2HB6A

Structure of caenorhabditis elegans leucine aminopeptidase (lap1)
Total Genus 174
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
174
sequence length
489
structure length
489
Chain Sequence
b'TQVLVRNGIQAVGDGLTSLIIVGKKSVLKNVTFEGKFKEVAQKFVTDGDSWNSMISRIPASGRHPLHYELAHLITVPDASSRGNTPTNAHSIYKELKPINYPEDTKNVHFVLFAEYPDVLSHVAAIARTFCKFSMKTSGIRELNVNIDVVCDKLTNEDAVFLTDLSESVRETARLIDTPANILTTDALVDEAVKVGNATGSKITVIRGEELLKAGFGGIYHVGKAGPTPPAFVVLSHEVPGSTEHIALVGKGVVYDTGGLQIKTKTGMPNMKRDMGGAAGMLEAYSALVKHGFSQTLHACLCIVENNVSPIANKPDDIIKMLSGKTVEINNTDAEGRLILADGVFYAKETLKATTIFDMATLTGAQAWLSGRLHGAAMTNDEQLENEIIKAGKASGDLVAPMLFAPDLFFGDLKSSIADMKNSNLGKMDGPPSAVAGLLIGAHIGFGEGLRWLHLDIAAPAEVGDRGTGYGPALFSTLLGKYTSVPMLK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Leucine aminopeptidase 1
publication title Crystal Structure of Caenorhabditis Elegans Leucine Aminopeptidase
rcsb
source organism Caenorhabditis elegans
molecule tags Hydrolase
total genus 174
structure length 489
sequence length 489
chains with identical sequence B
ec nomenclature ec 3.4.11.1: Leucyl aminopeptidase.
pdb deposition date 2006-06-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00883 Peptidase_M17 Cytosol aminopeptidase family, catalytic domain
A PF18295 Pdase_M17_N2 M17 aminopeptidase N-terminal domain 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10590 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Zn-dependent exopeptidases 2hb6A01
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 2hb6A02
2OR4A 2V8DA 3PB6X 1AYEA 3D67A 8CPAA 3IC1A 3RBUA 2PJ9A 4G1PA 1JQGA 3I1UA 3PB8X 4MCSA 1XMBA 3PRTA 2ZEFA 1YW6A 2V8VA 3KASA 3SJFA 4NGNA 4NGMA 4X8IA 3BHXA 4UEFA 4OC2A 4W9YA 3KHZA 5JM6A 4GM5A 5K8MA 2JEWA 2ZELA 4OC1A 2PVVA 2V8GA 2EWBA 2PJ7A 2AFUA 4P6YA 3S9MA 1TXRA 3B3CA 1IGBA 4ZI6A 4P4EA 4BD9A 3B2YA 3ISZA 2RFHA 1Z2LA 4P4BA 4NJQA 1LAMA 2XEIA 2WZNA 4YWYA 5HVGA 2XEFA 4DJLA 3WC5A 2PRQA 2G9DA 2CIJA 1HDUA 4PXEA 3WABA 3VARA 3FEDA 3VATA 5D8NA 2EK9A 2ZENA 4F8ZA 1YW4A 4PQAA 4WWVA 3B7IA 1GYTA 4OIDA 3CDXA 4OC5A 3IIBA 5HVFA 1ELLP 2EK8A 3FMCA 4Z65A 2PJ5A 4P4FA 2J9AA 3D66A 1IY7A 2F7VA 3FX6A 2ZOFA 1F2OA 2BO9A 3DGVA 4ONWA 3IJ3A 3V38A 4EMEA 1BAVA 4F9VA 4FAIA 3CPAA 5ELYA 2O53A 3NH5A 3QNVA 4MHYA 4MCRA 3SJGA 2JBJA 1DE4C 3B35A 3FECA 1UWYA 3FF3A 2AFWA 4TWEA 1CP6A 5CBMA 2C1CA 3KR5A 3JRUA 5JH9A 3D4UA 3TC8A 1YSJA 1BLLE 2HC9A 5F09A 1F2PA 1CBXA 3PB4X 4TNUA 3NH8A 1ZG7A 3V7ZA 1H8LA 1TKFA 2I3CA 2XEGA 1R3NA 2ZOGA 1Z8LA 4KSIA 4MXUA 1VIXA 4UEZA 1ZG8A 3LWUA 2ABZA 1CX8A 2OOTA 7CPAA 4MRIA 3RZAA 4LQGA 4A94A 2O4HA 3D7DA 3PEIA 4UIBA 4FBEA 3B3TA 4PXDA 1CP7A 2CF4A 1ARMA 1LANA 2PIZA 4MCPA 1VHEA 4WJBA 1XBUA 1LAPA 4DUKA 2PJ6A 2NSMA 2QJ8A 4F9UA 3WT4A 2GREA 3KR4A 2PJAA 2PJ1A 3KZWA 3FJUA 1LCPA 4MMOA 3HUVA 4PXBA 1BPNA 4R7MA 2GU2A 2BOAA 3PB9X 4IHMA 3KL9A 4YU9A 4H2KA 2WYRA 4A37A 1LFWA 2AFZA 1TKHA 2CTBA 3RAMA 3NH4A 4P45A 3D7HA 4CPAA 1CPXA 4Q7AA 2C6CA 4A39A 2GLJA 2PIYA 5JGFA 5K8NA 2F8HA 3KI9A 1TKJA 2VL1A 2ZEHA 3IFEA 3BI1A 5CPAA 1R43A 2ANPA 2Q4ZA 4EWTA 3S9NA 4UF4A 4EFDA 4NGQA 1CG2A 1TF8A 5LYFA 3KHXA 3SI0A 5HVHA 2ZEGA 5K8OA 2ZEDA 2FVGA 4NFRA 3N5FA 1EE3P 4OC4A 3PB7X 3GB0A 3IEHA 4X2TA 2ZEEA 1M4LA 4MCQA 4JYWA 2PJ4A 3S9LA 3ISXA 1YMEA 2AFOA 4NGRA 2IMOA 3WC6A 1YLOA 3SI1A 5LYIA 5LRGA 4P4IA 1PYTB 2HB6A 2PE3A 2IJZA 4IK2A 2BCOA 3SI2A 2PJ3A 2AFMA 2Q51A 4K3NA 4OMEA 2PJ0A 3D68A 3SJXA 1KWMA 5LYDA 2PJ2A 5D29A 2Q43A 1LOKA 2RB7A 3GLJA 3VH9A 4ZY1A 5LYLA 4P4JA 4ZYQA 3FVLA 3MRUA 3K2KA 4NJRA 2ZEMA 2AFXA 3IWWA 4OKOA 2QVPA 2XEJA 1RTQA 1Y0RA 3T8WA 4P10A 2POKA 1HDQA 4PPZA 3B3SA 5THWA 5J1QA 3H8FA 4R76A 1QMUA 4NGSA 1Z5RA 3B3VA 3BI0A 1FNOA 4OP4A 4P44A 3H8GA 3CT9A 3KGQA 1XFOA 1XJOA 2ZEOA 4B6ZA 3CPXA 2ZEPA 4MHPA 3KQXA 1ZLIA 1ARLA 4ZX9A 3GUXA 5K8PA 3H8EA 1ELMP 2NYQA 1CPSA 1FT7A 2C6PA 3B3WA 1BPMA 5LRKA 2V8HA 2PJ8A 4JZ0A 1ZG9A 3FH4A 3TX8A 3WC7A 1XRYA 4A38A 1F57A 3SJEA 2GLFA 3L2NA 3D7GA 2PVWA 4NGPA 4ZY0A 4PXCA 1PCAA 4NGTA 2DEAA 2C6GA 4OC3A 1Q7LA 4AXVA 2PJCA 1VGYA 6CPAA 2PCUA 4UIAA 4R6TA 4OIWA 1ZLHA 4ZY2A 5IB9A 1DTDA 5HXDA 1Y7EA 3NA6A 2IQ6A 3PFOA 1NSAA 2V77A 4OC0A 3FEEA 3NFZA 3HLPA 4X3RA 3MN8A 4RUHA 3PBBA 4IAVA 5LRJA 3PFEA 4MHZA 4UEEA 1VHOA 2AFSA 4MHNA 2PJBA 3PBEA 1OBRA 4ZX8A 5I4MA 3DLJA 1AMPA 1QQ9A 3KQZA 3K9TA 4FWUA 4DYOA 4P4DA 1HEEA 1TF9A 2CTCA 3BXMA 2QYVA 3D7FA 4O23A 4FUUA 4R8FA 2JBKA 3IO1A 5DS0A 1Y0YA 3LMSA
chains in the Genus database with same CATH superfamily
3I0MA 3KPJA 4ZT4A 1Z0IA 3RBXA 3MB8A 4G0OA 1IDOA 4FWBA 1AGRA 1JEQB 4M8SA 1ML3A 4MCSA 1XMBA 3FH0A 4RV5A 3GLHE 1AZTA 2OZGA 2RI1A 4DF3A 2WIBA 1D3AA 5DKFA 4MGZR 4QDXA 2ZW6A 4V2IA 2V4UA 2PJ7A 4LFAB 4LGMA 4L9WA 2ZYSA 1JQ5A 5CT4A 1YZNA 1PI3A 1VQ1A 3JWPA 1T5IA 4IPTA 1QE3A 4WK0B 3DP7A 3K70C 2JH8A 1I3OA 3C3PA 2E7ZA 3GMSA 4TXHA 3DLTA 3SHTA 4BO8A 4I55A 3HKEB 4FFOA 1QZUA 2DTEA 5EA2A 1YBAA 4M76B 4ZVMA 4OC5A 2OAEA 4DJAA 4PW0A 1GCGA 3TGPA 1UXHA 1DFHA 1VKHA 1SJ9A 5ETJA 4FD3A 1OAOC 2D06A 4Q12A 4UXJA 1XV5A 1EIZA 1W85A 3FIJA 1LC3A 1NA5A 1UWYA 5AW1A 3PNKA 1CCWA 4B3HA 2DJ5A 3D31A 3WLNA 2IXFA 2XZTA 1QHFA 2V45A 1LX6A 4EQ6A 2OGUA 1JR6A 3OZRA 3RTDA 3ZDAA 3QE2A 1VL6A 4OHRA 2Q4RA 4UEZA 4OK3A 3DTTA 1DZ3A 3FB3A 1QWOA 3B9QA 4DNQA 3G68A 1EVIA 3UMYA 3R75A 2P69A 4YI3A 3A05A 2EGHA 3M5PA 4CL0A 2AFIA 4EVRA 3EA4A 4JC0A 1CUXA 3TW4A 4MVJF 5IAKA 3E05A 2J3IA 3RABA 3KSRA 3ZHCA 1LFWA 2CTBA 1YZKA 3NG1A 3G89A 5DM4A 3LBHA 2R2AA 2ARKA 2PIYA 2RGCA 4MJ7A 3IFEA 4FGKA 1L7QA 1YU6A 4FFNA 3PPVA 2R7LA 4YEDA 2FZKA 3N0RA 2BP7B 2ECKA 2E3JA 4BN4A 4IF6A 3WY9A 2WYWA 3G13A 1AKVA 1HDXA 1D7OA 4FT4A 2JKVA 4U02A 4BNDA 3ICCA 5DW3A 2WSIA 1EGAA 2ORIA 4KBFA 4PTLA 4M1ZA 5A7FA 1OFUX 4E0AA 1LLCA 5L7WA 5T64A 3FKSA 2PJ2A 3C3WA 3R7NA 3Q41A 2PSHA 2VF7A 3TFOA 4HMOA 1MFZA 2I3BA 4UVGA 1MO5A 4DNCA 2G5GX 4GHWA 1WL8A 1QC5A 2ORVA 4P4JA 1WF3A 2UDPA 3OP1A 5F2KA 4NJRA 2NP6A 4HDMB 1W0JA 3G0DA 1WDKA 1RTQA 1H2FA 2ZJZA 5JRZA 3VVCA 3SHPA 2OM6A 1UQUA 4YDQA 3GVPA 4XIFA 4EX7A 2AXPA 2ID8A 4M9QA 3C3XA 3JYQA 1F38A 2VIIA 4OQMA 5K8CA 3I2IA 3TIFA 1VGQA 2D7CA 1P29A 3I45A 3ZG6A 3PHBE 4MKFA 3LWDA 3P9PA 3ZWNA 1ZC4A 2VHTA 4D02A 4P08A 1NY5A 3FN4A 5CM9C 1EP1B 3BIFA 1RC0A 2TMYA 1RO5A 4L4SA 3WWEA 4KGVA 1F4LA 5C8YB 2OLEA 1EK5A 1HR0B 4I2NA 4YP7A 1Z6QA 2B7CA 1NVMB 1Y3DE 4ESEA 1SBCA 4OAPA 2AZ4A 3ADDA 1N0WA 1H8ED 1FDOA 4KO3S 1OLSA 2Q5HA 1ONPA 1RQ7A 5HDBB 3PFEA 4MHZA 1Z4LA 4QM7A 1UOEA 1IDN1 2PL9A 5CITA 3TH5A 5U1PA 2XDQB 4B82A 1ZVVA 3LGAA 2I71A 3BDIA 3MJVA 3P94A 4HNUA 5IJXA 2WZQA 3VC1A 2PSSA 3IE0A 3WIOA 2B69A 2OFPA 1JIVA 1RCFA 3DZDA 5IKEA 3AO0B 2RK6A 1MCZA 5CNIA 1MIOB 1NVUQ 2P9YA 3SF8A 2ODPA 4BVHA 2EWWA 4DBLC 2C7QA 2IOFA 4YRSA 2JKZA 3KXLA 4BVEA 1Z7YA 1QYCA 3C7CB 3OAAD 2IHUA 4K86A 4CEHA 2D8AA 2WJ3A 3WABA 4F85A 2G8LA 5G3ZA 1SQ5A 5HUJA 4PIPA 1EFPA 1E1QA 4U9IS 3RYHA 1SVIA 3GCWA 4DBVO 4AICA 4HSGA 1TLTA 3D7RA 3PFIA 4POOA 5CB0A 4YDRA 1CVIA 1WXWA 2WUGA 5ALYA 4BNXA 5A3QA 3TL3A 4DJFC 1N9ZA 2BKXA 1HZZA 3KFLA 1QRDA 1RRCA 2CVHA 2XV1A 4PGGA 4H7FA 5B7QA 4B75A 3KVRA 4LOHA 4M36A 4BEBA 4HGZA 1QS0B 1K66A 1IN7A 2AD1A 4LQCA 4NLLA 1UPTA 4CU5A 4BFLA 2I3CA 2DPLA 2WQZA 5KNBH 1SUEA 3B6JA 4ON9A 2OFWA 3DVAA 4BNZA 1ULBA 1I0LA 3I92A 3L6RA 3P2YA 3AIMA 1G5FA 3CNEA 3RYFA 3PC8C 2P2DA 1QFSA 4QLBA 3T7JA 5BUQA 5JAQA 1N92A 2DPGA 3H5WA 4RMHA 4G4SO 5CX1A 4KOSA 2FZVA 3EBOA 2FGJA 2W6MA 1L3CA 2RHJA 1WB6A 3A6PC 4PSDA 2FOIA 3BJIC 1WZUA 1L4NA 5IYZB 4E03A 2OZKA 4OFXA 4OHWA 4RK7A 5PNTA 2IYLD 1G3UA 1RWPA 2RHHA 2PH7A 1E7YA 1NWHA 4O4LF 1W36D 3BSFA 2Z98A 3SXUB 4EIWA 5JR3A 3AXSA 3K5WA 4J43A 3BD6A 3PE6A 4Y6GB 2BKUA 3SI1A 4DPKA 4P53A 3QKIA 2PE3A 1B41A 4H27A 3DH0A 1YMQA 3W1VA 1VRWA 4MEJA 5KHLB 2H65A 3N53A 3CX6A 4TT3A 4F5WA 1ISFA 1UJ2A 3ZQJA 1VIDA 3I6BA 4ZVVA 4RZQA 3TLBA 3ROZA 4HXYA 2ZRDA 2R8ZA 4MH0R 2VT7A 2IEZA 2ZSDA 1FFCA 4MVJD 4WFIA 2XCIA 4LRWA 5LQMA 2A0WA 3RH0A 3K2KA 2X5KO 3LDAA 2YGWA 1P72A 2P68A 4TGLA 3W91A 4FXPA 3IAXA 1E2KA 1KI9A 3KHKA 4X1KA 2W6OA 1TF7A 4IUYA 3D8UA 4B4DA 4LGCA 4A0GA 2M6SA 2QU7A 5ABPA 4B8WA 1N5KA 4QBJA 2AI2A 4X93A 3M7IA 5KNDD 4FOPA 4H3KB 2Z3NA 1SH7A 3NXKA 2KLBA 4RDIA 4H31A 5I7HA 4WQMA 4CQLB 3C2QA 3TW8A 6YASA 3G49A 1ZITA 4OBEA 4PBRA 1PT7A 5A0VA 5D86A 2PCUA 3WB0A 1USVA 1JP7A 3ZZTA 1JDUA 2DPXA 1E1RA 2QRKA 2BDUA 5L95A 4EA7A 1EX9A 4FLEA 1PZFA 4JXKA 4CV3A 4DV7B 3EOAI 3R1KA 1IHDA 4MKRA 2FE4A 3PL5A 2C7VA 4QXOA 4N7JA 3KSDO 4ZO9A 2NIPA 3VOBA 2QTRA 1XRPA 2H1FA 1L6RA 3ZE6A 4MULA 2D5CA 1HFWA 4UULA 4UW9A 3HB5X 1M6EX 1BE0A 1WQ3A 4YLEA 1R0SA 2AOVA 1OX6A 1SVNA 4O2RA 2XYVA 2FEOA 3B13B 5G4LA 2Q5IA 2NZWA 3KJGA 1QDUA 5CK4A 3NVKI 2HRDA 4J8PA 3HZRA 4XGIA 1EM8A 2XCOA 3LAWA 4P8RA 2HPVA 4QOSA 3K9LA 1UM9B 3OA2A 1XD2B 1XCOA 4EFNA 4U63A 5FD8A 4CQNA 3R3ZA 3I62A 3NWEA 1ZAYA 1UPAA 1VLHA 4CKEB 2WNIA 1MPTA 2IH4A 1G3RA 3L02A 3W90A 1QBKC 3PF8A 2GPAA 2EFJA 2GM3A 4IG4A 2NUPA 2CJYA 4ZQBA 3VPFA 4QBFA 1FDTA 2EKLA 3EEQA 2JBJA 3B35A 3R1IA 3FF3A 2PL3A 1Z62A 3VYRB 1O7JA 3GEHA 1XKLA 3KTDA 1CUZA 1DJOA 1NIPA 2H9AA 5F3WB 2EKZA 4TRMA 1RJ9A 2IHBA 2ZR9A 3D3SA 3IXQA 2JCGA 3J7AC 2QI9C 4Y2SA 2QT9A 4U2DA 4RULA 4CM6A 5GY7A 2VKTA 5K0SA 1TD9A 1MO4A 1R6DA 1VSBA 1DIAA 2ZWVA 5DH9A 3TOCA 4RXUA 3EMDA 2Y8EA 4ZCLA 3GMIA 1HE5A 5EWLA 3C5WP 2QENA 3TRKA 2ZTHA 4TS3A 4LGYA 4DA9A 4MR7B 5KJEA 4J91A 1Q3HA 3VWEA 1NPDA 5D1NA 3E8XA 3IJEB 1ZNXA 1FDSA 4QYMA 3X1MA 3QVMA 5I4BA 3V1NA 5T4FA 2WKRA 1MX3A 4EDHA 3KB1A 3SJBA 5TVGA 2GTPA 3RU2A 2HNKA 1NW3A 4IM7A 3B1FA 2Q4ZA 4FR2A 4CBVA 3UV3A 3VZSA 4F06A 4CIBA 2DUNA 1NNSA 4TRNA 1HO3A 4MV6A 4TQUS 1M8PA 1XMJA 4RJJA 1EDOA 3NAGA 2CK3A 4OYYA 2Z4SA 3OJWA 4LYHA 1M73E 3N86A 1HE2A 3WQQA 2Z43A 4A6EA 4EELA 3L8HA 4ATNA 5HQTA 1BQ3A 4W5TA 3NDIA 1DAIA 3X1WA 3D2MA 3I6IA 2PH3A 5CA0A 3G85A 2I2AA 3SQXA 1Z9BA 2G63A 1O94D 4QKQA 1BMQA 5KNCA 1QB7A 1R10A 2IP1A 4YP1A 7GPBA 5BV7A 1SU6A 2WG0A 1DAGA 4H1HA 1BTOA 3BB1A 4G23A 4DMUB 5AW7A 3EMBA 3CPXA 3ZXSA 5IEJA 2QSUA 4FONA 3JWHA 5AJHA 4R2XA 3ORRA 2YCBA 1WD7A 1GPUA 3CSUA 1LRLA 3LLUA 4S24A 2H2DA 2ZITA 4LJLA 2VI5A 5K6RA 2W6QA 1Z6TA 3B53X 2YNCA 2J3LA 1ZGJA 4I4NA 2E6KA 3U44A 1JPJA 3TOXA 2PJCA 1NUUA 4A1OA 1VGYA 3BMXA 1PR3A 4HWOA 3RC2A 1ORHA 3BA1A 2JZOA 3SYNA 2XKKA 4P1ZA 1S2DA 5JSYA 4FC6A 4X8LA 2MJLA 4CIXA 4AF6A 2C7GA 1P9LA 4UHBA 5DHPA 3TD9A 4RVHA 5HR5A 4PYIA 3ZVNA 1RE1A 5I9BA 3TKAA 2EQ5A 1S3IA 4RUHA 2I3DA 1KDPA 1YDGA 4J2TA 2IYNA 1HWYA 4QTYA 1T9AA 5IK2A 5CVTA 1P73A 2F55A 2D4PA 3TZHA 1QDLB 3IA7A 3UATA 1H2BA 2P4HX 3E1SA 5HZHA 2H7CA 2AIRA 2EP7A 2FRDA 4NK5A 2JCYA 4EI9A 5L7YA 3F1LA 5KWJA 3IC1A 2PVSA 3U39A 4G1PA 3HCFA 4FPXA 3MJFA 1M5UA 3G5TA 1DJPA 4L50A 3IVRA 1AKUA 3A9TA 1CD5A 2LP4Y 3N39C 5AVJA 1U0SY 1G4UR 2G8NA 5TPWA 1TA9A 5AJUA 3LVBA 3B51X 4FDUA 1U4OA 3KL4A 4LTDA 3DTVB 1W93A 2Q7SA 2C7RA 4R2LA 621PA 4ROTA 1P1KA 2ZSHA 3JQ7A 3DFFA 3OZTA 4UEWA 1KKUA 3GELA 2JVKA 2PLRA 3BXHA 3V2UA 1PUJA 3GFQA 4BNMA 5DBFA 3Q3JB 4BVJA 4B6RA 1NQWA 1XN4A 2G17A 3DR5A 1TADA 4YV0A 4XB1A 1WDTA 2PO5A 4KOXA 4RY0A 1IOLA 1VI6A 4CKCA 2ZWAA 3DGVA 4FAIA 3R9XB 4KXLA 2W2LA 4AZVA 2C27A 1JFSA 2DYKA 3B3AA 4MKHA 4HNTA 2ICAA 1E2HA 2OYCA 1G0OA 3JARB 1MT3A 1G5QA 4FBLA 4TWJA 3ZE9A 3PZJA 1KYZA 2O8CB 5LIRA 3H1GA 4RKEA 3DFIA 4R9SA 3B20A 4B14A 1A4XA 5EHNA 1T35A 5A02A 4ICIA 3GROA 4GOJA 2XWJI 2ZPTX 1PRYA 1TMYA 5KYWA 2J4DA 8OHMA 3R4VA 1Z63A 4NMWA 1MJGA 3LT1A 1CNEA 2QN6A 1NVFA 1FVOA 5JXGA 2RIPA 4R2HA 4NZOA 3CLRD 3FYTA 1E4YA 5IXSA 1H65A 4E2AA 3RI3A 3V1YA 4RHYA 3VZCA 5FA5A 4H60A 4LXXA 2R4UA 2UZ0A 4WBNB 5ARCA 2XDWA 1ZJ5A 5BMVF 1XT6A 2WIJA 3WC6A 5IWCA 1P0FA 2XY4A 1Q7RA 2DR2A 4TV8A 2Y1EA 3NUZA 4ZT7A 1L4LA 1NKTA 1Q92A 1IJBA 2WV9A 4OREX 1Y34E 2WHQA 3GEBA 1EE2A 2W0MA 5MF6A 4Y2YA 2O7VA 5DISB 5LYLA 4CUJA 1JYSA 4EB8A 4DYHA 5CCEA 4X1IB 2Y05A 3N59A 4B3RB 1W0JD 5H83A 4OLJA 3H9GA 2ZXFA 1B3BA 1XA3A 1M6VA 3KQHA 4UARA 1T91A 1BC5A 5AK6A 5ERGB 1YE8A 1KU6A 4AURA 1JSXA 3OCZA 4EF5A 2AEMA 5J4HA 2V3CC 1ZJYA 1LA2A 3AHJA 1HOXA 1KIAA 3IE2A 5K0GA 3INYA 5DGCA 4PLZA 1LK5A 3VJRA 3GJXC 1NM5A 1KEWA 4HNRA 1BPMA 1XJ0A 4W5QA 3U1VA 1XPJA 5IPFA 5KQGA 2P2GA 1KU0A 2A0YA 4L78A 1TDJA 4DIDA 3L8GA 3FUTA 2QXTA 4BXOB 4JU8A 5E0KB 3WGYA 3L8MA 5IM4F 4L2IA 3RT7A 1AB6A 1Z8FA 1SU8A 4TYQA 4QB9A 2LE0A 3WZLA 1T8YA 4OC0A 4RIHA 1W94A 4CIWA 4JSTA 1CZUA 2VPIA 4TVKA 1ZUNB 2PL1A 4UUMA 2RC5A 3NYWA 1QBGA 4AG3A 4N39A 1U8CB 2Q5QA 1XDGA 5AJTA 4B3FX 4NCZA 5HUQA 1K7XB 1Z5UA 2I7DA 2X86A 4P80A 2OO5C 5DS0A 1QRRA 1J90A 3M2PA 4EPVA 4Q48A 1DUIA 3N6XA 4XX0A 4B5PB 1FBTA 2QN2A 4B3XA 1NBOA 5CAEA 5LUAA 2LKDA 1YDEA 1K9VF 5THXA 2J9YB 3GF4A 4CAFA 4KLWA 1OBOA 2YZGA 3L0ZA 5BR8B 3VDMA 4QL3A 4UBKA 4P6YA 1Z5PA 1NT4A 3TN7A 2DHCA 2FPRA 3O2QB 2VP9A 2H08A 3VGPA 4W5OA 3TSWA 1KMMA 3FHTA 1VLLA 4ZYTA 1Z47A 1NF9A 2WD8A 2XCSB 1NV9A 3Q7EA 1D04A 1SMKA 4PQFA 1OFTA 2C88A 5CJ2A 5G0SA 2D4OA 3O84A 4RDHA 3AI7A 4D9GA 2SKEA 2JJ8A 1ULUA 1OT3A 2D5LA 1UBUS 2QN8A 1BN7A 3U3KA 1E1QD 1W2HA 5AXDA 3PR3A 1WWKA 2O0LA 1KFJB 3MWEB 3C3KA 3BCRA 2VPWA 2OCIA 4NYJR 4EB6A 3VQTA 2BFFA 2AS0A 2UVDA 3QVOA 1JE0A 2JHPA 5D1HA 4C76A 1C3OA 4QDOA 5DWVA 1UXKA 4PFJA 3NTOA 2Q9UA 1WMDA 2V0NA 2OKCA 4IF4A 4ZGGA 2XUJA 3BWEA 4DV2B 2O7NA 1R3NA 1J09A 2G5CA 2DKFA 2PUTA 1FSPA 2RHTA 4DM3A 1J8DA 5LDHA 4WKGA 2Q3EA 4K3VA 4RE6A 4R3KA 1TUBB 2JLWA 4L6AA 4JXZA 1PV1A 5A7GA 4A73A 2P9EA 2HQBA 1NBAA 4C08A 2IUEA 3QVKA 3L6OO 2ODQA 4EABA 3ULKA 1JPVA 1AN9A 4JJZA 3VZRA 3ZOKA 1A5SB 2ZBDA 2NYRA 1TJ4A 1ZWLA 3OUUA 4G5YA 1PZXA 1JDNA 2FW9A 4LXQA 5JADA 3FB4A 3FGPA 3KEFA 2QDXA 4ZEMA 1BWPA 2GUGA 1ECGA 1E1YA 4WEOA 1RAAA 4Q15A 3N5FA 3G02A 3M9WA 3PT5A 1BX1A 3T9AA 1YOVB 2EHDA 4U7GA 4GZMA 4LQ6A 4ZDKA 1H8EA 4E8OA 1YO6A 3L9XA 3DMRA 4B11A 3BTUA 4ZHQB 4HEHA 5BYBA 5AG4A 4EY4A 3T12A 2E49A 3TTTA 3ZV3A 2VK4A 3IHTA 3ZE7A 4F0XA 3QFRA 5DCWA 2EW1A 5I45A 1KWGA 3OJEA 1DAPA 2QB5A 2DETA 1M0WA 3OCWA 5BNTA 4ENVA 4HAUA 1V2HE 4JBYA 4OHOA 3GRRA 4XPLA 4R68A 4ZQGA 4O4IB 2JFHA 3B1XA 5CT9A 1P1CA 4BP3A 3U2QA 5G1OA 2OV4A 2QIOA 1CY4A 1L0BA 3Q5EA 2H31A 1CBUA 2XUZA 2GD1O 3VR4H 1M6NA 4L4ZA 3CS3A 2VYVD 4AY2A 3W6NA 3DR3A 2EFYA 1ZOIA 4QAJA 3VNVA 3OAAA 5A4KA 3UYKA 4ITUA 2PVWA 3MRTA 4UM9D 3QY0A 2YH2A 5CLHA 1HLPA 5F4ZA 3DBIA 3RROA 5ERXA 1XJWA 3DQZA 3DEYX 5HKLA 1MNQA 4FS8A 1GQOA 3QQ5A 2A9VA 1BOBA 2L0XA 2IBSA 4B6SA 4MI3A 2PR1A 4RDXA 4CYMA 4UEEA 1A8QA 2D2FA 1HFKA 3WAKA 2QAGB 1PAUA 2X7XA 3ZS8A 3EVNA 1GGEA 2DFVA 4G0ZA 5JEDA 2FLKA 3VSCA 5D7NA 3LS2A 4Z0HO 3I01M 3L8CA 1AYEA 4O2AA 3SHOA 2EJTA 5F76A 3M1IA 1QSGA 1ZRNA 3WLSA 4HTAA 4HLCA 2XIQA 1CT9A 2CBGA 1U2DA 5C7YA 1RQLA 2Z3WA 4DYDA 4Y0VA 2XNDA 3C74A 1MZPA 4PTYA 3NH6A 2Z30A 4LF7B 4K88A 3LSTA 1VG0B 1N0HA 4HEQA 1UC9A 2NPOA 3NDJA 1Q1GA 1WDWB 3FMFA 3DTNA 4EB3A 2RB4A 3KL2A 1IEQA 1XLUA 4FW8A 3JQDA 4BX0A 1CJBA 1NQ5A 4WOKA 4HPSA 1WIWA 3JYLA 1SBIA 1HNZB 2NTEA 1WK4A 2D0PB 3D6NB 3QWAA 1PR9A 1JLLB 3DEHA 2AJDA 3LSYA 5T57A 2F3UA 4RTPA 3HJHA 4KOEC 3IT1A 2VDQB 1MIOA 5HIMA 3V6LA 2Y1XA 1KZFA 3K6SA 2RGNA 4AY6A 2PX3A 4LCJA 3R7WA 3DLCA 1TGVA 1CQJA 1XKQA 2QRGA 1H93A 3ELDA 3MT0A 4BGEA 2VP2A 5JWHA 5FUMA 3SP1A 1SKUA 4YRRA 3G6WA 1FJXA 2XUQA 3QEOA 5CCXA 4TKVB 4ARCA 3EZ6A 2QF7A 2R1UA 4TSKA 5DHFA 3F9RA 2FFHA 5CH3A 4ZAZA 1HTWA 3FDIA 4JYAB 1NXTA 2ETXA 4ETIA 1E1CB 1QDEA 4BVFA 2DFTA 2QY9A 5JU6A 3P9SA 3WT4A 3U80A 3ZUPA 1NW9B 4MGHA 3ROKA 2Z3VA 3UMGA 2GPTA 1YOBA 5KNDA 4UA3A 4DA8A 3AKEA 1AUPA 3C4QA 3E9MA 3DYBA 1K97A 5DYIA 3TTXA 3NLLA 4OPMA 1ZM7A 1PWYE 1PFWA 1U81A 4FGLA 1M8FA 3KPUA 5DNDA 3WGIA 3FB1A 3VC3A 4XW2A 1E2BA 4MPJA 4EA6A 2MT9A 2XEDA 3HY4A 4KTTE 5FADA 3MIZA 4CE6A 2I66A 2C3UA 1PQPA 4L02A 3DE7X 4ARVA 4QSMA 2IVFA 3CZMA 2CK3D 3AZPA 2NO4A 1E0JA 1PFKA 1BDMA 4CCWA 1J5PA 1NYLA 3K73O 3UK2A 1VLJA 4ZJUA 2WMNB 4UVHA 1IBSA 1UC5B 3MSCA 4P81A 2FEPA 2ZEMA 2ZYDA 1HGXA 4RX1A 2FMKA 4GMHA 4QXAA 4G8DA 4LZPA 4YRHA 4FGUA 4IHJB 1AE1A 1OIWA 3PC6A 1T9BA 4UBOA 4Z53A 3K0HA 3G2OA 1ZLIA 1JHZA 3GJ6A 2WVGA 4ALLA 4RLHA 3WYFA 3QELB 1WB4A 4EDFA 3U56A 3MOSA 3W5BA 3OQPA 2W6JA 2V8HA 3NGMA 3ANMA 1EGQA 1YC2A 3GVCA 4HWRA 1GU0A 1YR6A 3H4VA 5K0CA 3RIYA 1NN1A 2G1JA 2WM9B 5CM8B 4O02B 1FRNA 2DR0A 1MTZA 1A1VA 3OE4A 1U99A 3WLOA 3VYWA 5AG6A 4TWBA 4DCNA 2AEFA 1KPHA 5G22A 1XRMA 1CZRA 1E5LA 4DNFA 2CMHA 4EMBA 4G8BA 2ZJYA 4KPUB 1BOFA 3KJHA 4FINA 2B4BA 5BXQC 2Y3IA 3QOXA 1PIWA 1SU4A 4F8JA 1UDXA 2NVBA 4HN4B 3ANLA 5K01A 4RLFA 3GFRA 1W49A 2IP4A 4LF9B 5IK2D 1LWNA 4P36A 2ZVQX 2CY2A 2C9OA 1G291 4LWZA 3UFXB 4B0PA 3KC2A 3IURA 3WMGA 2RGEA 4ZOEA 3MOIA 1BXGA 4WXRA 1SHUX 2ZUEA 3M3PA 3D67A 1SOUA 4C05A 1WUJS 1RQPA 3V8MA 1KDRA 2CKMA 3X2EA 3H1TA 2GF9A 2CLHB 4PGFA 2XI4A 5AG5A 1KIMA 3AR5A 4KQGA 1YHYA 2Q3DA 2W98A 3C7DB 5EFOA 1XZJA 3ADBA 1P18A 3FAZA 3BL6A 4EY3A 4M9XA 1EQ2A 2FWRA 1EK6A 1BNCA 1HA3A 2CDCA 4CDRA 4MRMA 4KRGA 3FNFA 1ZUWA 4JK3A 3WGOA 1EEXB 4LSMA 2OOSA 3JVIA 5HBRA 3CWZA 1EVYA 2CHGA 4D26A 4M87A 1V7CA 2CFOA 2AK2A 4JVMA 4OG2A 4A27A 4IO0A 2WMYA 3PDUA 3RWOA 2OT3B 3OHMA 1I2CA 4MO9A 1GG8A 1FU4A 3EQZA 4P7GA 1ZVJA 1DLIA 4K05A 2HA5A 2Q3BA 1ZX1A 3HNOA 4LQ4A 4OQEA 3D3NA 4R1LA 2PJ5A 3V4LA 1MAHA 2O9JA 1EYZA 2FSHA 3PDIA 2XNCA 3BMOA 4KXYA 4KFRA 3PGLA 3NKLA 4MVWA 4X7BA 1FP1D 1F3LA 1BW9B 2VJAA 4LDZA 3QNVA 2GKSA 3R9EA 2JIQA 5HJ2A 4A1FA 4Q4LA 3VRHA 3NBYC 4Z1MD 4DIEA 4P35A 1IIRA 2X6TA 5C8ZA 4U2BA 4NECA 4KZKA 2AG0A 3PJDA 3I3SR 5EEGA 4CKEA 4J0DA 2NOAA 4U6SA 4Q18A 2AFRA 4JBNA 5CIQA 5FB3A 1O0SA 4HGOA 2C1XA 1XSEA 1QRSA 3RT9A 2EL7A 1U65A 1DJMA 3K94A 2WM3A 2ZJ8A 4QC6A 3S6FA 5ENDA 1U8XX 5DASA 3RFUA 4XGKA 4IX9A 1Z4EA 3MMSA 5GV7A 4CKWA 2GBPA 1AHHA 5CJJA 4HNAB 4ITRC 3SIWA 3MUNA 4Y9SA 1PP4A 3RYCB 5ESRA 3RUCA 1ZGGA 3CINA 4TSRA 1JT9A 4MP6A 2PGLA 3MWYW 2OY0A 2FZLA 3GPLA 3VMFA 2ZGVA 1QYRA 5F5NA 4TTVA 3LV8A 1TKJA 1D4FA 2QP3A 1TO6A 2DFKB 1S0UA 4B35A 2H1SA 2AXQA 4RH1A 5K8OA 2VEDA 1DJNA 1EWVA 2P8SA 1PT6A 4OC4A 1N2SA 2H9IA 2JPDA 4IWYA 3NATA 1E79D 3WGLA 5J47A 3AERB 1TMOA 5DX1A 3RKSA 3TFWA 3ZE0B 2JGFA 1VBMA 1K75A 1KZ7B 5AQ1A 4KXNA 4BC0A 1LPOA 3D68A 1GCIA 2BOVA 4RCVA 4XLTA 5D29A 1PT8A 3FHCB 4DXDA 4DG9A 1YJ8A 4UZFA 1NVTA 2V5AA 1SOVA 2DPHA 2AYYA 4WBSA 3OJ0A 1KA9H 1G66A 5LOVA 4FKZA 3ANXA 3WGTA 2QJRA 4JQOA 3THWA 4HI0E 3QJ5A 3WGVA 3F5SA 1DJLA 5JYCA 1OILA 5CVCA 4YAKA 3GNSA 2OBMA 1XNGA 1QNFA 4UMVA 1R12A 1W8IA 5JS6A 1U0TA 4OO3A 2ZI5A 2BZ0A 2OHJA 1KZHA 1M10A 4GUAA 4J03A 4MIKA 4BAUA 3NM4A 3C8DA 4C2XA 1E1NA 3G2LA 2YC4C 2HHJA 3PD1A 3HV0A 1H2HA 3BXPA 4JENA 3HP4A 3SQLA 4QFBA 2PZMA 4O2AF 4I9UA 1WLYA 3WC7A 3A2MA 3HXOA 1JJFA 1UBMS 4AG6A 1YB7A 4H1UA 1BYUA 4OJKA 1BJKA 2F1RA 2JFOA 1C14A 4TX1A 1Q3KA 1B87A 4WOPA 2RGWA 5CFQA 1ODSA 2YWXA 2P40A 1FJGB 5AKEA 4QBTA 2XVXA 5B6IA 4LHEA 4MV1A 1AO0A 2CC2A 1LTQA 1WWZA 2AUMA 2Y1CA 4E32A 1ZI6A 1US8B 4BKMA 4YAUA 5JO0A 4OKSA 1Z0KA 3L84A 3ZCVA 1NXSA 1H23A 3HFGA 3GXOA 2C4MA 2LWIA 1Q1NA 3D0OA 3RC1A 4P7FA 1WV0A 3UMVA 4HBZA 1EFVB 2W2VA 4JR0A 1QUEA 4RW0A 3VSAA 1EZ1A 1DDOA 4GT1A 2ZM5A 4A10A 4NSNA 4Y6RA 2ZT8A 3FYUC 4EPYA 2BFDA 5FF9A 4KPGA 1NF2A 1RWNA 3TAXA 4JA0A 4LJSA 3HEMA 1H2AS 3IDSA 2W2KB 1I0IA 1YSCA 1MUUA 4P58A 4G8CA 3R9WA 2AE1A 4O8CA 3R5SA 1G3IA 1WXFA 4M9ZA 5FFMA 2NMVA 3EJWA 3FMVA 1N2ZA 5LLDA 2XMSA 4KR0A 1X1RA 2V3WA 3CNNA 3OM0A 3I6ZA 2PYIA 5JEEA 1CTQA 1EXVA 3FUUA 1SUFA 4EW3A 5EP2A 1U7OA 4YUXA 4URFA 1A8UA 1PZEA 3EFEA 4YTEA 2VH1A 4WA7A 3E7FA 1XEXA 4MQ4A 1PBTA 3LUJA 3HDTA 3O73A 1J56A 2C9CA 1MEJA 3FPFA 1XZBA 5IU6A 1BXRB 3IBGA 3MJEA 4EB0A 3ZD6A 2I4RA 1V43A 1BGVA 4EFMA 1XTQA 1EA7A 3NXSA 1GQFA 2Q1TA 4CRWB 1Y33E 3TIIA 3JZMA 2G08A 5EJ4A 2P6GA 3NALA 4AKEA 5KDDA 4L8YA 2QORA 1IZ0A 2H2WA 4RK1A 2QHXA 4CLRA 1F2DA 4RTMA 1S4QA 4XWGA 2BFBB 2CJXA 4J0JA 5IZ4A 3U0BA 1GL6A 3IR5A 3X0DA 5LXTA 2L18A 3D4NA 4TRRA 3SSAA 3RKUA 1EFCA 2VSOA 4V3CA 2HCBA 4MUKA 4CHGA 4H0NA 4K6CA 3KEOA 4WH0A 1U2EA 3HSSA 1VIVA 1OX4A 3ENWA 1EK1A 1DWPA 1GUZA 4MFJA 3FA2A 2O8CA 4LHYA 2QVZX 2PWYA 3EG9A 2BIFA 4GE3A 5E96A 3EFBA 1LW6E 1Q1QA 2GHQA 1ADBA 1FLNA 3NPAA 4DM4A 4GMKA 4LC0A 5BXYA 4JB3A 5LP6C 1YZYA 3Q9UA 4J1NA 2NXCA 1K7SN 4OIFA 4GKVA 1ZM3A 2Y0CA 5I8WA 1ZD8A 4D3SA 3AM3A 4MFLA 3B1VA 3SBXA 2IEIA 1QH0A 1IHXA 3K1AB 2Y71A 3CISA 4RIIA 2N0SA 3VH9A 3U3XA 2ZIXB 3ZNPA 4WACA 1YL5A 4MVYA 4WCDA 1A5ZA 5CK5A 2B5GB 2ZBVA 2Q0XA 3UKDA 4IXMA 4FMCB 4HNXB 4NCIA 4QU8A 1IBKB 1P6UA 3K7EA 4BKOA 3GW8A 4INOA 3EDMA 1WY7A 4C4XA 3AB7A 4RTSA 1N8KA 2ZEPA 1FYEA 2GPWA 5J1TB 4F3RA 3CVVA 3DBOB 5JD4A 2EJBA 3NH9A 4YH1A 1KUXA 3BD8A 4RWEA 2QVYX 4XSHA 5KWEA 3A1WA 4KVGA 1KO8A 4O33A 4R6XA 1F3OA 3QMPA 4PHTA 2IYTA 2YINC 1R7RA 1Z8HA 1BKSB 3E22A 2J3HA 4DA0A 3QFFA 5TGDA 4I4TB 4FQ7A 1Q7LA 1UJMA 4P82A 1F4VA 3PXAA 4RDCA 2JIDA 3JR3A 1E62A 3GOHA 3L7OA 4OP1A 3E03A 2CVFA 3GLUA 1DVRA 2UXDB 3DWFA 5JD6A 2ZUVA 1M2HA 3ILSA 1EWYA 3FLMA 3MS2A 1CZKA 3D6JA 4PFSA 4LHZA 1VSUA 3TRFA 3GUVA 2H07A 1LDGA 4NYMR 3B1WA 3FDZB 1TA4A 1DTWB 4DNPA 3B8EA 5BWCA 4L75A 3W8NA 3PLRA 3CJTA 4CIAA 2KS6A 3EGXA 1HQDA 3PENA 5AUQA 3KOYA 4YCAA 5EZYA 1OPXA 3BZUA 1QH1A 3Q3EA 4QLOA 3NAQA 4E3WA 4L3WA 2XNDD 1CF2O 1DC7A 1XLTA 1N9GA 3NYQA 4Z4HA 3VHRA 3QYPA 3RG8A 2GDJA 1IY1A 3R0JA 1L1EA 5GMOA 5JSZB 2X8AA 4Q9IA 5HF5A 4YXWA 1H6BA 2GVDC 2GPBA 3CX8A 1U9IA 1GM5A 3QNUA 1M2NA 4PC2A 2PIDA 1ZNZA 5NLLA 5JHHB 2FVYA 4WFJA 1DWOA 5DTMA 3Q4GA 3MGBA 4N3BA 2O7QA 2VPQA 3ITDA 3E35A 4UZEA 1ILEA 1HT1E 3BH0A 4L4YA 2KI5A 2GJ9A 1DKUA 1X7WB 4NABA 5JWRA 3VZQA 4UCXA 1FXWA 3LACA 3A1DA 1JMVA 4UTPA 3OIUA 1YRBA 1FEZA 2K2WA 2XLCA 4K26A 2B8NA 4DVJA 3DE5X 3X44A 1IEVA 4KQJA 4LWPA 3HBNA 4GBJA 3ME5A 4RORA 4IQ4A 4IWXA 1ZNQO 4MRIA 3CH7A 2JBAA 2PCJA 5DOZA 5CFOA 1PJBA 4HB0A 3B9BA 3DSBA 4FGWA 1HDGO 3CEHA 3C24A 4E13A 4ZQIA 2PJAA 2MSKA 1E0SA 3C97A 1IK6A 2RKWA 3FYCA 5LOVF 5EP3A 5ILOA 1KMHB 2NSDA 3EY9A 5BUZA 1B6RA 1UP4A 3KL9A 1UT5A 3OC6A 2CJWA 2I55A 2A1IA 2VYVA 5ALZA 4WZBA 1BFKA 2P62A 2J67A 1C3JA 1RI2A 1HSZA 2M6LA 5LYFA 3R4CA 1AHNA 4BBPA 1N6PA 1XBTA 1U5BA 1GKUB 3RW9A 1EVEA 5FPKA 5B1YA 2H2IA 3IEMA 2G1PA 3AUSA 4BP1A 5CFRA 3MBIA 4MS1B 4DV1B 5EGNA 3BSSA 3H7AA 2HKIA 4FX5A 5DTJA 2ET6A 4DDMA 5H4HA 4YYEA 1V3VA 1VYHA 5BOSB 3E27A 3TDKA 4EVSA 4MTCA 4BQFA 2CWDA 3A32A 4LDRA 3P4YA 4I55F 3NGLA 3KALA 3DFZA 2B7LA 3DFMA 3F2VA 2FEAA 1MJAA 4YONB 3K5PA 1L8XA 2C0CA 1OBCA 1V6AA 1GZSA 2XMQA 4AS2A 3OMXA 3QFTA 5KTTA 3DB2A 5HFJA 2IY8A 1OASA 5DTEA 2A0XA 1FUIA 4FMDB 1CRPA 1F2UA 1GO2A 3B3VA 3SC6A 3E4DA 4LYAA 3N07A 3GLSA 3H05A 2B6HA 1ACLA 4GOXA 4XB6B 1IBRA 3JRNA 3X2FA 3BQ9A 2OWEA 5DP2A 3VUEA 2QNBA 1Y5IA 2AE2A 3S8MA 3QENA 4GOLD 1E20A 1IYLA 4JZ0A 3TX8A 3M1LA 2AFHA 2W6JD 4MLPA 5DOVA 1M1YE 4TS1A 5ARDA 2HRCA 2J3MA 2Z6AA 2WWGA 4M1QA 3PQ6A 3D7LA 5JVDB 1VZ2A 4NIMA 2P65A 4PZCA 2WNSA 3VX3A 1JWLA 1Z4JA 1EVLA 2H92A 3AYXB 4RZXA 1V4BA 3TTYA 1XP5A 3K2IA 3E3NA 4CXMA 4IDOA 4B44A 1EUQA 4J75A 5EQFA 4JKYA 4U7JA 1G2QA 4LXUA 3TG8A 4M49A 1TZJA 4NBLA 1A9OA 4OQNA 1I7DA 4OA5A 1JFLA 3V8VA 4R7ZA 4I1RA 5EQTA 3THOA 2P9CA 2AXNA 1C9NA 2WM8A 4J4BA 3KQLA 2CLSA 1BZYA 3CRVA 4MVJG 4Q37A 7YASA 3WBFA 2RGAA 5FOVA 1GQ2A 3IS3A 2IQ5A 3DR6A 5IF9A 4U7DA 2HMYB 1AGYA 4WFQA 3H6GA 2GCNA 4M6WB 3WLEA 3UA4A 1G42A 2DUUA 3AR7A 4E1BA 4GX1A 3D6UA 4WZAB 2W71A 3PDCA 2VFAA 4X6YA 1QIEA 1OYVA 1EVKA 5IRCD 5AVXA 4Y6QA 3RSHA 2Z56A 2PH1A 3SVLA 5GTDA 2WK1A 2C2KA 4JI5B 3WQHA 3V7YA 3V5NA 1FS4A 1M66A 1ZINA 2J9AA 3MW8A 1RIIA 3C3MA 4AKTA 2GFHA 4GXNA 1WLSA 4Z86A 5AWFC 3EPPA 1QTIA 3VYUB 3MTDA 3LFTA 5JAPA 1CS4C 3HUDA 3NWOA 3D59A 3SJUA 2EKQA 1Y3AA 3KLNA 4TTRA 1V71A 1NRJB 1QHEA 4F3NA 5KTMA 2V7WA 2YNMA 1A69A 3V2HA 3COWA 5J4KA 3CWQA 1JLLA 3I73A 3H5VA 1JZQA 4H7JA 2IXAA 2C2BA 3GARA 3P26A 1CR2A 4F5ZA 2VUUA 2DECA 3PVCA 4ORFA 4UOQA 3ET5A 3Q7PA 3SDBA 1AF4A 4KH0A 2ZIWB 1IVYA 5IC5A 2B98A 2N46A 5EUMA 2BF4A 3V7UA 4FE4A 4UMFA 3SLKA 3ECSA 2B4QA 1J8MF 4WN9A 1RRPA 2X22A 1JFVA 4LKRA 2RHLA 3HSYA 3KE8A 1R8YA 5EIXA 1JS1X 1U02A 4HQLA 2RKOA 1NC1A 2ODAA 2ZXVA 3W6PA 2FZCA 2AW3A 3PXCX 2GNOA 3ZPXA 2FHPA 1ZJJA 1U3TA 1UXOA 4X95A 4MQ6A 2OHOA 1VIYA 2JEZA 4PG4A 4C3OB 5TT0A 3WYDA 1GPKA 4W1RA 4FOLA 4NWIA 4EF4A 1GFZA 5EC4A 1A72A 4K0KB 4Q39A 4ZYVA 1MJNA 4GOOD 4DSTA 1HI9A 1XP8A 3FTFA 3MC1A 1J9GA 1GPDG 4RSMA 2C5LA 2FDRA 4AO6A 4UD2A 2W4MA 1NVEA 3CSSA 1VECA 4E0BA 3BHIA 2JBWA 3H8GA 1XFOA 1ZD9A 3ROGA 4TZ6A 3T7CA 3TNLA 3BFKA 1U1IA 1T25A 4HH1A 1KJNA 3EY4A 4QPJC 1C4KA 1AK2A 1T5OA 3ZCQA 4NAVA 5DLPA 4Q4HB 1G20E 5K9ZA 1UBRS 4N82A 1IYKA 1NT2A 3KR2A 2GRJA 2NZXA 2PGXA 3NHLA 1XDDA 5HG0A 2GYYA 1L2TA 1G9SA 1P3JA 5K1ZA 4BE4A 2QD3A 5ESWA 2P90A 3E5MA 2VTBA 2CLIB 1R9MA 3EXAA 2MINB 2I2DA 4X20A 1Z8DA 3QJYA 2D7JA 4P22A 4EATA 1NVWQ 1M33A 1G5HA 4EPTA 4EMSA 1IH8A 4C0JA 1EE1A 3AKYA 5FORA 4BWYA 4OM8A 4CL2A 3CO0S 2P3LA 1KHTA 3TO7A 4Z1MA 2JI6A 5DI3B 2RHGB 2FLVA 1F12A 5B7PA 3KOXA 3OE7A 2HM7A 4M1EA 1KE1A 3D8SA 1N2XA 3OLZA 3CQ9A 3ZWCA 3IQXA 4LA4A 4WUVA 2WG2A 4RL6A 4HUTA 2AEEA 5FO0A 4PR0A 4NNOA 5FXMA 5TSDA 2XA1A 3SHQA 3GVIA 2WIKA 5AKGA 3MILA 4P86A 4JUIA 1HMYA 4IG9A 5CW2A 4TLEA 3UFXA 4QDKA 3IIJA 2OORA 5EWMA 1PHRA 3LE8A 1NX9A 1X70A 3O75A 4UCWA 3O8LA 3JSAA 4OMDA 4TQAA 4HXFB 2BJHA 2YVAA 4QAQA 3ZHBA 2EJUA 3AFHA 1E79A 2JZCA 5HP4A 4L57A 1JDVA 4AVBA 1XNJA 2VJDA 2C78A 2BSWA 5AI5A 4HLUA 3ZCRA 3A9WA 1FUEA 5DT9A 3IR6A 2JL1A 1GYRA 4MA0A 1ZK2A 3ZZIA 1DC8A 3ZBQA 3NJRA 4EYQA 2AJ6A 1KZ4A 3WI7A 5I4KA 1KK0A 4XIIA 2DPMA 4KUAA 1WVGA 4ZT6A 3LPLA 2YN0A 2CNOA 1EGMB 2ZE7A 2V59A 4QRIA 3ZQ6A 2HBRA 3GT7A 3G7NA 3RIEA 1PR1A 2EP8A 4URXR 1AB5A 3H18A 3BCHA 1T5HX 4G4GA 2W8BB 3V9PA 5AUPB 3KZWA 2GHRA 4K03A 1RPNA 1FX0B 2VP0A 2GRAA 4Q4JB 4TYMA 3ITKA 1GD1O 4GOND 5LQKA 1LB1B 4JBWA 3L0DA 1CB7A 2ANPA 1RRFA 2J9FA 3HVIA 5IZCC 2OG1A 3Q5DA 2A84A 3IQIX 1DNPA 2G1AA 2VSFA 2Z3LA 2ZKIA 5JALA 1KOLA 1A9YA 2AFOA 2ZW5A 4FWTA 4BTLA 1L5GB 3WYCA 2X4GA 1YB6A 2FN3A 3FPLA 4J0CA 2KWIA 4LISA 3WLRA 2ZCUA 2CWWA 2WICA 5I9IA 2WIAA 4DNXA 3IHWA 3HZOA 2D13A 5F12A 4ZEWA 4KQXA 1AOXA 1MR3F 4R1NA 1U80A 3FPEA 3DCYA 5DMHA 2YWGA 4QBHA 2IRWA 5B3LA 3P0EA 3WMWA 1TB4A 2QTWB 3FRHA 5TNXA 4KITB 1XJQA 4L27A 5CVDA 3EODA 5SZHB 3UCEA 3N70A 1RAFA 1GGMA 1SQGA 1NSFA 1KI8A 5GP1A 3E2MA 2GMWA 1Q0PA 2NZJA 3O8BA 5FR1A 2V65A 4HGPA 3HLKA 5LD2B 3UG6A 5E8RA 3SC2B 1RKXA 1WUIS 4DRXA 1YHNA 4UNNA 3VMMA 4FE7A 4JUCA 3HB7A 3GA5A 4KV9A 2O3TA 1SXPA 3F78A 1LY1A 1FP4B 2HJVA 4I19A 4ARZB 4YHHB 5HTOA 2XGMA 2IEBA 4JOSA 2AOTB 2FPGB 3TAHA 4OMUA 3HWRA 1OYWA 2OEPA 2GZ3A 1JEQA 3CVOA 2Z9DA 1A8IA 4C5CA 1KJ9A 3LKDA 4B81A 1B42A 4PX2A 2PZFA 4BEWA 1OH7A 1XMPA 2JI8A 5EXDA 1Y5MA 4M21A 5LRJA 3A14A 4NHOA 4J0GA 3WK7A 2JGAA 4L5JA 5K99A 1SXJE 3VTZA 1R57A 1XYYA 2RG7A 3E3AA 1QR6A 3VKVA 3GVXA 4P4DA 4QGAA 4WJKB 4FUQA 2WKSA 2JAWA 4XOUA 3K70B 3ORYA 4MAAA 1ISHA 4CM3A 1WTAA 2C84A 3N76A 3GFFA 3IP7A 4JC4A 2EZ9A 3HKEA 5DXJA 4OLLA 5A4MS 2A9OA 4NGNA 4D9HA 3KELA 5IC6A 3MJRA 2QYHA 2QMZA 4TMXA 1XK7A 1ISRA 2VF2A 2J8NA 2A57A 5I0CA 3KUKA 1E32A 1DEHA 1QRUA 2GAAA 5JAOA 2PV0A 3RPEA 4BPRA 3LM8A 5CA0F 3CKKA 2EX1A 2XEFA 2P41A 1XAJA 4WADA 3AXTA 4RA9B 2BCGY 3V8PA 2X15A 3R5KA 5BYJA 4MIYA 3LC7O 2FDXA 4E46A 4YXWD 1JSCA 3UMBA 5KDLA 5G0UA 3WWYA 1JTEA 2ZBFA 2AG5A 1TZBA 3B52X 2K7FA 4CKYA 3DCJA 3FX6A 2VYNA 1IXYA 4CKZA 5TDHA 1P5RA 3PXBA 4EMEA 4C4TA 4TWZA 4HEA6 2AN3A 3ZBPA 1UBFA 1YONA 2Q62A 4O59O 1NP6A 4RM3A 3FF1A 3NHMA 3FGOA 3X3HA 1DV2A 3NHSA 4MKGA 1GUDA 3LFHA 4C7IA 1CUAA 1KH3A 3EN0A 3BE8A 2OAQ1 3HLTA 3NM6B 5C46F 3DE0X 3HRHA 4O5OA 3SKYA 4ABYA 1J0XO 5CU7A 2A14A 2BP7A 4FGZA 1PJ8A 4OQZA 3A10A 2F8TA 3TAUA 2W83A 3UY5A 2VATA 4HAVA 1PJQA 4LY3A 2HSZA 1NBWB 3K4PA 2R1ZA 3WL5A 5HYVA 1IY9A 3O4FA 1X1TA 3K09C 2W6PA 5A4FS 4MJ8A 1M54A 5IB0A 2J4FA 1BCRB 4G0XA 2I6TA 4A39A 2YMLA 2C1EA 3MMNA 1J4AA 3PI6A 3EVZA 4MCHA 2EIHA 3E9DA 1IU8A 5L3VA 2HUZA 5FTNA 2IX3A 3ORQA 4HDMA 1OAKA 3EWSA 1XEBA 2GILA 3KB6A 4PG5A 2IYSA 2VTDA 4DSAA 5LNK6 4UUOA 4Q3KA 5EZSA 4UBMA 4NF1A 2XB6A 5A5GA 3DZHA 1WZEA 1DX4A 3SG0A 2ZVPX 2PA0A 4B48A 3AHDA 3ZV5A 1YF3A 1COWD 3IVCA 1KIFA 3A6HA 5D87A 3SQMA 3ABSB 1ZPDA 1GL7A 4UWJA 2GOYA 4QPNA 5A4AA 2ZZNA 1TAUA 1Z08A 3WA6A 1C3VA 4RPLA 2MDTA 5LQNA 2ZKLA 1TQ4A 3AVQA 3OF5A 1C1YA 5I7WA 2HQSA 1A04A 1FFDA 1JG7A 4JIMA 1KEVA 1X9IA 4HUQB 2GJ4A 2W43A 5C8YA 5DTQA 2O6HA 1P6QA 2LXNA 3ITEA 3HWSA 1MB3A 1KDZA 1J8VA 1O95C 1W5TA 3D3EA 1QSRA 1VCIA 4P4TA 5J2UB 5FIUA 4NBRA 4LZJA 2ERXA 3OETA 3HA7A 5EIEA 1NSLA 2Q4BA 3SLGA 2X5OA 4S12A 2H5JA 3F6BX 1G17A 2EATA 3PXUA 4YMVA 2HREA 3ZJVA 2XDQA 1P2GA 2W22A 3KQUA 2C77A 3NOVA 5IABA 1KL7A 5KUTA 3K3PA 5JANA 1KGSA 1JQEA 4NBTA 4Q3AA 4DJEC 1JIJA 8MHTA 4HATA 3DAPA 3SOZA 1N6NA 4F0JA 2IHVA 3HEBA 3DLIA 4CG3A 2FB9A 4YRCA 5AM3A 4KE7A 1JLHA 2D1TA 4Q3NA 3UWDA 5DHRA 1BRTA 5HA5A 1F5NA 1N6IA 2DFPA 3PP8A 3SYKA 1JSRA 4RTRA 4Q82A 3W2GA 3H1EA 3DUFB 3HUEA 3TYXA 1PJLA 3O47A 1B74A 3ROEA 3K9TA 1E0DA 3F8SA 4FDAA 1DRUA 4HX2A 2HO4A 1RJWA 4CAXA 4HPWA 1L0CA 4JT2A 1NQTA 4WLVA 2D7DA 1I7PA 1V2GA 4UVEA 3FWZA 4PXYA 3HWWA 5EIFA 3O03A 4TV8F 2LUOA 2R6HA 3I2HA 1ZCZA 3LQFA 1JDBC 1XF9A 3TJMA 2Z5FA 4G1BA 4O1HA 1USKA 3RKRA 4NG5A 1EX6A 2AJCA 3DFUA 2YRFA 5FWYB 1Z2LA 2XUDA 3R7AA 4KR9A 3UMCA 4I1SA 5EXTA 5TGZA 2WTMA 3VHXB 3UWPA 4KO1S 5KYUB 3LECA 3QLVC 1QS0A 3GJ7A 2NO0A 3VNQA 1ZH0A 4CEIB 1GR0A 1BYIA 1GT6A 4ZI5A 3FCCA 4PYMA 1EE9A 3KSZO 3TVTA 1P1FA 4PIMA 4TXLA 2F3TA 2WAYA 3BF7A 1T9DA 5BN4B 4XUGB 4ZKDA 1HNXB 2D0IA 1FPMA 4FNGA 3I61A 2H7VA 5JFTA 2Y6VA 1LH0A 4WDQA 3LG2A 7REQB 1EEHA 2GAJA 4FUTA 5I4CA 2VN8A 4BPBA 5IYZA 4TROA 2PS3A 1TTHA 2QMYA 3GVHA 2B1RA 2YNMD 3OP4A 2A4KA 1QPZA 7CPAA 4FFDA 4V1CI 3FWYA 4NCNA 2YY5A 2GEFA 3SXUA 2B5OA 4BB5A 3ZWAA 2IPMA 4BLTA 2PJ6A 4H7IA 1Q0ZA 1ISIA 1FJHA 4IVQA 1QCYA 3HBJA 3OEHD 4U0JA 4YAIA 3C15C 3L4JA 1TKHA 3FPSA 4P45A 2WEKA 4K6HA 1IQ0A 1OYYA 1RKBA 4PZYA 3UIEA 2EERA 4P4GA 1V48A 1Q0TA 3DL7A 3QPWA 3HN2A 2ZRHA 4PONA 3MCZA 1EE3P 1KJWA 1GYQA 1G8KA 1TKCA 1YZHA 3S2UA 2OFFA 2NACA 4U7TB 3EQ6A 1KK3A 4EVQA 3FBGA 1KMCA 4QREA 1IOWA 3EWIA 1DKNA 3V46A 3PQ3A 1L1QA 2WTEA 3IQFA 4MQUA 2YXPX 1I13A 2GEUA 4FLFA 1KWMA 4BMXA 1QIJA 1EB8A 5L45A 4IOLA 4BX2A 5AH0A 2XQGA 521PA 4LFCB 2CN1A 1L4MA 3TQIA 4CQLA 2R5NA 2H5IA 2FQYA 3P8ZA 3WG9A 3G6KA 3C8ZA 5DWNA 1HDQA 2ZAGA 5FULA 3GAAA 3A6EA 3ITNA 1BA3A 1I51A 4XYMA 4OP4A 3HV2A 3IBCA 1HYQA 1NIJA 4MMXB 5BSEA 3NC4A 1NF8A 4Q9LA 4LF6B 5C7IO 3IB6A 4BTVA 3REFA 4UEQA 5D5PA 5FA6A 3VR5D 1R74A 2I5PO 4GI3A 5LRKA 4J0IA 5K51A 2P4UA 3DOUA 2ZEJA 4HEA1 1DTSA 3ABIA 3WGKA 1HT2E 4NEQA 3UUWA 3CXQA 3AUAA 5FAKA 4A6PA 3U60B 1L5FA 3MPUA 3L82B 5IJ9B 5TS3A 3O3CA 5KNLA 4EHDA 1ZOOA 1A1SA 4Q4AB 1MOPA 1TE2A 3FWNA 1L4HA 3UAOA 4IDAA 2Z1NA 4Q1AA 3OJOA 3COPA 4FK8A 3DW1X 2ODWA 1XKTA 3QBJA 2RCYA 4RTNA 3IIIA 1UM9A 1XD2A 1XZKA 1L9KA 4MV9A 3AT1A 4AKHA 4XFJA 2PD4A 3OE7D 1TYEB 4QDTA 6Q21A 1XVUA 3IUEA 3FYDA 3AVTA 2HWWA 5LM3A 4M54A 5JPHA 1KI3A 3TOVA 3ANYB 3C3AA 1CZHA 4RVOA 2D2XA 3QH4A 2B3DA 1LNZA 4QICA 2I6UA 1VFPA 2Y9MB 3LPCA 3LKBA 3WMEA 5LNK1 2PD6A 1U3DA 2XF2A 5EHZA 2XEIA 1FC0A 3T3MB 4UFVA 1DAFA 3WGHA 2H4HA 2VNSA 3TO5A 3ELYA 4FD7A 1ZS9A 5K6AC 4Z3DA 1NMZA 2O8EB 3I09A 2GN8A 4XVCA 1IHPA 4XKJA 1PJ3A 1GNPA 2VAWA 4M6WA 4XFKA 4XWTA 2JS7A 5EIBC 4OBWA 4PX3A 3VPSA 5EMHA 2PJRA 4U7FA 2W6NA 6PFKA 3NBUA 1NAIA 1TAQA 3ZHTA 3BJMA 4MR7A 4P7KA 1YQTA 3QITA 2XCUA 3RRXA 1QZXA 2IDZA 4LFBB 1ORVA 5IHPA 4GSYA 3VJMA 1CBXA 3OCJA 1X1EA 5UKDA 2EFGA 5ECDA 1RYMA 4X1OA 4JU9A 1XU4A 3B3GA 1B93A 3GLGE 3R5JA 1I5EA 4LVUA 3D4BA 4JAVC 3WNDA 4NV3A 4ZKEA 3UK7A 3P45A 3RNLA 2GZDA 3PEYA 3OURA 1AZSC 1R16A 4NL4H 1ODKA 3RTEA 3ZZMA 3CXPA 2X8WA 3ZH2A 4DA6A 1LQTA 2XHEA 1N9KA 2VQ3A 1WXGA 4JBGA 2BMFA 1LCPA 4ECEA 4L8AA 4R5HA 5K2MA 4INZA 2VJKA 3H9UA 4MBUA 5ITZB 2ECPA 2ZAYA 2X5JO 5HIAA 3G5LA 2WOJA 5C8YF 5MHTA 3A28A 2ONZA 3ER8A 4J94A 5K8IA 2NXJA 4C89A 4TXMA 2JVIA 1YBFA 3OQBA 3GGDA 4PS1A 4RPJA 5AW3A 4DAOA 2O2DA 3U19A 3H5TA 1Q2CA 5GJCA 3NP7A 1Z5WA 3QFCA 5EWJB 4C30A 3T4EA 3VO9A 3MFQA 2E55A 4C6SA 4DDKA 3OZCA 4AS1A 4GQIA 2YN2A 2FWNA 1IYZA 3SC4A 5ER9A 5I8PA 1W87A 2H29A 3HJGA 2JAPA 4ZAXA 4AYWA 1TUIA 3BT7A 2I99A 1CVLA 1RRMA 4W5WA 1PDOA 4EENA 4ZFNA 2I03A 2L82A 4KYIB 1WO8A 2FCKA 1Y7RA 5AHWA 3D2CA 4KUBA 2AN9A 3NKVA 1I4LD 2YV1A 2VP6A 4MUNA 4M9SA 2I3AA 1II8B 1U2TA 1TU4A 3IVGA 1UODA 4JROA 3I5YA 1EUDB 4X54A 3PKIA 4NE7A 4LQDA 1Z2PX 2G80A 3MOGA 1CR0A 1AD2A 1GVNB 1RLJA 2JFFA 4PN7A 1E69A 4EK9A 2CNBA 4DW8A 2BHSA 2G04A 2ZPUA 5AKIA 3KXIA 3DT9A 3EQ9A 3AVYA 4F2DA 3HTXA 5KVQA 4OHUA 1O6FA 3K9BA 3RTGA 4IW3B 4KAFA 4RZUA 1GZDA 5F5LA 4ZVUA 4UQOA 1ZRMA 1VA5A 3EVEA 2IEGA 5B4VA 1A98A 1FW6A 2JHGA 2BW0A 3IQGX 3AG6A 4QOFA 4IH4A 4MWBA 5HXDA 2FUNB 1MQ9A 1A7AA 4IAOA 4J4TA 1I80A 5DNYB 2JIZA 5AM4A 3RQSA 4AROA 4NCXA 3Q9SA 1XVTA 3E84A 4TMWA 3G17A 1YKGA 4KO4S 4OHKA 3I37X 3DTVA 2Q0SA 3DZ8A 3WGMA 1Q7CA 1YQDA 1J1UA 4NCHA 1ZRSA 3VBEA 4R2IA 4I14A 4N0PA 2R6DA 4PO8A 2Q27A 4TMKA 5K03A 1WMAA 3RBZA 2ZQZA 2HAEA 4LZZA 2JGEA 3GIWA 3ZGYA 3I9V6 4JWKA 4DMRA 4QG7A 4RPIA 2QP4A 4I5DA 3DZKA 3QVXA 1SC3A 2VBCA 3PFGA 2CDNA 2O14A 4MVJI 3ZU2A 3R9XA 2DSNA 1YVRA 5IYZF 1Q6YA 2AH5A 5I6DA 3OHPA 1LI5A 3CB2A 1CETA 1KC1A 3JARA 3ZY3A 1RBMA 3ZYCA 1BO6A 4NP6A 1W30A 2X9LA 3M1YA 4R40A 3VI3B 1UMCB 4DSOA 4ZHSA 4MI1A 4BVKA 3VVBA 1O0CA 1NJSA 1IM5A 5EJIA 1QO9A 3NNNA 1JHPA 1CRLA 1LDNA 1OXUA 2GEBA 2C8JA 2JD0A 2VYND 5DDIP 4C2ZA 5IHXA 2V9ZA 4AIRA 4B71A 2OO7A 5KIAA 3WLJA 1QQ6A 3UOAB 3IULA 1T5BA 3UBTA 2DPTA 4OL0A 3M1AA 5B2EA 1P60A 2PPLA 3SEQA 4C20A 2Z9BA 1XKXA 4WBNA 4DGSA 3KQNA 1Z7EA 1U2ZA 1L5SA 5DWDA 3BXFA 2R6AA 2IUFA 5GJBA 1TEZA 3IEXA 1ND5A 1Q77A 2I80A 4EY6A 3R3YA 2OAGA 4I1UA 2FR1A 4WJBA 3DYVA 5CT6A 4CFYA 3S5UA 4F84A 3WBJA 1ZZEA 2B9EA 4Q1DA 3ZR4B 4G84A 3I9OA 1KNXA 5JAMA 3RK4A 1UBKS 3BE5A 1NDUA 1FX1A 3AG5A 4M53A 1YZTA 4YXFA 4KRXA 1TUEA 2ZI6A 1S8AA 1X2BA 4X1IA 1FQOA 4YRAA 2GFIA 4KPYA 5LJIA 5IN5A 1LPMA 3BHNA 1LJUA 2FE7A 1B14A 4KU4A 3EIEA 2HRRA 3QY9A 5E2AA 2O3JA 2HL6A 4BBZA 3HP7A 2I79A 4OHCA 1Y1RA 1FB5A 3R3SA 5CLLA 3FTPA 4KXVA 1QG2A 2O2ZA 2QZPA 4G0UA 4ERXA 1UF9A 1P4RA 2BPOA 2IVZA 1Y8QB 3HCEA 1RP7A 1AKWA 3ENNA 3C6BA 3ZS9A 1Q84A 3PGVA 1P7PA 4XD7A 4XTRA 3FR8A 1QGED 3QVUA 4BXOA 1W52X 4G0VA 3ROQA 4HNGA 4J3FA 1QTNA 2VP3A 3QFSA 4UZSA 2R96A 2ST1A 2HRBA 5LN1A 1HZJA 5K8TA 1LX7A 1Z7WA 2ZRLA 3DZBA 2A67A 4M0KA 2PX0A 3QMWA 1YVPA 2ZSIA 3GT3A 1ZUNA 1P5JA 2ACWA 3HGMA 3GBVA 2JEOA 4BU1A 3ZZ1A 4A38A 1X0XA 5HMLA 1R0LA 1JHUA 4DFDA 3V8RA 3FRJA 1QOZA 4B5PA 4B0OA 1XA4A 2FW1A 4FFBB 4X7RA 3SM3A 1ZSVA 4X6UA 3F5FA 4II3A 1QTRA 1B23P 4EFKA 1C9DB 4DY4A 5LB4A 3SC2A 3W8EA 4BNNA 5IDYA 4PSKA 3RS2A 2CHQA 3IBSA 1E7SA 3DGFC 2X77A 3G2PA 2YZ2A 4Q16A 5I8ZA 3KOUA 3WLFA 2CB9A 5AUNB 1F0YA 2CTCA 4E5VA 4BIMA 2Z3ZA 3G2KA 3A4NA 1EFKA 3ILHA 2V6BA 3WR7A 1QHXA 1IM2A 2EL9A 4I8XA 3V1UA 5TXGA 3MQ2A 2F00A 1A9ZA 2QLNA 2JCBA 2PSWA 1XQ6A 4PLWA 2CV2A 3EMVA 1GRQA 3HHEA 3MWEA 3EXFB 2F8MA 3QF7A 2OHGA 3Q10A 1VCNA 2O8BB 4URWR 3OHSX 1ZW6A 2XOXA 2VAVA 4LYFA 2J0EA 4QFDA 4OFBA 1KY5A 2HA7A 3A70A 1M6HA 4C1NA 4LYYA 4LMPA 4WTOA 3BVPA 1JVSA 2Q4VA 4OB7A 4J9VA 4MV5A 3TSYA 3EISA 1SUCA 1YQEA 2FW8A 4GOKA 2ZIAA 4ZARA 5K4GA 1G9XA 4H6ZA 3MHPA 1NTRA 3CIFA 1S2IA 1YW4A 1XD9A 4DZRA 4FD2A 1F8UA 1FFYA 1PLJA 3IDOA 5TV2A 1VL0A 3E5NA 2B4DB 5DSZA 2GIVA 1VXRA 4JLNA 3REGA 2YVLA 3ASUA 3WA7A 1TUBA 1YNSA 3QVGB 1QK5A 2ZOFA 1OVMA 3IDFA 1LTKA 4XZ3A 3KPYA 3HXQA 1HDIA 4OHMA 1COWA 3F4BA 2OD7A 3O38A 4WBXC 3KXKA 2G1UA 4H6VA 1BHJA 1KY2A 4FZ3A 1RQ2A 3DXYA 2QJTA 2WPDA 1OJLA 4N6NA 3WADA 1PZGA 4PAMA 2LKCA 1IVNA 3PHCA 2FSSA 3WTBA 2OILA 3WRXA 4NAHA 2XIJA 1AKNA 2SECE 4L8WB 3SHWA 2DUJA 2BY4A 1GGHA 2XGGA 3K5IA 1SB9A 3GLIE 1IICA 3T06B 1A8SA 1O54A 1G8AA 2H54A 4JLPA 5BN1A 1YOVA 1SQ0A 4KORA 4C2TA 3LBNA 4GPEA 1J9EA 3W3AH 1JKXA 2XF8A 4J0HA 1UANA 3GEPA 3ZWPA 3G8WA 4ZHQA 3HUVA 3N2EA 3FHOA 5F1OA 5HKAA 2ZSEA 3JQPA 4QUIA 2WG1A 5CP8A 3HJTA 2XCLA 3TZCA 4U2FA 3QKSB 3SXNA 5EKXA 3T7TA 5LCXA 1EAMA 4YVFA 4II2A 3PPIA 5EGSA 1NBME 1C2YA 2NUTB 1MEEA 1Y0BA 1LDYA 2HY7A 1LRZA 4O4IA 4KOYA 2JFYA 2P6UA 4PPNA 4ZQHA 5FTWA 4C22A 2P2ZA 3ER9A 4PYOA 1IMOA 3SJXA 1C0IA 4L07A 2QL7A 4QXMA 3NPMA 3I9V1 4Q7EA 3VNSA 1O5OA 3FYSA 3KSBC 3GEGA 2D4AA 4MDYA 1DGQA 3MRUA 3OZVA 1H3EA 2VDNB 2VDLB 3LZDA 3RIXA 3TOAA 1QAQA 1ODIA 2XVMA 3D4OA 1WVMA 4CM1A 4CS0B 1BCSB 4ZDIA 2Y66A 1KPGA 1YNOA 2GXQA 4HRAA 1GAEO 3GN1A 2TSYB 1J8YF 4J7AA 3R40A 1FFWA 4JLOA 4M8LA 5C88A 4PSCA 2PC1A 2GN4A 5LMUB 2J5QA 2QAGA 1ORWA 2KHZA 2VBFA 1S2NA 5A9RA 5J4VA 3BK7A 5CLGA 3K0BA 4XX1A 2H5LA 4AVYA 2PANA 1VIMA 2ZUCA 3ISVA 5KWIA 2BGGA 1Z56C 5E1DA 4G9EA 4KRYA 1I2ZA 3S6HA 4M1SA 1NQAO 5KQLA 3WNBA 4MEAA 5LXTF 3ND9A 1V8ZA 3MN8A 2J3DA 4FEGA 1OX5A 3NNSA 3TLEA 2VCYA 4OATA 1RXSA 5K3CA 1CDEA 3IWGA 4CHTA 2I6XA 2OGTA 2RH4A 3CE6A 4FOOA 1QIDA 3OECA 4LRTB 3LBAA 1IQRA 1JHRA 4IY1A 5JNLA 3B78A 3GLTA 4OADA 4JJ4A 4EJFA 1A7JA 2BCEA 4ED9A 3GGCA 3BHXA 3I34X 4Q3DA 1B8NA 2I2XB 5JNSA 5E1BA 4REOA 2IYZA 3QYJA 1N0UA 1Z17A 5KVVA 3LRTA 1UDRA 4G9GA 2EWBA 2WJ6A 1Z3IX 3M6AA 3QE4A 2G07A 3FJ1A 4ZZ1A 4Y98A 3DUFA 1GITA 1BVUA 2CBZA 3H5OA 3OEHA 1NXWA 1NFFA 2EDAA 1D6NA 5GIPE 5ESXA 3WIVA 4WT7A 4WBNF 3W05A 4CGYA 3AJEA 3GRFA 1KI1A 2E6UX 2H4ZA 3ZDXB 4H3VA 4TKVA 4HUJA 4X3OA 3A4LA 1GG2A 3FPGA 1ZG3A 4US0R 4MHOA 1GRVA 5DIFA 3KD2A 3OEYA 4FFMA 4AKSA 2PQ6A 4PANA 4JITA 1FTNA 3FFAA 5EJ5A 1E7RA 2QJWA 3QMVA 1E1CA 2QP9X 1E64A 4YP5A 1AO3A 2F1KA 3MGCA 4JJ8A 1YDFA 1V9LA 3ZCXA 1P2BA 4MOWA 3O7MA 3A9VA 1RWKA 5C1OA 5AIBA 2PJUA 5KMGB 4IKPA 2OV2A 2PO7A 4I50B 1JEYB 1XTIA 2Z08A 4UAJA 1F2TB 1M6YA 2FPLA 4AMVA 4QVTA 1H1LB 4K7JA 1MB9A 1HDZA 1U1CA 2JIBA 4U6QA 1VB3A 1U04A 2DGDA 1KJQA 5IASA 3LT0A 1ITZA 4P5EA 4I5FA 1GA6A 2O2CA 2IL4A 2Z2KA 2WILA 1K88A 5AESA 1B0PA 1Y81A 3WK6A 3RZAA 1QOQB 3WLIA 4O6VA 1F6WA 5LQCA 1QGYA 1GILA 2OZLB 4MYSA 1I9GA 1IXZA 4KWIA 3HYSA 1P2SA 3W6ZA 1S2OA 3ZGVA 1JU9A 3ICPA 2I1QA 1M1UA 1KSJA 4DADA 2P0WA 3D5EA 1JFFB 2TMGA 1NU6A 4ZYLA 5A3RA 4TL6A 4RCYA 3DMDA 3E7PA 3UGTA 1KYVA 3VR5A 5LVAA 1U1EA 4MLZA 5LA6B 1RJEA 1Z26A 3D1VA 1S2GA 3HZZA 1W47A 3IDAA 1XOIA 5JS7A 4FU0A 2NUAB 4KS9A 5EZYF 5JDCA 1TA0A 3MINB 4J1TC 1BKYA 3ND5A 3L07A 3GCXA 3IRVA 1AS2A 3NTVA 5B55A 3SEAA 2ID9A 4IHJA 1DC4A 2A2ZA 1Z25A 1ORIA 2C2ZA 2QN9A 1OWMA 5HJEA 1GN9A 1XRRA 1R0BA 3N8NA 4N49A 4Q3BA 1NKVA 3GH3A 3QELA 3UICA 4JP2A 1IXRC 1NUSA 5EPUA 1D4AA 3DKRA 4QU9A 4Q66C 2ZI9A 4WLUA 2P6MA 1LDBA 2O5VA 2WJYA 4NFSA 1ORDA 4R1PA 3CLTC 1TT7A 1IWPB 1Z2AA 4R76A 1KP3A 4NGSA 2V98A 1P5HA 3A1CA 1RR6A 4WL0A 2ORED 4Y67A 4KPUA 2IYFA 2OZUA 3IERA 1FXWF 1ENPA 1PQWA 1QHHB 2LCQA 3HKBB 3E2IA 4ZEVA 3QX7A 1H9CA 1FT7A 3VSDA 4F2HA 1R5OA 5JI2E 4GGPA 1Z7GA 2PT7A 3CCBA 3H9JA 1VXOA 1HNWB 4TMFA 1TYZA 2AVDA 3ZBUA 3G59A 3CPHA 2Z3OA 3AKCA 4KVOE 4WN3A 5B6JA 3HU3A 3ONDA 1XRQA 2PWPA 2VSNA 1FP6A 4Z7NB 1P4NA 3PA6A 2LW7A 2VBIA 4ALKA 1RHQA 4KOTA 1APBA 2WUEA 4N7RA 1PJCA 4MRPA 2RH5A 2JIZD 2ZRKA 4FI3F 4JBXA 2O48X 4ME6A 2VJNA 1Q6ZA 4WGGA 4HP8A 5FEUA 1MQSA 4IFTA 2X14A 3MG9A 4AJPA 1ZISA 4PZLA 1NQUA 3DE1X 3HM9A 3DTVD 1X1DA 3EYAA 4TLLB 1FVFA 5A9SB 2ECFA 1KO4A 2PEYA 2Q6LA 1QNLA 1HSOA 2ZEFA 1AXRA 3NORA 3LQKA 4A95A 2O2XA 2HDOA 2JFUA 4J7XA 1GP2A 4MO2A 2RMKA 4OQXA 1P4JA 5CG2A 3RUIA 5NULA 2X58A 3CNHA 4YCJA 3NHBA 1IUKA 1C4XA 2EBJA 5DGDA 4AW9A 4GI5A 2AFUA 4RE5A 2GD2A 5DBHX 3OM1A 5C31A 3FDXA 2OCLA 1BW9A 3WIBA 5KX5B 5JYBA 3TECE 2GM9A 1KZ6A 1MQAA 2XUAA 4XR9A 1UKYA 3LL7A 4IJWA 5I4IA 2O2IA 3LVQE 1MG5A 2I65A 1QG6A 1FK8A 2EHJA 1NUHA 2EG5A 4HVTA 1ODLA 2QM0A 2X4IA 4II7A 2CNMA 3IBTA 3V00A 4ARUA 4YCLA 4ECAA 1OXBB 1CY2A 4ZHQF 1BVRA 1PGNA 5F3DA 4KVFA 2XCQA 3GJQA 2D3TA 4AMYA 2R8XA 4IINA 1WUTA 4AY3A 2NZUG 4HFJA 4F6AA 1XJ5A 3F97A 3O83A 4HNAA 1CP6A 5L9AA 1U0JA 3RYCA 3FTEA 4F4HA 4RN7A 1QHSA 4UE2A 4JYZA 4UEJA 2ZB2A 3HJAA 2YWEA 3FCXA 1J49A 3GFVA 5D5HA 4O4IF 1A2OA 4KQWA 3ZGNA 3VR2D 1TJ5A 5CIWA 4QTXA 4QYSA 1R64A 1YA8A 2CYCA 4YRGA 1NPYA 1CP7A 1ARMA 3AERA 4IDNA 4QUSA 3H75A 2B92A 1BO4A 3O2JA 2AOUB 1EP2B 4JT4A 2XB9A 5EEHA 4GPTA 4IGEA 4JDPA 2JFNA 2ZAMA 4CT4B 2OCKA 4OK5A 3QWHA 4N18A 2BH2A 1IK4A 1C4OA 1CPXA 5DX8A 1PWHA 1NE2A 4PCUA 3MTJA 1FNSA 1E9VA 1LVGA 3TD2A 3TB6A 2ALJA 2RGBA 2R8BA 2V58A 2R1IA 2Q1UA 2WU4A 2FVGA 2QPLA 4BO2A 1FTSA 3EDRA 1RZ3A 2WIDA 1YRAA 1UMDB 3GUZA 3RIMA 1RQNA 4G26A 1JR3E 2V7PA 2UVPB 1GKYA 2HW8A 2BVNA 4NBWA 5B3JC 1V7QA 4CYOA 1Q21A 1VMAA 5HEKA 2KBFA 3IPRA 2Z0ZA 4H1WA 2PL5A 4BFYA 1PR6A 4WY5A 5IW8A 4AS3A 4JI0B 2G72A 1XNQB 1KJJA 4DCOA 4KQHA 2YY6A 1BXKA 1U9YA 5HMNA 5TRTA 4XD7D 4I36A 2C95A 4XIYA 2ZDGA 1QIGA 3AIKA 3DJFA 5BQFA 2NGRA 2ZUBA 6REQB 1QX4A 1KARA 3NAMA 2AB0A 3GEDA 1W29A 1GNRA 2HLDA 4HGQA 4U2GA 1RJDA 4O3MA 4M3NA 1US8A 4XJVA 4RETA 2NVOA 1G6Q1 3PX7A 3L3BA 2IUTA 4F2PA 4GICA 2NPFA 3VVMA 1Y63A 2F1OA 4RY9A 3LUCA 3U81A 4BNJA 2QTAA 3OTOB 4FMBB 3MLAA 1EFVA 3H8JA 1IATA 1EUDA 3LLSA 3BM5A 3MTBA 3FEEA 1U7TA 4AJEA 1CV2A 2BGKA 3CMCO 2W2NA 3JQAB 1T9HA 2YWJA 3H2IA 2Z1MA 2JHAA 1Y1TA 4RC9A 5GGXA 3B6ZA 3FYUB 4EY5A 1RU3A 1MJFA 5DSTA 3SN6A 5J43A 3OEED 3G0HA 5JISA 1TT5B 4JP5A 3WGZA 2W2KA 2QIRA 1CLUA 1OMOA 2Q45A 1E2LA 3URKA 3K9GA 3QQPA 4MKZA 3LQ4A 4BFTA 1OTHA 4JIGA 3V8EA 3D7MA 4V0ME 1GUFA 4MQFB 1HT3A 1IWBB 1H2XA 3U3ZA 3B6IA 1TK2A 2X9NA 5JI3E 2PVVA 2PN1A 2C2HA 4EECA 1H2YA 4NF2A 4F8EA 3D6AA 2ESRA 5AW8A 3ST7A 1N77A 5CFMA 2VYFA 2QTNA 3RD5A 9LDTA 2R68A 3BKWA 4OLFA 2F9MA 3AHFA 4WAUA 1SOWA 4M4SA 3WVNA 4J0EA 5E2IA 3NDPA 3K70D 3I9FA 1BXRA 2P9JA 3A8TA 3G2MA 3ID6C 4TYWA 4CLHA 1W73A 4Y2HA 3I9LA 1UAYA 3FSJX 4NYJQ 2WJVA 4TWIA 4QTZA 3Q15C 3WK8A 4M2LA 3IL2A 3UAXA 4AP6A 2GTHA 4Q38A 2BFBA 3QWFA 1DE4C 4D5EA 3KJFA 3ZYZA 3T0FA 3OU7A 3W6OA 2WPDD 2GO7A 2RONA 4RHUA 3KV1A 1M2WA 4LC1A 3V80A 4AM8A 3RVQA 2X3YA 4CL8A 2AMFA 1JL3A 3MMZA 4E51A 1TK3A 1LD3A 4IHJF 1UWCA 2QQEA 5JQGB 4RNCA 2OOTA 1Z2CA 3LMKA 2WVJA 1I1DA 5FI5A 3QPCA 1YZQA 4QT4A 4LDJA 4GLBA 2XRYA 4OXQA 5E7QA 4C87A 2DBVO 3IALA 5JAHA 4KQFA 2NQ8A 3F9CA 2NSMA 3S4YA 3M9LA 5LP6B 4RF5A 4HWSA 4QNMA 1V41E 2H11A 3EASA 3VKHA 3DOFA 5THQA 5ALRA 2H85A 3F7MA 3RAMA 4KHPB 3W5HA 4DB4A 1XQXA 3K1AA 1Q14A 3KT3A 1K0UA 3JQFC 1JHAA 4LHVA 2ZIXA 4NGQA 1ZLYA 1JLSA 2IYYA 2V6GA 3LDUA 2B5GA 2BTEA 1PD0A 3KQVA 1U7HA 4DJJA 3AK4A 2CV1A 4EHKA 5T67A 4QXQA 3DAYA 1E61A 2FK7A 3ETHA 4QHTA 2EUIA 1G5IA 1FFBA 4LUAA 3U49A 2BEWB 1N8TA 1CSEE 1P0MA 2HA4A 3O9MA 5F1YA 3NO4A 4KEAA 4CCSA 2UYHA 5J1SB 2PT6A 1HORA 2QWXA 2P77A 1AUVA 3V48A 3RS3A 1ZKMA 1KEKA 4FDMA 1CW2B 2X76A 3LA6A 3FVLA 2C3PA 5FT9A 2C4WA 5HF8A 4ENQA 2IXGA 4F7WA 1WXEA 4E5NA 3HDVA 4I4TA 1DKMA 5DF1A 5HRCA 2ZYGA 3WQBA 2H1IA 4IP0A 2BKEA 5FWNA 2H1CA 4HNHA 3UYLA 3I04M 1PO7A 2QEQA 3JSXA 1IY0A 2BMWA 2MMGA 4K6GA 4YAGA 3I4LA 4Z3KA 4C6HA 4DN6A 1FOEB 3R5HA 3GL9A 3TNYA 2JIRA 2WHPB 3RAJA 1Y8QA 5AW4A 1NSTA 2VH2A 2BYTA 4M6GA 5ALEA 3IAFA 1GWNA 3VU9B 3GPBA 3FDZA 1JN0A 3M81A 2FSRA 1DTWA 4HYTA 4EHNA 4A8HA 4YMTA 1XROA 3PDWA 4L72A 4UIAA 1P3DA 5JY6A 4NYIQ 5C51B 2WSSA 4GQBA 4KLAA 5DK4A 2IQ6A 2PUFA