2HB6A

Structure of caenorhabditis elegans leucine aminopeptidase (lap1)
Total Genus 174
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
174
sequence length
489
structure length
489
Chain Sequence
TQVLVRNGIQAVGDGLTSLIIVGKKSVLKNVTFEGKFKEVAQKFVTDGDSWNSMISRIPASGRHPLHYELAHLITVPDASSRGNTPTNAHSIYKELKPINYPEDTKNVHFVLFAEYPDVLSHVAAIARTFCKFSMKTSGIRELNVNIDVVCDKLTNEDAVFLTDLSESVRETARLIDTPANILTTDALVDEAVKVGNATGSKITVIRGEELLKAGFGGIYHVGKAGPTPPAFVVLSHEVPGSTEHIALVGKGVVYDTGGLQIKTKTGMPNMKRDMGGAAGMLEAYSALVKHGFSQTLHACLCIVENNVSPIANKPDDIIKMLSGKTVEINNTDAEGRLILADGVFYAKETLKATTIFDMATLTGAQAWLSGRLHGAAMTNDEQLENEIIKAGKASGDLVAPMLFAPDLFFGDLKSSIADMKNSNLGKMDGPPSAVAGLLIGAHIGFGEGLRWLHLDIAAPAEVGDRGTGYGPALFSTLLGKYTSVPMLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Leucine aminopeptidase 1
publication title Crystal Structure of Caenorhabditis Elegans Leucine Aminopeptidase
rcsb
source organism Caenorhabditis elegans
molecule tags Hydrolase
total genus 174
structure length 489
sequence length 489
chains with identical sequence B
ec nomenclature ec 3.4.11.1: Leucyl aminopeptidase.
pdb deposition date 2006-06-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00883 Peptidase_M17 Cytosol aminopeptidase family, catalytic domain
A PF18295 Pdase_M17_N2 M17 aminopeptidase N-terminal domain 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10590 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Zn-dependent exopeptidases 2hb6A01
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 2hb6A02
4P4IA 1VHEA 4ZYQA 4X2TA 2I3CA 2ZOGA 4IAVA 2AFSA 5K8OA 3RAMA 1XFOA 4TWEA 3H8EA 3PFOA 1JQGA 3D7HA 5HVGA 2O4HA 2XEJA 3PB7X 4WJBA 4ZX9A 1FNOA 4NJQA 4UF4A 4NJRA 4H2KA 3FEDA 2ZENA 4OKOA 1LOKA 4NGNA 4NGPA 4GM5A 5D29A 1DTDA 1ELMP 2PE3A 4OC5A 4ZX8A 1AMPA 3PEIA 3D7GA 3GB0A 2J9AA 3B3CA 4OC2A 2BCOA 1OBRA 3HLPA 2AFZA 4ZI6A 3GLJA 4DUKA 2DEAA 2PJ6A 4Q7AA 2C6GA 2PJ5A 1BPNA 1LAMA 2Q43A 3V7ZA 3B3VA 3KGQA 4JZ0A 3LMSA 4PQAA 1Y0YA 3B3WA 3FJUA 3PB9X 1TF8A 1BPMA 5J1QA 1PYTB 3IWWA 1F2PA 1HDUA 1VIXA 4OMEA 3IC1A 4A94A 3NH5A 1CP7A 2CTBA 3DLJA 3SJFA 3ISZA 3MRUA 4EFDA 3BHXA 4NGMA 1TKJA 2NYQA 5LRJA 4MHZA 4LQGA 2F8HA 2CTCA 4MCRA 5LYIA 1HDQA 3GUXA 7CPAA 4MCSA 3WT4A 3D68A 2V77A 3D67A 1RTQA 2AFUA 5DS0A 3SI0A 3KI9A 3PB8X 5LRGA 4FWUA 2PJCA 2XEFA 1M4LA 2JBKA 4KSIA 2XEIA 4IHMA 3KZWA 3LWUA 4MMOA 2ZEDA 4MHNA 4PXCA 1AYEA 2EK8A 2FVGA 2ZEEA 3WC6A 4Z65A 5JM6A 1KWMA 1CPSA 4FUUA 2GU2A 3SI2A 2POKA 2PJ0A 1LCPA 3WC5A 4OC0A 3KHXA 3CPAA 1TKHA 2JEWA 4X8IA 2PIYA 3ISXA 5D8NA 1Y7EA 4NGTA 2V8GA 5JH9A 3D7DA 3KR5A 4NGSA 2AFMA 1LANA 4CPAA 1CPXA 3KHZA 3S9MA 1H8LA 3FF3A 2PIZA 2ZEPA 4W9YA 3WABA 2AFWA 1LAPA 5I4MA 5HVHA 1ARMA 2ZEOA 2ZOFA 4P4DA 3NFZA 2PCUA 4A37A 4AXVA 3PBEA 2BOAA 2QVPA 3RZAA 2GLJA 5K8NA 3RBUA 2NSMA 4OC4A 4B6ZA 3K9TA 4YWYA 3CT9A 4P4JA 5HXDA 3IO1A 1YMEA 1Z5RA 3KQXA 2V8DA 4P44A 2PJ7A 2ZELA 2IMOA 4FBEA 4NGQA 2F7VA 2HC9A 4ZY1A 2JBJA 4TNUA 4EMEA 4OP4A 3S9NA 3D66A 2PJ9A 4P6YA 5HVFA 2IQ6A 3PB6X 4O23A 2VL1A 2C6PA 4YU9A 3CDXA 5THWA 1DE4C 1XRYA 1CP6A 1ZLHA 3MN8A 4MXUA 2AFXA 2OOTA 2EWBA 3IIBA 3KASA 1UWYA 2WZNA 5JGFA 4UIBA 4ZY2A 3L2NA 2PVWA 3BI0A 3B7IA 1F2OA 1R3NA 1BLLE 1XJOA 4PXEA 3K2KA 3FECA 4PXBA 4P4FA 4K3NA 3FVLA 2RB7A 2GREA 2CIJA 1XBUA 2C1CA 3IJ3A 2C6CA 3SI1A 5LRKA 3NH4A 5LYLA 2PJ3A 4F9VA 1VGYA 4NFRA 2ANPA 2AFOA 2PJBA 2XEGA 3S9LA 1Z8LA 3WC7A 8CPAA 4WWVA 1EE3P 3SJXA 4MRIA 1YW4A 1ELLP 3H8GA 4A38A 4UEFA 1IY7A 2PJAA 3VARA 1BAVA 5IB9A 5LYFA 3IFEA 2HB6A 1Y0RA 4FAIA 2G9DA 3D4UA 1Q7LA 2ZEFA 3FMCA 4OC3A 2QYVA 4P4EA 3V38A 3PFEA 3VATA 4ONWA 3VH9A 2QJ8A 2PJ1A 4F8ZA 4P4BA 4OC1A 3I1UA 4ZY0A 3HUVA 1Z2LA 2ABZA 5K8MA 4PPZA 3BXMA 2PJ2A 3JRUA 4F9UA 3SJGA 1YW6A 1PCAA 3N5FA 4OIDA 1LFWA 3PBBA 3QNVA 3B2YA 2ZEGA 2BO9A 1YLOA 3IEHA 1ZG9A 3SJEA 3B3SA 3B35A 2Q4ZA 3FEEA 4JYWA 1ARLA 1NSAA 1TF9A 1VHOA 3BI1A 2O53A 5LYDA 4R76A 5K8PA 3T8WA 1TXRA 5ELYA 4MHYA 3FH4A 4MCQA 1TKFA 4NGRA 4DYOA 4UEEA 3KL9A 5F09A 4MHPA 3TX8A 1QMUA 2ZEHA 3TC8A 4IK2A 5CPAA 4PXDA 1IGBA 3KR4A 1FT7A 4P45A 2PVVA 1CBXA 3D7FA 4A39A 5CBMA 4R7MA 1ZG7A 3FX6A 3B3TA 3KQZA 4BD9A 1ZG8A 4R8FA 1YSJA 2PRQA 3PRTA 2V8HA 2ZEMA 2Q51A 4MCPA 1QQ9A 3NA6A 2EK9A 1F57A 2V8VA 2PJ4A 4DJLA 1CX8A 1XMBA 3DGVA 2CF4A 3NH8A 2IJZA 4G1PA 4X3RA 2WYRA 4OIWA 4R6TA 2OR4A 4P10A 1HEEA 4EWTA 1GYTA 3H8FA 2RFHA 3CPXA 3PB4X 4RUHA 2PJ8A 1R43A 6CPAA 4UIAA 2GLFA 1CG2A 4UEZA 1ZLIA
chains in the Genus database with same CATH superfamily
5AVYA 5DTJA 3QTBA 5HQ3A 4RK5A 4LECA 2W2KA 3H86A 1GAXA 5HF9A 2QR2A 3NJ4A 2PMKA 2ZB4A 1BMFD 3SHOA 3QU4A 2WB4A 2E4VA 3UOAB 1IOLA 3MINB 4U02A 4ANFA 4NJEA 1A96A 1CUJA 4IF4A 3SOZA 4C87A 1DT3A 2VT3A 3P52A 4OB8A 1R16A 3BTVA 4G8CA 2GJSA 5IDWA 3LCVB 5B3KA 3VO8A 3D4NA 3BJMA 1V8OA 6GPBA 5LJLA 3B89A 3OF3A 5REQA 3ESCA 1UXOA 2A78A 3V7ZA 3FPHA 1CB0A 3INRA 4G1UC 1GLGA 1DHTA 1RM0A 3SJFA 3F49S 4JBHA 1AZWA 5A71A 1NT2A 3BWXA 3C3BA 2YNMA 3CX3A 1CB7A 3AVPA 2FX3A 4Q7QA 3FGPA 1YR9A 1Z2EA 3I8XA 2PGXA 3RARA 1SVSA 2C54A 3NHSA 5ALZA 1XCLA 3DAOA 3R75A 3L6CA 2C9MA 3GLFA 2GN0A 4TRMA 3PB8X 5AKJA 3ZGLA 3LQKA 4QUGA 2YJGA 2P7HA 1G3QA 5FPHA 3GG9A 4E0AA 1QGED 5FA6A 1Y4DE 4LZWA 3R8FA 3GROA 4J3NA 2POKA 1N33B 4R5HA 4DMCA 3CF6R 4F7DA 4E5YA 4I50B 5B3JC 3T9CA 2F1JA 1QE0A 2PKRA 3K2BA 4GVPA 2DFNA 2I91A 3CT4A 4JJZA 5C52B 1S4QA 1F12A 2B7LA 4FOTA 5DYTA 2Q6KA 2UU9B 3OKFA 3SIPA 1XT6A 1DV2A 1Q0UA 4L1KA 2JGMA 2VO1A 2OH1A 2J6CA 3V34A 4UHDA 2XTNA 2HRBA 4F1WA 3COPA 3ZLTA 4QDOA 1KSJA 4RD3A 1M2HA 3UJ8A 4FOSA 1VHQA 4GBED 4IFEA 2C8KA 2PTGA 7ADHA 2OAEA 2EHDA 5KVAA 1Z5UA 4RO0A 3C3CA 1KEUA 2V0CA 1VHLA 3UFXA 1AUPA 2J9XB 2V45A 3OIWA 3B7IA 4X60A 4ZAZA 1ZI8A 2Q1WA 4KXXA 2OKGA 4ZEOA 1J9ZA 4MVYA 4KBYA 1RWWA 5JVDA 4X93A 3DL7A 3VNUA 3URKA 1ZL0A 1OKKD 5DISB 2FWMX 4Z54A 1HK7A 4CNQA 1O7JA 1E64A 3SKYA 1U7UA 4M3NA 1K9SA 1XELA 5LFAA 4LGMA 3MMPA 1JSRA 2QJTA 1E59A 3AOEC 1T4MA 4AZ3B 1PKEA 1EXDA 3DTVD 5SY9A 4YV2A 1Q2DA 5FBHA 3AJDA 3OZUA 4J94A 4R1LA 1P7ZA 2AOTA 1XE3A 1OYVA 2B4DB 4CI0B 4BMYA 3LTEA 1CV2A 3QFCA 1P2FA 4F04A 3VU8A 4GRDA 5ARDA 1QK3A 1QFYA 1ZLYA 2FLWA 3KJHA 2C00A 4FFOA 2WMYA 1AZLA 3MJDA 1S2MA 3R41A 3DBRB 3QVMA 3HXLA 4GX5A 5P8WA 2YHIB 2PXAA 5HE9A 2H1IA 5I7FA 5JC1A 3T4PA 4PZEA 2PGLA 3NBFA 2ZT6A 4LYEA 4PPYA 2Q5EA 3TC8A 4IK2A 1PI3A 4H6ZA 2QN7A 1QH8B 2WAAA 3OJWA 1DTWB 3ZIAD 1DFIA 3BD7A 3RANA 1U28A 3CNEA 1E9VA 3G8BA 4RN7A 3R0XA 3ONEA 2QVCA 4LCEA 3EIEA 2E89A 2XLBA 1PQPA 3JU3A 3LDUA 3GRUA 2JHAA 2QY6A 1A8HA 3P20A 3TOCA 2PJ4A 1I2ZA 1P2DA 1OZGA 3I9MA 1KJNA 4EMUA 5CP8A 3ZHTA 4K86A 3L4JA 1B6SA 2TMKA 1GYTA 4YJFB 4Q82A 4XYBA 3JAKA 1BSVA 5EMLA 4M6GA 2ZXVA 2ODEA 2ZIWB 3U3MA 1KDTA 3BQMB 4V0MA 4EQZA 4E07A 1HQKA 2PSWA 2GKGA 1NI3A 4LDAA 4W1QA 2UVDA 4JR0A 3NS7A 1F4PA 3CH4B 1OX4B 1TZJA 3R95A 4WDQA 1RJ9B 4PX5A 2JIRA 5FOSA 5AWFC 1VKRA 2D5IA 4KSAA 1M76A 4FYYA 2QJFA 4EHFA 1KEVA 2V8OA 1RQ2A 5C18A 4CM4B 2X23A 4HPJB 1OIWA 2XCIA 2ERCA 2PJ6A 3EZ2A 1NQXA 3PLRA 1H0KA 5CYFA 3RT9A 4HAVA 3HZHA 5DXFA 4AP5A 2Q0QA 3N8HA 4DQUA 2NZYA 3OX1A 4ZPXA 2G80A 3JQQA 2R5NA 1N3BA 2VQ6A 1DIBA 3INYA 1TZ2A 4JNKA 4E15A 4V39A 5FNVA 3N2GA 5K4GA 1X7ZB 5JS6A 2CDNA 2Y1LA 2JFPA 1F60A 4HLQB 2QL6A 2PVPA 1JIIA 1DO8A 4LXUA 2BOVA 1JIXA 2R6ZA 5DHRA 2H2AA 2AFUA 4ARUA 1ZI9A 2WLSA 5DVZA 4I5EA 2EFDB 2XSZA 4HRVA 1NJSA 5BYJA 1XZ8A 3Q3IA 1O8BA 1Z8DA 4TYYA 3U39A 1XD8A 4JSYA 3CB4A 3HRIA 3L0DA 4G0OA 3ANYB 5EPEA 2P8SA 5ETJA 1VP3A 1NHWA 3VO2A 4GGMX 4AJEA 3OOWA 5GZ3A 4NCXA 1R6AA 3C7CB 4Y2YA 2Z3NA 2YWCA 2FEAA 3K71B 4XPIA 1E9FA 1JFFB 1B0PA 4Q16A 3HLYA 3M83A 4AKHA 2KPOA 1MC1A 4GT1A 2M32A 1E3SA 1V96A 3GWGA 5K0NA 4MPDA 2R8RA 3BTOA 5HVFA 1L7AA 1ZUHA 2ZI7A 3WNBA 2C27A 5C8ZA 4GX0A 3KHKA 4FFVA 1NVMB 4C5AA 2RC4A 3LZDA 4MH0R 2C5GA 4TV9B 1PEKE 2ZRIA 2PVWA 4EUNA 1XR3A 4B71A 3W0LB 3K20A 4JV5B 4DDWA 4C4RA 5FOUA 3FVLA 4GRIA 2F55A 1IOWA 1GQOA 4RFVA 3QVXA 1PTJA 2RJNA 4OJMX 2HSEA 3GAZA 4R54A 2HJWA 5T8KC 3CUTA 4TS4A 3FMFA 2DFTA 1L7QA 4RD4A 4P7BA 5CA0F 3HUEA 2O8DA 3CJTA 4ZAVA 4MLZA 5GIOE 2FIAA 2OCPA 1U6IA 1WD5A 2ZBEA 4CRWB 1NW3A 5CDFA 4JY7A 3WLNA 3EXNA 2ATVA 1KQNA 2ZJFA 4YCAA 1GO2A 3RRJA 2Q49A 3UCXA 3BXZA 4MUNA 4JA2A 4KN6A 1GNSA 5LKAA 4JL6A 3RUDA 3K6JA 4QHSA 4MV8A 2WIBA 3LG2A 4DB2A 3BXMA 1GLVA 1UMKA 1XF1A 2WUEA 4BVGA 3ML1A 1C1YA 1N75A 3LY9A 4RL6A 3R9WA 4JBWA 4QM6A 3OJFA 3G82C 2ZATA 2ECOA 4JC4A 1HNXB 2EERA 4F8EA 1FCJA 2G3AA 1K68A 3I5UA 3PB3A 3F0TA 4RHFA 5C1PA 3G0HA 2VDNB 1SKYB 2R4QA 3CUEF 3S5UA 3EMBA 1XK6A 4FI3C 2OZHA 1XMPA 4F3NA 4JLNA 4JODA 1N6LA 3MRSA 2R00A 2WW8A 5FKJA 2FN3A 5KPDA 4E30A 2P0EA 2DB3A 3RS2A 1FFDA 1E1MA 2IPNA 5ITSA 4OJNA 4WZAB 4ZQFA 1DAPA 5CBPB 1IRXA 1CX8A 5CLLA 4UPEA 5CDTA 3VHQA 4MUHA 4AY5A 3JW8A 4MYTA 3O4FA 4OLFA 4CKWA 3CX8A 3K1AB 2NZWA 4IYJA 4AW9A 3AB8A 4QVKA 1AKEA 2X41A 1GPNA 3SHVA 1RKBA 1UBRS 2QIOA 5ILQA 3NGLA 1IZYA 1ZGCA 2O6HA 5KMGA 2G88A 2WEKA 4YMTA 4NAVA 3FCOA 1Z5GA 3K5WA 4U2KA 4WJBA 1PLJA 3V7NA 4G5SA 1BXRB 2R8EA 4EABA 9ABPA 1XIXA 3VR2D 1T4CB 2GGSA 2V7UA 3PPIA 3V9AA 3UZUA 2Q5FA 4HZUA 1IZ8A 4R01A 1V3TA 5BQ3A 4QELA 5IS2A 1DX4A 1P80A 3ESDA 2REOA 3L0ZA 2PUGA 4UULA 4K9SA 5K8TA 3R9KA 3NEYA 2RC6A 2JVKA 2O52A 1JPVA 3KG2A 2HXGA 3R3WA 4ILKA 5HXAA 1L3CA 3L8ZA 2PCJA 4DM7A 2A1UA 4KIJA 4JLWA 4TGLA 3D8HA 3GGPA 4RELA 3PC8A 4K1XA 3WL3A 3QVJA 4JXJA 2VJLA 3O4RA 4MMOA 2OV6A 2A9VA 2P2ZA 2JLMA 2PRYA 2H31A 1Z37A 3HUFA 4ALNA 1SVLA 4LVNA 1U3VA 5ALXA 1C1DB 3KP1A 1N9KA 1AQNA 4OGGA 1NLYA 4X00A 1I7QB 4PCVA 4NGTA 4R9NA 1E6KA 3DHVA 2ZEPA 1JT9A 4N82A 4ND5A 4MJXA 4C2TA 3KR0A 4N40A 2IDJA 5BN3A 3W5HA 1MLDA 3EC1A 1PW7A 1EBFA 4HAIA 1MBZA 4FYKA 2ISQA 4CN9A 2QYHA 2PXHA 5U4XA 1I3KA 2X4IA 3SQDA 3ZZIA 2IYFA 4Z1OA 5DT9A 3SJAA 2V6JA 4Q3NA 1GPLA 2WUWE 1DKMA 3GLFE 2OTCA 2CB0A 4I5DA 3V3TA 1GADO 4NOJA 1ZK1A 4DUGD 3T7CA 4C7VA 5FPPA 4OQFA 2HU8A 3LP8A 2CFSA 1OTYA 4CKEB 1VPTA 4MY0A 2WZNA 2ID7A 4XGQA 1P2UA 2JGDB 1IWBB 4EY3A 2CN1A 3TT2A 5KKNB 3ZGZA 4WBSA 3OTHA 3RS8A 1GZHB 4N5NA 3LRTA 1VGYA 3R9EA 1WU7A 4UFWA 2IOHA 2BFBA 4K2AA 2QJOA 3F3SA 3ZV3A 5EYPB 1AC5A 3Q9NA 1RHJA 1WSWA 1MG5A 3IHKA 2GPTA 1YO6A 1AG9A 2FW8A 4EEKA 1PR6A 3IAS1 3A4LA 1JWAB 5JSUA 4ZALA 2NADA 4UTNA 1Q7TA 2JK1A 1I7LA 3AY6A 3PNSA 3TIFA 2ZRPA 4ZMBA 3HDYA 3WBJA 2F43A 5JWHA 2OKCA 1HX7A 1VB5A 1XEXA 2G36A 1VCHA 3F7NA 1BCSB 1M6EX 2FRDA 2BFOA 2AUMA 2ET6A 4RC9A 1WCXA 2ZTUA 3GRCA 1X9GA 2X1LA 3RSGA 3KZKA 4YMWA 3IWGA 2R3SA 2VG8A 4YJ2F 2QR3A 1B41A 3ICQB 4DYOA 3IMKA 4UEEA 5EUBA 5CHEA 2X76A 2ODNA 2EYQA 3W5UA 4LXGA 2DBQA 3K94A 1II8B 1NKSA 3IAUA 2QIPA 1F5SA 2OCKA 3K0EA 621PA 4BKRA 1ZOOA 3T7TA 1A9YA 3ZKAA 2WJGA 1WDKA 3S7TA 4BBAA 2BH2A 3KKNA 3B8HA 2QE7D 2RKBA 3IDQA 1P0FA 4G5HA 1NF3A 5DN6A 1KFEB 4RORA 2J7PA 4LC0A 5LZ2A 2GDJA 4D8YA 4X7RA 3GDOA 2MU1A 2HBZA 3E18A 3GRZA 4UIAA 1FSGA 1WCYA 3M9XA 3G13A 4WMLA 1AHPA 1FSZA 4URXR 4FQ8A 1A0OA 5A9SA 1N34B 1GPWB 3BRSA 3E15A 1BVRA 1Y8QA 4UNQA 1JVBA 4RIIA 1K97A 1U2RA 2LPMA 1SXGA 2CLHB 3RREA 3RFTA 2D4PA 1ZH6A 1Q0QA 4UE2A 4Y1GA 1C3VA 2HIGA 3IHWA 1WCIA 5AJYA 4B74A 5TEVA 1VRCA 4FYPA 5KNDD 4C3UA 2PZJA 3TF5A 3U3RA 1IXRC 2WM3A 5CVVA 3LLUA 3DVLA 3C1OA 3IJEB 4XD7A 1F4LA 5TT1A 1KJ9A 2QUIA 4YRFA 4OGFA 3EYAA 1OZHA 5FT9A 4OM8A 4V0ME 4PYOA 4F12A 3SC2B 5IM4A 4P7GA 1SQGA 2NUPB 3R8XA 2JFBA 3MMNA 4CL0A 1GAEO 2LCIA 1PT7A 2FUCA 4Q4HA 3ZWMA 1CUVA 3IOYA 2C20A 3K7EA 3PF8A 1KY2A 4A7PA 3FUCA 1PD1A 3LWUA 1MPXA 1Y81A 1B7GO 5J4KA 2VNIA 1E1NA 3L7YA 1KWMA 4EL5A 3GLKA 1JP7A 2BE9A 3HU1A 3KT6A 3MWKA 3C26A 2H11A 4UM9B 3JD3A 2PIYA 1LB1B 1ZH8A 1KAGA 3IP8A 4Q1FA 1IQRA 1KVTA 4JLJA 2GVZC 2MT9A 4JR2A 5KI6A 1PGQA 1EVZA 3E22A 3ASVA 3NBKA 1FQJA 4DUYB 1HUQA 1K4KA 4P44A 4YP9A 1XPJA 4ZYWA 1NF8A 4FBEA 5BR4A 4RF5A 5E6RA 1HM5A 4RTOA 3AI7A 1IWPB 4G9EA 4O08A 1WW3A 4JUBA 3I9V1 4U8GA 1PZHA 1II0A 2L18A 2ETVA 1U8XX 3NOOA 2I4OA 2DM6A 3RASA 4TUYB 4IXNA 4AY3A 2OE2A 2BL1A 2VBCA 3W05A 4V1CI 2WMDA 1EP1B 3BSFA 2ABWA 1HZJA 4GWKA 4CF5A 2QMUA 3OHSX 4ITUA 2CCGA 4NBNA 1KC1A 4E70A 1JEYA 4FI3F 4Y1RA 3A9CA 1X10A 1G98A 1E7SA 3KSMA 4D9FA 1KVSA 1NN0A 2JI8A 3QFHA 1XTJA 4FGWA 3THWA 2FN9A 4OK3A 2IDZA 1DB3A 1BKSB 1GAJA 4D9CA 1BTOA 1AM4D 2F2TA 4GP6A 4PQYA 5B6PA 2C99A 3FOZA 4PW0A 4MB0A 1VHOA 3K15A 4AZ0B 4A6PA 4P0PB 3ZI7A 4GMXA 5DGHA 3KCQA 2OYSA 3KKEA 4KOEC 1MB4A 4MGIR 3VSBA 5HK9A 1VG1A 3FUWA 2GYWA 5IJXA 1GT6A 3SSMA 3KT3A 3VH2A 5CDFE 3D0RA 1DC4A 1QDUA 5L8VA 2VL7A 4BWYA 3HYCA 6PFKA 3ZWVA 1C0LA 4IJ6A 1VLMA 1N1GA 1ZMOA 1PLLA 5LJIA 4KFTA 4CRZB 5KKCA 1OC2A 1FSFA 2YXLA 1USGA 1WPXA 1Z07A 3GWZA 1DADA 1UC8A 4Q7EA 1DEXA 1G20B 4D81A 1OBVA 3BE5A 3UWMA 1IHPA 4AL4A 2OHJA 3VVBA 3V97A 4ARZB 3LCUA 5HIIA 3EIQA 3EWSA 3GF4A 5LXTA 1XALA 3GIWA 1AK9A 3LD9A 4DQVA 4MKXA 3AR7A 4XCQA 4ZANA 4LZAA 5AI9A 4F60A 4NS4A 1W5TA 3DBHB 4YHHB 3I42A 2CV1A 4H60A 4ZOLA 1RABA 4A3SA 5J2UA 4AJKA 1J8QA 5IBCA 3SHWA 2ZJZA 1IOZA 1V1MA 2IX9A 4I50F 2YTZA 5EXEA 3N2KB 1ORVA 4KQMA 1JG2A 1EFAA 5G1PA 4ILEA 4K3UA 3LYHA 4N5HX 1N2CA 4XNHB 3OCVA 2JIQA 3ED1A 1IN6A 1T3TA 5AVSA 1RWNA 3KQSA 5KUTA 4KK3A 4LTNA 3L4BA 2JZOA 3HCOA 4KXYA 4IMRA 1KFKB 2DKFA 1Y82A 3Q1LA 4QOGA 3E2PA 2IU4A 3TAXA 6REQA 4QRHA 1DMRA 3AF3A 1P4RA 5JS7A 1MOQA 5EIHA 5A1JA 1WCWA 1R5JA 1F2DA 2PM8A 2HQYA 4RA6B 4FYVA 4OM7A 2P30A 2TS1A 3J7TA 4F8JA 2XBMA 4ZYZA 5HZMA 1YR3A 5IZCC 3O26A 1N7HA 3HDQA 3O8QB 1WF6A 3LK6A 1D5WA 3D0QA 3LTNC 2HLDD 1RNLA 2ZTVA 1YK1A 1MEOA 3OM8A 4XIGS 3ODGA 4OG2A 3PRHA 3E9EA 3AI2A 5HQTA 2BHNA 3IOEA 3HCDA 1A1SA 2O3RA 3FVQA 1SNYA 1TUGA 4JGBA 3B6ZA 1QHGA 2D3TA 4YUVA 3BXEA 2V65A 3DE6X 4MVJG 3G2JA 2Q3CA 4FDTA 4H0NA 1WDMA 3CE6A 3QVUA 3SSOA 3H6GA 4AJPA 2OHHA 1HR0B 3W5AA 1G2OA 2X3UA 1ICIA 4P5PA 5KC9A 3PGMA 2DPYA 3PWKA 4BDTA 2P6EA 3THYB 4MIOA 1H2FA 4FNAA 3MJCA 4BJHB 4GO1A 1BDMA 3AVOA 3L9WA 3OWCA 3DR5A 1XZMA 4FN4A 1EEHA 4IGEA 1N5MA 1G3MA 4XIIA 2VSFA 1TC2A 3I6MA 5DI3B 1AKQA 1GP2A 5KQGA 5EA2A 3FYHA 4A38A 5CM8B 1BX1A 2XCOA 5MGNA 2G3YA 2XOEA 3L6OO 2CLDX 4U2CA 3R3VA 4N03A 3C87A 3OICA 4MWTA 2OZLA 4KXLA 1G17A 1NUTA 1O6BA 5TB5A 4EMBA 2KMLA 2I2DA 4GSKA 2GCEA 3VH1A 1XCGB 1Q21A 4NH0A 2OXFA 3X0DA 5H68A 2HRQA 2JLCA 3FN4A 5JAIA 2BGWA 4CIWA 2O6LA 1IB0A 2BKVA 3B3SA 2YYSA 2XV1A 2BR4A 4AYTA 2YBEA 4UE6A 3P1JA 4LVCA 5G0SA 4X8HA 5FEUA 2KLBA 5EHIA 3SJBA 5ESXA 2REQA 3TQIA 2B4TO 3L92A 1VGVA 4WRRA 4BFWA 1G9TA 1LF0A 3EC4A 4HI0E 4OJYA 1L4GA 3MILA 3AY3A 2OCDA 3WK9A 3FHLA 4QAQA 5IBRA 3UJAA 5CA1B 4D8VA 2R86A 4U9HS 3PWSA 4LYJA 4IFIA 3DONA 2IYSA 1ZA1A 1ATIA 1OT5A 2JD2A 5I47A 1VPWA 3NWBA 1UADA 1SCKA 3AR9A 3C3MA 1NMZA 2QWXA 1Z4JA 4B6OA 1FUKA 1X94A 4EGCB 1Z63A 1BA3A 3KWLA 3TYXA 1Y5MA 5CLIA 2UUOA 3W3AA 3OT5A 4WFIA 4E31A 1KDYA 5K3FB 2QK4A 3LW7A 3M6XA 2JBHA 5CX1A 3GEBA 3BWVA 5D1NA 1B6GA 2QYOA 2W37A 3QVGB 3L3BA 2PRZA 4KMRA 4B7XA 3VU0A 2QQGA 1Y42X 2ZRHA 3EMDA 3ZHVA 3JYNA 4LC1A 2Z09A 5LU9A 3HN7A 3DOJA 4DR3B 1SUSA 3T4XA 2OHIA 3C74A 1JDNA 5EUQB 4LF5B 1CP7A 2PD6A 4C7XA 3IP5A 4OV6B 4HX2A 3WRXA 2FAXA 4JITA 5CDUA 4NBKA 5HGXA 1H6DA 1ZM9A 5EVCA 1MRSA 1GKIA 4UM9D 4X3PA 1M2GA 1QWOA 4G9GA 5EP1A 5D51S 3TDNA 2BP7B 2WHPA 1KK1A 4ZZ2A 1T9GS 3RB8A 3W6NA 5JPCA 1GPH1 1NPDA 1LVUA 3FCSB 4GG1A 2D0PB 3RIMA 3OOHA 2ZTLA 2RHRA 3K92A 3DHYA 3I6ZA 4DIEA 1XLVA 3EXFB 3WGZA 1MJFA 3KXKA 3SJCA 4UTOA 2W2MA 5I7VA 4DUZB 4R3LA 3KTFA 4TV9F 1JR3D 3DULA 2QI9F 1O9BA 1Y1KE 3OC0A 2UUPA 5CCXA 4E3WA 2QMQA 1K7YA 1J56A 2HDWA 5ESDA 1WQ1R 3I2KA 1OBHA 4GVLA 4ZDJA 1JJVA 1FPQA 5LR6A 5AKZA 4GEGA 1Q84A 3EIXA 1PQWA 4OC4A 1T2VA 3U62A 4B31A 3GG2A 4N3CA 4TX1A 4UQLA 4TSKA 4H0FA 3O1IC 1QYWA 1PJ2A 4QBFA 5IK2D 2FOLA 2ZM6B 3GJ0A 2LP4Y 4IRUB 2CWWA 4C0SA 2PWBA 3K05A 1MFPA 1K5HA 1NBIA 2P4UA 3FFXA 1SHLA 5I7OA 2ZDQA 2V6FA 1W7AA 4MYRA 4M1MA 1RYZA 4KIUA 3VZDA 3VBEA 2DETA 3M1LA 4X1OA 5HRCA 5EEGA 2Z2JA 5E38A 5AJHA 3VC2A 1CLUA 5DI9A 4Z8YA 1UDXA 4X0EA 5FI1B 3RTEA 1KETA 3ILXA 5DWNA 2EWVA 4U2FA 1BS1A 1AQYA 4L9WA 1CY2A 3IUJA 3UJPA 3B2NA 4YGXB 1Y5IA 3SJXA 3EUFA 1A71A 1P9WA 4IJQA 2AXQA 2VP4A 4NAHA 3U37A 4BLUA 2Z10A 1D6SA 3NH9A 3D2PA 3GFGA 2TMYA 4GC9A 2GHIA 1Y5LA 3PFWO 5AM4A 1YJBA 4CCWA 5ELXA 2WTNA 2NU7A 4RK1A 5DYNA 2QBYB 5LZ9A 4ZVRA 1T24A 5JWRA 5C8VA 1XKLA 1EKXA 1IY0A 3KEQA 1EWQA 1HORA 3MQFA 3K4QA 1QAQA 3TQSA 4K6OA 1OXUA 3KUDA 4HQLA 5THKA 5C51B 2RIPA 3K16A 4W5OA 2E9SA 5LMUB 3HDTA 3KQMA 4A9AA 4HSGA 4ZO4A 3GJ8A 1OI7A 2ZSUA 1Z9UA 2HL6A 3TVTA 1JHUA 3R23A 3VJKA 2EWWA 4RNCA 4AAYA 4X63A 3UK6A 4CGPA 1DUSA 3CS3A 4B73A 3BHMA 1W2WB 1V35A 2NTNA 3AG5A 3SNKA 3RAPR 5F98A 1GR1A 1VA5A 2GXSA 5JBQA 3TEFA 4L74A 1TADA 5T4BA 1YJ8A 1YZGA 1PZNA 3WY9A 2Z3VA 3NAMA 3KHSA 3A11A 5M04A 2RK6A 1WKBA 1YKFA 4ZVVA 5H3HA 3BFKA 1CG2A 1MO6A 4Z9FA 3K0FA 4MW1A 4Q3BA 1V26A 2HF2A 1JLHA 4ONUA 1JHAA 3AR3A 4RI1A 1U65A 1L5RA 2Z6AA 3N2EA 5IAEA 2VHCA 4CAEA 2CUKA 3KQOA 4MDYA 4DN6A 3O73A 1Z0UA 3QF4A 3TQFA 1OD6A 4EG0A 3FUXA 2F3TA 1RBMA 1P1FA 1KDPA 2ZENA 5EJGA 4J2TA 1WMSA 2NNLD 3OZBA 3R6DA 4YAKA 5EIXA 3RNOA 2FHPA 1L4LA 1ZC4A 5ICMA 4UVGA 2N46A 3DUFA 1KBOA 3GD5A 3EUEA 4P4SB 2QOEA 2B4KA 4G5XA 1T4BA 2FRXA 4I3HA 1MNQA 2VKTA 3KLPX 4QXOA 4MS1B 3DO6A 3CEMA 2RSLA 1U0EA 5EN4A 4EW2A 5E95A 1E92A 3C3EA 2VXOA 2GOYA 5LLSA 5LRJA 1BGVA 2CXAA 4FFSA 2IHUA 3C0KA 4E12A 4XNHC 3EGXB 3FTCA 3L46A 5AKYA 4F2WA 3DDNA 4E2WA 5HUQA 2W43A 3TQRA 1ZNZA 2FG5A 5CH3A 4R1QA 2O2JA 1J39A 3A3PA 3H3XA 5FUYA 3JWJA 4IIDA 1S02A 2Q28A 1IONA 4PINA 2HK7A 1U99A 3FNGA 1S5KA 1WTCA 1NBWB 4XWGA 3FMOB 4YP5A 5LBIA 4PRKA 4O5AA 5AM1A 4X1KB 1SXQA 2UZAA 3LS2A 1KYYA 1LW7A 1W8DA 4IOKA 3BWEA 5IP5A 1XEWX 1CQWA 4F8YA 3NYWA 5MHTA 2FPRA 3ABQB 3RHSA 4LSZA 3E27A 3S2GA 1SA0A 3JARB 4B5LA 4ZCIA 4DCUA 2R97A 4YAWA 4KVXA 4QLAA 2ZAOA 4XSGA 2A5YB 1N2CE 3PA6A 2A30A 2FZWA 4I36A 1P19A 2SCUA 1G1MA 5GJVC 4N6GA 5TRTA 3S9NA 2YJ5A 4M53A 2C2GA 5ALQA 3OZCA 1QRDA 1RIFA 1XZDA 2C7BA 4F3CA 3I9V6 1Y3CE 1R4ZA 3I2HA 4LK2A 2AQ8A 3H1FA 1LWNA 4F84A 2Q6LA 2O06A 4TMYA 4PZDA 1U3UA 1D2EA 4MLDA 4Y6GB 4Q4LA 5J4VA 5AW4A 2R68A 3OPVA 5A7FA 3BRWD 3M7IA 2JLUA 4RMIA 1DOHA 3N6RA 2W5UA 4UU0A 1E1QA 3ONNA 2GBCA 3JQ7A 2PUHA 4YAUA 1NR5A 2D62A 5A1TA 3QGMA 4OD0A 3QPUA 3GEHA 1KNXA 5B4TA 2ZE5A 1UOEA 4LV6A 2Z0ZA 4O0LA 5C8XA 3HSYA 3FD8A 2ZAIA 3N58A 4HX5A 5AUOB 3ZHBA 1L9KA 4EDHA 2VDWA 3WGOA 1C3EA 2QMEA 3BTSA 3B12A 1XMVA 3AKCA 3O3OB 3JCZA 1GAWA 3I6QA 1R74A 1HG1A 3QELB 5E1OA 3LBIA 5D87A 1NR7A 2JFFA 1ACLA 4II7A 4PR0A 3T8WA 5TPWA 3PFBA 2IHBA 1JSXA 3RLIA 1F17A 4I8IA 1URPA 1E5LA 4EFKA 5FOWA 1VECA 1L0CA 3QMMA 4A32A 1AV6A 4KXFB 4Z7JA 3D7FA 4ZIRA 3SAJA 3BT7A 1XKXA 1ZOPA 3W6PA 2OZGA 2VBQA 3DAPA 1PJ8A 4R9UC 4B3DA 4L4ZA 3S55A 3OWXA 3B70A 1QQ9A 2VRCD 1W4ZA 1UBCA 4X3RA 4UBIA 4AVCA 3T7JA 1TAGA 3IAEA 2V98A 2WIFA 3AL2A 1RLJA 2QRQA 4QT4A 4BVBA 1E5XA 3AR6A 4KNVA 5CCEA 3T6KA 4PSWA 2YVAA 1X13A 1E1DA 4D0NA 1FNNA 2R60A 3HN6A 3PV0A 2J3MA 1NUUA 1WETA 1SBCA 1YOVA 2XYRA 4QOIA 2VTKA 1CM0A 5AG6A 1YR7A 1ZIDA 4HB0A 3PUVA 1KOJA 1KJ8A 4C29A 4FGJA 1D07A 2WVAA 5F12A 3BAFA 4V0SA 4OQPA 2COKA 1DTDA 4OH7A 2OZVA 2IOFK 1J0DA 4N39A 5EP2A 4IIXA 5JSKA 1DXQA 3ZBTA 1Y89A 4PNEA 2C5BA 4I1UA 1DAOA 3DFMA 2EJCA 5HFNA 3KSUA 4Z2AA 1P7WA 1NVBA 2VF7A 3FXAA 4WKNA 3TRIA 4LV5B 4A6XA 4RZHA 5K1ZA 3AFIA 3PCTA 5K3DA 2AWOA 2PS3A 3DQQA 2C4WA 2D59A 4YV7A 1U4SA 3HB4X 3DZDA 3SEAA 3TTXA 3U31A 1YHYA 2I7CA 1HMYA 4OLLA 3R1KA 3RVNA 1I3NA 4RMNA 3RG8A 3SJZA 4LOAA 4IHMA 3VHLB 2H54A 1R9MA 4DR1B 4INAA 4H35A 4HGYA 2QP9X 2ZEJA 3Q2IA 3AQ4A 4MX8A 3W6ZA 3WGTA 1AD2A 4ZCMA 5K0JA 3RVOA 3GB9A 1Q95A 3R9GA 2QM8A 2V8GA 1VPEA 3N7ZA 2G72A 1PHRA 1TYZA 2ZI3A 4TUYF 2OYRA 1UFOA 2Z9CA 4J16A 1GVHA 2GZ3A 4D4GA 1K75A 4DJFC 4TLCA 1JAIA 3LAWA 5AJVB 1NF2A 3O4JA 3TSWA 4RD1A 3RKUA 2H6EA 3U4HA 1YZYA 2VDKB 1T5IA 2AW5A 2YJTD 3R44A 3DDWA 5FUQA 3IBTA 2BSQA 2XTJA 2A0KA 3PQFA 5C34B 1JVSA 4EHBA 2P67A 4ZZ1A 1Z6PA 4DYDA 3EIHA 3DPIA 3HBAA 1IOVA 2G8NA 4EUFA 1W581 4OHKA 1GA1A 5DBFA 1CD5A 4RCVA 4MO2A 5KTTA 1V6CA 5EZSA 2XX3A 4ZWNA 1UWYA 2I5PO 3OX2A 5F2KA 4OUDA 2WDPA 1W47A 2P0WA 2GFHA 4IMIB 1EUQA 1UUFA 4DAOA 4WJKB 3JZDA 1A9ZA 3I05A 4EO7A 4C21A 1JYFA 2CVFA 3AONB 1OA1A 5LCXA 3GY0A 1KH2A 2YGWA 2N0SA 1TYAE 1UPXA 4AO6A 3OUTA 1PEYA 2ZI6A 3MVEA 3HS3A 4FLEA 2P6MA 4LX0A 2ZI5A 2XUIA 1OIVA 1I0ZA 4DDKA 5KVQA 4JUIA 3HJCA 4JAVC 3R0VA 2OB1A 3BZWA 3TKYA 2FN4A 4CKZA 2I6XA 3RWBA 5E9AA 4KYIB 2OG1A 5BUQA 1Q50A 1MT0A 3DE0X 3CTMA 4AVBA 4C04A 1F8GA 1ZLXA 1P7CA 3V00A 4R3WA 3DVQX 3MTQA 4NWIA 1PYOA 2ZSIA 3UUFA 4RLHA 4WN3A 4N3NA 1EQAA 2WSBA 2VDMB 1HDIA 4RV9A 1Z4NA 4LPKA 4KJZA 4QZVA 2X40A 3K0BA 3AEQA 3JZMA 1FLAA 1EDOA 1N7IA 4E11A 1BOBA 5LMNB 1SVUA 2NM0A 4JP8A 3T12A 1NW5A 2FLVA 2Q50A 2NT4A 4L6AA 2PIAA 4CTMA 1FFGA 2QD4A 4E5DA 3W8EA 3D5QA 1T2EA 1HQDA 5CM2Z 3DNMA 2RH5A 3FGZA 3KTAA 1H2YA 3ZE7A 1KI2A 3GEGA 1X1RA 4MAFA 1KP9A 1ZD1A 4J1TC 3OLCX 1HYHA 1Q2XA 3E2MA 4B8YA 5AT1A 4FBMA 5IYZF 4I46A 3VJMA 3IEXA 1E2JA 2IYOA 4BDSA 2F3RA 3U6KA 4ZTUB 4IJ5A 4Y2SA 1SZCA 2VPYA 3RS7A 5ALUA 2RHWA 1YCGA 4YQEA 3U56A 3L8FA 4M6WA 3JD4A 3K8ZA 4MNTA 2QT9A 1SKMA 3D7GA 4MITA 3OEHD 2VP6A 3WLQA 5IT9A 1YONA 1EI9A 3ID6C 5CXXA 3PQ3A 1P31A 3CKMA 2HU7A 4JOBA 1JEQA 3C5EA 1L8XA 2EWMA 3FM9A 2G6TA 3QLUC 5M3BA 5UKDA 1SOAA 1SOVA 1C3OA 4G63A 2G06A 1H2ZA 4M1YA 2AC4A 4RK4A 3IL2A 3JWHA 1R37A 3DLJA 4ER6A 4ND8B 1E96A 1RHRA 3IKTA 2Q7XA 2WSYB 2WY2D 2Z4SA 2HWYA 3N6VA 3O47A 1UXGA 2YV5A 2GQ0A 2X9LA 3FG9A 5FV4A 4P3NA 3I09A 3HLKA 1I5EA 4HXFB 1CPYA 4PXAA 4LHEA 1E4YA 3M2TA 3JYOA 4PE5B 3L43A 2X0KA 3T7IA 2Z2YA 2O0JA 5BV2P 1A8QA 2WIGA 2VTBA 1M66A 4D8TA 1XVAA 1H3NA 1I24A 2QLLA 3Q5DA 1H8LA 2AFWA 2Y1WA 3ROFA 3SYTA 2W9XA 2ZOFA 3Q72A 3UY5A 1WEKA 3CFYA 3GNTA 2GXUA 1H05A 1NU8A 3QHQA 3VOAA 4Q01A 4DJEC 3KQHA 3FVVA 1Q14A 5MN5A 4A15A 4GPTA 3HKEB 3JQGB 3NKVA 1GRNA 3JQFC 2ZU0C 3MCZA 5A4JA 1IVSA 2PHZA 3G9UA 2WWGA 3R9XB 3RU3A 4O25A 2VYQA 1Z4EA 5IVIA 1DLIA 3N2LA 2WHYA 1W35A 1R6TA 1Q1ZA 4MXUA 1DARA 4PLYA 1EUDA 1T5OA 3BHJA 3GRRA 4RGQA 4ZGWA 3M5CA 3GJ6A 5DPMA 4MV7A 1R3UA 2FDCA 3IGRA 1U7HA 4GR9A 1NOKA 3FCUB 1XV5A 3LHKA 1HEIA 2AOVA 5FWNA 1CIPA 2QV7A 2B78A 1KAEA 3DMDA 3Q7EA 2CBGA 4H59A 4U7FA 2F1RA 2KM1A 3PNQA 3AFGA 3ELBA 3I61A 3R3JA 2VUHB 1SUCA 2FSRA 3B9PA 4LZNA 3O4HA 2PH1A 4GPAA 2VZYA 2V58A 4QQFA 1D04A 3I1UA 5FJJA 2CBZA 5CA1F 3P2OA 4BLTA 3JZAA 1UKZA 1G8KA 5EHGA 1M2OB 3TOVA 5KSYA 1JHQA 3UPTA 1COWD 2XUFA 4Y67A 4TTJA 1IZ0A 1R6DA 5FBLB 5K51A 1W4AA 2ODAA 1ZEMA 1JIKA 3L0IB 4P36A 3K35A 1KE2A 4REMA 1L5HA 4PTLA 4R2XA 2CHUA 4IWNA 3DE2X 3S29A 3ONWA 1JPNA 1TKCA 4PY2A 4B3FX 4DG9A 3TW4A 3B3TA 3OF2A 4NFLA 5J3JA 1GPUA 5E9QA 2OCLA 4FT2A 4DLSA 4NCZA 1KZHA 5HRAA 2VDRB 1XEBA 2H7YA 5KYWB 4NK4A 3LWDA 1GVNB 5F7OA 5AVZA 2QRKA 4G1PA 3PNOA 2W6JA 3D3WA 1WAMA 2O8BA 1O95C 3BSWA 2AF3C 5BSMA 1YA4A 2UZ1A 2NSDA 2RGYA 3F8SA 1Z0ZA 2JS7A 1RWXA 1VFPA 2JA1A 1YR0A 2D5BA 3V2HA 3I9NA 1OAKA 1RADA 1NQWA 3IO5A 3RUCA 1S7NA 3B36A 4G5OA 2ADOA 1O03A 3CVYA 4IH4A 4MV3A 1FNOA 1MEJA 4M3SA 3H17A 4YR9A 2BW0A 3WZMA 3IOBA 3QZUA 5DP1A 2IBSA 4OI4A 3CBGA 2G40A 5D7NA 1ZUIA 3KFVA 4ZI6A 4TOIA 2RBEA 4TS9A 2PLAA 3LL7A 1Q15A 1AQLA 4L8VA 4QQ8A 4N0DA 1BGXT 1HZZC 4TVOA 2C5SA 5AG7A 2ZUCA 3U3KA 1AURA 1HDQA 1JHZA 2DYKA 2DMRA 1MENA 3WJAA 5K8CA 1A69A 1GT91 2P2GA 2GYUA 3SYKA 2HJ9A 1FFHA 3H16A 4QTTB 3Q7TA 2CL0X 4KV9A 2AXPA 2IZ6A 2X5KO 2C98A 1F2TB 3ZIUA 3GAAA 5AM2A 1S6YA 2ZEEA 2ZR0A 4B9EA 3JQDA 2K7ZA 1H22A 4NOMA 2QE6A 4K9OA 2ZUUA 1WLYA 3D7DA 5HBGA 3JTMA 3DFZA 1GD1O 4FNMA 1XRLA 1DJPA 4G4SP 3BA1A 5K2OA 3VDQA 1XFAA 4OHOA 1OFUA 2JIMA 3UA4A 3WLSA 2ACWA 3PEFA 3VR3A 4CNBA 3LXRA 2VQYA 2O0HA 2HAEA 3D7RA 1K89A 2PL3A 1JALA 3KO8A 1VI6A 2GCOA 4ENVA 3QOXA 4RHYA 4EMEA 5DM4A 4RADA 4KLAA 1VYHA 3EFBA 5EZ6B 3OI7A 3CZPA 4KX3A 2ZAMA 2Q4BA 4RZ2A 2C3PA 4YMUA 4MDEA 3PC6A 4AWAA 3K2KA 3IUYA 1H2WA 2GREA 4BFXA 3BEDA 3SDSA 4UTXA 4MLCA 4OCZA 4NE2A 4WW0A 2AG6A 3DW1X 3CKLA 2JJMA 1V0JA 2AD1A 5LZ8A 1U4OA 4NABA 3B13B 1NJ5A 1ELLP 4HXYA 2CFRA 1XQ9A 3CUSA 1A5AB 5A6SB 1BAVA 2B4AA 2WG1A 2DQ4A 2YZKA 4IMJB 3V7YA 1UEXC 4PC6A 3D1VA 4ATNA 4NCJA 3FH0A 4HNGA 4UMVA 1FUUA 2Z3ZA 4HNUA 4RTMA 4S2UA 4R3NA 2X8LA 1POWA 3TZ6A 1QV7A 4DIUA 4DW8A 2QPAA 4R1OA 1SQFA 4KVFA 2EATA 1NE2A 1QKJA 5FR1A 1EXNA 1YVKA 3Q3HA 1F9AA 4EZBA 3BWCA 3HM2A 4BP9A 4ARCA 3KVVA 4JX9A 4MVJH 4IV0A 4DBLC 3FEEA 4GW3A 1DX9A 2FMHA 4PSXA 4MWDA 6ABPA 2ERXA 1C41A 1DBRA 1OE0A 1N6OA 2LV8A 1MTOA 1NVVR 2MDTA 3L7JA 2WU1A 3HNPA 4N49A 3N0XA 2AKYA 3ZU6A 2KE5A 3UANA 2B5GA 1JU4A 1TVKA 1RWBA 4DA4A 1UBEA 2HRCA 3G2LA 3RAGA 3UMRA 1U2PA 3HYSA 5EHXA 1B8UA 1R0SA 5K8JB 1HEEA 4MPTA 4S2EA 3ENQA 2ZSDA 2AEEA 3WGLA 3C39A 4M9RA 5AW5A 3ZQUA 1XQYA 3RVRA 2BFFA 3LQ2A 3UQZA 2ZYUX 4EYOA 1Q83A 2HWWA 2OM6A 3QKWA 3BGDA 5LNK1 4KDRA 1JVNA 3NWJA 1W9MA 4HFJA 4XB1A 4DKJA 2ILTA 2WMOB 4NBSA 1WP9A 4P33A 1P75A 1EK0A 2FPGB 3MQ4A 3EF1A 2IY7A 3SQWA 3EQ2A 3D2AA 3ZC3A 2AG8A 2IZ1A 4C20A 1A9XB 3EA5A 1ZH0A 5DM0A 5FL7D 4MWBA 2F3PA 1JJIA 1UPBA 4JZ0A 2DBYA 4DRXB 3B3WA 2OFFA 4E5MA 1AUXA 1XU4A 3I2GA 3HEAA 1BDBA 3L4SO 3V80A 3G85A 4UA3A 4PX3A 3ZK8A 5I9MA 1G6OA 5AJWA 4RIGA 3HB7A 2SHKA 4XFJA 3RODA 2R11A 4S1VA 4DV0B 4Q9DA 1SH7A 4YCCA 3IA2A 4JHXA 3MELA 3CX6A 3S40A 5JPDA 3Q3JB 2QI9C 1RLIA 1PJLA 3AR4A 4YJGA 2X8WA 3WA6A 4CKCA 3WWZA 3DE3X 1JSCA 3H4VA 2OLEA 1PJCA 4KLWA 3WWOA 3ZV5A 3H84A 3PLNA 2X6RA 1UKAA 4RJJA 1HBJA 3VGPA 3G2PA 1R6UA 3AUXA 1MB9A 3EA0A 1WXEA 1UOQA 2AKEA 3GGJA 1J20A 2OORC 2JFXA 3ZS9A 1MB0A 3HCNA 1Z28A 4REQA 1ARMA 1YB5A 3MUEA 2COEA 2J5XA 2JDDA 2H3HA 4U7GA 3AZQA 1X8XA 1O87A 2HK6A 3GC6A 1VJRA 1E3JA 3NFRA 1GAQA 4M0FA 3CXQA 2VHXA 2IW3A 1MVOA 3C8HA 3T5CA 5EXTA 3S8YA 3S1LA 5F5LA 1H8EA 1Y1PA 4D6PA 3CG0A 4KVGA 2BLLA 1OVMA 2KBFA 4BS9A 2GS9A 1WSBA 3IIKA 3GLHA 4JP5A 2C6PA 2VDOB 2A9FA 3OM9A 5JDIA 3F4KA 3F6EX 1QQTA 2BONA 3I4CA 2ATEA 5EJMA 3CLUC 3D54D 3ZE6A 1IY1A 2IXBA 3NAQA 1R3NA 1C7FA 2ISSD 3A3YA 1BLLE 2HSJA 1OFHA 4ME6A 2JARA 2JEZA 5LRKA 1W0KA 3LC7O 1HE8B 1T9AA 2DPXA 1HLFA 1E7WA 4RM3A 4NMWA 1KTVA 2AFOA 1JAHA 4H7PA 4AY6A 3FTFA 1W5AA 2Q8PA 5DXJA 4E13A 1Y5NA 4TKLA 3DWFA 3T3HA 2XWJI 3GN2A 1BE8A 5K0LA 1I3LA 5JCOA 2OV2A 3NNSA 2AF4C 1JS1X 3IFEA 1DG9A 3ENZA 1GHTA 4DXDA 3VMMA 5AK4A 3NPAA 2IJGX 3GN1A 3K5HA 4BL5A 4P6VF 4TZ6A 2O7QA 4Y2HA 2VNJA 2PK3A 1F8FA 4OHXA 5F5XA 1V16A 1Z2LA 2ABZA 2P6FA 3RRMA 5JNTA 5JIBA 4M46A 4J4BA 1BFDA 5KHAA 5I9BA 4WK2B 1PX0A 1IN8A 5LBUA 1R12A 1X8LA 5FORA 5CLFA 4ETWA 1Z17A 1T9CA 3UV3A 4L8GA 4OFBA 5LZ5A 3LVBA 4GDMA 5IYZB 3HVIA 1KI6B 1VBNA 2SECE 4EGAA 1BXKA 1A5TA 3OTOB 1M2FA 4FU0A 4GXHA 4LRXA 2IS1A 5EEHA 3BWYA 1V5IA 2D5AA 4JEUA 2XTMA 5I7RA 3T9BA 4PONA 4P8RA 2YC4C 4MUBA 4AMGA 3QPAA 4DCVA 1R10A 4KOAA 3SR3A 1O94A 1V5GA 4Y6PA 3VOTA 3FFBA 4UEZA 1ZRNA 3OQIA 3BULA 1GGJA 4P4IA 2OD7A 4Y1EA 3RNZA 5A3RA 4X2TA 3BSYA 1ABFA 2POCA 3RAMA 2ZG6A 2O3TA 4BYGA 1U1GA 5ARCA 1GZ7A 5KOJB 4GS5A 1U5AA 5JMWA 1QG4A 3PGVA 3C1UA 1VFNA 1QHSA 1U0TA 4DLZA 1YU9A 3C7DB 1RLUA 3AGPA 5KU7A 2IHVA 1ZEJA 4KPYA 1ZVJA 2OAQ1 1HL3A 4INZA 3S81A 3IP1A 2VK4A 2RAFA 2P6UA 3HJHA 3DLHA 2OCAA 3A4YA 3WJ1A 3TAHA 3F6SA 2MMCA 4DA9A 1ISFA 1E6EA 4HQ0A 2IW1A 1FXWA 2IX3A 3EH2A 3G8DA 4P4NA 4CV1A 1FNCA 4R8KA 1JSLA 2Q5CA 4KN8A 3QI2A 3NW9A 3NYQA 1B26A 1GZSA 1OSNA 4PPFA 2Z95A 3EY9A 2BHRA 3HXQA 3H75A 2KCWA 1WY5A 1L5SA 4LJ7A 2AZ4A 1K7SN 3DV0B 1GGHA 2VHWA 4LWOA 1PWYE 1QG0A 3FLMA 4CFSA 4JC8A 3AGQA 2XUGA 3IA7A 3WA7A 3OU7A 2GPSA 1N5OX 4J4HA 1ONSA 2JBAB 1IQ0A 4M49A 2G77B 3RK1A 2Z58A 2FUG1 5JFGA 4O02B 3DEJA 3IQHX 2QTMA 1WM1A 2F9FA 2WE7A 1DHRA 1KY5A 2W2XA 2FKNA 1SOMA 1Z4QA 2Q0YA 3GFPA 4PYIA 1L5OA 2JI4A 1KMMA 2BOAA 3DP7A 2B2NA 2JLRA 2Y1EA 2HCRA 1EVKA 2JI6A 2IUSA 2P3LA 2NVBA 3IO1A 4AG9A 3D4PA 4C6HA 4IVPA 4IM7A 4D4JA 2Q99A 1ZOLA 4LNAA 2IQ6A 2NV2B 4JDPA 4RY9A 4L0MA 4IDPA 1QP4A 1DC3A 1TJNA 3QYAA 3N5KA 3AB3A 4D9MA 3SBOA 2DTDA 5B1EA 4Y6QA 2QYSA 2Z04A 3CX4A 4JI8B 1ENZA 1Z83A 3OJ0A 4GR5A 4HPXB 1Z8XA 4GC5A 3NAGA 3BFXA 4P0QB 1C0IA 4HYQA 3BIJA 5J2TB 2UZIR 1FFSA 1O0BA 4MRIA 2X9GA 3A4MA 3UK1A 1N36B 3NANA 2FPPB 5IARA 1YA6A 4Z3OA 4BGUA 3IJPA 4PXYA 2YIMA 2QYVA 2PZKA 4BB0A 3VKVA 1VJ0A 2FJ0A 1C9KA 1EJ6A 2CL6X 4CLHA 1XXHA 1AQJA 2JAUA 3WS7A 3KZNA 3I23A 1FDRA 3WDKA 1PWZA 1CF9A 4AF6A 4DJAA 4G0PA 1N1MA 4AJOA 4R2KA 2FSGA 4CCAA 2Y1OA 4TLDA 1X87A 2B4YA 2RB4A 3O7WA 5E9JA 5TE9A 3S2FA 4HDQB 1SURA 2ASVA 3HL0A 1B87A 1OZAA 1N1EA 2ZR8A 1EGVB 4RSHA 4HBGA 2BFDB 3ESAA 1X7WA 1VKHA 5TMPA 1A7AA 8ATCA 3IBSA 4QM7A 4N6OA 1O96A 4J0HA 4FS3A 4Q0MA 2QMZA 4ZP1A 1ZN9A 3E53A 4MHSA 1XMXA 1BS9A 1TYBE 2YNEA 4R6TA 3B3FA 3L0OA 5DTMA 1Z18A 1P5RA 1KYWA 3JR7A 3OZSA 4PCUA 1X42A 1U3FA 3GJZA 3PGJA 2AWNA 2WT8A 4ND3A 2H52A 3HB9A 3IB3A 4RYLA 5L6MB 4KDEA 4Y98A 3K4HA 2QTRA 2Q07A 3ABIA 3BXGA 2I4LA 1K4MA 1QSOA 5EG5A 1CXZA 4JLKA 5KVSA 5LQMA 4BNDA 4OC5A 5GINE 2WC1A 4L75A 4H7DA 5BVGB 3OOEA 4OHYA 2G5CA 2WHXA 3NDJA 4N41A 1Y6RA 4QTXA 6Q21A 4D46A 4XLZA 5LUBA 4ES6A 1M6WA 1M1YA 4CUKA 3LMSA 4ZJUA 1UFQA 2J41A 4NBLA 1SIWA 1T8UA 4XUDA 2HSGA 5G3YA 3RRBA 3TNLA 4D9IA 4ZAYA 4ONEA 3Q8MA 1O4VA 1MTZA 1OXSC 2JKZA 1XDBA 1LDGA 3UB3A 2FW6A 1PT5A 3VYWA 2FK8A 3RIGA 2EHJA 4IL5A 3WC6A 3SQOA 2AG5A 1ZAKA 1DLJA 2OO7A 3IV6A 1NQTA 2WJIA 1LCPA 3SFVA 5DWQA 1I0LA 1FS5A 1Y5RA 2NACA 4PC2A 2NTYC 2FFHA 4EEXA 3U44A 4MCHA 1Q0SA 2I34A 5HVHA 3NMUF 4F9EA 4CMBA 4YPVA 3P0RA 4Y7CA 3BH6A 5CXUA 5AIAA 4P54A 2PMEA 3EQ8A 3NE7A 5JS2A 5FQNA 1BMTA 2FF7A 4CTKA 3GRVA 4X20B 2O2HA 1US8A 3KYDA 4AY2A 1FFBA 2Q8NA 4MIEA 5FTNA 1SG6A 4NGQA 2G9VA 3RUEA 4EYSA 4M8LA 2G7ZA 4PCLA 4GI5A 1L6RA 1LTKA 1RPZA 3Q1KA 2X5JO 3RJTA 4ZYYA 3E8XA 4FWTA 2QTVB 2HK9A 3EJ6A 3ENKA 5F3RA 4KR3A 4OX9B 2XJ9A 1WLSA 4EPYA 1OVGA 2HBRA 1OGJA 2V4MA 1VIMA 3D02A 3NFYA 3PRJA 4K3NA 2X6QA 2IP1A 1Z26A 3FTQA 3TE7A 1D1TA 2X8AA 5GGYA 1V1JA 1DIRA 4YV0A 1GUYA 2GZ2A 5TMBA 4F91B 3L7KA 1OLUA 4YAJA 1T0JB 1IU9A 4TYMA 3NDRA 5LQDA 3HKDB 4JEMA 3WYAA 2REFA 2DUWA 4W7SA 3IQFA 1X8KA 1LK7A 3BWDD 4OQYA 5H5JA 4X3CA 2GJKA 1VLVA 5AXAA 5KNBH 4QXPA 1MDFA 1IB1E 2BCEA 3AUYA 1LPNA 4RTNA 2FP4B 3GLHE 1NY6A 3ANXA 2OBXA 5CNKA 5K8MA 5CB4B 1XKQA 4C2BA 2VH1A 3IEVA 1Y4SA 4DTIA 2DLNA 1QSTA 3TSAA 4FD3A 3CWCA 1AXRA 3VH4A 3PC2A 2BTEA 4I1SA 1KWKA 1U80A 1MJHA 2GN6A 4M8KA 2GO7A 2W6QA 4P3KA 1XZPA 1GFSA 3PVSA 4NGRA 4R6XA 3MA0A 4QQRA 1RQLA 1XCOA 2ZVJA 4MKGA 1ECGA 2IOFA 4JB3A 3W4JA 3E5RA 1TQDA 4ENPA 3KKLA 2ACKA 1WHSB 3V1YA 3VFDA 1SCBA 1ZAYA 4RKRA 1TD9A 4PHCA 2I6FA 4EKYA 4RWEA 4OYYA 1DBIA 4FMDB 3E9QA 2RGRA 3SBXA 5DBHX 3OE1A 3Q9SA 4PO8A 3OURA 3EFOB 1TRHA 4UEKA 3UTCA 1TGVA 4JT4A 4R1SA 3G79A 2FPSA 3D4BA 3W34A 4Q36A 5HGJA 3T3EA 5JAQA 2R4TA 4ASUA 3N75A 4HG2A 2OO5C 5BN1A 2LCFA 3MTAA 4PGAA 1JDZA 2J3KA 1P6XA 1FU8A 4WCFA 4R16A 2LR0A 4TWEA 1E3EA 2CJWA 1K7CA 4JOCA 4GLJA 3WHLA 5L3SA 4PYLA 3TMAA 3L7IA 2AYYA 2JA2A 4IUCS 2AI1A 4GP7A 4M0EA 4CAFA 5A4KA 4OHFA 5LNK6 4XWOA 2PSJA 4G3XA 1HT3A 1SOUA 4HAZA 3EEFA 1GDHA 3PXGA 2A0XA 1JT2A 1L5LA 4UDOA 3P9KA 4MQLA 3TS1A 2AXEA 3QQ5A 3ZCPA 1CS0A 4ARBA 1O6FA 2NNWB 3LPNA 4J8PA 1NBEA 1QYCA 1EESA 1WXIA 2QIRA 4H6UA 4EG7A 4GYWA 1R5BA 3HBMA 4IJWA 1XD2B 1AHIA 1QIKA 3LXMA 4JN6B 4ESEA 1JFVA 4BB6A 5JZOA 4D3XA 2W6MA 3QKSB 2QENA 1JHYA 4UXHA 1SXHA 2NTJA 4IHJA 1CS4C 1RQRA 4Y2VA 4R3UC 1N78A 2XOKA 2NU9A 3N3AC 1E9SA 3FI9A 1L5VA 3T95A 2VJKA 3MJFA 4QKQA 3W2GA 4RETA 5C3UA 4WQMA 2Q21A 4ETNA 4KVAA 3NPMA 3QJ5A 4DA7A 2B37A 1VHDA 4QU0A 4ISBA 3VR6H 4YFJA 2FR8A 2PEYA 5HRUA 3WDLA 2AUNA 4M1EA 2ZBUA 1ICEA 1NJ6A 1X6VA 1CY6A 1EFRD 5IJAA 4EBBA 1UMCA 3TDKA 2O2EA 2Q3BA 3KHTA 3M89A 4L02A 2ZU6A 2RHDA 2CXSA 1FVFA 2I71A 5TSDA 3G2QA 2AE2A 2RH8A 3AI1A 4LHXA 5SZIA 4GOKA 1YS4A 2ZR7A 1NV8A 3N7TA 4RF4A 4YU9A 3AHCA 3Q5GA 1K5PA 3ZVRA 3DW3X 4CZ2A 3L40A 4U9IS 3ELUA 3WHPA 2ZM5A 4MI4A 1XJOA 3W1WA 4BE9A 2QA5A 5F9FA 1DCFA 1CNEA 4KAXA 5JH7A 3WBBA 5I7WA 1V9SA 4INOA 3KPUA 3MAGA 1JAYA 3S9LA 2TYSB 2X8JB 1E79A 3ZHQA 3MPUA 2V6IA 4JYMA 2I22A 4LOHA 5KNLA 2CD7A 5AUNB 3RYCA 3BMCA 4RH3A 1FYXA 4TQUS 1KQGA 3OZAA 4K9PA 1JR6A 3TAUA 4W9NA 4MI6A 4P4BA 2V03A 1RWKA 2PX5A 4WZBB 4H1TA 4N5IX 4R1NA 1NSYA 4H16A 3N5FA 1XQVA 1EJBA 1DJOA 3VR4H 3HWX1 5JBIA 1GL9B 5J1SB 4HKTA 2UVQA 1EQ2A 4KZKA 3QI7A 4KW7A 1I33A 1XLTA 3SZUA 3BC1A 4FPXA 4ODIA 1XZHA 2PQ6A 3MCWA 1W0JD 2PRIA 5B3AA 2I9KA 1ZISA 4ZT6A 4LZPA 4UCWA 4ORFA 3ZX5A 4PV7A 3RTBA 1LQUA 1KERA 1JJFA 1MW8X 4RWZA 1PUAA 16PKA 3FKSD 3D5EA 1CTQA 3O4IA 1BEUB 2Z56A 4F2DA 5B53A 1M1NB 1XXHE 4ZDWA 1ZP6A 2VWGA 5B7QA 2QXTA 3DGEC 4OI2A 1DG1G 3U7JA 1YZKA 4BEBA 5JOQA 3HL4A 3EVBA 1MXFA 4H7IA 5EZQA 4RJLA 2H57A 1QB7A 4QPCA 1G3IA 1N3YA 1JR2A 1XPUA 2H9YA 3HFJA 4ZV7A 1TCCA 3E7WA 3LIIA 3K53A 3LDHA 4MUGA 4C0AC 4JROA 2WSSA 4PV6A 2ZRBA 1WX1A 1GKLA 3EVFA 2XIQA 3H1PA 2NO6A 5D85A 3D2LA 4EG4A 1VBKA 2IF0A 4E2ZA 2BHSA 3L8HA 1WHTB 1A72A 2AG0A 3LGXA 3MC1A 3AERB 4JFRA 5JSFA 3LX4A 2C2HA 2Z83A 4ER0A 3FWZA 3D0OA 4ZCPA 2O8NA 4PNPA 1XTVA 3ZY6A 3BM5A 3M6VA 3PDIA 1DDIA 3VPCA 3M70A 1I3OA 2WHQA 3D31A 3CLHA 4RIHA 3D68A 3AEKA 3MIIA 1SQ6A 3OE7D 1E0SA 4QUAA 4TTIA 1K0FA 2C7GA 5NLLA 2Z9DA 1R0ZA 1VYUA 2Q7BA 3L7CA 1FVOA 2HMAA 1KL7A 3C5VA 1R4NA 4PYKA 4P0TA 1DEHA 4R6WA 3ZCRA 3OFKA 4L16A 2ZPAA 2ZP1A 4RK6A 4FHCA 4X8IA 3RNLA 4URWR 4GPBA 1Y7EA 3R8CA 1NQVA 2HLHA 1YRQA 1M5TA 2FUG6 3OE4A 3IVCA 5DNUA 2X7BA 4FOPA 1VE3A 1CR4A 1PP4A 3OZTA 2FPIA 5ICEA 2ZUEA 1IG3A 1YJQA 3BBPA 2PKWA 2PS9A 3WHKA 1NWCA 1VKJA 1DZIA 3P9ZA 1Y7LA 2E48A 4KDFA 4CR6A 3MG9A 4WV3A 4N0MA 5JAOA 1RWVA 2C2YA 4B32A 5DXAA 2BFCA 1V1RA 3BZBA 1II9A 4HO1X 5DHUA 4HDOB 1B1AA 3WL4A 1HSOA 4UOEA 1CDOA 5JCXA 3WLAA 3K32A 1EP9A 3I9JA 4IF5A 2BFEB 2XRYA 1J7KA 1P2VA 3R40A 4JVOA 4Q4AA 3RC9A 2HF9A 4BZQA 1Z5VA 4KXWA 4Q3DA 4J29A 4B2PA 3VR5H 1KORA 5ARBA 2G70A 4NEHB 5EP4A 4MKRA 3GGOA 2ZJ6A 3GP5A 4X85A 3AFHA 5AK5A 4TMZA 1DJLA 2D1TA 1N2XA 4YXWA 3H8GA 4YUXA 4H08A 4PN7A 4YECA 4ZI3A 2Q4OA 4QJBA 4WNAB 1SBTA 3UIEA 3W9UA 1KDOA 2QTZA 1NUAA 3W2IA 3WP0A 3IT0A 2NZ2A 3FR7A 2ZTSA 2GBLC 1T5LA 4URZR 2NVOA 2XMRA 3RVBA 4KZPA 2Z3MA 4Q9KA 1HRKA 1REQB 2XUPA 4WN9B 2PAAA 2Z5FA 3IPRA 1CF2O 3M2PA 1KO1A 1WMEA 4QJ3A 3NTLA 3RVLA 1Q1BA 1PV4A 1G291 1UBGA 4BX0A 3SWWA 4M7PA 4KE9A 4J3FA 3EODA 3SF8B 1XF8A 2Z2IA 4K9LA 3HJRA 3R6LA 2V3WA 2O0MA 1XMQB 5JQGA 2CVQA 1Z0SA 1A76A 3T5BA 1SBNE 2UKDA 2GVNA 4BNNA 2ZWOA 4KQIA 1AKTA 3BRQA 2DJ5A 5HMLA 3JQ8B 2ZKIA 3MJHA 2O1XA 3ABOB 2R1IA 5JY1A 1ZCAA 5CVCA 4IBOA 4I3FA 2WF9A 2H4XA 1W46A 1RWPA 3VZQA 1NYRA 2G0TA 1ILWA 5BRNA 3FHCB 3LSTA 1JWLA 3CT6A 2OPHA 1G21A 1OWMA 4D8WA 1RZ3A 4W5HA 4KBGA 4AJ2A 1I9GA 3PSHA 1PGJA 3JASA 5HM6A 1E89A 1FP1D 4JQYA 1WXGA 3B52X 1YOBA 5AICA 1ENOA 4TWZA 3IUNA 2IZZA 4C88A 1Q20A 1J25A 1UKVY 5K0TA 2I3CA 3EG5A 5AQEA 4JJ6A 2W93A 1ZCFA 3D3JA 1H4SA 1EZ1A 1ZDMA 2XZTA 4YMHA 4GU5A 4QX6A 2FDRA 3FGNA 4IV8A 4E5UA 4MFPA 2VPZA 2ZTMA 4BJ3A 4HLUC 1DL5A 1RCFA 1QSNA 3TH5A 5FRDA 1MQSA 3JVDA 4AM8A 1DAIA 1LZLA 4Z5XA 1WPRA 4YWJA 1M73E 3O1HB 1SHTX 1XZKA 4QLOA 2NYAA 2H2WA 4QEZA 4MFQA 3WLJA 2A7XA 1A3CA 2YJZA 3KUXA 2Y6UA 4O4IB 1KZYC 2X4LA 3OECA 2HHCA 3AB7A 2A5DA 2XB9A 2PC1A 3WSWA 3F47A 3GFVA 4LY3A 5CFNA 3AVWA 3KELA 1DOAA 1W73A 5DNEA 2WVJA 5EZ5A 3RFFA 1E4VA 4DV2B 4DLWA 1TQ8A 3GMDA 4TKZA 2W4QA 2JKVA 3E23A 4MRMB 2Q9BA 3QBDA 5P21A 1JLSA 4AG6A 1UC9A 3TLJA 4PU0A 2XUQA 3A6DA 4Y18A 1XVIA 4RYDA 1RTQA 5IKEA 1YI1A 1WWKA 2J9YB 4LQ6A 2B4QA 1OH7A 3QX3A 1RHMA 2CE7A 4JI5B 4E5NA 3EZ6A 5C3MA 2RK4A 3V8QA 5G0TA 4PR3A 4QODA 1F7UA 1PJ3A 2K2QB 4KQFA 3RBAA 1Y9DA 4U7PB 2QAGA 1NVXQ 3WBFA 2CXOA 3KR1A 5FNVF 1OLXB 4PK3A 4FGSA 4QBIA 1Z5NA 3ED5A 2WD9A 3G0OA 4X92A 4E1BA 1GILA 2RB5A 3WABA 2QUHA 3AXTA 4QBGB 4Y0AA 2P27A 5IAAA 1IUPA 4BE7B 1N8KA 3PVZA 4Y9TA 5FWXA 1TD1A 3AF0A 1JV2B 5J2TF 5F47A 1Z5PA 1Y7IA 4W5RA 4P83A 3SXJA 1AKYA 3A4VA 3EVCA 5JNRA 2Z3LA 2CJFA 4BIMA 1G6HA 1ZN2A 2X9NA 4RDXA 4ITRC 3ZJVA 4TLMB 3ROTA 2O7VA 4U2GA 4LMBA 4V02A 4DFDA 5IC4A 5IKMA 2QUJA 4FQ5A 1GKYA 1LDEA 3CVXA 4HTFA 1JECA 2CEAA 2W8BB 1T1IA 1O95D 1I4DD 4EY6A 2QHXA 1GPMA 4EGQA 3KYCB 4KQ2A 4DG5A 4F4IA 3PCXA 2JPDA 5JW6A 2JGKA 2XZOA 1KY3A 5DHTA 1T3LA 4DNXA 1AVTA 5FBZA 1JN0A 5HM8A 3NR2A 4M7WA 4R8RA 3H5AA 1Q6ZA 1YDEA 2NOAA 3K2EA 4C0BA 4X65B 5FLEX 3OY2A 3ZBUA 1PT9A 2OBFA 3OPQA 3JQAB 1TX4B 1OI2A 2HQ1A 3REOA 5H84A 1I6MA 4QYXA 4CCSA 2IH4A 1WCV1 1W4BA 1EFCA 5FBWB 4DR7B 4ONWA 2BGTA 4DMHA 2B1RA 1X80A 4PC3A 1U3CA 3CYFA 3C6MA 1Z2PX 3CPHA 4XLLA 3H5IA 3DLBA 4EAQA 1TFUA 1EB8A 4YRIA 2GEFA 4KR9A 2EG5A 1K06A 1VTKA 1Z4PX 1P73A 2OGZA 5E6UB 5K0FA 1OXMA 3HB5X 1B2LA 2Y1GA 4XSHA 4NSQA 1DC7A 1V95A 2PUWA 3HP7A 2NU6B 1GPKA 4DDUA 2QJRA 4ZXFA 3FNBA 1K6MA 4RFLA 1P0QA 3F78A 1QHNA 1YE8A 1B76A 4Y2QA 3QEAZ 4X1YB 1G5TA 1MC4A 1Y8CA 3AIOA 2F00A 3MWEA 5L40A 3KB8A 1QPBA 2FHSA 3KYIB 1RMYA 4ZQBA 5EKDA 2OBLA 4DM4A 2ODQA 3ESXA 2IL4A 4R1TA 3AYZB 2Z8YA 1IICA 5F33A 4OXYA 1W2GA 2XMQA 4RU1A 4L73A 4XGIA 2PNJA 1D0SA 4S0ZA 1KXZA 1ZJ5A 2PA3A 3JD2A 3RSZA 3QXXA 4JXQA 1M4IA 4TTPA 2FXIA 5C82A 4C0XA 3NRBA 5EOVA 4RTJA 3H2YA 4JKYA 1PL7A 4CAXA 5JJBA 5CD9A 3GUVA 3DR8A 1PGNA 2DPMA 4Q7AA 4W6ZA 4PGFA 4P81A 3N39C 2VP0A 1PN3A 2EQAA 2PR2A 3ZZMA 5K8VA 1SN7A 2X15A 1H1LB 1BFKA 5HKKA 2YHUA 3G23A 1GUBA 1HDUA 1IY2A 5G4LA 2DKOA 1Z12A 2PS0A 4F6AA 2AOUB 2QW0X 3IP9A 3BJ7A 1CJKC 3VYSB 4DGSA 5FWYB 1JQJC 3FBUA 4A2WA 3P27A 4MHZA 1KSFX 1EIWA 1W88A 2YXPX 2IGBA 2WF5A 2HM7A 2M1XA 2BMJA 2J5KA 3B60A 1C30B 4H4EA 2IEDA 2MYNA 2HWXA 2HZBA 5EJEA 2FF5A 4MR9B 5G41A 2FEWB 1L7MA 2PT7A 2Y27A 4KFUA 1TEXA 3Q3GE 1NRWA 4TMFA 2P5SA 3NHWA 5A9RA 2I78A 2X5XA 2G0AA 3J81k 4EGFA 1X3SA 2BSXA 3SLRA 3KSBC 1NDHA 1FMFA 4M7OA 5AKEA 7REQA 4LC9A 1UJ5A 1IM5A 4A6EA 1RM3A 4Z6KA 3DBLA 1A1VA 4NQRA 2Y1CA 2FZVA 4KPUA 4ALLA 1MIOB 5JJIA 2GETA 3NM5A 1YZHA 4NXYA 1QTRA 2VSXA 2FMXA 1LWOA 1EVJA 3FJYA 3NP7A 1Z29A 4L9SA 5JFOA 2OHGA 5F4ZA 3H11B 2B30A 4XWAA 4Q4JA 3G5UA 3K2QA 4BNWA 3BMOB 1UMBA 2C57A 3MN8A 1YIAA 1XWFA 4PYMA 5CB4F 3L8MA 4Z53A 2RGNC 3OLYA 1OFUX 4OAQA 3UEOA 4MHDA 4KUAA 3IDFA 4G6ZA 4LJKA 3COWA 1G2QA 1Z5OA 5K6TA 1Y4AE 1DUVG 2O3UA 1VL5A 1PV2A 1NP3A 4ADSG 2JFWA 4KQCA 5EXXA 1L7OA 3IVGA 4BC0A 1Z8LA 4XGKA 3PXAA 1RXTA 3AETA 2D8AA 4J0DA 3D6TB 1E0AA 3EG9A 2RAUA 2O5VA 2XQKA 4JJ7A 1M2JA 5ALDA 4Q00A 1UJ4A 3Q3EA 4EVQA 2AVDA 4B10A 2HT6A 4FMDF 3CCCA 4DIKA 2FR1A 3FUVA 1N2EA 1L4UA 2R62A 3W5SA 1YZTA 3UYLA 2Z4RA 4NL4H 1PT6A 3IDAA 1NUPA 1FLDA 1TK2A 4RDIA 3NYIA 1YKSA 4N7MA 1QS0A 5MGBA 3S8EA 4M0DA 5BWCA 1QH9A 4J49A 3LBAA 2VYFA 2OD2A 2JD1A 2CLSA 1VKZA 2J6IA 2KI5A 2J0EA 3TK1A 1LJUA 3S1AB 3WGVA 2I6SA 3AVTA 3FDZA 2XODA 1M1ZA 1ZWKA 2FWIA 1R9NA 3TVDA 4YVFA 2XMZA 1I4LD 4YNBA 4EB3A 2VAWA 1CQIA 6CHYA 3F9IA 4IY1A 3QKRB 3P5BA 4D9KA 1XWWA 5K3BA 2ZULA 1BE6A 3AESA 4TTAA 2WUUA 4DWWA 3N6XA 1E8MA 2DHQA 4MCPA 3S2IA 2Z5GA 1E9AA 4I1RA 3O1LA 3FGOA 4UMFA 3MXTA 2X1HA 3C45A 4HPSA 1U1FA 4AXBA 3FFTA 2A9QA 2VWHA 1QOQB 3K30A 2ZJ7A 3ZWDA 3I28A 3FNCA 4Z86A 5HQ3B 3WICA 4JHLA 3W1VA 3MT7A 2W2KB 3ONVA 4LDJA 4IZOA 5IV0A 2C1XA 4UNPA 1EWTA 3CPSA 1AU9A 4QBTA 4NJEB 1I1HA 2YFYA 4OK5A 4WESA 1LLQA 5D29A 2BFPA 3FFWA 3T94A 1WDLA 4ISCA 1PGOA 3I1YA 1V8DA 2FR0A 2JFNA 3CLUD 1U0LA 4XQ0A 1E1CB 4K9KA 1J0AA 4UM7A 4ZD6A 5G0UA 2EBHX 4GKBA 1KEWA 2Z6VA 3TSZA 5REQB 3QLVC 1NQOA 1G21E 4R9MA 2PG3A 3B6JA 3ORHA 2YIDA 1B74A 4DMMA 4C7OA 2LDXA 2CFOA 2C78A 3BGOS 2VOEA 4DLTA 3HCFA 4HQRA 1MX1A 4PBRA 2ECKA 3H4QA 3VNBA 721PA 4B75A 2VZ8A 4OGKA 4K8OA 1SD1A 3NXSA 1X8JA 4BO6A 4R71A 1QRRA 5TVGA 1OXVA 3FAZA 5CURA 1SPXA 3GLFB 1GIAA 1N6PA 2QROA 2RARA 1AUGA 4HEHA 4R7TA 3DYBA 2CVPA 4E3ZA 4HGPA 2EK8A 2F1KA 3C5WP 2YV1A 2YMLA 1UM9A 4NATA 3OCZA 4A82A 2FMTA 4PWZA 5C32A 4XD2A 2PFKA 1DAEA 2PXXA 4J9UE 4JJIA 5ESRA 2BKLA 5BXYA 1NRXA 2HADA 3A2LA 4AJ1A 2YKGA 2QVPA 1P5FA 4JP1A 1U2GC 4YAEA 3S6HA 2P4HX 3WK7A 4O4HF 1WUJS 5TV2A 1E7RA 3K2IA 1NBHA 4ZYLA 4KLNA 2AJCA 2WTEA 1STOA 3JQPA 1U2ZA 5B36A 2X22A 4IMPA 2HU2A 2O2YA 4B09A 4B2LA 1TAUA 3JQAD 1A5BB 2WNHA 2GJ4A 2R7LA 5KOHA 5CJJA 1RYDA 4A0RA 3PHJA 1N8TA 3GJ5A 3ZWYA 4RCZA 5IJ9A 5L7YA 2J30A 4DILA 4OAEA 4NYIR 1O8CA 4QSHA 5BQOA 2B5WA 1OX5A 4G67A 4XYMA 2AMJA 2PN1A 2EIHA 4OBEA 1KMCA 4I0WB 4WKCA 1QTIA 4DCMA 2IIBA 4GZ3A 3WC7A 4D9HA 3T0IA 3PNVA 3IBGA 1HV8A 2WAXA 3FVWA 3P9PA 1JQEA 2PQ0A 1J5PA 2FEXA 1IU8A 2XB4A 2PKYX 3DAYA 1VLZA 3TOBA 3W6UA 3K0HA 4HQ6A 2Z1DA 4UFVA 3FTEA 3L1VA 1R8QA 3VKFA 3C6YA 2AOTB 4M22A 3EIFA 3DDHA 4GOJA 1XZIA 1XOIA 1Y8RA 3WE7A 4NDAA 4IIJA 4CFZA 3MWGA 4DPMA 1SG0A 2R44A 3FOFC 5CFOA 4U0KA 1QB8A 5KNBA 3R9IA 4JNCA 2BSAA 2OV4A 5LYDA 3VKGA 5EWLB 3R3XA 5H9WA 2J31A 2JW5A 3ZOKA 1WZ2A 2JCYA 2JAQA 2VAPA 1G0OA 5BV7A 1N4AA 1E9DA 3IE0A 4TWIA 4R2JA 5JYEA 1B6TA 1O0CA 2VYVA 2BFMA 1G5IA 2D2IA 2PO5A 1DINA 5H81A 1FQOA 4B14A 4Q7JB 5DB4A 1QZZA 1UT5A 1HTBA 4CF3A 1J4JA 3MBIA 5AM3A 1EXVA 4NLLA 5DT2A 3NORA 1W36B 4MB6A 2E37A 4KOVA 4CYNA 2X9QA 4F72A 4AN1A 3CZRA 1QHHA 6CPAA 5YASA 3W4IA 3JAKB 5D84A 2G83A 3A1VA 4PG6A 4WOPA 4L27A 4CKBA 4DIMA 1M8KA 4J3GA 1N2JA 3PVCA 4BB5A 5TS2A 1XFOA 3L7AA 5D3ZA 1Z15A 3H8EA 4Z7NB 4L9RA 3H5RA 4FKZA 3COZA 4IXDA 2DEUA 3HPQA 2SICE 4YFVA 4B4VA 2F6RA 5B55A 3H9UA 1L7BA 2QX4A 4OXKA 4FR0A 3LHDA 4YHBA 3U4DA 1B4DA 1DMSA 4B3SB 3R3YA 2VHVA 3THXA 1AK1A 8ADHA 1RD4A 4AJLA 1LNQA 4LQCA 5EXDA 4YCBA 3FPKA 2J0SA 3KBOA 4OB6A 4TYNA 4LWZA 4IDBA 2CCKA 2A5FA 4M54A 1R4MA 4MEJA 3M33A 3NH5A 2VXCA 2WILA 5FNVB 1XTRA 3N2GB 1YSCA 4UASA 4CM6A 2VTVA 3GUXA 3TFWA 1Y3FE 3C3KA 4ZOLF 4IRXA 2V77A 3QVOA 3I2FA 1INLA 3FRIA 5KU1A 1VXRA 5EERA 1CUHA 1P1IA 3HNOA 2AJ6A 2Q1XA 3P7MA 2JIZA 3KPVA 4NK5A 1EUYA 3G5MA 1AK2A 4EY5A 3WJ7A 1UXIA 1CPSA 5CFZA 4EFNA 2V0GA 3QV1A 2ZK7A 2DP4E 5CW2A 5HOEA 1IAQA 4C0WA 1D4OA 2XB8A 4PSAA 3R6WA 1ORIA 3FYNA 1JXOA 3K9BA 5HPYB 2ORWA 3LQYA 2PKQP 3CKYA 3VPGA 1ZVVA 2E55A 2HEIA 2YV2A 2ZCUA 3F6PA 2WT9A 4QREA 4PSUA 1NMXA 1U9ZA 3WV5A 1YDMA 4NAUA 5TIIA 3EF0A 1LGYA 2R0QC 5ERGB 4M87A 3T3GA 1PG0A 1M67A 2HNKA 1C4WA 1E99A 4W9MC 3A4TA 2YWEA 4KQKA 1AMUA 3KQXA 3MM4A 3DTNA 4P7JA 3IQGX 4GSYA 2C5LA 3SQNA 3KRTA 3UWDA 3NTOA 1T6YA 3PEUA 5JI2E 2VJOA 1OLSA 1Z6TA 4FDMA 2YOFA 2VHYA 3LKZA 1F6DA 1QAOA 4JYPA 3I04M 1N2GA 4DLAA 5DIFA 2GN4A 1QC5B 1XU7A 4PXEA 2A88A 2VUUA 1K6EA 3NU1A 1XZBA 1FJXA 4OJKA 4CKXA 5HX7A 1WZNA 3S2EA 1LPMA 3OZWA 4LVUA 1AE1A 1NW6A 1Z5WA 2J8ZA 1VMIA 3NTUA 2O8DB 1Z2DA 2XKKA 3RC7A 4N8DA 3OVMA 1BHQ1 5HIJA 3DMHA 4RXUA 4G1EB 1SIOA 1YS6A 4W1PA 4X8OA 4YQFA 3R5HA 3WLFA 2QV0A 1F8UA 4A6DA 2QVLA 4PM4A 3EDQA 4FZVA 3REFA 4ZMSA 2VH5R 1BQ3A 1FP6A 2Q7DA 4X9XA 1UC4B 4AC9A 4TT3A 2D1QA 5FA8A 3QEKA 2GRJA 4PLVA 1NSTA 1Y4UA 1LFWA 2NO5A 1D7OA 3MEQA 3R7AA 1RRGA 2PSDA 1YIOA 3C6QA 1GQ2A 5DF1A 4DJ5X 3GNSA 2I1LA 4I4CA 3LXXA 1UK8A 3QIVA 4QGBA 4A27A 1FY7A 3SMVA 1QVAA 4RJ2A 1H8HA 1CC1S 4TKVA 4UJ5A 5F2EA 2I1VB 3VR4A 5C5EA 1YASA 4RVSA 2C3YA 4XGRA 2OC4A 3A0RB 2I2XB 4B6GA 3AY0A 2CLOB 4BVJA 1NAIA 3RS3A 1KI7A 2Q41A 4RFSB 4QG7A 2V7XA 2XNHA 2IXAA 2E18A 1GCIA 4WX2B 5DMXA 4LYAA 4D97A 3H5LA 2DSNA 1KHHA 3PFKA 4O4IF 3ICPA 2PJ8A 4HAOA