OH1A 4Y49C 1MJBA 4FD4A 3FNCA 4QVTA 2FIAA 2HV2A 3I9SA 2P6EA 2VBQA 4FD5A 4F6AA 2FL4A 4KOUA 1XIXA 5I0CA 2Z11A 2Q4YA 4GS4A 3GY9A 4NF1A 3D8PA 2EUIA 1FY7A 1S5KA 4ONUA 1PU9A 4OADA 2FXFA 1XE4A 3EO4A 4XPDB 2CNMA 3TE4A 5E96A 1M1DA 1MJ9A 2REEA 2G3AA 5KTDA 2X7BA 4M85A 1I1DA 3G3SA 4CRYB 3BJ8A 5FVJA 1NMTA 3F0AA 4MHDA 5H84A 4B5OA 4XPKA 4YGOA 4QB9A 2OZGA 1QSMA 3TOBA 5F47A 1P0HA 1MK4A 2VXKA 3R9EA 2JEVA 2GANA 1CJWA 2Q0YA 3PP9A 5HH1A 5DWNA 1IICA 2GE3A 3D3SA 4KOTA 1IIDA 2ZW6A 3GKRA 4II9A 4R3KA 5J8FA 5EC4A 4U5YA 3P2FA 3P2HA 2HQYA 1ON0A 2PRBA 3PZJA 4XPDC 5GCNA
chains in the Genus database with same CATH superfamily
4R76A 4PSXA 4M6GA 1MJAA 4FD7A 2PJ8A 3W91A 2EK9A 4NXYA 5G21A 2WPXA 3IWEA 4B5PA 1XF8A 2BL1A 2J8NA 3D7FA 1SQHA 3GLJA 4P4JA 2Q04A 1YW4A 2AFWA 4K3NA 2R98A 4UBRA 1WK4A 1ELLP 1ZG9A 2IMOA 2QJ8A 2YGWA 4GXHA 4CGOA 1Z8WA 2B58A 4HKFA 3ZJ0A 1PUAA 1TXRA 2QIRA 4MFLA 4BD9A 4CAXA 1YMEA 4HNXB 3DLJA 4WJBA 2R7HA 4AVAA 2FSRA 1M4IA 3ISXA 4P4BA 2REFA 4A2ZA 4B6ZA 2GLJA 3I1UA 5CBMA 1CPSA 1ZLIA 4L89A 1AMPA 1XMTA 1Z8TA 2J8RA 3D2MA 4OC0A 3FECA 4PXBA 4C2XA 4A37A 3NE8A 4R3LA 2P0WA 2JLMA 3L2NA 2GFQA 3WC6A 4UFVA 1YLEA 2WUUA 4CAWA 4CYOA 5J1QA 1Y0YA 3KHZA 5JGFA 1YX0A 8CPAA 1FNOA 2FIWA 1S60A 1ARMA 4NGTA 3RO0A 2JDCA 3DR8A 4JXQA 1Q7LA 2B5GA 1YK3A 4MCRA 3RYOA 2Y0MA 1VKCA 3TT2A 5DS0A 3EC4A 4MXUA 1B87A 2CIJA 3KGQA 1IYLA 4FD6A 4RUHA 5IX3A 1M44A 2ZEEA 2PJBA 5KTCA 2YNCC 4CGPA 4MHYA 2PJ0A 1CM0A 2AJ6A 4X5KA 5F48A 3D7GA 2PJ6A 3GUXA 2PJ7A 5JQ4A 3D66A 1Z8XA 2CTCA 2JBKA 2Z3MA 1KWMA 2Q43A 3DNSA 1Y0RA 5LYDA 4G1PA 2CY2A 2DF5A 4CAEA 2PCUA 3SHPA 3E0KA 4IK2A 2PE3A 5CNPA 2B5GB 3KR5A 1VHEA 1GHEA 3SJXA 4PK3A 1QSOA 1R43A 3NFZA 4PPZA 4TNUA 2BSWA 4KS9A 3R95A 4C7IA 4CYPA 1NE9A 5K8NA 3TO7A 4MCQA 2GIVA 4F8ZA 4TWEA 2GREA 1LRZA 3R96A 2Q7BA 1M4DA 2Q4VA 5ELYA 2VQYA 4LQGA 2K5TA 4FAIA 1XJOA 4UWJA 3R9FA 3FEDA 4MFPA 5H86A 2BUEA 3D2PA 2ODFA 3V8IA 2DEAA 3VWEA 3W6XA 4CYQA 2EBJA 2Z0ZA 2RC4A 5G22A 3S9NA 1S7FA 5IB0A 2EK8A 2R1IA 1Z4RA 5A27A 3GIUA 4UFXA 4EWTA 2Z3OA 1XMBA 3N7ZA 2AFSA 1XEBA 2J9AA 2B4DB 3BXMA 5THWA 4ZX9A 1R57A 4QUSA 1TF9A 4KOWA 1CP7A 2FVGA 4PK2A 4PXDA 2AE6A 3KQXA 3B3TA 2QMLA 1VHOA 2BEIA 1DE4C 2IJZA 3R1KA 3IGRA 4B5PB 2V8DA 4ZI6A 1BPNA 2Z3LA 2HC9A 4KUBA 4MJ8A 2PJ5A 3KL9A 1K4JA 4DUKA 4L8AA 1BO4A 3FX6A 2OZUA 2I00A 3S6KA 3D4UA 4ZY1A 4U9ZA 4DJLA 2I3CA 2B3VA 1LAMA 4C2YA 3S9LA 4CS0B 1ZG7A 3B3WA 4OKOA 2XEJA 4UA3A 4W9YA 4AG9A 5C82A 5JPHA 1OZPA 4YU9A 3V7ZA 2ATRA 2ZOGA 3OWCA 3FIXA 3LMSA 5ISVA 2BOAA 2V8VA 3H8GA 3KKWA 3QAYA 1YREA 3PGPA 3PB8X 4OC5A 5J8CA 2YNCA 4IF5A 4JWPA 2AFUA 4F0YA 2C1CA 4MFZA 1KUYA 3W6SA 1BOBA 4YRHA 4R7MA 3RAMA 1V0CA 2IQ6A 3S6HA 2D4PA 2HUZA 4OP4A 2QYVA 4A30A 3HLPA 2EVNA 3IC1A 4XNHC 4ZY0A 2YNEA 2PJ1A 2Z3KA 5DWMA 3MGDA 2F8HA 1QSNA 1LANA 3PFEA 7CPAA 1IU8A 4KZTA 4LUAA 1PYTB 1Z8LA 2OU2A 3K2KA 4K30A 4P4IA 3CZXA 3DDDA 5JM6A 4OC1A 1BLLE 4BINA 1M4LA 4RN7A 3JUWA 5KTAA 4F0XA 3FH4A 3UY5A 4HNWB 4UCPA 3NA6A 3HUVA 5K8OA 3PB6X 3NH5A 2PJAA 2A4NA 3PB7X 4PQAA 5A28A 1YLOA 4BMHA 2H5MA 1FT7A 4WWVA 1Z5RA 2C6CA 3TOAA 2CTBA 4JLYA 4UEEA 5AG5A 4NSQA 2XEIA 2CNTA 4MHNA 3TO9A 1VHSA 2ZEHA 4H6ZA 4R87A 2FE7A 3B7IA 3DSBA 1IY7A 1TIQA 3CPXA 1KZFA 1RO5A 4R6TA 3IWWA 1YVOA 4P4EA 4CYNA 1Q2CA 4P4DA 1CX8A 4MI4A 5IV0A 3EXNA 2J8MA 3BLNA 1BPMA 4OC2A 3TTHA 2F5IA 2WZNA 4JZ0A 3F5BA 2B3UA 2PDOA 4UEFA 5CPAA 4B14A 3SJFA 4A31A 3S6GA 1UFHA 3B8GA 4UF4A 4X3RA 4R9MA 3TO6A 3PB9X 1QSRA 2ZEFA 4I49A 4OAEA 2PIYA 2KCWA 2IL4A 3SI1A 4KVME 2CNSA 4Z65A 2Q44A 3TCVA 1QSTA 1I21A 3FBUA 5LYIA 1YSJA 2ARHA 3MN8A 2ZW5A 4IUSA 4M6IA 3LACA 1LFWA 2AFMA 4NEXA 1KUXA 4KUAA 2B4DA 3FRMA 3SI2A 1QMUA 4KORA 2ZPAA 4P10A 4J3GA 4NGSA 4IHMA 4KOXA 3T8WA 3PBBA 5HVHA 3SXOA 5HVGA 2CF4A 4MFJA 5AG4A 4A39A 2XEFA 4FWUA 4C68A 2NMTA 1RXTA 2ZELA 3NH4A 3TC8A 2RFHA 1UWYA 3IEHA 2Q7SA 3FVLA 4IAVA 5EMIA 4OIDA 4OLLA 4F9VA 5F09A 1F57A 5LYLA 1AUGA 3WC5A 4MBUA 4MMOA 3K9UA 3PFOA 3WC7A 2AFOA 4EVYA 4EFDA 3B3SA 3TFYA 4PXCA 5EBVA 4C7HA 4CGLA 4PV6A 3KHXA 2PJ9A 2B4BA 3G8WA 3RNZA 2QVPA 4MRIA 4ORFA 3BI0A 1CBXA 1VIXA 4MFQA 3D68A 1N71A 3H8FA 2DPSA 1YW6A 2O28A 4MHPA 4P45A 3BI1A 1IYKA 3FJUA 3CXPA 3N5FA 2O53A 1X12A 1CPXA 1XFOA 1AYEA 4E8OA 2ZEDA 2D4OA 6CPAA 3SI0A 3LWUA 1LOKA 2JDDA 3EFAA 3IIBA 5G1ZA 3KI9A 5BWAB 3SXNA 3F8KA 3JVNA 2GLFA 4Q38A 4AXVA 2ANPA 2HB6A 1B6BA 2Z3NA 4GM5A 3S9MA 4C2ZA 4KSIA 5LYFA 1XOVA 2FS5A 1NSLA 3DR6A 3T9YA 1RTQA 2WYRA 2Q4ZA 3D7DA 3GYAA 4JD6A 1CP6A 4NFRA 1ZG8A 4U9YA 1XBUA 4QC6A 4RI1A 4RS2A 3VWDA 4YFJA 1P4NA 4JJXA 3H5ZA 1YGHA 2FCKA 4CPAA 4DNCA 3I3GA 3K9TA 4H89A 3FYNA 4XNHB 4UWIA 1A2ZA 3SJGA 4JXRA 5D29A 1EE3P 2P6FA 3QNVA 3S6FA 3R9GA 4ONWA 1Z9UA 2G9DA 2G0BA 3D7HA 3KZWA 4H2KA 3MRUA 3VARA 4UFWA 1Y9KA 2JBJA 2V8HA 2G3TA 3PB4X 2VZYA 2ZXVA 3RBUA 3CXSA 1Q2DA 2BCOA 2YNDA 3IJ3A 3NH8A 5D8NA 2CXAA 3A9LA 3CXQA 5AGEA 3FXTA 2C6PA 4B12A 1IB1E 4NCZA 3WR7A 4FUUA 2PRQA 2Z10A 4CAFA 4P4FA 5K8MA 2ZW4A 3IWGA 4OC3A 4NGNA 4A32A 3D67A 2WSAA 1ARLA 4MY3A 5HXDA 3JTKA 4KLWA 4OC4A 3KQZA 4KVXA 2AFXA 4ZYQA 3KR4A 2PC1A 3FB3A 1XRYA 3VH9A 3CDXA 5F46A 4LX9A 3ZZIA 5G20A 1HDQA 1I12A 4R57A 2GU2A 2ZW7A 4MY0A 4CAVA 1Q2YA 1Z4EA 4YWYA 3IFEA 5C88A 2RB7A 3DGVA 3B35A 4PSWA 4AB7A 5I4MA 4Y49B 2OB0A 1L0CA 5AG6A 2PR1A 4KVOE 2P6GA 2PJ4A 1OBRA 1S7LA 1TKFA 4NGPA 4AG7A 1KUVA 3PEIA 3EY5A 1ZLHA 1U6MA 4AVBA 3CT9A 2R8VA 3WABA 1J4JA 3LD2A 2DPTA 1S7KA 3NE7A 4ZX8A 4DYOA 2JEWA 2PR8A 4HNYB 2WPWA 2Q51A 4KOSA 4FBEA 2QECA 2ZEMA 3QB8A 4UCNA 1M4GA 1H8LA 3ISZA 3JRUA 3KASA 3BJ7A 4KSAA 4UIBA 3RZAA 2NSMA 3C26A 4KOVA 2I79A 5F49A 4ZBGA 2F7VA 2DXQA 1GYTA 1YR0A 3LODA 4MCPA 4X2TA 4A95A 4QBJA 2VZZA 1WWZA 4M3SA 5HVFA 1S3ZA 2EO8A 1VGYA 4P44A 3PBEA 4ZGYB 1IOFA 2PQ8A 3BHXA 4F9UA 3QAHA 5HMNA 4OIWA 2OZHA 2FT0A 2C27A 4H6UA 4KLVA 2NYQA 4XPLA 1DTDA 4NGRA 1Y7RA 4CRZB 2VI7A 1S7NA 2VEZA 4UCMA 4UEZA 4AVCA 4CGMA 2PSWA 4E0AA 4A33A 4E2AA 4CGNA 1Y9WA 1QQ9A 1TKHA 1X10A 3H4QA 1YVKA 4MFKA 3SJEA 2POKA 4KOYA 3T90A 2OH1A 4Y49C 2OR4A 1MJBA 4X8IA 4FD4A 1NSAA 1IGBA 3VATA 4B13A 4HPSA 2Z3PA 3FNCA 3FEEA 4QVTA 1LCPA 4MHZA 1JQGA 4ZY2A 2FIAA 1LAPA 2HV2A 3I9SA 1Z2LA 2P6EA 3B3CA 2VBQA 3TX8A 2XEGA 3FMCA 5LRKA 4FD5A 1R3NA 2ZEOA 3PRTA 1HEEA 1TF8A 4NGMA 4O23A 4F6AA 3CPAA 4Q7AA 2FL4A 3IU1A 2EWBA 4KOUA 1XIXA 4BBHA 2Z11A 2Q4YA 5I0CA 2C6GA 4GS4A 3GY9A 4NF1A 3D8PA 2EUIA 2O4HA 4B11A 4UIAA 4PXEA 2ZOFA 1YQEA 3B2YA 3B3VA 2PJCA 1FY7A 4B10A 1S5KA 3IO1A 4ONUA 1PU9A 3H8EA 4OADA 4P6YA 4OMEA 3GB0A 2FXFA 1XE4A 3EO4A 4XPDB 4EMEA 2CNMA 3TE4A 5E96A 1CG2A 1M1DA 2ABZA 2PIZA 1MJ9A 2BO9A 2REEA 1ZO0A 2G3AA 2V77A 4NJRA 3V38A 5KTDA 2X7BA 4M85A 1IOIA 1I1DA 2PVVA 3G3SA 4A94A 4CRYB 2VL1A 2ZEGA 3BJ8A 1HDUA 1NMTA 5FVJA 3F0AA 4MHDA 5H84A 4B5OA 3IU2A 2V8GA 4XPKA 1TKJA 4YGOA 3WT4A 4QB9A 3FF3A 2OZGA 1QSMA 2ZENA 4LQ6A 1BAVA 2OOTA 3TOBA 5IB9A 5F47A 4JYWA 1MK4A 1P0HA 5LRGA 2VXKA 3R9EA 1Y7EA 2JEVA 2GANA 1CJWA 2Q0YA 1PCAA 1F2OA 3PP9A 1ELMP 2ZEPA 5HH1A 1F2PA 5DWNA 1IICA 2GE3A 3D3SA 4KOTA 1IIDA 2ZW6A 4MCSA 4NGQA 3GKRA 4KSFA 4NJQA 2AFZA 2PJ2A 4R8FA 4II9A 4R3KA 5J8FA 5EC4A 4U5YA 4A38A 3P2FA 1JWQA 2PJ3A 3P2HA 2HQYA 5LRJA 5K8PA 1ON0A 2PRBA 3PZJA 4Q36A 4XPDC 5GCNA 5JH9A 4M6HA 5AG7A 2PVWA
chains in the Genus database with same CATH topology
4PSXA 1MJAA 4FD7A 3W91A 5G21A 4NXYA 2WPXA 3IWEA 4B5PA 1XF8A 2BL1A 2J8NA 1SQHA 2Q04A 2R98A 4UBRA 1WK4A 4CGOA 5A28A 2YGWA 2B58A 4HKFA 3ZJ0A 1PUAA 2QIRA 4MFLA 4CAXA 4HNXB 2R7HA 4AVAA 2FSRA 1M4IA 2REFA 4A2ZA 4L89A 1XMTA 2J8RA 3D2MA 4C2XA 4R3LA 2P0WA 2JLMA 4UFVA 1YLEA 2WUUA 4CAWA 4CYOA 1YX0A 2FIWA 1S60A 2JDCA 3DR8A 4JXQA 2B5GA 1YK3A 3RYOA 2Y0MA 1VKCA 3TT2A 3EC4A 1B87A 1IYLA 4FD6A 5IX3A 1M44A 5KTCA 2YNCC 4CGPA 2AJ6A 1CM0A 4X5KA 5F48A 5JQ4A 2Z3MA 3DNSA 2CY2A 4CAEA 3SHPA 3E0KA 5CNPA 2B5GB 1GHEA 4PK3A 1QSOA 4C7IA 2BSWA 4KS9A 3R95A 4CYPA 1NE9A 3TO7A 2GIVA 1LRZA 3R96A 2Q7BA 1M4DA 2Q4VA 2VQYA 2K5TA 4UWJA 3R9FA 4MFPA 5H86A 2BUEA 3D2PA 3V8IA 3VWEA 3W6XA 4CYQA 2Z0ZA 2RC4A 5G22A 1S7FA 5IB0A 2R1IA 1Z4RA 5A27A 4UFXA 2Z3OA 3N7ZA 1XEBA 2B4DB 1R57A 4QUSA 4KOWA 4PK2A 2AE6A 2QMLA 2BEIA 3R1KA 3IGRA 4B5PB 2Z3LA 4KUBA 4MJ8A 1K4JA 4L8AA 1BO4A 2OZUA 2I00A 3S6KA 4U9ZA 2B3VA 4C2YA 4CS0B 4UA3A 4AG9A 5C82A 5JPHA 1OZPA 2ATRA 3OWCA 3FIXA 5ISVA 3KKWA 1YREA 3PGPA 5J8CA 2YNCA 4IF5A 4JWPA 4F0YA 4MFZA 1KUYA 3W6SA 1BOBA 4YRHA 1V0CA 3S6HA 2D4PA 2HUZA 4A30A 2EVNA 4XNHC 2YNEA 2Z3KA 5DWMA 3MGDA 1QSNA 4KZTA 4LUAA 2OU2A 4K30A 3DDDA 3JUWA 5KTAA 4F0XA 3UY5A 4HNWB 4UCPA 2A4NA 4BMHA 2H5MA 3TOAA 4JLYA 5AG5A 4NSQA 3TO9A 2CNTA 1VHSA 4H6ZA 4R87A 2FE7A 3DSBA 1TIQA 1KZFA 1RO5A 1YVOA 4CYNA 1Q2CA 4MI4A 5IV0A 3EXNA 2J8MA 3BLNA 3TTHA 2F5IA 3F5BA 2B3UA 2PDOA 4B14A 4A31A 3S6GA 1UFHA 3B8GA 4R9MA 3TO6A 1QSRA 4I49A 4OAEA 2KCWA 2IL4A 4KVME 2CNSA 2Q44A 3TCVA 1QSTA 1I21A 3FBUA 2ARHA 2ZW5A 4IUSA 4NEXA 1KUXA 4KUAA 2B4DA 3FRMA 4KORA 2ZPAA 4J3GA 4KOXA 3SXOA 4MFJA 5AG4A 4C68A 2NMTA 1RXTA 4OLLA 4MBUA 3K9UA 4EVYA 3TFYA 5EBVA 4C7HA 4CGLA 4PV6A 2B4BA 3G8WA 4ORFA 4MFQA 1N71A 2DPSA 2O28A 1IYKA 3CXPA 4E8OA 2D4OA 2JDDA 3EFAA 5G1ZA 5BWAB 3SXNA 3F8KA 3JVNA 4Q38A 2Z3NA 1B6BA 4C2ZA 2FS5A 1NSLA 3DR6A 3T9YA 4JD6A 3GYAA 4U9YA 4QC6A 4RI1A 4RS2A 3VWDA 4YFJA 1P4NA 4JJXA 3H5ZA 1YGHA 2FCKA 4DNCA 3I3GA 4H89A 3FYNA 4XNHB 4UWIA 4JXRA 2P6FA 3S6FA 3R9GA 1Z9UA 2G0BA 4UFWA 1Y9KA 2G3TA 2VZYA 2ZXVA 3CXSA 1Q2DA 2YNDA 2CXAA 3A9LA 3CXQA 5AGEA 3FXTA 4B12A 1IB1E 4NCZA 3WR7A 2Z10A 4CAFA 2ZW4A 3IWGA 4A32A 2WSAA 4MY3A 3JTKA 4KLWA 4KVXA 2PC1A 3FB3A 5F46A 4LX9A 3ZZIA 5G20A 1I12A 4R57A 2ZW7A 4MY0A 4CAVA 1Q2YA 1Z4EA 5C88A 4PSWA 4AB7A 4Y49B 2OB0A 1L0CA 5AG6A 2PR1A 4KVOE 2P6GA 1S7LA 4AG7A 1KUVA 3EY5A 1U6MA 4AVBA 2R8VA 1J4JA 3LD2A 2DPTA 1S7KA 3NE7A 2PR8A 4HNYB 2WPWA 4KOSA 2QECA 4UCNA 3QB8A 1M4GA 3BJ7A 4KSAA 4KOVA 3C26A 4ZBGA 2I79A 5F49A 2DXQA 1YR0A 3LODA 4A95A 4QBJA 2VZZA 1WWZA 4M3SA 1S3ZA 4ZGYB 2PQ8A 3QAHA 5HMNA 2OZHA 2FT0A 2C27A 4H6UA 4KLVA 4XPLA 1Y7RA 4CRZB 2VI7A 1S7NA 2VEZA 4UCMA 4AVCA 4E0AA 4CGMA 2PSWA 4E2AA 4A33A 4CGNA 1Y9WA 3H4QA 1YVKA 4MFKA 4KOYA 3T90A 2OH1A 4Y49C 1MJBA 4FD4A 4B13A 2Z3PA 3FNCA 4QVTA 2FIAA 2HV2A 3I9SA 2P6EA 2VBQA 4FD5A 4F6AA 2FL4A 3IU1A 4BBHA 4KOUA 1XIXA 5I0CA 2Z11A 2Q4YA 4GS4A 3GY9A 4NF1A 3D8PA 2EUIA 4B11A 1FY7A 4B10A 1S5KA 4ONUA 1PU9A 4OADA 2FXFA 1XE4A 3EO4A 4XPDB 2CNMA 3TE4A 5E96A 1M1DA 1MJ9A 2REEA 1ZO0A 2G3AA 5KTDA 2X7BA 4M85A 1I1DA 3G3SA 4CRYB 3BJ8A 5FVJA 1NMTA 4MHDA 3F0AA 5H84A 4B5OA 3IU2A 4XPKA 4YGOA 4QB9A 2OZGA 1QSMA 3TOBA 5F47A 1P0HA 1MK4A 2VXKA 3R9EA 2JEVA 2GANA 1CJWA 2Q0YA 3PP9A 5HH1A 5DWNA 1IICA 2GE3A 3D3SA 4KOTA 1IIDA 2ZW6A 3GKRA 4KSFA 4II9A 4R3KA 5J8FA 5EC4A 4U5YA 3P2FA 3P2HA 2HQYA 1ON0A 2PRBA 3PZJA 4Q36A 4XPDC 5GCNA 5AG7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PSX A;  1MJA A;  4FD7 A;  3W91 A;  4NXY A;  2WPX A;  4B5P A;  1XF8 A;  2BL1 A;  2J8N A;  1SQH A;  2Q04 A;  2R98 A;  4UBR A;  1WK4 A;  2B58 A;  4HKF A;  3ZJ0 A;  1PUA A;  2QIR A;  4CAX A;  4HNX B;  2R7H A;  4AVA A;  2FSR A;  1M4I A;  2REF A;  4L89 A;  1XMT A;  2J8R A;  3D2M A;  4R3L A;  2P0W A;  2JLM A;  4CAW A;  1YLE A;  1YX0 A;  2FIW A;  1S60 A;  2JDC A;  3DR8 A;  4JXQ A;  2B5G A;  1YK3 A;  3RYO A;  2Y0M A;  1VKC A;  3TT2 A;  3EC4 A;  1B87 A;  1IYL A;  4FD6 A;  5IX3 A;  1M44 A;  5KTC A;  2AJ6 A;  1CM0 A;  4X5K A;  5F48 A;  5JQ4 A;  3DNS A;  2CY2 A;  3SHP A;  3E0K A;  5CNP A;  2B5G B;  1GHE A;  4PK3 A;  1QSO A;  2BSW A;  3R95 A;  1NE9 A;  3TO7 A;  2GIV A;  1LRZ A;  3R96 A;  2Q7B A;  1M4D A;  2Q4V A;  2VQY A;  2K5T A;  4UWJ A;  3R9F A;  5H86 A;  2BUE A;  3D2P A;  3V8I A;  3VWE A;  3W6X A;  2Z0Z A;  2RC4 A;  1S7F A;  5IB0 A;  2R1I A;  1Z4R A;  3N7Z A;  1XEB A;  2B4D B;  1R57 A;  4QUS A;  4KOW A;  4PK2 A;  2AE6 A;  2QML A;  2BEI A;  3R1K A;  3IGR A;  4B5P B;  4KUB A;  4MJ8 A;  1K4J A;  4L8A A;  1BO4 A;  2OZU A;  2I00 A;  3S6K A;  4U9Z A;  2B3V A;  4CS0 B;  4UA3 A;  4AG9 A;  5C82 A;  5JPH A;  1OZP A;  2ATR A;  3OWC A;  3FIX A;  5ISV A;  3KKW A;  1YRE A;  3PGP A;  5J8C A;  4IF5 A;  4JWP A;  4F0Y A;  1KUY A;  3W6S A;  1BOB A;  4YRH A;  1V0C A;  3S6H A;  2D4P A;  2HUZ A;  2EVN A;  4XNH C;  5DWM A;  3MGD A;  1QSN A;  4KZT A;  4LUA A;  2OU2 A;  4K30 A;  3DDD A;  3JUW A;  5KTA A;  3UY5 A;  4HNW B;  2A4N A;  4BMH A;  2H5M A;  3TOA A;  4JLY A;  4NSQ A;  3TO9 A;  2CNT A;  1VHS A;  4H6Z A;  4R87 A;  2FE7 A;  3DSB A;  1TIQ A;  1KZF A;  1RO5 A;  1YVO A;  1Q2C A;  4MI4 A;  5IV0 A;  3EXN A;  2J8M A;  3BLN A;  3TTH A;  2F5I A;  3F5B A;  2B3U A;  2PDO A;  3S6G A;  1UFH A;  3B8G A;  4R9M A;  3TO6 A;  1QSR A;  4I49 A;  4OAE A;  2KCW A;  2IL4 A;  4KVM E;  2CNS A;  2Q44 A;  3TCV A;  1QST A;  1I21 A;  3FBU A;  2ARH A;  2ZW5 A;  4IUS A;  4NEX A;  1KUX A;  4KUA A;  2B4D A;  3FRM A;  4KOR A;  2ZPA A;  4J3G A;  4KOX A;  3SXO A;  2NMT A;  1RXT A;  4OLL A;  4MBU A;  3K9U A;  4EVY A;  3TFY A;  5EBV A;  4PV6 A;  2B4B A;  3G8W A;  4ORF A;  1N71 A;  2O28 A;  1IYK A;  3CXP A;  4E8O A;  2D4O A;  2JDD A;  3EFA A;  3SXN A;  3F8K A;  3JVN A;  1B6B A;  2FS5 A;  1NSL A;  3DR6 A;  3T9Y A;  4JD6 A;  3GYA A;  4U9Y A;  4QC6 A;  4RI1 A;  4RS2 A;  3VWD A;  4YFJ A;  1P4N A;  4JJX A;  1YGH A;  2FCK A;  4DNC A;  3I3G A;  4H89 A;  3FYN A;  4XNH B;  4UWI A;  4JXR A;  2P6F A;  3S6F A;  3R9G A;  1Z9U A;  2G0B A;  1Y9K A;  2G3T A;  2VZY A;  2ZXV A;  3CXS A;  1Q2D A;  3CXQ A;  3FXT A;  1IB1 E;  4NCZ A;  3WR7 A;  2Z10 A;  2ZW4 A;  3IWG A;  4MY3 A;  4KLW A;  4KVX A;  2PC1 A;  3FB3 A;  5F46 A;  4LX9 A;  3ZZI A;  1I12 A;  4R57 A;  2ZW7 A;  4MY0 A;  4CAV A;  1Q2Y A;  1Z4E A;  5C88 A;  4PSW A;  4AB7 A;  4Y49 B;  2OB0 A;  1L0C A;  2PR1 A;  4KVO E;  2P6G A;  1S7L A;  4AG7 A;  1KUV A;  3EY5 A;  1U6M A;  4AVB A;  2R8V A;  1J4J A;  3LD2 A;  1S7K A;  3NE7 A;  2PR8 A;  4HNY B;  2WPW A;  4KOS A;  2QEC A;  3QB8 A;  1M4G A;  3BJ7 A;  4KOV A;  3C26 A;  4ZBG A;  2I79 A;  5F49 A;  2DXQ A;  1YR0 A;  3LOD A;  4QBJ A;  2VZZ A;  1WWZ A;  4M3S A;  1S3Z A;  2PQ8 A;  3QAH A;  5HMN A;  2OZH A;  2FT0 A;  2C27 A;  4H6U A;  4KLV A;  4XPL A;  1Y7R A;  4CRZ B;  2VI7 A;  1S7N A;  2VEZ A;  4AVC A;  4E2A A;  4E0A A;  2PSW A;  1Y9W A;  3H4Q A;  1YVK A;  4KOY A;  3T90 A;  2OH1 A;  4Y49 C;  1MJB A;  4FD4 A;  3FNC A;  4QVT A;  2FIA A;  2HV2 A;  3I9S A;  2P6E A;  2VBQ A;  4FD5 A;  4F6A A;  2FL4 A;  4KOU A;  1XIX A;  5I0C A;  2Z11 A;  2Q4Y A;  4GS4 A;  3GY9 A;  4NF1 A;  3D8P A;  2EUI A;  1FY7 A;  1S5K A;  4ONU A;  1PU9 A;  4OAD A;  2FXF A;  1XE4 A;  3EO4 A;  4XPD B;  2CNM A;  3TE4 A;  5E96 A;  1M1D A;  1MJ9 A;  2REE A;  2G3A A;  5KTD A;  2X7B A;  4M85 A;  1I1D A;  3G3S A;  4CRY B;  3BJ8 A;  5FVJ A;  1NMT A;  3F0A A;  4MHD A;  5H84 A;  4B5O A;  4XPK A;  4YGO A;  4QB9 A;  2OZG A;  1QSM A;  3TOB A;  5F47 A;  1P0H A;  1MK4 A;  2VXK A;  3R9E A;  2JEV A;  2GAN A;  1CJW A;  2Q0Y A;  3PP9 A;  5HH1 A;  5DWN A;  1IIC A;  2GE3 A;  3D3S A;  4KOT A;  1IID A;  2ZW6 A;  3GKR A;  4II9 A;  4R3K A;  5J8F A;  5EC4 A;  4U5Y A;  3P2F A;  3P2H A;  2HQY A;  1ON0 A;  2PRB A;  3PZJ A;  4XPD C;  5GCN A; 
#chains in the Genus database with same CATH topology
 4R76 A;  4PSX A;  4M6G A;  1MJA A;  4FD7 A;  2PJ8 A;  3W91 A;  2EK9 A;  4NXY A;  5G21 A;  2WPX A;  3IWE A;  4B5P A;  1XF8 A;  2BL1 A;  2J8N A;  3D7F A;  1SQH A;  3GLJ A;  4P4J A;  2Q04 A;  1YW4 A;  2AFW A;  4K3N A;  2R98 A;  4UBR A;  1WK4 A;  1ELL P;  1ZG9 A;  2IMO A;  2QJ8 A;  2YGW A;  4GXH A;  4CGO A;  1Z8W A;  2B58 A;  4HKF A;  3ZJ0 A;  1PUA A;  1TXR A;  2QIR A;  4MFL A;  4BD9 A;  4CAX A;  1YME A;  4HNX B;  3DLJ A;  4WJB A;  2R7H A;  4AVA A;  2FSR A;  1M4I A;  3ISX A;  4P4B A;  2REF A;  4A2Z A;  4B6Z A;  2GLJ A;  3I1U A;  5CBM A;  1CPS A;  1ZLI A;  4L89 A;  1AMP A;  1XMT A;  1Z8T A;  2J8R A;  3D2M A;  4OC0 A;  3FEC A;  4PXB A;  4C2X A;  4A37 A;  3NE8 A;  4R3L A;  2P0W A;  2JLM A;  3L2N A;  2GFQ A;  3WC6 A;  4UFV A;  1YLE A;  2WUU A;  4CAW A;  4CYO A;  5J1Q A;  1Y0Y A;  3KHZ A;  5JGF A;  1YX0 A;  8CPA A;  1FNO A;  2FIW A;  1S60 A;  1ARM A;  4NGT A;  3RO0 A;  2JDC A;  3DR8 A;  4JXQ A;  1Q7L A;  2B5G A;  1YK3 A;  4MCR A;  3RYO A;  2Y0M A;  1VKC A;  3TT2 A;  5DS0 A;  3EC4 A;  4MXU A;  1B87 A;  2CIJ A;  3KGQ A;  1IYL A;  4FD6 A;  4RUH A;  5IX3 A;  1M44 A;  2ZEE A;  2PJB A;  5KTC A;  2YNC C;  4CGP A;  4MHY A;  2PJ0 A;  1CM0 A;  2AJ6 A;  4X5K A;  5F48 A;  3D7G A;  2PJ6 A;  3GUX A;  2PJ7 A;  5JQ4 A;  3D66 A;  1Z8X A;  2CTC A;  2JBK A;  2Z3M A;  1KWM A;  2Q43 A;  3DNS A;  1Y0R A;  5LYD A;  4G1P A;  2CY2 A;  2DF5 A;  4CAE A;  2PCU A;  3SHP A;  3E0K A;  4IK2 A;  2PE3 A;  5CNP A;  2B5G B;  3KR5 A;  1VHE A;  1GHE A;  3SJX A;  4PK3 A;  1QSO A;  1R43 A;  3NFZ A;  4PPZ A;  4TNU A;  2BSW A;  4KS9 A;  3R95 A;  4C7I A;  4CYP A;  1NE9 A;  5K8N A;  3TO7 A;  4MCQ A;  2GIV A;  4F8Z A;  4TWE A;  2GRE A;  1LRZ A;  3R96 A;  2Q7B A;  1M4D A;  2Q4V A;  5ELY A;  2VQY A;  4LQG A;  2K5T A;  4FAI A;  1XJO A;  4UWJ A;  3R9F A;  3FED A;  4MFP A;  5H86 A;  2BUE A;  3D2P A;  2ODF A;  3V8I A;  2DEA A;  3VWE A;  3W6X A;  4CYQ A;  2EBJ A;  2Z0Z A;  2RC4 A;  5G22 A;  3S9N A;  1S7F A;  5IB0 A;  2EK8 A;  2R1I A;  1Z4R A;  5A27 A;  3GIU A;  4UFX A;  4EWT A;  2Z3O A;  1XMB A;  3N7Z A;  2AFS A;  1XEB A;  2J9A A;  2B4D B;  3BXM A;  5THW A;  4ZX9 A;  1R57 A;  4QUS A;  1TF9 A;  4KOW A;  1CP7 A;  2FVG A;  4PK2 A;  4PXD A;  2AE6 A;  3KQX A;  3B3T A;  2QML A;  1VHO A;  2BEI A;  1DE4 C;  2IJZ A;  3R1K A;  3IGR A;  4B5P B;  2V8D A;  4ZI6 A;  1BPN A;  2Z3L A;  2HC9 A;  4KUB A;  4MJ8 A;  2PJ5 A;  3KL9 A;  1K4J A;  4DUK A;  4L8A A;  1BO4 A;  3FX6 A;  2OZU A;  2I00 A;  3S6K A;  3D4U A;  4ZY1 A;  4U9Z A;  4DJL A;  2I3C A;  2B3V A;  1LAM A;  4C2Y A;  3S9L A;  4CS0 B;  1ZG7 A;  3B3W A;  4OKO A;  2XEJ A;  4UA3 A;  4W9Y A;  4AG9 A;  5C82 A;  5JPH A;  1OZP A;  4YU9 A;  3V7Z A;  2ATR A;  2ZOG A;  3OWC A;  3FIX A;  3LMS A;  5ISV A;  2BOA A;  2V8V A;  3H8G A;  3KKW A;  3QAY A;  1YRE A;  3PGP A;  3PB8 X;  4OC5 A;  5J8C A;  2YNC A;  4IF5 A;  4JWP A;  2AFU A;  4F0Y A;  2C1C A;  4MFZ A;  1KUY A;  3W6S A;  1BOB A;  4YRH A;  4R7M A;  3RAM A;  1V0C A;  2IQ6 A;  3S6H A;  2D4P A;  2HUZ A;  4OP4 A;  2QYV A;  4A30 A;  3HLP A;  2EVN A;  3IC1 A;  4XNH C;  4ZY0 A;  2YNE A;  2PJ1 A;  2Z3K A;  5DWM A;  3MGD A;  2F8H A;  1QSN A;  1LAN A;  3PFE A;  7CPA A;  1IU8 A;  4KZT A;  4LUA A;  1PYT B;  1Z8L A;  2OU2 A;  3K2K A;  4K30 A;  4P4I A;  3CZX A;  3DDD A;  5JM6 A;  4OC1 A;  1BLL E;  4BIN A;  1M4L A;  4RN7 A;  3JUW A;  5KTA A;  4F0X A;  3FH4 A;  3UY5 A;  4HNW B;  4UCP A;  3NA6 A;  3HUV A;  5K8O A;  3PB6 X;  3NH5 A;  2PJA A;  2A4N A;  3PB7 X;  4PQA A;  5A28 A;  1YLO A;  4BMH A;  2H5M A;  1FT7 A;  4WWV A;  1Z5R A;  2C6C A;  3TOA A;  2CTB A;  4JLY A;  4UEE A;  5AG5 A;  4NSQ A;  2XEI A;  2CNT A;  4MHN A;  3TO9 A;  1VHS A;  2ZEH A;  4H6Z A;  4R87 A;  2FE7 A;  3B7I A;  3DSB A;  1IY7 A;  1TIQ A;  3CPX A;  1KZF A;  1RO5 A;  4R6T A;  3IWW A;  1YVO A;  4P4E A;  4CYN A;  1Q2C A;  4P4D A;  1CX8 A;  4MI4 A;  5IV0 A;  3EXN A;  2J8M A;  3BLN A;  1BPM A;  4OC2 A;  3TTH A;  2F5I A;  2WZN A;  4JZ0 A;  3F5B A;  2B3U A;  2PDO A;  4UEF A;  5CPA A;  4B14 A;  3SJF A;  4A31 A;  3S6G A;  1UFH A;  3B8G A;  4UF4 A;  4X3R A;  4R9M A;  3TO6 A;  3PB9 X;  1QSR A;  2ZEF A;  4I49 A;  4OAE A;  2PIY A;  2KCW A;  2IL4 A;  3SI1 A;  4KVM E;  2CNS A;  4Z65 A;  2Q44 A;  3TCV A;  1QST A;  1I21 A;  3FBU A;  5LYI A;  1YSJ A;  2ARH A;  3MN8 A;  2ZW5 A;  4IUS A;  4M6I A;  3LAC A;  1LFW A;  2AFM A;  4NEX A;  1KUX A;  4KUA A;  2B4D A;  3FRM A;  3SI2 A;  1QMU A;  4KOR A;  2ZPA A;  4P10 A;  4J3G A;  4NGS A;  4IHM A;  4KOX A;  3T8W A;  3PBB A;  5HVH A;  3SXO A;  5HVG A;  2CF4 A;  4MFJ A;  5AG4 A;  4A39 A;  2XEF A;  4FWU A;  4C68 A;  2NMT A;  1RXT A;  2ZEL A;  3NH4 A;  3TC8 A;  2RFH A;  1UWY A;  3IEH A;  2Q7S A;  3FVL A;  4IAV A;  5EMI A;  4OID A;  4OLL A;  4F9V A;  5F09 A;  1F57 A;  5LYL A;  1AUG A;  3WC5 A;  4MBU A;  4MMO A;  3K9U A;  3PFO A;  3WC7 A;  2AFO A;  4EVY A;  4EFD A;  3B3S A;  3TFY A;  4PXC A;  5EBV A;  4C7H A;  4CGL A;  4PV6 A;  3KHX A;  2PJ9 A;  2B4B A;  3G8W A;  3RNZ A;  2QVP A;  4MRI A;  4ORF A;  3BI0 A;  1CBX A;  1VIX A;  4MFQ A;  3D68 A;  1N71 A;  3H8F A;  2DPS A;  1YW6 A;  2O28 A;  4MHP A;  4P45 A;  3BI1 A;  1IYK A;  3FJU A;  3CXP A;  3N5F A;  2O53 A;  1X12 A;  1CPX A;  1XFO A;  1AYE A;  4E8O A;  2ZED A;  2D4O A;  6CPA A;  3SI0 A;  3LWU A;  1LOK A;  2JDD A;  3EFA A;  3IIB A;  5G1Z A;  3KI9 A;  5BWA B;  3SXN A;  3F8K A;  3JVN A;  2GLF A;  4Q38 A;  4AXV A;  2ANP A;  2HB6 A;  1B6B A;  2Z3N A;  4GM5 A;  3S9M A;  4C2Z A;  4KSI A;  5LYF A;  1XOV A;  2FS5 A;  1NSL A;  3DR6 A;  3T9Y A;  1RTQ A;  2WYR A;  2Q4Z A;  3D7D A;  3GYA A;  4JD6 A;  1CP6 A;  4NFR A;  1ZG8 A;  4U9Y A;  1XBU A;  4QC6 A;  4RI1 A;  4RS2 A;  3VWD A;  4YFJ A;  1P4N A;  4JJX A;  3H5Z A;  1YGH A;  2FCK A;  4CPA A;  4DNC A;  3I3G A;  3K9T A;  4H89 A;  3FYN A;  4XNH B;  4UWI A;  1A2Z A;  3SJG A;  4JXR A;  5D29 A;  1EE3 P;  2P6F A;  3QNV A;  3S6F A;  3R9G A;  4ONW A;  1Z9U A;  2G9D A;  2G0B A;  3D7H A;  3KZW A;  4H2K A;  3MRU A;  3VAR A;  4UFW A;  1Y9K A;  2JBJ A;  2V8H A;  2G3T A;  3PB4 X;  2VZY A;  2ZXV A;  3RBU A;  3CXS A;  1Q2D A;  2BCO A;  2YND A;  3IJ3 A;  3NH8 A;  5D8N A;  2CXA A;  3A9L A;  3CXQ A;  5AGE A;  3FXT A;  2C6P A;  4B12 A;  1IB1 E;  4NCZ A;  3WR7 A;  4FUU A;  2PRQ A;  2Z10 A;  4CAF A;  4P4F A;  5K8M A;  2ZW4 A;  3IWG A;  4OC3 A;  4NGN A;  4A32 A;  3D67 A;  2WSA A;  1ARL A;  4MY3 A;  5HXD A;  3JTK A;  4KLW A;  4OC4 A;  3KQZ A;  4KVX A;  2AFX A;  4ZYQ A;  3KR4 A;  2PC1 A;  3FB3 A;  1XRY A;  3VH9 A;  3CDX A;  5F46 A;  4LX9 A;  3ZZI A;  5G20 A;  1HDQ A;  1I12 A;  4R57 A;  2GU2 A;  2ZW7 A;  4MY0 A;  4CAV A;  1Q2Y A;  1Z4E A;  4YWY A;  3IFE A;  5C88 A;  2RB7 A;  3DGV A;  3B35 A;  4PSW A;  4AB7 A;  5I4M A;  4Y49 B;  2OB0 A;  1L0C A;  5AG6 A;  2PR1 A;  4KVO E;  2P6G A;  2PJ4 A;  1OBR A;  1S7L A;  1TKF A;  4NGP A;  4AG7 A;  1KUV A;  3PEI A;  3EY5 A;  1ZLH A;  1U6M A;  4AVB A;  3CT9 A;  2R8V A;  3WAB A;  1J4J A;  3LD2 A;  2DPT A;  1S7K A;  3NE7 A;  4ZX8 A;  4DYO A;  2JEW A;  2PR8 A;  4HNY B;  2WPW A;  2Q51 A;  4KOS A;  4FBE A;  2QEC A;  2ZEM A;  3QB8 A;  4UCN A;  1M4G A;  1H8L A;  3ISZ A;  3JRU A;  3KAS A;  3BJ7 A;  4KSA A;  4UIB A;  3RZA A;  2NSM A;  3C26 A;  4KOV A;  2I79 A;  5F49 A;  4ZBG A;  2F7V A;  2DXQ A;  1GYT A;  1YR0 A;  3LOD A;  4MCP A;  4X2T A;  4A95 A;  4QBJ A;  2VZZ A;  1WWZ A;  4M3S A;  5HVF A;  1S3Z A;  2EO8 A;  1VGY A;  4P44 A;  3PBE A;  4ZGY B;  1IOF A;  2PQ8 A;  3BHX A;  4F9U A;  3QAH A;  5HMN A;  4OIW A;  2OZH A;  2FT0 A;  2C27 A;  4H6U A;  4KLV A;  2NYQ A;  4XPL A;  1DTD A;  4NGR A;  1Y7R A;  4CRZ B;  2VI7 A;  1S7N A;  2VEZ A;  4UCM A;  4UEZ A;  4AVC A;  4CGM A;  2PSW A;  4E0A A;  4A33 A;  4E2A A;  4CGN A;  1Y9W A;  1QQ9 A;  1TKH A;  1X10 A;  3H4Q A;  1YVK A;  4MFK A;  3SJE A;  2POK A;  4KOY A;  3T90 A;  2OH1 A;  4Y49 C;  2OR4 A;  1MJB A;  4X8I A;  4FD4 A;  1NSA A;  1IGB A;  3VAT A;  4B13 A;  4HPS A;  2Z3P A;  3FNC A;  3FEE A;  4QVT A;  1LCP A;  4MHZ A;  1JQG A;  4ZY2 A;  2FIA A;  1LAP A;  2HV2 A;  3I9S A;  1Z2L A;  2P6E A;  3B3C A;  2VBQ A;  3TX8 A;  2XEG A;  3FMC A;  5LRK A;  4FD5 A;  1R3N A;  2ZEO A;  3PRT A;  1HEE A;  1TF8 A;  4NGM A;  4O23 A;  4F6A A;  3CPA A;  4Q7A A;  2FL4 A;  3IU1 A;  2EWB A;  4KOU A;  1XIX A;  4BBH A;  2Z11 A;  2Q4Y A;  5I0C A;  2C6G A;  4GS4 A;  3GY9 A;  4NF1 A;  3D8P A;  2EUI A;  2O4H A;  4B11 A;  4UIA A;  4PXE A;  2ZOF A;  1YQE A;  3B2Y A;  3B3V A;  2PJC A;  1FY7 A;  4B10 A;  1S5K A;  3IO1 A;  4ONU A;  1PU9 A;  3H8E A;  4OAD A;  4P6Y A;  4OME A;  3GB0 A;  2FXF A;  1XE4 A;  3EO4 A;  4XPD B;  4EME A;  2CNM A;  3TE4 A;  5E96 A;  1CG2 A;  1M1D A;  2ABZ A;  2PIZ A;  1MJ9 A;  2BO9 A;  2REE A;  1ZO0 A;  2G3A A;  2V77 A;  4NJR A;  3V38 A;  5KTD A;  2X7B A;  4M85 A;  1IOI A;  1I1D A;  2PVV A;  3G3S A;  4A94 A;  4CRY B;  2VL1 A;  2ZEG A;  3BJ8 A;  1HDU A;  1NMT A;  5FVJ A;  3F0A A;  4MHD A;  5H84 A;  4B5O A;  3IU2 A;  2V8G A;  4XPK A;  1TKJ A;  4YGO A;  3WT4 A;  4QB9 A;  3FF3 A;  2OZG A;  1QSM A;  2ZEN A;  4LQ6 A;  1BAV A;  2OOT A;  3TOB A;  5IB9 A;  5F47 A;  4JYW A;  1MK4 A;  1P0H A;  5LRG A;  2VXK A;  3R9E A;  1Y7E A;  2JEV A;  2GAN A;  1CJW A;  2Q0Y A;  1PCA A;  1F2O A;  3PP9 A;  1ELM P;  2ZEP A;  5HH1 A;  1F2P A;  5DWN A;  1IIC A;  2GE3 A;  3D3S A;  4KOT A;  1IID A;  2ZW6 A;  4MCS A;  4NGQ A;  3GKR A;  4KSF A;  4NJQ A;  2AFZ A;  2PJ2 A;  4R8F A;  4II9 A;  4R3K A;  5J8F A;  5EC4 A;  4U5Y A;  4A38 A;  3P2F A;  1JWQ A;  2PJ3 A;  3P2H A;  2HQY A;  5LRJ A;  5K8P A;  1ON0 A;  2PRB A;  3PZJ A;  4Q36 A;  4XPD C;  5GCN A;  5JH9 A;  4M6H A;  5AG7 A;  2PVW A; 
#chains in the Genus database with same CATH homology
 4PSX A;  1MJA A;  4FD7 A;  3W91 A;  5G21 A;  4NXY A;  2WPX A;  3IWE A;  4B5P A;  1XF8 A;  2BL1 A;  2J8N A;  1SQH A;  2Q04 A;  2R98 A;  4UBR A;  1WK4 A;  4CGO A;  5A28 A;  2YGW A;  2B58 A;  4HKF A;  3ZJ0 A;  1PUA A;  2QIR A;  4MFL A;  4CAX A;  4HNX B;  2R7H A;  4AVA A;  2FSR A;  1M4I A;  2REF A;  4A2Z A;  4L89 A;  1XMT A;  2J8R A;  3D2M A;  4C2X A;  4R3L A;  2P0W A;  2JLM A;  4UFV A;  1YLE A;  2WUU A;  4CAW A;  4CYO A;  1YX0 A;  2FIW A;  1S60 A;  2JDC A;  3DR8 A;  4JXQ A;  2B5G A;  1YK3 A;  3RYO A;  2Y0M A;  1VKC A;  3TT2 A;  3EC4 A;  1B87 A;  1IYL A;  4FD6 A;  5IX3 A;  1M44 A;  5KTC A;  2YNC C;  4CGP A;  2AJ6 A;  1CM0 A;  4X5K A;  5F48 A;  5JQ4 A;  2Z3M A;  3DNS A;  2CY2 A;  4CAE A;  3SHP A;  3E0K A;  5CNP A;  2B5G B;  1GHE A;  4PK3 A;  1QSO A;  4C7I A;  2BSW A;  4KS9 A;  3R95 A;  4CYP A;  1NE9 A;  3TO7 A;  2GIV A;  1LRZ A;  3R96 A;  2Q7B A;  1M4D A;  2Q4V A;  2VQY A;  2K5T A;  4UWJ A;  3R9F A;  4MFP A;  5H86 A;  2BUE A;  3D2P A;  3V8I A;  3VWE A;  3W6X A;  4CYQ A;  2Z0Z A;  2RC4 A;  5G22 A;  1S7F A;  5IB0 A;  2R1I A;  1Z4R A;  5A27 A;  4UFX A;  2Z3O A;  3N7Z A;  1XEB A;  2B4D B;  1R57 A;  4QUS A;  4KOW A;  4PK2 A;  2AE6 A;  2QML A;  2BEI A;  3R1K A;  3IGR A;  4B5P B;  2Z3L A;  4KUB A;  4MJ8 A;  1K4J A;  4L8A A;  1BO4 A;  2OZU A;  2I00 A;  3S6K A;  4U9Z A;  2B3V A;  4C2Y A;  4CS0 B;  4UA3 A;  4AG9 A;  5C82 A;  5JPH A;  1OZP A;  2ATR A;  3OWC A;  3FIX A;  5ISV A;  3KKW A;  1YRE A;  3PGP A;  5J8C A;  2YNC A;  4IF5 A;  4JWP A;  4F0Y A;  4MFZ A;  1KUY A;  3W6S A;  1BOB A;  4YRH A;  1V0C A;  3S6H A;  2D4P A;  2HUZ A;  4A30 A;  2EVN A;  4XNH C;  2YNE A;  2Z3K A;  5DWM A;  3MGD A;  1QSN A;  4KZT A;  4LUA A;  2OU2 A;  4K30 A;  3DDD A;  3JUW A;  5KTA A;  4F0X A;  3UY5 A;  4HNW B;  4UCP A;  2A4N A;  4BMH A;  2H5M A;  3TOA A;  4JLY A;  5AG5 A;  4NSQ A;  3TO9 A;  2CNT A;  1VHS A;  4H6Z A;  4R87 A;  2FE7 A;  3DSB A;  1TIQ A;  1KZF A;  1RO5 A;  1YVO A;  4CYN A;  1Q2C A;  4MI4 A;  5IV0 A;  3EXN A;  2J8M A;  3BLN A;  3TTH A;  2F5I A;  3F5B A;  2B3U A;  2PDO A;  4B14 A;  4A31 A;  3S6G A;  1UFH A;  3B8G A;  4R9M A;  3TO6 A;  1QSR A;  4I49 A;  4OAE A;  2KCW A;  2IL4 A;  4KVM E;  2CNS A;  2Q44 A;  3TCV A;  1QST A;  1I21 A;  3FBU A;  2ARH A;  2ZW5 A;  4IUS A;  4NEX A;  1KUX A;  4KUA A;  2B4D A;  3FRM A;  4KOR A;  2ZPA A;  4J3G A;  4KOX A;  3SXO A;  4MFJ A;  5AG4 A;  4C68 A;  2NMT A;  1RXT A;  4OLL A;  4MBU A;  3K9U A;  4EVY A;  3TFY A;  5EBV A;  4C7H A;  4CGL A;  4PV6 A;  2B4B A;  3G8W A;  4ORF A;  4MFQ A;  1N71 A;  2DPS A;  2O28 A;  1IYK A;  3CXP A;  4E8O A;  2D4O A;  2JDD A;  3EFA A;  5G1Z A;  5BWA B;  3SXN A;  3F8K A;  3JVN A;  4Q38 A;  2Z3N A;  1B6B A;  4C2Z A;  2FS5 A;  1NSL A;  3DR6 A;  3T9Y A;  4JD6 A;  3GYA A;  4U9Y A;  4QC6 A;  4RI1 A;  4RS2 A;  3VWD A;  4YFJ A;  1P4N A;  4JJX A;  3H5Z A;  1YGH A;  2FCK A;  4DNC A;  3I3G A;  4H89 A;  3FYN A;  4XNH B;  4UWI A;  4JXR A;  2P6F A;  3S6F A;  3R9G A;  1Z9U A;  2G0B A;  4UFW A;  1Y9K A;  2G3T A;  2VZY A;  2ZXV A;  3CXS A;  1Q2D A;  2YND A;  2CXA A;  3A9L A;  3CXQ A;  5AGE A;  3FXT A;  4B12 A;  1IB1 E;  4NCZ A;  3WR7 A;  2Z10 A;  4CAF A;  2ZW4 A;  3IWG A;  4A32 A;  2WSA A;  4MY3 A;  3JTK A;  4KLW A;  4KVX A;  2PC1 A;  3FB3 A;  5F46 A;  4LX9 A;  3ZZI A;  5G20 A;  1I12 A;  4R57 A;  2ZW7 A;  4MY0 A;  4CAV A;  1Q2Y A;  1Z4E A;  5C88 A;  4PSW A;  4AB7 A;  4Y49 B;  2OB0 A;  1L0C A;  5AG6 A;  2PR1 A;  4KVO E;  2P6G A;  1S7L A;  4AG7 A;  1KUV A;  3EY5 A;  1U6M A;  4AVB A;  2R8V A;  1J4J A;  3LD2 A;  2DPT A;  1S7K A;  3NE7 A;  2PR8 A;  4HNY B;  2WPW A;  4KOS A;  2QEC A;  4UCN A;  3QB8 A;  1M4G A;  3BJ7 A;  4KSA A;  4KOV A;  3C26 A;  4ZBG A;  2I79 A;  5F49 A;  2DXQ A;  1YR0 A;  3LOD A;  4A95 A;  4QBJ A;  2VZZ A;  1WWZ A;  4M3S A;  1S3Z A;  4ZGY B;  2PQ8 A;  3QAH A;  5HMN A;  2OZH A;  2FT0 A;  2C27 A;  4H6U A;  4KLV A;  4XPL A;  1Y7R A;  4CRZ B;  2VI7 A;  1S7N A;  2VEZ A;  4UCM A;  4AVC A;  4E0A A;  4CGM A;  2PSW A;  4E2A A;  4A33 A;  4CGN A;  1Y9W A;  3H4Q A;  1YVK A;  4MFK A;  4KOY A;  3T90 A;  2OH1 A;  4Y49 C;  1MJB A;  4FD4 A;  4B13 A;  2Z3P A;  3FNC A;  4QVT A;  2FIA A;  2HV2 A;  3I9S A;  2P6E A;  2VBQ A;  4FD5 A;  4F6A A;  2FL4 A;  3IU1 A;  4BBH A;  4KOU A;  1XIX A;  5I0C A;  2Z11 A;  2Q4Y A;  4GS4 A;  3GY9 A;  4NF1 A;  3D8P A;  2EUI A;  4B11 A;  1FY7 A;  4B10 A;  1S5K A;  4ONU A;  1PU9 A;  4OAD A;  2FXF A;  1XE4 A;  3EO4 A;  4XPD B;  2CNM A;  3TE4 A;  5E96 A;  1M1D A;  1MJ9 A;  2REE A;  1ZO0 A;  2G3A A;  5KTD A;  2X7B A;  4M85 A;  1I1D A;  3G3S A;  4CRY B;  3BJ8 A;  5FVJ A;  1NMT A;  4MHD A;  3F0A A;  5H84 A;  4B5O A;  3IU2 A;  4XPK A;  4YGO A;  4QB9 A;  2OZG A;  1QSM A;  3TOB A;  5F47 A;  1P0H A;  1MK4 A;  2VXK A;  3R9E A;  2JEV A;  2GAN A;  1CJW A;  2Q0Y A;  3PP9 A;  5HH1 A;  5DWN A;  1IIC A;  2GE3 A;  3D3S A;  4KOT A;  1IID A;  2ZW6 A;  3GKR A;  4KSF A;  4II9 A;  4R3K A;  5J8F A;  5EC4 A;  4U5Y A;  3P2F A;  3P2H A;  2HQY A;  1ON0 A;  2PRB A;  3PZJ A;  4Q36 A;  4XPD C;  5GCN A;  5AG7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...