2HB6A

Structure of caenorhabditis elegans leucine aminopeptidase (lap1)
Total Genus 174
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
174
sequence length
489
structure length
489
Chain Sequence
TQVLVRNGIQAVGDGLTSLIIVGKKSVLKNVTFEGKFKEVAQKFVTDGDSWNSMISRIPASGRHPLHYELAHLITVPDASSRGNTPTNAHSIYKELKPINYPEDTKNVHFVLFAEYPDVLSHVAAIARTFCKFSMKTSGIRELNVNIDVVCDKLTNEDAVFLTDLSESVRETARLIDTPANILTTDALVDEAVKVGNATGSKITVIRGEELLKAGFGGIYHVGKAGPTPPAFVVLSHEVPGSTEHIALVGKGVVYDTGGLQIKTKTGMPNMKRDMGGAAGMLEAYSALVKHGFSQTLHACLCIVENNVSPIANKPDDIIKMLSGKTVEINNTDAEGRLILADGVFYAKETLKATTIFDMATLTGAQAWLSGRLHGAAMTNDEQLENEIIKAGKASGDLVAPMLFAPDLFFGDLKSSIADMKNSNLGKMDGPPSAVAGLLIGAHIGFGEGLRWLHLDIAAPAEVGDRGTGYGPALFSTLLGKYTSVPMLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Leucine aminopeptidase 1
publication title Crystal Structure of Caenorhabditis Elegans Leucine Aminopeptidase
rcsb
source organism Caenorhabditis elegans
molecule tags Hydrolase
total genus 174
structure length 489
sequence length 489
chains with identical sequence B
ec nomenclature ec 3.4.11.1: Leucyl aminopeptidase.
pdb deposition date 2006-06-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00883 Peptidase_M17 Cytosol aminopeptidase family, catalytic domain
A PF18295 Pdase_M17_N2 M17 aminopeptidase N-terminal domain 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10590 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Zn-dependent exopeptidases 2hb6A01
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 2hb6A02
5LYLA 2ZEPA 3IWWA 3D7DA 1CX8A 3RAMA 3ISZA 3B2YA 5JGFA 3KZWA 4ZI6A 3CT9A 3HUVA 4K3NA 4P4IA 5J1QA 2AFSA 2VL1A 4EMEA 1Y0RA 4RUHA 2PRQA 4CPAA 5D29A 1CPSA 1FNOA 4NGQA 3SJXA 1VGYA 4F8ZA 2PJ4A 2PJAA 4MHZA 3GUXA 2F8HA 1Z8LA 3B7IA 4A94A 2ZELA 2Q43A 1TF9A 3NH5A 2OOTA 3KR4A 3SJEA 4H2KA 3PB6X 4PPZA 1HEEA 3WC7A 3FMCA 2GU2A 2NSMA 2PCUA 3FECA 2QYVA 1TKFA 2ANPA 3HLPA 5DS0A 3NA6A 3VH9A 4DYOA 1DTDA 4OC5A 1GYTA 3MN8A 4AXVA 3D68A 3WC6A 2PVVA 3GLJA 4P4FA 2AFUA 4MCRA 3SI2A 2PE3A 2EK9A 5HVGA 1BLLE 5THWA 4MCPA 4Z65A 3B3VA 3QNVA 4UEZA 1F57A 5I4MA 4MRIA 4P4DA 3B3TA 2GLFA 2CIJA 2POKA 3KQXA 5CBMA 3PB4X 3IIBA 8CPAA 4DUKA 1YMEA 3FH4A 4A38A 4P4JA 4F9UA 1ZLIA 3FJUA 3IEHA 4NFRA 1VHOA 4NJRA 4R76A 3S9LA 2JEWA 2ZEHA 3LMSA 3JRUA 1BAVA 3SJGA 2GREA 4ZY1A 1PCAA 3CDXA 2OR4A 1VHEA 2WZNA 3DGVA 3RBUA 2G9DA 4JYWA 5LRGA 1AMPA 1H8LA 4X2TA 1LCPA 3B3WA 3FEEA 2C6GA 4DJLA 3L2NA 3BI1A 2NYQA 1IGBA 3PB9X 1CP6A 2PJ5A 4FAIA 4OC2A 3S9NA 2RB7A 3IFEA 3V7ZA 3FF3A 2PJCA 2BCOA 3SI0A 4OP4A 4PXBA 3PRTA 4LQGA 5HVFA 2HB6A 4NJQA 5K8OA 3IO1A 5K8PA 4R7MA 3V38A 1Q7LA 1LFWA 2PIZA 1TXRA 1XBUA 4W9YA 3BI0A 4P10A 4OC3A 2XEIA 2ZEFA 4GM5A 4R6TA 3D67A 4IK2A 2PJ3A 5D8NA 4ZX8A 1YW6A 2IQ6A 1XMBA 5IB9A 1HDQA 2CTCA 2BOAA 5LYDA 2J9AA 3TC8A 3H8EA 4NGRA 4G1PA 2V77A 2HC9A 1R3NA 3B3CA 3MRUA 5F09A 4NGTA 1TF8A 1UWYA 1RTQA 1ARMA 1LANA 1QQ9A 2AFXA 2PJ7A 2Q51A 3KQZA 4O23A 1HDUA 2O4HA 3BHXA 1FT7A 3TX8A 4OIDA 1YSJA 2ABZA 3WT4A 4Q7AA 4X8IA 5LRJA 3IC1A 2PJ8A 4UIBA 3NH4A 3PFEA 2JBKA 2ZOFA 1DE4C 2QVPA 1TKJA 2C6PA 1ZG8A 3PB8X 4ZY0A 2PJ0A 1CPXA 2V8VA 3D7HA 4MHYA 1XJOA 4TNUA 2AFMA 1BPMA 2V8HA 1XFOA 2PIYA 2RFHA 4OIWA 3PBBA 3D7GA 2ZEEA 2JBJA 2EK8A 2GLJA 1IY7A 1PYTB 1ZG9A 5HXDA 3KI9A 4P4BA 3IJ3A 4EWTA 1F2OA 1JQGA 3PB7X 4FWUA 2ZEGA 4A37A 1R43A 1Y7EA 2PJ9A 2BO9A 3D66A 3LWUA 2PJBA 4UIAA 2CF4A 4F9VA 1KWMA 4R8FA 1OBRA 3PFOA 1ZG7A 3D4UA 2V8DA 2O53A 2XEFA 4ZX9A 4IHMA 2IMOA 3KHZA 3ISXA 1LAMA 2ZENA 4OC0A 3KASA 2F7VA 5LRKA 3RZAA 4NGNA 2WYRA 3H8GA 4MCSA 1F2PA 4MCQA 4MXUA 1YLOA 2AFWA 2CTBA 1ZLHA 2AFZA 4OC4A 1CBXA 2XEGA 5HVHA 3GB0A 2IJZA 4UF4A 4TWEA 5JH9A 3D7FA 3B35A 7CPAA 4EFDA 2C6CA 4UEFA 2FVGA 3I1UA 1QMUA 3H8FA 3SJFA 3FEDA 2ZEMA 3B3SA 4NGPA 4PXCA 2PVWA 4ONWA 2AFOA 1XRYA 4YU9A 3K9TA 2C1CA 1Z5RA 2DEAA 5ELYA 1Z2LA 1NSAA 2ZOGA 2PJ2A 4MHNA 1LOKA 3FVLA 5LYFA 5LYIA 2Q4ZA 3KL9A 4P6YA 1EE3P 2EWBA 4NGMA 4WJBA 5CPAA 2I3CA 2PJ6A 2QJ8A 3FX6A 1ELMP 3SI1A 1CP7A 1M4LA 1TKHA 4IAVA 4P4EA 1ELLP 1CG2A 3WABA 3KHXA 4PQAA 4PXEA 5K8MA 5K8NA 1ARLA 4FUUA 4P45A 4PXDA 3BXMA 3T8WA 4OC1A 4B6ZA 4WWVA 1YW4A 3VARA 3NFZA 2ZEOA 4BD9A 4OMEA 3K2KA 4ZY2A 3CPXA 4P44A 1Y0YA 4NGSA 3CPAA 4OKOA 4MHPA 3NH8A 3KR5A 4ZYQA 2V8GA 4KSIA 4A39A 4MMOA 5JM6A 3DLJA 1LAPA 4YWYA 1AYEA 3S9MA 4X3RA 3PBEA 2XEJA 3N5FA 6CPAA 3WC5A 1VIXA 3KGQA 3PEIA 4JZ0A 1BPNA 3VATA 4UEEA 2PJ1A 2ZEDA 4FBEA
chains in the Genus database with same CATH superfamily
3I01A 1QQTA 3SXOA 4DNPA 4P4LA 4RZSA 3FUXA 1X74A 1QNLA 2C7PA 5CX4A 3UB2A 3PQ8A 5LP6B 3T94A 3FTPA 4LHEA 5J43A 3RBZA 3MILA 4K28A 4ITVA 4XASA 1AE1A 4A0RA 1SHLA 5FWNA 2ZRJA 3B7IA 2NT4A 3HACA 2GMWA 1RWBA 3EVCA 4XIGS 3I3GA 2BFOA 3TX2A 4POOA 1OTYA 1IEQA 1C5KA 3HB7A 3P2YA 1L5MA 1H0SA 2QQ5A 2D7DA 3AQIA 4W1RA 3DT9A 3WYFA 1ZXXA 4I49A 2IFTA 5J9FA 3BPSA 4CN9A 1LK0A 3FTEA 2DRIA 3CKLA 4F0XA 3TLBA 3QBJA 1LC3A 4PIMA 3MGBA 2QM0A 2FNAA 5L7WA 5E2BA 1B43A 3OJCA 5F7ZA 3VPHA 3MBIA 2SICE 2R6DA 2PU7A 3ZIAA 1RE0A 1XD2A 4NJRA 4KGVA 2VSOA 1C3EA 4RSHA 4FCVA 2QPLA 1XOIA 3SJGA 1FQKA 3VKVA 4EO7A 3COZA 1NF8A 3AVUA 1B0AA 4WLEA 3SYRA 1IHXA 3UWPA 1V1RA 4DJ5X 1RPJA 2BFWA 4D6PA 3A58B 3DBLB 5JDCA 3S9NA 2JJ8A 3GMTA 3T7KA 3ACBA 3UJ9A 1O6FA 1EX7A 2BEWA 1YZFA 5CLQA 2IW3A 1VIDA 1XDGA 1OAAA 1DWQA 1UBFA 5DHQA 5LD2B 4HN9A 2GXSA 3F8TA 1GA1A 3ANTA 4Z4QA 1CR2A 2YJTD 4NAHA 1Y3FE 1D6SA 1ELOA 5LZ4A 5E9JA 4WZAA 3SS8A 1ZBDA 1OXSC 1C30A 3D8PA 1P0CA 3UIEA 4X84A 2X4DA 2P9BA 2P4HX 4GOOD 3BOSA 4L0DA 3SHOA 1H22A 3SD7A 3WWZA 2YWCA 3NDRA 3BHXA 4CIAA 1REQA 5LRJA 1DBSA 3RH0A 3BK2A 3OCZA 2FPIB 4E6EA 4A2QA 4B12A 2XODA 2DFPA 1QSRA 4U7PB 1M1YA 4B5PB 3O8DA 4GM4A 4WCVA 1L4FA 2ZWPA 3ENQA 5FFNA 3GLFB 3MJSA 2DOKA 2FWRA 1KE1A 4QUSA 4TKUB 3AV0B 2GZDA 2X0DA 4AY6A 4KOXA 2VWPA 4JXZA 4EY8A 5G3ZA 4XUCA 4UDYX 1GPJA 4L73A 4B8WA 3ZWVA 1N92A 1EJBA 2IIPA 1UMKA 2HK6A 3IHWA 3FWHA 3P1JA 2HSWA 2BR5A 4GE0A 2ZIFA 1F2PA 3WKEA 3LY9A 1RQPA 4JB8A 2GFIA 1E94E 2XEGA 2C0CA 4Z2AA 3RRMA 4YRZA 2NSJA 1OAKA 2X8AA 2JC3A 4IDFA 3WQRA 4FYVA 3K53A 3FKSD 5BVGA 1YGYA 1BCRB 1LA2A 2FKAA 1BFDA 1XO1A 1MO6A 13PKA 3FTDA 4M1TA 2WWGA 4ZT4A 4GLLA 1RAAA 2YIDA 1XZDA 1Z5UA 1GD1O 3TFYA 4IQ0A 1TUGA 3AJ8A 4ZKDA 4YUAA 4H77A 3TQIA 4FEYA 2GM9A 4N4AA 5DJ5A 4R81A 2GT1A 1DJPA 3GARA 3TFWA 2HH9A 2W4MA 4OMEA 5EWLB 3QPBA 2OUKA 4LEIA 1B23P 2W8ZA 3T5PA 2VTVA 3W4JA 3RSHA 4QC6A 3VU3A 1W75A 3WMWA 3I9MA 3HV2A 3Q87B 2G6TA 3TTXA 2EGUA 2AT1A 2QL6A 4XPDB 1SBCA 5DTQA 3IEIA 1JRLA 4MS3B 1EFAA 4F6RB 1PQ4A 4HAYA 2XNSA 1KO4A 4BQPA 4DJAA 2JGJA 3OCCA 2ZEPA 4PYJA 3R7NA 1G63A 1OBVA 3WFZA 3L4JA 3QW4B 3CRNA 2FOIA 4R69A 1QIJA 3CVWA 3OOWA 1E1RD 2IXDA 4MCIA 4PSDA 4RLHA 1R8QA 1M76A 2PLAA 3HKBA 4H7KA 3CZPA 4AG9A 4V38A 2E1RA 4A0GA 3A11A 1JFVA 1XRRA 3F6YA 3VBEA 4DUYB 4YLYA 1F0PA 1PHRA 2X9VA 2O8CB 3H3FA 1XF1A 1MO5A 2PZMA 5HM8A 4PTLA 3TOSA 1RC1A 1KFEB 1SBQA 1TEHA 4B5KA 5CFRA 4MV3A 1ONBA 5GWXA 2RHCA 3BF8A 4YMLA 3AGPA 3DDCA 3EGOA 3OQMA 2R66A 4RMGA 4MYHA 4MJ7A 2B4BA 2AEMA 6REQB 4BJ5A 1HGXA 1OA1A 1CUAA 3IEHA 2OHIA 4HH4A 3KB1A 4OFBA 1CF9A 4WI1A 5DXFA 3IQGX 1Z7EA 5BSMA 1GYPA 3CR3C 4QGBA 4AB1A 3ZBTA 4M36A 5LSAA 3H5AA 2SKCA 1R9JA 2DUMA 1KH2A 1MTZA 5KWIA 2JKZA 1A9ZA 3TTTA 2ADFA 2JLVA 3HJCA 1OH7A 1BOBA 4OC2A 1CZRA 1QGED 3UMMA 4JU8A 1UT5A 4R3UC 1FDWA 1KO5A 2X9QA 4NE2A 4G24A 3K20A 2O8EB 3EZ6A 3FZGA 4BP9A 3OM8A 4W9YA 1ICEA 3RYHB 3GC6A 2Z2KA 2Y1KA 5HGJA 4P1ZA 2ZW7A 2CDAA 2E6UX 4E5YA 3AEZA 3KYIB 3DQZA 4XUGB 4O6VA 4UPDA 1U4OA 4O4JB 5JOQA 4G5QA 1Y1SA 3O9VA 3X1MA 3QOWA 1KQNA 3ZDYB 4TUYB 2WP8J 1L6RA 1YR2A 5HH1A 5FI0B 1T3ZA 4BNYA 4OIDA 3NHYA 2IZZA 3B7WA 2CB0A 4EI2A 1ZQ1A 4PQGA 4LJKA 5JBQA 4D9FA 4I19A 1F51E 2B8JA 3SIXA 1PFYA 3I04M 2BFEB 2WTBA 4QASA 2RC4A 1E9CA 3SJZA 1JHPA 3FFTA 5AVQA 2ACEA 3RAFC 1F2OA 3NIGB 1T4CB 2J0UA 3X2EA 1OWMA 3IDQA 4CM1A 3LDUA 1LDGA 1KYYA 1E62A 1OIXA 2FN7A 2GVDC 3HC7A 3RJ5A 4UIAA 5L7TA 1DJNA 2PBLA 4A6DA 4PZPA 4ER7A 2PKYX 3WIEA 1O3YA 4BATA 4BVHA 4ZOLA 1SC1A 1DC5A 1EUYA 3U80A 3FVWA 4P3OA 1NVAA 4WGGA 2GXAA 4DJTA 3PA8A 1W5TA 4ALNA 5LZ9A 2HMTA 3G8AA 4PW0A 1UQRA 4DCCA 2YQ4A 1QR6A 3GJTA 3WWEA 4BFWA 1EP3B 3BZUA 2G25A 2CMFA 2WHRA 4XCQA 4OATA 4LECA 4KLRA 2FPGA 2REXB 3KQUA 2XI4A 3KEMA 4ARVA 3O93A 3A6JA 5DK4A 3ROFA 3OZRA 1ZGZA 1T1RA 2ZRKA 1B93A 1O03A 2R86A 3ETLA 4ZCSA 1JDUA 1C1XA 4B2LA 1YZ3A 2G5TA 1M5RA 2JFGA 4DLXA 4D0RA 4PG4A 1SD2A 1I33A 2FMIA 4XX0A 4DANA 4I3GA 2XGOA 1S9HA 5HPYB 3ORYA 1DG1G 3KD2A 3EVBA 4YJFA 2B4AA 4YRQA 1OC4A 1R27A 2ZIXA 4YY3B 3HABA 3WK9A 4D3YA 4PX5A 3P8ZA 1M1NA 5BSEA 4QO8A 2YZGA 4DSTA 2Y0EA 3I32A 5JSZA 4JEHA 4FGLA 4ZOEA 4F2GA 5AVSA 4ZAFA 2JFNA 1IXSB 1VL6A 1SOWA 3IDSA 1Y3BE 2HIHA 2QQ0A 3HWX1 3TL2A 2W2KB 3AHIA 4MP6A 1PNQA 2VBQA 3V2IA 1YHYA 4E2FA 2A9PA 4DR6B 4Y18A 3D1VA 5AKLA 4NGQA 1A9RA 3AEXA 2UZ1B 2AWOA 2QMLA 3OLZA 4HMQA 1NASA 5JH7F 4FFVA 1VDZA 3D0KA 2FMXA 1LI4A 4UZSA 4LDRA 5A0FA 3IRVA 3JU3A 4Q3CA 2F8SA 1FCJA 2JASA 2FN3A 5IJ0B 3DPSA 4KU4A 1WXHA 4UUQA 1O6CA 5LMUB 3JS5A 1KA9H 4EB0A 1HFEL 1EFPA 2X76A 2V4UA 2Z08A 3F3MA 4Z65A 1YDHA 5LR6A 2D2EA 4OVKA 1RYBA 3LLCA 4A4DA 5CB6A 2HA6A 4UM7A 1Q11A 1XRLA 3DFMA 3DXFA 1U2GA 4U2DA 4C05A 4KDEA 3NVDA 1S2IA 4BMPB 4QJ3A 3GG9A 3CN7A 1Z5OA 3PWTA 2YFQA 4PX3A 1MVLA 4NFSA 1F0YA 3TOZA 5AK0A 3VU9A 4U7FA 4ZI2A 2A5YB 3TFQA 1UEXC 3IMKA 2OAQ1 5G2OA 3KE8A 3C8HA 4DAOA 5EUMA 1VI5A 5UKDA 5D51S 4O8CA 2AMVA 3DVLA 3CX6A 3BJ8A 5KX5F 1DIGA 2PYZA 3TE4A 2G88A 2ZYVX 2AQHA 4X0EA 2J5QA 3MRSA 1IY0A 2YY5A 3CEJA 3UXHA 2VPIA 4RNCA 3RC9A 3GGGA 1KS9A 1LSJA 4M3NA 1NLFA 1W29A 4EY4A 1H2ZA 1KOLA 5BUZA 4XWOA 5ABPA 3VKFA 1YRBA 1KJWA 1KJNA 5JAPA 3RHZA 2HLHA 4QYMA 3CPEA 4JGIA 3B1VA 3OIWA 5IT0A 1YE5A 4RY9A 3B60A 1G2QA 5BY2A 4DSUA 3UTCA 1EWVA 2A86A 4EBFA 2CNDA 2MCFA 3BWDD 3BWXA 2H08A 1P44A 2XCTB 1ZD9A 3CO5A 3CJQA 3PBBA 2VZ8A 5AM1A 1CQIA 2VT7A 3JQ9A 4FX5A 1XMOB 3PICA 3I34X 2ZSHA 2O48X 4P31A 3TSZA 3M4JA 4YGOA 4M0LA 2ODBA 4QFBA 4F3CA 3TW4A 3G0HA 1WG8A 2ETXA 2DKNA 4PK2A 4HF7A 3R40A 4XAQA 5EPEA 3PHLA 4NRDA 1FFXA 1IJKA 3QUBA 3ZU4A 4XD2A 1EXDA 4D9JA 2FW8A 3AL0C 3HFSA 4JSRA 3WAJA 1ZRNA 3T35A 1XL0A 2K5TA 2BUBA 4PGAA 3B3SA 1NPDA 3RC2A 4QT4A 2AXEA 2X6QA 1JQEA 2R3SA 5KKNB 2XMBA 2GHRA 3TR5A 3OESA 2OCLA 1V3QE 3DMRA 4FKZA 1NR1A 2WEKA 4Y0VA 2CDNA 1GDDA 2EFYA 2D1YA 4DIBA 4JLYA 3MHPA 5JZBA 1LSSA 1RWKA 4XGKA 4F5EA 1NVDA 2PZGA 5D5HA 1YS9A 1NMQA 2JGKA 5JS2A 4KQXA 4BNLA 1IN7A 1COWA 4J16A 1GITA 3A10A 4UJ3A 2H1CA 2QTFA 3WNZA 5L53A 1J21A 3VR6H 3MS7A 3S9MA 1SVOA 3ZD7A 2OCBA 1WCV1 3C5VA 2QTVB 2Q3HA 4H08A 4BCDA 4JROA 3RJZA 3H6GA 2ZTVA 4UAJA 3HO8A 4NG4A 3W2TA 3B2EA 4HRYA 1FNBA 1L5SA 3D4IA 5AW7A 3L8GA 4AUMA 1TMYA 4EFLA 3K9GA 3GVIA 5LA6B 3H5OA 2Q4YA 4MMYB 4IEIA 4R68A 4OOEA 3QF4B 1VMEA 2PVSA 3UF0A 2IH4A 1EVZA 3AKEA 3OECA 3USCS 2HDWA 2FFBA 5EIXA 3Q3HA 3NH5A 4LW8A 3WWCA 3A0UA 4M8SA 1Z0AA 1AZWA 1H8EA 1MT0A 1MX5A 1NNI1 5LXTB 1L1EA 1PJRA 1D2HA 1FU8A 2AFIE 3N8KA 3DBOB 4F5YA 4J6FA 4WA8A 1QYXA 3NAMA 1THTA 3W2HA 4TLDA 2QI9F 5FH9A 1U7HA 2YYYA 1QGZA 1Y5LA 2PAFA 3IQHX 3H65A 2NTNA 4KBGA 2JPDA 3UY5A 3P7MA 4G1EB 2O7SA 4W8OA 5HVNA 3P45A 5FXMA 1RPTA 2PYDA 1T2FA 1U2EA 4YMIA 2Y1CA 5CM9C 5IRCD 3V48A 5EJGA 1E32A 1D1QA 4DLBA 1XTQA 4H0CA 2VQ6A 3A4TA 4QIHA 2IUEA 2PEZA 1HQCA 1L5ZA 2WJHA 4RIGA 4YUWA 2ZXFA 3RJ9A 2DQZA 1ZH2A 1GZSA 2V8OA 1EI9A 1E2PA 4RKWA 5EHIA 5EQTA 4CR6A 4EATA 3KU1A 4IFTA 2PVPA 3A6PC 2O4UX 4CIYA 3FNRA 3RUDA 1SVKA 2WIKA 3VAYA 4O2AB 1HEYA 5K8PA 4FHFA 1AKTA 1R9NA 2F62A 2PUWA 1SWVA 2HU5A 4MFJA 4E21A 3V8QA 5I9TA 5BSWA 1QU3A 5TY0A 4HPSA 1IYZA 1YE8A 3PDCA 5EP4A 5L4LA 2NTVA 1ECJA 5JJKA 2FWMX 1LTQA 4XUDA 5I5GA 4JLUA 1R57A 4KLVA 4RJTA 4RLFA 2FZ4A 2CXSA 4X00A 4IX9A 3ITDA 4B7ZA 1IAVA 1X12A 2PJ7A 2GCIA 3MAGA 3WT4A 5DHRA 3TF5A 1FTWA 1AD2A 1HMYA 3IQEA 3E2PA 5E2AA 3WB1A 4EMBA 1ISJA 3TTWA 3E27A 3FZEA 5BWCA 6NULA 1T0JB 3T3MB 5JANA 3MD0A 4Q9IA 3ZLBA 2WDPA 2CNNA 4OSEA 1M6VA 1TTHA 2QD1A 1PNTA 1JVSA 1BMTA 1HLPA 1R0KA 5GJWC 4H7IA 1W0JA 4IIJA 1UIMA 4ID3A 2HBQA 2OGZA 1A2OA 1N0VC 4BE7B 3BDIA 3IULA 4LYDA 3LSYA 4EJSB 4Z2YA 4R41A 5IBCA 1IY1A 1OLOA 4XB1A 4MXUA 3RRZA 4OLBA 2CFTA 3NHRA 5ESWA 2WZQA 2W6PA 3KKMA 2PT7A 3LMKA 1Y4ZA 4UFXA 2VDVE 2R6HA 3GAZA 4XIIA 4XRGA 2DHEA 2C6CA 2FVGA 4GMGA 4R4JA 1QMUA 4OGFA 3CUSA 1HT3A 1Z2AA 5G4KB 4Y2XA 3WDMA 4KFTA 4D4HA 2HU2A 4XM1A 4MKHA 1E1KA 1WLYA 2ZPUA 1IBMB 4CKCA 3P0JA 1GPUA 4JJZA 3HXPA 1EWKA 1GNLA 2PSSA 3VRHA 3NETA 4LHZA 3OF3A 3PQEA 1NY5A 1TJ5A 2G07A 4JUBA 3ICPA 4GOJA 4YB8A 1E64A 3PQ5A 4NOLA 4DQXA 2ZAYA 4UD6A 2C4WA 4ZQBA 1XTVA 3S27A 1C7JA 3TTSA 3UGJA 1R0CA 4RPIA 1WTAA 3MTQA 2F64A 2Q04A 3L5OA 2QRZA 3ZKWB 4DEYA 5L3RA 4NXNB 1N3YA 3N8HA 4JBIA 4X3RA 4LA4A 2HRRA 5JQGB 4DV3B 4Q9NA 3N1UA 5B7PA 4QHSA 1P2UA 3NHZA 3OCVA 3O2QB 4GMHA 3CU5A 1FRQA 1SB8A 4KDFA 2V6MA 3AXTA 2BY4A 1KZHA 4YAIA 4HZGA 1H0HA 3AR9A 3BMCB 4RK6A 4AECA 3AV3A 1JS1X 1PO7A 4QLBA 2IRWA 5KVVA 5LBTA 1LKZA 2JAOA 2XA9A 3VHLB 2PX2A 3DP9A 1T2UA 2ZEJA 2ENUA 1QH8B 2WWWA 1MT3A 4RXTA 1TF9A 1JU9A 3CXRA 1Z45A 4RK5A 4YWHA 4IS3A 4Y2TA 5TE9A 1FFSA 4UHFA 3TO9A 1CB0A 4PVDA 3IQFA 2VJMB 4MRMB 3QELA 3FW1A 4RZHA 2QYHA 3L3BA 4HWOA 2EX1A 2A78A 3U3OA 2ZIAA 2Q27A 2ZQYA 4BX3A 1WXEA 4AUKA 3LT5A 3PT5A 5DH9A 4IOMA 4OJTA 1YVRA 4L4ZA 2QG4A 4UQLA 2LKDA 1EJ0A 3CYFA 1H2FA 2H00A 3E05A 1RJWA 4CLEA 2A58A 1NVGA 2EX0A 2BWJA 3NHWA 2CMGA 4ECEA 2QIRA 4C0LA 7REQA 4MLDA 1UUFA 1EG2A 4EG4A 2ZYTX 1W36C 1UQUA 4EA8A 3UBMA 1IATA 2D0DA 3RS9A 1VIVA 2HBYA 5JNRA 2J46A 2MYUA 1QYDA 4IMRA 3G9UA 4FAIA 3WZLA 2ZJYA 3E1GA 4B2YA 2NV6A 4K03A 1JG6A 1ODKA 5ALHA 4PQEA 4FMBB 5DI9A 1YQXA 4GUDA 4XPLA 4LGYA 2ODQA 1JN0A 3SQMA 4K5QA 4R7MA 4ZV9A 3HE3A 4XRRA 3KZCA 1P2FA 1Y9JA 2C4UA 4BCBA 5CYOA 2O3JA 3FZQA 3KJQA 3OPYA 3JZAA 5IB9A 3NTRA 4DCPA 1VHDA 4HNAB 4LKRA 4D57A 2BGNA 3O4FA 2EDCA 2AQ8A 2CGEA 2HRZA 1W581 2EBUA 4P4UA 4M6WA 4XPIA 2P3LA 3QG5A 2Z3NA 3IRUA 4NDAA 2F3TA 4RACA 3SLKA 1X7DA 3PX2A 1R5NA 3MCUA 3SI7A 1SHJA 3SVTA 4MK4A 2UYCA 2QVPA 3SP1A 2I33A 3NGLA 2BDEA 1H65A 4I46A 3OKAA 1K6JA 3IP9A 3AVTA 3D3EA 2VJNA 4ESVA 4MV1A 2UXDB 2NZJA 2V1UA 2PIYA 3LD2A 5HQ3A 5K4HA 5CW2A 3O0TA 2PYIA 4GL4A 3H84A 4P4SA 1R2QA 3NP7A 1KC1A 4P81A 3NH9A 2A88A 5HK9A 4YACA 1PFKA 2VI5A 5FQOA 4PNZA 2BLNA 4DXDA 1TXGA 1LPMA 2O7QA 3RSGA 3W6ZA 2X0FA 4ZMBA 2X3UA 1EUDA 3H2SA 2ZRQA 2FX5A 3EC4A 1U0RA 3IHTA 5H80A 4FIZA 3NCTA 4LYYA 4XQGA 3B5EA 2FZKA 5FWXA 3KEQA 1OKKA 1J49A 4UEFA 2Z4TA 1SPBS 4S2EA 5LYJF 3PTAA 2I9KA 2Z0ZA 2AFHB 2MU1A 1OROA 1JMKC 2FWBA 2C1CA 3T4PA 3DWIA 5CVTA 2DY1A 4JI0B 4Q3AA 2L18A 3ED1A 4GPD1 4L8YA 3W8EA 3CZCA 3OT4A 5LQSA 1PWEA 3QOFA 4OX9B 2NO6A 4HGPA 2GPWA 1LI5A 2IA5A 4NS4A 1TZJA 4R16A 4JI3B 4Q3EA 4ZQIA 3VZCA 4CMJA 1I1NA 2JKYA 3I9NA 3GBVA 2BGGA 4KQIA 4KGDA 3ZTTA 3JQCA 4CAEA 3VI4B 1SA0A 1EE2A 1E2LA 1HE1C 2OV8A 2O8FB 4ZYZA 3UUGA 5CCDA 1TM3E 3BXFA 3RVMA 1BWPA 1KAEA 2OV6A 4JLBA 5HNKA 2EQBA 4YAJA 4UXJA 5G1OA 3N3AC 4TV9A 4Z1MD 4ZI6A 1I2ZA 4GXRA 4MQUA 3F7MA 3VH2A 3TPZA 3RVOA 1YR6A 3PE4A 2VWGA 1CPSA 5KTSA 1YZNA 2HA7A 4I4TA 5K01A 1MB4A 2DQ4A 3BREA 5DNWA 1S3IA 3U1BA 4O3FA 1Z75A 2JZNA 2HWUA 4RUKA 2IU0A 2QJRA 2QXUA 4JXXA 3ZWWA 3A26A 3AIOA 2M1XA 4ED9A 4BC0A 1G5TA 4YCAA 3UANA 3DLPX 1AC5A 1WPQA 2GCOB 5AIAA 2BFCA 3IKJA 5H86A 3T41A 3ONEA 4JXQA 4MKGA 1ZS9A 2ZSJA 2H7CA 2VSQA 1IZYA 1V8FA 3PKZA 2BKAA 4ZVSA 4JUIA 1HT0A 4F9GA 2W90A 4PINA 1NX6A 2EERA 2BRUC 4YJ3F 2XMGA 3IEVA 1WNTA 2CYCA 4RKQA 2BM8A 3ANMA 3RBUA 3EJWA 2VTEA 4J3JA 4M1YA 3IYLW 3DAOA 1E9DA 4KPUA 4RJJA 1GQOA 1R0LA 4N5MA 4QDZA 4MVJA 3VPDA 4YJ2F 3GT7A 2H2AA 5EJEA 2GUGA 4BNUA 2A0WA 3FFAA 5ULLA 1A2KC 3NVAA 4QE3A 5E7JA 2R25B 2QUIA 1WHTB 1JG7A 3OPMA 1Z13A 5HKKD 1TQDA 2I7DA 3PFNA 4INAA 3F6EX 1V45E 2HV2A 4CEIB 3IR6A 4EHBA 1QH9A 1LNZA 1KI6B 2QR5A 1QSTA 2VYCA 4PWYA 1CFZA 4MUMA 3UK6A 2J67A 1SCQA 5JISA 4GEKA 1XPOA 3S1SA 1M8PA 4RE5A 1BX1A 5LWQA 1P1CA 2QX6A 3ELDA 4M8KA 4LXQA 5AXAA 4V1CB 2J4FA 4FDAA 4MYCA 1ENOA 4TMWA 4Q4HA 1NP7A 1XJOA 4I4LA 3WYGA 3PQFA 3BAZA 3SF8A 4UBRA 1FMTA 1P77A 4KSAA 4XQ0A 1F6DA 3AHDA 2V7XA 1Z2DA 3A6FA 1YFJA 3K30A 4YPFA 4RPHA 1RM4A 2FE7A 1QV7A 1S2NA 4IX1A 2DTEA 3GNLA 3GA5A 3OLWA 2W71A 1E9RA 1NLYA 4C3VA 1BA3A 3O2SB 5JMOA 3E2IA 1FP2A 1GKLA 3QFTA 2QYOA 4M60A 3UYLA 4UEJA 2FB9A 2NG1A 4MCSA 3FYNA 5CEFA 5JJIA 4ZYTA 1U8ZA 1VLHA 2V9CA 1TZ2A 2P30A 1LXCA 1IH8A 3I1UA 1U02A 3AOGA 4KWIA 3I72A 5A0VA 5HIIA 3ZU6A 4ENQA 3V42A 1CWUA 3QFRA 2Q3DA 3C3BA 2KJQA 4X7PA 4NEQA 4DMLA 1JSRA 2XVMA 3V80A 1SNYA 4PG7A 1KI2A 2QD5A 3UHAA 3CR8A 2XVYA 3E7FA 3GLGA 4B6RA 3AT1A 3E58A 1IUNA 1M4LA 4LGMA 4NICA 3JD3A 3RKSA 3CCBA 3EAFA 4P3YA 1YCGA 3B78A 2NU9A 2IEGA 2WP0A 5EE1A 2PE5A 2WWTA 5CVJA 1S8AA 1XX6A 2WUUA 3QTLA 5ALGA 1VPDA 2Y9PB 3P71T 1ADGA 2AFIB 4EVYA 4RKEA 1EK0A 1TYEB 4RO0A 3D6JA 1BHSA 1UKCA 4DDHA 2F9LA 4K9QA 4PVCA 5A06A 2UKDA 4ZQEA 2QX7A 4ARSA 3ZCUA 4HQNA 1OLXA 3SZOA 2CEAA 3IV9A 1VE5A 2MYTA 3OT1B 1NE7A 1EGQA 2JANA 3JAKA 4EO9A 2JJQA 5FYQA 4KLCA 4F2WA 3FSEA 2RK3A 1OHHD 1J0BA 3D3WB 3N2ZB 3GJ8A 4OYYA 1Q2XA 5JTTA 3R7WA 1AY0A 2J59A 2VTDA 3PK0A 1AN0A 4UHDA 4C6SA 1BMQA 4CKBB 1II0A 1B6BA 3NEAA 1WVIA 3FHCB 2V7WA 2VPQA 1VL2A 2VH1A 1XD8A 2VQFB 1H3NA 3PP9A 4HOYA 3NHUA 4KAXA 1G8GA 1WWKA 4BO3A 4HTFA 3ME5A 3LUBA 4DKXA 3I2HA 4P83A 1JBEA 3OWHA 1B16A 2PJZA 4FEEA 5C8DA 4BVAA 4LCEA 1ZVJA 3PDHA 2W0SA 1JR3A 4C30A 4BDSA 1MZVA 1Q95A 1SUEA 3DM9B 1Y7PA 3R6WA 1W87A 3X2FA 4OAEA 3IIMA 4UCNA 3EDYA 2PCLA 2BHSA 2ZXEA 2HF2A 5EN4A 2X14A 3T4XA 3LZ6A 1WPGA 4KHPB 3G7SA 4QJ4A 3KHSA 1D2GA 4NCBA 3FNEA 2OM2A 1UK9A 3W8DA 3TXXA 1DHTA 1ZEJA 2IS1A 3R5KA 4HEA1 2Y1EA 4I6EA 2ZVDA 1YDEA 3PRTA 5HVFA 1P62B 3LF1A 2P67A 1I80A 4ZAYA 1X10A 1W59A 5FOQA 5JO9A 3VX3A 2CWWA 1L7EA 5HRAA 3LQFA 4IDNA 1E58A 2ZJ2A 4BZZA 2C77A 3D8SA 4MXDA 3S2UA 3ONFA 3CW2A 3GUVA 4OXIA 3U19A 2YNMC 3NBMA 4K9LA 4MP3A 2R1TB 4BX0A 4ADSG 1M3SA 3I4CA 5A5DA 4B6GA 5JIBA 4YAKA 1JXQA 2E5WA 4V2IA 3FBUA 2BEIA 3F9CA 2INGX 1T9KA 4LRYA 1J20A 4MOWA 1FUEA 4MHYA 2IYFA 1T9GS 1CULC 4PGMA 3OOEA 4TLBA 3CXQA 3DW1X 4KXYA 3IXMA 2O3QA 4BWYA 3TSCA 2DBRA 3OJFA 5D00A 1QX4A 4LQDA 5KQMA 2XTJA 4PHTA 4WGFA 4ZCPA 3BTVA 2IPOA 2J9FB 3R0QA 2J85A 2VLBA 1NFFA 4MEAA 1J1IA 1OZHA 4JGBA 1D2AA 3NDJA 1JQ3A 1N6PA 2HSDA 1V7QA 4PAGA 4ASUD 4JA2A 4JHXA 4CCYA 1UC4B 4O33A 4BKOA 4U7WA 3IDZA 3I76A 2I87A 3KJEA 1RYDA 3KJHA 3HB4X 1KAMA 4CHGA 1VBKA 3IIEA 1ONNA 1NVVR 4TSFA 1KMHA 1PN3A 3C15C 2QLLA 1SQGA 3OEEA 4OAQA 3FBWA 4OBEA 2GF9A 2V7PA 5A4MS 2A9QA 2R8RA 1ORDA 4DUPA 2WU0A 3K4HA 1UWKA 4M1KA 1J06A 3W8RA 5AW8A 1P8AA 3L8MA 4ZVUA 1CXZA 4B6OA 1I30A 4PAWA 1WAMA 1PI3A 1QVZA 5KHAA 2G08A 1Z62A 2HZBA 4UFPA 1L7NA 2TRSB 5KYKA 2AEJA 1QX3A 3QA9A 4GC9A 1BZYA 4UHJA 3RVPA 4B6ZA 4Z7QB 3G7UA 1OI7A 5EE3A 4CEHB 5CFQA 1E6CA 3T3OA 4GDFA 3LUFA 1PVVA 3Q40A 2X0NA 4B10A 1XQYA 2IYNA 4X1KB 1GJRA 3A7EA 2XUPA 4CM5A 3O91A 3PGLA 3T0GA 4PC3A 4NLLA 3F96A 3S2YA 3GPIA 3WC5A 4CMBA 4UBOA 2OD9A 4CKZA 1MJBA 4D0GA 4QOIA 1JLLB 3OE5A 1CETA 2CBZA 4LHXA 1BKYA 2XV1A 3Q1KA 1FNNA 2ZWIA 4F2DA 3ENZA 4B9AA 3D1JA 5JI2E 2QLBA 4C4XA 2GHQA 4B3SB 2FIWA 1YWGO 5B4VA 3O3CA 5B6JA 2WF9A 4F96A 4QOEA 2OEPA 3H83A 3OJLA 2JHGA 1SUPA 2IOHA 3A70A 4X95A 4DLUA 3RSSA 3BFXA 3BJZA 5CDSA 1J99A 3CT4A 5HP4A 3QYFA 2PVCA 5LM3A 4WBSA 2G7MC 2GETA 3I05A 1M2HA 1YB6A 3B6ZA 4JLAA 3S40A 3WV5A 2BMVA 1GPDG 4AG7A 2CIJA 1QOQB 3L40A 3JQGA 4BVJA 1Q0QA 4LY0A 4HQFA 2GA9A 4RC9A 1FEZA 2O4CA 3MS4A 8CPAA 4K81B 2YNEA 4BV3A 2ZW5A 4C89A 1U9IC 1GG2A 3CH6A 5I5EA 3LPDA 4FN5A 2Q6KA 2WYWA 2OR3A 3D81A 1GU1A 3DE4X 4AVYA 4U7DA 4GUAA 1NVXQ 4DREA 3S55A 3Q41A 4XKJA 2ORYA 2JRCA 4PN3A 1YJ8A 3GT3A 2HHHB 3N2KA 3L8DA 2J0QA 2Q9BA 5IYZB 1GLNA 1DJOA 4YLGA 3AX6A 1GG9A 5A5EA 1TTQB 1KY3A 5E7IA 4LI3X 3IAUA 5ALRA 3M0EA 5F64A 3DZKA 3F5FA 3WYAA 3QMWA 2FWIA 2XWSA 1JSCA 4ND8A 3CIFA 3HRIA 1RLTA 2A0KA 2CW5A 3ZI0A 3GO4A 4ZAXA 3C1AA 5ALNA 3X2SA 3UMYA 2ADMA 1TIQA 5K1ZA 4N7JA 3WYCA 4J07A 1XQWA 2NUTA 2Z04A 4BV9A 4TS3A 2DUWA 4FSXA 3TDKA 4G5FA 4UM5A 5TX7A 4FQ7A 3E3AA 4IY1A 4LSWA 1YQGA 5TARA 3DOUA 2BMFA 4E70A 2HLPA 3G0CA 3PHCA 3P2HA 5DLDA 4A10A 3L07A 2FHPA 2OL4A 3AZQA 4UM9D 2PBFA 4CKXA 4NCHA 1M2VB 4HFMA 3HGMA 3QWFA 3PB8X 4B13A 2HDHA 4L78A 3B1JA 5HX7A 3N7ZA 2AN5A 2FGJA 5IJ9A 4DDKA 3D7KA 3R3XA 2JBJA 5IFLA 5AQEA 3F6BX 1ZG9A 5IVDA 3EW9A 1VG1A 3GRCA 3KPYA 4FZJA 3GGPA 4JB3A 1DMRA 1E3SA 1X94A 2ON6A 3EHDA 1BDMA 2BM9A 3PPWA 1YU6A 3MSXA 3WJ7A 4K26A 3KASA 5CCXA 2VXYA 4QYSA 5CH5A 4QPDA 5ALTA 1K68A 2EWWA 3R3ZA 2EX4A 4PZDA 3BKWA 4EMUA 4X8MA 4EFDA 2QL9A 4FMDF 4NZPA 5JR3A 4BLOA 3AF5A 3W05A 2ZBFA 3ZXYA 4CNQA 4PFSA 2QJFA 2Z3KA 4WKPA 5T6BA 3TIGA 3H2BA 3NEPX 1FW8A 2OWEA 4D0NA 1BFKA 2KQUA 2UZ3A 2FJUA 4C0BA 4JDPA 2PKXA 1L9XA 5DNEA 2PWZA 2RGRA 4ENRA 1ELMP 2QAJA 3QSGA 2AA3A 3I9FA 4R57A 1XD2B 2ZSEA 2GQ0A 2H1LA 5KNBH 4UEKA 1K4JA 2P9JA 2BTOA 2C5HA 2HUZA 3NALA 4FFSA 2GNOA 3QKIA 1EIZA 3F6CA 1U0SY 4IXNA 2HY7A 1W46A 4FE3A 2ID9A 4TTAA 2ZAMA 1V1RB 2P90A 3TW8A 2WNSA 4TMFA 2GI4A 5EJ5A 2PJ1A 1KR5A 2BEWB 4NCZA 3RS8A 1LI7A 1XPRA 3DTVB 1Z5ZA 1X1CA 3UA4A 4YDSA 4NENA 1W9MA 3KCNA 3C2QA 1NVFA 1O95D 2VPZA 4R5MA 2OC9A 2XX3A 5F3DA 3I6BA 2D54A 1JHUA 2WT8A 1AV7A 2C4VA 3TZBA 2ZRGA 5IAAA 1NJSA 3OCUA 3GHYA 2Y99A 1KOGA 2XOKD 1C30B 2GK3A 1XBTA 1HXHA 4P34A 3H1PA 2YOFA 2QI9C 3L02A 4CGMA 3FECA 1J4AA 1REQB 3MB8A 4L8VA 1BEUB 4EFNA 5CAEA 1W47A 2NACA 3BEOA 4GKVA 3DXYA 3ADKA 2W2TA 4MUEA 1QRRA 4BB0A 5FFMA 5G3YA 2N1BA 4GVXA 2QSZA 5AW1A 1U81A 1NYQA 4IDAA 1NZDA 1L8QA 4H15A 1HE5A 1VYHA 1RQ7A 4BFTA 3VM6A 1R3DA 4KIFA 4B6EA 2YV4A 4F7DA 3WGIA 1YZLA 1H69A 1OFUA 3EMBA 2HTFA 1NVWQ 2HQBA 4YP7A 3TJZA 4Q66C 4OHMA 2GCPA 2NTYC 2O7RA 4UM8B 3QBVA 3TYXA 2LIVA 1BRTA 3M6IA 3BSFA 4E1AA 3E9EA 4Q6BA 4AJPA 2VTBA 5IJWA 1OJ7A 3GFRA 1U3TA 5I8ZA 4L3VA 4R2XA 1JKXA 5HF6A 3QWBA 2ZANA 4D3SA 2CY2A 4EW2A 1LY1A 4AW9A 2WAMA 2JFPA 4I5FA 4K6HA 3WGKA 2Z6AA 5BVGB 4IZHA 4U5QA 1VJCA 4JITA 1Z22A 1IBCA 2Y05A 4I9NA 3ZU5A 1C8VB 2CFOA 3HI6A 3DZJA 5K99A 4ZT3A 4KYVA 1A77A 1R66A 2DLNA 1P7PA 4X97A 5FBLB 2Z1MA 1N9KA 2F1JA 4I0WB 1Y8RA 5U4XA 4KRGA 3RU7A 3ZQUA 4O4IF 3W91A 1ADYA 1P74A 2J41A 3ENVA 1Z5VA 1N5LA 2G1UA 3ZDCA 1CERA 3SYTA 3QXSA 1ZG8A 1DJLA 3PHJA 1VYVA 3BH7A 3IT0A 2QTCA 4A2CA 3E84A 3RIEA 3LL7A 1AKRA 3CZRA 3P0RA 1NJ6A 3LP6A 1M0WA 1YCFA 1ZCAA 1SUFA 3UWOA 3LRXA 4QXQA 3PEWA 5ALVA 4DLKA 1YC5A 2PS0A 4I4CA 1WUTA 1HI9A 1BH2A 2AMFA 5AI6A 2AFHE 1D8AA 2H9YA 1E5DA 3LK7A 5ALOA 2H5EA 1TEVA 3ECCA 1JEYA 1AQNA 5F78A 3VOBA 3DGEC 4NCXA 1JG3A 2EJCA 1H42A 1B15A 1LBIA 2G1AA 2HV9A 3HKBB 2Z2ZA 4D46A 5EXPA 2P6EA 4NZNA 3PR3A 1E3DA 3C3PA 2RAUA 4IINA 2BD0A 3NYIA 2VF8A 3IKMB 4L8FA 1BMFA 4PZUA 2I5PO 3QW2A 1PUJA 4MJ8A 4RQUA 1EMDA 2QRVA 4B09A 4MDEA 1O6ZA 1Z7BA 3AUTA 1YFLA 4GG1A 4HB0A 5KTYA 4EH1A 4P82A 3HFGA 2PJDA 1DLJA 2EFEB 3UK0A 3B85A 3C43A 4Q4AA 4ZK6A 3FSJX 2WYHA 2OZEA 1U8YA 4OP3A 4XTRA 3EVTA 4RTSA 2LCFA 1A2ZA 1SR8A 3IUSA 5DWVA 3G02A 3OLCX 2VWQA 1MPTA 1PK7A 3KAKA 4DZRA 3I8SA 2WV9A 5F21A 3F9RA 2H54A 4REQB 3WIVA 3VNVA 4ML3A 1DDOA 4L27A 2PL1A 3JQBC 3PDUA 4CDMA 3DKPA 3EFEA 2Q41A 5IJAA 1N36B 3RNOA 3OQJA 1MLDA 2GAJA 2EQ5A 1KOJA 2RH5A 5B57C 3RGGA 3GGSA 1LFAA 2HA5A 1VJ1A 1BD4A 1QM5A 1IXYA 4R84A 1JTEA 5AVKA 2C5AA 1N3BA 1PL7A 3R09A 3BCUA 5DF1A 2PJAA 4NPCA 3WQBA 2XUGA 3PGKA 1E99A 4E22A 3MMXA 2ZJ5A 4ILEA 2GU2A 5C82A 3TMKA 1JAIA 1Q15A 4WDRA 4EO4A 3RYTC 1PRYA 3OVMA 4YH1A 3TRDA 1PQPA 5HVGA 5EMLA 4HYYA 2G9VA 8AT1A 2Z0MA 3IB3A 1KO8A 3IMGA 4JODA 1BD3A 2OPBA 4IKPA 3KQPA 3NFRA 3RUEA 2H4WA 1WU8A 7ADHA 4LHWA 4DIUA 2ZUVA 3OCJA 1TUIA 2DHQA 5DX1A 2PFKA 1GEEA 4HMOA 3SC2A 2I7CA 2ZS9A 1ENPA 1F8FA 3QYAA 4DGQA 4LISA 2V7BA 2P62A 4NV1A 3UAGA 1SCAA 3UOWA 2FN8A 1L0CA 5CT6A 1S8FA 4ZOLB 3EC1A 4L1KA 5KAMA 2AR9A 1KHHA 4OBXA 1RRKA 3FRHA 1PS0A 4EWLA 1ZK3A 3TQTA 2GB4A 2FUG6 4PG6A 4FGWA 3CB2A 4G1CA 3H8VA 2ZI6A 1OPRA 5AKKA 2GTIA 5HS6A 2FOLA 4FNGA 4ITRC 4RPCA 1NATA 3HSSA 2XYHA 1ENZA 3ETHA 3HA3A 2FPGB 2GBLC 2PRJA 5AVWA 4Q9JA 1UBMS 5JRJA 5DTMA 4BAGA 4KQJA 4JLWA 4EYGA 1TX4B 1QQ9A 2GRAA 3NTLA 3DZDA 3EDCA 3DT6A 3T5AA 1RNLA 1ADBA 1KEVA 2P69A 4KQGA 4XX0B 1JILA 1XTSA 4EG1A 2IXBA 2XYRA 3HFJA 4YJFB 1J1ZA 2ZIXB 2FY8A 4IHAA 2AFMA 3G88A 3K0FA 2NSHA 2XSZD 3HDVA 3TW0A 1M1NB 1BC5A 3C3JA 3PFFA 1UBSB 1N6IA 2KSQA 3WL3A 5JSZB 4ZYWA 3I53A 5TF4A 3BXPA 2DHRA 5HKOA 4Y1EA 4IWYA 4A82A 4GPZA 2J0SA 2OXFA 1Z4OA 3OAAD 4Z0TA 5EESA 4PZAA 1NQTA 3I62A 3H2ZA 4BBHA 1E2NA 2F7VA 3F71A 1LRZA 1U0EA 4FD6A 2QXTA 1BRMA 5TGDA 1NMYA 3K5WA 1L4YA 2JF0A 2CTBA 3W9UA 2W6ZA 4LF7B 1KEUA 2IHTA 1GTG1 1U8TA 1FJ2A 1YZKA 2E5FA 3BHIA 3V8RA 3ADBA 2ZB2A 5CLGA 3K8YA 3AVQA 3FNGA 2ZEMA 1PS9A 4J3GA 4KRYA 4K6GA 3ZTWA 1J7KA 3ZHBA 1UADA 1EFPB 1F14A 1R6BX 3QB8A 1S6YA 1I2MA 3ASZA 1X8KA 3SIRA 4C2AA 2IYXA 2OHGA 5T57A 1R37A 1I0LA 4BJ6A 1MGOA 3HXKA 2FDCA 3H42B 5MFPA 4NGMA 3DWGA 3SBDA 1XZ8A 3D6TB 3R6LA 2ZZKA 1NXQA 3DULA 1VI2A 1D6JA 4LZWA 2KHZA 4GP7A 4L4UA 4MUNA 1EDEA 4AQYB 5C46F 4RZXA 1FBNA 4XWGA 3VU9B 3MTJA 4FZRA 3U0VA 4N6GA 1MAWA 2MSDB 4JZ0A 1ZR2A 4ER0A 1ONOA 3UAZA 4RF5A 4QM7A 1CP3A 4W4TA 3RAMA 4F12A 3LC2O 4UMDA 5BNIA 4Y8VA 1VHWA 4DA9A 5AW4A 4RY8A 4JBWA 3L77A 2KWIA 4JYPA 3PQDA 2G0NA 5ALLA 4MFQA 3LDFA 1RRFA 2XUKA 2PSDA 4K30A 4HKTA 1L5VA 1HDGO 5ARBA 1Z8WA 1JKFA 2F9FA 4PLZA 4FD3A 2W6CX 4MVJE 3KOUA 3ZX5A 4J3FA 1L7BA 2GSWA 1R12A 1R00A 1W7AA 5TS2A 1ILWA 4E6PA 4OH7A 3EDQA 2AK3A 7ABPA 4B3GA 1TMKA 3P4YA 1JIIA 1J8MF 1G6OA 1E5XA 1U7PA 4RQAA 2K2QB 1CQIB 4TZTA 5G4LA 2OCPA 4L02A 2E37A 2ZU0C 3UPUA 1KYXA 8ADHA 3ZXSA 2B34A 3GELA 1ODFA 3MQ4A 3CB4A 4WLVA 2W2PA 3V2UA 1NRIA 4FINA 2C7QA 2VCHA 2OQVA 2XTNA 1P75A 1H94A 4GW3A 2ZJZA 2FX2A 2XMZA 2Q4VA 3NWOA 3D7SA 1EWTA 2H2DA 2ZJFA 1RAEA 2ZJ8A 1H3EA 3RSQA 1NBEA 4KQCA 3K70B 4MGIR 2WYIA 5J5AA 4KJXA 1TIBA 4NJQA 4XSGA 3IT3A 4OBWA 4Y98A 5EE0A 1ZEMA 1I9GA 5AK3A 1MRZA 4EHFA 1ANKA 4P6VF 1AKEA 1LC0A 2W4QA 4ZO7A 1H23A 3PL5A 4A16A 4O2BA 4V0QA 4AKIA 3T3GA 1SVIA 5G0SA 4EA7A 3H8EA 3FI9A 3UENA 2IYWA 3A4MA 2R8BA 1OYVA 1Q0UA 3OIDA 1IUOA 3PVSA 4C2UA 2EFCB 1EWRA 3OMLA 1P61B 5JS8A 4W99A 1ZUD1 5KNBD 1GGMA 1R1DA 5J2TA 4XIJA 1NTOA 1N6HA 4OHPA 1PR2A 3E4CA 1DJQA 3GJRA 1NBWB 4UCMA 2DBZA 2KPOA 5I7AA 1OVGA 3OHPA 3V8EA 1NULA 2JIQA 4QG3A 2G4VA 1APBA 2I1WA 2B61A 4GI7A 5HXDA 2C8JA 3K8ZA 4TPKA 4CJXA 4HGRA 4MEBA 2VDMB 4KORA 3EFOA 4AB7A 1DKMA 4R54A 3TM4A 2XKBA 4HQ6A 3QX7A 4ZJPA 4DTCA 4JEUA 4BNVA 3JYQA 1E1NA 3KVYA 1DQSA 3T7RA 2HPHA 3C6BA 3P9ZA 1A8SA 2OWDA 2YNDA 1VLVA 2A4KA 3B1KA 4BX8A 5AWFC 1L2TA 4NMLA 1ECFA 3IL2A 3GHHA 1XZQA 5K05A 4R2IA 4OQQA 1J8YF 4XFKA 1GL9B 2ATIA 4K2HA 4CTJA 3WQSB 2V4ZA 5HIJA 3TXAA 2Q5QA 5DNVA 3B9RA 4XB6B 4NF1A 3F5QA 3GUUA 1MRSA 1XRSB 4B0OA 2ZTMA 1GPAA 1FDUA 1NUUA 1A9TA 3KQNA 4MW6A 4WJBA 2JFUA 3QU9A 1T8UA 1YMQA 3BIJA 2G70A 3I6YA 1C4WA 2IYRA 1IZZA 2GWHA 4PQAA 3DDWA 3PGXA 3ITEA 1RAGA 3OQPA 1TKAA 1CTQA 2OC4A 1SIWA 3FM9A 1F5NA 1SH7A 1P31A 2H9AA 5KMGA 4FFBA 3BL6A 2XZPA 3WRWA 4NFLA 5LIRA 3H1GA 4O4LF 5EJFA 5EJ6A 4ETWA 1BVRA 4TTSA 2XB8A 2JI8A 3PEIA 2B1QA 3DEYX 3MGDA 1TJPB 3VOSA 3N2EA 2C61A 2NU6A 4Y49B 5LYLA 1DVRA 2QMQA 2PH7A 3I61A 1IFXA 3DAGA 1WXQA 4OBBA 2JAWA 2NZYA 1EA5A 1JR3E 4EB6A 2CVHA 1QH0A 1QHEA 3OIGA 3VJKA 3AKCA 2ZRLA 1A3CA 1I94B 1RYHA 4EIWA 4KPYA 2VJQA 2JJ2D 3BSYA 3CEAA 4LWZA 1GR0A 1DIAA 3TLCA 4TWBA 5FNVF 1WZIA 2CF5A 4N3BA 5GVRA 4EYSA 3SM9A 4BMZA 2C8LA 3OE7A 2D4OA 5IBRA 2VYFA 4RTOA 4G0YA 4G4SO 3ZI4A 2G9NA 5EP2A 3M3HA 1T9ZA 2OMKA 1UH5A 2IHNA 1X9HA 3PNOA 2R85A 2NU7A 4QX6A 2P65A 4YAFA 4P7KA 5TNXA 5E38A 3FZNA 2K7ZA 1JAZA 1HWYA 3LGAA 4XD7A 2J8NA 2YN4A 3RVQA 3OC6A 2PJUA 1M6VB 4KUGA 3KVNA 3L7BA 4LMRA 1D8TA 2WHPA 4EK9A 4HNWB 4IIJB 2KE5A 5CFOA 3LQ2A 5JADA 3EY9A 4QPCA 5CYGA 1JDSA 5BSKA 1F17A 1XV5A 3ONNA 1ZX1A 2AS0A 3C48A 2YICA 4HLUC 4QKQA 3DD1A 3OCWA 1ZC3A 2HF9A 3STTA 3N86A 4I1OA 1CP6A 1BSVA 4PSWA 5HR5A 4IIVA 5EZYF 4O5OA 1VJ5A 2VDOB 4WNAA 4MV0A 4G36A 2NADA 3IXLA 1K9SA 3MM4A 4BZQA 2VF4X 1DL5A 5ENVA 3LNCA 4P10A 4LDAA 4B87A 4RBNA 5AVUA 5F98A 2IX9A 4RFSA 1NNEA 1XDSA 4CKCB 5B3LA 4IMPA 4YPVA 4TS9A 3K9HA 1D9ZA 4YR9A 1ZQ9A 3AG5A 3KZMA 3H75A 4KFCA 5BSVA 5A27A 4AAYA 4DLLA 3PEUA 3OIVA 4FI3C 4X6XA 3F90A 5I7RA 3ZY3A 4JCCA 3D59A 1L3CA 4CNBA 3NBAA 5ESDA 1O9HA 3ADPA 3EISA 4LJSA 3ZXXA 4CUKA 1WQ4A 4JBHA 1Z9BA 2H18A 1FFDA 1XU4A 2ORED 3C1UA 1NMXA 4E2ZA 1F2DA 1K8RA 2CJXA 3P2MA 1BVYF 1DARA 2RSLA 1CHDA 4RA9B 3H4MA 3LRTA 3S8YA 5IKXA 2BFDA 2ZDQA 1H5UA 1HPLA 1G8HA 3BFKA 3ZJUA 2Z6UA 4M88A 1MB3A 4C7VA 3R76A 4ILKA 1CQZA 1BS9A 1J8DA 2I29A 2P1RA 2D1RA 3PNYA 2QD4A 3HL0A 2UVPB 2EP7A 1A8QA 4R8MA 1ZZEA 4DLZA 4KI7A 3KL4A 1IG3A 4EEZA 4TWEA 1FRVA 5BR7A 1SVSA 4HI0E 4DBVO 2JK1A 3RLFA 4Q9AA 4KN5A 4U0JA 4U7HA 5BWMA 1M4GA 4HNVA 2F4NA 1X7ZA 2WWVD 2CCGA 3QELB 4EHJA 3N74A 2QRNA 4DG9A 3KJXA 4QUEA 1P3DA 5EQJB 3SHTA 2J5BA 2R7LA 4GU5A 2Q4ZA 4L8WB 1NAHA 3PXBA 1JGTA 1HDYA 4FBGA 3MF4A 1LW7A 1F6WA 5JSQA 5C1DA 3QU4A 3KHXA 1QOPB 1GL6A 1F1JA 4RZ3A 2HWYA 1UDXA 2W2VA 2ZEOA 4JVMA 7REQB 4UOEA 4LQCA 4FHCA 3GJ5A 3FYTA 4WZAE 2K87A 5KOIA 3U3MA 4C5AA 1X42A 4DJEC 4D42A 1JJVA 2CLLB 2PZKA 4DBLE 2PHZA 5IDVA 5JLAA 1TKBA 1T35A 3QPDA 3AI1A 3PHIA 3M4ZA 4XB2A 1JNYA 2OBFA 4HPXB 4WRRA 4I14A 1EFRA 3UW1A 1J9ZA 1IQ0A 3GAFA 2X42A 1DPGA 1KSJA 3O9ZA 1U5BA 1B2RA 3FHJA 3WL6A 4P3PA 3GJ6A 4MRVA 2QTWB 3OPYB 5DYWA 4AG6A 1M1YE 2NWQA 1IJBA 4DWOA 4A3SA 4E33A 3B48A 5H02A 1JDTA 4IV5A 4JJIA 1JBQA 1XQXA 3NEYA 3RROA 2AJ6A 3ED5A 3KYCA 4H2KA 4M6WB 4HFRA 4XPIB 1G41A 2N75A 3HLPA 1XAHA 1ZN7A 3U09A 5H3CA 2H7XA 4DLPA 2QGNA 3MNFA 5BSRA 4DILA 1EAMA 2O5EA 2VJLA 4RH1A 1QIHA 4QRIA 4TL8A 1HEUA 5JS6A 3TOBA 3QUCA 5HQ3B 4Q7QA 2VIIA 4OKSA 3A28A 4P4SB 3GYBA 2ECFA 1VYTA 1YGPA 3EXHC 4WSOA 2BJVA 4K6OA 3A1DA 1CY4A 2W00A 2ZEHA 3EVNA 5LQRA 5ER9A 2C7BA 4BVKA 5J4YA 4GOMD 1XELA 2R97A 1J8QA 2EFGA 3VOTA 1NBMA 5D3MA 1S2MA 3FEEA 1MH1A 3KIPA 4N01A 1EUDB 1T5HX 1XNRB 1QWSA 3T7AA 4DCOA 2JI6A 1XDUA 1E0JA 1JVBA 4QFCA 1Z0DA 3QLTA 2ZDGA 3A9RA 1JBKA 2WHXA 3LWNA 3Q3JB 5AJWA 4LXXA 5FWXB 2E82A 1N6RA 4IIHA 4J4TA 3T15A 4IIYA 4YUXA 5T6MA 5KSZA 3DKVA 1QXSA 3GLHA 2ZFUA 4Y2HA 4NYMR 3U3JA 4Z53A 4YT5A 3A1VA 3NANA 1RMTA 2GM5A 3FTNA 3K3PA 1Y8AA 4IG9A 2I66A 3ZE0B 1JEJA 2WSAA 2RB5A 4XWWA 4AWBA 3RW9A 3WP1B 5HKBA 2JI4A 4UVHA 3KSUA 3HJAA 4CU5A 4RFLA 4G0NA 4PZ9A 4CCSA 4E2XA 5F49A 4B6QA 1OAOC 4BNDA 3O73A 3KWMA 1CR0A 2DETA 1SEVA 5ALZA 4AUEA 4LVNA 2YXBA 5AIBA 1PQWA 1ZH6A 1VRCA 2PO5A 1U0TA 3SZMA 1P6QA 3L7JA 3WGMA 3GUHA 2AF3C 5J2UF 2XA1A 5GM1A 3NONA 2YS7A 4ZBGA 2PIAA 2HFKA 3O03A 4CQMD 3DONA 1QIDA 4NU0A 2Q3MA 1IVNA 4US2R 2QENA 4TV9B 4B6PA 2R98A 2PGLA 3GFBA 3V4ZA 3L8YA 1IZ9A 4L3OA 5DWNA 3SJUA 2HQYA 4Y6GB 3FGPA 3Q2IA 2I6QA 2IX3A 3DZGA 3FVRA 1O7JA 1MV8A 1MNQA 4I4TB 4KITB 4KOUA 2IS2A 4J3NA 3QYPA 1WVGA 3O21A 1JZSA 3UOAB 1UAAA 1C3OA 3J81k 1UBGA 1ETHA 5TV2A 3PJGA 5FLXA 4YDHB 2GCGA 1CR6A 1XRYA 1VPWA 1WZEA 4M9XA 4ZYVA 1U5AA 4F6CA 3FVQA 3FOCA 2BFCB 4MHTA 2FSUA 4BZXA 3BIWA 2C4NA 4Q7MB 1XCPA 5JAOA 1H1DA 1AHPA 2ZW6A 4R7TA 5F23A 3LLUA 3O0DA 4Y6SA 2QX9A 4P86A 3HP4A 1HDZA 3SEQA 1U6JA 1ODCA 2LRHA 3WLJA 2BRUA 5DBIA 4DR4B 3SZ3A 1K98A 4KPUB 3OQNA 2BZGA 2IF2A 5HRCA 2AE6A 3HS3A 2H1SA 1T2NA 2RARA 4PX2A 3QFCA 5T4EA 3LDHA 3JZMA 3MSCA 1AKYA 2ECPA 1VKOA 2X7HA 3HVUA 2A0UA 5CVEA 3IBGA 2EKQA 4RS4A 1GZVA 4CQJA 3M6WA 1QSOA 4MRRA 1RZ3A 3REQA 2H4JA 2O2ZA 3D6VA 5CTJA 4R1MA 2E85A 1HNWB 3EDMA 1P1RA 4K9NA 5C5EA 1JUDA 1JYEA 1C50A 4PRKA 3D9QX 3RGWS 1CKEA 5AUPB 3W34A 4LUCA 4R8VA 5F4ZA 2XNCA 1ZC4A 3R3WA 1GL7A 4BKMA 5KNDA 3LX8A 3FMPB 1GPMA 3FR8A 5AVTA 1W30A 1J33A 3ZBPA 3HJFA 3IBSA 4KIGA 1YX0A 3C98A 2NZWA 4D81A 1VYUA 1B3RA 3C3CA 2OQ2A 2EBFX 5DYGA 5E96A 1YR9A 2M6SA 2IGBA 2GM4A 3U4GA 2B4DA 5H9VA 2AC2A 2E1PA 3SF8B 2J8ZA 1AQJA 1K6EA 1PG5A 2I0FA 3BE5A 1YMEA 2QR2A 3AUFA 4WY8A 4MTLA 4OGKA 3AVPA 5LQNA 1LWOA 1NG1A 4AP6A 3EBOA 1NJ5A 3DV0A 3FLEA 4ZHQF 4HGZA 3UXYA 4IOKA 4QGSA 3EZXA 2XWJI 2ETVA 2IWHA 3TECE 4DMKA 1BGWA 2PX0A 1W52X 2PL3A 1YL5A 1ZN9A 4PO3X 2QGFA 2XZLA 5C88A 2C59A 4KUHA 2PGXA 3L7LA 2YIJA 3PEVA 5AJVB 1IG0A 3RT9A 4HQKA 4C3UA 1VHQA 2B78A 3P4UA 4OP4A 2WWXA 3CC8A 5FTJA 5BRNA 1R0RE 1Q7LA 1U99A 4J1SA 4LWOA 5JG7A 2JAXA 2IV3A 1C80A 2RJOA 1SC6A 3UUEA 1LK5A 4G0ZA 2W6NA 4TQUS 3I9OA 5BSUA 4E15A 1NNUA 1HK7A 4P4TA 1JDNA 1VE9A 1KPHA 3GRYA 2HLDA 3GLGB 3ZDFA 5J5CA 1RM3A 4DV2B 1LBHA 1CDOA 1X86B 3R8CA 1IRIA 3RI3A 3KKLA 2FUNB 2Z5VA 2RHRA 2X77A 2PJ8A 3OPVA 4U1RA 5EIOA 3AQ4A 4XH9B 4CFSA 1AK1A 3KVVA 1F0NA 3WHKA 4FYMA 3CRQA 1FXWF 2Q1WA 1ISGA 3HBJA 2RGBA 4JP5A 5C7OO 4RD0A 3ICCA 4RH0A 1XFOA 3OT5A 4L6IA 3WGGA 5EPUA 2Q4DA 3ON5A 3M9WA 4BP1A 5HDBB 3S6FA 3W7VA 1ZMTA 4IZOA 4QWWA 1D7OA 4HAWA 4D9MA 2E9SA 2E4ZA 1GGNA 1OLXB 3KS9A 1N6LA 4PHHA 3UQYS 4DCVA 2V8DA 4IHMA 2E48A 1D3AA 2HF8A 5KYTA 3JAKB 2VYVA 2ZRPA 3FSGD 1BFUA 4TXHA 3ZE2B 4A5OA 3TNLA 4UATA 4DM3A 5C32A 4E5UA 1YUMA 4C0SA 4ZXPA 1C9EA 3R7WB 4DIMA 1Q0LA 3FRMA 2YR0A 4JLPA 2IP2A 3TWOA 4S12A 2DC1A 4YGYA 3OZDA 3LACA 4PS1A 3GQBA 3DV9A 4C4AA 1BU8A 3RASA 2KCWA 3LXXA 3PEEA 2W6MA 4QAQA 4AVBA 4PYLA 3DR8A 5GM2A 2WAAA 1PGPA 2RI0A 1U2SA 3OLYA 2GFQA 3SZRA 3H2HA 1U3GA 4GH5A 1Q7BA 3A9LA 1E8NA 3QPUA 4HNUA 1N75A 1H0RA 3LC7O 2GTPA 2PU5A 2IYYA 4US0R 1SD5A 1FQOA 2ZDHA 2OP1A 4CL8A 4WDQA 1WUIS 4G3XA 5AM2A 5A3JA 3VGJA 2PH3A 1CW2B 4ZANA 1KE2A 4BP3A 1KY4A 5B7NA 3D8UA 3NZEA 2EJWA 2JEYA 3R3HA 3N5FA 4GI2A 3GUZA 1WIWA 2WM9B 4WOCA 3PIIA 4NPHA 4LTNA 4IIUA 4P7GA 2VSFA 2OT3B 3K2EA 4TL6A 2ZWVA 3F1KA 3K9QO 3NDBB 3RFVA 4DG5A 4TXMA 2WFLA 5IS2A 4F3YA 1QZ3A 3MUNA 5MDHA 3KDAA 4RHUA 1QAMA 1M75A 3VJMA 4TWZA 4KKXB 4YAGA 3UK7A 1US8A 4AKEA 4UW9A 3SSOA 4JUFA 3IJPA 3ND6A 4QOJA 4K9RA 3U7EB 3HJNA 1XTTA 4AKHA 2ONYA 1QO0A 2FWPA 2YNMA 2CMKA 2NW6A 2OFXA 3NA6A 3UG6A 4EUSA 1BW9A 3PU6A 4BE9A 4YCMA 3K96A 3MCTA 3THYA 3I5MA 1DTWA 2HHLA 2W6OA 4G0MA 3H19A 2EK9A 3OC0A 2QP9X 1PLJA 4Y9RA 1H9AA 4U5XA 5DYYA 1SUSA 1NQXA 2QUZA 3U7QA 2Q6TA 5DTJA 2QPOA 4FB5A 3VR4H 4E3ZA 3TD9A 1PAUA 2XYPA 2OGUA 3WX0A 3P0IA 2PQ0A 3HYLA 4F0YA 4DXHA 3SSNA 2VEDA 4WBNF 1UDBA 1I1HA 3BGWA 1W4RA 5A9SA 4XWTA 3MWLA 4ZGGA 3K4QA 5SYAA 4W6ZA 3ETNA 1FA9A 2HX1A 4RK4A 4H6XA 3N05A 3ZVKA 4CCYB 1E7WA 1K0FA 5JBNA 3ZCQA 2DWPA 3KJGA 3UCXA 2EBJA 2ZWAA 4AX4A 1QPBA 1DCFA 2W58A 2B1IA 4FNOA 1EP1B 1KMHB 1LPPA 3CLRD 3R3UA 1P3JA 4JLVA 2WSSA 1E2DA 3G5MA 1J0EA 1D6NA 3QAHA 4O4HF 4RX1A 4JWPA 3SXPA 4UQOA 1SVLA 1X13A 3RARA 1OWNA 4F4CA 1UJCA 1EFUA 1NWCA 1P5JA 4LE2A 2OHVA 1NKSA 3EQZA 5FKJA 1TGYA 3VO1A 1TVMA 2JVJA 1X0VA 4FS8A 3MK31 1ZSNA 3ZV5A 2JAQA 1J0AA 1IPEA 1MIHA 1XGKA 4GX2A 2ZOFA 5JFGA 4X8OA 2JHCA 4L75A 4V39A 5ICSA 1N2CA 2CNTA 2VYND 1RJGA 3VVCA 4AI6A 4N5DA 3KV3O 1EZ1A 1BVHA 1GYRA 5JAHA 3MUFA 1JPNA 1CJVC 3K0EA 3Q4GA 2G80A 3D6HA 2R1ZA 1JQGA 3ANLA 2AI3A 1Y6GA 3ZUGA 3I3SR 3CG4A 3E1KA 2Y1OA 4F9VA 2C58A 3IUEA 4EBBA 3RRNA 2GD6A 4R6WA 2HJVA 2Q50A 2ONZA 3OX2A 4HQOA 3CVVA 4MGYR 6ADHA 3JXEA 4JIMA 1UFOA 4I3HA 3QK7A 1L3IA 5H1YA 2LP4Y 4RMNA 5EI5A 2CMDA 1T0PA 3YASA 2XUFA 4HWRA 1K06A 2J6BA 5HIKA 3U3XA 5BUCA 4BMCA 2HPAA 1N5KA 4HH1A 1LFDB 5B30A 1AKWA 4WZAB 4RW0A 2WBLC 4UTOA 3LE8A 4J43A 5EHQA 5FHRA 1D4AA 2JLRA 2GXUA 3ZHVA 4RJKA 3OOJA 1XZLA 1QV9A 4N3NA 2XRMA 1PJ2A 3JQGB 4UBMA 2Q99A 4GQAA 4Z0PA 2FOXA 5CITA 3OM0A 4FW9A 3WTCA 1LVHA 2WPXA 4OC1A 1M1YB 1HG1A 4X7BA 4JV5B 2XECA 1OX6A 4KNYA 5AR1A 5AOBA 4BVEA 2PMEA 4WJKB 4NMWA 4REMA 4FGUA 1XKLA 3JD1A 4QB9A 3N2KB 5L51A 3RUIA 1MJ5A 3CO0S 4MW2A 1JXMA 2JGIA 4CT4B 2NIPA 1A88A 2CHEA 4LE1A 2BMAA 3C5EA 4NCAA 4ND8B 4X64B 3SOPA 1ZHHA 3H87A 3VH1A 5HOEA 3V5NA 1SELA 2DE0X 4QQRA 1GTZA 3EF0A 4KQFA 2HTEA 3Q9SA 2PG3A 1M6WA 3DAFA 3JQAA 1AX9A 1L7AA 5JJBA 2NUTB 5KSOA 4RULA 3OEHA 4GSYA 1Y6FA 3KQOA 2H51A 5ITSA 1XMVA 4ZRMA 3MJTA 4F9FA 3SOZA 4NC9A 1C7FA 5KKAA 3LXRA 3DW3X 1YU9A 3V6MA 1X70A 3DDDA 4W7IA 1AUQA 5DW0A 2V6IA 5JFOA 5C8VA 1NHGA 3F2IA 4BXOA 1NLMA 3TLJA 1LCIA 1B26A 2WZCA 3GBSA 4CMIA 1Y7RA 2HA3A 2VPWA 3R9KA 4UVDA 1QHHA 5C5CA 1FFGA 1NW7A 3B3TA 2RGDA 4AZ3A 5IJ9B 1GN9A 3D0RA 4TV8F 4MUGA 3F7OA 3B1YA 1FFYA 4YRFA 2P4EA 1T1EA 3JSXA 4RHEA 1E1QA 5C5DA 3DO5A 3CXSA 1VE6A 4D56A 1FK8A 5EXXA 1IXRC 1GP2A 2GEFA 3E82A 4IOLA 4R87A 1R4NA 3OLVA 3OQIA 2C3PA 3U9TA 2RDMA 2G77B 3DBIA 1EHCA 2BCGY 2FR0A 1EVQA 1AMPA 2KLBA 3DWEX 1JQDA 1P5HA 2O2GA 5TT0A 1E4VA 4DRZA 3WWDA 2ID4A 1T2VA 4HXFB 1PF7E 3HXTA 2JIDA 4RF4A 4X1YA 5DU2A 1RMYA 1WW3A 1W85A 3CR7A 3L0IB 2M6KA 1KBQA 2Y77A 5IH7A 2FQ1A 4GM1A 1M1UA 5ES4B 1EWQA 3MERA 3VX4A 1M2FA 4ZCRA 1ZUWA 2XDAA 3NT5A 4R6TA 2WUVA 5HUHA 4GGOA 4WN9A 1CEYA 2CTCA 5JNWA 3ZWDA 4I8IA 1PK8A 2XIJA 2VXKA 2CXOA 2IYLD 2PR7A 3MELA 3D8HA 3OH8A 4TRJA 1PJZA 3CPJB 1GCIA 4B5LA 5TPZA 1ARMA 2JS7A 5EBVA 1EDDA 2AFXA 1KOFA 1P0FA 2PNFA 4Y6QA 2YJ3A 5BOSA 4TRMA 3U26A 4K3VA 1EKXA 1MC4A 2XUOA 2JBKA 4A32A 3W9SA 2VHVA 2F1OA 4L5YA 4K2AA 3MRXA 3EPLA 3O2NA 4I1IA 3DMGA 4HR7A 1KI1A 2QRHA 4N82A 1OF1A 1W6RA 3R4VA 1UJ4A 3BTSA 1DELA 3TW8B 4XJXA 1ECGA 3NR2A 3SZGA 4EGFA 1G7CA 3IC5A 4MUBA 2ZIEA 1B6GA 4DLTA 1IBKB 5H5JA 3BERA 4OQDA 4P8RA 4DV6B 1G6HA 4AKGA 1ONSA 4NENB 4N0PA 3T9BA 5KTTA 3HY6A 3T1HB 4H6PA 5E4JA 4K9SA 2FVYA 2ZWMA 4G2TA 3FD8A 3OP4A 4MWCA 1QFXA 2MMGA 4M21A 3PGPA 1UIRA 2JIRA 1TZMA 1WOYA 2PIDA 3E0KA 1X6VA 4EUKA 1CD5A 3VDNB 3QF7A 4M37A 1ZSYA 1CY1A 3LCVB 1J0XO 1K2VN 3NYWA 4GLOA 1XQ6A 5DN6A 5CAEB 2X1MA 1NL3A 5DTEA 2WFMA 2R2AA 1KKMA 4QPJC 1NSAA 4LS3A 3EUAA 4IEFB 3EGWA 4JKYA 3Q9UA 3FKQA 5C1OA 1A69A 1R5BA 5FL7D 4G0VA 4WHMA 2AXQA 4P4EA 3ZGXA 3R3YA 2BBOA 3BMNA 4D9KA 1LQ2A 4JWKA 4PXDA 3NFZA 1U3CA 1TU4A 3PC8C 1N7GA 3F3YA 4F3RA 1FJGB 2PGDA 2J0UB 1VP3A 3VH4A 4BPRA 1GGJA 4NFYA 3DLJA 2ASEA 3E6AA 1CYDA 2P6PA 3I9KA 2VTBB 3FAKA 2R6ZA 5ARDA 2YS6A 4WINA 2FWNA 1NJ2A 1MAVA 1QVVA 1EVEA 3TIXB 1KDZA 3DVSX 3IO5A 1PR9A 3AM5A 1YREA 2YMPA 2J0EA 4B2PA 1C8BA 3ZWPA 1SUCA 4KE8A 4Y6PA 3B6MA 1NUQA 2GLUA 4JT8A 4CL3A 1QSMA 1I1DA 2VZ0A 4RNDB 2Z2JA 1GKYA 1T4GA 5G0UA 1KI3A 1V8PA 3PUIA 1Y8RB 4IQ4A 3NHPA 3RSZA 1UXGA 3GFSA 2BKEA 3SHVA 1QIKA 2OO7A 4DYOA 1QLWA 1DV2A 3JVVA 4PK3A 3NP9A 3IXQA 5ICGA 3IA7A 5DV9A 4RIFA 4KIWA 1C1XB 3LK6A 4ZOQI 1V4BA 3FI0A 1KR2A 3N8NA 2O50A 3D54D 3UJCA 4HATA 4ZYYA 1BGXT 3UFBA 4M99A 3ILHA 3E35A 5K4AA 3BFVA 4MVYA 4A38A 4FE7A 4Q9LA 2F1HA 1Z28A 1X1BA 3WLMA 4MVJG 2RGEA 2HXGA 4EJMA 1N6OA 3F5BA 1USKA 1H8HA 2VH2A 2BEKA 3SS7X 4CRZB 4RVSA 5D2CA 3MQFA 5MHTA 3KPUA 1JEYB 2HMYB 1W1WA 3BGVA 3UPTA 3TT2A 4CMHA 5H8WA 1WOMA 3AUSA 3ZQ4A 1XRJA 3KOOA 3KUCA 3BHJA 1RXIA 4MJ3A 3TQQA 3G68A 1F2UA 4UU8A 1G18A 2OD2A 4D7AA 2PUFA 3ZK9A 4KXMA 4EGJA 3QOYA 2XRZA 3BXEA 4X45A 4JNKA 5IDYA 3IEMA 4DV5B 3G2KA 3Q15C 4KCGA 3QKSA 2UUAB 3ZGZA 2QRVB 5C8YF 3SQNA 4RHYA 4OI0A 3C70A 3VHRA 3M89A 4TQAA 2JHFA 1XC7A 4YRBA 4HBZA 4QNNA 1Z17A 1SHKA 4TMYA 4W9NC 2G28A 5FTNA 4Q4AB 2XDWA 4B33A 3ESBA 4G0OA 3HHEA 1F12A 4UOQA 4OHWA 1VZ3A 2GAIA 1CZOA 2ZG6A 2B8WA 3ES9A 1OIVA 3BGIA 4BFSA 4J9UE 2V7QD 6Q21A 1O5OA 1CEEA 2EOAA 2OKCA 4HNHA 2HZ7A 3GT0A 2CXRA 4B34A 2YX1A 1E8MA 1VHTA 3PZBA 4FOSA 2R8PA 3FR7A 1GM5A 4JJ4A 1RXTA 5HSGA 4UTNA 3PQ6A 1DCTA 3M8KA 3Q7RA 3C16C 5DT9A 3JQBA 4TGLA 2YDXA 3N8DA 3RNZA 3WE7A 5TMEA 1S2LA 1SOAA 4CL2A 4HNQA 3BD8A 2WSBA 5IM5A 1GG5A 1VLJA 5F7JA 3WKAA 1MEEA 2TMGA 1XZEA 4OC4A 4K6FA 3LUDA 2CNBA 3FPFA 1II8A 4Z5XA 3MT7A 4B17A 3CBQA 3FPKA 1YB1A 4IR7A 2VHQA 3A1CA 4BO7A 4H3HB 1S2DA 3VPXA 3U7JA 2I99A 1P72A 5CNPA 1U2TA 2P0WA 3INNA 1A8IA 3OFND 5EHGA 5JXIA 5LLDA 2Z10A 2TYSB 4QLAA 3B89A 4EY5A 3KKNA 1N2EA 1AKNA 2P2GA 1NMEA 5DULA 4J94A 1Q6ZA 3VR4D 4P6YA 1YA8A 2R1IA 3ICOA 1FX0A 4JSYA 4QXAA 4KBYA 1ORIA 1IY8A 4OXRA 3SI1A 1HNZB 3LBHA 1ELLP 1VCMA 1NV9A 4MFPA 5CNMA 5G21A 4OH1A 4JJXA 1GXSA 1NLZA 4NPAA 3SKXA 3SC2B 2AUTA 1VB3A 4ZY2A 4IS2A 3I2JA 3FDIA 3MVEA 2MTBA 3S28A 3DB1A 2X23A 3VPSA 4WJLA 2H5IA 2IQIA 3N53A 4PXYA 1LZLA 2J4DA 1B1CA 3P9IA 1IPFA 5EP3A 2TMYA 5G1PA 3P2FA 1NI3A 4M4SA 2BI4A 1D2EA 3R1KA 2O23A 2C2HA 1Z88A 3IBYA 3QVTA 3OX3A 1FFXB 4YAWA 4A0HA 5JYEA 1TPZA 4H1WA 2DYKA 3O1JC 1P33A 2CUTA 5EEHA 1NI5A 4L4SA 2EEPA 5JMWA 2X5KO 5AD1A 2C3UA 2CJPA 2UV8A 3RDPA 2IPXA 4E03A 2Y4OA 2GBLA 5D3KA 1B0ZA 4NZOA 3SHFA 2GKOA 1Q84A 2ODNA 1WTCA 4N0QA 3DNPA 3O8LA 2V7TA 4UHBA 3QE0A 3PUXA 1JPVA 1YIAA 4U5YA 5B1EA 1PJAA 5EQFA 5IVKA 1EDOA 3UHPA 3CA8A 1NVTA 4W5QA 4KVXA 1VHJA 5GONF 3VV3A 3F5SA 3ERCA 1D0VA 1Y37A 4BO9A 3GKRA 2X7BA 5KTCA 1RP7A 4MTCA 3FPCA 5HKAA 4ZGYB 4P4DA 5KJCA 1UXKA 3K0FB 3MCVA 4OYHA 4YQZA 4C0KA 3NJ8A 4GMXA 1DKUA 1GGKA 1NVVQ 3FLMA 1FY7A 1DS6A 3SICE 3H0KA 2WM3A 1XHEA 5A71A 2ZT6A 2EJVA 2J31A 4JZYA 1P9RA 2ZI5A 4N7RA 1ABEA 2HUNA 1VHEA 3BRQA 2ARHA 5AW9A 4PCLA 4WQMA 3HVKA 4CRYB 4C9BA 1KDOA 4WXEA 1H2RS 1Y9KA 1Z4RA 1S96A 1C1YA 1DRVA 1T6NA 2XCRB 5SZJA 3GLGE 1PX2A 3CLSC 3HVRA 2FPLA 2DQSA 3PXGA 2CLKB 2Z3OA 4HPWA 2GERA 3AY6A 3LYAA 3QBTA 2CEKA 3PFGA 2ZREA 2HHAA 2I8LA 4B4OA 3I09A 4AMUA 5LYJA 1SC3A 2JD2A 4G0PA 1JA1A 3A6DA 2QSYA 1DC6A 5IWAB 2ZIVB 2JEVA 3IBFA 1NU6A 2QRPA 4C0QC 1GKUB 3K1JA 1U0LA 4MV5A 3WK7A 3DDUA 1C2TA 3S7TA 2EKDA 2JL1A 2IPAB 4FT4A 3B3CA 4DPMA 3LKBA 2Q1SA 2J9ZB 1SPXA 4NEGA 2CZCA 3T52A 1VIYA 1UMDA 4RHFA 1Y1PA 1WA5A 2WY2D 2V8BA 4QELA 1SULA 3IE2A 1JR4A 1MJHA 4C0HA 3DDSA 1BHJA 2P4UA 1HDEA 1FLVA 2FSFA 1G6KA 1G38A 2EFDB 1F5SA 4I1YA 1SRRA 4H7EA 2Q6OA 4WBXC 4EPVA 4XDHA 3B51X 3KEOA 3FIXA 1RMQA 2WA1A 1TF7A 1XVAA 4RV4A 2O19A 2EJTA 2Z2IA 1PZEA 4QWMA 1YRWA 4A8PA 1BO6A 1PL8A 1PQYA 3TZ6A 4A36A 3AEUA 5IULC 2IZ0A 2JIPA 2WG2A 3G79A 3TD6A 4DHEA 1OT3A 4L6AA 1B73A 2XB4A 3C6ZA 2GPYA 2Q0QA 1VJRA 4HDOB 3FA2A 1Y9ZA 1HOXA 2CXQA 4AY4A 1C0IA 4GXNA 1UBTS 1K7EB 3Q7EA 2G5CA 2O05A 4CM9D 4Z9YA 4LZLA 5E2IA 4J1NA 4NDNE 3OPNA 2UZ4A 3T9YA 2WRZA 1J2YA 2VZEA 3CWZA 5JALA 4WD3A 3W8NA 1N7JA 4UBLA 2R8YA 3GJ7A 4JL5A 1PWHA 1HG0A 4PAMA 3K6JA 5CA0F 4WUVA 1FP6A 5AK6A 1CHNA 2FN9A 2CLOB 1NSLA 4YJ3A 4BVBA 2QJ8A 4IAVA 3KJZA 3UO8B 1VL8A 1TMOA 3NUZA 4R0NA 1KS2A 2QTAA 3LC1O 1A50B 3Q7QA 1PEYA 4ESEA 1HLFA 1GU0A 2XT0A 3U4DA 1Y1RA 4YCCA 1QCDA 2ZJ7A 2WJ3A 3G8WA 4POAA 2O8DA 4YJ2A 1E1CA 3PC7A 1ZJYA 5EMHA 5F9FA 3FPEA 2FSGA 3LCMA 4MHDA 4B48A 3TEFA 2A0FA 3NT4A 1XG5A 3NEJA 3BGDA 4IHQA 3GRRA 1M8JA 3I42A 4NBUA 5IEBA 1NW3A 1RPZA 1ORTA 1VPLA 5AKHA 2HQOA 2GEJA 4X71A 2WICA 3OFVA 3ENWA 4AMYA 1RKBA 4O2BB 4QTZA 3UJNA 4YFJA 2I2AA 2OPHA 2Z09A 4PYOA 2PJ4A 2GEVA 2IEBA 2OORC 3PSAA 3LFTA 1R6VA 4JEIA 2X8JA 4LC0A 4COOA 3KEGA 2CD7A 3PENA 2A4MA 3NPMA 2C07A 3WOVA 4BQOA 1L8OA 2SCUA 1RVV1 5ED0A 3B5JA 3KHTA 5J2TB 3TTYA 3KG2A 5FX2A 2GJAA 2O5RA 4OHFA 1JMYA 4EY6A 1SURA 1BLLE 4E1BA 1U8UA 4J0QA 2O2DA 5CNIA 1KI8A 5FA5A 5I4MA 2GLFA 3RSLA 2WTUA 2RAFA 5IEJA 3CUVA 1MX3A 2HLNA 4N65A 5JQWA 1DB3A 5E6UA 1A72A 5JMTA 4D02A 1IHYA 4S1VA 2PBRA 1NVMB 1Y6QA 3EFOB 4H6UA 4RPGA 3WJAA 3SYNA 4ID9A 2I8AA 1WQ3A 1QAQA 5C51B 1ICIA 3TRKA 4Y67A 4JSTA 5IH3A 3COJA