2HB6A

Structure of caenorhabditis elegans leucine aminopeptidase (lap1)
Total Genus 174
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
174
sequence length
489
structure length
489
Chain Sequence
TQVLVRNGIQAVGDGLTSLIIVGKKSVLKNVTFEGKFKEVAQKFVTDGDSWNSMISRIPASGRHPLHYELAHLITVPDASSRGNTPTNAHSIYKELKPINYPEDTKNVHFVLFAEYPDVLSHVAAIARTFCKFSMKTSGIRELNVNIDVVCDKLTNEDAVFLTDLSESVRETARLIDTPANILTTDALVDEAVKVGNATGSKITVIRGEELLKAGFGGIYHVGKAGPTPPAFVVLSHEVPGSTEHIALVGKGVVYDTGGLQIKTKTGMPNMKRDMGGAAGMLEAYSALVKHGFSQTLHACLCIVENNVSPIANKPDDIIKMLSGKTVEINNTDAEGRLILADGVFYAKETLKATTIFDMATLTGAQAWLSGRLHGAAMTNDEQLENEIIKAGKASGDLVAPMLFAPDLFFGDLKSSIADMKNSNLGKMDGPPSAVAGLLIGAHIGFGEGLRWLHLDIAAPAEVGDRGTGYGPALFSTLLGKYTSVPMLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal Structure of Caenorhabditis Elegans Leucine Aminopeptidase
rcsb
source organism Caenorhabditis elegans
molecule tags Hydrolase
molecule keywords Leucine aminopeptidase 1
total genus 174
structure length 489
sequence length 489
chains with identical sequence B
ec nomenclature ec 3.4.11.1: Leucyl aminopeptidase.
pdb deposition date 2006-06-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00883 Peptidase_M17 Cytosol aminopeptidase family, catalytic domain
A PF18295 Pdase_M17_N2 M17 aminopeptidase N-terminal domain 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10590 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Zn-dependent exopeptidases 2hb6A01
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 2hb6A02
3IWWA 5ELYA 1CPSA 4NJRA 1YW6A 4MMOA 3NH5A 3PBBA 4FWUA 5LYFA 2C1CA 3B3VA 3H8GA 3SJGA 1YLOA 4MCRA 3SJXA 4IK2A 5HVGA 1TKFA 1HEEA 2EK8A 2NYQA 5LRJA 3D67A 4OKOA 3FEEA 4YWYA 1BAVA 3ISZA 4P4BA 4IHMA 3S9LA 3RAMA 4O23A 4LQGA 2DEAA 4MXUA 4P6YA 4NFRA 2JBJA 6CPAA 3NH4A 4MHZA 2AFMA 4EFDA 1F2PA 3SI2A 1IY7A 1CX8A 4UEFA 2CTCA 3FX6A 2ZEOA 3JRUA 4NGTA 4ONWA 5K8MA 4F8ZA 5F09A 1GYTA 4BD9A 3KI9A 4UEEA 2V8DA 3KQXA 2J9AA 1ARMA 3RBUA 2Q51A 2JEWA 2V8HA 5HXDA 3SI1A 2ANPA 3KHXA 3CPXA 4FAIA 4JZ0A 3S9MA 3WC7A 1QQ9A 4R6TA 1TKHA 3B2YA 4NGQA 1LOKA 4F9UA 2ZOFA 1LAPA 4OC4A 1HDUA 3FEDA 4NJQA 1KWMA 4TWEA 2F8HA 1R3NA 3KASA 3S9NA 2IJZA 4K3NA 1Z5RA 1BLLE 3CDXA 4WWVA 3BI1A 3K2KA 1Y7EA 5HVFA 3HUVA 3VH9A 4A37A 2ZENA 1CP7A 3FJUA 4OC0A 4OIDA 4OP4A 1Y0YA 1BPMA 4NGMA 3N5FA 3BI0A 3PB4X 2ZEGA 5D8NA 4ZY0A 5IB9A 4FUUA 4OC5A 3H8EA 4OMEA 4PXDA 4P4DA 2AFWA 3PB8X 4NGPA 3TC8A 4CPAA 4NGRA 4P10A 1ZG9A 3IEHA 4A38A 2PIZA 4ZY2A 2C6GA 4DYOA 5I4MA 1CPXA 2PJ8A 2QJ8A 1M4LA 2ZELA 4OIWA 5CBMA 2PJBA 4MHPA 2O53A 4AXVA 4WJBA 2XEJA 3KR4A 2AFUA 4GM5A 1YSJA 4NGSA 2RFHA 3ISXA 2V77A 4R76A 4A94A 2V8VA 4P44A 3NH8A 2PRQA 5DS0A 2PIYA 4R8FA 1TF8A 3B3WA 2F7VA 3CPAA 5THWA 1LANA 2ZEEA 3VARA 3BHXA 3LWUA 4NGNA 2Q43A 2ZEMA 3B3CA 2HB6A 3PB9X 3V38A 2I3CA 3KGQA 3D7GA 5LRGA 4B6ZA 1TKJA 2PJ5A 2O4HA 1ZLHA 4PXBA 3D66A 2PE3A 4A39A 1PYTB 4MCPA 3MN8A 1ZG7A 1IGBA 1CG2A 3PFEA 4X3RA 5HVHA 3D7FA 1VGYA 1RTQA 4IAVA 1XJOA 3HLPA 5J1QA 4DJLA 4YU9A 8CPAA 2XEGA 4UF4A 3FF3A 1XRYA 2GLJA 4OC3A 3I1UA 1ELLP 1YW4A 1FNOA 4EMEA 2CTBA 3B7IA 4DUKA 2ZOGA 1FT7A 2FVGA 3B3SA 4UIAA 4FBEA 2C6CA 3IO1A 2EWBA 4X2TA 1Y0RA 1TXRA 3D7DA 4P4IA 2WZNA 5LRKA 3D7HA 3IIBA 4MRIA 3PFOA 5JGFA 1HDQA 1BPNA 1CP6A 2GREA 3FVLA 3KZWA 5LYLA 5K8OA 2OR4A 2RB7A 1VIXA 2BO9A 2PVWA 3NA6A 4R7MA 3WC6A 1CBXA 3VATA 1F2OA 3GUXA 3KHZA 2PJ2A 4H2KA 1DE4C 4PXEA 3KR5A 3NFZA 1R43A 5JM6A 4MCQA 4X8IA 2EK9A 1AYEA 1PCAA 1LAMA 3SI0A 2IMOA 3PEIA 4ZX9A 2NSMA 2PJ7A 4PPZA 2HC9A 3DGVA 3K9TA 1ZLIA 3WABA 4W9YA 4P4FA 1ARLA 2OOTA 1Z8LA 3V7ZA 4MHYA 4F9VA 4P45A 2PJ4A 2PJ9A 3RZAA 2AFZA 1JQGA 1XMBA 3PB7X 2ZEDA 1XFOA 2AFSA 2CF4A 3QNVA 1XBUA 2QYVA 1ZG8A 4JYWA 1LFWA 2Q4ZA 2WYRA 5K8NA 3WC5A 3LMSA 3KL9A 2VL1A 4ZI6A 3T8WA 1VHOA 3GLJA 2IQ6A 5JH9A 3SJEA 4Q7AA 2XEIA 3PRTA 4RUHA 2PVVA 4PXCA 1VHEA 1DTDA 2POKA 3H8FA 1Q7LA 3MRUA 4UIBA 4KSIA 2C6PA 1Z2LA 2XEFA 4MHNA 2PJCA 2CIJA 2BOAA 1NSAA 2PJ6A 2JBKA 1TF9A 3GB0A 3DLJA 4Z65A 5K8PA 2AFOA 1AMPA 2GLFA 4PQAA 5LYDA 3IC1A 2QVPA 1H8LA 1OBRA 4OC1A 4TNUA 1QMUA 4ZYQA 2G9DA 2ZEFA 1EE3P 5D29A 3B35A 4EWTA 3IJ3A 3SJFA 2ABZA 4P4EA 3L2NA 7CPAA 3B3TA 4G1PA 2PJAA 2PJ0A 3FH4A 4ZY1A 5CPAA 1YMEA 1ELMP 4ZX8A 1UWYA 2PJ1A 2V8GA 4MCSA 3PB6X 3TX8A 4OC2A 3BXMA 1F57A 4P4JA 5LYIA 3CT9A 1LCPA 3D4UA 3IFEA 2PCUA 2AFXA 4UEZA 3D68A 2ZEHA 2BCOA 3FMCA 3WT4A 2GU2A 3PBEA 2ZEPA 3FECA 3KQZA 2PJ3A
chains in the Genus database with same CATH superfamily
2EJBA 2XZDA 3GW8A 5KPDA 2R2AA 1FFBA 3MYRA 3O4FA 1KQ3A 3RLFA 1EXNA 2AF4C 5KQPA 4HJRA 1P1RA 1GPMA 1AK9A 1R5BA 4FWUA 3QF4A 4GYWA 4ZODA 4EYSA 4H1VA 1YZKA 3A11A 3PQ5A 1U8XX 2PHZA 2C5FA 4WRRA 1IHPA 2CLIB 4FUTA 3GR6A 2HA3A 3AR5A 1TKFA 4YR7A 1ENYA 1NPDA 3FPKA 1RBMA 3RWMB 4F5YA 1FU8A 4GKJB 3ROTA 1JFVA 2O8NA 4C0KA 4PTZA 4E22A 3OWOA 2N46A 4GKBA 4ISCA 1AU9A 1IJKA 4ZO7A 1SUPA 2J5XA 3G17A 5MFPA 1FRNA 3FMOB 3I05A 3L1JA 3ISTA 2NU9A 3MJHA 4KXNA 5A71A 3IP6A 3PRKE 1Q95A 1GLGA 3K9FC 1NFQA 4IWYA 3HA7A 1CUWA 3L4JA 3ZXUB 5DWMA 4PZCA 3NU1A 4B7ZA 4K81B 4H4EA 1NGSA 1G59A 5BPFA 2TMGA 2ZWOA 4NFRA 3RCBA 2P35A 1BX0A 5ENZA 1VRCA 1XLWA 1VP9A 1P3Y1 1H8EA 2A5DA 2EERA 2HA4A 2QPTA 2WKSA 3CA8A 3DKVA 3PK0A 5A04A 2DEUA 1H2BA 1WXFA 4MHZA 1E3SA 1DDIA 1KBQA 1T2DA 2J8MA 1OHHD 1SCIA 4D9HA 1DIHA 2JZCA 3ICWA 1U4OA 4U0KA 2YHIA 4ABYA 5CW1A 2CTCA 1LDBA 1A95A 1I6MA 3AUTA 3OA2A 1PNRA 1M72A 4YCLA 1U1GA 1H93A 4G23A 2I0FA 4NGTA 2X8LA 1CVLA 2FJUA 5CFPA 2IS4A 3W79A 1V5GA 1J0DA 1QANA 2AW5A 4ESOA 2O3JA 3K0CA 4WLEA 2H51A 4BD9A 4MEJA 4PLGA 2GA8A 2QEQA 3RS3A 3WLJA 4BBPA 4W5QA 5AG6A 3MBKA 4YEDA 3W6SA 3KDSE 3R0IA 4JGBA 2OGTA 2V8DA 1XIVA 1PU2A 2DQ4A 4CGOA 2O3RA 4WI1A 3U4QB 2FRDC 1E2HA 1A04A 2M9MA 5HXDA 2REBA 2J0SA 4XDGA 1TI7A 4FMDF 1QG2A 4ZOBA 3UKDA 3F90A 4F1WA 1KZFA 1JP7A 4XH9B 2NVBA 5IWAB 4IHJA 1JDSA 2XRZA 4CEJB 1IOLA 1HOXA 1K4YA 3PI6A 5FPYA 3U7JA 3NHKA 1BGWA 4RK5A 4MP8A 4NZMA 3QPCA 4KQJA 4M6WB 4MLCA 1CS0B 4X6UA 1KO7A 3L7KA 4FZ5A 1RRCA 2BGMA 3DZDA 5A6SB 4RKWA 4PSKA 1JQBA 2CHVA 4RC9A 2H1HA 4OBXA 4IF4A 4US2R 3TTXA 5KTTA 5K3FB 4HRAA 2Y1WA 3EARA 4E0BA 2E48A 1UMDB 2OB0A 2C9YA 3SJBA 4X20A 1TTHA 1ZVMA 2XUAA 3D3NA 3RRXA 2VT7A 4QQFA 3TZLA 1XAGA 1JXMA 3QLJA 4X92A 3LC1O 1RXWA 1CUYA 4MFJA 2OP0A 3KZ1E 3W34A 3X1YA 5CXUA 1B26A 1ND6A 3ONDA 3RC2A 1KYQA 3ULKA 1KMHB 1SC4A 2O3UA 2XQFA 3O95A 2V54A 1VCIA 1UEXC 2KE5A 2YS7A 3QVVA 3D2MA 3EIXA 3TUZC 1L5WA 3MXTA 4KAJA 4LQDA 4B7AA 3OFND 3R3YA 2JRCA 4P32A 3AHFA 5F2KA 1COWA 4Q37A 3U7HB 5E96A 1PR5A 3JQDA 1ICIA 4RTLA 2Z3OA 1M6YA 5AW0A 2HPHA 1RJDA 4TSFD 2NV6A 2WF7A 2OYCA 3M2TA 5HMLA 2QTBA 1Z0JA 4G8JA 1Z2PX 2WWWA 4LNUA 4NNJA 4IG4A 4D3XA 2Z5FA 4LZWA 4EG5A 1P1BA 3EGWA 3CVVA 1DG9A 1IIBA 5J2TA 4C4SA 2C8LA 4LW8A 4ZRDA 3HCRA 3WYCA 1XUOA 5DIZA 4CHGA 3BSSA 1QVAA 1UC5B 3KQVA 4PC3A 4LDPA 4DARA 2I33A 3AVVA 4PGHA 4EQ6B 4JUBA 2ZYAA 4G2NA 1P4HA 2M2IA 1H5NA 1NXPA 4YGXB 4XJVA 1J6UA 2A3NA 3VKHA 4DR3B 3RADC 2X40A 4RA6B 1P7CA 4BNDB 3C6MA 4ZI7F 1TTTA 5K3FA 5JDIC 3FFAA 4D42A 2JHCA 5DWDA 4JBHA 4NBVA 3TC8A 4KH0A 2J5KA 2CNNA 4K3VA 4FEYA 2ZBRA 2C07A 2RGYA 3LHDA 4D9NA 3SVTA 3WS7A 1K75A 2YXDA 1N4AA 4G0WA 1RE1A 1RI2A 4TMTA 3W8DA 4ZI3A 5LDDC 4HDKA 5LQJA 4JWKA 2HPZA 1YE8A 3ZD8A 2HA0A 3LUDA 5F51A 5KNCH 3MEQA 2UYCA 2AKEA 2BSWA 4ZVNA 2UVPB 2DGDA 4QBKA 4U63A 4WCFA 3I3SR 3W6XA 4DCUA 4HQOA 3QXXA 1ND5A 2XUZA 1T1SA 3FDZB 4DFDA 1TMKA 3FPCA 4JLJA 1C3OB 2V6GA 1NC3A 1P9RA 5IT9A 1SN7A 4MRVA 2RFHA 1NSLA 4K9PA 4B11A 1VE3A 3CF4A 1YOVB 4XGIA 2JGRA 1Z28A 3HDGA 2FX5A 4EYEA 4HGZA 5FPPA 2OK8A 1Z6GA 1R12A 1O95D 2P6FA 3HDVA 3NOVA 3QVXA 5KDLA 3RSQA 3WB2A 3MFQA 3ZE1B 4AG6A 5AFSA 2P4HX 5JJ5A 3I8SA 3H9GA 3T7SA 4DR4B 1Y33E 2GILA 2DJIA 5ES4B 4N3NA 2V8VA 2EP5A 1XPRA 3G0HA 4BPBA 4A9AA 1IC6A 1G66A 2GYVA 2IIBA 1DC4A 4RFSA 4V2UA 1G7RA 3T5CA 2PX5A 3OURA 3IB3A 3GY0A 3L5KA 4AUKA 3PICA 2IBMA 2VCHA 4GXNA 4OHUA 2YINC 4XLTA 2BMVA 5EMMA 3S81A 3QB8A 4HDAA 4BFZA 1XC7A 5ADVA 5I7HA 5C7OO 4TSRA 3JPWA 2ZEEA 1QVWA 4OBBA 4G0VA 2CNBA 3KWFA 3C7AA 3R8XA 4Q9IA 4CF5A 1LF5A 4DG8A 4U5YA 1DQZA 3EQ7A 1JV2B 3BSFA 3O1HB 3MFYA 1WKCA 3I4FA 1O96A 3K35A 2PGDA 5K0NA 5TPWA 3SF8A 3WYFA 1EP3B 1P4AA 1UH5A 3ET4A 1Q12A 3LI2A 3DNSA 2WJIA 3CLSD 1SB9A 1Q1ZA 2WINI 4IHKA 4NWIA 2OFOA 3DFIA 4I9HA 4AAYA 3K96A 2GZAA 1V48A 4C7MA 3GJ8A 1N25A 3L05A 4PQGA 4WVLA 3D66A 3EEFA 1QVZA 3EVBA 2HCJB 4KWIA 2O2DA 3FYNA 1A9OA 1L5QA 1PGQA 3N8IA 4RQAA 4DSAA 3EH2A 5H9VA 4QTUB 1K2VN 3HU5A 3O8CA 5IKPA 2NM0A 2ZDGA 1G5IA 1VHSA 2OGSA 1HLFA 3DBHB 4HH3C 4C4TA 2AW3A 2HMTA 1B0ZA 1XG5A 3QPVA 5TJHA 1RYDA 2VRCA 4UAVA 4F3CA 2I4TA 4WZAB 1QYRA 5A9SA 3BCHA 4L73A 4I1PA 1OBVA 4OLBA 1Y7IA 5AW7A 1IM5A 3KTAB 4JT9A 3PFHA 3W78A 3ZE9A 5EXDA 1ZDMA 4OC3A 4BMSA 2P79A 4JWPA 3GWZA 2DUUA 2IZ5A 3H4IA 3AJDA 4JEMA 4TWBA 3LT0A 3VNUA 1KI6B 5ALLA 2H4YA 5J5CA 2A8YA 1R2QA 3HR4A 2BI7A 3OVMA 2C83A 2UZAA 1RT9A 3FJ1A 1DAOA 4QAJA 1HMYA 4EG6A 2ZSIA 1KKLA 2NTVA 1ZOPA 5DTEA 3BIXA 1X7HA 2GXSA 2QX4A 4U2GA 3L6DA 4P81A 5CP8A 4YLEA 4AKHA 5CB4F 1FQKA 1FT7A 3B9PA 4DIBA 3TCXB 2KCWA 4P36A 3B3SA 2C9MA 2R5WA 4EDHA 2C20A 1TF7A 1WZEA 1QRDA 2VRNA 1P72A 2GAJA 3RD5A 4XPIA 4RZIA 5BUZA 1E3LA 3QVUA 3JYOA 4IKEA 2DHQA 4FYWA 4OF4A 3SHTA 1V0JA 1ENOA 4MRIA 3RYHB 4U5XA 1ORIA 1H3EA 1OLXB 1BPNA 3NEPX 3DTTA 6GPBA 2GREA 3KZWA 1KVTA 2A5JA 4ZOLA 1U8FO 5CCBA 3R7BA 3KKLA 3GKRA 4UEKA 2XIJA 2JB9A 5DXAA 3NA6A 4BNFA 2Y99A 3GT3A 1IU9A 3ILVA 2I2DA 3JQGB 1T1IA 4XPKA 4ARAA 1MNAA 3EAGA 1UPXA 2ZWMA 3RK0A 4NFHA 3LP8A 1TJ5A 2COUA 4Q15A 2P62A 2E4AA 4XZ3A 4OV6B 4DM7A 3HCCA 3NWJA 9LDTA 3DHYA 3C3DA 1HSZA 1I0IA 2IXEA 4BMDA 2YWGA 4L9AA 4OJMX 2H85A 3R5JA 2Q6IA 4Y1EA 1WHTA 3T0FA 1C1DB 4Z3OA 4KK3A 1ULBA 1F14A 2RGUA 4KV9A 5T3UA 3T94A 3EUFA 4HAOA 4RANA 4MRMA 2ZUTA 2EZ9A 4KN6A 2J08A 4FD5A 2B4RO 4OH7A 3GJ6A 4G5YA 3TZHA 4JD5A 1B0AA 1KI6A 1U1CA 3CM0A 4YC7A 5HS4A 1R4NA 2CC2A 5J2UA 5AICA 5HGJA 3F5FA 3WRWA 3AEZA 4H1TA 3E5NA 4YP6A 1IXRC 1FFXA 1KXJA 2XRFA 5KNCD 4L3WA 3I9MA 4NJOA 3NT4A 5CD9A 2NSDA 5ICMA 2G9RA 1Z2AA 1J09A 1QX4A 3QJYA 1HE8B 1XTSA 3KXPA 4MCAA 3TQOA 1YT5A 2QZ4A 3DZ8A 5KVCA 1WMDA 3H2IA 3L8ZA 5A27A 1JU4A 2HA6A 2WKQA 1XI2A 3FF1A 4FC6A 4RH3A 1I30A 2SCUB 3B70A 1TRHA 4JQYA 2F9MA 1WXIA 4QTZA 3V9AA 1IY0A 3TRFA 4BO0A 2JEZA 1J90A 5F33A 3ILHA 5F23A 1Z68A 4YRPA 2IPOA 1VSBA 3HZRA 3BHMA 2A58A 1T9GS 2AH5A 3GEEA 3AERB 5CB0A 1DCKA 1M9NA 2IQ5A 4AUEA 3BMNB 1N2CA 3TLAA 5DOVA 4GPAA 4R9VA 3TN7A 3EASA 5CFNA 4MY0A 4JX8A 5HG0A 5B5SA 1LPNA 4MKRA 3TLYA 4HN4B 4MDFA 2VJBA 4I2VA 2VDPB 1E6LA 2R6ZA 3FSJX 1TT5A 2GZDA 2P5UA 3GJZA 4FJ1A 2CLMB 4R41A 2DG2A 2C04A 1CZOA 5A3VA 1YO6A 3EQ6A 3MMXA 3Q6IA 4RX1A 5JS2A 3RIYA 3SS8A 2BFCB 1NVFA 3WSTA 3FXAA 4EG7A 2E4ZA 2W48A 3QNUA 3SZUA 3J7AC 1PJSA 3IHLA 4OI2A 4Q9KA 2YRWA 4RGVA 4E3WA 1JHRA 3GUZA 3NVMB 3GCZA 4UQPA 4X1KB 2VJOA 3KZCA 4QUAA 3WLOA 4BRZA 5BN4A 2WV9A 4KN9S 2B69A 3HKEA 3D4PA 3ZGYA 5JCPA 3MYYA 4D9CA 1H6AA 3FN4A 4P4GA 2H1WA 2O1EA 3KEQA 2HOQA 2JF0A 3GUUA 5H16A 1T35A 1KZ1A 1FMTA 1U0HC 5AKYA 2PUFA 4EF6A 1LPPA 4P83A 1JEAA 2VHWA 4WQMA 3TQIA 3F1KA 3Q11A 1GGJA 2WSYB 3D8BA 2GJAA 5LQSA 4A2WA 1KK0A 4MPDA 3HZOA 3UANA 2EJUA 1YJXA 3BTSA 4R54A 5KX5F 5TGDA 1JBQA 2O1SA 3N2ZB 1T15A 4X61A 2X1HA 3EC2A 5FAXA 1P80A 1EXWA 2YJGA 2ZYRA 3LY5A 3IELA 1B1AA 4Y9TA 1G291 3TVDA 4D8XA 1HF3A 3EGXA 3P2JA 4TNUA 5KTCA 2NX2A 4DA0A 1BE1A 1KQFA 4G1FA 2X7JA 4N18A 3GAZA 3VH2A 1EK6A 4MS4B 2ZTLA 4Y7DA 5BW8A 2FPLA 2DPGA 2ID9A 4J0QA 2FPGA 1AUPA 2Z2YA 2C3YA 3KWJA 1SUWA 1ZIPA 3AC0A 1Y8RA 1RXEA 3ABRB 1WR8A 3H19A 3H4MA 3OJCA 3QYPA 4CMHA 4CNBA 1GDTA 1J22A 4RIHA 3W5VA 4E7OA 2Z3MA 3QVGA 5TC4A 1Q14A 4BEVA 2R47A 4GR5A 5CU7A 5F7JA 3SEZA 4BNWA 2MINA 4WOJA 1I2ZA 3I12A 3JYNA 2XMQA 4WVFA 2P4UA 3HRHA 1U9YA 3LT4A 5FUBA 3OLXA 4CNQA 3S8EA 1UKBA 2LVBA 1VE1A 3ZJUA 3IFEA 3OICA 4ZHQF 4UPVA 1PHPA 1X10A 1A4RA 1I2MA 3HUUA 5ALXA 4GBED 1X74A 1QONA 2VA9A 4PS1A 2GT1A 2Q4YA 3D2BA 4YBZA 3RG8A 4A27A 1ZCAA 3KSAC 5BMVF 4KIUA 2OCLA 1U28C 3F8WA 1ORRA 3IRUA 1FTQA 3MMPA 1H0KA 1XCBA 2Q1UA 2VOEA 5JNUA 5F1KA 4Q7EA 4RA9B 4RHUA 1XU4A 4DUPA 3L4SO 4IKPA 3AF0A 3H5RA 4MW1A 1GYQA 2I4IA 2FK8A 3KKOA 1RIFA 2D3WA 5HF8A 5CFZA 2FSVA 4D26A 3OKCA 4X44A 5ELYA 3B7GA 4AS1A 5MHTA 1ODTC 1XK6A 3FPLA 4QJIA 3NH5A 3MUFA 3G0DA 3PD0A 2F4VB 1JBKA 2LE0A 4RTOA 3CTPA 1JTFA 4M6IA 4LQCA 4RJLA 3V2IA 1W73A 1ZUNB 3PXAA 5KOIA 3WL8A 4IIJA 1ID8A 2FPUA 3REQB 1HFWA 1UKYA 4QOGA 4TTAA 1OFTA 4BUJA 5AKHA 2SNIE 2ZEJA 3WGIA 1DV2A 3FWHA 5HW0A 1DEHA 1GNLA 3ENNA 3JWJA 4LNUB 4XRRA 1CJSA 1RYBA 3B5EA 5DHUA 5LRJA 2BF4A 3NALA 4XNHC 5DFAA 4UD6A 1U0TA 1VG1A 2VSNA 3D2CA 1RPAA 1QH8A 2IYPA 2X5OA 4I1OA 1JQLB 2QTTA 4HF7A 1I01A 4OLLA 1N7HA 3R44A 4C0HA 1RD4A 2BFFB 3DXXA 4RM3A 4W9NC 1LVGA 2IVZA 2J1LA 4X62B 1O0SA 2PL1A 4FYIA 3R74A 1ISIA 2BM0A 2Q5CA 4ICIA 4QUIA 4QLBA 4LQGA 1V4BA 2I1VB 4L3OA 4UAUA 3USZA 4ALLA 5EZ5A 2VN8A 4B8ZA 4BCCA 1A7UA 4DMHA 5IUKC 3TSCA 4Y98A 5EQTA 2ISCA 3E4DA 1N9GB 2Y1CA 3F4BA 3KPVA 1T1JA 2VT6A 1RYEA 1ZUIA 4L2IA 2WFLA 1G7SA 1S3FA 3N5KA 1E96A 4BZXA 4OHRA 2XCQA 4UUPA 3L40A 4KX3A 2ZRCA 1TMGE 2LWIA 2MR6A 5KYYB 1Q74A 2XKJE 3OOEA 1Y8CA 2B2NA 4GPTA 5TNXA 3VPAA 4DM4A 3J80A 2JIZD 4YRHA 1EDEA 1CYDA 4CETA 4F92B 5TB5A 3U4QA 5FWAA 5FTKA 2F62A 4QYIB 4U7GA 1BA3A 2VHCA 4JC0A 2OBFA 1BA2A 5AIBA 5EC4A 3T4XA 1KF0A 2VZZA 1EXDA 4D0GA 1EX6A 1XRRA 2ON6A 4OLFA 3CCFA 3MRSA 4UEQA 5JZ9A 4A0QA 2OYSA 1XO1A 1MO2A 2HFJA 2IYOA 3CZCA 2VSOA 4B4WA 5BVHA 4OLHA 1PTJA 4YMLA 3KQPA 5BYAA 2HK9A 4NAHA 5CFQA 4LMPA 2H9YA 3DBHA 3EVEA 4JP5A 4J9UE 4PPGA 1UDWA 3SC2B 1UK9A 3SC4A 2COKA 5KOJB 1CZRA 5BUSA 1UPAA 3SX4A 2Q3EA 3ED1A 2YICA 4MYUA 3R5XA 1Y8QB 1WZ2A 4IO0A 3VYTB 2H1OA 4J7CA 5K3AA 4FYJA 5CDFE 4JGIA 3D4OA 3I6IA 1HTWA 3ZU2A 3WB1A 1CZUA 4PYJA 4JJ7A 1D04A 3HNPA 2I4NA 2PUWA 2WEKA 4QFMA 3ZVNA 4BQFA 4M7PA 3CPXA 2ZIUB 2XE7A 1NW9B 2BFDA 5CRIA 4YO8A 5IFKA 2NO6A 2JJ2D 5HNKA 1EIZA 1QVVA 3DL7A 4GGMX 4PU0A 4E2XA 4EARA 4LV8B 3QELA 5IUNC 3SZMA 4DL9A 3S9MA 3M1LA 4JBNA 4FZRA 3TJZA 2B7LA 4U7TB 5FBRB 1S3IA 1RYZA 1V5FA 1DTWA 2WTAA 4LF6B 3SBXA 1Z37A 1FQWA 3HY3A 1R18A 2GKSA 3EOZA 3HKEB 1Y4DE 2UYHA 2O8DA 1PWYE 2RAUA 2B4BA 3PUJA 1QRSA 1FZTA 2QG4A 4EW2A 3VKGA 4LQ6A 1U1EA 2BEVB 3GX1A 2QJOA 2Q5HA 2Q5QA 3C3MA 5LJIA 3CJQA 1YRAA 3GCWA 1JG7A 4C0WA 4YRQA 3GLIA 2A3RA 3MM4A 1WSBA 4PF1A 4WKPA 5JT1A 4LV6A 4E1BA 3TRHA 1P75A 2Q1WA 4RKFA 1LTKA 3KFVA 2W2OA 3W5AA 1YZ3A 2FG5A 2R66A 4D56A 4C6HA 2V7TA 3S9NA 4RMIA 3COSA 1O94C 2G28A 2C92A 3I1YA 2V03A 1OYWA 3BEOA 3HY6A 4HWGA 4Q4HA 4PGAA 2NU7A 2P90A 4I99A 5KIAA 1E5QA 3BK1A 2Z3LA 3HJFA 4L4YA 1G3MA 2QPOA 4C6TB 2IU0A 2PLRA 3PQ6A 4A10A 3MMZA 2CYCA 3EZ2A 4TXMA 4Y0NA 3EA0A 2J48A 3LQRA 1H3NA 4MW5A 4D4JA 4M0DA 1ZFNA 2Z9BA 4MWGA 4DR1B 3D0KA 2IZ7A 1UFOA 2QX6A 1E3QA 1V16B 2DTDA 3IT1A 1RQNA 3L92A 2EQAA 3IAS1 4J91A 4S0XA 4ERNA 2VTBA 1E1RD 1Q6YA 5JUWA 3ITKA 3IE2A 2AZMA 1U2EA 3EXHC 1B43A 4J07A 4MIYA 3BFPA 3U0BA 4ZIRB 1R6TA 1PR1A 4R1QA 1SJ9A 2GH1A 3MJEA 1BJRE 1RP7A 3NB0A 3UB3A 1AZWA 3HVUA 5C5CA 1JSCA 2LD4A 3CG4A 2CL5A 3QPBA 4FNAA 3QHPA 1A2OA 4S35A 4YAKA 4AO7A 3FBUA 3JAWA 4RU1A 5TE9A 4JMLA 2HU5A 4IMJB 3A1CA 4OA8A 1PJQA 1H9AA 1NYLA 2ST1A 3VH3A 4BZZA 2EEPA 1NJ6A 3CLTD 4TXHA 1E79A 4F8JA 3T38A 3K5IA 1UFRA 4QYWA 3GN1A 5EE1A 3RC1A 2PIZA 3AYXB 1OC2A 1W5AA 2SKCA 1KSJA 3T95A 2QIPA 4HDQB 5A7HA 1LJLA 2UV8A 4KFCA 3OY7A 4RSGA 3N75A 1H2YA 4CIAA 3IQWA 3IPCA 3KB8A 5DW3A 4H3SA 5F7ZA 5FJJA 2FPRA 3R75A 3ZNNA 3QJ5A 1CJKC 1J2YA 1N1EA 4OKIA 4CR7A 3MGDA 3ANLA 1AURA 2PU7A 5K7SA 1O57A 3GFTA 3LT5A 1FCJA 4GM5A 3U3MA 1J9GA 1I7PA 1IG0A 1OYOA 2IYFA 3DTVA 1U7UA 4TWZA 2CE2X 3S55A 4AJ9A 4PC6A 3OU2A 1IHDA 4R7TA 4NQRA 1MGOA 3ZYCA 1GGNA 4WK4B 4JXRA 5ADHA 1BVHA 2ZSHA 4FYXA 3URMA 3X1WA 1PVOA 1JB1A 3FY4A 3G8YA 1BFKA 3QGMA 1J07A 1M4DA 1MH9A 3EF3A 5LZ4A 1Y89A 2ZJBA 1HT1E 4JP8A 4ZDIA 4KO4S 5ERXA 4CF7A 3OJLA 2K87A 2XB8A 3L0YA 3P2OA 1G60A 3PRYA 3SVZA 1Z06A 2XF2A 5L9AA 1TMOA 1XQ1A 3E9ZA 3N8DA 2HSWA 3RIGA 3ZV7A 3NH8A 1Q84A 1XOVA 1NP6A 1EU1A 1EVLA 1KFJB 1UKZA 4R1SA 4X1YA 2QTVA 3DZHA 5B12A 2ECFA 1XD8A 3KEOA 3JQAD 1ZZEA 2RG1A 1VPVA 1UZUA 1NFRA 1LD3A 5EIBD 4E21A 5B1IA 2DHDA 4RABA 3RVNA 2WVHA 3DT9A 3F73A 1L5OA 3PEFA 4P2GA 1G8YA 2A94A 5FOQA 1LANA 4O2BB 1QB7A 1UJNA 3D2LA 1XEWX 4NGNA 3LX5A 1L5HA 2A59A 1CG6A 3K30A 2PDAA 3AV0B 4N6GA 4QE3A 2O9JA 4EWLA 4PN3A 2FSVC 5C5DA 2I3CA 3KGQA 3TQFA 3S27A 1ZGGA 1BC5A 1YJ8A 5THKA 2OAGA 3WDSA 1QFJA 1QIJA 2BI8A 2LR0A 3D7GA 3HH8A 1KK3A 2A30A 3AM5A 3ONVA 3UJDA 1WLYA 3TXXA 2O4HA 1ZK4A 2XTJA 3FH0A 1DG1G 4HCJA 1GFIA 3HHPA 4FI3F 4DDHA 3O21A 4XDZA 5HCIA 1W0JD 2PE3A 3FCUB 4D9KA 2B4AA 2GLTA 3KEFA 4LQ4A 2Y1KA 5E2IA 3TT2A 2VJAA 4IEEA 1GUDA 4MS4A 3DF9A 4OXQA 2FSIA 5G1ZA 2B7CA 4BFUA 3GLFE 4LVCA 2OWDA 4LOKA 1JSXA 1VGYA 1NASA 3HUFA 3GFOA 2PRKA 4YT2A 2PUBA 3ADOA 1XRMA 4P35A 3GMIA 4LBYA 4ADSG 2DFKB 1S0UA 4G5XA 1XZKA 1W30A 3OIYA 3L7CA 5FWXB 1CU1A 5FT9A 2CMFA 1Z4JA 3FFTA 4MUMA 1KYYA 5T4EA 1H94A 2G04A 3A6JA 3S4YA 4BNIA 2G83A 5HJ2A 5BN5A 3L4EA 1KI1A 2J6IA 4JWTA 5AJTA 3WGOA 4E5SA 4EMEA 4CLXA 5LQMA 4CE6A 1EK2A 2YFQA 4PPYA 4ZAYA 2OZPA 5AK4A 3OX1A 5I01A 1H42A 2CCKA 5IB0A 1L7QA 3PEEA 3OHSX 3C4JA 4PG8A 1JXAA 1Z36A 2I5PO 3UA3A 3IAFA 4M1WA 4EGQA 3OPNA 1OI7A 3QQ5A 3H2HA 2F6RA 5KTRA 2KJQA 3NM5A 2JGIA 2XMDA 4PX9A 3MHTA 1QYXA 2B4KA 2FSSA 2HA2A 3DXZA 4NCZA 3FYDA 2A9QA 1SQSA 2HF7A 2REOA 3A04A 3ZCTA 3AR6A 4C07A 2EWBA 3EA4A 5FJIA 4EI7A 1D9ZA 2EBHX 4LI3X 4GR9A 5L51A 3IGFA 4R8KA 3K70D 4BVHA 2R6FA 1Z8LA 3PB3A 5J59A 5CB6A 4Y3UA 3BMQB 3QMWA 4MYTA 4B47A 1FJGB 1PJTA 1E1NA 2ZBPA 2AQ8A 2C2HA 4MV3A 4R1LA 4ZPJA 3F9IA 4G5GA 4F45A 5LYLA 2HQ1A 3ZWCA 4L5IA 1AQYA 1SVKA 4FNMA 1MRNA 2RB7A 3PHGA 4QREA 1OE0A 3OIGA 4CWAA 2REXB 5K3OA 3ZU5A 3P9ZA 4EATA 2ZJ8A 3HCWA 2ODTX 2G5PA 4PGGA 3T3PB 4GLBA 4KAAA 1I5EA 2CXRA 4QSHA 4FGJA 4B5KA 3DQQA 1E18A 1O3YA 3E03A 3M6XA 3OCZA 4UMEA 5BO5A 1W29A 4EHBA 1GPDG 3H04A 2N3ZA 4J0IA 3UJHA 2X9LA 4IUSA 4G4JA 4PRLA 3Q9UA 3LCVB 4IVQA 2I3GA 4Z8YA 4MJ7A 4M99A 4MWOA 3FWPA 3QFSA 3KR5A 5AHOA 1JDTA 1UBEA 2BE9A 2QHXA 1Q7CA 3IP1A 4NVRA 2O3TA 1N0UA 2QV0A 1LVHA 2Z8ZA 3WNVA 3UCEA 1Y4AE 4ARBA 3QIVA 4P22A 1JR3E 4PZLA 4RO0A 2F8SA 3LC7O 4PSAA 3TW0A 1LAMA 3GJ3A 1HLGA 4ZCIA 2I9KA 1BO4A 2C2KA 4EJ6A 2HJGA 3PTZA 4OFBA 2Y1XA 2Y4OA 1W94A 4L7QA 2JFOA 4YRMA 2CBZA 1Q3KA 3KQOA 5DP2A 1TW2A 4X7PA 2LCQA 2Z8XA 2BR3A 4F04A 4GLFA 2XMSA 1FB5A 1D2RA 1QYDA 3Q7TA 2NU8B 2ZPUA 3OQMA 1JLSA 4RPJA 1N7JA 4KRYA 2QL9A 4YRIA 4JCOA 4QC6A 1NULA 2B5WA 2NYVA 4YIHA 1KNQA 4MUJA 4MHYA 4QFDA 1VSTA 2PPLA 2PUDA 3K8YA 1F0NA 1QRUA 1T4CB 1N2ZA 1DINA 4UASA 3AUJB 4ZT3A 3HN7A 3VJLA 3FDIA 3F8SA 2Y0EA 3UAGA 4PGFA 3W7AA 4GOMD 3W8EA 2EARA 2PO7A 2QSUA 1JQGA 3HXLA 1JAIA 3IP7A 1P4NA 4II2A 2FPXA 4RSMA 1A4XA 1XEWY 5DBOA 1Z83A 2FP4A 3OC0A 5KSZA 4CDNA 3SHVA 1I24A 2GCOB 4CGNA 3QUCA 2WIBA 1SU8A 4LF8B 1INLA 4NCJA 5AR1A 3HWWA 1TTQB 1LFWA 1SXJB 1SELA 2P1RA 3D5EA 3CH5A 3OJFA 4DE5A 1X6VA 2VVTA 2Q5JA 4KXVA 4MMXB 4CM7A 1XQVA 4ENTA 3IV6A 1CE8B 3WZLA 4BTVA 1XZBA 4KQ1A 3RC8A 3EVDA 3E23A 4C30A 2GETA 4XPIB 3PX2A 5DX1A 5AKIA 1L7OA 2BUBA 3I3OA 3FR7A 1WL8A 2NYRA 4HGQA 4TKVB 3N8NA 4UNNA 1NI4A 4GO1A 5FPTA 3WY9A 4XCVA 5JFGA 3OT4A 3JD4A 4ID3A 2E1PA 2KI5A 1N3YA 4O4JB 2MHCA 5EQDA 4ZV7A 5CDUA 3I9NA 4J0JA 1RRPA 2B21A 1MR3F 3DAPA 4M9XA 3W05A 4AJEA 5KEIA 3ABSB 1GTJ1 2J3JA 1J49A 3GEHA 4EGSA 3KOZA 1CB0A 2W0MA 2XAAA 1GTL1 3T5BA 4BMNA 1EWKA 2QD4A 3BGOS 4B32A 1FP4A 2HIHA 2WIKA 3W9UA 4BB5A 1ORWA 4PYQA 4D9JA 3B6JA 2I87A 1OF1A 3W77A 5TLSA 2D2IA 1C3XA 4N9QA 2XEFA 4UCNA 5HZKA 1TJPB 2CKDA 1HFEL 2IHJA 2IHNA 3A05A 4TKUA 2GZSA 1HRKA 4NMWA 3H6KA 1Z6YA 1IXZA 3KLOA 3TQSA 3Q7PA 4N1AA 2TYSB 1X0VA 2SKEA 1N78A 4I1YA 4CV1A 1BCRB 1TF9A 1KHHA 1YZFA 1YMQA 4ZCQA 4E14A 1P77A 1VHLA 2FWAA 4RVCA 4PQAA 4BP3A 2YWCA 1O6BA 4Q00A 1G17A 3CXQA 1JMVA 1ZH0A 2G9DA 3A2MA 1Y3BE 1FMLA 4GRDA 7GPBA 2OD2A 4CKBA 3C7CB 5FOVA 3R6LA 4AP6A 1OBOA 1YDFA 2FCRA 1ZNXA 2VATA 4JLVA 4YRSA 4P4EA 4C6TA 4CLRA 4G1PA 3M49A 1BKSB 1W44A 2NT4A 2YV4A 4DMUB 3RREA 1KMCA 3KEGA 5LP1A 2IUTA 1H2XA 2ERCA 5EGNA 2PVSA 3KYBA 2E18A 3LYLA 3MQ2A 3ORQA 4NYIR 3G3SA 1VIMA 1KI9A 3K0KA 3Q3IA 4C4ZA 2CD9A 3G7UA 4LZNA 3Q12A 4Z0PA 2C3PA 4HNQA 1Z12A 1K8QA 4AT1A 2YC2C 3HM9A 1M7GA 5EMLA 4LPKA 5HQTA 1CUUA 3OT1A 3UPUA 1KE1A 4DVGA 2XUJA 1T91A 2I1WA 1EPUA 2X4DA 3L93A 4DLNA 2RH9B 1ECLA 2KM1A 1ZHHA 1MLDA 3CN7A 3TTYA 4BFYA 3ZDAA 4MY3A 5HH1A 5KQLA 3D68A 3RYIB 1G21A 1SR8A 1W46A 3LZCA 1W85A 3FMCA 3DLCA 5IV0A 1SBHA 3IXQA 3K1ZA 3HYNA 3OJWA 3MILA 1WP4A 1P1KA 3JQGA 3HJRA 3QUQA 1EUYA 3I9FA 2KB0A 1GCUA 2JBAA 4I1IA 4IGKA 5EJ6A 3KRTA 4BLPA 2DY1A 2PQ2A 3GOHA 1QTQA 4Y0VA 3UBTA 3LX6A 3UCXA 1BMTA 2LTAA 1L3IA 3E3LA 2RI6A 3MS2A 3IIKA 4FFSA 3ZKWA 4EFLA 4XWOA 3CV3A 3KOYA 4EVYA 1RHJA 3CB2A 5JBIA 3W3AD 1RKQA 3TI9A 4QHSA 1CPSA 4L22A 4K46A 3FR8A 1ADFA 5HP4A 1GL9B 1XVAA 2O0JA 2OHXA 2YHBA 1G1MA 3AEKB 1QG6A 5HCUA 1V1RA 3DE2X 4ZREA 4CMJA 8GPBA 4A2ZA 3HQ4O 3CSUA 4MQEA 3GZ4A 4OUDA 5EJMA 4AMUA 3PUHA 1ZIDA 2H1IA 3CX7A 1ZW6A 3NKLA 3SC3A 4ALKA 3G2QA 1QUEA 1D5CA 1X80A 3CLHA 1MABA 1VRWA 3TMKA 2FZVA 2G17A 4I50A 1V35A 2ZW7A 3SC6A 3WE7A 2OA0A 3DDOA 2AC2A 2W6CX 4G37A 2MIIA 5ALKA 5F2EA 3L8EA 1ZQ1A 1AK1A 1S3ZA 1N75A 2CJWA 4G41A 1SU4A 2ZUBA 4NULA 5KWSA 2M6LA 5L4NA 4H16A 1NJFA 1BE0A 4D4KA 1RMQA 1C3EA 3K0FB 3L1VA 3P9YA 4HNWB 4X60A 1MRZA 2D8MA 3U40A 4J8PA 5J5AA 3WAGA 3GPLA 2GAFA 1BD3A 1ITZA 3R0QA 1M2OA 4QARA 1NRWA 1FVXA 4F0YA 1U1IA 4LDAA 4IO1A 4IDGA 4TTTS 3UMYA 5JAIA 5FI5A 1F8GA 3WK4A 1F2PA 1UWLA 1IIRA 4NMLA 2H57A 1BOBA 2ZRAA 5GADl 1H2WA 2ZSBA 1ZC3A 3QBVA 4DC0A 1VIYA 3FX6A 1NBEA 2KLHA 2XI4A 5A4MS 2O5CA 1E79D 2VDVE 5KS2A 5JJKA 3TO6A 1BOFA 5KJ6A 2ECOA 3GRFA 4NKRA 2XNDD 2CNOA 1Z4RA 2NO5A 4KU4A 3A9CA 1PQUA 1IJBA 2ODAA 2OQ2A 4ZZIA 5EUCA 1NE2A 1T2EA 2B1JA 2FRDA 1AG9A 2P9TA 2CHQA 1RWKA 2VL7A 3GEDA 3L8MA 4I9UA 2IQIA 3VKVA 5C8DA 4FMCB 3QE9Y 2H4HA 1F7UA 3KI9A 3GEIA 2CMKA 4RPKA 2WT9A 1QSRA 3GIUA 3SE7A 1PX0A 2MSKA 3L1IA 4OATA 1GA1A 5D1HA 4BN0A 2J8RA 4G84A 3NBUA 1W36B 3IXLA 3P9QA 2WJJA 3VNSA 4MVJP 1I2AA 1Y48E 3ZYZA 2ANPA 3HI6A 3N8HA 2FTKE 2YXBA 1Q1BA 4O2RA 2E2WA 3GUYA 3DOHA 2WFZA 1EFDN 3MWDB 1E7QA 4JLMA 4O8CA 4P80A 5DBIA 3ROFA 2IH5A 2QBYB 4GI5A 1VLJA 2AWOA 1MZVA 3CX3A 5CLGA 1ZEMA 3E61A 3OCWA 1TFUA 4EAAA 2Z04A 3A1FA 1DEXA 3UJCA 2QG6A 3ZBTA 1BROA 2JA2A 4DSTA 4YJFB 5CM2Z 4TT8A 1F4PA 3PC7A 4M9RA 3PNVA 4CKYA 5BV0A 2C0QA 1XKTA 3VO9A 4MUFA 3ZE8A 3H5IA 4BZPA 4RV9A 3PVCA 3GJ5A 4RD1A 5IJ0A 3HJAA 2O8EB 3UT5A 3L6EA 2F1IA 2CJXA 2GPJA 3CLRC 3E3OA 4M89A 4FCTA 3WIOA 3ZNPA 3A9SA 4X1IB 3OKFA 3MUEA 1LC3A 5JCZA 1R9MA 3BHNA 4KLZA 4MRRA 4LKRA 1QYVA 3LCCA 4BVLA 2XHEA 1KIMA 1VE6A 2YW2A 3GP3A 4IM7A 4P7KA 2PL5A 2WYIA 5FQOA 4DQ0A 3HYLA 5IYZB 5E4YA 1E0JA 2GVDC 4INZA 3EY9A 4URHA 4BAGA 3R9XA 1JAHA 1PTKA 2QVXX 3F5BA 1HH4A 3LHFA 3DONA 2OLEA 4RVDA 1BS1A 4JKIA 5AD1A 3TFYA 1Q7GA 2VWHA 3GT0A 5K1ZA 2ZPAA 4NTZA 5D3MA 2VKQA 1T34A 2IOYA 3KEMA 5FL7A 4ZEXA 5TIIA 5AW8A 1W581 4LC9A 2AXQA 5C7IO 2Q3BA 4KR6A 2GCEA 3QKSB 1I4DD 1MENA 5CJPA 1V1MA 3O82A 4D8WA 2NACA 3H5AA 3R2JA 4YMSA 2FW6A 1CY1A 4F8EA 5KYWA 1UKAA 5EBVA 1XNGA 1TA9A 3OZCA 4UHBA 2XMGA 1V45E 1SU7A 3PSHA 3IFSA 1VI6A 2A9VA 3I8OA 1ULAA 2R87A 3JATA 3KKMA 1K7FB 1HYQA 2JJ8A 3LU1A 4MLDA 4NFSA 4Q4DA 4QM7A 3CF4G 3WLTA 4EG8A 2WAOA 1DAGA 4ARVA 3MZ0A 5K45A 2O8DB 3HJTA 3ZIAA 3KHSA 5CDTA 2A4KA 5FX2A 5HQ3B 1ODIA 4PAMA 2NU6A 2VEOA 3NGLA 2IF0A 4M1ZA 4HB2A 2EKPA 3KG2A 4N01A 1HA3A 2Z98A 4I81A 1E58A 4OHVA 5FL3A 5EHXA 2YYZA 4WPGA 1N77A 4C3ZA 4H9GA 4WNYA 1VHDA 1NR1A 1VRVA 4N6NA 5AMXA 4GX1A 5GM1A 4ZGBA 3CPSA 4DA4A 4AICA 2FZ5A 4E6EA 5E4FA 1OLSB 3LQKA 3WL4A 1QMGA 1YQDA 4B45A 5L4LA 1KA9H 2PJRA 1XDUA 1CLUA 4GMKA 5LVAA 3SZGA 2ZYUX 3GEBA 1Z45A 3AJ8A 3NHYA 4FWIB 2GBPA 4RVNA 2OP1A 2PRZA 5EJIA 4PYIA 3SNHA 4BIMA 4ETMA 5DHFA 5CB8A 4U5QA 4TUYF 3KCNA 1ONNA 2G63A 3PE3A 5DXFA 2D0DA 3VDRA 1DUIA 2ONKA 4G81A 2Y9MB 4PVCA 3NETA 3T1NA 4K6OA 1T0BA 1O6ZA 1SVWA 1N2HA 4Q9DA 4C0XA 1NRXA 1FFHA 3OZGA 4WXYB 5FPSA 4CGYA 1MOQA 2VYND 1I2BA 5FR1A 4EGCB 4YB8A 1MJGA 1TC2A 4D99A 3ACBA 5L3SA 2WIDA 4MGIR 3OQNA 3T12A 4YX9A 4HEJA 5F49A 3BBLA 2CW5A 2GTHA 3WO1A 2GQ0A 3UMJA 4LJAA 4A30A 5H86A 4A32A 2RKOA 4FUQA 2PR8A 4WNCA 4WEOA 1BDHA 1I36A 1JEQA 3RT1A 4EG4A 4MWTA 3M5CA 3V46A 5G1OA 2C1EA 2JK0A 4JENA 5LQRA 2GJSA 1DRKA 4UCXA 2Z3PA 5T67A 5KSWB 5LM3A 1WDLA 3PB9X 5THWA 3UFXA 1FYFA 1BWQA 2TMDA 1A98A 4B44A 4EHHA 4NMXB 4B9EA 2EUIA 3JAKB 1S8NA 2BUCA 3VX3A 1SBIA 2CDCA 1E9AA 2QRQA 2V7XA 1ML3A 1GQYA 2HRBA 4JYBA 3RG2A 3L9WA 5IAOA 5IHPA 5JQWA 4KDRA 4RPLA 3Q7RA 5E0OA 1VDMA 3SHQA 2CHFA 4BLTA 4D92A 2OFPA 1RFGE 4I3HA 4CDRA 1PJRA 4POAA 4QYMA 1ZLHA 2QIOA 2NAFA 3FZQA 3NVDA 4M8KA 4FS8A 2YVLA 3GELA 4G8DA 1OIVA 2RKWA 1Z5WA 1ZQ9A 1OILA 2XCLA 1P4RA 1LQTA 1F3LA 2H4WA 3NHUA 4KSBA 3NIGB 2FMIA 5EXEA 3SYNA 4EUNA 1IGBA 4XD7D 4DIUA 5AGEA 5DK4A 4ZXFA 4FEEA 1JECA 2YZKA 3RQIA 3MS7A 3FHCB 5K0ZA 4TLDA 4UMVA 3L5OA 5LQAA 3BULA 1AB6A 2QMUA 1N5OX 1P2UA 2QUAA 2P2NA 2YYYA 5AK3A 5EIEA 4QBJA 2XCSB 2C5LA 1HX7A 2QN9A 3CPEA 4RDIA 4KPFC 5JPCA 3HLKA 4DJLA 1E1YA 1T9AA 1FXWF 3HSYA 3GFSA 4M8IA 1E99A 3WYEA 1M73E 2K2QB 4A92A 1UP4A 1KDPA 4DT1B 4AK9A 3RJTA 4QVIA 1N2CE 5K8VA 2BELA 3R7NA 3W2TA 5TMPA 2GHQA 2F43B 2GVNA 2X3FA 1OLXA 3H99A 4RTNA 4EHDA 3LQ1A 3RVLA 1YNOA 4CMKA 1QSMA 2JGEA 3TE6A 3OQOA 4HNSA 4JODA 3IESA 1UDCA 4JBIA 2CTBA 3KELA 2N42A 2NG1A 3MTGA 4LHVA 2WMYA 5K99A 4F2PA 3A06A 1AV6A 2PAAA 2O8CA 1V1JA 2X5NA 3Q2OA 4CFZA 4D4LA 1OWPA 3NANA 3BZWA 2EZUA 3SJCA 3G8AA 1M2WA 1UMDA 1YFKA 2PIDA 3I4CA 1L4HA 3KSZO 2P8JA 4IXTA 4UHKA 2D5BA 1CJUC 2XTAA 3LNCA 5CNMA 3RBVA 4X64B 4X2TA 1KAOA 3PNPA 4MZDA 2ZXVA 2XODA 4HTFA 2FU5C 2OH1A 3TLGA 4V0KA 3IO5A 3NT5A 3K5HA 5LQNA 3OZSA 2FR0A 2OHOA 3G89A 2IU4A 4M8LA 5I7AA 2UZ3A 3O9MA 4GDFA 1RTQA 2C88A 2VF5X 4ONEA 3ZVKA 1YCFA 3WQQA 4EEXA 5AHXA 3VZDA 3RYCA 3CVJA 3GRCA 1M1YA 3QU9A 4URXR 2VJLA 3KR2A 3A14A 3BJ7A 1USVA 2OCPA 4G56A 4NZZA 4Q3OA 3U17A 3QAHA 3HA5A 2J8ZA 1A76A 1RTTA 2A9OA 2QN6A 4QVGA 4OQXA 3TCKA 2H2GA 4D97A 3LOUA 3OUUA 5FWDA 4EZBA 1JIXA 3DMYA 3VATA 4CTOA 4EKEA 2HDHA 2GEBA 3X1XA 1DX4A 2YV3A 4RLSA 3SYLA 3AF3A 5FHQA 2R8RA 1UPTA 2AT1A 1KERA 1YQGA 2X2EA 1NW3A 3KJZA 4YO7A 1C9KA 3UH0A 1CZLA 1QKIA 2QTFA 4JP3A 4D74A 2QBYA 1MZPA 3PPIA 4RTRA 1S9DA 3CRZA 3IBFA 3KKKA 1OH8A 1KFEB 1LBIA 2EOAA 4ZAFA 2PCLA 4QEKA 3NORA 3AW8A 5JDCC 2OYRA 1IPFA 1UJBA 4LRYA 3NHPA 5LP6F 3K20A 1AYEA 3EBPA 3MJ4A 1A9RA 4AQYB 3CWZA 2PQMA 4MAMA 4URZR 5BSRA 2IOFA 5JI2E 4ZQFA 4ZX9A 2CMGA 4IIXA 3HKCA 5H82A 2NSMA 2DHCA 4PYOA 1GM5A 3DOIA 4UEWA 1RHUA 3SD7A 2O0HA 5CFLA 4PPZA 3EEQA 1T1RA 3B89A 3EZLA 2XJ4A 3CT6A 4C4RA 3R23A 3LYHA 2ECKA 3NYWA 1EK5A 3M1AA 4L76A 3CWQA 3WABA 2FG6C 4YJ2F 5CDSA 3QAYA 5AW1A 4NJQA 2PVPA 4MVJA 4F9VA 1V6AA 3VYRB 1WMAA 3UUFA 1B93A 4B13A 3U9SA 3O5AA 3Q6MA 5BYBA 1DMSA 4IHAA 3KDPA 3ZDQA 2BISA 3OJ0A 2H2AA 4B3DA 4HRVA 5HBRA 1NVBA 3R41A 4YPVA 2JLMA 5ALGA 1KVQA 5KB3A 1PEYA 3RT9A 2B5VA 4EJMA 1JN0A 1KS9A 4QFBA 3HJGA 2ZYDA 4QUSA 1PYGA 1JILA 1RYNA 2IIQA 2QK4A 2VBFA 3HKBB 1JUDA 4L0QA 1GPKA 2GPYA 3FW1A 2DFTA 2IV2X 4C03A 3OX4A 4XIJA 4MVJM 3VU9B 4AJHA 3R7DA 5A4AA 1B0UA 1LFDB 4G89A 1EDZA 1FUEA 3LWDA 2GNPA 1WULS 5F73A 4DDTA 4J16A 2EWVA 1Z2DA 2VNIA 5IAEA 2AFRA 4AZTA 5HFAA 3K1TA 3NTVA 4E51A 1VCNA 2ZSAA 1DT5A 1R8YA 2DE0X 2GJ8A 3TGPA 4OI0A 5FQNA 4BE4A 4RVFA 4YIKA 3HGQA 2FQWA 3O8NA 1JEEA 5EP2A 1C4XA 1CVRA 1MF7A 5CA1A 3JQ7A 1Z2CA 4IHQA 3EWIA 3A2KA 4WZBA 2HIMA 1M2JA 1EQ2A 4XW2A 4NEXA 4Y49B 4MB2A 4U2FA 2HMWA 4R6XA 4YV2A 2JI7A 4KFSA 1O4WA 2WF6A 3C48A 4DG9A 3DXYA 5ALNA 1Q7LA 2ARHA 2AJCA 2GAIA 2O50A 4NDZA 2BHTA 4OI1A 2OZLA 1YE5A 1DWQA 3VPDA 5B6IA 5GVSA 1ZBDA 2Y0PA 3MJDA 3G2LA 4K40A 3GT7A 4BNYA 1TT7A 4C3UA 1C3JA 4H7FA 1E5VA 1DUVG 1XVUA 3DR3A 3QV1A 1C41A 3FOEC 3GJ0A 2XGJA 1HLPA 2D59A 4FOSA 2UYGA 4GI2A 3TSAA 2HJHA 3PZBA 4S05A 2X6TA 3LACA 4OYYA 2UU9B 4BX0A 4CM8B 1NVKA 3IT3A 3MS4A 5LQDA 2XCIA 1LI5A 1D07A 1TVMA 3SIWA 3V7FA 2XGSA 3GO4A 1F9EA 1PNQA 3AB3A 3EBLA 3RU9A 1UT6A 3HE3A 4P3XA 1E2BA 4HYYA 4GP7A 1OBRA 3GCXA 3OOYA 4V0RA 3HJHA 3S0JA 4P31A 4EB6A 1FF9A 3QMMA 5JIBA 221PA 1BE8A 4FOOA 4ZAWA 1P1CA 3I2IA 4XVRA 1G21B 3W8NA 3VC2A 3B3TA 1HT2E 2O8BB 4H0CA 4FSXA 2JLZA 2JHFA 1NMXA 4URYR 2G82A 2KW5A 3NM6B 4DHWA 1T29A 3M6MD 3SG0A 4J03A 1ECFA 1HE4A 3U7FB 3ZCQA 3LC2O 2C03A 2CLLB 2NO4A 1C0KA 2H1CA 5A9TA 2QTGA 2EW1A 2P2GA 3EWSA 1GQOA 1M6HA 1K7EB 5A4JA 1TLTA 2ZB7A 4IICA 2R96A 2GF0A 1ZSVA 3CNQS 4KBGA 5EPEA 2E21A 2YY5A 3TAUA 1Y1LA 1EGAA 1XZEA 3V2UA 5KNCA 3MRTA 3WAKA 4AZ3B 5SV2A 4UEZA 1ZI8A 3K6SA 2VBCA 4WGGA 1YVDA 4DADA 3OEYA 1M10A 4OQZA 3WT4A 4M83A 2OOSA 4ON9A 121PA 4OQLA 1IN7A 4C4AA 5CH8A 1P1JA 2EXXA 1EUDB 4MQ4A 2Q0SA 2VYFA 5HIMA 2BHNA 2DBYA 1DARA 3TLBA 3V1YA 3F3SA 1NVEA 2FPIB 4ZJYA 1ULUA 2ZPTX 3JU3A 1X42A 3HB7A 1W48A 1JI3A 4GVXA 1KKMA 3RRNA 2WWXA 5BVGA 5CYOA 3E9YA 2UZIR 2Z11A 2XIQA 2ZJZA 3UK7A 4I14A 2HZ7A 3MBOA 5J2UB 4OHZA 1H2AS 1Y5NA 2BV3A 1FA9A 3M89A 1VG0B 3MD9A 2OCBA 1RXYA 2J4CA 3QWAA 4I4LA 5B7QA 3SEQA 1Z5UA 1W76A 3LXXA 5LD2C 3H87A 2C1ZA 4Z9AA 5BOSA 4WINA 1TLFA 1BQ4A 1NBAA 1I13A 2VTEA 3IAM1 4FCWA 3R6DA 1B6BA 1R88A 1XALA 2JGDA 3RARA 3OLCX 4BNZA 5T6BA 1P1IA 4KCGA 4XNHB 1R6DA 4REOA 4X94A 1I5OA 3RANA 1T5OA 1KJYA 4JKOA 3E9QA 5G4LA 4PQYA 1QCYA 2ODBA 1SC9A 2YXLA 3UGTA 2GK7A 5DNVA 4KFUA 4JXZA 2DECA 1FU7A 1SHKA 2VUIB 2FE1A 4X1OA 2O5RA 1A2ZA 1ZI9A 3AL3A 2ZJ4A 3JQBC 5I9LA 1DTSA 1V8FA 2CV1A 1DIRA 1KJZA 3PI7A 4XWGA 2X7BA 2P9QA 1PKEA 2Z2IA 4AO6A 4HRXA 2VQYA 3FF4A 4K5QA 3S2IA 1SUBA 2WF9A 5REQA 1MPXA 3HWSA 3O7WA 1R3DA 5CA0A 1AHPA 1AA9A 1GV1A 4LDJA 2HJVA 1VL6A 3BEDA 3L82B 5DCYA 3JVNA 3NH4A 3VISA 3WJAA 5KYUB 5AUQA 1IEWA 1GP2A 4XYLA 1T9HA 1YMVA 1YC2A 1EFAA 1XNQB 3QOXA 2V3WA 1BXKA 1OX6A 1VYUA 2J3LA 3DOCA 4TV9F 1ZZGA 2QLBA 5KJEA 3WHKA 1PS0A 5IKMA 4FB5A 1KL7A 1IK6A 3N58A 1XEFA 1JKXA 4M0PA 2Z6QA 1TT5B 3O8QA 4ONWA 1UDRA 1Z0DA 4CM8A 3OTQA 3D3WA 2DT8A 3T9AA 2AR7A 2RJOA 3MTJA 1N4DA 3RW9A 3MUOA 4OL9A 4TYWA 3RPEA 4C5BA 1MD9A 1XL0A 5LFAA 2EDCA 2GZHA 4DV7B 4HLUA 1F1JA 3HFSA 2WTEA 4MGZR 4B6GA 1VPDA 1N0IA 5DM0A 1SVOA 2YNMD 2YWBA 4BNMA 3BM5A 3BWYA 3SHFA 1AM4D 3MOSA 2MYNA 1U4SA 2NVOA 3IMEA 4BCBA 1XNJA 1B41A 3GA0A 1V25A 1Y63A 3TW6A 1VKHA 3KHXA 2P7HA 1UL1X 3MIZA 4I9GA 3KQHA 3IMGA 1TK3A 3QXHA 4K6CA 2P0YA 3GYGA 3AOEA 5TQ0A 1QQ9A 4R1TA 4IDHA 2R44A 1RYMA 4NU8X 4BMYA 1TEVA 4OKNA 1KMNA 4NV3A 1WUKS 3DR8A 2D1RA 3NVAA 4ZV9A 2ZJOA 4WY5A 3ZGLA 2I1LA 4H6PA 4LCEA 1RJGA 4DA9A 1FDVA 3R4CA 4XIGS 1J5EB 2H3EA 4AZ3A 3EHDA 1W5TA 2Q4BA 3PBKA 4IDEA 5CVCA 2B78A 4EHNA 5KC9A 1LAPA 5JI3E 1ZXLA 1JTVA 4TLAA 1HMPA 2SHKA 2XZPA 3PL5A 3QPAA 1JDPA 5EXSA 2Z1NA 2JD2A 2IXDA 5BQ3A 4PONA 3SKXA 1OZHA 3K70B 3I01M 1VJCA 1I5RA 4BRWA 4QSMA 3DGEC 5CEFA 2HT1A 3C8UA 4M8NE 4LVUA 5DYWA 1YDEA 1ICEA 4L57A 1SFRA 1ZVVA 3NHRA 1KOFA 2OCDA 3LIIA 3PXEA 2OO3A 1M1DA 2H54A 3DVLA 4MW6A 1RPJA 4NBRA 4B3GA 2ZSDA 3BHJA 5BN1A 1RU3A 4B5PA 3CW9A 1TIBA 4TWIA 2Q50A 3VTFA 1I1DA 1SEVA 3E27A 3ND8A 3ETLA 4QDTA 1Z9UA 2FWNA 3TNYA 2ZIGA 5ALOA 4HS4A 3RU3A 5BNZA 2WA2A 3ETCA 2ZT6A 3HC7A 3HP7A 5K8CA 1ZAYA 1U2TA 3HZHA 4OP4A 1Y3IA 4W5JA 3DPIA 3QY0A 4PLYA 1GQQA 3ORSA 4NNOA 3ZUPA 2CV2A 1UPCA 4X3OA 4ZY0A 4PZZA 1B76A 4ND5A 4XYGA 4Z9FA 4GQIA 4FUUA 3D8SA 721PA 1SXHA 4HEQA 4CMIA 4MLPA 3VYVA 4DJJA 2FVYA 1W19A 4AY2A 5JSUA 3GWGA 4OUKX 2GBCA 5I3ZA 5JANA 3KO8A 3T9FA 2IKSA 4FPXA 4Q3EA 3UMRA 4B3SB 1U7DA 1AGYA 2ZBFA 3Q88A 1G19A 1KI2A 4PLFA 3KE8A 3F4KA 4KXYA 5ALYA 1SHLA 4B12A 5IBPA 3OQ1A 4R2LA 3K1JA 2PKRA 2ZAMA 3D7SA 2FPSA 2C3OA 1I7QB 4JGGA 4YJGB 5FXMA 2XDYA 3HS3A 3K1AA 1YUMA 3Q3VA 4OOFA 2GVZC 1V6CA 5JJIA 4DOMA 2BSQA 3ADDA 1F2UB 3ID6C 4PXSA 4FVTA 2Q45A 1KGDA 1UDXA 2R751 3KOMA 4ZIRA 1NHWA 4TL9A 3AM1A 3D4IA 4MHPA 2H5LA 4UTPA 2IY9A 4W5WA 5DWNA 1QGAA 3M70A 4TN5A 1DAIA 1S02A 2JPDA 1H2FA 4CS0B 4OHXA 1USGA 1L7XA 2HNAA 3JZFA 4KIGA 3KNZA 4M4SA 5CIQA 3DBIA 5INTA 5JO0A 3P2HA 1X7WA 3DAFA 5F1PA 2IUYA 1Z0IA 4A6EA 3F96A 2NWQA 3L6UA 3EIFA 3PYLA 4B85A 2IBSA 1Q0HA 4RF4A 4ZJUA 3ZZ1A 1Z8DA 2V7VA 3JTMA 4Z99A 5BWBA 4Q9LA 1XTVA 2ATXA 3N7UA 4JJAA 4V38A 5K0FA 4MGHA 4PZEA 2I03A 4KMRA 3SMQA 4AG9A 2V77A 3DHNA 1EE1A 4MI6A 2OWEA 2I3AA 3M9XA 3I37X 4A8HA 5DGXA 3RRMA 2XKAA 4XB6B 1THMA 2EP8A 3P2IA 3WL3A 5FTWA 4NOLA 6YASA 1E61A 3DEFA 1Q1NA 3VVCA 4IP0A 5AKKA 4FFBB 4N5LA 5DASA 3HVKA 3EXFA 1WVIA 5ESXA 4JNCA 3UCFA 3QG1A 1XU9A 4HVCA 1T8SA 2Q0HA 3NNDA 4BLWA 4PRZA 2ZSKA 1ZH4A 4WE3A 1CQJB 3ELBA 3JW8A 2K5UA 5CA1F 2AK2A 4RS3A 2I2FA 1LJ8A 1P0FA 1ZIXA 4Z2AA 4CEHA 3G6KA 4MLZA 4D0RA 4TS4A 2UZ1B 3R0XA 3ZUGA 4EX7A 4DXHA 5IX8A 5JNVA 3A9UA 4C7IA 1LPOA 1NZFA 1Z4PX 1JFLA 2P9HA 3PQDA 2PYIA 4H4DA 1VG9B 4NLLA 4QATA 5G21A 4B6ZA 2R48A 5ECYA 2JLUA 1TKJA 2Q21A 4BLUA 2I76A 1SVIA 2G0BA 3DKRA 3LYAA 4IRXA 4OOEA 1JLKA 2HZBA 2WHRA 3CF6R 3VHLB 5KQRA 2VJQA 5J4YA 5L3QB 1R57A 3FYSA 5A6SA 3AFHA 2CLFB 4L4ZA 2RJNA 4LDNA 4M9UA 3BRWD 5J63A 5JARA 2GEDA 3KLNA 1ZJYA 5ALSA 5EE3A 2IH4A 4C29A 3PC4A 5T41A 4OLJA 3WTBA 2Z1MA 4ZDWA 3ZQKA 5BRNA 4X3RA 1JHMA 4IDAA 1BS9A 3QE3A 3ZV4A 3I6BA 3K9NA 2AI2A 3KSDO 1QGUA 2BFPA 1TCUA 4BVJA 4EG3A 4RENA 1QQ5A 2OILA 1XCMA 4UF4A 2ASEA 4HB3A 3G2NA 3UMVA 1ETHA 5AXCA 1XNHA 3M4NA 5DULA 1ZJ5A 4CMBA 2XZOA 3RGWS 2Q4TA 1BJKA 4MR9A 4DV0B 4ZDJA 1GAQA 4E12A 4I8XA 5AO9A 5DN6D 5FVJA 5A28A 2XITA 1EWRA 1JQJC 3ND9A 4I9NA 3MT8A 4KSYA 4P2BA 3ROMA 2NQ8A 3OMLA 3P9NA 4KVAA 1PW7A 2OG1A 1MQ8B 2QT1A 3DVQX 2IJGX 3FVRA 3IP9A 1GZDA 3PCRB 3QV2A 3MPOA 4HWSA 4L5AA 4XTRA 4WXEA 1PWEA 1T8RA 2ZYIA 3MTDA 2B4DB 2ZI4A 1G3IA 2QMYA 1FMJA 4MB0A 3EG9B 4CL2A 2XXBA 1IBKB 3TOAA 2JD1A 3AFNA 4G5QA 4ZDKA 1QH1B 1MABB 2CXHA 4BV3A 2AQKA 2IZ1A 3W5UA 3BTUA 2LW7A 2R86A 3DUWA 4DNOA 2H7VA 1ZGZA 3A1NA 3BICA 3D7DA 4H7HA 1R6VA 3LBIA 4GPBA 3W0LB 2LXNA 3FOFC 2WM9B 4Q1VA 1ISPA 1KJ9A 3CLRD 4OH1A 3ZU6A 3O4VA 5AJYA 5LL6P 3K4QA 3KKQA 1XQ9A 4FLFA 3SX2A 3PXXA 4UW9A 2QLNA 2AQIA 3KQKA 1SHZA 3BTOA 3DUFB 3I30X 1YQTA 1VIAA 5SZHB 4KUHA 4TQGA 5ES3A 1RQPA 2JAXA 3Q3JB 1E5DA 3SQLA 3ANYB 4B3MB 1L4KA 1RM5A 4V0NA 3PQFA 2J4FA 1GLNA 2B1QA 5TS2A 1J70A 4UCFA 5FEMA 4W9NA 2IUUA 4P82A 2B61A 2YIDA 3UOAB 2HIGA 5IM4F 1P61B 1QFYA 3R9WA 2QGFA 3NO4A 1VB3A 1YR3A 2C5HA 1F5NA 2JS7A 3TZKA 4LTDA 3R9IA 4CW7A 1GR0A 5I8WA 1E77A 1RXSA 1G98A 1GNVA 1WXXA 5IJ9A 5JD4A 4JI8B 5AKXA 5KCMA 2CZCA 1YR2A 3HDHA 4EVRA 4N7BA 3GXOA 1MA0A 1V8OA 3NOOA 2WU3A 5EC8A 1Z38A 3ASYA 2BONA 4KO1S 4OM7A 4A6DA 2R1VA 2R7HA 4MCQA 4MFLA 4W1QA 1GSAA 2L2QA 5KYVA 1CVIA 1EHYA 1QZUA 4WH0A 4FR2A 1PCAA 3BTVA 4JL5A 4OX9B 2HHJA 3P52A 2JGFA 2GERA 3AEUB 4CM4A 4Z0HO 3OJEA 4TYPA 5DI3B 4DLZA 2FZWA 1N2CB 4DWWA 3IRVA 2BW0A 3EDOA 2B5OA 4YNBA 5U9CA 4O0MA 1QH1A 4IH9A 1VLZA 3CE9A 5A02A 3IP5A 3TX6A 4A0SA 2WPXA 3CSSA 2PT5A 3JWPA 1FXWA 3E0QA 2QS9A 2YVUA 3RJMA 3V7ZA 3OCYA 4A0RA 4NZ9A 4Z86A 5ILQA 2PJ9A 3BMXA 3RBXA 4UDXX 2ZWPA 4ER3A 2VCEA 3E22B 5SY6A 3V4VB 4HDKB 3SI7A 1U02A 1IOIA 3HP4A 3P8ZA 1KSHA 5FOSA 4R71A 3PB7X 2GXQA 2Y05A 1YTUA 3CU5A 2EBJA 3QF4B 1A97A 2HEIA 1VL1A 4KR9A 4X8LA 4Z1MA 1HNWB 3TDNA 1F8XA 2XYPA 1JG4A 2MSNA 3WFZA 1GL7A 2DLCX 4LVOA 1BCSA 1VLVA 4ZVTA 4JI5B 1UODA 1FJHA 4WTOA 2WFLB 4JYMA 5DNEA 3RHSA 2Q4ZA 1J20A 3GA5A 4JL8A 3ZU4A 1VPEA 2VPWA 2O6LA 2ZSFA 1V9SA 3ENVA 3PHIA 4CU5A 1A27A 2UVDA 3U09A 4EJSA 4ZOQI 2WJ3A 3Q40A 4HDNB 3D7MA 2ZAGA 3ZEAA 2PMCA 4JN6B 2CFIA 3ZGOA 4JI2B 3HXMA 1HM5A 4EQ6A 3IUSA 5KNBD 1SQ0A 3EYAA 3FUUA 1SUDA 3IUNA 4UNSA 5J3JA 1VHOA 1HC7A 1KJNA 1Y37A 1Z17A 2QMHA 3JZIA 2FUCA 3L0OA 3B7PA 4W1RA 2PH7A 3DZIA 4WV3A 2R00A 3WP1B 5T57A 4MYSA 2AKYA 4NY1A 4MV7A 5BV2P 2ZTMA 2H1FA 4PAWA 1U3WA 3NBMA 5KVAA 3T0IA 3S40A 3ANTA 4H18A 4R6WA 2NAPA 5DBEX 3MRUA 3HTXA 1JEYA 1IRIA 1QV7A 3KWLA 3AB8A 5AVXA 2NO0A 3QFRA 1ZK3A 2C0CA 1AUXA 1SNYA 3SIPA 4WSOA 3KYJB 1YFJA 4XX0A 1JU9A 3L6CA 2Z58A 5D51S 3LUCA 2CLCX 5IBQA 2JFVA 4ZARA 3IE1A 4KR0A 1MEOA 3AP2A 4ZC1A 4TMXA 3X0DA 5B1DA 1DXOA 2FN4A 3FA2A 4J0GA 4B3HA 4I1UA 2ZIEA 3EGDA 4GI3A 2D2EA 2ZOSA 4HAUA 1KMHA 5EQFA 4LFCB 2R7KA 3PGMA 4HNGA 2FIAA 4EUSA 4CLEA 1ESCA 1AGXA 2E85A 2Z2XA 3QEKA 1SOAA 3MJRA 3VFDA 1QSTA 4TUYA 5HDQA 3SMVA 2QVPA 1W0KD 2FFBA 1AXEA 4D3FA 2K4MA 3MGKA 1EE3P 1YDHA 5ECWA 1GA6A 4MJXA 5AXDA 5JVDA 1U6JA 3NHMA 2PMEA 4DCVA 3UFXB 3KS9A 3H4QA 1PLKA 1NVXQ 1E2GA 1DWPA 4YREA 4AJ4A 2R8BA 4DUKA 3IA2A 3NMUF 4OGKA 5IZ4A 2QSYA 5GZ6A 2WIFA 4IDQA 1ZX1A 2V1XA 4AIIA 1ZNWA 3BK2A 1D4OA 3MD0A 4TV9A 4YP5A 1XCJA 4NBUA 5IPFA 2Q1YA 4D5EA 1ODCA 1NG9A 4YRLA 4B3TB 3A6PC 4YFYA 4MHSA 3H13A 4BQOA 2B1RA 3DFFA 4IVNA 5F4ZA 3CRVA 4OC2A 4BQIA 2EV9A 5CPFA 3BJRA 5AG4A 1Q91A 3TLCA 4P4JA 5KNBA 3MVEA 1Z6ZA 1PR4A 2JFZA 2Y3IA 4P4TA 1LCPA 2OFWA 3WKEA 2HLDA 2XQIA 4UCQA 5EPUA 1UDAA 1VHWA 3RM3A 4B35A 4ZJZA 2QJTA 3TZCA 2ZRLA 2XTZA 1NVVQ 1OTYA 4JFAA 1V1RB 3H86A 2WDZA 4E31A 2XVAA 4XPZA 3ZHCA 1I6WA 1JLLB 1C3LA 3U1TA 3TQCA 5AUPB 3GRZA 4AL4A 7REQA 1EINA 1X8JA 1N92A 3KKPA 3RIMA 4A95A 4HAZA 2DKOA 4HXFB 3LBHA 2FN9A 2Z9DA 3C15C 3Q3GE 3TBKA 2HCBA 2OUKA 3H9QA 5I4IA 3TZ6A 4D79A 3IWWA 1U3GA 2ZTHA 3GLGE 4ML3A 2GLUA 2O2XA 1ULSA 4TQ9A 1ZONA 3DDNA 5AHWA 1DTWB 1UOEA 4FYHA 4A5SA 4B6QA 1MJAA 2IW3A 2W9XA 2ZBQA 3AB7A 5EFZA 1YB6A 3TW8A 3V4LA 5BNTA 4DV6B 4IK2A 4NFYA 3SDSA 1UIRA 3VPHA 2LIPA 2Q2OA 2OEPA 3V1MA 1UJCA 2PBRA 2VH2A 4BP9A 3BCUA 5JFTA 5KNBH 2EK8A 2NYQA 2AG0A 3AWIA 5L6LB 1ZRHA 2IFTA 2NYAA 2CD7A 1BKYA 1SZJG 2G7ZA 3DVAB 3G6WA 3IUJA 3K4PA 2J9FA 1AN9A 4KN5A 1TO1E 1G0NA 3AOEC 4M9QA 4L27A 1HE5A 2WPNA 5L3ZA 5IN5A 2OAP1 1BAVA 2OV3A 5FTLA 3G2HA 3WKAA 2Z30A 2I29A 1POXA 1SD1A 3VSDA 1XEBA 3RNZA 2GSDA 1QLWA 2I8AA 5EUBA 4C4PA 4KOXA 4R9NA 4B8WA 4IDNA 2J3DA 3NTXA 2Q9BA 4EJ0A 2B6HA 1NBIA 3C6QA 4U9HS 1Y3HA 2GF2A 4W8OA 6CPAA 4L89A 4MKFA 2B83A 4OHPA 4KC0A 3KBBA 4ED9A 4M60A 1R50A 1YONA 4U8HA 1O03A 2XSZD 4NHOA 4YRBA 3ANMA 1E7YA 2QKYA 3ZY4A 3H2KA 5A4FS 3W90A 5B3KA 1RWPA 2BM8A 3D64A 2WU1A 3UWPA 1PWHA 1TQ4A 4I4TB 1CX8A 5GP1A 4UBMA 4HL6A 4QIHA 4ZVOA 4J3JA 3PA6A 1ZVKA 4P98A 1S1MA 2H5IA 4YJ3B 4E4YA 2QT0A 5C8XA 2PXXA 5AKEA 3FGNA 1HT0A 1HZZA 1N5IA 4F8ZA 1RXTA 4ALJA 3Q1KA 6LDHA 4L2IB 1E2IA 4XQEA 5DYIA 2NZVG 3A6GA 1OYVA 2CDNA 2YY6A 1E9EA 3E53A 2H1SA 2OO5C 2YRFA 1RADA 4CAVA 4KVME 2PJ6A 1RHRA 2ZULA 2JCSA 1SVLA 5JD5A 1Y1KE 3OLZA 2G8NA 4UJ5A 4YAJA 5IH3A 2GHIA 1NJ8A 2BKUA 2MMCA 2ZWVA 4PNPA 5C2JB 2Y1EA 4CIXA 4UBRA 3R76A 1S7CA 4H08A 4HNRA 2OCAA 2O7QA 3GCDA 2GCIA 2NOAA 4R3UC 1E1QD 1YVEI 1FFWA 4R2WA 5HF5A 1Z9BA 2HI0A 3BXGA 1FSGA 5B2FA 1XZFA 4RDCA 3T54A 1IZ0A 1UMCB 1WHTB 4JI1B 3WJ7A 3DAOA 2FWRA 1Q2CA 3B2YA 2DB3A 1HKUA 1UOOA 3ONFA 4NXNB 2GEVA 2FJ0A 3DLPX 4WT7A 4ARCA 2WIAA 4LXIA 2QW0X 3M6FA 4GMDA 1FDIA 1PJCA 3FUCA 4PK2A 4F9FA 2DQYA 4KQ2A 4A91A 1N36B 1T8YA 3PC2A 3OFNA 5K6RA 3S2ZA 4NL4H 2VDQB 2XLCA 2CUNA 3QSYA 2AFHA 2J3EA 1FW6A 2PMDA 3QVMA 1CEEA 4DILA 1LCIA 1MAHA 1O6GA 1W87A 2WJYA 1B8VA 1KC3A 3B5JA 3R3VA 1MOSA 1IUNA 2IXAA 1FDRA 2J9YB 3SXPA 3ORYA 4JQSA 3W7VA 3KJFA 1WPGA 2VDRB 3FRJA 3KASA 4M1TA 4OGLA 3NXKA 4LYFA 2IP2A 1U4NA 4M8SA 5HOQA 2B1IA 2QAIA 3AUUA 2Y93A 4UJ3A 3PCXA 1XVIA 4NMHA 4XUEA 1XRSB 4UE3S 4RQUA 3I9V1 4E11A 1EJ6A 1X7WB 4BDTA 2ZJ3A 1YVOA 3VH9A 4AF7A 5BSFA 4XM2A 2DPYA 2WRZA 1WCIB 2YJ4A 3DE7X 4A5OA 1PVVA 2ZUCA 3R09A 3ZGVA 2J67A 4B84A 4UM9D 1YOVA 4BX8A 2W6ID 1SUIA 3MK31 4B5LA 3CC8A 4F9GA 2JCXA 4WXPA 5BYKA 1C9DB 3H18A 3R3SA 4G09A 1UXJA 3BBPA 2X58A 1S2LA 4IEIA 1PNOA 3AFIA 4IV8A 4MVJF 4KQHA 4YJ2A 1ZR4A 1I3CA 4KFRA 3VZRA 1NJSA 2IUSA 4UWJA 1ZM7A 3JYLA 5HS6A 4HK4A 3HUTA 1MW9X 4G0XA 5JXGA 2ZVJA 3G7NA 1CUCA 3YASA 4OMEA 1SUEA 1V8BA 4L85A 1YVPA 2JZOA 1EUCB 3DM5A 1S5KA 3CFYA 5DHPA 4P4SA 2H00A 2AFWA 3PFKA 4JXQA 2P78A 5LP6A 4Q3CA 5HWSA 2CLHB 4D8YA 2PX4A 3L7IA 4F3KA 1GKLA 2B3DA 1G18A 1YCHA 2YOGA 4NGRA 4OFZA 2CXOA 1B4DA 2O6HA 5JD3A 5TEVA 1BD4A 4ZT4A 2IZ0A 2WWFA 2ZYVX 1KH1A 3C45A 3UG7A 4AXBA 4GOKA 5ENDA 1FVFA 2RD2A 3GL9A 3LKDA 1SCNE 1N6KA 2P2CA 3GRKA 2AX4A 4IFTA 7ADHA 3RGGA 3KYIB 4PPNA 1U2QA 1VMDA 5CNKA 5FD8A 2APJA 3QBEA 3ZIAD 5A5FA 1XE4A 1GGVA 3L8YA 2QZPA 1W6UA 1FLNA 2NVUA 1NQXA 4TRRA 1QO7A 3C3JA 2EBFX 2RGAA 3RH0A 3SOPA 2ORWA 3OPYA 5G02A 4YLGA 4N0DA 4MJ8A 2HYDA 5JE8A 1SB8A 1IQPA 3THOA 4HG2A 3EFBA 4UBOA 3EGEA 1O77A 3HWX1 1ZRSA 2KBEA 2AUMA 5DEIA 4TL7A 1D6NA 5BSGA 3IJPA 3O4JA 3QEMA 1ZJJA 1X1SA 2HXSA 1NZDA 4EHFA 2Y66A 4DUZB 3MINA 1D9XA 1B6RA 3BF8A 2ZLBA 3VGJA 1E8DA 1I6LA 3E6AA 1M2VB 4JLNA 1Q21A 3OZRA 3PYMA 4II3A 1OTHA 1Z08A 2OM2A 1I4EB 3GH1A 3MHPA 5G20A 1CY4A 2KWIA 3BREA 2CCGA 5AT1A 1MNQA 4LNAA 4OXYA 4UBJA 2LRHA 5BPHA 2JDID 1SXJC 2P6PA 4CT0A 2E5WA 4X1KA 3N86A 5JCJD 2YL2A 3D4BA 3X43A 4BATA 1Z2EA 4DAEA 3PHHA 4G1CA 3GLFA 2D5CA 1TK9A 2EC5A 4X97A 4B14A 1K88A 3FWZA 1I3KA 4Z2YA 4BVBA 3W91A 1KDRA 2E1RA 3LDFA 2YUIA 3ZHTA 1PQWA 1H6CA 1HLDA 2AZDA 1TYDE 5HIJA 3BQ9A 4J4HA 3PQEA 4Z4CA 2PH5A 3LZ6A 3FHJA 2OHFA 3KQMA 4KE9A 4TLBA 3WR5A 4ZCTA 4IZHA 2AG8A 2MMGA 4C06A 4F97A 5L95A 3RO7A 4UAGA 2IC5A 2VJPA 1BFDA 4ISBA 3U13A 5F3WB 3NIWA 4MKZA 1N57A 1LSSA 2YN2A 3LXMA 1CHNA 3GZNB 3IUBA 4LSMA 4XFKA 5FB3A 1FVOA 3A1WA 5D5QA 5FA6A 3ZWWA 2XB9A 3AVWA 1PYTB 1ZNZA 3L4KA 1ZG7A 2DAPA 4WCFC 5DN6A 4UVHA 4MKHA 4GZ6A 4KXWA 1BNCA 1NIJA 3GNSA 1DCTA 4QUHA 3VPCA 3C5VA 1QF7A 3FRMA 2VH1A 2QM0A 3L0SA 3MWFA 4F5DA 3HDYA 5FPKA 1H2EA 3AM4A 1JLMA 4GPD1 1E94E 1QGZA 1XDWA 4HGRA 1H4SA 1QOPB 2IV7A 4F8YA 3HLPA 5J1QA 3MOIA 4JOSA 3HU1A 5IKEA 4MR7A 1IN6A 5FO1A 4S24A 3DNFA 1P0IA 1SKYB 3A4IA 4AVAA 1D5WA 1MP0A 5D8DA 4PFKA 3FNBA 5JCOA 4LGYA 1VKOA 3Q98A 2AIRA 1ELLP 3TOCA 2YYAA 1RQXA 2QPAA 1UMBA 2C5BA 2OMKA 5E4TA 1VTKA 1BVUA 2W8BB 3VNBA 4RD6A 1IM2A 1S01A 1GUBA 1KMIY 2NTJA 5EJ7A 3ZWMA 2J59A 1U2DC 4ZAGA 3X1DA 3JQAA 4E30A 1C9MA 5ELXA 3IPXA 2IX3A 3EWAA 1UPBA 3PD7A 4QBFA 1NXVA 1WZNA 2VAPA 3DFUA 4ZXPA 1AMUA 4MQBA 2KBFA 3EE6A 1ZD4A 2PKQP 3UM9A 1VKJA 1Q0RA 3L7JA 1AA6A 1TQ6A 1M2GA 2NTNA 3D6UA 3PHJA 3WNZA 3UGJA 1N5MA 1ZSNA 1Y42X 3K0CC 2Q9UA 2IK8A 1U8TA 1HOTA 3QKRB 4II7A 1IHYA 3WGJA 1PIWA 4LXTA 5C35A 1YGHA 2D5IA 3EFOA 3QXSA 3KJNA 3CZ4A 1LX6A 3H1FA 1BDJA 2D4AA 2ESRA 2R1UA 1F9AA 3SX0A 1H8HA 4BHTA 4YDRA 3Q72A 2FPKA 5E2BA 4DCMA 4FT2A 5TT0A 3R1KA 3MMNA 2PSDA 4QUEA 1X1RA 4UMDA 4KAFA 1C0PA 3OPYI 3UAWA 2Z9CA 4KXQA 4GF5A 4AUMA 3VYSB 1DE4C 4L8AA 4PQRA 3BFJA 3OIDA 1F7VA 4TRNA 3AOGA 4YI3A 3KUKA 3GCGA 4KOVA 3W6UA 4NICA 2HK8A 1LRKA 2Y4NA 3GLRA 3IEIA 1GFSA 1V41E 1F2TB 3FNHA 3PU6A 4XIYA 2Q6OA 4P7GA 4BFCA 1VZ2A 3NLLA 4KE7A 2G1JA 1YCDA 2RK4A 1NVVR 1P2TA 1JKFA 4HI0E 4C7HA 3OPMA 1RLMA 4I66A 3HVRA 4H3VA 4IDDA 4XA8A 2JLCA 2GO1A 3EVTA 3FI0A 3TIGA 3U4CA 4C87A 2PQ6A 1CZHA 5DMXA 5IRCD 1JFTA 2H06A 2ZITA 1KDTA 2F3QA 3A9TA 4L4RA 2W22A 2QDKA 4FGWA 1KGSA 3EGOA 3M6AA 2VF7A 3QE2A