4H6UA

Tubulin acetyltransferase mutant
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
187
structure length
165
Chain Sequence
SFTMDFPYDLNALFPERISVLDSNLSAGRKAHGRPDPLPQVTTVIDELGKNRHHLYLLKDGEGGRGVIVGFLKVGYKKLFLLDQRGAHLETEPLCVLAFYVTETLQRHGYGSELFDFMLKHKQVEPAQMAYDRPSPKFLSFLEKRYDLRNSVPQVNNFVVFAGFF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Alpha-tubulin N-acetyltransferase
publication title Crystal structures of tubulin acetyltransferase reveal a conserved catalytic core and the plasticity of the essential N terminus.
pubmed doi rcsb
source organism Danio rerio
molecule tags Transferase
total genus 36
structure length 165
sequence length 187
chains with identical sequence B
ec nomenclature ec 2.3.1.108: Alpha-tubulin N-acetyltransferase.
pdb deposition date 2012-09-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05301 Acetyltransf_16 GNAT acetyltransferase, Mec-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4h6uA00
3W6XA 3R1KA 2CNTA 4PK2A 3R96A 4ORFA 1Z4EA 4RS2A 3GY9A 5EC4A 3EO4A 2OZUA 4R87A 2B4DA 4MJ8A 1WWZA 4CRYB 3FB3A 3SXNA 1IYLA 1Q2DA 4QB9A 1S7KA 4HNYB 3PGPA 1IIDA 4F6AA 5H84A 4U9YA 5J8CA 1QSTA 2P6FA 2FIWA 3EXNA 4KOUA 4H89A 4EVYA 1M4GA 1NMTA 1U6MA 1Q2YA 4XPKA 2EVNA 2JDCA 1M44A 3N7ZA 4PK3A 2Q44A 1BOBA 1S7LA 4YRHA 4JD6A 4JWPA 1KZFA 4FD5A 3KKWA 3TOBA 5ISVA 2AJ6A 2B3VA 2R1IA 5C82A 1S7FA 1IICA 3I3GA 4E0AA 3S6GA 3S6HA 5IB0A 2B5GB 3I9SA 4OADA 3BJ7A 3CXSA 1L0CA 2BEIA 2OH1A 2VEZA 4YGOA 1P4NA 2REFA 2BUEA 1YK3A 1QSOA 2Z0ZA 2VQYA 4UWIA 4YFJA 5H86A 5EBVA 2I00A 1BO4A 2ATRA 3NE7A 4NSQA 2C27A 4AG9A 1S5KA 2ZW4A 2FIAA 4II9A 4MBUA 4L8AA 4B5OA 1I12A 2ZW5A 3W6SA 3D2PA 2J8RA 3CXQA 4K30A 4JLYA 4Y49B 2HV2A 4M85A 2PC1A 2X7BA 4AVAA 3BLNA 5IX3A 2WPWA 2B3UA 4PSWA 2Q04A 2Y0MA 1KUXA 4B5PB 3QAHA 5HMNA 3TE4A 4CAXA 4ONUA 4MI4A 1IB1E 2FE7A 2QECA 4NF1A 4IF5A 3R9EA 1K4JA 3SHPA 3TO9A 2FCKA 4U5YA 3OWCA 3QB8A 3VWEA 1CJWA 4HNXB 1N71A 3LD2A 5I0CA 1OZPA 4XNHC 3W91A 1J4JA 2VZYA 3P2HA 3G3SA 4I49A 4UBRA 5F48A 3PP9A 1QSMA 4L89A 4KOSA 1YREA 1Y9WA 3ZJ0A 1QSRA 2A4NA 2RC4A 4KVME 4Y49C 4CAWA 3DSBA 3V8IA 2DXQA 2OZHA 4RI1A 1YVKA 4J3GA 3UY5A 5KTDA 4FD6A 4E2AA 3FYNA 4R57A 3D8PA 4PSXA 2VZZA 2PQ8A 4LX9A 2G3TA 2FXFA 1V0CA 5IV0A 3FRMA 5J8FA 2BL1A 3TTHA 1YGHA 3CXPA 2HQYA 4CRZB 1VHSA 4KLVA 1Y7RA 4KOVA 3JUWA 3F5BA 3TO7A 2CNSA 1TIQA 3BJ8A 4AVCA 2VXKA 1KUYA 2Q4YA 1NSLA 5C88A 3LODA 4KZTA 2ZPAA 2R8VA 4KOXA 4OLLA 2OU2A 1R57A 4XPDB 4H6UA 1WK4A 4AB7A 4AVBA 3FNCA 1XF8A 2PSWA 3DR6A 1YLEA 1GHEA 2D4OA 1VKCA 2ZXVA 2Q7BA 4UA3A 2PDOA 4QUSA 1Q2CA 4GS4A 3TT2A 4KOYA 2G0BA 1SQHA 4H6ZA 4QBJA 4ZBGA 3EFAA 4NEXA 2G3AA 3GKRA 4KLWA 2B4BA 4JJXA 3E0KA 2JLMA 4CS0B 2FS5A 5KTAA 1ON0A 5F47A 1LRZA 3EY5A 4XPDC 2VBQA 2KCWA 5JPHA 3C26A 4UWJA 4JXRA 3D2MA 4CAVA 2D4PA 4E8OA 2EUIA 2B4DB 1B6BA 2HUZA 4HNWB 1XMTA 3R9FA 3F0AA 1RXTA 2H5MA 2O28A 4KOTA 3P2FA 2Q0YA 3T9YA 1YR0A 3TFYA 1FY7A 4XPLA 4R9MA 4B5PA 4MY0A 3EC4A 1QSNA 2QMLA 4HKFA 3TO6A 1XE4A 1M4IA 3DR8A 3IWGA 2PR1A 1M4DA 1PUAA 3SXOA 2OB0A 2AE6A 2Z10A 4NCZA 3S6FA 3F8KA 3S6KA 1YVOA 2NMTA 1I21A 4R3KA 3GYAA 4FD7A 2B58A 1NE9A 5CNPA 1Y9KA 5DWMA 2REEA 2J8MA 2FSRA 1CM0A 2BSWA 2FL4A 3R95A 2I79A 1I1DA 2GIVA 2OZGA 2R7HA 4BMHA 2Q4VA 2PR8A 4IUSA 3R9GA 1UFHA 5E96A 1P0HA 2Z11A 3VWDA 3T90A 1MJAA 2CY2A 3IGRA 2P6GA 1Z9UA 5GCNA 2GANA 4KORA 5DWNA 4QVTA 3FBUA 1MJBA 2J8NA 2IL4A 2QIRA 1XIXA 4KOWA 4F0YA 2FT0A 2PRBA 5HH1A 3FXTA 1MK4A 4PV6A 2B5GA 2ARHA 1M1DA 2ZW7A 3G8WA 3H4QA 2GE3A 1PU9A 1RO5A 2P6EA 2JDDA 2K5TA 2R98A 1XEBA 1YX0A 4X5KA 4KUBA 4OAEA 4DNCA 3B8GA 3RYOA 4KUAA 4KVXA 4FD4A 3TOAA 2ZW6A 1IYKA 3ZZIA 1KUVA 2VI7A 2WPXA 3TCVA 5F49A 3D3SA 4XNHB 4U9ZA 3K9UA 5JQ4A 3MGDA 4NXYA 2JEVA 4MHDA 2F5IA 3DNSA 4JXQA 5KTCA 4M3SA 5FVJA 1S3ZA 1S7NA 5F46A 2CNMA 1Z4RA 4AG7A 1S60A 1B87A 4KVOE 1MJ9A 3DDDA 3JVNA 4QC6A 3PZJA 4MY3A 4LUAA 2P0WA 3FIXA 3WR7A 4R3LA
chains in the Genus database with same CATH superfamily
4R7MA 4P4BA 5LRJA 1LANA 4EMEA 4UFWA 3FH4A 2POKA 3W6XA 3K9TA 2YNCC 3R1KA 2CNTA 4PK2A 3R96A 4ORFA 4ZY2A 1Z4EA 4ZY0A 4RS2A 3RZAA 3S9LA 3GY9A 2ZOGA 5EC4A 1IU8A 3D67A 5HVGA 3EO4A 2OZUA 4R87A 2PJ0A 4CGNA 3FX6A 2B4DA 4MJ8A 1FT7A 3LWUA 3V7ZA 4C7IA 1WWZA 4CRYB 3FB3A 3GB0A 3SXNA 1IYLA 1Q2DA 2OR4A 4QB9A 1S7KA 1TKJA 4HNYB 5K8PA 2IMOA 3PGPA 1IIDA 1AMPA 4PXEA 4F6AA 3PEIA 5H84A 1YQEA 4CPAA 2WSAA 2C1CA 2AFXA 1QSTA 4U9YA 2P6FA 3IU1A 4JZ0A 2FIWA 4ZYQA 5J8CA 3KL9A 4JYWA 4MHNA 3EXNA 4P44A 2YGWA 1BLLE 3BHXA 2CIJA 2V77A 4KOUA 4O23A 4H89A 4EVYA 1Q7LA 3GUXA 4MCPA 4Q36A 1M4GA 4K3NA 1NMTA 1U6MA 2V8VA 4ZY1A 1Q2YA 4XPKA 2PJCA 3D7FA 3VH9A 2JDCA 2EVNA 1CPXA 1CP7A 1M44A 1PCAA 2Q44A 3MN8A 3N7ZA 1BOBA 4PPZA 5G22A 3CZXA 1S7LA 4FAIA 4IAVA 4YRHA 2C6PA 3FVLA 3JTKA 4JD6A 4JWPA 1KZFA 1Z2LA 3FF3A 3CPAA 4FD5A 5AG5A 2EWBA 3KKWA 2ZEGA 3B35A 3TOBA 5ISVA 2AJ6A 5G1ZA 2B3VA 2R1IA 3IU2A 5C82A 1S7FA 5AG4A 4MRIA 2ZEFA 2EO8A 3NE8A 1RTQA 1IICA 1LFWA 3H5ZA 3WC7A 2WZNA 2Z3MA 3I3GA 4MFQA 1EE3P 3S6GA 4E0AA 3S6HA 3D4UA 2PJ9A 1X10A 5LYDA 5IB0A 4PQAA 4B13A 4ZI6A 2B5GB 5J1QA 2Q43A 3I9SA 1BPMA 3CDXA 2XEIA 1Y7EA 4NGNA 4OADA 5AG7A 3VARA 4B6ZA 1VHOA 2DEAA 3BJ7A 3CXSA 1L0CA 4OIDA 4CGOA 2AFZA 3IIBA 3D66A 2BEIA 2OH1A 2VEZA 2XEGA 3NFZA 4YGOA 4A95A 2Z3PA 1Z8XA 1P4NA 4PXBA 1ZG9A 1AUGA 4KSFA 4A31A 4BINA 3QAYA 3HUVA 4P4JA 4CAFA 5CBMA 2REFA 2WYRA 2BUEA 2V8GA 2PJBA 1F57A 1YK3A 1QSOA 1TKHA 3KGQA 3NH8A 4UCPA 2Z0ZA 2VQYA 4UWIA 4YFJA 5H86A 5EBVA 2V8DA 3FJUA 2I00A 1BO4A 2ATRA 3NE7A 4NSQA 2C27A 4NGTA 4OIWA 3GIUA 1S5KA 1VHEA 4AG9A 2AFMA 2ZW4A 2FIAA 2ZEPA 3ISXA 5D29A 4II9A 3L2NA 4UCNA 1CX8A 4C7HA 1DE4C 4MBUA 4MMOA 3WABA 5LRKA 3H8FA 4BD9A 3FEEA 4L8AA 3B7IA 4B5OA 1I12A 1NSAA 2ZW5A 4PK3A 1AYEA 4A33A 4OC2A 3W6SA 3D2PA 2J8RA 4C68A 3CXQA 4A32A 4K30A 4JLYA 2F8HA 2AFSA 2DF5A 2PJ4A 4P45A 4Y49B 2HV2A 1TF9A 3TX8A 3LMSA 4LQ6A 4NGMA 4UFVA 4IHMA 1VGYA 3KR4A 2PC1A 4M85A 2X7BA 2YNCA 3BLNA 3KASA 2Q7SA 4AVAA 4ZGYB 5IX3A 1DTDA 1TXRA 2B3UA 2JEWA 2WPWA 4B11A 4PSWA 2Q04A 1Z5RA 2Y0MA 1KUXA 4B5PB 1TKFA 3QAHA 2CTBA 5HMNA 3TE4A 4CAXA 4ONUA 4OC0A 4MI4A 4KSIA 1IY7A 1IB1E 2FE7A 2I3CA 2QECA 4NFRA 4YWYA 4NF1A 5HVHA 4EFDA 3KZWA 4IF5A 3R9EA 3T8WA 1K4JA 3SHPA 3TO9A 2FCKA 3PBBA 2PJ5A 3SI1A 4B12A 4P4DA 2PIYA 3OWCA 4U5YA 5THWA 3QB8A 2QYVA 3VWEA 1CJWA 4KSAA 4HNXB 4CGMA 1N71A 4F9VA 2WUUA 3LD2A 5ELYA 5I0CA 1OZPA 4XNHC 1ELMP 3KHXA 1J4JA 3W91A 2VZYA 3P2HA 1CP6A 5AGEA 3SI0A 4M6IA 3G3SA 1XOVA 4I49A 1YLOA 4OC4A 4UBRA 4A30A 2XEJA 5F48A 3PP9A 1QSMA 4WJBA 4L89A 4KOSA 1Z8TA 1YREA 1HDUA 1Y9WA 2GU2A 1QSRA 3ZJ0A 2A4NA 2EK8A 3KR5A 2RC4A 1QMUA 3K2KA 4KVME 1XMBA 3DSBA 3IFEA 4Y49C 3V8IA 4CAWA 2DXQA 2OZHA 4RI1A 4R8FA 1YVKA 4J3GA 3UY5A 5KTDA 1HDQA 4RN7A 1FNOA 4CYNA 4FD6A 1F2OA 3SJXA 4E2AA 2GFQA 3FYNA 5HXDA 4R57A 4MFJA 2Z3LA 3D7DA 3BI1A 2V8HA 3D8PA 4AXVA 4CGPA 4PSXA 4CAEA 4R76A 2ABZA 3GLJA 2VZZA 2PQ8A 2ZENA 2YNEA 3RNZA 4LX9A 2G9DA 4X3RA 2G3TA 1M4LA 2Z3KA 2FXFA 1V0CA 4ONWA 3D7HA 5IV0A 4GXHA 4CYQA 3PBEA 4BBHA 4R6TA 4P10A 2ANPA 3FRMA 5J8FA 2GLJA 2BL1A 5K8NA 3TTHA 3NH4A 1YGHA 3CXPA 3WT4A 2Z3NA 4MFLA 2HQYA 4CRZB 2PJ1A 4A37A 1VHSA 1XJOA 4KLVA 1Y7RA 3SI2A 4UF4A 4KOVA 3JUWA 3F5BA 1Z8WA 4OKOA 5K8MA 3TO7A 1Y0YA 1TIQA 2CNSA 1F2PA 2PCUA 2RFHA 2PJ7A 4IK2A 4P4FA 5LRGA 5LYFA 1PYTB 3BJ8A 3PB4X 4EWTA 1KWMA 5D8NA 4MHPA 2PE3A 4AVCA 1KUYA 2VXKA 3WC5A 3MRUA 3B3VA 2Q4YA 1NSLA 5C88A 5AG6A 4C2XA 3LODA 4KZTA 2ZPAA 4UEFA 2R8VA 4KOXA 4OLLA 2OU2A 2ZELA 1R57A 4XPDB 4YU9A 1ZG7A 2NSMA 3IO1A 4H6UA 1YSJA 3V38A 1QQ9A 1WK4A 1Z8LA 4AB7A 4OP4A 4AVBA 1YW4A 3FNCA 1XF8A 5A27A 2PVWA 5EMIA 3B3SA 2PSWA 3BI0A 3DR6A 1YLEA 1GHEA 2D4OA 1VKCA 2ZXVA 3DGVA 2Q7BA 4UA3A 2CTCA 2PDOA 2VL1A 4A94A 4QUSA 1Q2CA 4GS4A 3TT2A 2PJ2A 3KHZA 2ZEHA 2G0BA 4KOYA 4WWVA 1LAMA 1SQHA 4H6ZA 2O53A 4QBJA 6CPAA 4ZBGA 3EFAA 4NEXA 1GYTA 2G3AA 1JWQA 4ZX9A 3GKRA 1UWYA 3DLJA 3KQZA 2HB6A 2XEFA 4KLWA 4DUKA 3B2YA 4FBEA 2BCOA 4GM5A 1A2ZA 2B4BA 4JJXA 4NGSA 2F7VA 2YNDA 3FEDA 1ZLHA 3E0KA 2JLMA 2DPSA 4X8IA 4CS0B 4TNUA 4C2ZA 2FS5A 1ZG8A 8CPAA 2BOAA 4F8ZA 5KTAA 2Q4ZA 2J9AA 3PRTA 2PIZA 1JQGA 1ON0A 2AFUA 4MFPA 3SJGA 4W9YA 5F47A 3RO0A 2PJ8A 4HPSA 3BXMA 2RB7A 1LRZA 4OC3A 3EY5A 4XPDC 2VBQA 2KCWA 1IOFA 2AFWA 2QVPA 3C26A 5JPHA 4UIAA 4NJQA 2HC9A 4JXRA 3D2MA 1IOIA 4UWJA 4CAVA 2D4PA 4B10A 3N5FA 4E8OA 3CPXA 3IWEA 2JBJA 4KS9A 2ZEEA 4FWUA 1OBRA 2EUIA 2B4DB 1B6BA 1BPNA 4UFXA 5JGFA 3B3TA 2HUZA 5IB9A 4HNWB 1XMTA 3R9FA 3F0AA 1RXTA 3A9LA 2H5MA 2O28A 4KOTA 4UCMA 3P2FA 1ARMA 2Q0YA 3B3CA 1YR0A 3CT9A 3PFEA 5CPAA 3T9YA 1FY7A 4XPLA 4MHYA 4R9MA 4DYOA 4B5PA 4M6GA 2C6GA 3EC4A 3I1UA 4MY0A 4RUHA 1QSNA 4NGPA 1YW6A 2QMLA 3JRUA 1XRYA 1YMEA 4HKFA 3TO6A 1XE4A 1M4IA 3DR8A 3IJ3A 3IWGA 2PR1A 4TWEA 1Y0RA 1M4DA 3PB6X 3SJFA 4MFZA 1PUAA 2IQ6A 3SXOA 2OB0A 2AE6A 2Z10A 3PB8X 2JBKA 4NCZA 3S6FA 5K8OA 3F8KA 2DPTA 3LACA 3S6KA 1YVOA 2NMTA 1I21A 2ZOFA 4R3KA 3GYAA 4FD7A 2B58A 1LOKA 1NE9A 5CNPA 2EBJA 1Y9KA 5DWMA 1LAPA 3PB9X 2REEA 4PXDA 2J8MA 4UIBA 2FSRA 1CM0A 2BSWA 2FL4A 2FVGA 3KQXA 4LQGA 2I79A 2QJ8A 4P4IA 3R95A 4CYPA 1I1DA 3FIXA 2GIVA 4NJRA 2OZGA 2R7HA 4A2ZA 2Q4VA 2PR8A 4BMHA 3SJEA 4CGLA 4IUSA 1ZLIA 3R9GA 1UFHA 4B14A 1BAVA 1TF8A 2GLFA 5E96A 3FMCA 4F0XA 1HEEA 1P0HA 2Z11A 2PVVA 4DJLA 4UEEA 1X12A 2Q51A 3TC8A 4P4EA 3T90A 1R3NA 3VWDA 2AFOA 4H2KA 1IGBA 1MJAA 2CY2A 2O4HA 1ARLA 4A38A 5G20A 3IGRA 1XBUA 2P6GA 2CXAA 2PJAA 1Z9UA 4P6YA 5GCNA 2GANA 2IJZA 3NA6A 3B3WA 4KORA 5DWNA 4QVTA 3S9NA 2PJ3A 3FBUA 1MJBA 4PXCA 2J8NA 4ZX8A 3IWWA 2IL4A 2QIRA 1XIXA 4KOWA 1ELLP 4NGQA 5A28A 4F0YA 2FT0A 2GREA 2PRBA 3FECA 4MFKA 4OMEA 5HH1A 3FXTA 2C6CA 1MK4A 2ZEMA 4PV6A 2B5GA 3IC1A 2ARHA 1M1DA 2ZW7A 3G8WA 5G21A 3H4QA 5LYIA 2GE3A 1PU9A 1RO5A 3KI9A 2P6EA 2JDDA 2K5TA 1CPSA 3QNVA 2R98A 5HVFA 2PRQA 4Q7AA 1CBXA 3PFOA 1XEBA 1YX0A 4X5KA 4C2YA 4KUBA 3HLPA 5BWAB 4OAEA 4MXUA 4DNCA 2OOTA 3B8GA 4UEZA 4KUAA 4KVXA 4FD4A 1R43A 2NYQA 3RYOA 3TOAA 2ZW6A 1IYKA 3ZZIA 4X2TA 1KUVA 2VI7A 2WPXA 4OC5A 5F09A 5JH9A 3TCVA 5F49A 3NH5A 3D3SA 2EK9A 4MCRA 4XNHB 4U9ZA 3K9UA 3IEHA 5LYLA 5JQ4A 3MGDA 3TFYA 3VATA 4M6HA 2JEVA 2ZEOA 3ISZA 4G1PA 4MHDA 2F5IA 3DNSA 4NXYA 4OC1A 4JXQA 4MCSA 2Z3OA 4FUUA 2ZEDA 4Z65A 5KTCA 4M3SA 5DS0A 2PJ6A 1XFOA 1S3ZA 5FVJA 4MCQA 1S7NA 3RBUA 5F46A 2CNMA 3D68A 5I4MA 3D7GA 1Z4RA 3H8GA 4AG7A 4CYOA 1S60A 1B87A 4KVOE 1LCPA 3RAMA 7CPAA 1H8LA 1ZO0A 1MJ9A 3DDDA 3JVNA 2ODFA 5JM6A 3PB7X 1CG2A 3S9MA 4QC6A 4Q38A 3PZJA 4A39A 4NGRA 1VIXA 3WC6A 3H8EA 4MY3A 4LUAA 2CF4A 2P0WA 4MHZA 4F9UA 2BO9A 3WR7A 4R3LA
chains in the Genus database with same CATH topology
4UFWA 3W6XA 2YNCC 3R1KA 2CNTA 4PK2A 3R96A 4ORFA 1Z4EA 4RS2A 3GY9A 5EC4A 3EO4A 2OZUA 4R87A 4CGNA 2B4DA 4MJ8A 4C7IA 1WWZA 4CRYB 3FB3A 3SXNA 1IYLA 1Q2DA 4QB9A 1S7KA 4HNYB 3PGPA 1IIDA 4F6AA 5H84A 2WSAA 4U9YA 5J8CA 1QSTA 2P6FA 3IU1A 2FIWA 3EXNA 2YGWA 4KOUA 4H89A 4EVYA 4Q36A 1M4GA 1NMTA 1U6MA 1Q2YA 4XPKA 2EVNA 2JDCA 1M44A 3N7ZA 4PK3A 2Q44A 5G22A 1BOBA 1S7LA 4YRHA 3JTKA 4JD6A 4JWPA 1KZFA 4FD5A 5AG5A 3KKWA 3TOBA 5ISVA 2AJ6A 5G1ZA 2B3VA 2R1IA 3IU2A 5C82A 1S7FA 5AG4A 1IICA 3H5ZA 2Z3MA 3I3GA 4MFQA 3S6GA 4E0AA 3S6HA 5IB0A 4B13A 2B5GB 3I9SA 4OADA 5AG7A 3BJ7A 3CXSA 1L0CA 4CGOA 2BEIA 2OH1A 2VEZA 4YGOA 4A95A 2Z3PA 1P4NA 4KSFA 4A31A 4CAFA 2REFA 2BUEA 1YK3A 1QSOA 4UCPA 2Z0ZA 2VQYA 4UWIA 4YFJA 5H86A 5EBVA 2I00A 1BO4A 2ATRA 3NE7A 4NSQA 2C27A 4AG9A 1S5KA 2ZW4A 2FIAA 4II9A 4UCNA 4C7HA 4MBUA 4L8AA 4B5OA 1I12A 2ZW5A 4A33A 3W6SA 3D2PA 2J8RA 4C68A 3CXQA 4A32A 4K30A 4JLYA 4Y49B 2HV2A 4UFVA 4M85A 2PC1A 2X7BA 2YNCA 3BLNA 4AVAA 4ZGYB 5IX3A 2WPWA 2B3UA 4B11A 4PSWA 2Q04A 2Y0MA 1KUXA 4B5PB 3QAHA 5HMNA 3TE4A 4CAXA 4ONUA 4MI4A 1IB1E 2FE7A 2QECA 4NF1A 4IF5A 3R9EA 1K4JA 3SHPA 3TO9A 2FCKA 4B12A 4U5YA 3OWCA 3QB8A 3VWEA 1CJWA 4KSAA 4HNXB 4CGMA 1N71A 2WUUA 3LD2A 5I0CA 1OZPA 4XNHC 3W91A 1J4JA 2VZYA 3P2HA 5AGEA 3G3SA 4I49A 4UBRA 4A30A 5F48A 3PP9A 1QSMA 4L89A 4KOSA 1YREA 1Y9WA 3ZJ0A 1QSRA 2A4NA 2RC4A 4KVME 4Y49C 4CAWA 3DSBA 3V8IA 2DXQA 2OZHA 4RI1A 1YVKA 4J3GA 3UY5A 5KTDA 4CYNA 4FD6A 4E2AA 3FYNA 4R57A 4MFJA 2Z3LA 3D8PA 4CGPA 4PSXA 4CAEA 2VZZA 2PQ8A 2YNEA 4LX9A 2G3TA 2Z3KA 2FXFA 1V0CA 5IV0A 4CYQA 4BBHA 3FRMA 5J8FA 2BL1A 3TTHA 1YGHA 3CXPA 2Z3NA 4MFLA 2HQYA 4CRZB 1VHSA 4KLVA 1Y7RA 4KOVA 3JUWA 3F5BA 3TO7A 2CNSA 1TIQA 3BJ8A 4AVCA 2VXKA 1KUYA 2Q4YA 1NSLA 5C88A 5AG6A 4C2XA 3LODA 4KZTA 2ZPAA 2R8VA 4KOXA 4OLLA 2OU2A 1R57A 4XPDB 4H6UA 1WK4A 4AB7A 4AVBA 3FNCA 1XF8A 5A27A 2PSWA 3DR6A 1YLEA 1GHEA 2D4OA 1VKCA 2ZXVA 2Q7BA 4UA3A 2PDOA 4QUSA 1Q2CA 4GS4A 3TT2A 4KOYA 2G0BA 1SQHA 4H6ZA 4QBJA 4ZBGA 3EFAA 4NEXA 2G3AA 3GKRA 4KLWA 2B4BA 4JJXA 2YNDA 3E0KA 2JLMA 2DPSA 4CS0B 4C2ZA 2FS5A 5KTAA 1ON0A 4MFPA 5F47A 1LRZA 3EY5A 4XPDC 2VBQA 2KCWA 5JPHA 3C26A 4UWJA 4JXRA 3D2MA 4CAVA 2D4PA 4B10A 4E8OA 3IWEA 4KS9A 2EUIA 2B4DB 1B6BA 4UFXA 2HUZA 4HNWB 1XMTA 3R9FA 3F0AA 1RXTA 3A9LA 2H5MA 2O28A 4KOTA 4UCMA 3P2FA 2Q0YA 3T9YA 1YR0A 3TFYA 1FY7A 4XPLA 4R9MA 4B5PA 4MY0A 3EC4A 1QSNA 2QMLA 4HKFA 3TO6A 1XE4A 1M4IA 3DR8A 3IWGA 2PR1A 1M4DA 4MFZA 1PUAA 3SXOA 2OB0A 2AE6A 2Z10A 4NCZA 3S6FA 3F8KA 2DPTA 3S6KA 1YVOA 2NMTA 1I21A 4R3KA 3GYAA 4FD7A 2B58A 1NE9A 5CNPA 1Y9KA 5DWMA 2REEA 2J8MA 2FSRA 1CM0A 2BSWA 2FL4A 3R95A 4CYPA 2I79A 1I1DA 2GIVA 2OZGA 2R7HA 4A2ZA 2Q4VA 2PR8A 4BMHA 4CGLA 4IUSA 3R9GA 1UFHA 4B14A 5E96A 4F0XA 1P0HA 2Z11A 3VWDA 3T90A 1MJAA 2CY2A 5G20A 3IGRA 2P6GA 2CXAA 1Z9UA 5GCNA 2GANA 4KORA 5DWNA 4QVTA 3FBUA 1MJBA 2J8NA 2IL4A 2QIRA 1XIXA 4KOWA 5A28A 4F0YA 2FT0A 2PRBA 5HH1A 4MFKA 3FXTA 1MK4A 4PV6A 2B5GA 2ARHA 1M1DA 2ZW7A 3G8WA 5G21A 3H4QA 2GE3A 1PU9A 1RO5A 2P6EA 2JDDA 2K5TA 2R98A 1XEBA 1YX0A 4X5KA 4C2YA 4KUBA 5BWAB 4OAEA 4DNCA 3B8GA 3RYOA 4KUAA 4KVXA 4FD4A 3TOAA 2ZW6A 1IYKA 3ZZIA 1KUVA 2VI7A 2WPXA 3TCVA 5F49A 3D3SA 4XNHB 4U9ZA 3K9UA 5JQ4A 3MGDA 4NXYA 2JEVA 4MHDA 2F5IA 3DNSA 4JXQA 2Z3OA 5KTCA 4M3SA 5FVJA 1S3ZA 1S7NA 5F46A 2CNMA 1Z4RA 4AG7A 4CYOA 1S60A 1B87A 4KVOE 1ZO0A 1MJ9A 3DDDA 3JVNA 4QC6A 4Q38A 3PZJA 4MY3A 4LUAA 2P0WA 3FIXA 3WR7A 4R3LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3W6X A;  3R1K A;  2CNT A;  4PK2 A;  3R96 A;  4ORF A;  1Z4E A;  4RS2 A;  3GY9 A;  5EC4 A;  3EO4 A;  2OZU A;  4R87 A;  2B4D A;  4MJ8 A;  1WWZ A;  4CRY B;  3FB3 A;  3SXN A;  1IYL A;  1Q2D A;  4QB9 A;  1S7K A;  4HNY B;  3PGP A;  1IID A;  4F6A A;  5H84 A;  4U9Y A;  5J8C A;  1QST A;  2P6F A;  2FIW A;  3EXN A;  4KOU A;  4H89 A;  4EVY A;  1M4G A;  1NMT A;  1U6M A;  1Q2Y A;  4XPK A;  2EVN A;  2JDC A;  1M44 A;  3N7Z A;  4PK3 A;  2Q44 A;  1BOB A;  1S7L A;  4YRH A;  4JD6 A;  4JWP A;  1KZF A;  4FD5 A;  3KKW A;  3TOB A;  5ISV A;  2AJ6 A;  2B3V A;  2R1I A;  5C82 A;  1S7F A;  1IIC A;  3I3G A;  4E0A A;  3S6G A;  3S6H A;  5IB0 A;  2B5G B;  3I9S A;  4OAD A;  3BJ7 A;  3CXS A;  1L0C A;  2BEI A;  2OH1 A;  2VEZ A;  4YGO A;  1P4N A;  2REF A;  2BUE A;  1YK3 A;  1QSO A;  2Z0Z A;  2VQY A;  4UWI A;  4YFJ A;  5H86 A;  5EBV A;  2I00 A;  1BO4 A;  2ATR A;  3NE7 A;  4NSQ A;  2C27 A;  4AG9 A;  1S5K A;  2ZW4 A;  2FIA A;  4II9 A;  4MBU A;  4L8A A;  4B5O A;  1I12 A;  2ZW5 A;  3W6S A;  3D2P A;  2J8R A;  3CXQ A;  4K30 A;  4JLY A;  4Y49 B;  2HV2 A;  4M85 A;  2PC1 A;  2X7B A;  4AVA A;  3BLN A;  5IX3 A;  2WPW A;  2B3U A;  4PSW A;  2Q04 A;  2Y0M A;  1KUX A;  4B5P B;  3QAH A;  5HMN A;  3TE4 A;  4CAX A;  4ONU A;  4MI4 A;  1IB1 E;  2FE7 A;  2QEC A;  4NF1 A;  4IF5 A;  3R9E A;  1K4J A;  3SHP A;  3TO9 A;  2FCK A;  4U5Y A;  3OWC A;  3QB8 A;  3VWE A;  1CJW A;  4HNX B;  1N71 A;  3LD2 A;  5I0C A;  1OZP A;  4XNH C;  3W91 A;  1J4J A;  2VZY A;  3P2H A;  3G3S A;  4I49 A;  4UBR A;  5F48 A;  3PP9 A;  1QSM A;  4L89 A;  4KOS A;  1YRE A;  1Y9W A;  3ZJ0 A;  1QSR A;  2A4N A;  2RC4 A;  4KVM E;  4Y49 C;  4CAW A;  3DSB A;  3V8I A;  2DXQ A;  2OZH A;  4RI1 A;  1YVK A;  4J3G A;  3UY5 A;  5KTD A;  4FD6 A;  4E2A A;  3FYN A;  4R57 A;  3D8P A;  4PSX A;  2VZZ A;  2PQ8 A;  4LX9 A;  2G3T A;  2FXF A;  1V0C A;  5IV0 A;  3FRM A;  5J8F A;  2BL1 A;  3TTH A;  1YGH A;  3CXP A;  2HQY A;  4CRZ B;  1VHS A;  4KLV A;  1Y7R A;  4KOV A;  3JUW A;  3F5B A;  3TO7 A;  2CNS A;  1TIQ A;  3BJ8 A;  4AVC A;  2VXK A;  1KUY A;  2Q4Y A;  1NSL A;  5C88 A;  3LOD A;  4KZT A;  2ZPA A;  2R8V A;  4KOX A;  4OLL A;  2OU2 A;  1R57 A;  4XPD B;  4H6U A;  1WK4 A;  4AB7 A;  4AVB A;  3FNC A;  1XF8 A;  2PSW A;  3DR6 A;  1YLE A;  1GHE A;  2D4O A;  1VKC A;  2ZXV A;  2Q7B A;  4UA3 A;  2PDO A;  4QUS A;  1Q2C A;  4GS4 A;  3TT2 A;  4KOY A;  2G0B A;  1SQH A;  4H6Z A;  4QBJ A;  4ZBG A;  3EFA A;  4NEX A;  2G3A A;  3GKR A;  4KLW A;  2B4B A;  4JJX A;  3E0K A;  2JLM A;  4CS0 B;  2FS5 A;  5KTA A;  1ON0 A;  5F47 A;  1LRZ A;  3EY5 A;  4XPD C;  2VBQ A;  2KCW A;  5JPH A;  3C26 A;  4UWJ A;  4JXR A;  3D2M A;  4CAV A;  2D4P A;  4E8O A;  2EUI A;  2B4D B;  1B6B A;  2HUZ A;  4HNW B;  1XMT A;  3R9F A;  3F0A A;  1RXT A;  2H5M A;  2O28 A;  4KOT A;  3P2F A;  2Q0Y A;  3T9Y A;  1YR0 A;  3TFY A;  1FY7 A;  4XPL A;  4R9M A;  4B5P A;  4MY0 A;  3EC4 A;  1QSN A;  2QML A;  4HKF A;  3TO6 A;  1XE4 A;  1M4I A;  3DR8 A;  3IWG A;  2PR1 A;  1M4D A;  1PUA A;  3SXO A;  2OB0 A;  2AE6 A;  2Z10 A;  4NCZ A;  3S6F A;  3F8K A;  3S6K A;  1YVO A;  2NMT A;  1I21 A;  4R3K A;  3GYA A;  4FD7 A;  2B58 A;  1NE9 A;  5CNP A;  1Y9K A;  5DWM A;  2REE A;  2J8M A;  2FSR A;  1CM0 A;  2BSW A;  2FL4 A;  3R95 A;  2I79 A;  1I1D A;  2GIV A;  2OZG A;  2R7H A;  4BMH A;  2Q4V A;  2PR8 A;  4IUS A;  3R9G A;  1UFH A;  5E96 A;  1P0H A;  2Z11 A;  3VWD A;  3T90 A;  1MJA A;  2CY2 A;  3IGR A;  2P6G A;  1Z9U A;  5GCN A;  2GAN A;  4KOR A;  5DWN A;  4QVT A;  3FBU A;  1MJB A;  2J8N A;  2IL4 A;  2QIR A;  1XIX A;  4KOW A;  4F0Y A;  2FT0 A;  2PRB A;  5HH1 A;  3FXT A;  1MK4 A;  4PV6 A;  2B5G A;  2ARH A;  1M1D A;  2ZW7 A;  3G8W A;  3H4Q A;  2GE3 A;  1PU9 A;  1RO5 A;  2P6E A;  2JDD A;  2K5T A;  2R98 A;  1XEB A;  1YX0 A;  4X5K A;  4KUB A;  4OAE A;  4DNC A;  3B8G A;  3RYO A;  4KUA A;  4KVX A;  4FD4 A;  3TOA A;  2ZW6 A;  1IYK A;  3ZZI A;  1KUV A;  2VI7 A;  2WPX A;  3TCV A;  5F49 A;  3D3S A;  4XNH B;  4U9Z A;  3K9U A;  5JQ4 A;  3MGD A;  4NXY A;  2JEV A;  4MHD A;  2F5I A;  3DNS A;  4JXQ A;  5KTC A;  4M3S A;  5FVJ A;  1S3Z A;  1S7N A;  5F46 A;  2CNM A;  1Z4R A;  4AG7 A;  1S60 A;  1B87 A;  4KVO E;  1MJ9 A;  3DDD A;  3JVN A;  4QC6 A;  3PZJ A;  4MY3 A;  4LUA A;  2P0W A;  3FIX A;  3WR7 A;  4R3L A; 
#chains in the Genus database with same CATH topology
 4R7M A;  4P4B A;  5LRJ A;  1LAN A;  4EME A;  4UFW A;  3FH4 A;  2POK A;  3W6X A;  3K9T A;  2YNC C;  3R1K A;  2CNT A;  4PK2 A;  3R96 A;  4ORF A;  4ZY2 A;  1Z4E A;  4ZY0 A;  4RS2 A;  3RZA A;  3S9L A;  3GY9 A;  2ZOG A;  5EC4 A;  1IU8 A;  3D67 A;  5HVG A;  3EO4 A;  2OZU A;  4R87 A;  2PJ0 A;  4CGN A;  3FX6 A;  2B4D A;  4MJ8 A;  1FT7 A;  3LWU A;  3V7Z A;  4C7I A;  1WWZ A;  4CRY B;  3FB3 A;  3GB0 A;  3SXN A;  1IYL A;  1Q2D A;  2OR4 A;  4QB9 A;  1S7K A;  1TKJ A;  4HNY B;  5K8P A;  2IMO A;  3PGP A;  1IID A;  1AMP A;  4PXE A;  4F6A A;  3PEI A;  5H84 A;  1YQE A;  4CPA A;  2WSA A;  2C1C A;  2AFX A;  1QST A;  4U9Y A;  2P6F A;  3IU1 A;  4JZ0 A;  2FIW A;  4ZYQ A;  5J8C A;  3KL9 A;  4JYW A;  4MHN A;  3EXN A;  4P44 A;  2YGW A;  1BLL E;  3BHX A;  2CIJ A;  2V77 A;  4KOU A;  4O23 A;  4H89 A;  4EVY A;  1Q7L A;  3GUX A;  4MCP A;  4Q36 A;  1M4G A;  4K3N A;  1NMT A;  1U6M A;  2V8V A;  4ZY1 A;  1Q2Y A;  4XPK A;  2PJC A;  3D7F A;  3VH9 A;  2JDC A;  2EVN A;  1CPX A;  1CP7 A;  1M44 A;  1PCA A;  2Q44 A;  3MN8 A;  3N7Z A;  1BOB A;  4PPZ A;  5G22 A;  3CZX A;  1S7L A;  4FAI A;  4IAV A;  4YRH A;  2C6P A;  3FVL A;  3JTK A;  4JD6 A;  4JWP A;  1KZF A;  1Z2L A;  3FF3 A;  3CPA A;  4FD5 A;  5AG5 A;  2EWB A;  3KKW A;  2ZEG A;  3B35 A;  3TOB A;  5ISV A;  2AJ6 A;  5G1Z A;  2B3V A;  2R1I A;  3IU2 A;  5C82 A;  1S7F A;  5AG4 A;  4MRI A;  2ZEF A;  2EO8 A;  3NE8 A;  1RTQ A;  1IIC A;  1LFW A;  3H5Z A;  3WC7 A;  2WZN A;  2Z3M A;  3I3G A;  4MFQ A;  1EE3 P;  3S6G A;  4E0A A;  3S6H A;  3D4U A;  2PJ9 A;  1X10 A;  5LYD A;  5IB0 A;  4PQA A;  4B13 A;  4ZI6 A;  2B5G B;  5J1Q A;  2Q43 A;  3I9S A;  1BPM A;  3CDX A;  2XEI A;  1Y7E A;  4NGN A;  4OAD A;  5AG7 A;  3VAR A;  4B6Z A;  1VHO A;  2DEA A;  3BJ7 A;  3CXS A;  1L0C A;  4OID A;  4CGO A;  2AFZ A;  3IIB A;  3D66 A;  2BEI A;  2OH1 A;  2VEZ A;  2XEG A;  3NFZ A;  4YGO A;  4A95 A;  2Z3P A;  1Z8X A;  1P4N A;  4PXB A;  1ZG9 A;  1AUG A;  4KSF A;  4A31 A;  4BIN A;  3QAY A;  3HUV A;  4P4J A;  4CAF A;  5CBM A;  2REF A;  2WYR A;  2BUE A;  2V8G A;  2PJB A;  1F57 A;  1YK3 A;  1QSO A;  1TKH A;  3KGQ A;  3NH8 A;  4UCP A;  2Z0Z A;  2VQY A;  4UWI A;  4YFJ A;  5H86 A;  5EBV A;  2V8D A;  3FJU A;  2I00 A;  1BO4 A;  2ATR A;  3NE7 A;  4NSQ A;  2C27 A;  4NGT A;  4OIW A;  3GIU A;  1S5K A;  1VHE A;  4AG9 A;  2AFM A;  2ZW4 A;  2FIA A;  2ZEP A;  3ISX A;  5D29 A;  4II9 A;  3L2N A;  4UCN A;  1CX8 A;  4C7H A;  1DE4 C;  4MBU A;  4MMO A;  3WAB A;  5LRK A;  3H8F A;  4BD9 A;  3FEE A;  4L8A A;  3B7I A;  4B5O A;  1I12 A;  1NSA A;  2ZW5 A;  4PK3 A;  1AYE A;  4A33 A;  4OC2 A;  3W6S A;  3D2P A;  2J8R A;  4C68 A;  3CXQ A;  4A32 A;  4K30 A;  4JLY A;  2F8H A;  2AFS A;  2DF5 A;  2PJ4 A;  4P45 A;  4Y49 B;  2HV2 A;  1TF9 A;  3TX8 A;  3LMS A;  4LQ6 A;  4NGM A;  4UFV A;  4IHM A;  1VGY A;  3KR4 A;  2PC1 A;  4M85 A;  2X7B A;  2YNC A;  3BLN A;  3KAS A;  2Q7S A;  4AVA A;  4ZGY B;  5IX3 A;  1DTD A;  1TXR A;  2B3U A;  2JEW A;  2WPW A;  4B11 A;  4PSW A;  2Q04 A;  1Z5R A;  2Y0M A;  1KUX A;  4B5P B;  1TKF A;  3QAH A;  2CTB A;  5HMN A;  3TE4 A;  4CAX A;  4ONU A;  4OC0 A;  4MI4 A;  4KSI A;  1IY7 A;  1IB1 E;  2FE7 A;  2I3C A;  2QEC A;  4NFR A;  4YWY A;  4NF1 A;  5HVH A;  4EFD A;  3KZW A;  4IF5 A;  3R9E A;  3T8W A;  1K4J A;  3SHP A;  3TO9 A;  2FCK A;  3PBB A;  2PJ5 A;  3SI1 A;  4B12 A;  4P4D A;  2PIY A;  3OWC A;  4U5Y A;  5THW A;  3QB8 A;  2QYV A;  3VWE A;  1CJW A;  4KSA A;  4HNX B;  4CGM A;  1N71 A;  4F9V A;  2WUU A;  3LD2 A;  5ELY A;  5I0C A;  1OZP A;  4XNH C;  1ELM P;  3KHX A;  1J4J A;  3W91 A;  2VZY A;  3P2H A;  1CP6 A;  5AGE A;  3SI0 A;  4M6I A;  3G3S A;  1XOV A;  4I49 A;  1YLO A;  4OC4 A;  4UBR A;  4A30 A;  2XEJ A;  5F48 A;  3PP9 A;  1QSM A;  4WJB A;  4L89 A;  4KOS A;  1Z8T A;  1YRE A;  1HDU A;  1Y9W A;  2GU2 A;  1QSR A;  3ZJ0 A;  2A4N A;  2EK8 A;  3KR5 A;  2RC4 A;  1QMU A;  3K2K A;  4KVM E;  1XMB A;  3DSB A;  3IFE A;  4Y49 C;  3V8I A;  4CAW A;  2DXQ A;  2OZH A;  4RI1 A;  4R8F A;  1YVK A;  4J3G A;  3UY5 A;  5KTD A;  1HDQ A;  4RN7 A;  1FNO A;  4CYN A;  4FD6 A;  1F2O A;  3SJX A;  4E2A A;  2GFQ A;  3FYN A;  5HXD A;  4R57 A;  4MFJ A;  2Z3L A;  3D7D A;  3BI1 A;  2V8H A;  3D8P A;  4AXV A;  4CGP A;  4PSX A;  4CAE A;  4R76 A;  2ABZ A;  3GLJ A;  2VZZ A;  2PQ8 A;  2ZEN A;  2YNE A;  3RNZ A;  4LX9 A;  2G9D A;  4X3R A;  2G3T A;  1M4L A;  2Z3K A;  2FXF A;  1V0C A;  4ONW A;  3D7H A;  5IV0 A;  4GXH A;  4CYQ A;  3PBE A;  4BBH A;  4R6T A;  4P10 A;  2ANP A;  3FRM A;  5J8F A;  2GLJ A;  2BL1 A;  5K8N A;  3TTH A;  3NH4 A;  1YGH A;  3CXP A;  3WT4 A;  2Z3N A;  4MFL A;  2HQY A;  4CRZ B;  2PJ1 A;  4A37 A;  1VHS A;  1XJO A;  4KLV A;  1Y7R A;  3SI2 A;  4UF4 A;  4KOV A;  3JUW A;  3F5B A;  1Z8W A;  4OKO A;  5K8M A;  3TO7 A;  1Y0Y A;  1TIQ A;  2CNS A;  1F2P A;  2PCU A;  2RFH A;  2PJ7 A;  4IK2 A;  4P4F A;  5LRG A;  5LYF A;  1PYT B;  3BJ8 A;  3PB4 X;  4EWT A;  1KWM A;  5D8N A;  4MHP A;  2PE3 A;  4AVC A;  1KUY A;  2VXK A;  3WC5 A;  3MRU A;  3B3V A;  2Q4Y A;  1NSL A;  5C88 A;  5AG6 A;  4C2X A;  3LOD A;  4KZT A;  2ZPA A;  4UEF A;  2R8V A;  4KOX A;  4OLL A;  2OU2 A;  2ZEL A;  1R57 A;  4XPD B;  4YU9 A;  1ZG7 A;  2NSM A;  3IO1 A;  4H6U A;  1YSJ A;  3V38 A;  1QQ9 A;  1WK4 A;  1Z8L A;  4AB7 A;  4OP4 A;  4AVB A;  1YW4 A;  3FNC A;  1XF8 A;  5A27 A;  2PVW A;  5EMI A;  3B3S A;  2PSW A;  3BI0 A;  3DR6 A;  1YLE A;  1GHE A;  2D4O A;  1VKC A;  2ZXV A;  3DGV A;  2Q7B A;  4UA3 A;  2CTC A;  2PDO A;  2VL1 A;  4A94 A;  4QUS A;  1Q2C A;  4GS4 A;  3TT2 A;  2PJ2 A;  3KHZ A;  2ZEH A;  2G0B A;  4KOY A;  4WWV A;  1LAM A;  1SQH A;  4H6Z A;  2O53 A;  4QBJ A;  6CPA A;  4ZBG A;  3EFA A;  4NEX A;  1GYT A;  2G3A A;  1JWQ A;  4ZX9 A;  3GKR A;  1UWY A;  3DLJ A;  3KQZ A;  2HB6 A;  2XEF A;  4KLW A;  4DUK A;  3B2Y A;  4FBE A;  2BCO A;  4GM5 A;  1A2Z A;  2B4B A;  4JJX A;  4NGS A;  2F7V A;  2YND A;  3FED A;  1ZLH A;  3E0K A;  2JLM A;  2DPS A;  4X8I A;  4CS0 B;  4TNU A;  4C2Z A;  2FS5 A;  1ZG8 A;  8CPA A;  2BOA A;  4F8Z A;  5KTA A;  2Q4Z A;  2J9A A;  3PRT A;  2PIZ A;  1JQG A;  1ON0 A;  2AFU A;  4MFP A;  3SJG A;  4W9Y A;  5F47 A;  3RO0 A;  2PJ8 A;  4HPS A;  3BXM A;  2RB7 A;  1LRZ A;  4OC3 A;  3EY5 A;  4XPD C;  2VBQ A;  2KCW A;  1IOF A;  2AFW A;  2QVP A;  3C26 A;  5JPH A;  4UIA A;  4NJQ A;  2HC9 A;  4JXR A;  3D2M A;  1IOI A;  4UWJ A;  4CAV A;  2D4P A;  4B10 A;  3N5F A;  4E8O A;  3CPX A;  3IWE A;  2JBJ A;  4KS9 A;  2ZEE A;  4FWU A;  1OBR A;  2EUI A;  2B4D B;  1B6B A;  1BPN A;  4UFX A;  5JGF A;  3B3T A;  2HUZ A;  5IB9 A;  4HNW B;  1XMT A;  3R9F A;  3F0A A;  1RXT A;  3A9L A;  2H5M A;  2O28 A;  4KOT A;  4UCM A;  3P2F A;  1ARM A;  2Q0Y A;  3B3C A;  1YR0 A;  3CT9 A;  3PFE A;  5CPA A;  3T9Y A;  1FY7 A;  4XPL A;  4MHY A;  4R9M A;  4DYO A;  4B5P A;  4M6G A;  2C6G A;  3EC4 A;  3I1U A;  4MY0 A;  4RUH A;  1QSN A;  4NGP A;  1YW6 A;  2QML A;  3JRU A;  1XRY A;  1YME A;  4HKF A;  3TO6 A;  1XE4 A;  1M4I A;  3DR8 A;  3IJ3 A;  3IWG A;  2PR1 A;  4TWE A;  1Y0R A;  1M4D A;  3PB6 X;  3SJF A;  4MFZ A;  1PUA A;  2IQ6 A;  3SXO A;  2OB0 A;  2AE6 A;  2Z10 A;  3PB8 X;  2JBK A;  4NCZ A;  3S6F A;  5K8O A;  3F8K A;  2DPT A;  3LAC A;  3S6K A;  1YVO A;  2NMT A;  1I21 A;  2ZOF A;  4R3K A;  3GYA A;  4FD7 A;  2B58 A;  1LOK A;  1NE9 A;  5CNP A;  2EBJ A;  1Y9K A;  5DWM A;  1LAP A;  3PB9 X;  2REE A;  4PXD A;  2J8M A;  4UIB A;  2FSR A;  1CM0 A;  2BSW A;  2FL4 A;  2FVG A;  3KQX A;  4LQG A;  2I79 A;  2QJ8 A;  4P4I A;  3R95 A;  4CYP A;  1I1D A;  3FIX A;  2GIV A;  4NJR A;  2OZG A;  2R7H A;  4A2Z A;  2Q4V A;  2PR8 A;  4BMH A;  3SJE A;  4CGL A;  4IUS A;  1ZLI A;  3R9G A;  1UFH A;  4B14 A;  1BAV A;  1TF8 A;  2GLF A;  5E96 A;  3FMC A;  4F0X A;  1HEE A;  1P0H A;  2Z11 A;  2PVV A;  4DJL A;  4UEE A;  1X12 A;  2Q51 A;  3TC8 A;  4P4E A;  3T90 A;  1R3N A;  3VWD A;  2AFO A;  4H2K A;  1IGB A;  1MJA A;  2CY2 A;  2O4H A;  1ARL A;  4A38 A;  5G20 A;  3IGR A;  1XBU A;  2P6G A;  2CXA A;  2PJA A;  1Z9U A;  4P6Y A;  5GCN A;  2GAN A;  2IJZ A;  3NA6 A;  3B3W A;  4KOR A;  5DWN A;  4QVT A;  3S9N A;  2PJ3 A;  3FBU A;  1MJB A;  4PXC A;  2J8N A;  4ZX8 A;  3IWW A;  2IL4 A;  2QIR A;  1XIX A;  4KOW A;  1ELL P;  4NGQ A;  5A28 A;  4F0Y A;  2FT0 A;  2GRE A;  2PRB A;  3FEC A;  4MFK A;  4OME A;  5HH1 A;  3FXT A;  2C6C A;  1MK4 A;  2ZEM A;  4PV6 A;  2B5G A;  3IC1 A;  2ARH A;  1M1D A;  2ZW7 A;  3G8W A;  5G21 A;  3H4Q A;  5LYI A;  2GE3 A;  1PU9 A;  1RO5 A;  3KI9 A;  2P6E A;  2JDD A;  2K5T A;  1CPS A;  3QNV A;  2R98 A;  5HVF A;  2PRQ A;  4Q7A A;  1CBX A;  3PFO A;  1XEB A;  1YX0 A;  4X5K A;  4C2Y A;  4KUB A;  3HLP A;  5BWA B;  4OAE A;  4MXU A;  4DNC A;  2OOT A;  3B8G A;  4UEZ A;  4KUA A;  4KVX A;  4FD4 A;  1R43 A;  2NYQ A;  3RYO A;  3TOA A;  2ZW6 A;  1IYK A;  3ZZI A;  4X2T A;  1KUV A;  2VI7 A;  2WPX A;  4OC5 A;  5F09 A;  5JH9 A;  3TCV A;  5F49 A;  3NH5 A;  3D3S A;  2EK9 A;  4MCR A;  4XNH B;  4U9Z A;  3K9U A;  3IEH A;  5LYL A;  5JQ4 A;  3MGD A;  3TFY A;  3VAT A;  4M6H A;  2JEV A;  2ZEO A;  3ISZ A;  4G1P A;  4MHD A;  2F5I A;  3DNS A;  4NXY A;  4OC1 A;  4JXQ A;  4MCS A;  2Z3O A;  4FUU A;  2ZED A;  4Z65 A;  5KTC A;  4M3S A;  5DS0 A;  2PJ6 A;  1XFO A;  1S3Z A;  5FVJ A;  4MCQ A;  1S7N A;  3RBU A;  5F46 A;  2CNM A;  3D68 A;  5I4M A;  3D7G A;  1Z4R A;  3H8G A;  4AG7 A;  4CYO A;  1S60 A;  1B87 A;  4KVO E;  1LCP A;  3RAM A;  7CPA A;  1H8L A;  1ZO0 A;  1MJ9 A;  3DDD A;  3JVN A;  2ODF A;  5JM6 A;  3PB7 X;  1CG2 A;  3S9M A;  4QC6 A;  4Q38 A;  3PZJ A;  4A39 A;  4NGR A;  1VIX A;  3WC6 A;  3H8E A;  4MY3 A;  4LUA A;  2CF4 A;  2P0W A;  4MHZ A;  4F9U A;  2BO9 A;  3WR7 A;  4R3L A; 
#chains in the Genus database with same CATH homology
 4UFW A;  3W6X A;  2YNC C;  3R1K A;  2CNT A;  4PK2 A;  3R96 A;  4ORF A;  1Z4E A;  4RS2 A;  3GY9 A;  5EC4 A;  3EO4 A;  2OZU A;  4R87 A;  4CGN A;  2B4D A;  4MJ8 A;  4C7I A;  1WWZ A;  4CRY B;  3FB3 A;  3SXN A;  1IYL A;  1Q2D A;  4QB9 A;  1S7K A;  4HNY B;  3PGP A;  1IID A;  4F6A A;  5H84 A;  2WSA A;  4U9Y A;  5J8C A;  1QST A;  2P6F A;  3IU1 A;  2FIW A;  3EXN A;  2YGW A;  4KOU A;  4H89 A;  4EVY A;  4Q36 A;  1M4G A;  1NMT A;  1U6M A;  1Q2Y A;  4XPK A;  2EVN A;  2JDC A;  1M44 A;  3N7Z A;  4PK3 A;  2Q44 A;  5G22 A;  1BOB A;  1S7L A;  4YRH A;  3JTK A;  4JD6 A;  4JWP A;  1KZF A;  4FD5 A;  5AG5 A;  3KKW A;  3TOB A;  5ISV A;  2AJ6 A;  5G1Z A;  2B3V A;  2R1I A;  3IU2 A;  5C82 A;  1S7F A;  5AG4 A;  1IIC A;  3H5Z A;  2Z3M A;  3I3G A;  4MFQ A;  3S6G A;  4E0A A;  3S6H A;  5IB0 A;  4B13 A;  2B5G B;  3I9S A;  4OAD A;  5AG7 A;  3BJ7 A;  3CXS A;  1L0C A;  4CGO A;  2BEI A;  2OH1 A;  2VEZ A;  4YGO A;  4A95 A;  2Z3P A;  1P4N A;  4KSF A;  4A31 A;  4CAF A;  2REF A;  2BUE A;  1YK3 A;  1QSO A;  4UCP A;  2Z0Z A;  2VQY A;  4UWI A;  4YFJ A;  5H86 A;  5EBV A;  2I00 A;  1BO4 A;  2ATR A;  3NE7 A;  4NSQ A;  2C27 A;  4AG9 A;  1S5K A;  2ZW4 A;  2FIA A;  4II9 A;  4UCN A;  4C7H A;  4MBU A;  4L8A A;  4B5O A;  1I12 A;  2ZW5 A;  4A33 A;  3W6S A;  3D2P A;  2J8R A;  4C68 A;  3CXQ A;  4A32 A;  4K30 A;  4JLY A;  4Y49 B;  2HV2 A;  4UFV A;  4M85 A;  2PC1 A;  2X7B A;  2YNC A;  3BLN A;  4AVA A;  4ZGY B;  5IX3 A;  2WPW A;  2B3U A;  4B11 A;  4PSW A;  2Q04 A;  2Y0M A;  1KUX A;  4B5P B;  3QAH A;  5HMN A;  3TE4 A;  4CAX A;  4ONU A;  4MI4 A;  1IB1 E;  2FE7 A;  2QEC A;  4NF1 A;  4IF5 A;  3R9E A;  1K4J A;  3SHP A;  3TO9 A;  2FCK A;  4B12 A;  4U5Y A;  3OWC A;  3QB8 A;  3VWE A;  1CJW A;  4KSA A;  4HNX B;  4CGM A;  1N71 A;  2WUU A;  3LD2 A;  5I0C A;  1OZP A;  4XNH C;  3W91 A;  1J4J A;  2VZY A;  3P2H A;  5AGE A;  3G3S A;  4I49 A;  4UBR A;  4A30 A;  5F48 A;  3PP9 A;  1QSM A;  4L89 A;  4KOS A;  1YRE A;  1Y9W A;  3ZJ0 A;  1QSR A;  2A4N A;  2RC4 A;  4KVM E;  4Y49 C;  4CAW A;  3DSB A;  3V8I A;  2DXQ A;  2OZH A;  4RI1 A;  1YVK A;  4J3G A;  3UY5 A;  5KTD A;  4CYN A;  4FD6 A;  4E2A A;  3FYN A;  4R57 A;  4MFJ A;  2Z3L A;  3D8P A;  4CGP A;  4PSX A;  4CAE A;  2VZZ A;  2PQ8 A;  2YNE A;  4LX9 A;  2G3T A;  2Z3K A;  2FXF A;  1V0C A;  5IV0 A;  4CYQ A;  4BBH A;  3FRM A;  5J8F A;  2BL1 A;  3TTH A;  1YGH A;  3CXP A;  2Z3N A;  4MFL A;  2HQY A;  4CRZ B;  1VHS A;  4KLV A;  1Y7R A;  4KOV A;  3JUW A;  3F5B A;  3TO7 A;  2CNS A;  1TIQ A;  3BJ8 A;  4AVC A;  2VXK A;  1KUY A;  2Q4Y A;  1NSL A;  5C88 A;  5AG6 A;  4C2X A;  3LOD A;  4KZT A;  2ZPA A;  2R8V A;  4KOX A;  4OLL A;  2OU2 A;  1R57 A;  4XPD B;  4H6U A;  1WK4 A;  4AB7 A;  4AVB A;  3FNC A;  1XF8 A;  5A27 A;  2PSW A;  3DR6 A;  1YLE A;  1GHE A;  2D4O A;  1VKC A;  2ZXV A;  2Q7B A;  4UA3 A;  2PDO A;  4QUS A;  1Q2C A;  4GS4 A;  3TT2 A;  4KOY A;  2G0B A;  1SQH A;  4H6Z A;  4QBJ A;  4ZBG A;  3EFA A;  4NEX A;  2G3A A;  3GKR A;  4KLW A;  2B4B A;  4JJX A;  2YND A;  3E0K A;  2JLM A;  2DPS A;  4CS0 B;  4C2Z A;  2FS5 A;  5KTA A;  1ON0 A;  4MFP A;  5F47 A;  1LRZ A;  3EY5 A;  4XPD C;  2VBQ A;  2KCW A;  5JPH A;  3C26 A;  4UWJ A;  4JXR A;  3D2M A;  4CAV A;  2D4P A;  4B10 A;  4E8O A;  3IWE A;  4KS9 A;  2EUI A;  2B4D B;  1B6B A;  4UFX A;  2HUZ A;  4HNW B;  1XMT A;  3R9F A;  3F0A A;  1RXT A;  3A9L A;  2H5M A;  2O28 A;  4KOT A;  4UCM A;  3P2F A;  2Q0Y A;  3T9Y A;  1YR0 A;  3TFY A;  1FY7 A;  4XPL A;  4R9M A;  4B5P A;  4MY0 A;  3EC4 A;  1QSN A;  2QML A;  4HKF A;  3TO6 A;  1XE4 A;  1M4I A;  3DR8 A;  3IWG A;  2PR1 A;  1M4D A;  4MFZ A;  1PUA A;  3SXO A;  2OB0 A;  2AE6 A;  2Z10 A;  4NCZ A;  3S6F A;  3F8K A;  2DPT A;  3S6K A;  1YVO A;  2NMT A;  1I21 A;  4R3K A;  3GYA A;  4FD7 A;  2B58 A;  1NE9 A;  5CNP A;  1Y9K A;  5DWM A;  2REE A;  2J8M A;  2FSR A;  1CM0 A;  2BSW A;  2FL4 A;  3R95 A;  4CYP A;  2I79 A;  1I1D A;  2GIV A;  2OZG A;  2R7H A;  4A2Z A;  2Q4V A;  2PR8 A;  4BMH A;  4CGL A;  4IUS A;  3R9G A;  1UFH A;  4B14 A;  5E96 A;  4F0X A;  1P0H A;  2Z11 A;  3VWD A;  3T90 A;  1MJA A;  2CY2 A;  5G20 A;  3IGR A;  2P6G A;  2CXA A;  1Z9U A;  5GCN A;  2GAN A;  4KOR A;  5DWN A;  4QVT A;  3FBU A;  1MJB A;  2J8N A;  2IL4 A;  2QIR A;  1XIX A;  4KOW A;  5A28 A;  4F0Y A;  2FT0 A;  2PRB A;  5HH1 A;  4MFK A;  3FXT A;  1MK4 A;  4PV6 A;  2B5G A;  2ARH A;  1M1D A;  2ZW7 A;  3G8W A;  5G21 A;  3H4Q A;  2GE3 A;  1PU9 A;  1RO5 A;  2P6E A;  2JDD A;  2K5T A;  2R98 A;  1XEB A;  1YX0 A;  4X5K A;  4C2Y A;  4KUB A;  5BWA B;  4OAE A;  4DNC A;  3B8G A;  3RYO A;  4KUA A;  4KVX A;  4FD4 A;  3TOA A;  2ZW6 A;  1IYK A;  3ZZI A;  1KUV A;  2VI7 A;  2WPX A;  3TCV A;  5F49 A;  3D3S A;  4XNH B;  4U9Z A;  3K9U A;  5JQ4 A;  3MGD A;  4NXY A;  2JEV A;  4MHD A;  2F5I A;  3DNS A;  4JXQ A;  2Z3O A;  5KTC A;  4M3S A;  5FVJ A;  1S3Z A;  1S7N A;  5F46 A;  2CNM A;  1Z4R A;  4AG7 A;  4CYO A;  1S60 A;  1B87 A;  4KVO E;  1ZO0 A;  1MJ9 A;  3DDD A;  3JVN A;  4QC6 A;  4Q38 A;  3PZJ A;  4MY3 A;  4LUA A;  2P0W A;  3FIX A;  3WR7 A;  4R3L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...