2HB6A

Structure of caenorhabditis elegans leucine aminopeptidase (lap1)
Total Genus 174
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
174
sequence length
489
structure length
489
Chain Sequence
TQVLVRNGIQAVGDGLTSLIIVGKKSVLKNVTFEGKFKEVAQKFVTDGDSWNSMISRIPASGRHPLHYELAHLITVPDASSRGNTPTNAHSIYKELKPINYPEDTKNVHFVLFAEYPDVLSHVAAIARTFCKFSMKTSGIRELNVNIDVVCDKLTNEDAVFLTDLSESVRETARLIDTPANILTTDALVDEAVKVGNATGSKITVIRGEELLKAGFGGIYHVGKAGPTPPAFVVLSHEVPGSTEHIALVGKGVVYDTGGLQIKTKTGMPNMKRDMGGAAGMLEAYSALVKHGFSQTLHACLCIVENNVSPIANKPDDIIKMLSGKTVEINNTDAEGRLILADGVFYAKETLKATTIFDMATLTGAQAWLSGRLHGAAMTNDEQLENEIIKAGKASGDLVAPMLFAPDLFFGDLKSSIADMKNSNLGKMDGPPSAVAGLLIGAHIGFGEGLRWLHLDIAAPAEVGDRGTGYGPALFSTLLGKYTSVPMLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords Leucine aminopeptidase 1
publication title Crystal Structure of Caenorhabditis Elegans Leucine Aminopeptidase
rcsb
source organism Caenorhabditis elegans
total genus 174
structure length 489
sequence length 489
chains with identical sequence B
ec nomenclature ec 3.4.11.1: Leucyl aminopeptidase.
pdb deposition date 2006-06-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00883 Peptidase_M17 Cytosol aminopeptidase family, catalytic domain
A PF18295 Pdase_M17_N2 M17 aminopeptidase N-terminal domain 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10590 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Zn-dependent exopeptidases 2hb6A01
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 2hb6A02
4NGTA 2BO9A 3PB6X 4ZY0A 4KSIA 4ZX8A 1F2OA 2DEAA 1PCAA 4OIWA 5J1QA 2PVVA 2IQ6A 4P4DA 1CPSA 2ZOGA 4P6YA 4MCQA 2BCOA 3FEEA 4AXVA 3WC5A 1TKFA 3HLPA 4MHYA 1PYTB 2PJ3A 4JZ0A 3H8EA 1GYTA 1UWYA 4G1PA 4YWYA 1XBUA 3D7DA 4O23A 3D67A 1ELMP 2C6GA 4UEZA 2ZELA 2JBJA 2XEIA 1EE3P 3RZAA 3N5FA 4F9VA 2PJ9A 2BOAA 4WWVA 4P4JA 1Z8LA 4FUUA 1LAPA 1Z2LA 3SI0A 2ZEOA 2G9DA 1HEEA 4NJQA 1LANA 1KWMA 3D4UA 4IHMA 2CIJA 4X3RA 4OMEA 4IAVA 4ONWA 4TNUA 2QVPA 3RBUA 2XEFA 4LQGA 4MCPA 4X8IA 3S9NA 4W9YA 4P10A 3TC8A 1YLOA 3SJEA 3H8GA 1OBRA 5CBMA 4UF4A 2AFUA 3FMCA 1AYEA 1DTDA 2PRQA 3IO1A 3CPXA 1H8LA 3D7HA 4R76A 1BPNA 2NSMA 4FWUA 4ZY1A 1YW6A 2GREA 4OC4A 3ISXA 5LYLA 4PXEA 2XEJA 4B6ZA 3KR4A 1LCPA 2AFSA 2O4HA 4TWEA 2PJ4A 3CPAA 4FAIA 3S9MA 2Q43A 1XFOA 3JRUA 3BHXA 4F9UA 3B3TA 2C6PA 3VH9A 1QQ9A 1Q7LA 1TF9A 3L2NA 3PB8X 5K8PA 4ZYQA 3NH4A 2GLJA 4GM5A 3V38A 3KI9A 3V7ZA 3CDXA 2PIYA 2PJ2A 3DLJA 3QNVA 2IMOA 5LYDA 1AMPA 3GLJA 2ZOFA 2GU2A 4EMEA 1CP7A 4OKOA 4EWTA 2PJCA 2I3CA 3FEDA 1TKHA 1ZG8A 4P4IA 2PJ8A 3B2YA 2JBKA 4MMOA 3NH8A 4MXUA 3PB4X 4OIDA 3KL9A 3PBBA 2F8HA 4MHPA 2ZEGA 3NH5A 4OC3A 3WT4A 3WC6A 2ZEMA 1M4LA 3I1UA 4NGRA 4R7MA 1IGBA 2Q4ZA 5D29A 1YMEA 3PB7X 4DUKA 4MHZA 2CTBA 1HDQA 3SI2A 2C6CA 5HVHA 3VARA 2PJ0A 2PJ1A 5JM6A 4P4FA 2POKA 2ZEDA 1FT7A 4OC2A 3B3CA 3IJ3A 2AFMA 2VL1A 2ZENA 1NSAA 4UEFA 4NGMA 2OR4A 2V8HA 2CF4A 3KHXA 5K8MA 3DGVA 2NYQA 4PXDA 4UIBA 3SJFA 2EK9A 6CPAA 4MCRA 2ABZA 4A37A 4UIAA 3BXMA 4IK2A 3D7GA 1QMUA 1F57A 1VIXA 1HDUA 1Y0RA 5LRJA 2RFHA 5DS0A 3PBEA 1YW4A 1ZG9A 3VATA 4X2TA 4OC0A 1ARLA 4BD9A 3FVLA 3K9TA 3K2KA 3B3VA 1Y0YA 2FVGA 2PJ5A 4MRIA 4UEEA 3PFOA 4Q7AA 2F7VA 2V77A 5HVFA 2WYRA 3T8WA 1YSJA 5LYIA 3WC7A 2PCUA 3WABA 3PEIA 1XJOA 3BI1A 4PXBA 4R8FA 2J9AA 1ZLHA 1JQGA 4Z65A 4P45A 1ZG7A 5K8NA 4NFRA 7CPAA 4P4BA 3LWUA 5K8OA 4ZI6A 8CPAA 3D68A 1CBXA 2AFOA 1LOKA 5ELYA 3CT9A 2C1CA 5I4MA 4ZY2A 2PJ6A 3SI1A 1ARMA 2PE3A 1IY7A 3MRUA 4NJRA 1TXRA 3FX6A 1R3NA 3NFZA 2GLFA 4NGQA 1CPXA 5JGFA 2AFZA 2OOTA 3GB0A 3KGQA 1BAVA 3KASA 3IFEA 3HUVA 1LFWA 1R43A 4PPZA 2V8VA 4ZX9A 2ZEEA 3KHZA 2AFXA 3SJGA 3H8FA 1DE4C 1BLLE 1VHEA 4OC1A 1RTQA 2V8DA 4DYOA 3MN8A 2HC9A 2ZEHA 3FH4A 2HB6A 2ZEPA 2CTCA 4WJBA 2ZEFA 2JEWA 1VHOA 4YU9A 3PB9X 4P4EA 2AFWA 5IB9A 1XRYA 3KQZA 3NA6A 5LYFA 2ANPA 3TX8A 4NGNA 3ISZA 4H2KA 4A39A 2PIZA 4PQAA 2PJBA 1ELLP 3D7FA 5F09A 3FJUA 4NGSA 2RB7A 4R6TA 3S9LA 4NGPA 3PFEA 5HXDA 5CPAA 3KZWA 3FECA 1XMBA 2O53A 3KR5A 4OC5A 4DJLA 3KQXA 1BPMA 1Z5RA 4RUHA 3GUXA 3IC1A 2Q51A 4A38A 3IIBA 4MCSA 1FNOA 2WZNA 1CX8A 4JYWA 4F8ZA 4PXCA 3D66A 3B3WA 5THWA 4EFDA 5LRKA 1VGYA 5JH9A 3IWWA 3B7IA 3B3SA 4A94A 1CP6A 4MHNA 1ZLIA 2EWBA 5LRGA 2QJ8A 1F2PA 1TF8A 2EK8A 5HVGA 2PJ7A 3LMSA 2PVWA 4OP4A 2IJZA 4CPAA 1TKJA 5D8NA 2XEGA 3BI0A 3IEHA 4K3NA 4P44A 2QYVA 1CG2A 2V8GA 4FBEA 3B35A 1Y7EA 1LAMA 3RAMA 3PRTA 3SJXA 2PJAA 3FF3A
chains in the Genus database with same CATH superfamily
2CVHA 4RQAA 5K0NA 1CRLA 3W5VA 3PDUA 3L0IB 1NVBA 2H4FA 3L7NA 1BIFA 4BKMA 2QF7A 2J5XA 3N0VA 3WADA 1QR2A 4OF4A 3U16A 1ENOA 2C9ZA 2I4TA 4HXYA 5DTEA 1E1QA 3JZDA 3RAJA 4E0BA 5JH7F 4XSHA 4Q16A 2J46A 1YZQA 4XFKA 1ZNZA 3SI0A 1IAVA 2DKNA 2Y6UA 5TEVA 2QLFA 3A70A 4TTVA 1GNPA 4DV4B 1ESMA 1GYRA 4XI9A 1U1FA 2HH9A 4BO7A 3ZH2A 1UBHS 1XDDA 2Y1CA 3D8BA 2PBZA 4B6GA 1PLKA 2XVYA 4LVCA 2EF1A 1CQPA 2GN4A 3M6VA 1IIBA 4EYKA 1GPAA 1QXSA 4O0LA 1Q74A 4FZJA 4OOFA 1AV6A 2Z2YA 3G0OA 1QO0D 2OCIA 3IE1A 1C9JA 4L28A 3FVRA 4L16A 4RELA 4DG8A 1RLUA 1BVRA 4QPDA 5ERYA 4IILA 2BZGA 3B7WA 3K0HA 3T54A 3DNMA 2DPLA 4G1VA 4B3GA 1W25A 3AWIA 1B3BA 3T7RA 1N92A 2HIMA 4B79A 1YK3A 4JNCA 3IKTA 3KJIA 4BEJA 1GRVA 2H3HA 3LG2A 4MBUA 3RUIA 1N32B 2C4NA 2B4DB 2ZSJA 4TL8A 4UU7A 2WM2A 3UWMA 2BF7A 3A9RA 2WUWE 5JAMA 4GXTA 1JT2A 1UBGA 4XGRA 3TXAA 5JJBA 1K4YA 1G6KA 3F47A 2XT6A 2C2KA 3E7DA 5K2MA 4W5WA 5H0IA 1TW2A 5D29A 1TIQA 4AMGA 5BYBA 2VRBA 5BW4A 1Z28A 1NVWQ 1C9NA 3K32A 5EZYF 3QIVA 4PLZA 4GMFA 1VCHA 4Q5IA 3OU2A 3I62A 1JNXX 1FNBA 1IBSA 5KQSA 2QTTA 4PLFA 3EPPA 3REQA 3TSCA 4U7TB 1PR2A 3NP7A 1G16A 5BSVA 1EGHA 2XADA 1H42A 2ERCA 8ADHA 3IPAA 5CFRA 4TKUA 1QVVA 2VJYA 4WI1A 2PRZA 4PQYA 1XDUA 3R6TA 3PFOA 2OPHA 1KVQA 2G1AA 1QAQA 3RUHA 3ZTYA 3C6MA 5JQWA 2RK6A 1ESNA 4DMCA 4L73A 5EPEA 1P3Y1 5IU6A 5EP4A 1PSZA 3MVEA 4KBYA 5B1HA 3UT5A 4D97A 5AXBA 4L6CA 2XJ9A 3O8OB 2VZ8A 3SDZA 5F2EA 3OWXA 1PV4A 5FOXA 4XE5A 4PAMA 3RAPR 4DA0A 2JLYA 1WDWB 1T8RA 2VJDA 3FPEA 1ZG3A 2EDAA 2PH5A 1T9KA 1JIUA 5JJLA 1I3KA 4TN1A 4M9XA 4UZFA 3N3BC 5ESDA 1A9SA 2IHVA 3HJAA 3ND6A 1GRCA 3IHWA 2EGGA 4HV4A 5B1YA 5IHPA 3WL8A 4EHIA 3ZWQA 1OLSA 1BTOA 2QW0X 2CFTA 3TL3A 1LF5A 3TGPA 1NZFA 3WLNA 3IIEA 1R4NA 1EAYA 2XGSA 4OHZA 1ETHA 4P4SB 4KJZA 3DCNA 3WLQA 1WWZA 2WIAA 4RUHA 3OQ1A 3FOAA 2CL5A 2HZBA 4ILKA 5D7BA 1NBHA 2ZWPA 3ONFA 1SBCA 2BEKA 2ENWA 1KDTA 1R4MB 4LWOA 4M1OA 4O33A 2P27A 1SKUA 1N2CE 1M1NA 4AQ7A 5FBHA 2G63A 2VJNA 4N6OA 2DFLA 3O1JC 3PYXA 4YJDA 4J9UE 4DHWA 4C1NA 3EF1A 3GXBA 3CLUC 2JGJA 1MO5A 5CVJA 2DEAA 1KMHB 4Z1OA 2J1LA 3SBDA 1UMDB 5LZ5A 4Q3NA 1E3WB 4GXQA 3U37A 2VP9A 2XUIA 5JZBA 2F1JA 3S1AB 4IZ6A 3NAMA 4LWZA 1DE0A 4NK4A 3NW9A 4LOHA 2D2XA 3K5HA 5B3KA 3DPIA 2J87A 2CHEA 3KK0A 2X15A 3RZAA 1WZEA 2CCJA 2XNJA 1G20B 1RMQA 2KI5A 4EB3A 3ZKWB 5C34B 2KBEA 4OQZA 3ZV6A 5KVQA 1Z73A 2VG8A 3D3JA 3I92A 4R3WA 5TQVA 1IAQA 3OQIB 3UUGA 2REQA 3GLGB 2NNWB 2XYQA 5CLQA 4L3VA 2RHCA 3IO1A 1HX7A 2RI0A 3B7GA 5F4ZA 3G2MA 3V1MA 3QITA 5CJ2A 1ORHA 1E4VA 3WWPA 2FUG1 1KSHA 5IMBA 1SEPA 3HPRA 4GR9A 1XZEA 3IDAA 1IRXA 2JLQA 3KUCA 1O8BA 1JMYA 2BMFA 1JQJC 3OHMA 1ONSA 4DVJA 3RIMA 3L0DA 4BJ5A 4NXMB 2W8BB 4WIAA 4HGOA 4I46A 4AKTA 4R1NA 1YDFA 1Z06A 13PKA 3LU1A 1JQDA 3S2SA 4JGBA 4FINA 5C31A 5KYWA 1D4OA 3TRHA 4TX1A 2I3CA 4WJLA 4RUKA 1I2DA 4I3GA 3BWXA 5FV4A 4BV8A 1ZNWA 3OZBA 2C9DA 3DHWC 5K8JB 4D46A 1W49A 2QTAA 1ZRMA 4S0ZA 5HKOA 3QFRA 1CIVA 1CG6A 2O1XA 5JCPA 2Q4ZA 3T7EA 2UU9B 4P4LA 3KXIA 2VBQA 3WZLA 4X6YA 2VL1A 3VKGA 3DL7A 4H1UA 4YCLA 3K2IA 2OVFA 1NBME 1AV7A 3AQ4A 1W5BA 3EXFA 1HYBA 4XLTA 2D06A 1ZVQA 2ADMA 3PT9A 4PS0A 1NVXQ 5E0OA 2ZBUA 2Z9DA 1KRXA 4MDFA 1U7WA 4MB2A 1WUIS 3LRTA 4Y8VA 1CIPA 3HH8A 4R3UC 3ZZ1A 4WCFC 4TMZA 1AQUA 2PJUA 4IIBA 3L4SO 4AO7A 2P2SA 5IAGA 4O4LF 4BV2A 1MU0A 3U4QA 2E5LB 3W78A 5P21A 3REFA 2FNAA 1WMEA 1V6CA 3G8WA 1WSDA 3QJ5A 3ZUPA 3PE4A 3KKKA 2JRLA 1XAIA 2M6RA 1PTKA 4LY9A 3R9FA 4M86A 1BAVA 4WXMA 1VL5A 2E48A 1A5SB 1SPXA 5JPCA 4UTRA 3KTFA 1VHEA 1SIBE 3PICA 3O8BA 3BRWA 4ZVMA 1YS9A 3UPDA 1L7RA 3AEQB 1YB6A 1HZJA 2BTEA 2OA0A 2W5UA 4GKAA 1M73E 2R1TA 1G41A 3C6XA 1DEKA 1R8JA 5C4MA 3KJHA 2IOQA 3EVDA 4W7HA 3C85A 3CA8A 3ORHA 2G9NA 4JV5B 1RQPA 2CWDA 5DX0A 1UINA 3B1FA 3CS3A 2FW8A 3RW9A 1Y1RA 2AWNA 4OY3A 3Q3GE 3OIGA 3D5QA 3LYAA 4GMHA 1RZUA 1ZKMA 1ZFNA 4QOFA 4UAVA 3NATA 4PGMA 4GUDA 1L2TA 3L6BA 2X0IA 1B1AA 5AKLA 4M8SA 3V7FA 1PFVA 7REQB 4G0UA 3K0FB 3GT4A 1ISRA 2NO6A 1SBTA 2RCNA 5LPNA 4ZX8A 1RFGE 1DV2A 1S2DA 2J9GA 1G2PA 1VGVA 2VQDA 3L01A 3ODPA 2C8LA 4LRQA 1N7IA 3T7SA 3IUBA 5HKBA 1UAYA 3ZDYB 4ZVOA 3LP6A 4TKMA 2AHOA 4M9ZA 1HDCA 4A5SA 1EE3P 2IEGA 1TCVA 4YR7A 3QE3A 4YO7A 4C7BA 1EG7A 3A6DA 1QLJA 5BXYA 2Z98A 4X45A 2GBCA 1VCIA 2RI6A 2NUTA 2IV7A 1G63A 3HO6A 1ORVA 3LVQE 5K3DA 3FBGA 4XNHB 3ZS9A 1OYWA 1LQUA 2K7ZA 1WUTA 3WNCA 4JJXA 3L4JA 3RSLA 2EKLA 2ZIWB 3ND9A 2XTAA 4LYAA 3G02A 3FXTA 2V8OA 4ALLA 1YCHA 2QRMA 4KE8A 4PYIA 5JNVA 4W7IA 5SZHB 3ZZUA 2ETXA 5C81A 1PT7A 2XYVA 3LRPA 2KM1A 3OHSX 3SD7A 1LDMA 4Y2QA 4OI2A 5JAUA 5EWJB 2Q44A 5JRJA 1DCKA 1MPXA 1AG9A 2VAVA 1COWD 1U6IA 1HG1A 2E6KA 2V6MA 3BIXA 4KN9S 1OXSC 2QRJA 3LWZA 2GLJA 4B11A 5JEDA 1T3GA 4WBXC 4ZICA 2VLIA 5E96A 3FWPA 2GU2A 4K6MA 5K3FB 2LTAA 5JG7A 4B3IA 3N1UA 1XK6A 5MN6A 1OH6A 4CEIB 1QPZA 3O3NB 1JTVA 4DCMA 3SFVA 1WUYA 1NMYA 1VBFA 3S8YA 4LGCA 2BFNA 4FONA 5JJ5A 4KU4A 1EGVB 1AGYA 2QTGA 4BB9A 4TYQA 4IUDS 4JBLA 4TWBA 3CLUD 1C0PA 1P1IA 4IG9A 2O8DB 4UQPA 3U4DA 4KTVE 3WB1A 3AIMA 4DR6B 5K01A 3T7AA 5F76A 5CBPB 1CUYA 4UEOA 1KZHA 3W5BA 2CB0A 3H4VA 2XRZA 2H65A 1M9NA 4AN4A 4H9GA 4I3HA 3SMQA 3JVEA 4BBHA 3GLUA 1E99A 4BD9A 1U8FO 4OXRA 2AHRA 2AMVA 4CYPA 2YW9A 4L75A 5K0BA 1ESEA 2YYAA 4COKA 3HV0A 4PPNA 2HQ1A 1GNVA 3G1UA 2G25A 1D6NA 5BV2P 1CU1A 1E1YA 2QLMA 3RS3A 4ZYWA 1UL1X 1P8AA 4KLVA 5JAOA 3VKUA 4AS2A 5IKMA 2OH1A 1XRRA 1HSOA 2BBTA 3PC3A 1Q0QA 2NQ2C 4WY2A 1CQWA 5F2OA 3K94A 1U3WA 2C95A 1SBQA 1IB0A 1CUCA 2VDMB 1G59A 1RPNA 4G8JA 3GCXA 1O0CA 4CF3A 4INZA 3FZGA 1TTQB 2JBAB 1QE0A 1B73A 1MENA 4WBNF 1TM7E 4NWIA 3PEUA 3WLJA 3MOGA 4IMRA 3WLIA 4F8YA 5F3RA 7ADHA 4MWDA 3M6XA 1YI0A 3MMXA 4WLNA 3ZOZA 3TTVA 2W2TA 1S2OA 5JVDF 4HLQB 1Q84A 1JHDA 4UA3A 4A39A 4Y2XA 3S2EA 2GN1A 1GHTA 4ZBGA 3PFNA 4FT2A 2C4MA 1T3SA 3H5ZA 3PFFA 1PP4A 2VHYA 2XZOA 2EG5A 4M55A 3T5MA 4DQKA 4X85A 2ZTVA 5I7HA 4EHKA 1ZM7A 4ED9A 1FSGA 1ZC4A 4U7FA 1KFCB 1YUNA 4KXMA 5JZSA 4KOXA 4NMHA 4BTVA 1DC3A 4DN6A 4JI6B 5KTCA 4MUEA 4ENWA 5AVVA 4UNQA 3JSAA 2VZYA 1FP7A 4MS1A 4KPEC 4A16A 3QVGA 2I2FA 2DUWA 4OGWA 3ONDA 3PWSA 1QC5A 4M7OA 3A31A 1SUPA 3PB6X 3UWOA 3BJ7A 4KX3A 2VPWA 1R8QA 4AXVA 4FZRA 1POWA 4HRYA 1HQCA 1QP7A 3FLAA 6YASA 3S6JA 2I4IA 3AR6A 3EDQA 5EESA 2P5SA 2YN4A 1SOWA 1NUUA 1EP9A 3VPDA 2XRMA 5K6RA 4JQYA 2W83A 4TYMA 1E7RA 4M9RA 4RA9A 5DSTA 4YFJA 2QN3A 5ULLA 1G20E 1PFKA 3PDIB 4DJTA 3ZVMA 2VYVA 2R00C 2AKAB 4YRNA 2WVAA 4LJAA 1ZC3A 2QVPA 4V0ME 3KAPA 4UNNA 1OV4A 5B2ZA 1XVLA 1OFUX 5L7WA 4HUTA 3GLGE 5LMCA 1EINA 4BAGA 1R57A 3QRWA 3IT3A 1U02A 1T1RA 2ZANA 3F3SA 4LX8A 3A37A 4FR0A 1ZCBA 4G9GA 3RUDA 2WP0A 3EWIA 1NV8A 3U1BA 3IR5A 1YK0A 1U2RA 3S9MA 4YJ2B 3ILVA 1WP9A 4PBTA 5F77A 4LPKA 1STOA 3M34A 5HX7A 3W6OA 3NIGB 1U2SA 1SUEA 1LZLA 1P80A 3USZA 3B2NA 2RG7A 4B76A 1RE1A 2AZDA 2XZDA 3P2OA 3CO0S 2R96A 5HZHA 3ZBTA 2GEDA 3WKEA 2PS3A 2E5FA 4R2KA 1TKHA 4BQSA 2Y8EA 3WLFA 4PNEA 3NM6B 4RS2A 1AZWA 3A2LA 3QA3E 1K3FA 5AK4A 3NEPX 5PGMA 1FMLA 3NAZA 3V7UA 3BAFA 2VL7A 1JDPA 4NEXA 4YRCA 2J9FB 3GFSA 1RHRA 2WWYA 4PO1A 4DMHA 3OPYI 4G5GA 5JMTA 3LF2A 1YRYE 2VWPA 4UDXX 1HUQA 3F6RA 5KOYA 3I2GA 1TKAA 4EWLA 3I73A 1BVYF 4UIBA 3P32A 2P9JA 4P93A 3HQ4O 4CMGA 1FSFA 3QKSB 4PG4A 2I3BA 1TYDE 4MYRA 1MHPA 4KGXA 5L3VA 3L1JA 5FFFA 4ARZB 2Q4OA 2X22A 2KS6A 2NUBA 3HA7A 1L5ZA 1U2GA 4R6XA 1JEQB 1F12A 4QUIA 1AO3A 4K28A 2VWGA 2KBFA 2UXDB 2B0CA 4ZWNA 2V6IA 5J2UA 3O6VA 2RB4A 4FGZA 4CUJA 1XNQB 4OAEA 5KKCA 5LA6B 1UXJA 4DWOA 2P0AA 3ZCRA 3HB7A 2DQYA 3TKYA 2RMKA 4QSMA 3W5HA 3P27A 1GU7A 3DB1A 1Q91A 4OJNA 4JUFA 3ZTTA 3VZCA 4ZKDA 4FQ5A 2IZOA 1KUYA 3OPVA 3R20A 2VHVA 3VPHA 1F1JA 2ZAOA 4BFCA 3V97A 3HU3A 2YGWA 4EENA 4JDPA 1YA4A 1RYHA 4TKLA 3BWVA 3DUFB 3LPMA 1GAWA 1XRLA 1YRAA 5C7IO 3I9SA 4L2IB 3O91A 5IEJA 4KMMA 1WXXA 1G8MA 2HIGA 3STWA 4B3BA 2VPXA 2IITA 5DBGA 3KWLA 3JARA 4G1BA 2KYRA 3GLIB 5B55A 1ZD9A 4RPJA 3IERA 2EW2A 2V54A 1UBKS 3AETB 1HM5A 4Z7NB 4BJ1A 3FOCA 1PS8A 4P53A 2BHRA 4BCBA 3TT2A 2AG8A 2A14A 1KSFX 4IHAA 8MHTA 1KI3A 4QT4A 1PT6A 3LGXA 3EAFA 3IQGX 5J1QA 1ZH2A 3GJ7A 4Q38A 3F49S 4JUCA 3RFTA 4D9NA 2F3SA 1XP8A 5KCZA 1OU4A 3K05A 3IXQA 4DRZA 2W6ID 3KEQA 1A7KA 1K5GA 3M70A 2BGMA 2UXBB 2VT7A 2IPAB 3NCHA 4KDFA 4NMMA 2HQSA 2FPWA 3KYJB 3QLJA 4UCPA 3W7BA 4GO1A 5LKAA 2NT4A 4FMCB 1Z82A 4FEGA 3RIGA 4B8YA 4D3FA 4IHMA 3QLEA 2ZAGA 5DCWA 4F93B 4RVDA 4ZU3A 4ZP1A 1GFWA 5EEHA 1H8ED 1A5ZA 3TLYA 4D0NA 4C6TB 4LOIA 2QVYX 3Q9NA 4YRHA 1KGDA 4LYYA 2DSNA 3WI7A 4K26A 1DZIA 2IQ5A 3N58A 1DQSA 5AGEA 2GREA 4KSBA 1R37A 1TVKB 2J3MA 2MT9A 4NENB 3ELYA 3Q85A 4RV9A 2DPXA 2PBFA 1DIGA 3JRUA 4P84A 4EG6A 1KAOA 1P1RA 3T3GA 4DDKA 5IZCC 4CKEA 3RFFA 5BUCA 2GDZA 1T6NA 3LT4A 2VOEA 3HXQA 4WL0A 2CNDA 5FPSA 1J8YF 1MJFA 2VT3A 4M37A 3G6WA 3FWKA 1EB9A 3QUQA 3C24A 2SHKA 4BO2A 1UDAA 3H16A 1KOFA 3CLVA 1IBKB 3ENQA 121PA 3EXHC 4Z4CA 1YR3A 4FYWA 4TV8F 1V47A 3A58B 4FEYA 3OLCX 1MUUA 3NORA 4MHZA 2DRIA 1J8VA 1S3GA 2H06A 3ORQA 4JB8A 1OBCA 3OMXA 2W2XA 4J6EA 2CD7A 1GAQA 2BI4A 4V0KA 2GEKA 5FPYA 3F4BA 3A6JA 2XUZA 4BYMA 3BWYA 1QKIA 2WI8A 4LRUA 5E6UA 1EFVA 3GJ5A 4RENA 4UE3S 3H83A 3WFIA 1GL3A 2WKRA 3DEAA 3K20A 5EXSA 4FHGA 2H2WA 4B7UA 5DSZA 3KOWA 4BRWA 3WR7A 3PKZA 1U3CA 2IF2A 5ISVA 1W5AA 3DM5A 1CDOA 4F6RB 2ZW7A 5LD2C 4B3MB 1X92A 4WE3A 5ESXA 5CX1B 1S8OA 2XA1A 1LXCA 5K6AC 3HP4A 3UA4A 1CKEA 3W5UA 4IWYA 4X71A 3SDSA 2F3QA 3CNEA 3DE4X 4GYYA 1KZ1A 3U7QA 1R8SA 4XTCS 2W7TA 4ABYA 1CY1A 1CUEA 4IXNA 3MCWA 3FTCA 1AKVA 3UJDA 4W1PA 1R6TA 4C2UA 4CTJA 2A3RA 1DE4C 2VJLA 3CVOA 2V8DA 3ENKA 1Z0FA 4UVHA 3IEPA 3PB9X 5B2FA 2HJGA 1C30A 3V4RA 2O8FB 2IKSA 4EEZA 4DCOA 3SYTA 2WIDA 4Q7QA 4A8JB 2QVLA 2JVIA 3TI9A 2XKAA 1ISFA 3GN2A 2F43B 4C68A 3EJWA 2JIZA 2A9VA 1JR3D 3G8DA 1P33A 4YMGA 1HE3A 4P3OA 4EY5A 1X13A 3E9CA 1EB8A 4PRKA 4EX7A 4ONUA 4ND2A 3SBXA 4IQ4A 1Q57A 5KTYA 1R50A 3IMGA 5T6MA 3DMGA 3BRQA 3MWGA 3MMSA 2BR3A 2EWBA 3CPHA 1N5JA 3QAHA 4JNKA 1J9EA 4E3ZA 1VMAA 3ROXA 2X1LA 1U6MA 1X1BA 3BIFA 2P2DA 4FKMA 3PRTA 3IXMA 1EH5A 3PUWA 1DAHA 3B52X 3GFGA 3KVYA 4QRHA 5DX8A 3H3JA 4MCQA 2WJGA 2BCOA 3QU7A 3KUDA 4P7JA 1SKMA 1GUFA 3HLPA 4TZKA 4KE7A 2Q0XA 1XCGB 4PAQA 1UWYA 3MCUA 4M8NE 2OV2A 1PNTA 2V8BA 3SGLA 3FCSB 5BR1A 2BFDA 4OFXA 3RRXA 1VGQA 1BEZA 3TFYA 2QRNA 5CU7A 3VHQA 3FCAA 3AJRA 1C3LA 3S6HA 1VHWA 5LSAA 2EFYA 1M3SA 3OT1A 2Z5GA 1OWOA 1U3TA 1Z0UA 1JU4A 2G80A 2BGWA 5JCOA 5LQJA 5JCZA 4PTZA 5I7WA 2HSZA 1R66A 3F8WA 5IANA 1G0OA 2RHMA 1IZ8A 2AEEA 1UKYA 4RDCA 3NXKA 1YREA 5B6JA 3AM1A 1QV7A 4LX9A 1TLLA 2BHNA 3L7AA 3N2KA 3QEAZ 5SYNA 4WOBA 5HBRA 3LUHA 4LDZA 4MROA 3DE2X 1E2GA 4D3YA 1FFHA 2JAXA 4Y9TA 2WHQA 1PK8A 5KBYA 4M60A 5KVCA 4B2YA 3B1KA 1JBKA 2JFNA 3ITDA 5DMXA 4JOBA 1N2HA 3RRJA 1N2BA 1AMUA 3RHFA 1E7MA 4Q01A 3RU7A 1DG3A 4LJLA 3TCVA 1RXUA 3DXXA 3MLAA 4FNMA 3ZWNA 4AF6A 1ZG8A 2QAGB 2ZUTA 3NJ4A 3KZKA 1FU4A 2CKMA 2YIMA 3UV3A 4GPEA 1NF9A 5LUAA 1ZHHA 3KL4A 3E2PA 1A7UA 4XFJA 1WZ2A 5KS2A 3KT6A 4M3SA 4XOUA 5I9BA 3TOAA 5TPZD 1M8GA 3HUFA 4Y9SA 2VYNA 2CDAA 4JXJA 5KDLA 2L69A 5H3HA 3NDJA 4AMVA 3EW7A 3FZEA 4TXLA 2RGNC 3ZWDA 2VO1A 3D8NA 2G9QA 2WYWA 5FA8A 4F0XA 3I1FA 2HK7A 3OD5A 2F59A 3GLTA 4DLXA 2Q41A 5LRJA 1UK7A 5CNKA 1YJXA 3PRKE 4V0NA 3EQ9A 2K2QB 3B38A 1S7LA 5ELXA 1E32A 2FSUA 4F4FA 1ZK2A 2WM3A 4YRJA 1QFZA 1GZ4A 4ALJA 4NX2A 4GQIA 3A1WA 4PYOA 3IMFA 1TEHA 2JZOA 4R8FA 4NDAA 2FCRA 1U8CB 2J32A 1X1RA 3LUJA 4M0CA 1E79D 2R6DA 2P67A 3O4IA 1Y5IA 4OMUA 3LOQA 3RSOA 2IYAA 5JARA 2PQ8A 1O3YA 5DHPA 3GQVA 3H3FA 4MCAA 1U31A 2H4YA 2NAPA 3J7AC 3NANA 3RROA 3W9YA 2BUEA 2XMPA 5BRJA 2CXNA 1UXGA 4BO3A 2XX3A 3R5KA 1VKOA 2IT1A 4KR6A 2R97A 4IDBA 4KDCA 1HG0A 3UAVA 2NUAB 2HPHA 3TOCA 1X7YB 1WLSA 3FMFA 4YYZA 3GX1A 4RLSA 4ICIA 3EODA 3EGDA 3QVJA 1U98A 3N6RA 3F98A 1YZGA 4D74A 2VAMA 1XTJA 3QB8A 3R9XB 3GLIE 3PG5A 2OXRA 1JHAA 3F1LA 2J0VA 2R79A 1LW7A 4E70A 5KTPA 1W75A 2DBZA 2VQ3A 1TKJA 1PJTA 1U0GA 1FRQA 3N6XA 3K70C 1G7SA 1Z6TA 2V58A 3JU3A 3CXQA 1PCAA 5TVKA 4OKNA 2Q4BA 4OXIA 2JGLA 1TM1E 3WGLA 3BEOA 1Y3BE 4QYWA 1DO8A 3NHYA 1Y7IA 3N39C 1UKZA 3Q7RA 5KNCA 4DZRA 4HLUC 4ZT3A 4M49A 3AB8A 1ELMP 2PAFA 1W1WA 4GX2A 4JQZA 5DMHA 2YR0A 4C0QC 1JHOA 1Z8LA 1QHNA 5CVDA 1MBZA 4E2XA 2B3TA 3KSDO 3VPFA 5HK9A 2PLNA 4WOKA 3UH0A 4ZI7F 5TQ0B 2RC5A 3DLHA 2J4CA 4KWCA 2PK3A 1ZXLA 3KPYA 2BH9A 4U1RA 1Q77A 4O02B 1Z6YA 2B34A 5EFOA 4KK4A 4Z9BA 3PDWA 2E55A 2O0MA 2GPSA 4KK3A 1G8FA 3SR4A 3HKBA 3TZKA 1ZI6A 1A95A 1BFUA 5I9SA 3H13A 2RGCA 2XCQA 1NXXA 2QUJA 5EFZA 5G4KB 1OVMA 4PSXA 2ZVDA 1P61B 4R8SA 3JPWA 4ER5A 3JQGB 4BNDB 5JMPA 2PU7A 3RVJA 3K09C 1EWKA 4LDPA 4LFBB 4KYUA 1MJGM 3N2YA 3ER8A 2P8JA 3HXKA 4FLEA 3RC8A 3ABZA 3Q8XB 2CB9A 1NA5A 2IZ1A 3VC2A 1VBMA 3KPVA 4REQB 1NJ2A 2B4TO 2MINB 4IDEA 4JOSA 3UKJA 2CK3A 1UC9A 7GPBA 4KKXB 1XD2A 3SJUA 4N82A 2CL7X 4BKRA 4B4WA 3RUCA 2VUTA 3IPRA 5EZ6B 2IS6A 3I01A 1BCRB 3BG5A 3O1IC 4ILEA 3L7JA 1W581 4QXPA 221PA 2C0PA 5HOQA 1FRZA 2BRUC 2UZ0A 4K5QA 1JJAA 1GV0A 2HV9A 4EQ6B 3GA5A 5IV0A 3JD1A 4Q7KA 1JIKA 5D51S 1WHTB 3AR7A 1HMPA 4Z99A 3P19A 3CLKA 3GN1A 3BE4A 5KYXA 3K4HA 4PYNA 3UMGA 4YFYA 1D1PA 3OEWA 2GT1A 3KU1A 1AN9A 3WDKA 1WUKS 4F8EA 4GECA 3OPYA 4FYKA 4QATA 4EVRA 5IDVA 1HDZA 2QYTA 4UBJA 5EP3A 5KPJA 4TSFA 4GRAA 3MJVA 1NNEA 2J3QA 5F2NA 1VJ1A 3AI1A 4G2TA 1GPWB 1TU0A 1GG2A 4X1YA 4GHWA 1IG0A 5IVIA 1WZCA 3ZXSA 3T3DA 5AW3A 4W5QA 1UK8A 2XCTB 1E5VA 5FLEX 3HM9A 3SJGA 5E4TA 3CE6A 3JYQA 1RJGA 3KBBA 1OV6A 3TK1A 2X0EA 4J3NA 3LDHA 5LQKA 1A9TA 3IAUA 4PINA 5IAAA 1CLUA 5GJCA 4DSNA 2ZRCA 1V3TA 4GOOD 2V7XA 4XPKA 2UVPB 3QU4A 1IWBB 1MD9A 1YKFA 1NMSA 5ALKA 4Z0HO 3T7IA 2O06A 2ODFA 4UFXA 3W5DA 3PL1A 2CXUA 4ZAZA 1BVHA 4MW1A 3NU1A 4QC6A 1FFBA 1JHQA 4E12A 4RIGA 5DYGA 4TUYA 4AUKA 3ANLA 5K8UA 3BI0A 4BCCA 1UOEA 2IEYA 2IXEA 1OXXK 5ALZA 2VXOA 1WX1A 2IEAA 3FMVA 3HFJA 4MFKA 4YJ3B 2OYCA 3PXEA 3DD5A 4IVQA 2UUPA 3CX3A 2WWFA 2BKEA 4HS4A 1J23A 4G1PA 2H1FA 3A3OA 1G8PA 4Q1DA 3JAKA 4DSAA 2ISSD 3EGEA 4Q3EA 3QELA 1MAVA 4C3VA 2VPQA 5E38A 1K9VF 3K1AB 1X1AA 5J4LA 4N3AA 3VQTA 4MKZA 1UOQA 2BL4A 3TMKA 5A1JA 4E5KA 3UVEA 2P6OA 1FDVA 3W9SA 2GM5A 2R48A 2UZ3A 4JDUA 3VBCA 1FQOA 3GEBA 5IHXA 5ALLA 4HPJB 1JLLB 4QGAA 3TE7A 1M2GA 2J30A 1F2TB 3DE1X 3I37X 3A4IA 1ZJ5A 2UYOA 4CLOB 3U19A 1BYUA 1NLUA 2ZI4A 4EMBA 4WN9B 1BWPA 3HCNA 2IDMA 1JA0A 1D2GA 4B73A 1BSVA 2ZYSA 4NESA 2ZS7A 3VO8A 2VF8A 3KR2A 2WTMA 4ZO4A 2WWTA 5LR6A 2QR5A 2YJ5A 5DNVA 1NWCA 4P34A 2PJ4A 2R11A 3KLPX 1EX1A 3N7TA 1KZFA 4EHBA 3HKDA 2SICE 5C7LO 1L4EA 3JQCA 3R7WB 3L77A 3CX6A 3CWCA 3EIXA 4LXHA 5CDUA 4FFOA 2PSSA 1YJAA 4Q4DA 4DIDA 2OFOA 5DN6A 5EKUA 1QSNA 2C2HA 3V4VB 2GPNA 2C2WA 3UBTA 1JL3A 3B78A 1GT91 2ATVA 4OBEA 2YWBA 4P4NA 4BOYA 4BNLA 2J9YB 2ZXFA 4E11A 3A3NA 1RE0A 4QPZA 4DDVA 5FBRB 3EIFA 3PSHA 3RK1A 2EO8A 2GBPA 1CVRA 2ZJ0A 3SBOA 3UFBA 3EVTA 1SHKA 2ZREA 1XRQA 3FHTA 4AKHA 3DZ8A 4ZZ0A 1YB2A 3N8DA 3X2EA 2HCTA 4UTPA 3I2IA 5AHRA 3K70D 1Y1QA 1NVUQ 2QL5A 2Q1XA 2I3ZA 2PWBA 1NM5C 2OMEA 4UEFA 1S96A 2GGSA 5CVTA 4QTYA 2VQSA 1DCTA 1RXEA 1QH9A 2HU8A 4F96A 1Y6FA 4RWEA 4CLRA 2IYLD 2CLFB 3CGGA 1HK7A 1VPWA 3ANYB 3KCQA 4WKOA 4J07A 4PCUA 3OMWA 4KNYA 3AM3A 1EUCA 1E9BA 4MR8B 3CCFA 4KSAA 1Y3HA 5AM2A 2VHJA 1QH8B 3VR6D 5IAKA 2ST1A 2OGUA 1VJTA 4YRAA 3C6BA 2FETA 4EYSA 1PD0A 1TM5E 2CVPA 4WESB 1ISPA 4U7DA 2FDRA 2RDMA 2G4LA 3Q0IA 3RFUA 1H8HA 1WSBA 2CVQA 2OOSA 2PUFA 2VK2A 3E9ZA 3SICE 3RRMA 5EZSA 2NLOA 5JISA 4NS1A 4PCAA 4D8TA 1AUGA 2Z2XA 4UXJA 4WJZA 3DNPA 4PN7A 2ZEEA 4AG6A 1EVZA 4GMXA 4LC9A 2C7PA 1RTQA 2C4TA 1NI4B 2G6TA 3VX4A 2PLWA 3FJ1A 5L3QB 1YBFA 1PL7A 5FD8A 4PGHA 1E5TA 3ISZA 1E1RD 4ID9A 3CRNA 3CH6A 5IUNC 4WKCA 3PQ7A 2G0BA 4CCWA 4B35A 1I4DD 3IQIX 2XHZA 1SHJA 4R9VA 3I53A 2WSAA 4KZTA 5LP6C 4B43A 3M49A 1ISSA 1YS1X 3UFXB 1MO6A 1A4UA 1Y4ZA 2IYNA 3PHLA 2CVOA 5THWA 4LJSA 3WWZA 2XUAA 1PQPA 4X65B 4IO0A 5LRKA 2ZRMA 1XE4A 3LPAA 4Y1FA 2IYPA 3ORFA 5FTKA 4UCNA 4RSHA 2C1XA 4JAVC 3L4KA 4UBNA 1OYOA 2OBFA 3KQPA 3FTPA 4UKDA 2PVPA 3JQRA 5KTSA 1TTTA 4MKFA 3WDMA 4CDNA 4TLBA 1J5XA 1XTTA 1OI3A 1R9JA 1KO5A 4Y1EA 1BJKA 1Z12A 4QOHA 1E4EA 3INGA 1TADA 3N2EA 2CFIA 4HEJA 4PG7A 2PM8A 2CV2A 3NPAA 2YHAA 2O3QA 2F8MA 5CHEA 1SBYA 4WNYA 5G3YA 2E4AA 4MEAA 5K0CA 1ZJZA 1TEZA 4F8JA 4NCHA 3HB5X 3KKQA 2XEIA 5IC6A 3QUBA 1PYGA 4H77A 4JP1A 2GWHA 2WLTA 2OD7A 1I0IA 4BQPA 5AKKA 3ILYA 4B32A 2ID8A 4ESVA 4ZHSA 5HRUA 5ALYA 4HN4B 4PSKA 2C9CA 4FBMA 4UPEA 2GOYA 5A3JA 1DXQA 4S24A 4U5XA 1EGAA 4X44A 3NHWA 9LDTA 1XJCA 4HF7A 3H2BA 5BV8A 2XBLA 3W5IA 4I1IA 1TRHA 4YJGA 3P4XA 1S9HA 1CR0A 1TTPB 2ID4A 3RKSA 3ETJA 1QSRA 5BR4A 4JBHA 3ICEA 1AK2A 5K2OA 1YQWA 1F0NA 5DM60 3SF8A 4AYXA 2J6BA 3GT0A 3WLOA 2DPGA 3P0HA 1Z38A 4M22A 2QRPA 4FYPA 1FNSA 2GCNA 3RHSA 1PT8A 4ENVA 4CM4A 1OY1A 1XPRA 4ZCPA 2LUOA 1Q21A 4K30A 2HUZA 1Z18A 3V8RA 2I1VB 2HWUA 3GLKA 1H0HA 5G1PA 2QP4A 3TLMA 4EUNA 2N1BA 1SAYA 1I6KA 1P7CA 5ALMA 3B2YA 3W34A 5FOTA 5I7RA 1FVHA 4D0SA 4FXPA 1PJ8A 1JAHA 3T99A 2EBHX 1HH4A 1A2OA 2FGJA 1A9YA 3V6MA 3ZTWA 3IH5A 2WTNA 5L45A 2YJ4A 3GRVA 1RPAA 1N5OX 2FQXA 1Q95A 1BJTA 2HJWA 2NYAA 3B3CA 4NL4H 3CZ4A 2HSDA 1XKLA 4ZEXA 4H1WA 1U90A 5C4IA 3R44A 3E22B 2KW5A 4II3A 2IYRA 5E9JA 1F8XA 4WD3A 4GW3A 5FO0A 4NJMB 1OGIA 2PUCA 2OV3A 1LX6A 4YI5A 3SPXA 1HDIA 4R6WA 5J9FA 1CZKA 2DT5A 2FCAA 3TRFA 2QVGA 1MGPA 3JR3A 5JSFA 4X3PA 2IU3A 3RRZA 2HR1A 3DKVA 4YACA 5AKZA 3O73A 2QVBA 3A9WA 4J0QA 4US0R 2G76A 3D68A 3SVTA 1Y89A 3QY9A 4I1OA 3SJZA 1PYOA 3GT7A 4C7HA 1XEBA 2VDWB 2GZMA 1DRVA 4KPYA 1JGTA 2AFHE 2Z58A 1NN0A 2BEJA 3GRPA 4M9UA 3SSNA 3IBYA 5B58C 3WSVA 3RUEA 4IUCS 2OHHA 1NR7A 2W37A 1RD4A 3B51X 4M6WB 1B76A 1PGPA 1N2EA 4CF4A 2FN3A 1GCIA 3QMPA 4NGNA 2WE7A 4ARVA 5BN4B 3O8CA 3VUEA 2E7ZA 1YVUA 2W6ZA 3ZCUA 1I30A 1NL3A 2Z8XA 1U7UA 1DXOA 2R0QC 3KR5A 2VAWA 1JJBA 4AZTA 5AMXA 3HMQA 1GARA 4QO7A 5DV9A 3IURA 3T38A 3JVDA 3V4OA 1GUYA 2GZHA 3WAGA 5FPPA 1WG8A 1UPFA 3AFHA 3KL2A 3T9YA 5KWSA 2QK4A 3TUIC 3CE9A 1LTQA 3ZQJA 2XWBF 1E1NA 4JXZA 4E08A 1DMSA 4F2WA 1L7DA 1XZ8A 3DDNA 2PA0A 3AUFA 4EECA 4HQRA 3H4TA 4D9IA 3O0TA 4M46A 1A98A 4C7OA 5EIXA 3KB1A 3OIFA 2OY0A 1GSOA 3P71T 1ZMOA 4XM0A 2Q6LA 5G02A 1RABA 3HZRA 2O2DA 4ZI5A 3BWEA 4LOJA 4Z4GA 1MG5A 4OSEA 3X0DA 4KVGA 4DFDA 4FHZA 1PVOA 2J45A 2Y0EA 3E15A 2PZMA 1PE0A 3WYCA 3UGJA 2QECA 1Q83A 1P8JA 3HZZA 4UU0A 3E18A 1MA3A 1MVOA 1KEVA 4HNRA 2Z0MA 4HQLA 4K6GA 2JGKA 4XJVA 4KOUA 2COEA 4FX5A 2PRYA 2JDCA 1BHQ1 4D1YA 2X0RA 4KIUA 2YBDA 4OQMA 3T5DA 1IY9A 1IOIA 4ZT5A 2RHDA 1F6BA 4MVJD 3CC8A 1AYEA 5EG5A 1ENYA 5J4YA 1RM0A 4X0EA 4BN5A 2RGRA 2AUTA 4ALMA 2VJMB 1H9AA 3OVMA 3UO8B 5G0WA 1LJ8A 3KJXA 1JG6A 3OCYA 4HYQA 4MFQA 2DUUA 2CV0A 3NHUA 1EEHA 4G25A 3O31A 2X76A 4DBVO 2DZDA 3K0CA 2Q27A 4BLUA 4KMOA 1DQZA 3L5KA 1EUDB 4EG5A 2AE2A 3QBTA 4W8HA 1PR5A 5SZJA 2PIAA 2J31A 2JIRA 3HBFA 3FPGA 3H9UA 2CNKA 3VHXB 3TZBA 3TUJC 1VIMA 3W6SA 1J8FA 1RYYA 4PXYA 4XCVA 5F3WB 1KZ6A 2BD0A 2ZBVA 1P9RA 1SBZA 2VZLA 3LKZA 1UBCA 2NOAA 3MAAC 3ITKA 3QX9A 3CFYA 3TRKA 2TMKA 1RT9A 1CE8A 2QIPA 3ZGOA 4ZTZB 3Q9UA 4J0HA 2JI8A 5THQA 4EFMA 3T35A 4MUJA 2I5PO 1TVMA 5B1SA 3DT6A 3PEFA 4KX5A 4GI7A 2Z83A 4DMLA 3T94A 5U4XA 5G40A 5DZSA 4DR1B 2H0RA 2XDQB 3I72A 3KT0A 1RQRA 3OFND 1L4MA 4TWZA 3IA7A 1J00A 2J67A 5EIBC 5BVHB 5EHZA 2O8CB 2BHLA 1Y6RA 1G19A 2O5VA 1E2UA 3HEMA 1I2CA 2FMUA 5C82A 1HDRA 4Z54A 4TROA 3QXXA 4P5EA 4EIWA 5AHKA 2B25A 1QE3A 3MT0A 5KDDA 4E4RA 2YDXA 1NVTA 2FZKA 3DBIA 2PUDA 1DQYA 4YBZA 1KJQA 1JJVA 2NXNA 1NE9A 3B2QA 4QFDA 4G5RA 2XE7A 4C0LA 4UASA 1XVUA 2HHCA 3P2HA 3EYAA 1H23A 4GLLA 1ID1A 1Z5NA 1KC1A 4EHLA 2Q21A 2GKOA 3K35A 1TUBB 1XLTC 5DISB 2QX6A 4DCPA 4L3OA 4GBGA 2CUKA 5FNVA 3BB4A 3HYSA 2BUAA 1YZKA 4BMNA 1VE1A 5DT9A 1KYWA 4RACA 1A9XB 1N3BA 1H2ZA 3FKSD 5C3UA 3F5MA 1Z5OA 4FW8A 2R6CA 3GRRA 4X24A 2B5GB 2HCFA 3PQ8A 4L9WA 5FTWA 2C5SA 1T9GR 1BPMA 4AXBA 2GNAA 1QGAA 3O84A 3TLZA 3C1AA 1S01A 4I4IA 3OOEA 1B2RA 2GHQA 4A38A 3E81A 4UAGA 2FN8A 3TJZA 3G59A 4EFDA 1X74A 4PQGA 2FA9A 2OCLA 2CZCA 3EBLA 1X3LA 2NXEA 5HVGA 3LMSA 1V45E 2IYSA 1TZKA 5BQ5A 1Y1TA 4J0DA 2HPVA 4I55A 1ZOSA 4KE6A 1J49A 3RTGA 3KLOA 3OIYA 1Y7EA 3ZJ4A 3RT1A 4Q4AA 1CDEA 4B5OA 4Z4FA 2B4AA 2A59A 2A5JA 1OHHA 5JOQA 4GX0A 3A3PA 4X61A 2QTHA 4E15A 1ONPA 4E2ZA 4J0IA 5ICGA 5CMLA 1KNQA 2KCWA 4CM9A 3PR3A 1D1SA 3A36A 1PDVA 1T8YA 3HA5A 3EB9A 3TX2A 2JLRA 2AN1A 5CLHA 4WZ6A 4ZV9A 4UEZA 2GPAA 4EVYA 3WICA 5HTOA 3TAHA 1UJNA 2CMHA 4IEFB 2PZAA 1WBBA 2NO0A 4J0FA 4W1SA 3MC1A 4KWHA 1FOEB 1JDBB 1X42A 1KK2A 3AVPA 1DTSA 1KY4A 1I10A 4RC9A 3VMMA 3I61A 3ZV5A 4JVNA 4BEWA 4TZTA 4CT0A 3PQ3A 3TO9A 2QM8A 3WFJA 3IPYA 4MA5A 4GI5A 1XDWA 3HJFA 4LXXA 1OBRA 3A14A 5DHFA 2ZZNA 1Y7PA 1NDQA 1S0UA 1DTDA 3CKKA 4II2A 2YYZA 2XOXA 2XRYA 1LDBA 2RAVA 4QLAA 1QQAA 4RX1A 4G1UC 1FLVA 3ISXA 2REXB 1YULA 4DANA 4GP6A 4MQLA 1W44A 4P3KA 3QV1A 3KZNA 2A88A 3VOSA 5FBKA 4D99A 3UGTA 4NATA 4UUPA 4TVOA 3URKA 3BMXA 5EIFA 5EIHA 2ZUFA 5DM4A 2A9QA 1ZS9A 2HFKA 5IBCA 2BBWA 4B4OA 4E3WA 4JHXA 5F5XA 5GOZA 4F2DA 3DVSX 3PI7A 3GHHA 2Q3MA 1LK0A 4WN3A 4OQFA 4UBKA 4IXWA 3T3PB 1VCNA 3GUHA 5CT8A 3T1TA 3GLHB 4RPLA 2PCLA 4PIVA 2IYFA 3LCUA 2V3WA 3UOGA 3NXSA 2WUGA 5AW6A 1M4LA 5EEGA 2VKTA 3KWMA 3DXZA 3BFKA 4L8GA 4FMPA 3TD6A 5IDYA 5E7QA 1CYDA 4LXUA 3HS3A 4JU9A 1KU6A 1WAMA 3WKCA 2CNBA 5AJVB 3OESA 1NRJB 4YJ2F 1CV2A 4OK6A 1TM2A 3PEEA 1NJSA 5FFNA 3ZOKA 1VCMA 1OGJA 3VI3B 4Q9NA 4XKJA 3F74A 3PVSA 4FYHA 3L4EA 5LNK1 3R5XA 4CT4B 1JDSA 3WRXC 3GBPA 1U8XX 3H17A 4DRXA 1D0SA 2VNJA 1EX6A 4IFIA 5I8WA 1VOTA 3B7PA 1CJWA 3Q10A 1BKSB 1XZNA 5DP1A 3LLCA 1AE1A 2V9PA 1QH1A 2JLWA 3BJEA 2B92A 3WK7A 2W48A 1YS2X 4PSWA 1M7BA 3PPXA 1DRUA 2YJZA 1JEYA 3EVCA 4OGLA 2QG9A 4N3NA 3LQ4A 2X8JB 1MQ9A 4HHEA 3ZY4A 4ZKEA 3I3GA 3ZU5A 4CIAA 4RPIA 4NGQA 1VQ1A 4PU0A 1HE4A 3TQOA 1P5HA 1YR7A 4N7RA 4LYGA 5LIPA 3NWOA 2J7KA 1D6MA 1FFXA 4LOAA 4AF7A 2DQSA 3L7IA 1I2ZA 3EZXA 3AY0A 4DJ5X 3IULA 2JEWA 4XWTA 4O4IA 2IGBA 2CNWA 1EM6A 5TF0A 3RFCA 5HKKA 4GT1A 4YAWA 4XTRA 5F35A 2FR0A 3MWLA 3GPLA 3DCJA 1GR1A 3WDSA 4MFPA 4MZDA 5HCUA 4REOA 5KYNA 2G5PA 5EL0A 1AGPA 3SE0A 3H86A 4DV2B 1HF3A 1W85B 1H6AA 3LHIA 3RO7A 3T5TA 4BFTA 4C4OA 5KTOA 2FSVC 4Y0NA 5CX4A 2O5RA 4FN4A 3V1YA 4EO9A 4MQMA 4XXHA 3HV2A 2UYGA 1GY8A 1JI3A 3ZIAD 1WXWA 5LA6F 1Z29A 5IDXA 4O4JB 3EC2A 1DTWA 3QKIA 4R68A 2CJWB 2XDWA 5JI2E 4MI4A 3H4QA 5JXGA 2A67A 4RZIA 1V1MB 3TKAA 2B1GA 3GDWA 2AJDA 1SWVA 4CMEA 4CJXA 4WZAA 4DSOA 2GJAA 1VB5A 2H5EA 4RTMA 4N9WA 4FPXA 4RAQA 2JFGA 1QDUA 2JLZA 1J22A 3PFCA 1GGVA 2I4MA 1HETA 1DAEA 2QN1A 2GZRA 5KTAA 3L8MA 5EIBD 2JKZA 2HWKA 2NPIA 4YCNA 3EC7A 4WKGA 4R01A 2W6JA 2C29D 4HC4A 3W90A 2BMDA 3I9KA 3HVKA 4MB0A 4ESOA 4K9DA 1PJ4A 3S1SA 2H1RA 3WIDA 4BUZA 3SR0A 2B4RO 3R7BA 4WH0A 2CXQA 1C9KA 3DKKA 1KWMA 4G5FA 4F0YA 5BWLA 1Z4JA 4XX0B 4BNVA 1OUMA 3DHYA 3Q88A 2OO5C 3QLVA 4JK3A 1TUEA 3N2IA 5BW5A 1NKTA 3UTDA 5EXTA 3QPDA 2WSBA 1IB6A 2WG2A 1BW9A 4MDYA 3SZ3A 4ZOLB 5M04A 3P9CA 1YW6A 4HNVA 3EHDA 3LQ1A 2JD1A 5L40A 2IHJA 3E27A 1ILWA 3UKDA 3OKFA 3LFUA 3FF4A 1H1DA 1GL9B 3KSUA 5LQAA 5CPFA 1FMTA 3GJ6A 5EY5B 2C20A 2WF8A 4NI5A 4CKBB 3OO0A 4P7KA 1WCIB 1G8KA 5CH5A 3NHZA 4HNGA 3PC8A 3QNWA 4MP6A 3RJMA 1N78A 3GKRA 2PA3A 4FMCF 1EFRA 1DEOA 2WK1A 3DLJA 3GOQA 3IKMB 5HH1A 5H3LA 2XB6A 5A7GA 4CG2A 4OQXA 5KJFA 4IGIA 4LSWA 1DDOA 2V03A 2ODAA 2MTBA 1KZ7B 1L3CA 1JYSA 3CRMA 4OLHA 3IEMA 4KAXA 3IV6A 1IGBA 2QN2A 1ZBQA 1EDEA 4PF1A 3R7LA 4A6PA 4BVFA 4EL5A 1FY7A 4P2GA 1LLUA 4BKOA 5GPBA 2WILA 1Z35A 1VC2A 2O3TA 2CMKA 1GRQA 3NNSA 1LSSA 1KI6A 4NV0A 4J16A 1VIXA 5B3JC 4CQJA 4EY8A 4QASA 3IMCA 5ICSA 2J3LA 4H15A 2BY4A 1LV7A 2BAGA 1YB7A 5KVAA 3FAZA 4AT1A 4K81B 4Y6GB 5G0TA 2QW8A 4ZC1A 1Y9WA 2P79A 4NBKA 1YSJA 3A05A 4G84A 1U81A 3EEQA 1PZHA 5CIWA 3HLYA 4HNQA 1KDPA 3SXJA 2ZUVA 3S5JA 1Y4UA 3KEFA 4Z86A 1VL6A 1TJ3A 4BRSA 1P91A 3VJMA 1R6VA 2FN4A 3VNUA 4G9BA 2CNOA 3DPSA 3EH1A 4NE2A 4GE0A 4Q82A 2P2CA 4A91A 3JD3A 3FYSA 3TSAA 3QUAA 4LMPA 1SCIA 1CUJA 1QO7A 1HDGO 1YVKA 2CF5A 5KNLA 1QOQB 2YXBA 4IFBA 3MRVA 5G0VA 4Z3KA 2OV1A 4S05A 5K8LA 2JEOA 2C4HA 3G82C 1XRYA 3FGPA 1XSEA 4YEDA 3TX8A 1R3DA 2IU6A 3BCSA 2Q4YA 2Q50A 4GOLD 4L8VA 4PQAA 1P17A 1SXGA 4OTZA 3P0FA 1NONA 1DIRA 1GGKA 4BGUA 1N6NA 4EEXA 5F9MA 4GWGA 2DBYA 2J41A 2ZRAA 3L18A 2GLXA 1JFLA 3Q6NA 3VJKA 4Y2YA 5EWMB 4IH9A 1WD5A 5EMLA 4RZHA 3ZPXA 3G2QA 4WCFB 5K3AA 1N3IA 3B7IA 5PNTA 1NFQA 4MHNA 4R54A 4HFNA 1SUCA 2GK3A 5BN1A 4C20A 3TOBA 4LRSB 2WYVA 4ZCTA 4L78A 2IBSA 3HADA 1RQ7A 1NLFA 3L2OB 3IEXA 4YRMA 1PG5A 3RO0A 2BYTA 4NONA 2IQ6A 3PXXA 1NWHA 5F21A 4ZALA 1U0NA 4KO3S 4R16A 3KE8A 2JAWA 4BCDA 2JFZA 3L79A 3B9BA 1UBSB 4WY8A 2H92A 2A0XA 3DMPA 4LS3A 4JI5B 3JUWA 2ADOA 1QNFA 1LAPA 1DXHA 1UFHA 2D8AA 4RD2A 1EYZA 1VL8A 2J0UA 1VFPA 1NG1A 4B6SA 5AK5A 4B31A 3F8KA 4IICA 1HRDA 2O9JA 3Q3JB 3QW2A 4ALNA 2L0XA 4GLJA 3A4TA 5BYAA 4QBIA 3FVQA 3RS4A 1O6FA 2V7PA 5F98A 3RIYA 4E88A 5AI4A 3D5TA 4DC9A 3K0EA 2BGIA 2CYCA 4EF5A 4OPMA 2IIBA 4DKJA 4RGVA 4EA9A 1G6OA 2WIFA 4E5MA 4D44A 3BFVA 3TLKA 5HYVA 4P35A 3H0CA 3RS5A 3ZZIA 3TQQA 1LPOA 3FYNA 2Z95A 1ODTC 4EKNB 4PIMA 3A9CA 3WLAA 4NCIA 5F49A 4HQNA 1SIUA 1THMA 5MGNA 2G9VA 4YP9A 3GUCA 1TLTA 4WV3A 3QA9A 4YAFA 3AESB 1O96B 2HX1A 3COWA 1KYZA 2GN2A 3VNSA 1P6UA 3DMHA 5SY9A 4CYOA 5F12A 3TKLA 3TWOA 3PE6A 4GBJA 2Z3ZA 4KIWA 2FUCA 3L02A 3GLHE 3RQIA 5D7NA 2IYOA 2ZJOA 4XJTA 1Q3TA 1LI5A 2OLEA 2CDBA 1XHLA 4B48A 2LBPA 3CUVA 2C42A 5C3MA 1X3SA 1GGFA 1ZK1A 3SHPA 4F21A 1VMKA 3PX3A 1OTXA 4ISCA 3HB9A 2NYUA 1P2FA 2PSJA 1L5FA 2QYOA 1J7KA 1GADO 5BSHA 1SD1A 1B6TA 4FFWA 3W05A 3I32A 3BSWA 4E2YA 5LM3A 2HWWA 1BMQA 4PZYA 2WFLA 4M36A 2ABZA 3OZAA 2CSXA 1IN8A 2ZTLA 4RF2A 4EI7A 2QVZX 4HEHA 1NY5A 3SJAA 1R74A 1D8AA 1EDBA 1RW4A 4GBED 4MJ8A 4E46A 5M3BA 4LCJA 3WA6A 3VR3D 2BWJA 3FUCA 2OZLB 3HDYA 1NATA 3ACDA 5BMVA 3IQHX 3W3AH 3AJ9A 2BEIA 3DVRX 3OOSA 3RREA 1DBIA 3ZBPA 4JGIA 2OKGA 2P75A 3LOUA 3S5UA 1U2DC 2QMHA 4DIFA 3VR4D 5DHSA 2ZXUA 3T5AA 7CPAA 4QXOA 3PB3A 4X63A 1ZD3A 3KQYA 1SUBA 3TQTA 1C1DA 3PD0A 4RABA 1CQJA 4MQ6A 2XUJA 1U7DA 1YKGA 3K1YA 5AVJA 3ZVRA 2XQFA 4UREA 3RV3A 3UJ8A 2QXUA 1DX4A 1F5NA 3MWJA 4X94A 2HK6A 4P5PA 3QKWA 3IMEA 2Q2NA 3QHQA 3O9ZA 3U3ZA 4OHYA 4L5JA 3EYWA 5AK6A 1CB7A 1VLZA 5L3SA 1JFSA 2AVNA 2PZGA 2XCIA 1DO0A 2JD0A 2Y0DA 5TGDA 4DR4B 2IU4A 3ZWYA 3WA7A 4DM7A 1P4HA 1FVFA 4CCSA 1ESZA 4J4BA 2EJTA 2V4ZA 2GUGA 2X7XA 1EIWA 2XAAA 2Z8ZA 4YS6A 4RJTA 4H7FA 1IXRC 3PD7A 2Q3FA 4I14A 4NC9A 4JXKA 1FPMA 3PX2A 4JVSB 4LHWA 4IHQA 3IO3A 3EH2A 4JD5A 3PHGA 3B3SA 3V4LA 2ONZA 3SG0A 3SWWA 4RJLA 4MRMA 2PVWA 2Z3VA 1Q1AA 2QRKA 2PTHA 3CG0A 4MOWA 4MNTA 2NIPA 3SS9X 1EVIA 4NGTA 1Z8HA 2BI7A 3BBLA 3G0CA 3PRYA 4KBFA 2AN3A 1SY7A 2G40A 3DEJA 4GGMX 2PD4A 3MTEA 1FNNA 2IKQA 2HMUA 4H08A 1QKKA 4CL2A 2HM7A 2O52A 2VBIA 4FFSA 2V59A 1EG2A 2D6FA 3C2QA 2ZELA 4RK1A 5E6RA 2HRBA 1WVGA 4LY0A 3JTMA 3FSGD 3W2HA 3MGGA 3WE7A 2V9CA 4NNJA 3PUHA 4RFVA 2AFIA 5A3RA 3H1AA 3SMVA 1WW2A 3V8QA 3KAKA 4GKJB 2FSSA 1OH5A 4CR7A 4XVHA 2D59A 2I4OA 3RADC 5ICMA 3F6SA 1W88B 5HR5A 1DKUA 3GDFA 3ASZA 1U4OA 1XJ0A 2ODNA 4R76A 4JHLA 4IFTA 3ZCQA 1KUXA 4JI8B 2PBLA 5LBIA 2F3TA 3KHUA 1NX6A 5CHYA 5CFNA 1YH3A 3WC4A 1KAMA 2Z2JA 2QN9A 2OCDA 4B3RB 3KYCB 4OB7A 1R9GA 2QX9A 5HJ7A 1JPUA 2BPOA 1GOTA 2HHAA 2FW7A 4X64B 2VK8A 4ZYYA 1ZPDA 3GZJA 5IS2A 3MTDA 1ICEA 2WJWA 1TF9A 3DBRA 1WLYA 3EQ8A 4OQ4A 2WWIA 3TO5A 2XCUA 3M1YA 4B6JA 3DG9A 4KBGA 3TE6A 1PK9A 4ZAWA 1L5GB 1EXVA 1SC3A 2OXTA 5EYPA 2AFHB 4OHVA 1HNWB 2VI7A 2YWGA 2CXRA 4M9CA 3E7FA 1K6MA 3CJTA 1G3UA 3OLQA 4EJSC 2QUKA 3UB3A 1EESA 3HP1A 2CHFA 2GAOA 1QJCA 4LZZA 4M0EA 2PJ1A 2PTGA 2POKA 2JKYA 3GJZA 4M0DA 1X80B 1C0EA 1ADJA 1BGXT 1KJYA 2A30A 2ZBEA 3CTMA 2EFCB 1XQXA 4ZAYA 1NN5A 2WE8A 5IKOA 2JAQA 1XN1A 2ZIXB 1DS6A 1R3UA 3WXBA 3LHFA 1XTQA 3PF8A 1ZI9A 1UMCB 3O3OB 2ZYHA 2B21A 1BO6A 2A9OA 2VNIA 3KJFA 1EQ2A 1R0ZA 1NW7A 3G68A 4C3ZA 1N0UA 1XTBA 2IVZA 2V7QA 1QB7A 4DC1A 3WC7A 4K6CA 4OSOA 2QE6A 1CUBA 4XQ9A 5AD1A 2FX5A 3JR7A 1RO5A 3A26A 2ZB4A 4RIHA 3FA2A 4Y49C 3BILA 4D79A 3Q41A 1J2JA 1IY7A 2RIRA 1I7DA 4N5HX 1W96A 3D6HA 3IT0A 4XUGB 3B36A 5TQ2A 4Z0TA 1T3LA 3EVGA 3PQ2A 1PUXA 1S4QA 5FBWB 4AJHA 4OYLA 4YC7A 4IJUA 3NEYA 3RVMA 3UK7A 1NAHA 4TLEA 3STVA 4A23A 1Z0DA 2C78A 3KDPA 2I7DA 3HRIA 4DUGA 1I14A 2VH1A 1L4KA 1XAGA 1RLMA 1E4YA 1YJQA 4QHYA 4GXRA 4N12A 1BO4A 3VPAA 5ECWA 3H9CA 4QELA 3HY4A 5A2GA 5CBKA 2QRZA 3D1VA 3VV2A 4WWHA 4MCSA 1Q2UA 2YJ3A 1E62A 4NMWA 2I78A 4HDKB 1NW6A 4HUQB 1LPAB 2FRDC 1JECA 4OI4A 3TO6A 4NZZA 1ZLIA 3U61B 1T0HB 1H5QA 2I1QA 4LV6A 2H6EA 5G0SA 4FTWA 4D9JA 3ILXA 3FF3A 5F9HA 1B2LA 5EJGA 3ZHQA 3ONNA 3FDFA 2VRWA 5A9RA 1RAIA 1LLQA 4X9XA 1WMSA 3WK4A 1Z17A 3ZE1B 2ZSBA 5AVSA 2DQZA 4HNXB 1US8A 1H69A 3EAQA 3O74A 4RJ2A 4OX9B 1M0SA 2PJ3A 1V37A 2ORWA 2GHTA 4BATA 4G5XA 3TNDA 4J0CA 3QEMB 4RK5A 4HQOA 3C6KA 4LAFA 4LF6B 3TTSA 3M4JA 4RKYA 2A6PA 2RAPA 3ZX4A 3QXSA 5B5SA 5LQNA 3Q87B 2GZAA 3I4LA 3TLEA 4U7JA 4LMAA 1JHZA 4DYVA 1O89A 3D4UA 1TKBA 2C5AA 3CRQA 5KNDD 3P0IA 3JWHA 3S28A 3KUUA 3TG2A 1RWPA 1JXMA 4LMRA 2V9ZA 3FVVA 3NHKA 4IDHA 5CYOA 1L1RA 5DN9A 2XB2A 5K6TA 1XRJA 3U44B 4ZT2A 3L8HA 1ULBA 4XWOA 1DJLA 5KJ1A 5AI6A 4I8XA 1RC0A 1GILA 4YJ3F 5FPQA 5BVGA 1MJAA 4NECA 2DWPA 2HMAA 1JKMA 4ME6A 1JSLA 4YCAA 1EJ0A 4N1AA 1JEEA 1NZDA 2XLBA 3RAGA 3UK6A 2E82A 5MFPA 2PRBA 3GNSA 3LT0A 1P1KA 2ATCA 1BS9A 2JLVA 2ZRFA 1YQXA 5HBGA 3FFBA 3MYYA 1BXZA 2AG5A 1RKXA 3MD0A 5GM2A 4BLOA 4XASA 4X1KA 1WEHA 2MYPA 2ZB3A 1IZ7A 3NFRA 5LZ7A 2C98A 5DGCA 1FTNA 2VNAA 1WKCA 1TD1A 3IAFA 4POOA 5L7TA 3BIWA 3DR3A 1LPBB 3OQHA 2JC3A 4QYSA 4C01A 1JEOA 4XWAA 4HWRA 2NGRA 4MHPA 1NVKA 1U7ZA 2FWJA 1ADYA 4WINA 3PKJA 1CUUA 4LISA 4EB8A 5CAEA 1T2CA 2DG2A 4RBNA 3CZCA 1FDRA 2P65A 2DSTA 3P1JA 1XZAA 2IOFA 3TPCA 5IFLA 4Q0MA 3GR6A 4YIHA 1KOJA 3ZGYA 4C0SA 1A50B 1OFVA 2W93A 1HLFA 4O2BA 3RB8A 1AZSC 4XPIA 3RD5A 5IM4F 4LV5B 4W9NC 3ROGA 4IV5A 3DDSA 4NXNB 1EVQA 2YNDA 3ZHRA 3Q7SA 4CEJA 3Q11A 2IYWA 4XIGS 3I5YA 4QUBA 4DV3B 4I49A 3G2OA 3FMIA 5GP1A 3RODA 4D4HA 2ZOSA 3SHQA 3NLLA 3P94A 5ETJA 1S7CA 4P38A 3KVRA 3OZDA 2X9QA 4RJKA 4FKBA 2MSKA 3JRNA 1UWLA 5TR9A 4L08A 1UWKA 4UM5A 1YOVB 1BXGA 1J0BA 1N2IA 4CI0B 2ZJAA 1YE3A 4I2VA 4N40A 1YU6A 4PPZA 5A5EA 4TXMA 3EGVA 2DFNA 5B1DA 3N8KA 3DOOA 4EJ0A 3F3YA 2KLHA 4BMCA 5B37A 1PUAA 2FHSA 5HSGA 1I6MA 2RGXA 5DULA 3T5CA 4XUDA 5HOEA 2N42A 1P6QA 2CW5A 1NBIA 1OLUA 2JFFA 1PLJA 5ENZA 3GQBB 1U0TA 1G9SA 3F71A 5HIMA 1L6IA 3CN7A 4FFPA 5IKEA 1KI4A 4GVPA 3EG9B 1L6RA 5LD2B 3FR7A 1V8PA 2E85A 3MCVA 3AUYA 3IVCA 4WFKA 4A94A 4E1BA 4PC1A 1BDMA 4G5OA 5ALRA 2ASVA 4MRSA 3OOJA 1UKEA 4OYYA 4MQ4A 3R3UA 1VG0B 3CXRA 3I1JA 1YR1A 2NU9B 2F1RA 1IY1A 4JR1A 1KEEA 1S2LA 1UBLS 4PXSA 3LAWA 4LRXA 3ZU3A 4HVLA 1NUQA 3C8UA 5D3MB 5M2QA 4DQVA 2CL0X 1WF6A 1T6ZA 2AA3A 5ALVA 1SKAA 4TVSA 3TLGB 1U3DA 2X2FA 3T3HA 4J7UA 5HA5A 2PXAA 4GVXA 2BOAA 4P4JA 5AKIA 2MR6A 1ZRSA 1K7SN 1AGRA 3EDCA 2ZJ1A 2ONCA 1MJGA 1YZNA 2J6IA 1NYRA 4D57A 4LNHA 4ZO6A 1NHWA 4MIKA 4Y9UA 4TV9B 3S9NA 3U26A 4N7MA 1GTL1 3CSUA 2BELA 1Y8QA 1X70A 3F0AA 4HZIA 3TZQA 1QKJA 4PC6A 2RGWA 4QIHA 4OIFA 1NY6A 1VLJA 1DFHA 4F7DA 1C7ZA 4RADA 1QYVA 5FOSA 4EI9A 2IF0A 3B6KA 2XIJA 3DM9B 2NXWA 4GE3A 1XX6A 1DDIA 4CRWB 3EXG1 2QU8A 2X9NA 1K8RA 2A1IA 1J4JA 1PJRA 3MTJA 3ADDA 3KYBA 4C4YA 4PYLA 4X84A 4JI7B 3SS8A 3DYBA 4AVYA 1CUHA 1XOVA 4M1EA 3JASA 3DWIA 4ON9A 1WJGA 2VNHA 4S35A 3VZQA 3FR8A 4BVHA 4LDAA 5IB0A 3GMSA 1L7VC 1SQGA 2X0KA 3LF1A 3RYHA 3BGWA 4BP3A 4YJFA 4AN1A 2QUHA 3JVNA 3JTKA 3KP1A 3NAQA 2XYPA 4CR8A 2X6QA 5J8FA 4ZJZA 1SULA 2J6HA 1I3OA 3DFUA 4MMOA 5ITSA 4EW6A 1O6ZA 2QMQA 2GNOA 5F1KA 3AF3A 3KV3O 2NTVA 3B3JA 4R2HA 2Q4TA 3GGPA 2YY6A 3K9WA 1KRHA 4ROSA 2HL6A 4J29A 4KPUB 2QSUA 5E6SB 4OAOA 3AHGA 3D6VA 3CXUA 5EHQA 2WHPB 4W9RA 2O4UX 5D6NA 1XJ5A 2FXVA 4GBMA 5K8MA 5GZ1A 1WB9A 3HO1A 2XTJA 3ZLJA 3SJCA 2VTBA 1RJ9B 2QTBA 4AW9A 3V5NA 3AUXA 1NXOA 2B4BA 4B9EA 3PPIA 2H48A 2ZYGA 2BTQB 4RF5A 3SQMA 3ZHOA 4BN0A 4E5PA 2AK2A 1L7PA 1GCOA 3UCEA 5CJPA 4MGHA 2Q0QA 1JT9A 5MN5A 4ND8B 2R87A 1KWKA 4Q7JB 1L3BA 3ON5A 3N87A 2QZPA 2HUNA 3FHOA 3RF6A 2OR3A 4P4BA 3FMGA 4YLEA 2AFOA 1JR3E 3THXB 3DVQX 1NP6A 3L92A 4GAEA 4CMAA 4S1TA 4OJKA 4QGFA 1EM8B 3FNBA 1XQ1A 4J1TA 1NI5A 1K5DA 1ATZA 4QU0A 3L7OA 2JLUA 1HRKA 2GN0A 4WZZA 4ZAFA 4LWQA 2CHQA 4PXAA 4QYTA 5H8WA 2FR1A 3IVAA 3KASA 1T2EA 3U13A 4G0WA 1Q12A 4QEDA 3NVAA 4MRRA 4A9AA 2GJ4A 3X2SA 2R8RA 4BX3A 4AWBA 3RQSA 1PWYE 4YQYA 1A1SA 5CA0A 1KIFA 5JD4A 4M6GA 4FOSA 3N8HA 1C2YA 4GZMA 3C74A 4EHHA 3GY9A 1EXMA 1VHLA 2VPTA 2ANPA 2YMMA 4CUKA 4JOQA 2RIPA 4JSYA 3MQ4A 3U40A 2C2BA 4EKDA 4V2UA 1XMBA 2JIBA 2B5WA 3CJRA 2PANA 3KETA 1IVNA 4UNPA 2PNJA 4LBWA 3DW3X 5KVSA 1OA0A 3ISTA 2QSZA 2I2CA 1IQRA 5ALGA 4CKWB 2VDPB 4MS4B 3QKRB 4EZIA 2Z5FA 6REQB 3K9QO 3VO1A 5KSOA 4RKQA 3VR5H 1V3QE 1C1XA 2P9GA 3DMNA 3H87A 2DKFA 4CMIA 3H2ZA 1CR2A 4MW7A 1BWRA 2CLKB 2Y67A 4D26A 1Q11A 4MJ7A 2D8MA 1KJNA 3TQFA 3G1WA 1DEHA 1Y0BA 1MAUA 1BE6A 3PWKA 4IGFA 4MJ3A 2IY7A 2WYUA 4OHKA 4UMEA 3DWEX 4NF1A 3ER6A 4O8CA 5KTDA 4G1EB 3UAXA 2R62A 5C46F 4QPCA 4BPRA 1QVRA 4BO1A 4MULA 3NHSA 3L4BC 3HY3A 3USES 3HN7A 4BC0A 4GNKA 4A33A 4LI0A 4AN0A 1OX4B 1Z3CA 1INLA 3AHDA 3TI7A 2P62A 3MCTA 1WOYA 1GA6A 1IONA 2IWHA 4JELA 1EE1A 1IN4A 3PUJA 3RBXA 3I04M 1O87A 4IS2A 5EE0A 4YMUA 2RHOA 3E0XA 5HIJA 1SH7A 4IHJB 2Z3OA 1M75A 3F9IA 4DCVA 4ZHQA 4KO4S 3MAJA 2R8OA 2DC1A 4CG0A 1UP4A 4YGOA 3K70B 1YZFA 2Z3PA 3ROZA 3DD1A 4FX2A 1CY4A 2CEAA 3ZBQA 1XRPA 3C3YA 2VHCA 4KNVA 3S7ZA 1H2AS 4LOLA 3GRCA 3I52A 2PGOA 1S1MA 5AHWA 5KKAA 1CUWA 3PB8X 3E4DA 2GHIA 3VR1A 3COSA 4RDIA 4XQCA 3R0ZA 1VRCA 3OLVA 3OAAD 2PJCA 3ESXA 1KZ4A 5JLJA 4FB5A 2Z9CA 2GF9A 3DF9A 5FBQB 1FL9A 4UD6A 2FSGA 2UKDA 2PMFA 1CHNA 3C3BA 5HPYB 1E2PA 2J7PA 2IBMA 1N6HA 1KI2A 4B3DA 4RETA 4S12A 5A4KA 4OC2A 3IOCA 1L8QA 1LBQA 1VECA 3SM9A 4NRDA 3C7TA 4MQ5A 2G82A 4QDJA 2Q6OA 2CHVA 4JCOA 2VR1A 1LTHR 3TOVA 5CEEA 4ASUD 1L4GA 1RYZA 3N86A 4PRZA 5IDQA 3OKAA 3L49A 3ISVA 1V5WA 1XALA 4KW7A 4QKQA 1A9PA 4GZLA 3TR6A 4MRAA 2JJ2D 2RH4A 3WWOA 5K99A 5HKAA 4N6NA 4D5EA 3PQ4A 4LDQA 1YV9A 4RD6A 3T1QA 4MRIA 3TW4A 2V77A 4CIVA 5LYIA 1LDGA 2ATXA 4MA0A 3S2GA 2GCPA 2ODTX 4MW9A 3ICVA 3ZHZA 3EASA 1ZD1A 4HNYB 2QW1A 4AXXA 1TQDA 2Y1LA 5DWMA 4QGGA 1QDLB 5ILOA 4AZVA 2R1ZA 3VXKA 3DA8A 5FQNA 2BFFA 3GJYA 2QL6A 1TF7A 2ZYVX 4ISBA 5CB4A 4JLMA 1LFWA 3PHBE 4D4JA 2XVMA 4EPRA 3OY2A 3UG7A 1EDZA 4IHJF 2ZEHA 3IIKA 3NM4A 3W1WA 1FJHA 2SKDA 4MV7A 5BN3B 1KP2A 4CI9A 2PDAA 3AOEA 4EHDA 3OSZA 2NU6A 3FCCA 3U9LA 1DXYA 5L53A 1QFMA 4MUGA 4FGLA 5JW6A 2XVAA 1C9EA 1BJRE 1C4KA 3UYKA 1MXHA 4BGIA 3AR3A 3CXPA 2C5GA 5H68A 1WULS 3IIBA 4RKFA 4MYSA 3N74A 1IEXA 2BV3A 3GPCA 5FR2A 3B3WA 3B20A 1E2LA 4ORFA 4K88A 2ILVA 5K0EA 1UWCA 2C61A 5EIEA 1OIVA 1WD7A 3EARA 3FXAA 1G7CA 5CH3A 3U39A 1BC5A 4OUDA 3JWIA 3JD0A 3P9SA 5D8NA 4CMJA 1M10A 4OADA 3MBKA 2HJVA 1MN6A 3AILA 3HWWA 4I1SA 2DWOA 2W4QA 2J3HA 3BC1A 1P0IA 3ND8A 1M2VB 2HO4A 2WWVD 1ZUD1 1ZK0A 3FEEA 2ZB2A 4IZHA 4LZWA 3S55A 3BREA 4J91A 1K3UB 3ZHXA 3MMZA 4AZ0A 4CTMA 3B13B 3JVUA 1P4GA 2EATA 2AD1A 1RQXA 3UJNA 1JR2A 3MJEA 2C5HA 2IHUA 4D9FA 1E66A 1T29A 4PLPA 3ZXUB 3OA0A 1LY1A 1OIWA 3QVXA 4RL6A 2BSAA 1RI2A 4EYOA 4JUAA 4X97A 2HSWA 3MJDA 5EMHA 2WF6A 5NLLA 5CB0A 2XNHA 1ACLA 2YVQA 4OOEA 5E9AA 1G0NA 1GCAA 1SXQA 3H84A 2G72A 4EHJA 1QOPB 4JJ8A 4FWUA 1XB2A 3VTKA 3QUTA 4CIYA 4HX9A 4ZZ2A 2VSOA 1Z9UA 1GQSA 5HEKA 2C9YA 4CIDA 3KLBA 3CW9A 1EXDA 3QTLA 3FYUA 4O2AA 1JHYA 3GBVA 4I6JA 2YNMC 4Y1GA 5DVZA 3PYMA 4Z1MD 1LSOA 5ECDA 2VQ6A 4FT4A 4E03A 2EXXA 4B3SB 3DFZA 3TB6A 3WGVA 4D0GA 1GQOA 3LCCA 2XUFA 3PNSA 1KFBB 3QV2A 3EDYA 1PNRA 5CNJA 4XIJA 2QGZA 3IP3A 1FTYA 1MK4A 4K9PA 2PX3A 4OKSA 4IZOA 2W0MA 3FOZA 4OJTA 3KSBC 3WC6A 2A4KA 4YUAA 4P31A 2DWCA 1K27A 3L84A 4N41A 5A6SA 1FUYB 1GRNA 1NNI1 1FUUA 2FE1A 3MGCA 1H22A 1U2ZA 3UXMA 1DOAA 3EA5A 5IH7A 2BKUA 2QTWB 2AFMA 4QM6A 3UMBA 3HVJA 4AJKA 4KO1S 1XEWY 1Y8RB 4F1JA 2AXQA 1P0HA 2G7MC 3NHBA 3JQAA 1WETA 3CV3A 3N0WA 2EG9A 1P3JA 7MHTA 1AUXA 3FN4A 3ADBA 1NQOA 4FEEA 2VN8A 2PR2A 3HR8A 4KVFA 4G5HA 1QPBA 5KOHA 4V2IA 5LJLA 4WDRA 2ES4A 2SCUB 3WTCA 5HZKA 5DLPA 1RKBA 2HXYA 5TE9A 1DELA 1P19A 4N0MA 1QMPA 2YFHA 3PRHA 4Q1VA 4A4DA 4BKPA 1U3VA 1UDWA 4ZI6A 4E6PA 4G26A 1CZNA 1QYIA 5KYUA 3G5TA 2NTEA 2P3LA 4D9GA 5C5IA 2C4KA 4LEIA 2PGDA 2PKQP 1GSIA 1SUWA 4S3MA 1G3MA 1JU3A 3LZ6A 2P4EA 5K3BA 4R7GA 2YIDA 2BFEA 3W8FA 1QTIA 4G36A 2WC1A 3BMNA 2OZGA 4YRGA 2ZAIA 2QN8A 4TWAA 5F9FA 5LWQA 2ZRHA 3TD2A 1XYVA 1G8GA 4DLYA 1NFFA 1FNCA 4CKCB 1AGXA 3LBNA 2PFKA 2V45A 3LBFA 1KYYA 3DJFA 1H2EA 3BTVA 4I6EA 3GU3A 3HKEB 1GUZA 1UMBB 1R6BX 5GZ6A 3I2KA 2X7HA 4GM0A 2RB7A 1OT3A 2ID9A 1PEAA 4DUZB 1ENZA 5ILGA 3PVZA 1ULTA 2WPNA 1LU9A 4A36A 1L4BA 2R8BA 4ANFA 4KXVA 1B8NA 4EGQA 2YY5A 4X1OA 3OFKA 1G9XA 4YN3A 5GADl 2WT9A 3NGXA 4TM8A 4OB8A 5JSZB 3HKCB 4URVR 1IICA 3G8BA 2TRSB 2EBJA 1Q2XA 5KTRA 3LBHA 1JAXA 2CJYA 3OIUA 3OBBA 2DECA 1PW5A 9LDBA 4QFMA 4AU1A 5FDFA 5K1ZA 5FA6A 2EFDB 1P2VA 1XZGA 1Q7RA 5CM9C 2P9QA 4ZJUA 1XF1A 5FLXA 3AB7A 2AC2A 2FWBA 2ECKA 1B1CA 5I4BA 2C2ZA 3WGKA 1GDHA 4HMOA 4OIWA 3FI9A 5DGDA 3JQPA 4ZQBA 3C7CB 2GPBA 4IIYA 2EW1A 3HWX1 2G8NA 5KU7A 2WVHA 1USGA 3GELA 2QBYB 1EUYA 4YMLA 2R8VA 2V5VA 3EISA 2G17A 2FAXA 4YWYA 3A4YA 2AMJA 1I80A 5FF9A 3JQ8B 5DW0A 1MAWA 5K03A 4WFIA 4MR9A 1U8ZA 4PANA 1BH2A 4LGMA 2PSEA 3IOMA 1GTSA 2DERA 3JQBA 3HYCA 4Y2PA 4OMEA 5IVKA 5LP6B 4GLOA 1N33B 1IZ9A 4DV5B 2OQIA 4O4JF 1F7UA 3OIVA 4MCPA 2Q7BA 1GO2A 3LE8A 4TZ0A 2JGEA 3MT7A 1NXPA 2O0HA 4YDQA 2L17A 2C31A 2X2EA 3LL4A 4YLYA 4MTLA 3AFGA 2HEGA 4LXYA 4MHTA 1C2TA 2JGFA 3WWCA 3CONA 5AHXA 5EGNA 2H1HA 2D1SA 2FWRA 3GG2A 1XNHA 1ZM3A 4TXJA 2XZLA 1XC7A 4TKVA 2M1XA 2D1FA 3FM9A 2A5LA 1EWYA 2VZ0A 2G06A 3HBJA 3HJRA 1XZJA 2H9AA 4QDKA 4YNBA 2QE7D 3QKUA 5JI3E 1JH9A 2IXAA 3P2EA 4Q05A 4AM8A 3TVDA 4IO1A 3TM5A 3E9RA 3I04A 4NOMA 3ONVA 5FL3A 1JLMA 1DKMA 3WTBA 4YDSA 3QNVA 4PK2A 3G2JA 4HXFB 4FLFA 2ZCJA 1TYAE 3F7OA 1KFKB 2IYQA 5IKXA 5LDGA 1DARA 3WGYA 5KNBD 1USWA 1DRWA 1VBNA 3E3OA 4MIOA 2PWAA 2PN1A 4DZZA 1WR8A 4Y6SA 2C8VA 2H9IA 1XEXB 2WV7A 3H0KA 1KKMA 4UDOA 4ZOLF 3ECSA 5T67A 4KFUA 5CH8A 1T91A 1K8XB 4DLWA 3BMOA 2JK1A 3ZHSA 2R751 4I9UA 2RBKA 1N6KA 1O94C 4A15A 2HLDD 4QRDA 1JALA 1Z5ZA 5JXJA 3GVXA 2EHDA 1FVXA 1D03A 2OOKA 2I76A 2QYHA 3O2JA 4H4DA 4OI1A 1VJGA 2UYYA 4QJ4A 1M2JA 4H4CA 4F46A 4B84A 3CUUA 4IIFA 1GRRA 1UK6A 3OIDA 5IK2A 5B7NA 1YFJA 3RYFA