2HB6A

Structure of caenorhabditis elegans leucine aminopeptidase (lap1)
Total Genus 174
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
174
sequence length
489
structure length
489
Chain Sequence
TQVLVRNGIQAVGDGLTSLIIVGKKSVLKNVTFEGKFKEVAQKFVTDGDSWNSMISRIPASGRHPLHYELAHLITVPDASSRGNTPTNAHSIYKELKPINYPEDTKNVHFVLFAEYPDVLSHVAAIARTFCKFSMKTSGIRELNVNIDVVCDKLTNEDAVFLTDLSESVRETARLIDTPANILTTDALVDEAVKVGNATGSKITVIRGEELLKAGFGGIYHVGKAGPTPPAFVVLSHEVPGSTEHIALVGKGVVYDTGGLQIKTKTGMPNMKRDMGGAAGMLEAYSALVKHGFSQTLHACLCIVENNVSPIANKPDDIIKMLSGKTVEINNTDAEGRLILADGVFYAKETLKATTIFDMATLTGAQAWLSGRLHGAAMTNDEQLENEIIKAGKASGDLVAPMLFAPDLFFGDLKSSIADMKNSNLGKMDGPPSAVAGLLIGAHIGFGEGLRWLHLDIAAPAEVGDRGTGYGPALFSTLLGKYTSVPMLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal Structure of Caenorhabditis Elegans Leucine Aminopeptidase
rcsb
source organism Caenorhabditis elegans
molecule tags Hydrolase
molecule keywords Leucine aminopeptidase 1
total genus 174
structure length 489
sequence length 489
chains with identical sequence B
ec nomenclature ec 3.4.11.1: Leucyl aminopeptidase.
pdb deposition date 2006-06-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00883 Peptidase_M17 Cytosol aminopeptidase family, catalytic domain
A PF18295 Pdase_M17_N2 M17 aminopeptidase N-terminal domain 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10590 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Zn-dependent exopeptidases 2hb6A01
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 2hb6A02
3GUXA 2I3CA 4OC4A 5CPAA 3HLPA 5DS0A 3RBUA 4PXDA 3SJXA 5ELYA 2PCUA 4RUHA 3VH9A 4UEZA 4R7MA 3PFEA 2BO9A 1HDQA 2CIJA 4YWYA 3V7ZA 2PJ7A 4X8IA 1XJOA 4P4IA 3PB7X 3FEDA 5LYIA 4ZY0A 4A38A 4TNUA 1F57A 1DE4C 1YLOA 2WYRA 3FJUA 2FVGA 4X2TA 4UEEA 4EMEA 4P4DA 4MHNA 4UIAA 5HXDA 4DUKA 2AFWA 3DLJA 4X3RA 2CF4A 1IY7A 5JH9A 2JEWA 2PIYA 2ZOFA 3KGQA 5F09A 1LAPA 2O4HA 2O53A 4A37A 1F2OA 3CPAA 3NH5A 2HB6A 2PJ4A 3VATA 1AMPA 3BI0A 3H8FA 3KQZA 4WJBA 3GB0A 4Z65A 4OKOA 3IWWA 1Y7EA 3B7IA 4ZX8A 4P4BA 4ZI6A 4OC1A 3KI9A 2J9AA 2DEAA 4MCQA 3KHZA 2Q43A 3NA6A 3FF3A 4EFDA 3B3SA 4A39A 2PJ9A 3JRUA 2VL1A 1XBUA 3ISZA 5HVFA 3D4UA 2Q4ZA 3IJ3A 4MHZA 1R3NA 2PJ2A 1NSAA 2ZEDA 2PVVA 3NH4A 3NFZA 3BI1A 3SJFA 2GLJA 5HVHA 1CBXA 1VGYA 4OC5A 4W9YA 1VHOA 4OIDA 2GREA 4IAVA 2V77A 3LMSA 3RZAA 2CTCA 3H8EA 3V38A 1VHEA 4MCSA 4NJRA 4FBEA 2OOTA 4IHMA 3ISXA 3TX8A 3B35A 1TKFA 4NFRA 4OIWA 4P10A 4WWVA 4P4FA 4PQAA 4GM5A 1YSJA 1Q7LA 3D66A 4AXVA 2ZEOA 5LRGA 2V8GA 2PJAA 4EWTA 1YW4A 2PJ1A 3B3CA 3FEEA 4P4JA 3BXMA 1YW6A 1Y0YA 1BAVA 2CTBA 3N5FA 3KL9A 3WC6A 1BPMA 1H8LA 1YMEA 3B3TA 3FMCA 2PE3A 4MXUA 1BPNA 2PJ5A 3PEIA 2EWBA 1CG2A 4NGMA 3IIBA 3SI0A 1VIXA 4R76A 2PJ8A 1Z8LA 2AFSA 2BCOA 5HVGA 4P45A 3D7DA 4OC2A 4UIBA 2V8DA 3IFEA 3B2YA 4G1PA 2PJ6A 1LCPA 4B6ZA 4MCRA 5IB9A 3QNVA 1RTQA 3IC1A 2ZELA 2C6GA 3FVLA 1ZG8A 2IMOA 4MRIA 5JGFA 4P6YA 3D7FA 3H8GA 4PXBA 3MRUA 1CPXA 1ZG7A 1FT7A 2XEFA 4F9VA 5K8OA 3KZWA 1LAMA 5LYDA 4LQGA 2AFZA 2HC9A 8CPAA 2QJ8A 2AFMA 1HDUA 3KQXA 1QMUA 1TF9A 2JBKA 2ZOGA 2EK8A 3HUVA 2PJ3A 3S9NA 5THWA 2GLFA 4F9UA 2C6PA 2PJBA 4NJQA 4DJLA 1BLLE 1Y0RA 4NGRA 2C1CA 3D68A 3PBEA 1Z2LA 3FX6A 4P4EA 4JZ0A 4DYOA 5LYLA 1JQGA 2RB7A 1ARMA 1TKJA 3B3VA 2RFHA 4R6TA 4OMEA 5I4MA 1Z5RA 3IO1A 3VARA 2ZEFA 3K2KA 2V8HA 3PB6X 3TC8A 1PYTB 2ZEHA 3WC5A 1TKHA 4KSIA 3PRTA 2ZENA 2PRQA 3CPXA 1R43A 4FWUA 2ZEPA 2QVPA 3LWUA 1F2PA 2BOAA 4FUUA 3PBBA 4R8FA 3L2NA 4ONWA 4UEFA 2XEIA 7CPAA 4JYWA 4MCPA 2PJ0A 3PB9X 3SJGA 3S9MA 3K9TA 2G9DA 4CPAA 2PVWA 2AFXA 2ZEEA 3D7GA 4ZY2A 3T8WA 1AYEA 3FECA 3D67A 4MMOA 5D8NA 2IQ6A 3S9LA 2F7VA 4BD9A 3SI1A 5D29A 1ARLA 2ABZA 5K8PA 3B3WA 3NH8A 4ZYQA 2AFUA 2ZEMA 3KASA 1KWMA 1DTDA 3I1UA 1ELMP 1IGBA 4OC3A 1TXRA 3KR4A 3IEHA 5K8MA 3CT9A 1LOKA 1ZG9A 4A94A 4UF4A 2Q51A 2IJZA 3D7HA 1ZLHA 4YU9A 4ZX9A 4MHPA 4OP4A 2PIZA 1XMBA 1TF8A 1GYTA 4PXEA 4PXCA 5K8NA 1CX8A 4ZY1A 1QQ9A 2XEGA 1UWYA 3KHXA 4O23A 5J1QA 1LANA 1CP7A 5LRJA 2PJCA 1HEEA 3WABA 2V8VA 2C6CA 3FH4A 4MHYA 4NGTA 5LRKA 3GLJA 5CBMA 4TWEA 3RAMA 4P44A 3PB8X 4FAIA 3SI2A 1EE3P 1LFWA 4F8ZA 3PB4X 4NGPA 3WC7A 2QYVA 1OBRA 2GU2A 3SJEA 3BHXA 3KR5A 1XRYA 1CPSA 2XEJA 2AFOA 1CP6A 4PPZA 2NYQA 1PCAA 3MN8A 3CDXA 2JBJA 3WT4A 2ANPA 2F8HA 1XFOA 4K3NA 1ZLIA 4OC0A 1ELLP 5JM6A 3PFOA 6CPAA 5LYFA 2EK9A 3DGVA 2ZEGA 2NSMA 4H2KA 4Q7AA 2POKA 4NGNA 4IK2A 4NGSA 2OR4A 1M4LA 1FNOA 4NGQA 2WZNA
chains in the Genus database with same CATH superfamily
1Q1GA 4J0KA 2JLCA 2HU2A 1QGED 1YGPA 2ZB4A 2CNKA 3KOOA 2AG1A 2YNMC 4X66B 2CYBA 2ZTHA 2A84A 4B5KA 1E2UA 1OXBB 2HZBA 3GJYA 3CRW1 5T6MA 3A1FA 2Y77A 3B7WA 4B33A 1XE3A 4HUQB 4DYDA 1Y1LA 2B4DA 1HL3A 1WCXA 1WQ1R 5F5LA 4FSHA 1XQ1A 4N18A 4YBRA 4UDOA 2NVUB 5GVRA 3SK0A 4EHNA 1WB4A 3EZYA 1BA3A 3FZYA 2CIJA 1YZNA 4E2WA 2ZJ1A 3NWOA 4ARZA 4G26A 4YAIA 4X8IA 1DPGA 2DR3A 2UYYA 3WGOA 2ZWIA 3AJRA 2XECA 1B93A 2ATRA 1E66A 2I4RA 3K9NA 3N2GB 3ZLUA 2IPAB 2UYGA 4U00A 4B0OA 3Q6NA 3PQCA 2OORC 4F5EA 1XIVA 2ETXA 4QELA 3EEFA 1QDEA 3L79A 3OOHA 3QWHA 1NF2A 4G1CA 1BXKA 3RTAA 2QD5A 3T52A 4G01B 3KEMA 1UBTS 5EP4A 4AU1A 2UU9B 1Z18A 3TLKA 1Q19A 1CR4A 5AI8A 4DA6A 3IKTA 1N2ZA 2PWBA 2G4CA 3ID6C 5AH0A 1Q7EA 2QSZA 3PTZA 1Z8WA 1IEQA 4AUNA 1AIPA 1YHNA 2I4TA 1U9ZA 1CR1A 4EELA 4YREA 3ZE0B 4KE6A 3HPQA 2PJBA 4LRYA 1K5DA 4EDFA 3H2IA 2X3UA 1Y3FE 1IM5A 4R2IA 1NU6A 3UY5A 5CDHA 2J0QA 2X9GA 2O0HA 3FPCA 4ZICA 1K2WA 4HH3C 1II8B 4NIMA 5GONF 1P3Y1 1OZHA 2O1SA 4LTMA 3NH9A 3S55A 3U4AA 4QLOA 4JLSA 3IAEA 1FFXA 5B37A 3WY9A 4TLLB 3C41J 3EXHA 3MELA 3P4UA 4K3VA 4NCAA 1F51E 3O75A 3QSGA 1X1EA 3MLAA 3ZW7A 4TRNA 4EF4A 5C8VA 4ENWA 1MIHA 4DSZA 2A35A 1LVHA 4ERXA 1Y7EA 2KWIA 3H83A 5A3JA 3R9EA 3H8VA 1GGJA 4RTSA 5FLYA 1E9EA 2HBZA 1CUSA 3VYTB 2H6EA 3VR1A 2H4ZA 2VF8A 1Y3CE 3O83A 4J16C 3T1TA 1L5WA 3LHDA 1KMIY 1LRJA 2B6NA 4KWCA 3RS3A 1RCTE 2CFRA 1XAHA 1I3CA 3TTXA 5CB0A 1OLSB 4CEIA 2A4NA 1J8VA 5HVHA 4OI0A 1FU4A 5K2OA 1E2NA 4RDCA 1PUJA 2R4TA 3DMTA 2FCAA 3JYOA 3INGA 5DMHA 1EFRD 1U04A 3FPGA 4NH4A 1JPNA 1RBZA 4OHBA 3TX6A 4EUSA 5LBTA 5C8ZA 3IJ3A 1QGOA 3S4YA 3H9BA 4UZEA 2H1LA 1MK4A 4EG3A 5I5EA 1NSAA 2HMUA 3NHBA 4PPYA 4F46A 2ZXFA 4TKVB 2ZRCA 1CY8A 3DVLA 3C5EA 3IBGA 1IJFA 2ZXEA 2EC5A 2FEOA 5HJ2A 3BI1A 1CVLA 1XQYA 1RC8A 2IX9A 4YASA 5IS2A 5LLSA 1BDMA 1I80A 5JWOA 2IE0A 2OHGA 4TN5A 2VI5A 2GUGA 2XB9A 2QTCA 1M0TA 3CPHA 1BGXT 2GZSA 2SKEA 5TMBA 4DJAA 2W58A 2Q6LA 3D2PA 1EE1A 1PHRA 1C7IA 2XMSA 3GMDA 4RCYA 2MTBA 5KTYA 3P96A 4OQNA 4BVHA 1D7AA 4HQ0A 3THWA 1HKUA 1P39A 3BK2A 1IATA 3F8TA 4C2BA 4K6GA 2O2DA 3EG9A 2AX3A 4FBGA 4JOCA 3KYIB 4OFWA 3RKUA 1CKEA 3SF0A 5C0OE 4JK3A 3GLGA 1VKNA 3TZLA 2QRGA 2YQ5A 2WTMA 3SF8A 4RPHA 3KR2A 4JYAB 3I73A 1EFHA 1H6BA 3NBZC 2GD6A 3JQAA 2W0MA 4LWPA 4M60A 1LLDA 1PT6A 4ZZ2A 4DILA 5ES4B 2XKAA 1GZ4A 1VMAA 2TMDA 2Y05A 2VDLB 3EVGA 3EQ8A 4X1KA 4AF7A 4E3WA 4ER3A 1JHPA 4E51A 5IZCA 4R2JA 4NZPA 3GV0A 3P2KA 1P5JA 4OJTA 5AW6A 1NL3A 2JFXA 3B7PA 3K9HA 2NUAA 4H7FA 1Z8DA 1GV0A 2QQFA 1NI5A 3EIEA 3N87A 1TVMA 5EP1A 5G0VA 1AXGA 2FPSA 3BEOA 4UVDA 3R6LA 5TQJA 2XVZA 3WGJA 3BXHA 2B3TA 5EWLB 5EWJA 2UV8A 3V55A 1L6IA 4D46A 1FP4B 2F43B 2H1IA 3L5KA 3CZCA 3QLVA 4OLBA 3RS8A 1ISPA 1Q7LA 1YSJA 4GLJA 4MIEA 4S1NA 4IJUA 4ZOLA 5CLHA 4LGMA 5FT9A 2HR1A 1OZPA 2ZEOA 2CFTA 4HF7A 4DNFA 3ZEAA 2ALJA 2I71A 4NWIA 4S1VA 4UE3S 4PG4A 1DC7A 2HKIA 5D8DA 4DM4A 4LFBB 3DG9A 2XUOA 1PS0A 3EBOA 4OG2A 3PPYA 4C7VA 1XYVA 2PRJA 3R96A 4AWXA 3EFOA 5ADWA 1RPZA 1I24A 1JTEA 2IYAA 3A3NA 4BWYA 4DDUA 1QU2A 3S2GA 1NBMA 2XWPA 1AC5A 2QL5A 2VP0A 1IHOA 1O54A 1OPXA 4M7RA 3W5DA 3KL9A 2HTFA 1ENPA 2GH1A 4G25A 2ZANA 3VNBA 3FX2A 2ZJ4A 3OO0A 3M7IA 2C82A 2N9UA 2JFPA 2QTMA 1EAMA 1PD0A 1W47A 2ZPUA 2AXNA 4MUIA 4Q1FA 4MP6A 5C1PA 4F4HA 2NO5A 3LSYA 4BV8A 1R5BA 1CS4C 1KARA 3HA5A 4KUEA 2AJTA 1RXIA 4MGEA 4I6JA 3IKVA 3QAHA 3KKLA 1OGJA 2EG5A 3BFJA 2MT9A 4KOEC 1T2UA 3ONDA 4Q4AB 1XAIA 2GGSA 3FOEC 2VSQA 1UBCA 3BZWA 1JHMA 3L7BA 3Q8XB 5HWSA 1FXSA 2Q4OA 1ZITA 3EE6A 1M8PA 2Q4EA 4JC8A 3IGFA 4KFSA 1WCIA 3B2QA 1W88B 3F97A 3KE9A 1UM9A 2REQB 1A5ZA 3DEKA 2QORA 4IVRA 3QXCA 4UUOA 2J5XA 4XJVA 1GZUA 2ADMA 2NO0A 3D0RA 3NAQA 3O2JA 3DM9B 4O5OA 2AFIB 4DBLC 1F2UB 4OC2A 4UIBA 4XM0A 5B2ZA 4ZU6X 1EE2A 1DUSA 4WERA 1YLEA 3KYJB 1DBRA 5EXSA 2LDBA 4F45A 2PDOA 2RI1A 1PJRA 4Q9HA 4KO1S 3M81A 5IJ9A 3RLIA 4GPTA 4K28A 2QNRA 2XD4A 2X41A 4Q3KA 2APJA 1POWA 1Z2DA 2A9FA 4R54A 3V3KA 5JCXA 1KAGA 4KYUA 3UJ7A 3C0KA 1AURA 1E0DA 2IU0A 2ZELA 2ZR0A 2WW8A 3EF3A 4DV2B 2C6GA 3FVLA 4TLBA 3IDAA 2VDMB 3LRTA 2E1RA 3T5GA 4YROA 3N9IA 3V4FA 2P75A 3M6WA 2PAAA 2FRDC 3DQQA 3PNMA 4EF6A 2J5RA 4NS1A 1ENOA 2EWMA 3VZBA 3GVHA 3NANA 4F9EA 4L74A 3NRCA 5HK8A 4BO1A 2GWHA 5JE8A 2WYVA 2P1RA 4JZKA 1ML3A 2B83A 3N2KB 1Q92A 5EQJB 1C4OA 2OPHA 3RFFA 3ZDZB 2CT8A 4M7PA 4TKLA 3HDGA 1C2TA 2FGJA 4K40A 4GT1A 2W2LA 2E5FA 4DPMA 2R00A 2EKPA 2N46A 2R1UA 1N5MA 3L1KA 4C4TA 2MSWA 4HGZA 4N3GA 1ZO0A 3G8DA 2ID4A 3VR2A 2PR8A 3PXCX 1QGUA 1R6VA 2DTXA 1PR3A 2GZDA 1ULBA 4BQQA 3PHJA 5GOZA 1FDUA 4J3NA 4AULA 4CTKA 1AOXA 4D8UA 2IS6A 4G97A 1VL8A 1TEXA 2AR9A 5TJHA 4ANFA 5LQMA 5GJBA 1N9GB 1M3SA 1M1YE 3ZDXB 5B1YA 4F9UA 4GDMA 2Q3LA 5H0IA 1XKXA 2W9XA 1CIJA 3CX7A 2BE9A 2H4JA 2R8ZA 3FOZA 1PDVA 3LT5A 5K3FB 4G23A 4PCVA 5AI9A 2JGJA 2UVQA 3C8HA 1OY1A 2REBA 1YE3A 3TLXA 3DXXA 3GLRA 2RGWA 2N75A 2BFCA 3O94A 4MYHA 3D68A 3URKA 3PBEA 3H6HA 1R6BX 4CKBB 2CLCX 5E6SB 1JLKA 3NYIA 5DWVA 5D3MA 2JLSA 4F96A 2CNWA 3AU8A 3MMXA 4G8DA 2CHUA 3LUDA 3NWEA 1JA1A 4GIBA 3AEKB 3G2JA 3O4RA 5HJ5A 4QX6A 3P1JA 3KT0A 5F9HA 3L02A 5LYLA 2OOSA 1MD9A 3X1XA 5K3EA 1ADFA 2RB7A 1B8VA 3MBKA 3V7WA 3ZH9B 4WK2B 2D13A 2ZZNA 4EG1A 5EIEA 4ITUA 2RGAA 3K72B 5I4MA 2PZ8A 4PW0A 4AY6A 1W5BA 4UUBA 3UBMA 3AOEC 2WIKA 2Y8EA 2JVKA 1A3CA 2NV0A 1E32A 2C3MA 4CHGA 5IN4A 2ZVDA 1M4IA 3ETDA 3FNRA 3SC3A 4MFJA 5M29A 5SY4A 1N5IA 1ZYUA 4K8OA 4WHMA 1IBKB 1NJ6A 2C4WA 4KR0A 3DR8A 3GFGA 3CVXA 1N5JA 4XDZA 5LXTF 3AP1A 2EJBA 2J3IA 4WY5A 4LNUB 4L15A 2DH6A 5IBRA 4E5UA 1OWLA 2ZENA 4DEVA 4ZEVA 3H42B 1JVBA 4O2AB 4FMPA 2W6ZA 2MSCB 4HGRA 1NSYA 2X0FA 1I3NA 2VLBA 4MKFA 3S1SA 2YX1A 4AG3A 4Y2VA 4HNAB 4MPPA 1KI6B 3K6JA 2BZGA 1VJGA 3M2PA 1QHSA 5CDFE 3IP6A 4GI3A 4N8EA 1DFIA 2WIDA 2Z0MA 4JSYA 1EUDA 3CO5A 5FEMA 1A9XA 4KFCA 3MS2A 4WN9B 1HDYA 1KEZA 1QHFA 3ZR4B 1N33B 1AZLA 1HURA 5NLLA 4M6GA 3T6KA 1N2IA 4RIIA 5EMNA 4NL4H 4R2HA 5AKGA 3O3CA 1A76A 1PV1A 3DBOB 1RWXA 4L9RA 3NHUA 4R0NA 1BIFA 1CJCA 2WEKA 1S1MA 2XDYA 2I33A 3BFXA 4Q9LA 1GNVA 4A2QA 2WFZA 1SCIA 3NBKA 2AEMA 4FILA 2VTEA 3WB9A 3W2GA 1MB9A 2AQKA 1BTOA 2QLBA 4FOOA 4C3OB 1N3IA 1WPXA 3CWQA 3UOAB 5JXHA 1U98A 1XQXA 4IY1A 3PGLA 2HK7A 1BN7A 3NTRA 3KJNA 5TPZA 4XYLA 4JLBA 4ENRA 4CIYA 1WSDA 3QW2A 2XYPA 4UM9D 1E8NA 4IMPA 4CMBA 4MAFA 4ZI5A 5HCNA 3Q9NA 3KQUA 4Y98A 1CJVC 4FINA 3IB6A 3TSWA 1E7SA 1WXIA 1UZMA 1W9MA 2A5LA 2VWPA 3JZMA 4IH9A 3H4IA 2F43A 1KU6A 4OXQA 4YRNA 2JLMA 3I4LA 5EBVA 2QL9A 3A4IA 3AH8A 2VP2A 2WM8A 4IRUB 3R4VA 4M0EA 2GJ4A 1YVPA 2NW6A 5CFNA 3Q12A 2N0SA 2AJCA 3BORA 3M4NA 4DIFA 3ZVNA 1RKUA 2YNDA 2IITA 3KZOA 4PG8A 3KJFA 5ILGA 2QRVA 3ZBUA 4JJ7A 8MHTA 1TYZA 1YZKA 1ZKMA 1RQPA 3R41A 4U1RA 2D0DA 4QHSA 4MVWA 3D43A 1RSZA 2YMLA 3QLUC 1GPJA 3C3KA 1RIIA 4C4YA 2J3MA 5LD2B 3BIJA 1NXWA 3WMEA 2Q9UA 1N2GA 1QWOA 3PD1A 3IO3A 2XSZD 4IHQA 5I8ZA 3WA6A 3ZQUA 3FTDA 4JODA 5KYXA 1YZHA 2G04A 4OP4A 2BEWA 3KQWA 4MUXA 3HSSA 1XQ9A 4ECEA 2B25A 2JJMA 1C14A 2VOJA 4HMQA 3THWB 4OQDA 5MN6A 4EB6B 1ZC3A 621PA 3IULA 2QTNA 2ZT7A 1NBME 4PN3A 2ZJFA 2H0AA 3OZDA 2NU8A 1JILA 3QX3A 1GTVA 1NAHA 1YJ8A 2BHSA 1CUHA 2Q2NA 2Q29A 2WI8A 4KE7A 1G19A 3D4NA 4M55A 1T8RA 2C84A 1FSFA 4PFKA 2XQKA 3TK1A 5FHRA 3SWWA 4EPXA 5IV0A 4PNEA 1RRFA 2G9QA 5DLYA 3R4CA 4NHOA 5AXAA 4BCCA 4KQWA 4TT8A 3JQ7B 3NKVA 1UMCA 2Q45A 2JJ8A 4G07A 4CLDA 4E11A 1SCAA 2FY8A 2G83A 2JEYA 2WHRA 3LVQE 5GM1A 4DCJA 1DMRA 3LOQA 1T5TA 2GBCA 3VJRA 2WE8A 5BYAA 1Z88A 1M0EA 1Z7WA 3IXQA 2L17A 3H0CA 2GU2A 5H1YA 2O4CA 4XCVA 2CJFA 5FWXB 1JEOA 1XXLA 2X23A 2RAPA 3C6BA 3DQPA 3N59A 4KAAA 1FL9A 1PJZA 1C9KA 4IJ6A 4L5BA 4BO2A 5G41A 4QOFA 1UDBA 2IYRA 3F98A 4JB8A 1GL6A 1Z83A 3MIZA 1O94A 3R8XA 2V4ZA 4PYOA 5EP3A 4D1YA 3B2NA 5EWMB 2EAUA 5ELXA 3NR2A 4B3FX 5EJ5A 1FIUA 2YWGA 1IN1A 3FVTA 3NM5A 4ON9A 1ECJA 2P9YA 1CQJA 1J2UA 3NYWA 3PUIA 3UAZA 2EFDB 5MGNA 1E2GA 5TPWA 2R7NA 3NTUA 3I9SA 4NSQA 4OHZA 5C7OO 1JBEA 5E6RB 2BI8A 3FCAA 1FUIA 3L40A 4BE7B 5K8NA 1FMCA 1YKGA 4Z53A 4GMKA 2F1RA 4Z8XA 3H5NA 4Y2PA 1E69A 2ZUUA 1ELLP 1TD9A 4FDMA 3ZYCA 7REQB 3ZLJA 1L1EA 1KK2A 1UJNA 1YQ9A 3G68A 1I13A 4AG7A 2OR4A 3C3AA 2ZFUA 4HFRA 3U4HA 4EGFA 5B58C 2H52A 4NGQA 2YZ7A 4B9AA 1T1GA 2JZNA 4F8JA 1KYTA 1I7PA 1E6UA 1Z82A 4FZ3A 5IX8A 5CXSA 5JPDA 1IAQA 5I8WA 2B94A 5ARBA 1G59A 1XNRB 1CU1A 1DFGA 2I2WA 4RS4A 4BLVA 2FDRA 3AGQA 3FH0A 2AEEA 4POAA 5BWAB 1IMOA 1XTJA 1N3BA 2ZTMA 3O4FA 1QB7A 4TS9A 3X0DA 4EKEA 3ZXIA 2CN1A 3EJ6A 2BFDA 2PA0A 2WU8A 2OVBA 1JSRA 1UPXA 4E08A 3CVVA 2O7NA 3AWIA 2QTVA 4TSKA 5BV1A 2AE6A 4PFQA 2I76A 2JD2A 5L40A 1CXZA 4JOBA 2YBDA 3B48A 4BDSA 4C6HA 3K1JA 1U2RA 1VLVA 2GNPA 2Y0EA 2YXDA 3KUXA 5CLFA 4MR7A 1TW2A 1ATZA 3AEXA 3T5CA 3FVQA 2PH3A 4L4XA 4ZY0A 4JA0A 4MPDA 1QOPB 3QOYA 4B47A 3CZ4A 3O7WA 3UJHA 3W1EA 3RJZA 3QP9A 3LFTA 4LSWA 3U0VA 3OLWA 3C98A 2KI5A 2PS3A 1B0ZA 4CNBA 3ASYA 3R0VA 1FW6A 2PO7A 1D03A 4WD3A 4NAUA 2QSJA 4PZ9A 2AYZA 3BKWA 3KIPA 3DTVB 3DFKA 1BE6A 1ORIA 3AZOA 4P0PB 4DIMA 4MHNA 1AK2A 1JX6A 3OQIA 4ND5A 1TIQA 2B3VA 4A6DA 4E2YA 1IYKA 4D5GA 1KQNA 2OESA 3V4LA 2ZUFA 1MPXA 5SZJA 3AKCA 2F9MA 2C9YA 3S27A 3NU1A 2GBFA 3KDSE 4ZEOA 4C07A 4Y6PA 3BRWD 1N6PA 4RF3A 4GMGA 1X38A 4IDDA 3KS9A 3E1SA 2Y6UA 4TMTA 2AG5A 2Q1UA 3F1LA 4Q6BA 1UPAA 3KJIA 4BU1A 2KJQA 3O8QB 3WK9A 5AVQA 4FUTA 4QICA 3HK2A 4NOJA 3NH5A 1ZINA 3TXXA 3RK0A 1W35A 1ELOA 4X71A 2DPHA 3H1PA 4X91A 2IBMA 5IABA 3AJDA 3EWIA 4G86A 2V6MA 3SOPA 4RK1A 4C4XA 5BNIA 4CGLA 1L4LA 3TXAA 4TYMA 1Z5VA 1BD4A 2UUPA 1GGNA 3EVZA 821PA 4TTIA 1Y4DE 4CM5A 5CDSA 3OQPA 4CKXA 2ST1A 3N70A 3S81A 3G6WA 4QT4A 3RASA 2Z1DA 4OC1A 3O4GA 5J4KA 1YIDA 4UJ3A 3BTUA 1MX9A 1EFLA 4BNDB 3PVZA 5K8VA 4BL5A 4FI3C 1UBJS 4MKHA 5IKOA 1B73A 2RFLA 2V9CA 1U0RA 2B61A 5AVTA 1FS4A 4M0KA 4K9OA 5ELMA 3FYCA 4UA3A 3QF7A 1ZPDA 2FSPA 2JGDA 1EK6A 2JCGA 3IAHA 5I9SA 2CB9A 2ESRA 2HOQA 1T8PA 4X3PA 2IYOA 1TMYA 1EXVA 3BSFA 4KVZA 2IKQA 2D3TA 2RHRA 3R3XA 3BXGA 1S7FA 3VUEA 2AMFA 2GA8A 4KRFA 2EF0A 3S2IA 1VKOA 3W5BA 1MAUA 3M1YA 4TQAA 2BN4A 1Q2CA 2ZYHA 2E2WA 2X4LA 3AR4A 3HADA 3OEED 4HTFB 4A0QA 5I4KA 5LL6P 2Q6IA 4X1IB 2W6QA 1EE9A 5J40A 1M0SA 3BYZA 3UJDA 1IPEA 1EGMB 2YN2A 4EAQA 3DLBA 2FHPA 3ROXA 3QU9A 3ISJA 4FDTA 1CG6A 2BEJA 2VAXA 2WF8A 3ADPA 4L5CA 1NBAA 4Z0HO 4L28A 1WW8A 3E9CA 3SJFA 4JBNA 5HEKA 3W5JA 3DF7A 1XMXA 4QJ3A 2PGNA 3NT5A 3ZJVA 1RYFA 3IBCA 2X3FA 1RHKA 3VU9A 2Q0QA 4RHFA 3I6BA 3ZZMA 4ZJZA 2GD1O 2EFEB 2CHEA 2J41A 2L19A 2WZBA 3ZW9A 1VMDA 3FCSB 3NAMA 4EPYA 2AQ8A 2IYWA 4G56A 5K8LA 2X5OA 2Z0ZA 1R4NB 2QN7A 1P91A 1RBQA 5J2UA 4WJKB 2YIDA 4IJVA 4D9GA 5C46F 4E5KA 3F5DA 5EIXA 1ODFA 3LMSA 3QPUA 3NIWA 1W36C 2G3TA 3VR4H 4V0KA 2CTCA 3G0IA 1FP1D 3V8BA 2YRWA 2PE5A 4LDPA 2PKWA 3GHHA 2BTEA 2QDXA 3O21A 6ABPA 1NJ2A 3BN3A 5B58T 3TYXA 2C07A 1VHEA 4LUAA 4BMDA 4FBEA 2ZIXB 3MWLA 1S01A 2RH9B 4MUKA 1NM5A 3ZKWA 1J23A 4MV1A 1YJAA 4RQUA 1NJ8A 3LPCA 5JAUA 1CRQA 3CVWA 5C9ZA 5FI5A 1MX1A 3GJ0A 5K7SA 3G2OA 3DNSA 5B57C 2IPMA 4LI0A 2HU5A 3HN6A 4I7EA 4MRRA 3LT0A 3NS7A 4MVJI 4ID3A 4ZAWA 1BOBA 2OYSA 4PTYA 1KWKA 1Z25A 2BEWB 3P2YA 4FDLA 4MUBA 3ZLTA 4HGPA 2IDZA 4D9JA 2A9PA 4NJMB 3FHCB 2K4MA 3LC2O 5ENVA 4PANA 4DBZA 3FRMA 5E3HA 1DG9A 3I1FA 2OT3B 1OB2A 5G1ZA 3IUJA 1YVKA 3A27A 2HD4A 5AOVA 3IHTA 3UF0A 1NKVA 3I0NA 4COKA 4JJ8A 2I79A 3MTEA 2BFEA 1DJQA 2BFFA 2HGZA 3PEYA 1I2DA 3CLVA 1ZGBA 5AYVA 1Q0HA 1ZOOA 4LYDA 3WAJA 4ZOQI 2HK9A 1QP7A 5LBUA 2A4MA 3RU7A 1AGRA 4IIBA 3ODGA 2NLOA 3VZRA 1EP2B 1Z2LA 2RHWA 2YFQA 3DVAA 4J2TA 1XZCA 2FXFA 1V95A 3OHPA 2RCYA 3M9LA 3I0ZA 1H1LB 2X8AA 1ADYA 4QO8A 2PR1A 4UBIA 2YJ6A 3OZTA 3MTBA 3QEKA 1KMQA 2Y2UA 3JPYA 2HUPA 4QTYA 2G6BA 1U02A 1D6MA 4MRVA 4D9HA 4ESOA 5HZMA 3STTA 4YMVA 2WILA 3F9IA 3HE3A 3OM8A 1KI3A 2O2EA 4EMSA 4QODA 1PBTA 1S02A 1A8SA 4Y6OA 3IBTA 4DQUA 3MAAC 1EX9A 3DE0X 4ZWNA 4NMXB 2C42A 3G85A 1RZ3A 4MMXB 1FUEA 3ZWAA 4BN4A 3T1YB 1JQJC 2RHOA 3HCDA 3D4BA 1VBFA 3BK7A 3C2QA 1NWCA 1Q14A 3ZOZA 2FW8A 3FPEA 2NGRA 4GXTA 4YCJA 3F8SA 4MSUA 4CQMB 4YAGA 1F14A 5CBKA 3KSMA 4F6AA 2GPWA 5C1IA 3CA8A 4DT1A 2I80A 1Z74A 3MBIA 4OQEA 1X1QA 3EOZA 4EYSA 3IWWA 4BFSA 1YVRA 4J9VA 1TAUA 1F8GA 4ZOEA 4PF1A 5TS3A 4LHWA 1GRNA 1E9BA 5JPIA 3TFYA 2VK8A 1S7GA 1VGRA 3QNUA 2WG1A 1H85A 1OVGA 3DS8A 1XR3A 1ZD8A 4IQ0A 4LOJA 1UFHA 3L9WA 1X19A 4GC5A 2M98A 2AE2A 3TDKA 1IJKA 1XZFA 3OLCX 1MAAA 3TEMA 1LBSA 4YGOA 3AM3A 5C8YB 1FT7A 4G0XA 4GYJA 4BHTA 3CXUA 1IHUA 3I42A 3K0HA 4FE7A 1EFAA 3MNFA 1ZK2A 4ZEMA 1JZSA 4TS4A 3BZUA 1ZQ1A 3AFGA 3EHEA 5ED0A 1AQNA 3EPKA 4EY3A 5L4LA 4CV2A 2QJ8A 4RKYA 5H82A 5I7HA 3OPYI 4ARZB 1VGQA 2F1KA 3UUEA 4OJNA 5LQAA 3DR6A 1KH3A 3LKVA 2C7RA 1QXSA 4PQRA 4RL4A 1SKBA 5JTTA 4U5YA 3FRJA 4BP9A 3ZY2A 4CV0A 3UBTA 3GDOA 4NCKA 1U0TA 4KZTA 3KZVA 4JJAA 5I5GA 3A0RB 4O2BA 1JAIA 1OC4A 1Q7CA 1JPJA 3CNLA 4F9GA 1NYTA 3UWOA 4AG5A 4X63A 4LVNA 1D2RA 2PEYA 3ANLA 4GNRA 1VYHA 1XP5A 3NBMA 5E1OA 4BMSA 4YYZA 5I7OA 1BCSA 2J3DA 3GUHA 2J0UA 1DQYA 1QG4A 2FAXA 1G20E 1RFLA 2VH5R 5I9MA 3ZD9A 4DNCA 1GRCA 1C3JA 4N6NA 3AVQA 3RUCA 1BH6A 2XUIA 1TDJA 2PGOA 4OYRA 1Q3HA 5A06A 2DUNA 2QVZX 3GEBA 2JBAB 1CNEA 1SVWA 3CNHA 1ON0A 2JFYA 2VAVA 4LGYA 2EZTA 2JCBA 4JQYA 2ZZKA 4YMLA 4FFRA 4DV1B 1ZN9A 3CN7A 3GARA 4M99A 5A9RA 4US2R 1Q0QA 1Z34A 5HIIA 2A33A 1TXGA 2ZUTA 5HRAA 2QTVB 1M6VA 4D98A 1RJDA 3OCUA 4MWEA 4U6NA 1OYWA 1H4QA 4YDRA 3VR5H 2ZEFA 1SY7A 4JUAA 4OQFA 1LLFA 1WUYA 4CETA 1UMBA 1VZ3A 4JP3A 3QF4A 5ISMA 3CXSA 2OV1A 4WVLA 2BL1A 3ROEA 3VVCA 4RKWA 1Z08A 1FTYA 4F5DA 4H1WA 2OMEA 1HLPA 1ID8A 1QH8B 1K63A 5KDDA 4G1EB 4NMLA 4TKMA 1Z6ZA 2WF5A 3B1XA 2CLEB 4H1HA 5HBGA 1NVVQ 3UFBA 1P2UA 3QTLA 1A8PA 5AI0A 1WDKA 3DXFA 5E8JA 3MYYA 3OMWA 3ZS8A 3QXSA 4MFQA 2P8SA 5AJYA 1TT5B 5FTLA 3RNLA 3AL0C 1P9RA 4E31A 4I9UA 2ZJZA 4WXMA 3W1WA 3PBBA 4R8FA 1SVLA 3A2NA 1QRUA 1GGKA 4WESA 4GPZA 3U7EB 2BM8A 2OBFA 3HCAA 4MXDA 1R50A 4DNPA 1DCFA 4PZCA 3QPAA 4JROA 4AZTA 1KBQA 3ICCA 4YJ3F 2QW0X 5HUHA 3SXUA 1YQXA 4CL2A 4BS9A 1YB1A 1YFLA 4GM0A 3LO8A 3V3TA 1L8AA 4TXLA 3LA6A 3KTAA 3D8HA 4QOIA 2XXBA 2LV8A 4U9ZA 2G9VA 2XLBA 2IBSA 1Z5UA 4FE3A 1YTLA 2ILVA 2VWHA 2AD5A 1Z4NA 2XUPA 3TT2A 3AF6A 3H1EA 3ORHA 5L51A 1A50B 4JKYA 5EKDA 1DVRA 5BNFA 1HYGA 3IYLW 1A8UA 1KJIA 2R66A 3DBVO 1GCIA 4BLWA 4CAVA 3E5NA 3EVBA 3IDFA 3GG2A 2IGTA 3E15A 4XLTA 1SC4A 4JI3B 1VRVA 4YH1A 4MV7A 1NJFA 3B1KA 4DXAA 3BSYA 5LQDA 1A95A 3G8BA 2HJSA 1A77A 3I9V6 4W9RA 3WNCA 3P9PA 3DUWA 2PS0A 5BMVF 1IPFA 2IK8A 4S04A 2PFKA 3VGPA 1ONOA 3B1FA 3DL0A 1K5PA 2P4UA 3X2FA 4D4IA 1MJAA 1HFJA 3K32A 3BJ8A 2FE4A 3JR7A 3RS0A 4HWTA 3T9BA 5DM4A 1FFHA 3V1UA 4RA9B 2G3YA 2P41A 1D0VA 5EMHA 3OCWA 1IGBA 4JVOA 1X7WA 4PZEA 5BR4A 1L4FA 4CL0A 4NV0A 4D8YA 2ACWA 1G4HA 4MTLA 5EC8A 5CH5A 4OI1A 4DLSA 5ICEA 5A9SB 4EB6A 2I34A 2CLOB 1F0NA 2PN1A 2W98A 4D44A 4DMHA 3GLFB 1QZ3A 3RJMA 2BEKA 2R0QC 3A58B 2X58A 3NJRA 2FWNA 1BJRE 1YRWA 1UKEA 3HY3A 3PUJA 4G0YA 4JVSB 4QU0A 4NG4A 4N3AA 1GLNA 2YXNA 4W8OA 4GQAA 3LQ4A 4P4UA 4CLRB 2AOVA 1ZLHA 1TOAA 2JAXA 2W8ZA 3G5UA 4X61A 4ABYA 4A15A 4AUMA 2BHRA 3C3WA 5DRTA 5FRDA 4YT2A 1E96A 1BHQ1 1JW9B 1RC0A 2FMKA 3A4MA 1LKZA 1SBIA 1T6XA 1AE1A 3JQGA 1GRRA 3ZNPA 1T24A 1QMGA 3DZHA 4M86A 4CGOA 3MWEB 1CF2O 3SHQA 2ZSUA 2H1FA 3T7KA 1N5DA 4LECA 3NM6B 4PC2A 1CQIB 1CFJA 3CRMA 3SIRA 3JYPA 1FRVA 3ZDRA 4XUGB 1ZAKA 2ZSDA 5AG6A 2Q4BA 3FUUA 4DG9A 4DCGA 3GLJA 2C4MA 2WZQA 4ES6A 3JQAB 2R1TB 3KXDA 3LUHA 4ME6A 4F97A 1D6NA 4GMDA 2Q2VA 3GRAA 4L0DA 5FPYA 9LDBA 4D8VA 2H1CA 1YC2A 2GJSA 2ZYGA 3L4SO 4EL0A 2WSSD 2J8ZA 4LWZA 2GM4A 2FEXA 4B3HA 4QLAA 5LDDC 1W36B 1E6LA 2QS9A 3M5CA 1CPSA 2H2GA 1ZW6A 2OILA 3DBHA 3NHRA 2RJNA 3BPSA 3TH5A 3TSYA 4BJ6A 2NO4A 2WKWA 3Q8WA 4FEAA 2O5CA 1ZHOA 5DPMA 3CGWA 3DHVA 5MHTA 1MJ9A 4PPZA 1QAMA 1SKUA 3E3OA 3IIJA 3LCUA 4XX1A 1TEZA 2IH5A 2E89A 3C48A 4Y0VA 5DLPA 3SE7A 2X9VA 1KUYA 1UBLS 3DC2A 5K6AA 3NDRA 4FKZA 1H69A 2GOYA 3HKDA 3PD0A 3O9MA 5AOBA 1MFPA 5DGIA 4ND8B 3OF5A 4WKNA 5IAJA 5ITZA 4P4SA 1NI4B 1ZUNB 5JU6A 1ZLIA 3I32A 2H4HA 4B13A 4F8YA 1XPOA 1L6RA 4PQFA 5J63A 5LYFA 1XNHA 2IDJA 4DMKA 1V4NA 4R5MA 4JXQA 5IT9A 2POKA 3GB0A 2YHSA 3OOWA 4HNSA 2JH3A 5E9WA 2Y27A 2AYXA 1JT2A 2WHXA 3FWKA 5HK9A 2QPOA 4FDVA 1AMOA 2PA3A 4Q3DA 2JCYA 4L8GA 2EP7A 4JI0B 1V2GA 1E7RA 4RQTA 2QYHA 3SR0A 5LOVA 1O89A 1NYLA 2D54A 3I09A 4M8SA 5K3SA 4D4LA 4RK4A 5HZHA 2PX3A 2NXEA 1G6KA 2AS0A 2ZIWB 4IIXA 5D1NA 2PRKA 3VTKA 3KLMX 1EGVB 5DX0A 5CIWA 2FSIA 5F1KA 1E2DA 1I30A 3JVIA 2P9GA 2JIZA 2BDTA 4AP9A 1PUIA 1NULA 2PLFA 3ZS9A 1XVTA 2AA3A 4CN9A 4Q01A 4C89A 5ELYA 1RWVA 2CCKA 4CIWA 3UMFA 3LOPA 4BVEA 3MB8A 2R7HA 2I78A 4C6RA 4ARUA 4Q18A 2J8RA 1U5CA 3T3GA 4NFLA 4ONEA 1DBPA 5AT1A 1RPJA 1C9DB 3WYAA 3EJWA 4AZSA 4OMDA 5BR8B 2DFDA 1SKYE 4D81A 4GC9A 1ORVA 1YOVB 4URXR 4KXVA 3QSYA 4HEJA 4NG5A 1Z2CA 2DETA 1T13A 3DW3X 4G84A 2JRCA 1N6HA 3ETLA 1G8MA 1NMXA 4JQZA 4MARA 2NQ2C 2XE6A 2ZW5A 3M6LA 4ZGYB 1S3GA 4KAJA 5K3FA 2FVGA 3RYTC 4F7WA 3BA1A 1K9SA 2Q44A 2HXSA 4M37A 3SQOA 3DR3A 2WT8A 3GHYA 3P2OA 3W6UA 1YDHA 2R9VA 1WDLA 4RZ3A 2A88A 3NG1A 3WGNA 3EVNA 1D4OA 4ZTZB 4QOEA 1IDOA 1A04A 3VTFA 1JLLB 1SOAA 4WZ6A 5AR1A 3OJXA 3U9LA 9ABPA 2JFGA 2J6HA 2K7FA 4FB5A 4KQKA 2IOFA 3PEFA 2AZMA 5BQFA 2ZOFA 3WL8A 4I81A 1H2XA 4BNVA 2NXWA 4MY0A 1KY3A 2FU5C 3C74A 1DIHA 4FEEA 3UHFA 1WW3A 1Z6XA 2O4HA 4N5LA 2VBCA 3AG5A 1HE1C 1U0NA 2H5IA 2ACEA 2RK3A 4U2BA 4ZGGA 1H0KA 4WAUA 4OHRA 1BMFD 1SHTX 3JWIA 5HF6A 4F3TA 1WBJB 1REQB 4NBTA 1RYMA 3WSTA 4H6PA 1R9JA 4ZAZA 5JNTA 3BWMA 4OB7A 2J3HA 1KMCA 1X1SA 1A1VA 3EDMA 1V11A 2X4IA 3EZ2A 1FXUA 2IU3A 1UC5B 4G89A 2VDUE 2IXBA 2ZRGA 3D4PA 3TTTA 1OI2A 1JIQA 3C1AA 5JZOA 3ZY3A 2QMYA 1B8UA 4WK4B 2FEAA 5LMZA 3TR5A 4XGIA 2ZYVX 3T94A 1IB6A 3GJQA 3O3MB 4UVHA 5E0OA 2HLPA 2P6NA 3QA9A 4N47A 4BEBA 3V4VB 1NR7A 1M2OB 3H05A 1G55A 4OP3A 1VG1A 3COZA 3PQEA 3K6RA 4C7MA 1T2NA 2DWCA 2P5YA 3ZI4A 2FE7A 4XR4A 1QHEA 3TR0A 4B3JA 1KTIA 1O57A 1H2ZA 3ZWMA 4I19A 4G5SA 2OECA 3RIGA 5JISA 4QULA 4YRZA 2O8EB 4YAWA 3B36A 4L2IB 2I0FA 4D96A 1TC2A 2YUTA 2X9NA 3LQ2A 4BBZA 1YGHA 3KKEA 2C4VA 2YV3A 2E4XA 5A6SA 5J47A 5L3SA 2HT6A 5JZSA 1KKLA 4BEWA 2RGUA 3AKEA 5JSUA 1LRZA 2XQJA 3AWDA 3F8WA 3K4QA 4N7BA 4MGHA 4QECA 1NONA 1VDZA 3TEJA 3MGKA 4HWSA 3PR1A 2ZRNA 4ZJYA 5A1TA 1E3MA 1VSUA 2L18A 3PC4A 1IK6A 1SQ0A 3UIEA 1HDZA 3REOA 2C2MA 1E0AA 2JGNA 3ZWDA 4ZIRA 4AKSA 3MT9A 3M4XA 1E63A 3JWJA 4R1SA 5CB8A 2ATIA 1P4HA 1K0FA 4G8CA 2I7XA 4C3ZA 3AVVA 2LD4A 4BVKA 2FUKA 1GD1O 2VF4X 2A59A 4KVOE 2D4PA 3JS5A 2VPYA 4FYHA 3L7JA 1ESNA 1ZK0A 4J0EA 3VU0A 3ZC3A 3VMMA 3D8PA 1BZYA 5LB4A 2WA1A 2EW1A 5SY9A 1JQKA 2ODEA 4L22A 2V7EA 1CS0B 4I1OA 4O4JB 1IOFA 3EW9A 3AT1A 1SHJA 2HPAA 1NP7A 4A2PA 3AIKA 1D2NA 4LY9A 1VJTA 2HQYA 1L5FA 2JAPA 4IF4A 4XARA 4TVBA 4HXFB 1MENA 3F74A 3GZTB 2XCQA 2G28A 3B1ZA 3CUYA 3JQ8A 1M2KA 4XJTA 2P2YA 4BKUA 1U9YA 4YDHB 4ZGBA 5J2TB 1T3ZA 4K8RB 3VU8A 2F17A 1DV2A 4WL0A 4ABTA 1FLAA 4C87A 1WG8A 3PC7A 5GV7A 4D99A 2Q9AA 3PXAA 3QENA 2VYND 4HGNA 4P10A 4E2AA 1L7RA 1NQ5A 1T35A 3C3MA 5GTDA 4P4FA 4QGSA 3IP3A 4JOSA 1CW2B 1N7GA 1P9LA 4YJ3A 2IEAA 2DPXA 3OQ1A 4H7EA 1QYRA 2D06A 4ND3A 3R3WA 5HPYB 2WDPA 2VZLA 3LBNA 3LG2A 1VE1A 1W30A 4Y7CA 1EFVB 4FFPA 2B4RO 1Q0PA 1LTHR 2HA6A 3LHKA 4JLNA 1M2JA 1DX9A 1OLOA 2OO3A 1SA0A 5KTDA 4OMCA 3NHFA 4QC2A 4B14A 1XDDA 1ZKDA 1DO0A 1IPHA 2EJUA 4FU0A 2R68A 1VE9A 1KR2A 2LRHA 4R7ZA 1HNNA 2CXXA 4PO8A 5CW1A 2GK4A 3C70A 1M2FA 4WUTA 5D6NA 1LBIA 4WFJA 2GZRA 2HTEA 3CJRA 3I5UA 1RRKA 4MHSA 4BX0A 1DRJA 4C2XA 2HL6A 3AL2A 5G0UA 3A0UA 3U1TA 2VPXA 5TR9A 4Y6SA 3RBZA 5K09A 2CVHA 1TJNA 1NNI1 3TR6A 5JR3A 1RLOA 3KZNA 5C3UA 3R23A 4FCCA 3VXKA 1Q6YA 1M6EX 4CKWA 1VCIA 2O1XA 4KYTA 5A3SA 2OD7A 5IVHA 4DR7B 1WPQA 2DT8A 1XKLA 3KXIA 2XCUA 1JRLA 4DZTA 1NTRA 2QJRA 4U0KA 2TMKA 3DDZX 3E9YA 4Z4FA 1S8OA 2GESA 3P9SA 3VPDA 1SVUA 4FFMA 1C1XB 2PZLA 3R9KA 5F35A 1LXCA 1SN7A 3JQBC 4ROSA 3SBOA 1II0A 2SHKA 4AZ0B 3D4OA 3IEKA 4P36A 3VX3A 4CQLB 1E2LA 1NOJA 1A1SA 4QYSA 4X92A 4ZDWA 1XZBA 2GK3A 3VBCA 1K08A 4A8JC 1QP4A 5I9NA 2YYAA 1SQHA 3PP9A 5KBYA 2GN1A 2VUUA 3B3QA 3KXPA 2BFNA 2GFQA 1RTQA 1FP7A 2ZBEA 4PX9A 3O8OB 2AG0A 1OJ7A 1PGJA 2QMZA 3JVNA 2GTHA 4JI1B 1VCMA 1DCKA 3NHMA 5BMOA 3PJDA 2R6HA 5JGFA 1YA8A 4DNXA 3OIFA 1MC1A 4EYEA 1AKNA 2NTYC 4WE3A 4CQLA 3JQBA 3A9WA 1JNYA 1JR4A 3FPHA 3NFYA 5EFZA 4RD3A 3L1UA 4QGGA 4L7VA 4JNCA 5C80A 4QRIA 2QJOA 1R88A 3ND9A 3MLBA 3ORQA 5AESA 2QKYA 3OPYB 2JHAA 1VHWA 1USGA 2LR0A 5EIAA 5BWLA 2POQX 1SXGA 3NOOA 1L5ZA 5K4AA 1P1IA 1AKUA 1N9ZA 3WNZA 1BXRA 2IDKA 1C9NA 4MIYA 1UXGA 4MFKA 1KJNA 3TOZA 1VSVA 2X8JB 3RM3A 1QYWA 3SYKA 5A5GA 1HOTA 2ZLBA 5JRDS 3F3SA 1NDUA 4P0QB 1E9CA 1D4FA 2JBAA 3KELA 1SBQA 1UBUS 3AG6A 2YV4A 2F3SA 4P3OA 4FS3A 4QHYA 2FYTA 5LIRA 4JJGA 2IXDA 1O87A 3CE9A 1Q12A 3L0CA 3E3MA 1F38A 2PJUA 3K94A 1YIAA 3LPAA 4LMRA 1YDGA 1RI3A 4R69A 1AGNA 3VOAA 4C88A 1UOOA 3K4HA 2YJNA 5A5FA 1KSJA 1Z5NA 3DULA 3PGA1 2HWKA 4KPFC 1UXOA 1O96B 4G4SO 4D3SA 4KUAA 4DMFA 4MI3A 4KEAA 4YRRA 2AOTA 2PFSA 4PBSA 2E85A 3N6RA 2GUWA 3L77A 1JLLA 3RBVA 1AVTA 3TOXA 2OWEA 3U7IA 3OU6A 3CVYA 3K09C 3LHFA 4K9KA 2JJ2A 3F7TA 4CF3A 3KSDO 1U9IA 4U8HA 3B3VA 1E20A 1YBAA 2ETVA 3KWLA 4FVTA 5CK4A 3H3JA 4RGYA 1NSLA 1H22A 2J48A 4RVDA 1NF9A 2XMDA 3WYGA 2ONZA 3S2EA 2BGGA 1X9HA 1RBYA 1E99A 2IQIA 1JQ3A 2VA8A 2HJGA 3PZBA 1P60A 1VXRA 4IDFA 5EQFA 9MHTA 1UH5A 2WVHA 3QX8A 2WWTA 1ZIPA 3ZYZA 5IUNC 2E55A 2K5TA 1Z5ZA 1GLVA 5A2GA 2WLTA 3TLCA 4FW9A 3RYHB 4BWFB 2C2KA 5FTJA 5EL0A 1SOVA 1JG1A 4C7KA 5KTOA 4YACA 1XEXA 4PPNA 5EHGA 4DSAA 2QRQA 3K09A 3EDRA 2D5LA 2WUDA 1D1SA 2PKQP 3L92A 5HE8A 2Q5IA 3U48A 3D4UA 3D5EA 3IO5A 2WR8A 2CV2A 3NEYA 5D6OA 1FX1A 4BRZA 1QP8A 5BVHB 3U39A 4R81A 4X1IA 4CDNA 2MJLA 3EZXA 3HC7A 1K3TA 2ZSFA 4MNTA 4UE6A 4XDYA 4EHFA 4HN2A 1Z4MA 1ZN2A 2IYSA 3Q5DA 3ICOA 3NEPX 5C52B 3I05A 1AXRA 1XWFA 2SKDA 4GKBA 3LRPA 4KMMA 4OV6B 4DLLA 2DF8A 1N0VC 5COBA 1SKAA 1B00A 2FFAA 2W2KA 3BGOS 4UEFA 4JQCA 2P2LA 4WMLA 1NE9A 3SU8A 2G8LA 4E2ZA 4MCPA 5ECYA 2OZUA 1BS9A 1RYDA 3KAQA 3TQFA 4ZGWA 2PJ0A 1TUGA 3IO1A 2C4TA 3HS3A 4MDHA 4TSFD 4PY2A 5G3YA 1CM0A 4EJ0A 1KFJB 1X7GA 4WXPA 2FPGA 5DM70 1FFEA 2E4ZA 1SHLA 3PUKA 4MV5A 3GZNA 2XE8A 2FZEA 1XEBA 2ZKLA 2C7BA 5ENZA 4A33A 3PUYA 1J8MF 3IQGX 3WNDA 1OLXB 1IN6A 2AD1A 2G71A 2ORYA 2V6JA 4TLMB 4TQUS 2W11A 3VNSA 1XQWA 3D7GA 5DI9A 2YASA 1U3WA 2G40A 1BQEA 4KTTE 3OZ7A 2P9HA 4G1UC 4NR0A 3IQWA 2O6HA 1SBHA 4B73A 3MRTA 4LJKA 1US8B 5F78A 3A4TA 1HTBA 3IDSA 4UNNA 4LV6A 4BAGA 2GS9A 4BUJA 4R1OA 2DWQA 3DKIA 2J3EA 2ISQA 3MHPA 4NYMQ 5BSRA 3OOYA 4AURA 1X7WB 1XCGB 1L8XA 1UC8A 2AOWA 2GAOA 3RR2A 4DC9A 3U61B 2ABZA 4X84A 2BFBB 3HRKA 3UG6A 3ZJ5A 2I7TA 2ZEMA 3I9NA 3P2FA 1WV0A 5AVVA 4F85A 5GZ6A 4EX6A 2RAFA 4KQFA 4QBGB 4N49A 1V9CA 4NCXA 3WK8A 1RYNA 3AFHA 4FN5A 4QQ8A 3T3PB 2VUIB 3HYTA 5CLJA 2H63A 3W04A 2OLEA 3KPYA 5EHIA 3CF2A 1GEEA 3IMFA 1QQ7A 1O58A 1NIJA 1R0XA 2GR9A 4L50A 3RRMA 1EFRA 2YFKA 4E15A 4DV7B 1YJCA 4UKDA 4XQ9A 4ZVMA 2QG4A 3FPSA 4FNGA 1CT9A 1NX6A 4GOND 4CHTA 1CLEA 3DFFA 3EULA 4JELA 4R68A 5C5CA 3OC6A 3REGA 5C8DA 1UZUA 3ENVA 3P5SA 3GLIE 3T1NA 1LDNA 3IRUA 1EDBA 5CA0F 5DM0A 5EXTA 5B1HA 2D4OA 2XB2A 3LODA 2FLWA 1CHDA 4G0UA 3HABA 5CEFA 1K7EB 3O84A 3NDBB 2R6CA 3NP7A 1NUSA 3KCNA 1G2IA 3LJKA 4HCJA 4HHEA 5LWQA 1C1DA 1SWWA 2Q50A 4TL6A 1M73E 2OH1A 1S0UA 2EIHA 3BMOB 1XA3A 3UJAA 1D2HA 1LPAB 4QYMA 3B89A 4M83A 4YJFB 2PJCA 1U2EA 3FTFA 1N25A 2V03A 1W4RA 1F2DA 1ULUA 3I83A 3CX4A 5TV2A 5LR6A 3LC0A 1H0SA 2I1WA 1HE2A 3OF3A 4UULA 5B53A 1Y9DA 4CM7A 3FH4A 4FHCA 1EB8A 3IFEA 1WKCA 1E1NA 3NVDA 1JDTA 1CNMA 3SS8A 3V9AA 4GHWA 5FI1B 4JLYA 5IEBA 4JU9A 3U1VA 4FAIA 3TOCA 4D45A 3OJOA 2WUUA 1AS0A 1J0AA 4JBYA 1M67A 4FLFA 2OHHA 4F8ZA 4BZWA 3NAGA 4OATA 2PRYA 4RHTA 1SH7A 2QYVA 3WC7A 2ZIEA 4P7GA 3ANNA 4N39A 2D1QA 2ONCA 3BHXA 3KHKA 1Q50A 4IHAA 5A0FA 3VWEA 1WS6A 4EJ6A 1C0EA 3O90A 3JWEA 3PFFA 5BSGA 3V97A 2E18A 3DAOA 5CX1A 1JXMA 4EAAA 4HNHA 1UDCA 3MC1A 5EJ4A 2VFAA 5DXFA 5K0GA 2O2JA 4UFNA 3GAFA 1ZGCA 4HNYB 1T5SA 3HZZA 2CCGA 4XYMA 4EYQA 4A30A 5DF1A 1P5HA 2JF0A 4HUTA 3B3JA 3PUWA 5KCZA 3EPHA 3EGDA 1ZOPA 2F8HA 1PQ4A 2C57A 5E8RA 4OLAA 1DRVA 5BW4A 3M6MD 2C3PA 4U63A 4KCGA 5SYNA 3UWSA 2XEXA 4L75A 4CV1A 1Y80A 1OWNA 3WLTA 1ACMA 1XMIA 2JAHA 5I9BA 3K05A 4KWTA 4KV9A 4RA6A 3HR4A 4JWTA 5EWMA 5AK5A 1THTA 2EK9A 1RIFA 1ODKA 3FUTA 3R6GA 4XPZA 5GM2A 1P45A 5ALZA 3DWGA 5ALHA 1G66A 4NGSA 4WZAA 2WVJA 4YRKA 3QGMA 1L0CA 5SYMA 1TYAE 1U7UA 3SDBA 4QARA 3TWOA 4CKCA 5ARDA 3K3PA 5FADA 1YF3A 3C4JA 4EEKA 1NURA 1TKAA 1UMKA 2Y71A 2HHJA 2VS1A 1V41E 3GD5A 3P9QA 4PWZA 4ZEXA 4YAFA 4QC6A 4X5OA 1V3UA 2VYCA 4F0XA 3GIDA 3MYRA 3B3FA 2PV0A 3CLRC 4ARCA 4QUJA 1EIZA 2YNEA 1V35A 3EGCA 1NA5A 3IQEA 3PJRA 4KW7A 4MLPA 4ZK6A 1E2FA 2B7LA 4XNHB 2E3JA 4TT3A 2VNAA 3F8KA 3WK6A 1J2JA 2WD9A 1NVGA 4V3CA 1I0LA 2GF2A 5U4QA 5BVGA 2DFKB 1PR6A 3LVRE 4G9GA 3U4MA 5CH8A 8ATCA 1ZRSA 3OUUA 4JD5A 4GGPA 1G8KA 5FL7A 3UGTA 4C01A 1OBCA 1H93A 1DBVO 3VRHA 1W49A 4TX1A 1QQAA 2IVFA 3L9XA 4NU8X 4WBXC 1CIPA 4LSZA 5AW9A 2BSWA 2EKLA 3VSAA 3N0WA 3DOEA 2FZ4A 1L5SA 3CPJB 1WU8A 1I6LA 3X1YA 2RGYA 4F06A 3OQMA 2FG5A 2XOKD 1I5RA 2NU6A 4JSRA 4OHUA 4ZODA 2WYRA 2C5GA 3BDIA 2ZOSA 1K92A 1RMYA 1E5XA 5HVNA 1W2GA 3RGGA 4X2TA 2ODTX 3V8QA 4C2ZA 3D4LA 2AG6A 3SG0A 2OBLA 4MJ7A 4E22A 5JO0A 4HZIA 3NO4A 10MHA 1U63A 4CEHA 1R6AA 4DRXA 1FYEA 1CCWA 4W5RA 3GLIA 1IB0A 3DLJA 2WOOA 1FLNA 3EA5A 1DBWA 3H5IA 1YRQA 3F7MA 3NHYA 4TS1A 5JH7A 3IU1A 1OGIA 1XRLA 2HEIA 3B53X 3SLRA 3KGQA 4UZSA 2O52A 4L4RA 1QS0B 1P6QA 2FLKA 2HLNA 1TTTA 3G17A 5BN4B 2ABWA 1VIAA 1WF6A 2I3AA 2QBYA 4C7IA 3ETJA 3T5BA 3TTVA 4INAA 1VLQA 4TXJA 5TQ0A 5DYTA 1S2OA 5IYZA 1R3UA 1HM5A 2DJ5A 3DL2A 1ZD5A 2XR1A 4I9HA 3LPLA 4JDPA 4OFBA 4OJMX 3UAOA 4KODA 1Z2PX 2V0NA 2PLRA 4BFUA 2G25A 3PRKE 1GFIA 5FWYA 1BE0A 2O2GA 3LW8A 3B9PA 4X20A 4ZQIA 3O8RA 2Z9DA 4DA4A 1RBMA 3CR7A 3H9UA 4CE6A 3LPMA 2X7BA 4JD6A 5AKJA 3IT1A 5DGTA 1A8QA 2ROQA 2WNHA 1XK6A 3QJGA 1GNTA 4OYLA 5FPQA 5H70A 2C04A 3W9YA 1QKKA 3HB0A 4ZAXA 3RROA 2R44A 1BFUA 3REQA 2HM7A 2W6CX 5B4TA 4PYKA 2QP4A 4DJ5X 1R2QA 3ZHTA 1BXRB 2EZ4A 4KORA 4YJFA 2P3LA 1OXMA 3C39A 4J94A 2NZYA 4V1CB 1UODA 3VU3A 4IUYA 2NPOA 5L4NA 2CGEA 1Q6ZA 2BEVA 2LNDA 2VXOA 4IKOA 5AVRA 5FUXA 2PJ9A 5DYWA 2YNCC 3FVWA 5JRJA 3B6EA 3FPFA 2GKGA 4MO2A 2H3EA 3GUCA 4Y6LA 3VX4A 1GG9A 4ZTBA 1TFRA 1E79D 2O2XA 5G20A 5I4IA 3H8JA 1PZNA 3M5WA 4YCBA 4JBLA 1O9BA 1SVSA 2OR3A 3QFCA 1G42A 5ALUA 2EJCA 5DNUA 4QG3A 5DXJA 1PFVA 1DAIA 1RRGA 3T3HA 3C4QA 1UPBA 3R3YA 3KVYA 2GEUA 1Z29A 5KYWB 3SBDA 2XZLA 2P7HA 2WZCA 1ZXXA 3WZMA 1BMFA 1M5TA 3BXPA 3WQQA 1GUYA 1FTNA 5GMOA 3THYA 4LFCB 3D1LA 2HDNB 4REOA 3G7NA 3RC1A 1BEZA 5BXQC 1ECLA 1ZUHA 4IR7A 1K6XA 1MRSA 4DW8A 4AN1A 1HA3A 1NVAA 1FOEB 2R1ZA 5GOTA 4X6LA 4RZXA 4OQMA 4RTJA 4R8SA 1Z4EA 2P6GA 2AQIA 1V6CA 1AZWA 4HDMB 5F49A 2ZTUA 1O0SA 2EHJA 3GLTA 4L57A 3HLKA 3T61A 2PUHA 4RK0A 2CLDX 3Q87B 4B46A 4OTZA 1VHDA 2JC3A 3C8UA 3PIRA 4MV8A 4KNVA 2HCBA 5JAHA 1TRHA 4YAKA 3LQKA 4OX9Y 3ZCSA 3OX2A 3QYJA 3LU1A 3OQNA 1YMQA 3F78A 4HMOA 5DCYA 2GMWA 5FWXA 3ZHYA 4JITA 2QRUA 5KSOA 4QB9A 5ICMA 3NFRA 4NU6A 1Q3KA 2P4EA 3I52A 3NC4A 3KJZA 4XUDA 5DM60 1WP9A 1TPZA 4POOA 1QMPA 2MR6A 1FUUA 4QREA 1WIWA 3T4EA 4HPSA 3NRJA 4CAEA 2PO5A 2YW2A 2XF2A 4DXDA 1TVKA 2BEUA 4G63A 4Q00A 4QUDA 1IZ8A 4A23A 5JIBA 2WINI 1DTWA 2AXEA 1CUZA 2PTGA 4OUDA 5LRGA 1EJ2A 4QEZA 3AQ4A 4PINA 5E4TA 3IVGA 2D6FA 1UF9A 3B3CA 3KCQA 4UTVA 3ZWWA 3AR2A 4P4JA 2O3SA 3FUXA 2CLKB 3KV1A 4UOEA 2AC2A 3WYDA 4DUPA 3ZX5A 4G0WA 4E8OA 3L1JA 4UWIA 4H7PA 1WXGA 4UXHA 4KLCA 2YCLA 5FFFA 1JECA 2WHPB 1QHGA 3L0ZA 2AQHA 1G8FA 1JF8A 1JG2A 2JS7A 1SUSA 3IV6A 1C9MA 1DWUA 5G02A 1DXYA 2QM0A 1N2EA 3IHLA 3ICVA 3HCEA 4QPCA 3W9UA 4BVLA 3GMIA 2IEIA 2R751 3CW9A 4UVGA 4D0GA 2G1KA 3DWFA 1DDOA 4CTJA 4JYZA 1DT3A 1G5RA 2FUEA 1NX9A 1OHHD 1PL6A 3B8EA 3HA2A 1B6RA 4PQGA 4YALA 1U2DC 2XI4A 4XGQA 1SD5A 3A6DA 3WRYC 1NUTA 1U5BA 3SFTA 4AJJA 5DHTA 1CQIA 1KJYA 3HEMA 5FUVA 4A91A 4FD2A 2FUCA 4CYNA 5JPHA 3L7YA 4KQ2A 1Q1EA 3ER8A 3I92A 1DAMA 1FDRA 1K7SN 1IG3A 4U7PB 2AUNA 2GFHA 1IXRC 1VKRA 4YWJA 3BSSA 5CYOA 2QB5A 3PNSA 5E3IA 4Z4GA 5BY2A 5JYBA 4W63A 3GLHA 1BO4A 2GHIA 1M6WA 2RBEA 2HA2A 2WJJA 3O95A 4QIHA 2DKOA 4MINA 2PJ6A 4GMHA 1MO4A 4B4KA 2C29D 4I8IA 2PK3A 2C8JA 2CXQA 4OHKA 4IIEA 5BW5A 1LUAA 4Q4AA 2NQ8A 4R0VA 4D3DA 1GUAA 1T36B 1YL7A 3LCVB 3SJCA 3IC1A 1FSPA 1XDWA 3TZHA 4MW7A 1S3FA 1YB5A 1UXHA 1BJTA 1G5FA 2XGMA 3B2EA 4YO7A 3VH2A 5ITWA 1W2HA 2IMOA 1PFQA 1OXUA 2FSGA 4LC9A 1JQBA 3HM2A 2JCSA 1H5QA 5M04A 4DFDA 2ZRAA 4GWLA 3OIUA 4IW3B 5ALVA 2F1IA 2W0SA 3IIKA 4EUKA 5JHGB 2A14A 4R2LA 4X6YA 3T9CA 1T5LA 4OHOA 2B1JA 1C3OB 1E1DA 1KVSA 4NOMA 2OV6A 2EJTA 1VPDA 2A2ZA 2CWWA 4XSHA 1L4YA 5FR2A 4A36A 2AFZA 3C16C 1PZHA 1ZJ5A 2AYYA 3KQXA 1GPMA 1CY1A 1M1XB 5ICCA 1T3HA 1MO3A 1U5AA 1VB3A 2Z2KA 3PFGA 3BEDA 5BVHA 3QVJA 4S0ZA 4BFYA 1QSGA 4X24A 3HUVA 3AF2A 3PICA 1QUFA 4GPBA 5D7BA 1NLUA 3W2EA 4CTNA 2H7YA 5H9VA 3G88A 3D3JA 3B6JA 1C41A 2C20A 4MW6A 1U2TA 2CUZA 1P73A 4OLJA 3UW3A 1U1CA 2VRBA 2WABA 3O8NA 4G5GA 2YXPX 3A9TA 1T43A 4M1MA 1DAHA 3JZFA 3HXMA 2XWJI 1O97D 1QE5A 2C1CA 1W44A 1DEOA 3HU1A 1F06A 4L8WB 1VPWA 3NC1C 3E3LA 4TKUA 4JN6B 2Q9CA 1XI2A 3M1LA 2NTJA 2F8SA 3DMPA 1UFOA 4PLFA 1T8WA 2PNFA 3PQDA 4Q12A 2D0PB 4ZO4A 3RC7A 5KJFA 2FR1A 1O3YA 4OJQA 5CW2A 1HE4A 4HB2A 4URFA 1YR2A 1UJBA 3DOHA 1EMDA 4H7DA 1MIOA 3BXOA 3OFKA 4JI6B 1ARMA 5ALGA 1TGVA 3PA8A 5LZ4A 1Z8TA 1N5OX 2Y99A 1RJFA 5FNVA 1DU4A 1TT5A 3WNBA 1C1YA 3FNBA 3NUGA 4RXMA 5HIJA 5THQA 4BRWA 1KJWA 4MUMA 4R6WA 4AJIA 1Z5RA 4FHGA 1QO9A 2VRCD 5JFTA 1CHNA 1WP4A 1R6UA 4AO6A 1OJLA 4FZRA 1JHXA 2PWPA 1QFJA 3GQBB 1GVNB 2QGFA 5CDGA 4NONA 1ZONA 2YH2A 1VBMA 2G09A 2VHEA 2ZEHA 1YACA 2XKJE 4CTMA 4C43A 1HYEA 4ILKA 4NCHA 2YHIA 3B20A 3CBGA 1QC5A 1M76A 3F5MA 4KFTA 4QSHA 4PSWA 5FV7A 2FSVA 3FSRA 1R43A 2X8JA 3CSUA 4RVOA 3ROTA 5A4AA 1KXZA 2ZBFA 3HQ4O 3R7NA 1CYDA 1JMYA 3K53A 3ECSA 1N9GA 4FHZA 2VAPA 3PLNA 2W2MA 2YN4A 2VDQB 3ET4A 1U28C 1AKYA 4CI9A 5B3JC 3DKRA 2Z4SA 2VRCA 3I9V1 1Q57A 3NOQA 1LSJA 4J7CA 5E1DA 1DIBA 2P78A 4LVOA 1ZN7A 1VI2A 2P4HX 2IA5A 4XB6B 2F3TA 4M46A 5A4IS 5FJIA 1OT3A 1OLSA 2B4TO 4G8BA 4HAUA 1EJ6A 1ND5A 1OI4A 3SJGA 3AUKA 4YJKA 5BXYA 1V8ZA 4XWWA 2Y1EA 3ASVA 3GDHA 1HH4A 3A6HA 4BTVA 1QVVA 3G13A 4ZALA 5JALA 2G9DA 4V0NA 5IKEA 4WGFA 4M6WA 2ZSBA 4EJSA 2HHCA 2Y1OA 1QAQA 3M6XA 4CG3A 5WRFA 4D74A 2BGKA 4TTJA 3Q98A 5ALIA 4EDHA 1PEKE 3DMRA 3FPBA 3K0BA 1X7YB 2NV6A 2OZKA 1Y8RA 4DDTA 5MN5A 4ALLA 2VAWA 1PTJC 3ROQA 4BD9A 2QENA 4O8CA 2IH2A 2V98A 3TS1A 3GT4A 4ZVKA 2V3VA 4WBNB 2O8DA 4R3LA 1P7ZA 2VO1A 4N54A 3QI2A 5AKXA 3LX4A 4R1PA 4IDPA 4S0XA 2AFUA 2PEZA 5KX5B 2DU8A 4Z3OA 3NMUF 3KASA 1JU9A 1HI9A 1KIAA 2NU9B 1H9BA 1YK0A 1WL8A 3H0EA 1P44A 1UBMS 4YP6A 3EXG2 1H8HA 2FWBA 2NYUA 2DBVO 1RQRA 4MWSA 4QTXA 4AD8A 4DMUB 5L95A 1KWMA 2NXNA 3P94A 2JLYA 3JAMA 1U94A 1VSBA 3BB1A 1E6EA 4HFNA 5AWFC 2CMGA 5CK5A 5JYDA 3G8CA 9ATCA 1R4MA 1Y7IA 5JSYA 1CC1S 1KI6A 3IFSA 3R0XA 3GFFA 4HQFA 4R41A 1XMJA 3LXUX 4K0KB 3L93A 2QDKA 3FJOA 1MX3A 1H2EA 3FMVA 3I8SA 1JMKC 1Z5PA 1CZKA 2JZOA 3JPWA 4RZ2A 1Y34E 1ZG9A 4RY2A 1KGDA 2V65A 4KN8A 3TFWA 3I9FA 5EMLA 2J9FA 4XQCA 2NU9A 2PUTA 1VZ2A 3AEUB 1NDHA 4JNKA 2J6IA 5EJ6A 4UVIA 5E1MA 4BBAA 5COAA 5JCOA 4I1IA 4L6CA 1DEKA 2XDQB 2YY7A 1IVSA 4DR6B 4DLUA 1JDBB 2A5YB 5DNDA 2XEGA 2IXAA 4MULA 4HVCA 4PAMA 3CSSA 2QUZA 4O23A 2O3UA 3AESB 3W7AA 3GEEA 2Q6TA 1ZJ4A 3NUQA 4KSCA 4GLFA 1Y1TA 4YAUA 2YRXA 4OD0A 1G6HA 1OWPA 3DGFC 4G5FA 1PQPA 1NXQA 5FUWA 5KQRA 4O1IA 4LBYA 1RAFA 2I4LA 4R16A 2FHSA 4OXKA 3OZXA 4CKCB 3U49A 4KLVA 4NGTA 2E4AA 2X0IA 3MT7A 4IF6A 4L0QA 4UHKA 3ADCA 4ZT6A 2HK6A 3Q88A 1H6CA 3HVKA 4GRDA 5TMEA 4ZMBA 2QTTA 2VTBB 1WETA 3SI2A 2IEYA 4RFSA 3ILXA 3ITKA 3CYFA 4OAPA 2DUUA 1GFZA 4GLLA 2ZQZA 4D56A 2VR1A 4LWQA 4DBLE 4JBIA 3J7TA 3HBNA 1UQRA 3FKSA 2UYHA 3ASZA 3K9GA 4IDCA 2RGGA 3CUTA 4H6VA 3RRFA 3F4LA 2QLFA 2I1VB 4QXOA 2I5PO 4CF4A 1E89A 3UMMA 4Z0NA 1MABB 1PEAA 2ZT5A 4WFKA 3AP3A 3N2NA 4MUNA 2FPMA 3SQMA 3OICA 1V7PC 4ZQCB 1I6KA 4R4JA 1M34B 4ZTUB 1MORA 2XWQA 2XMCA 3ESRA 3G1TA 2OCKA 4QVIA 4JEUA 3K70D 4KSYA 3L8YA 4W5QA 5JY1A 3GX1A 2FIAA 5G4KB 4FD7A 4E09A 1ATIA 4I5IA 4NEQA 3GLGB 2ANPA 1CZUA 2VXYA 2HCTA 2QVBA 3MD9A 2DCUA 1F20A 2DHEA 3JYNA 1P7YA 1AQUA 5B6PA 3GMTA 2NO1A 3DDWA 5YASA 1QF9A 4I9GA 4OBWA 2Q6KA 1PT9A 2YY6A 4LISA 2GARA 1WJGA 2W5UA 1KI2A 2NSLA 2P9ZA 3W2HA 2G80A 4IOKA 5KNBD 2JH8A 2QMEA 3ZKWB 2H8GA 2ZRIA 2Y0PA 4OPMA 4BKQA 2QQ5A 3KKZA 5KYYB 5TRTA 4EGSA 1XZJA 3B8HA 4I08A 1M4LA 4FP9A 4TN1A 4CM6A 2WQZA 1RWWA 3WYNA 3U4QA 1QCDA 3T3IA 4N76A 2P7IA 4KRYA 4LJAA 3WGTA 1VECA 2YVQA 1LFDB 4JSTA 5L4SA 2IOYA 3QPVA 4WRRA 3WMGA 5E6RA 4DEYA 3ETCA 2IRWA 3OPYA 4R1LA 4ZCMA 4NYIQ 4FXPA 1SG6A 2ORWA 3I23A 3JCZA 1C4XA 4N3CA 4I4NA 4X7MA 4O33A 3RC2A 2OFOA 4QDJA 4JV5B 2FZWA 1D4AA 4HQKA 2IS4A 4WZZA 1QZTA 1SZPA 5A2QA 3VSCA 1YV9A 5AVOA 2PCUA 2P35A 4WESB 3U5TA 4YUVA 2BDUA 2HCJB 4MQUA 4RANA 3GW8A 1I9CA 3FGNA 3T5MA 4F04A 2FMIA 2WPDA 2ZPTX 4ARSA 1H3EA 1XIXA 3JTKA 2B35A 3OWCA 4CG1A 3H4VA 3OQBA 5E9QA 2ZITA 4U7DA 1T4CA 5JZMA 1GGVA 1XJOA 3QA3E 3SAJA 1VGVA 5A7HA 3ZTTA 4HVAA 3PIDA 5EHZA 4GG1A 1YMUA 4BQIA 3QYAA 2GZ1A 4KGDA 4Y2HA 3BJZA 1DE4C 6LDHA 3ZZ1A 1HORA 1L1FA 4V2UA 3VH3A 1KAOA 3MTDA 1PL8A 1V1RB 2OK7A 2VT6A 4H3HB 4XLLA 1P4GA 1B43A 2R25B 4BKMA 2NAPA 3CRZA 2IPOA 2VNJA 4DIDA 3WV4A 3S7ZA 1KIFA 2J9GA 1KP2A 2JG3A 1DO2A 2EJWA 3OIVA 4DB2A 1IVYA 1C7JA 3WKDA 1FMLA 4UJ5A 4DUKA 2DCMA 2KSQA 3MGGA 3QXHA 4J4HA 3FWYA 3MTGA 2WFAA 3GJZA 2F4NA 2CF4A 5F73A 2PUFA 2CBXA 2R47A 1LRKA 2GYYA 2GLTA 3BCUA 3B5JA 3CKKA 5F09A 1DKPA 4HAXA 3D2BA 2BUAA 3DNMA 1THMA 1MXHA 4FR5A 4EKNB 2CDRA 3O93A 4R6XA 1JT9A 1E60A 5J1TB 1GKLA 1N2SA 4CM4B 1OFIA 3PKZA 3KKNA 1IUNA 3DSBA 1ZSYA 3RODA 4HGYA 1VFPA 2CB0A 3M33A 4D41A 4HS4A 2XB8A 3COYA 5HX7A 2QT1A 2XCTB 1AMPA 3BQNB 5JH7B 3BI0A 1N0WA 2OO5C 1DXOA 2YW9A 3SM3A 1Y3BE 1RXUA 3L0SA 3WKCA 3R74A 3OZAA 1NY5A 3AK4A 1DWOA 3G9UA 1GPLA 4G0OA 4X60A 5CM2Z 1JJ7A 5L3ZA 1G7SA 3EXNA 3NASA 2FJPA 4UTOA 3ZUPA 4JBWA 1NQTA 2NZ2A 2AWNA 3UWMA 3PWTA 4JAVC 1R9GA 3R40A 2WWFA 2ZT6A 1EWRA 4IDQA 5FYDA 5LP6A 1VBNA 2FP4A 1BMQA 3V7YA 3E81A 5FHQA 3RARA 4DIEA 4JJEA 6PFKA 4BQEA 3VHXB 5LLTA 4N0PA 3X3HA 4NXMB 3E2IA 1ZMOA 1KDVA 5HW0A 2EBFX 2ZRJA 3JRUA 4EW1A 1XZ8A 4HATA 4H0FA 3UFXA 1OH5A 5J4YA 2JA2A 1HNXB 5AG5A 1IWBB 2V7VA 1TADA 4CQNA 1PZFA 3A6GA 3TBHA 4MRMB 2NIPA 1DUIA 1Z17A 1DRUA 4Y3UA 3ORSA 5LQRA 1MGOA 1XDUA 4LK3A 2ENUA 4AM8A 1PQYA 2IHYA 1X1CA 2O0KA 3GRYA 4NTZA 5GPBA 2X7XA 3RUDA 3G8WA 5KVVA 1NQOA 2DBYA 4N82A 5HS6A 3NFZA 3K1AB 2WJ6A 3GR6A 3KU4A 2IU4A 2KBFA 3FXAA 3ZK8A 2ZWMA 1PNQA 1OFHA 3JR3A 4JT2A 3BT7A 4DT1B 2EWWA 1LI7A 2VK2A 4HPJB 3AFNA 2J67A 4YRDA 4WZBA 2GXAA 4CF7A 1A5SB 4W9YA 3DVSX 1YR0A 1QYIA 5DFAA 4PAGA 4HQOA 5FBQB 3SI7A 1ZR2A 1T9GR 3NXKA 1NJ5A 3PFCA 5CBPA 5KQMA 2V77A 3D6NB 4RK5A 3EVEA 4IGFA 5KNCD 3VNVA 4JYCA 5DOVA 1ILWA 1WK4A 1GXSB 2X7HA 4R6TA 3H99A 4KWIA 3A3OA 1S2DA 1L0BA 4PLPA 5DT9A 4RD4A 2XQGA 5HA5A 3WE7A 2OOTA 2QX9A 3DE1X 5EESA 4PNPA 3ISTA 4EP1A 1P5FA 3NDJA 2NPIA 1VPEA 3R6DA 2XYGA 4XM2A 1ZD9A 3URMA 1RWNA 3W05A 2IOQA 3G82C 4JASB 5FA8A 5DASA 3CLUC 4X44A 5GGYA 4QBJA 2BUBA 3NWJA 4L4YA 4RMHA 3A1SA 2PG3A 1NGSA 1ZHHA 2Q21A 4KJXA 3ABIA 5JMOA 4WI1A 1ECGA 1IZ7A 2F48A 3GEIA 3HNPA 5IDYA 1KY4A 4A0GA 5KUTA 3Q8KA 3L8HA 4HN4B 3IWGA 1CRLA 3E6AA 1DAFA 2OQRA 4FFDA 3W06A 4BEJA 2IX3A 3PIIA 1GAEO 1WVGA 1JEQB 4BB9A 2ILTA 2V6GA 5CD9A 4MS4B 3CBQA 1GTG1 3UA3A 3RYIB 1SBZA 2X9QA 4UHBA 3TL6A 3VKUA 3W3ZB 1EP3B 2WFMA 4IQFA 4CMEC 3ZVKA 4AMVA 1M54A 2O8CB 5JD6A 1KEPA 3QVXA 4RVSA 1P7PA 1GNSA 2VJPA 5JNLA 4FHDA 3T9DA 1YMEA 4XWGA 5J8FA 3ZZNA 3WBKA 5KOJB 1RPTA 3KPUA 2QLMA 2B1GA 2WV7A 2IFTA 2YR0A 3WL5A 3UH1A 4EVIA 5F2OA 2PE3A 3HDHA 4MQEB 3WXMA 1NVXQ 3H5ZA 3WTBA 2Z6AA 3MCTA 1ARZA 4HBZA 3FNHA 4MAAA 4JEHA 3GGPA 3AM5A 1K5HA 2ZJOA 2R8RA 3CVOA 2CXRA 4I55F 4P7BA 4YPVA 4B7UA 5A03A 3H19A 4FWIB 4NGMA 4LDZA 1LD3A 2VJYA 3MVEA 5C5IA 4K6FA 2NU8B 2V6BA 4R8RA 4FCVA 4LOIA 2CL0X 4HAOA 2FT0A 1DZ3A 3E0KA 5FNVF 3I1IA 4KOTA 3ONNA 3UO8B 5I7WA 1BX3A 1A9YA 4WLFA 2ZZMA 2FEWB 3TEFA 1Y3AA 1E0JA 3VO2A 3ZXUB 5ERYA 3TNFA 4MTCA 1FW8A 4DDMA 4LHZA 4UD6A 2SKCA 4NI5A 1U0FA 4F92B 3GPLA 5F3DA 5K3CA 1B14A 2WU4A 1OXXK 5FORA 2IWRA 1KO1A 1KQGA 2PUGA 3KAJA 4I2NA 4D0LB 2V55B 5IBQA 1Y1KE 1J07A 2C2HA 4NEGA 4BNLA 5LN1A 4XR9A 2G17A 3DDCA 4BO9A 3OEHD 4R2XA 3QOWA 5IJAA 4DQVA 3FW1A 4YRPA 4JYPA 1PWHA 5EVCA 1ZG7A 3GPBA 2OCDA 1T34A 1F2UA 5K8IA 2AV6A 7AT1A 5DYNA 1EK5A 1MAVA 1P7CA 2NPFA 1D6JA 5K8OA 3C6KA 2EBWA 2B20A 2ZB8A 3D8SA 1QRRA 3FJYA 3FLEA 5ALKA 2E5WA 3GVCA 3MA0A 4C78A 3KZWA 3W5IA 3ZCPA 4BJ3A 2GIVA 2EQ5A 4CDMA 4C2UA 2QLLA 1TT7A 2B9VA 2M1ZA 3LTEA 1U9CA 4QBKA 4UD2A 5B6IA 4IHJF 2OZVA 4BRUA 4LF7B 3EX7C 1QMUA 1HQDA 3UICA 3W8EA 5I3CA 1G2QA 4NJEA 3H9JA 4ML3A 4NPHA 3ABQB 4B3GA 1V8PA 4HKTA 1EUCA 4FYIA 4ILEA 4BO7A 4EJ2A 4Y2GA 3P32A 2VPTA 2X1VA 4OU4A 1C80A 4EGCB 4NJQA 3QLEA 5EXDA 1DBQA 3EMBA 5HZGA 1L7XA 1OD6A 1XCPA 2YZMA 5L6MB 2HMWA 1ZC4A 4FCTA 4OX9B 4C20A 4E1VA 3MGDA 2GX6A 3RVOA 2GDJA 1YQGA 2W2KB 4I99A 4QXPA 2JLVA 2H1WA 5JNWA 3T7SA 4ZBGA 4R1TA 1GGEA 2IYUA 2A9JA 1JKXA 1UQTA 4HAYA 5ESRA 3RS7A 4E88A 4NYJQ 1VYTA 1QZZA 1RQLA 1GDHA 3BWBA 2G07A 2H54A 5TQVA 2ZBVA 3DFZA 4Z9YA 4ZD6A 3OTOB 2WIJA 3OECA 5DLQC 3ICPA 4RGQA 5TGTA 1BDJA 1TKJA 5IMSA 1W5TA 3FYDA 2CWDA 2RIRA 4K6CA 5DNVA 2PZJA 4RORA 4KQCA 3K6SB 3H9QA 4FZVA 3WGYA 1G18A 3P2MA 4QAJA 1NFQA 5I7AA 5AVZA 4N8DA 5K8JB 3PB6X 2DY1A 2ZYIA 3KQQA 5KSWB 2VT7A 2PIDA 1JFFB 1M5UA 4E33A 4HLDA 3ET5A 3VI3B 2JGFA 1XL0A 5C8YF 1TKRA 4UU0A 5BYKA 2H11A 3LSTA 3W5CA 3FKQA 4M1EA 3ZCXA 1JFRA 3HDJA 3QUSA 5EUMA 5EJ9A 1UDRA 2HO5A 1V8DA 2PSEA 1FSSA 4HYEA 4OYHA 4QOSA 5ARCA 2LCQA 3STUA 3WLOA 5C51B 2E5LB 2O48X 4JVLA 2QIRA 3CV3A 4IVQA 1UKBA 4ISCA 5I4BA 1W4LA 2JIQA 1L7VC 3I2KA 3PXUA 3QITA 3QM1A 1F2PA 3OM1A 1UT8A 3V4SA 3QWBA 4XFJA 2VYNA 1CDZA 4O4LB 2FFJA 2R79A 2G5GX 1G1AA 4NCIA 1GNQA 2Q41A 4JMLA 1XB2A 3BICA 4HEA1 2EVWX 3KJQA 4Q16A 4XIFA 2ZETA 3JTMA 5FPTA 4DOMA 3RYCB 4MCAA 2ZSHA 1DCTA 1Z37A 1T15A 3TQTA 4TZ0A 3TW6A 3OBBA 3WB1A 5CX4A 1KA9H 1KH1A 3R5FA 2IIQA 4CM4A 3PB9X 3E61A 5F9FA 3CW8X 3C4VA 1K89A 1Y6QA 5ALYA 3RUEA 2WHYA 3UNXA 4BFCA 1SU4A 1YS6A 1C4WA 2XX3A 4KHPB 1OVMA 4BZXA 4RESA 1PV2A 2HNBA