5KTCA

Fdhc with bound products: coenzyme a and 3-[(r)-3-hydroxybutanoylamino]-3,6-dideoxy-d-galactose
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
187
structure length
187
Chain Sequence
b'VNFNLKANTTYLRLVEENDAEFICTLRNNDKLNTYISKSTGDIKSQAEWIRNYKNRENNGEEYYFIIFRSDDQSPIGTVRLYDFHENPKSFCWGSWILNEHKTKYAAVESALLVYEAGFSTLGFEQSHFEVMKGNDKVHSFHLKMGAQKISEDDENIYYIFPKSKYKENKIQYARFLGKLEHHHHHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FdhC
molecule tags Transferase
source organism Acinetobacter nosocomialis
publication title Structural and Functional Investigation of FdhC from Acinetobacter nosocomialis: A Sugar N-Acyltransferase Belonging to the GNAT Superfamily.
pubmed doi rcsb
total genus 61
structure length 187
sequence length 187
ec nomenclature
pdb deposition date 2016-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13302 Acetyltransf_3 Acetyltransferase (GNAT) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 5ktcA00
2IL4A 1I12A 1Z4EA 2H5MA 3GY9A 3FXTA 4NEXA 2G3AA 5HMNA 5IX3A 4MHDA 3PZJA 4R9MA 2HQYA 1Q2DA 2VZYA 3D8PA 2Q0YA 1IIDA 3F8KA 3GYAA 3R9FA 1MJBA 2OZUA 4CRZB 2FXFA 4R87A 1YK3A 1XEBA 4H6UA 5CNPA 4KVME 4GS4A 2NMTA 4U9YA 5F46A 2ZW7A 1XE4A 2OU2A 1S5KA 3PP9A 1U6MA 2QIRA 4KOTA 4XPKA 4AVBA 4HNYB 2C27A 1Y9WA 5I0CA 3I9SA 4PV6A 1XF8A 1IYLA 3LD2A 1R57A 2FL4A 3IGRA 4Y49B 2JLMA 4PK3A 1P0HA 4AVCA 3FB3A 1M4IA 4IF5A 2BSWA 4OLLA 4KUBA 3OWCA 3ZJ0A 2EVNA 2FT0A 2D4PA 2EUIA 2I00A 3TFYA 4HNXB 3DNSA 4JD6A 2B4BA 2B4DA 5C82A 5H86A 4E8OA 1OZPA 2PR1A 4LUAA 3TO9A 2BEIA 1M4DA 2PRBA 4ORFA 3R9GA 3C26A 4I49A 4KOUA 3SHPA 4QUSA 4AB7A 1XMTA 1MK4A 4JXRA 4U5YA 2R8VA 2ZW6A 4OAEA 4KVOE 5F47A 3D2MA 4B5PA 4FD5A 1ON0A 2FSRA 4FD7A 4M85A 1S7KA 4NCZA 3P2HA 4Y49C 3DDDA 1J4JA 1NMTA 2CNTA 4EVYA 1YVKA 2GIVA 1KUVA 4XNHB 4E0AA 2GE3A 5JQ4A 3S6HA 4B5OA 1QSRA 3TT2A 1FY7A 2WPWA 4CAXA 1M44A 1IB1E 1KUXA 3BJ8A 3TTHA 5DWNA 5J8FA 1I21A 1UFHA 3FBUA 3W6XA 4E2AA 2FIWA 2Z11A 4F0YA 2P6GA 4MBUA 3CXQA 4KOWA 1V0CA 1CJWA 2VZZA 1YR0A 4MI4A 2PQ8A 3R1KA 4XNHC 1QSMA 4KOSA 4PSXA 1S3ZA 4HNWB 3S6GA 5GCNA 2G0BA 4KLVA 2PDOA 4PK2A 4QBJA 1S7NA 2J8NA 3VWEA 3KKWA 2FIAA 3SXOA 4QC6A 2P0WA 4QVTA 3T9YA 2ZXVA 4R3KA 2ZW5A 1YVOA 3EFAA 1CM0A 2B58A 3SXNA 1Q2CA 1WWZA 4XPDB 1PUAA 1QSNA 4XPDC 1QSTA 2WPXA 3JVNA 5KTDA 4KZTA 1LRZA 2JDDA 2AJ6A 2X7BA 3DR6A 3W91A 2CY2A 4B5PB 2G3TA 3EC4A 3N7ZA 2F5IA 3EY5A 1B6BA 3DR8A 2VXKA 3TCVA 2Y0MA 2BUEA 2VI7A 3QB8A 1RXTA 3FYNA 2Q04A 4NF1A 4F6AA 5JPHA 3F0AA 3UY5A 4MJ8A 1WK4A 3P2FA 2Q44A 4JJXA 4KOVA 3FRMA 3TO6A 3H4QA 1Z4RA 2ARHA 4CAVA 3TOAA 4R3LA 1IICA 2B5GB 3GKRA 4MY3A 4PSWA 1Z9UA 5ISVA 1M4GA 2O28A 2HV2A 5C88A 4JXQA 3R9EA 3G3SA 2PR8A 1Y7RA 2QECA 3LODA 3JUWA 5FVJA 2I79A 3R95A 2Q4VA 3FNCA 4UWJA 2JEVA 5DWMA 3V8IA 4DNCA 3K9UA 2Z10A 4H6ZA 2Z0ZA 2HUZA 4UWIA 4FD6A 3T90A 2P6EA 1BO4A 3BJ7A 3VWDA 5H84A 2R98A 1TIQA 1K4JA 2RC4A 2A4NA 4L89A 5KTAA 1KUYA 2REEA 3IWGA 3E0KA 2VQYA 2D4OA 3TOBA 1MJAA 4M3SA 1YLEA 2R7HA 3S6FA 2GANA 1YGHA 1VKCA 1QSOA 2K5TA 3RYOA 4X5KA 4RI1A 1YX0A 1NE9A 1I1DA 1M1DA 3BLNA 5E96A 4II9A 4HKFA 2BL1A 4NSQA 2Q7BA 1L0CA 4KUAA 1Q2YA 4YRHA 3TE4A 2DXQA 5J8CA 2AE6A 1XIXA 1KZFA 4NXYA 2FE7A 1BOBA 2J8RA 4YFJA 3TO7A 5F49A 3NE7A 4OADA 5KTCA 3F5BA 4K30A 4RS2A 4KOXA 4CRYB 2PSWA 2PC1A 3I3GA 4JLYA 1S7FA 4ONUA 1VHSA 2Q4YA 4CAWA 2B5GA 4J3GA 4CS0B 2JDCA 3QAHA 5HH1A 4KORA 4AVAA 2B3VA 4XPLA 1S7LA 5IB0A 3CXSA 3B8GA 2FCKA 3EXNA 1GHEA 5F48A 3G8WA 4U9ZA 1MJ9A 2CNMA 4MY0A 2J8MA 2OB0A 2CNSA 1YREA 4R57A 2KCWA 4BMHA 1Y9KA 4UBRA 4H89A 2OH1A 4LX9A 3S6KA 3D2PA 3WR7A 1RO5A 4AG7A 3PGPA 3CXPA 4YGOA 1N71A 1S60A 2P6FA 2B3UA 2R1IA 3DSBA 3ZZIA 2OZHA 3R96A 3D3SA 1IYKA 3EO4A 3W6SA 1NSLA 2FS5A 2B4DB 2ZW4A 4UA3A 2ATRA 4KLWA 4IUSA 2ZPAA 2VBQA 5IV0A 4KVXA 4KOYA 4AG9A 4QB9A 3MGDA 5EC4A 1PU9A 5EBVA 4L8AA 1B87A 4FD4A 1P4NA 2VEZA 2QMLA 4JWPA 1SQHA 3FIXA 4ZBGA 2REFA 2OZGA
chains in the Genus database with same CATH superfamily
2IL4A 1I12A 4IK2A 4ONWA 3CT9A 4RUHA 2PJ9A 4B12A 1Z4EA 4RN7A 4ZYQA 2H5MA 3GY9A 3FXTA 2AFSA 4NEXA 4ZY2A 4MCPA 4WJBA 2WYRA 2G3AA 4NGTA 4A37A 3SI2A 5HMNA 5IX3A 4MHDA 3PZJA 5IB9A 4MCSA 4R9MA 2HQYA 1Q2DA 2VZYA 3BI1A 3D8PA 4C7HA 3IJ3A 2Q0YA 2OR4A 3S9LA 1IIDA 3F8KA 1CPSA 3GYAA 4MHNA 4P4BA 4B11A 2PJ0A 4AXVA 3R9FA 1FT7A 1MJBA 2OZUA 4UIBA 4CRZB 2FXFA 1IU8A 4R87A 5F09A 3PB9X 4M6GA 4A94A 1YK3A 3IIBA 1XEBA 4H6UA 1AYEA 5CNPA 5K8PA 4KVME 3PB6X 3B3WA 3S9NA 4GS4A 3H8FA 3NH5A 4BBHA 2DEAA 3KR4A 2ODFA 4OC1A 2NMTA 1R3NA 4U9YA 5HXDA 2YNDA 5F46A 5G20A 4NJRA 2ZW7A 1ZG7A 1XE4A 2HC9A 2OU2A 4A2ZA 1S5KA 3HLPA 3PP9A 1U6MA 4NGNA 2F7VA 3PRTA 5A27A 2QIRA 1ZO0A 4KOTA 4R7MA 3SJXA 2PJ4A 7CPAA 3H5ZA 3KQXA 1XJOA 3GLJA 1FNOA 4XPKA 2POKA 4AVBA 4MFKA 1R43A 1ZLIA 4HNYB 4F9VA 2C27A 1Y9WA 4MFQA 3RZAA 2OOTA 5I0CA 3I9SA 4PV6A 5I4MA 3D68A 5AGEA 1XMBA 1XF8A 1IYLA 4ZX8A 2PCUA 3LD2A 2PJBA 1R57A 1PYTB 2FL4A 3IGRA 4PXCA 4Y49B 4FBEA 2JLMA 2RFHA 3KI9A 2EWBA 3JRUA 4R76A 2DPSA 1P0HA 3D66A 3FB3A 4PK3A 3NH4A 1M4IA 4AVCA 4C2XA 4IF5A 2BSWA 4KUBA 4OLLA 3DGVA 3OWCA 5AG6A 2EVNA 2PRQA 3IC1A 2FT0A 3ZJ0A 4C68A 2D4PA 4R6TA 2EUIA 2I00A 3TFYA 4HNXB 3D7DA 3D67A 3DNSA 3V7ZA 4FAIA 4JD6A 4CAEA 2B4BA 2EBJA 4NGRA 4P4JA 2B4DA 3WC5A 2RB7A 5C82A 5H86A 2ZENA 4E8OA 2CF4A 1OZPA 5J1QA 2PR1A 4LUAA 3TO9A 4P4FA 2BEIA 1M4DA 2PRBA 4ORFA 4NGQA 3C26A 3R9GA 4I49A 4KOUA 3SHPA 2V8GA 1ELMP 4QUSA 4PQAA 4UIAA 4OC4A 3RAMA 4NGSA 4F0XA 4AB7A 4MXUA 1XMTA 1Z5RA 3QNVA 2PIZA 1MK4A 3H8GA 4JXRA 4U5YA 2R8VA 2ZW6A 3QAYA 4KVOE 4OAEA 4CYPA 5F47A 3D2MA 4B5PA 4FD5A 4Q36A 1ON0A 2FSRA 3NA6A 4FD7A 4M85A 1ARLA 2EK9A 1S7KA 4NCZA 3P2HA 2PJ5A 3IO1A 4Y49C 3DDDA 1J4JA 3H8EA 1NMTA 4CYOA 1HDQA 4UFXA 2CNTA 4NGMA 1F2OA 1YVKA 2O4HA 4EVYA 2AFMA 1KUVA 2GIVA 4XNHB 4A31A 4E0AA 2GE3A 4LQGA 5JQ4A 3S6HA 4B5OA 5ELYA 1QSRA 4PXEA 3TT2A 1FY7A 5EMIA 4OC3A 4MFZA 3K2KA 2PJ6A 2WPWA 4CAXA 2C6PA 1AUGA 1M44A 1Z8WA 4P6YA 1IB1E 1KUXA 1Y7EA 3BJ8A 3NH8A 3TTHA 3KHXA 3D7GA 4OC2A 5CPAA 2WSAA 5DWNA 2QYVA 1RTQA 2PJ3A 2ZOGA 3KQZA 4OMEA 5J8FA 2ZEFA 1I21A 1UFHA 4UF4A 3FBUA 3IU1A 3W6XA 2XEJA 4E2AA 4Q7AA 2Q51A 4MFLA 2FIWA 2Z11A 4F0YA 5A28A 2WZNA 2P6GA 3D7HA 4MBUA 3A9LA 3CXQA 4KOWA 1PCAA 1V0CA 1CJWA 2VZZA 1QMUA 1YR0A 4MI4A 5AG7A 1QQ9A 2PQ8A 3KGQA 3R1KA 5D8NA 4XNHC 1QSMA 4KOSA 4PSXA 1S3ZA 4HNWB 4EMEA 3S6GA 5GCNA 3KASA 2G0BA 2PJ7A 4GXHA 4KLVA 5G22A 1XFOA 4MMOA 4OC5A 2PDOA 4PK2A 4QBJA 3BHXA 1TF9A 1S7NA 2J8NA 4DUKA 4R8FA 3ISXA 2GREA 3IWWA 3FX6A 2IMOA 3VWEA 2ZEPA 1YQEA 5LRKA 3KKWA 4OIDA 1YW6A 2PJ8A 5LRGA 1IY7A 2FIAA 3RBUA 2FVGA 3SXOA 3CPXA 3IEHA 2V8VA 3B2YA 1DTDA 3NFZA 4FUUA 4QC6A 2P0WA 4QVTA 3T9YA 2CXAA 2ZXVA 1YLOA 5THWA 2PJ1A 4R3KA 2ZW5A 1XBUA 1YVOA 3EFAA 1VIXA 1CX8A 1CM0A 2B58A 3KZWA 5DS0A 3SXNA 3V38A 2YGWA 2YNEA 1ELLP 4CGNA 3VARA 1Q2CA 1WWZA 4XPDB 1PUAA 3MN8A 1AMPA 1QSNA 1GYTA 4XPDC 2G9DA 1QSTA 2WPXA 3JVNA 2V8HA 3B3CA 1LAPA 3SJFA 5KTDA 4KSIA 3MRUA 4KS9A 4KZTA 3B3VA 1LRZA 2JDDA 2F8HA 1CPXA 1M4LA 1CP6A 1F2PA 2GU2A 4MFJA 4UEZA 4X8IA 2WUUA 3BXMA 4A38A 3SJEA 2IQ6A 2AJ6A 2X7BA 3DR6A 3W91A 2V77A 4P45A 3VH9A 2CY2A 1YMEA 4B5PB 2G3TA 1CG2A 3EC4A 3B3TA 3N7ZA 3SJGA 2PJ2A 4OC0A 2F5IA 4UFVA 1X12A 2ZEHA 4TWEA 2AFWA 3EY5A 1B6BA 1TKJA 1DE4C 2VXKA 1IOIA 3DR8A 2Y0MA 1LFWA 3PFEA 4H2KA 4LQ6A 4EWTA 2BUEA 2VI7A 2Z3MA 3QB8A 4C7IA 3TC8A 8CPAA 4NFRA 1RXTA 4NJQA 1KWMA 2CIJA 2Z3LA 3FYNA 2Q04A 4NF1A 4F6AA 5JPHA 2XEGA 3F0AA 3UY5A 4UEEA 3L2NA 4MJ8A 5LYIA 1WK4A 3P2FA 2Q44A 1A2ZA 2C1CA 3IFEA 4JJXA 3KL9A 4KOVA 4BD9A 1X10A 1OBRA 3FRMA 3TO6A 3H4QA 1Z4RA 2ARHA 2YNCC 4YWYA 2AFZA 4PXBA 4CAVA 5K8OA 4X3RA 4CYNA 3TOAA 4R3LA 1IICA 2B5GB 3GKRA 1XOVA 4MY3A 4UFWA 3IU2A 4CGMA 4PSWA 4A30A 1Z9UA 4TNUA 2PVVA 4MHZA 5ISVA 1M4GA 2O28A 3WT4A 4MCRA 2HV2A 1XRYA 1YW4A 5C88A 2ZEEA 4JXQA 3R9EA 5LYFA 3G3SA 4DJLA 4CGLA 3SI0A 2PR8A 5JGFA 5BWAB 1Y7RA 2QECA 2NYQA 1Q7LA 3JUWA 1YSJA 2CTCA 3LODA 4UCPA 5FVJA 4MHPA 2JEWA 2I79A 1TXRA 3R95A 2Q4VA 4BINA 3FNCA 4UWJA 5HVHA 2ZEMA 5HVGA 2JEVA 1JWQA 5DWMA 1ARMA 2AFXA 3V8IA 3GUXA 3PFOA 3WC6A 3K9UA 4DNCA 2Z10A 4H6ZA 2Z0ZA 2HUZA 4UWIA 1LCPA 4FD6A 3FMCA 4OKOA 4P4EA 3D4UA 3T90A 4PPZA 3FH4A 4CAFA 2P6EA 1BO4A 3BJ7A 4CGOA 4ZI6A 2Z3KA 3VWDA 6CPAA 2BOAA 5H84A 2R98A 2IJZA 1TIQA 4MFPA 4UEFA 1K4JA 2Q7SA 2RC4A 3KR5A 2PJCA 3I1UA 1HDUA 2A4NA 4CPAA 4L89A 4NGPA 3CZXA 5KTAA 2ANPA 1UWYA 4B6ZA 2EO8A 1IGBA 1KUYA 2REEA 3IWGA 3PEIA 4YU9A 5LRJA 3GB0A 1TF8A 3E0KA 4EFDA 2VQYA 2D4OA 3TOBA 2GLJA 2BO9A 2Z3OA 1MJAA 2XEIA 3ISZA 4OP4A 4M3SA 2CTBA 4X2TA 1YLEA 2R7HA 3S6FA 2GANA 4P10A 3FJUA 2PJAA 3KHZA 5HVFA 1YGHA 3T8WA 1CBXA 3TCVA 1VKCA 3VATA 4B14A 1QSOA 1BPMA 3DLJA 2K5TA 3JTKA 3RYOA 4X5KA 4RI1A 1CP7A 2EK8A 4ZY1A 1YX0A 4Q38A 1NE9A 4PXDA 3GIUA 1I1DA 2V8DA 1M1DA 3BLNA 3PB8X 3PB7X 5E96A 3K9TA 4II9A 4HKFA 2BL1A 4NSQA 5K8MA 2QVPA 1L0CA 4KUAA 2DPTA 2J9AA 4KSAA 2Q7BA 1TKFA 4MHYA 1Q2YA 3FECA 1Z8XA 5K8NA 4A39A 1NSAA 2QJ8A 5LYLA 1LAMA 4YRHA 4K3NA 2PIYA 3WABA 3RO0A 3N5FA 1LOKA 2DXQA 5J8CA 3NE8A 3TE4A 5LYDA 2AE6A 1XIXA 4B13A 3CPAA 3LMSA 1KZFA 4P44A 1Z8LA 2FE7A 3D7FA 4NXYA 1BOBA 4JZ0A 2J8RA 4YFJA 2ZELA 1Z8TA 3PB4X 5F49A 3TO7A 4G1PA 4M6IA 5CBMA 3NE7A 4OADA 4JYWA 5KTCA 3CDXA 2NSMA 3F5BA 4K30A 4DYOA 4RS2A 4KOXA 2GLFA 4P4DA 4B10A 4A95A 1JQGA 2PSWA 4CRYB 5G21A 2PC1A 3I3GA 4JLYA 4WWVA 4O23A 1EE3P 1S7FA 2ZEOA 4UCNA 4ONUA 1VHSA 3B7IA 2AFOA 2I3CA 3WC7A 2Q4YA 4P4IA 4CAWA 4OIWA 1IOFA 2B5GA 2DF5A 2Q4ZA 4J3GA 4CS0B 1ZLHA 2Q43A 2JDCA 5JH9A 3QAHA 5HH1A 4KORA 4AVAA 2B3VA 4XPLA 1S7LA 5AG5A 3CXSA 5IB0A 3B8GA 2FCKA 1HEEA 4UCMA 3EXNA 1GHEA 5F48A 2Z3NA 3G8WA 4U9ZA 3PBBA 3LWUA 1MJ9A 2JBJA 2CNMA 2J8MA 1BPNA 2OB0A 4MY0A 2CNSA 1VGYA 3IWEA 3FEEA 1YREA 4R57A 2KCWA 4BMHA 1Y9KA 2C6CA 3FVLA 4GM5A 3B35A 3BI0A 4H89A 4UBRA 1ZG8A 2OH1A 4LX9A 5G1ZA 3S9MA 2GFQA 3S6KA 3D2PA 4MCQA 1TKHA 3WR7A 3LACA 1RO5A 2ZOFA 4W9YA 3TX8A 2C6GA 4AG7A 2AFUA 4ZX9A 1VHOA 2BCOA 4ZY0A 1BAVA 3PGPA 3CXPA 4YGOA 1N71A 1S60A 2P6FA 2XEFA 4KSFA 4A32A 4M6HA 2B3UA 2R1IA 3DSBA 3ZZIA 2OZHA 3R96A 3D3SA 1IYKA 4IAVA 2HB6A 3EO4A 2O53A 4C2ZA 1Y0RA 1Z2LA 3W6SA 2ABZA 4C2YA 2VL1A 4MRIA 1Y0YA 2PE3A 5AG4A 1NSLA 3FF3A 2FS5A 2B4DB 4CGPA 4F8ZA 2ZW4A 4UA3A 2ATRA 4KLWA 1H8LA 3SI1A 3B3SA 1LANA 4IUSA 2ZPAA 2VBQA 5IV0A 1BLLE 4Z65A 3RNZA 1VHEA 2ZEGA 4KOYA 3HUVA 4KVXA 4AG9A 4FWUA 5JM6A 1F57A 2PVWA 3MGDA 3FEDA 4QB9A 5EC4A 1PU9A 3PBEA 2Z3PA 5EBVA 4IHMA 4L8AA 1B87A 4FD4A 2JBKA 4HPSA 1P4NA 2VEZA 1ZG9A 2ZEDA 5D29A 4CYQA 4F9UA 4ZGYB 2QMLA 4JWPA 1SQHA 3FIXA 4A33A 4ZBGA 2REFA 2YNCA 2OZGA
chains in the Genus database with same CATH topology
2IL4A 1I12A 4B12A 1Z4EA 2H5MA 3GY9A 3FXTA 4NEXA 2G3AA 5HMNA 5IX3A 4MHDA 3PZJA 4R9MA 2HQYA 1Q2DA 2VZYA 3D8PA 4C7HA 2Q0YA 1IIDA 3F8KA 3GYAA 4B11A 3R9FA 1MJBA 2OZUA 4CRZB 2FXFA 4R87A 1YK3A 1XEBA 4H6UA 5CNPA 4KVME 4GS4A 4BBHA 2NMTA 4U9YA 2YNDA 5F46A 5G20A 2ZW7A 1XE4A 2OU2A 4A2ZA 1S5KA 3PP9A 1U6MA 5A27A 2QIRA 1ZO0A 4KOTA 3H5ZA 4XPKA 4AVBA 4MFKA 4HNYB 2C27A 1Y9WA 4MFQA 5I0CA 3I9SA 4PV6A 5AGEA 1XF8A 1IYLA 3LD2A 1R57A 2FL4A 3IGRA 4Y49B 2JLMA 2DPSA 1P0HA 4PK3A 3FB3A 4AVCA 1M4IA 4C2XA 4IF5A 2BSWA 4KUBA 4OLLA 3OWCA 5AG6A 3ZJ0A 2EVNA 2FT0A 4C68A 2D4PA 2EUIA 2I00A 3TFYA 4HNXB 3DNSA 4JD6A 4CAEA 2B4BA 2B4DA 5C82A 5H86A 4E8OA 1OZPA 2PR1A 4LUAA 3TO9A 2BEIA 1M4DA 2PRBA 4ORFA 3R9GA 3C26A 4I49A 4KOUA 3SHPA 4QUSA 4F0XA 4AB7A 1XMTA 1MK4A 4JXRA 4U5YA 2R8VA 2ZW6A 4OAEA 4KVOE 4CYPA 5F47A 3D2MA 4B5PA 4FD5A 4Q36A 1ON0A 2FSRA 4FD7A 4M85A 1S7KA 4NCZA 3P2HA 4Y49C 3DDDA 1J4JA 1NMTA 4CYOA 4UFXA 2CNTA 4EVYA 1YVKA 2GIVA 1KUVA 4XNHB 4A31A 4E0AA 2GE3A 5JQ4A 3S6HA 4B5OA 1QSRA 3TT2A 1FY7A 4MFZA 2WPWA 4CAXA 1M44A 1IB1E 1KUXA 3BJ8A 3TTHA 2WSAA 5DWNA 5J8FA 1I21A 1UFHA 3FBUA 3IU1A 3W6XA 4E2AA 4MFLA 2FIWA 2Z11A 4F0YA 5A28A 2P6GA 4MBUA 3A9LA 3CXQA 4KOWA 1V0CA 1CJWA 2VZZA 1YR0A 4MI4A 5AG7A 2PQ8A 3R1KA 4XNHC 1QSMA 4KOSA 4PSXA 1S3ZA 4HNWB 3S6GA 5GCNA 2G0BA 4KLVA 5G22A 2PDOA 4PK2A 4QBJA 1S7NA 2J8NA 3VWEA 3KKWA 2FIAA 3SXOA 4QC6A 2P0WA 4QVTA 3T9YA 2CXAA 2ZXVA 4R3KA 2ZW5A 1YVOA 3EFAA 1CM0A 2B58A 3SXNA 2YGWA 2YNEA 4CGNA 1Q2CA 1WWZA 4XPDB 1PUAA 1QSNA 4XPDC 1QSTA 2WPXA 3JVNA 5KTDA 4KZTA 4KS9A 1LRZA 2JDDA 4MFJA 2WUUA 2AJ6A 2X7BA 3DR6A 3W91A 2CY2A 4B5PB 2G3TA 3EC4A 3N7ZA 2F5IA 4UFVA 3EY5A 1B6BA 3DR8A 2VXKA 3TCVA 2Y0MA 2BUEA 2VI7A 2Z3MA 3QB8A 4C7IA 1RXTA 2Z3LA 3FYNA 2Q04A 4NF1A 4F6AA 5JPHA 3F0AA 3UY5A 4MJ8A 1WK4A 3P2FA 2Q44A 4JJXA 4KOVA 3FRMA 3TO6A 3H4QA 1Z4RA 2ARHA 2YNCC 4CAVA 4CYNA 3TOAA 4R3LA 1IICA 2B5GB 3GKRA 4UFWA 4MY3A 4CGMA 3IU2A 4PSWA 4A30A 1Z9UA 5ISVA 1M4GA 2O28A 2HV2A 5C88A 4JXQA 3R9EA 3G3SA 4CGLA 2PR8A 5BWAB 1Y7RA 2QECA 3LODA 3JUWA 4UCPA 5FVJA 2I79A 3R95A 2Q4VA 3FNCA 4UWJA 2JEVA 5DWMA 3V8IA 4DNCA 3K9UA 2Z10A 4H6ZA 2Z0ZA 2HUZA 4UWIA 4FD6A 4CAFA 3T90A 4CGOA 2P6EA 1BO4A 3BJ7A 2Z3KA 3VWDA 5H84A 2R98A 1TIQA 4MFPA 1K4JA 2RC4A 2A4NA 4L89A 5KTAA 1KUYA 2REEA 3IWGA 3E0KA 2VQYA 2D4OA 3TOBA 2Z3OA 1MJAA 4M3SA 1YLEA 2R7HA 3S6FA 2GANA 1YGHA 1VKCA 4B14A 1QSOA 2K5TA 3JTKA 3RYOA 4X5KA 4RI1A 1YX0A 4Q38A 1NE9A 1I1DA 1M1DA 3BLNA 5E96A 4II9A 4HKFA 2BL1A 4NSQA 2Q7BA 1L0CA 4KUAA 2DPTA 4KSAA 1Q2YA 4YRHA 3TE4A 2DXQA 5J8CA 2AE6A 1XIXA 4B13A 1KZFA 4NXYA 2FE7A 1BOBA 2J8RA 4YFJA 3TO7A 5F49A 3NE7A 4OADA 5KTCA 3F5BA 4K30A 4RS2A 4KOXA 4B10A 4A95A 4CRYB 2PSWA 5G21A 2PC1A 3I3GA 4JLYA 1S7FA 4UCNA 4ONUA 1VHSA 2Q4YA 4CAWA 2B5GA 4J3GA 4CS0B 2JDCA 3QAHA 5HH1A 4KORA 4AVAA 2B3VA 4XPLA 1S7LA 5AG5A 3CXSA 5IB0A 3B8GA 2FCKA 4UCMA 3EXNA 1GHEA 5F48A 2Z3NA 3G8WA 4U9ZA 1MJ9A 2CNMA 4MY0A 2J8MA 2OB0A 2CNSA 3IWEA 1YREA 4R57A 2KCWA 4BMHA 1Y9KA 4UBRA 4H89A 2OH1A 5G1ZA 4LX9A 3S6KA 3D2PA 3WR7A 1RO5A 4AG7A 3PGPA 3CXPA 4YGOA 1N71A 1S60A 2P6FA 4A32A 4KSFA 2B3UA 2R1IA 3DSBA 3ZZIA 2OZHA 3R96A 3D3SA 1IYKA 3EO4A 4C2ZA 3W6SA 4C2YA 5AG4A 1NSLA 2FS5A 2B4DB 4CGPA 2ZW4A 4UA3A 2ATRA 4KLWA 4IUSA 2ZPAA 2VBQA 5IV0A 4KVXA 4KOYA 4AG9A 4QB9A 3MGDA 5EC4A 1PU9A 2Z3PA 5EBVA 4L8AA 1B87A 4FD4A 1P4NA 2VEZA 4CYQA 4ZGYB 2QMLA 4JWPA 1SQHA 3FIXA 4A33A 4ZBGA 2REFA 2YNCA 2OZGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IL4 A;  1I12 A;  1Z4E A;  2H5M A;  3GY9 A;  3FXT A;  4NEX A;  2G3A A;  5HMN A;  5IX3 A;  4MHD A;  3PZJ A;  4R9M A;  2HQY A;  1Q2D A;  2VZY A;  3D8P A;  2Q0Y A;  1IID A;  3F8K A;  3GYA A;  3R9F A;  1MJB A;  2OZU A;  4CRZ B;  2FXF A;  4R87 A;  1YK3 A;  1XEB A;  4H6U A;  5CNP A;  4KVM E;  4GS4 A;  2NMT A;  4U9Y A;  5F46 A;  2ZW7 A;  1XE4 A;  2OU2 A;  1S5K A;  3PP9 A;  1U6M A;  2QIR A;  4KOT A;  4XPK A;  4AVB A;  4HNY B;  2C27 A;  1Y9W A;  5I0C A;  3I9S A;  4PV6 A;  1XF8 A;  1IYL A;  3LD2 A;  1R57 A;  2FL4 A;  3IGR A;  4Y49 B;  2JLM A;  4PK3 A;  1P0H A;  4AVC A;  3FB3 A;  1M4I A;  4IF5 A;  2BSW A;  4OLL A;  4KUB A;  3OWC A;  3ZJ0 A;  2EVN A;  2FT0 A;  2D4P A;  2EUI A;  2I00 A;  3TFY A;  4HNX B;  3DNS A;  4JD6 A;  2B4B A;  2B4D A;  5C82 A;  5H86 A;  4E8O A;  1OZP A;  2PR1 A;  4LUA A;  3TO9 A;  2BEI A;  1M4D A;  2PRB A;  4ORF A;  3R9G A;  3C26 A;  4I49 A;  4KOU A;  3SHP A;  4QUS A;  4AB7 A;  1XMT A;  1MK4 A;  4JXR A;  4U5Y A;  2R8V A;  2ZW6 A;  4OAE A;  4KVO E;  5F47 A;  3D2M A;  4B5P A;  4FD5 A;  1ON0 A;  2FSR A;  4FD7 A;  4M85 A;  1S7K A;  4NCZ A;  3P2H A;  4Y49 C;  3DDD A;  1J4J A;  1NMT A;  2CNT A;  4EVY A;  1YVK A;  2GIV A;  1KUV A;  4XNH B;  4E0A A;  2GE3 A;  5JQ4 A;  3S6H A;  4B5O A;  1QSR A;  3TT2 A;  1FY7 A;  2WPW A;  4CAX A;  1M44 A;  1IB1 E;  1KUX A;  3BJ8 A;  3TTH A;  5DWN A;  5J8F A;  1I21 A;  1UFH A;  3FBU A;  3W6X A;  4E2A A;  2FIW A;  2Z11 A;  4F0Y A;  2P6G A;  4MBU A;  3CXQ A;  4KOW A;  1V0C A;  1CJW A;  2VZZ A;  1YR0 A;  4MI4 A;  2PQ8 A;  3R1K A;  4XNH C;  1QSM A;  4KOS A;  4PSX A;  1S3Z A;  4HNW B;  3S6G A;  5GCN A;  2G0B A;  4KLV A;  2PDO A;  4PK2 A;  4QBJ A;  1S7N A;  2J8N A;  3VWE A;  3KKW A;  2FIA A;  3SXO A;  4QC6 A;  2P0W A;  4QVT A;  3T9Y A;  2ZXV A;  4R3K A;  2ZW5 A;  1YVO A;  3EFA A;  1CM0 A;  2B58 A;  3SXN A;  1Q2C A;  1WWZ A;  4XPD B;  1PUA A;  1QSN A;  4XPD C;  1QST A;  2WPX A;  3JVN A;  5KTD A;  4KZT A;  1LRZ A;  2JDD A;  2AJ6 A;  2X7B A;  3DR6 A;  3W91 A;  2CY2 A;  4B5P B;  2G3T A;  3EC4 A;  3N7Z A;  2F5I A;  3EY5 A;  1B6B A;  3DR8 A;  2VXK A;  3TCV A;  2Y0M A;  2BUE A;  2VI7 A;  3QB8 A;  1RXT A;  3FYN A;  2Q04 A;  4NF1 A;  4F6A A;  5JPH A;  3F0A A;  3UY5 A;  4MJ8 A;  1WK4 A;  3P2F A;  2Q44 A;  4JJX A;  4KOV A;  3FRM A;  3TO6 A;  3H4Q A;  1Z4R A;  2ARH A;  4CAV A;  3TOA A;  4R3L A;  1IIC A;  2B5G B;  3GKR A;  4MY3 A;  4PSW A;  1Z9U A;  5ISV A;  1M4G A;  2O28 A;  2HV2 A;  5C88 A;  4JXQ A;  3R9E A;  3G3S A;  2PR8 A;  1Y7R A;  2QEC A;  3LOD A;  3JUW A;  5FVJ A;  2I79 A;  3R95 A;  2Q4V A;  3FNC A;  4UWJ A;  2JEV A;  5DWM A;  3V8I A;  4DNC A;  3K9U A;  2Z10 A;  4H6Z A;  2Z0Z A;  2HUZ A;  4UWI A;  4FD6 A;  3T90 A;  2P6E A;  1BO4 A;  3BJ7 A;  3VWD A;  5H84 A;  2R98 A;  1TIQ A;  1K4J A;  2RC4 A;  2A4N A;  4L89 A;  5KTA A;  1KUY A;  2REE A;  3IWG A;  3E0K A;  2VQY A;  2D4O A;  3TOB A;  1MJA A;  4M3S A;  1YLE A;  2R7H A;  3S6F A;  2GAN A;  1YGH A;  1VKC A;  1QSO A;  2K5T A;  3RYO A;  4X5K A;  4RI1 A;  1YX0 A;  1NE9 A;  1I1D A;  1M1D A;  3BLN A;  5E96 A;  4II9 A;  4HKF A;  2BL1 A;  4NSQ A;  2Q7B A;  1L0C A;  4KUA A;  1Q2Y A;  4YRH A;  3TE4 A;  2DXQ A;  5J8C A;  2AE6 A;  1XIX A;  1KZF A;  4NXY A;  2FE7 A;  1BOB A;  2J8R A;  4YFJ A;  3TO7 A;  5F49 A;  3NE7 A;  4OAD A;  5KTC A;  3F5B A;  4K30 A;  4RS2 A;  4KOX A;  4CRY B;  2PSW A;  2PC1 A;  3I3G A;  4JLY A;  1S7F A;  4ONU A;  1VHS A;  2Q4Y A;  4CAW A;  2B5G A;  4J3G A;  4CS0 B;  2JDC A;  3QAH A;  5HH1 A;  4KOR A;  4AVA A;  2B3V A;  4XPL A;  1S7L A;  5IB0 A;  3CXS A;  3B8G A;  2FCK A;  3EXN A;  1GHE A;  5F48 A;  3G8W A;  4U9Z A;  1MJ9 A;  2CNM A;  4MY0 A;  2J8M A;  2OB0 A;  2CNS A;  1YRE A;  4R57 A;  2KCW A;  4BMH A;  1Y9K A;  4UBR A;  4H89 A;  2OH1 A;  4LX9 A;  3S6K A;  3D2P A;  3WR7 A;  1RO5 A;  4AG7 A;  3PGP A;  3CXP A;  4YGO A;  1N71 A;  1S60 A;  2P6F A;  2B3U A;  2R1I A;  3DSB A;  3ZZI A;  2OZH A;  3R96 A;  3D3S A;  1IYK A;  3EO4 A;  3W6S A;  1NSL A;  2FS5 A;  2B4D B;  2ZW4 A;  4UA3 A;  2ATR A;  4KLW A;  4IUS A;  2ZPA A;  2VBQ A;  5IV0 A;  4KVX A;  4KOY A;  4AG9 A;  4QB9 A;  3MGD A;  5EC4 A;  1PU9 A;  5EBV A;  4L8A A;  1B87 A;  4FD4 A;  1P4N A;  2VEZ A;  2QML A;  4JWP A;  1SQH A;  3FIX A;  4ZBG A;  2REF A;  2OZG A; 
#chains in the Genus database with same CATH topology
 2IL4 A;  1I12 A;  4IK2 A;  4ONW A;  3CT9 A;  4RUH A;  2PJ9 A;  4B12 A;  1Z4E A;  4RN7 A;  4ZYQ A;  2H5M A;  3GY9 A;  3FXT A;  2AFS A;  4NEX A;  4ZY2 A;  4MCP A;  4WJB A;  2WYR A;  2G3A A;  4NGT A;  4A37 A;  3SI2 A;  5HMN A;  5IX3 A;  4MHD A;  3PZJ A;  5IB9 A;  4MCS A;  4R9M A;  2HQY A;  1Q2D A;  2VZY A;  3BI1 A;  3D8P A;  4C7H A;  3IJ3 A;  2Q0Y A;  2OR4 A;  3S9L A;  1IID A;  3F8K A;  1CPS A;  3GYA A;  4MHN A;  4P4B A;  4B11 A;  2PJ0 A;  4AXV A;  3R9F A;  1FT7 A;  1MJB A;  2OZU A;  4UIB A;  4CRZ B;  2FXF A;  1IU8 A;  4R87 A;  5F09 A;  3PB9 X;  4M6G A;  4A94 A;  1YK3 A;  3IIB A;  1XEB A;  4H6U A;  1AYE A;  5CNP A;  5K8P A;  4KVM E;  3PB6 X;  3B3W A;  3S9N A;  4GS4 A;  3H8F A;  3NH5 A;  4BBH A;  2DEA A;  3KR4 A;  2ODF A;  4OC1 A;  2NMT A;  1R3N A;  4U9Y A;  5HXD A;  2YND A;  5F46 A;  5G20 A;  4NJR A;  2ZW7 A;  1ZG7 A;  1XE4 A;  2HC9 A;  2OU2 A;  4A2Z A;  1S5K A;  3HLP A;  3PP9 A;  1U6M A;  4NGN A;  2F7V A;  3PRT A;  5A27 A;  2QIR A;  1ZO0 A;  4KOT A;  4R7M A;  3SJX A;  2PJ4 A;  7CPA A;  3H5Z A;  3KQX A;  1XJO A;  3GLJ A;  1FNO A;  4XPK A;  2POK A;  4AVB A;  4MFK A;  1R43 A;  1ZLI A;  4HNY B;  4F9V A;  2C27 A;  1Y9W A;  4MFQ A;  3RZA A;  2OOT A;  5I0C A;  3I9S A;  4PV6 A;  5I4M A;  3D68 A;  5AGE A;  1XMB A;  1XF8 A;  1IYL A;  4ZX8 A;  2PCU A;  3LD2 A;  2PJB A;  1R57 A;  1PYT B;  2FL4 A;  3IGR A;  4PXC A;  4Y49 B;  4FBE A;  2JLM A;  2RFH A;  3KI9 A;  2EWB A;  3JRU A;  4R76 A;  2DPS A;  1P0H A;  3D66 A;  3FB3 A;  4PK3 A;  3NH4 A;  1M4I A;  4AVC A;  4C2X A;  4IF5 A;  2BSW A;  4KUB A;  4OLL A;  3DGV A;  3OWC A;  5AG6 A;  2EVN A;  2PRQ A;  3IC1 A;  2FT0 A;  3ZJ0 A;  4C68 A;  2D4P A;  4R6T A;  2EUI A;  2I00 A;  3TFY A;  4HNX B;  3D7D A;  3D67 A;  3DNS A;  3V7Z A;  4FAI A;  4JD6 A;  4CAE A;  2B4B A;  2EBJ A;  4NGR A;  4P4J A;  2B4D A;  3WC5 A;  2RB7 A;  5C82 A;  5H86 A;  2ZEN A;  4E8O A;  2CF4 A;  1OZP A;  5J1Q A;  2PR1 A;  4LUA A;  3TO9 A;  4P4F A;  2BEI A;  1M4D A;  2PRB A;  4ORF A;  4NGQ A;  3C26 A;  3R9G A;  4I49 A;  4KOU A;  3SHP A;  2V8G A;  1ELM P;  4QUS A;  4PQA A;  4UIA A;  4OC4 A;  3RAM A;  4NGS A;  4F0X A;  4AB7 A;  4MXU A;  1XMT A;  1Z5R A;  3QNV A;  2PIZ A;  1MK4 A;  3H8G A;  4JXR A;  4U5Y A;  2R8V A;  2ZW6 A;  3QAY A;  4KVO E;  4OAE A;  4CYP A;  5F47 A;  3D2M A;  4B5P A;  4FD5 A;  4Q36 A;  1ON0 A;  2FSR A;  3NA6 A;  4FD7 A;  4M85 A;  1ARL A;  2EK9 A;  1S7K A;  4NCZ A;  3P2H A;  2PJ5 A;  3IO1 A;  4Y49 C;  3DDD A;  1J4J A;  3H8E A;  1NMT A;  4CYO A;  1HDQ A;  4UFX A;  2CNT A;  4NGM A;  1F2O A;  1YVK A;  2O4H A;  4EVY A;  2AFM A;  1KUV A;  2GIV A;  4XNH B;  4A31 A;  4E0A A;  2GE3 A;  4LQG A;  5JQ4 A;  3S6H A;  4B5O A;  5ELY A;  1QSR A;  4PXE A;  3TT2 A;  1FY7 A;  5EMI A;  4OC3 A;  4MFZ A;  3K2K A;  2PJ6 A;  2WPW A;  4CAX A;  2C6P A;  1AUG A;  1M44 A;  1Z8W A;  4P6Y A;  1IB1 E;  1KUX A;  1Y7E A;  3BJ8 A;  3NH8 A;  3TTH A;  3KHX A;  3D7G A;  4OC2 A;  5CPA A;  2WSA A;  5DWN A;  2QYV A;  1RTQ A;  2PJ3 A;  2ZOG A;  3KQZ A;  4OME A;  5J8F A;  2ZEF A;  1I21 A;  1UFH A;  4UF4 A;  3FBU A;  3IU1 A;  3W6X A;  2XEJ A;  4E2A A;  4Q7A A;  2Q51 A;  4MFL A;  2FIW A;  2Z11 A;  4F0Y A;  5A28 A;  2WZN A;  2P6G A;  3D7H A;  4MBU A;  3A9L A;  3CXQ A;  4KOW A;  1PCA A;  1V0C A;  1CJW A;  2VZZ A;  1QMU A;  1YR0 A;  4MI4 A;  5AG7 A;  1QQ9 A;  2PQ8 A;  3KGQ A;  3R1K A;  5D8N A;  4XNH C;  1QSM A;  4KOS A;  4PSX A;  1S3Z A;  4HNW B;  4EME A;  3S6G A;  5GCN A;  3KAS A;  2G0B A;  2PJ7 A;  4GXH A;  4KLV A;  5G22 A;  1XFO A;  4MMO A;  4OC5 A;  2PDO A;  4PK2 A;  4QBJ A;  3BHX A;  1TF9 A;  1S7N A;  2J8N A;  4DUK A;  4R8F A;  3ISX A;  2GRE A;  3IWW A;  3FX6 A;  2IMO A;  3VWE A;  2ZEP A;  1YQE A;  5LRK A;  3KKW A;  4OID A;  1YW6 A;  2PJ8 A;  5LRG A;  1IY7 A;  2FIA A;  3RBU A;  2FVG A;  3SXO A;  3CPX A;  3IEH A;  2V8V A;  3B2Y A;  1DTD A;  3NFZ A;  4FUU A;  4QC6 A;  2P0W A;  4QVT A;  3T9Y A;  2CXA A;  2ZXV A;  1YLO A;  5THW A;  2PJ1 A;  4R3K A;  2ZW5 A;  1XBU A;  1YVO A;  3EFA A;  1VIX A;  1CX8 A;  1CM0 A;  2B58 A;  3KZW A;  5DS0 A;  3SXN A;  3V38 A;  2YGW A;  2YNE A;  1ELL P;  4CGN A;  3VAR A;  1Q2C A;  1WWZ A;  4XPD B;  1PUA A;  3MN8 A;  1AMP A;  1QSN A;  1GYT A;  4XPD C;  2G9D A;  1QST A;  2WPX A;  3JVN A;  2V8H A;  3B3C A;  1LAP A;  3SJF A;  5KTD A;  4KSI A;  3MRU A;  4KS9 A;  4KZT A;  3B3V A;  1LRZ A;  2JDD A;  2F8H A;  1CPX A;  1M4L A;  1CP6 A;  1F2P A;  2GU2 A;  4MFJ A;  4UEZ A;  4X8I A;  2WUU A;  3BXM A;  4A38 A;  3SJE A;  2IQ6 A;  2AJ6 A;  2X7B A;  3DR6 A;  3W91 A;  2V77 A;  4P45 A;  3VH9 A;  2CY2 A;  1YME A;  4B5P B;  2G3T A;  1CG2 A;  3EC4 A;  3B3T A;  3N7Z A;  3SJG A;  2PJ2 A;  4OC0 A;  2F5I A;  4UFV A;  1X12 A;  2ZEH A;  4TWE A;  2AFW A;  3EY5 A;  1B6B A;  1TKJ A;  1DE4 C;  2VXK A;  1IOI A;  3DR8 A;  2Y0M A;  1LFW A;  3PFE A;  4H2K A;  4LQ6 A;  4EWT A;  2BUE A;  2VI7 A;  2Z3M A;  3QB8 A;  4C7I A;  3TC8 A;  8CPA A;  4NFR A;  1RXT A;  4NJQ A;  1KWM A;  2CIJ A;  2Z3L A;  3FYN A;  2Q04 A;  4NF1 A;  4F6A A;  5JPH A;  2XEG A;  3F0A A;  3UY5 A;  4UEE A;  3L2N A;  4MJ8 A;  5LYI A;  1WK4 A;  3P2F A;  2Q44 A;  1A2Z A;  2C1C A;  3IFE A;  4JJX A;  3KL9 A;  4KOV A;  4BD9 A;  1X10 A;  1OBR A;  3FRM A;  3TO6 A;  3H4Q A;  1Z4R A;  2ARH A;  2YNC C;  4YWY A;  2AFZ A;  4PXB A;  4CAV A;  5K8O A;  4X3R A;  4CYN A;  3TOA A;  4R3L A;  1IIC A;  2B5G B;  3GKR A;  1XOV A;  4MY3 A;  4UFW A;  3IU2 A;  4CGM A;  4PSW A;  4A30 A;  1Z9U A;  4TNU A;  2PVV A;  4MHZ A;  5ISV A;  1M4G A;  2O28 A;  3WT4 A;  4MCR A;  2HV2 A;  1XRY A;  1YW4 A;  5C88 A;  2ZEE A;  4JXQ A;  3R9E A;  5LYF A;  3G3S A;  4DJL A;  4CGL A;  3SI0 A;  2PR8 A;  5JGF A;  5BWA B;  1Y7R A;  2QEC A;  2NYQ A;  1Q7L A;  3JUW A;  1YSJ A;  2CTC A;  3LOD A;  4UCP A;  5FVJ A;  4MHP A;  2JEW A;  2I79 A;  1TXR A;  3R95 A;  2Q4V A;  4BIN A;  3FNC A;  4UWJ A;  5HVH A;  2ZEM A;  5HVG A;  2JEV A;  1JWQ A;  5DWM A;  1ARM A;  2AFX A;  3V8I A;  3GUX A;  3PFO A;  3WC6 A;  3K9U A;  4DNC A;  2Z10 A;  4H6Z A;  2Z0Z A;  2HUZ A;  4UWI A;  1LCP A;  4FD6 A;  3FMC A;  4OKO A;  4P4E A;  3D4U A;  3T90 A;  4PPZ A;  3FH4 A;  4CAF A;  2P6E A;  1BO4 A;  3BJ7 A;  4CGO A;  4ZI6 A;  2Z3K A;  3VWD A;  6CPA A;  2BOA A;  5H84 A;  2R98 A;  2IJZ A;  1TIQ A;  4MFP A;  4UEF A;  1K4J A;  2Q7S A;  2RC4 A;  3KR5 A;  2PJC A;  3I1U A;  1HDU A;  2A4N A;  4CPA A;  4L89 A;  4NGP A;  3CZX A;  5KTA A;  2ANP A;  1UWY A;  4B6Z A;  2EO8 A;  1IGB A;  1KUY A;  2REE A;  3IWG A;  3PEI A;  4YU9 A;  5LRJ A;  3GB0 A;  1TF8 A;  3E0K A;  4EFD A;  2VQY A;  2D4O A;  3TOB A;  2GLJ A;  2BO9 A;  2Z3O A;  1MJA A;  2XEI A;  3ISZ A;  4OP4 A;  4M3S A;  2CTB A;  4X2T A;  1YLE A;  2R7H A;  3S6F A;  2GAN A;  4P10 A;  3FJU A;  2PJA A;  3KHZ A;  5HVF A;  1YGH A;  3T8W A;  1CBX A;  3TCV A;  1VKC A;  3VAT A;  4B14 A;  1QSO A;  1BPM A;  3DLJ A;  2K5T A;  3JTK A;  3RYO A;  4X5K A;  4RI1 A;  1CP7 A;  2EK8 A;  4ZY1 A;  1YX0 A;  4Q38 A;  1NE9 A;  4PXD A;  3GIU A;  1I1D A;  2V8D A;  1M1D A;  3BLN A;  3PB8 X;  3PB7 X;  5E96 A;  3K9T A;  4II9 A;  4HKF A;  2BL1 A;  4NSQ A;  5K8M A;  2QVP A;  1L0C A;  4KUA A;  2DPT A;  2J9A A;  4KSA A;  2Q7B A;  1TKF A;  4MHY A;  1Q2Y A;  3FEC A;  1Z8X A;  5K8N A;  4A39 A;  1NSA A;  2QJ8 A;  5LYL A;  1LAM A;  4YRH A;  4K3N A;  2PIY A;  3WAB A;  3RO0 A;  3N5F A;  1LOK A;  2DXQ A;  5J8C A;  3NE8 A;  3TE4 A;  5LYD A;  2AE6 A;  1XIX A;  4B13 A;  3CPA A;  3LMS A;  1KZF A;  4P44 A;  1Z8L A;  2FE7 A;  3D7F A;  4NXY A;  1BOB A;  4JZ0 A;  2J8R A;  4YFJ A;  2ZEL A;  1Z8T A;  3PB4 X;  5F49 A;  3TO7 A;  4G1P A;  4M6I A;  5CBM A;  3NE7 A;  4OAD A;  4JYW A;  5KTC A;  3CDX A;  2NSM A;  3F5B A;  4K30 A;  4DYO A;  4RS2 A;  4KOX A;  2GLF A;  4P4D A;  4B10 A;  4A95 A;  1JQG A;  2PSW A;  4CRY B;  5G21 A;  2PC1 A;  3I3G A;  4JLY A;  4WWV A;  4O23 A;  1EE3 P;  1S7F A;  2ZEO A;  4UCN A;  4ONU A;  1VHS A;  3B7I A;  2AFO A;  2I3C A;  3WC7 A;  2Q4Y A;  4P4I A;  4CAW A;  4OIW A;  1IOF A;  2B5G A;  2DF5 A;  2Q4Z A;  4J3G A;  4CS0 B;  1ZLH A;  2Q43 A;  2JDC A;  5JH9 A;  3QAH A;  5HH1 A;  4KOR A;  4AVA A;  2B3V A;  4XPL A;  1S7L A;  5AG5 A;  3CXS A;  5IB0 A;  3B8G A;  2FCK A;  1HEE A;  4UCM A;  3EXN A;  1GHE A;  5F48 A;  2Z3N A;  3G8W A;  4U9Z A;  3PBB A;  3LWU A;  1MJ9 A;  2JBJ A;  2CNM A;  2J8M A;  1BPN A;  2OB0 A;  4MY0 A;  2CNS A;  1VGY A;  3IWE A;  3FEE A;  1YRE A;  4R57 A;  2KCW A;  4BMH A;  1Y9K A;  2C6C A;  3FVL A;  4GM5 A;  3B35 A;  3BI0 A;  4H89 A;  4UBR A;  1ZG8 A;  2OH1 A;  4LX9 A;  5G1Z A;  3S9M A;  2GFQ A;  3S6K A;  3D2P A;  4MCQ A;  1TKH A;  3WR7 A;  3LAC A;  1RO5 A;  2ZOF A;  4W9Y A;  3TX8 A;  2C6G A;  4AG7 A;  2AFU A;  4ZX9 A;  1VHO A;  2BCO A;  4ZY0 A;  1BAV A;  3PGP A;  3CXP A;  4YGO A;  1N71 A;  1S60 A;  2P6F A;  2XEF A;  4KSF A;  4A32 A;  4M6H A;  2B3U A;  2R1I A;  3DSB A;  3ZZI A;  2OZH A;  3R96 A;  3D3S A;  1IYK A;  4IAV A;  2HB6 A;  3EO4 A;  2O53 A;  4C2Z A;  1Y0R A;  1Z2L A;  3W6S A;  2ABZ A;  4C2Y A;  2VL1 A;  4MRI A;  1Y0Y A;  2PE3 A;  5AG4 A;  1NSL A;  3FF3 A;  2FS5 A;  2B4D B;  4CGP A;  4F8Z A;  2ZW4 A;  4UA3 A;  2ATR A;  4KLW A;  1H8L A;  3SI1 A;  3B3S A;  1LAN A;  4IUS A;  2ZPA A;  2VBQ A;  5IV0 A;  1BLL E;  4Z65 A;  3RNZ A;  1VHE A;  2ZEG A;  4KOY A;  3HUV A;  4KVX A;  4AG9 A;  4FWU A;  5JM6 A;  1F57 A;  2PVW A;  3MGD A;  3FED A;  4QB9 A;  5EC4 A;  1PU9 A;  3PBE A;  2Z3P A;  5EBV A;  4IHM A;  4L8A A;  1B87 A;  4FD4 A;  2JBK A;  4HPS A;  1P4N A;  2VEZ A;  1ZG9 A;  2ZED A;  5D29 A;  4CYQ A;  4F9U A;  4ZGY B;  2QML A;  4JWP A;  1SQH A;  3FIX A;  4A33 A;  4ZBG A;  2REF A;  2YNC A;  2OZG A; 
#chains in the Genus database with same CATH homology
 2IL4 A;  1I12 A;  4B12 A;  1Z4E A;  2H5M A;  3GY9 A;  3FXT A;  4NEX A;  2G3A A;  5HMN A;  5IX3 A;  4MHD A;  3PZJ A;  4R9M A;  2HQY A;  1Q2D A;  2VZY A;  3D8P A;  4C7H A;  2Q0Y A;  1IID A;  3F8K A;  3GYA A;  4B11 A;  3R9F A;  1MJB A;  2OZU A;  4CRZ B;  2FXF A;  4R87 A;  1YK3 A;  1XEB A;  4H6U A;  5CNP A;  4KVM E;  4GS4 A;  4BBH A;  2NMT A;  4U9Y A;  2YND A;  5F46 A;  5G20 A;  2ZW7 A;  1XE4 A;  2OU2 A;  4A2Z A;  1S5K A;  3PP9 A;  1U6M A;  5A27 A;  2QIR A;  1ZO0 A;  4KOT A;  3H5Z A;  4XPK A;  4AVB A;  4MFK A;  4HNY B;  2C27 A;  1Y9W A;  4MFQ A;  5I0C A;  3I9S A;  4PV6 A;  5AGE A;  1XF8 A;  1IYL A;  3LD2 A;  1R57 A;  2FL4 A;  3IGR A;  4Y49 B;  2JLM A;  2DPS A;  1P0H A;  4PK3 A;  3FB3 A;  4AVC A;  1M4I A;  4C2X A;  4IF5 A;  2BSW A;  4KUB A;  4OLL A;  3OWC A;  5AG6 A;  3ZJ0 A;  2EVN A;  2FT0 A;  4C68 A;  2D4P A;  2EUI A;  2I00 A;  3TFY A;  4HNX B;  3DNS A;  4JD6 A;  4CAE A;  2B4B A;  2B4D A;  5C82 A;  5H86 A;  4E8O A;  1OZP A;  2PR1 A;  4LUA A;  3TO9 A;  2BEI A;  1M4D A;  2PRB A;  4ORF A;  3R9G A;  3C26 A;  4I49 A;  4KOU A;  3SHP A;  4QUS A;  4F0X A;  4AB7 A;  1XMT A;  1MK4 A;  4JXR A;  4U5Y A;  2R8V A;  2ZW6 A;  4OAE A;  4KVO E;  4CYP A;  5F47 A;  3D2M A;  4B5P A;  4FD5 A;  4Q36 A;  1ON0 A;  2FSR A;  4FD7 A;  4M85 A;  1S7K A;  4NCZ A;  3P2H A;  4Y49 C;  3DDD A;  1J4J A;  1NMT A;  4CYO A;  4UFX A;  2CNT A;  4EVY A;  1YVK A;  2GIV A;  1KUV A;  4XNH B;  4A31 A;  4E0A A;  2GE3 A;  5JQ4 A;  3S6H A;  4B5O A;  1QSR A;  3TT2 A;  1FY7 A;  4MFZ A;  2WPW A;  4CAX A;  1M44 A;  1IB1 E;  1KUX A;  3BJ8 A;  3TTH A;  2WSA A;  5DWN A;  5J8F A;  1I21 A;  1UFH A;  3FBU A;  3IU1 A;  3W6X A;  4E2A A;  4MFL A;  2FIW A;  2Z11 A;  4F0Y A;  5A28 A;  2P6G A;  4MBU A;  3A9L A;  3CXQ A;  4KOW A;  1V0C A;  1CJW A;  2VZZ A;  1YR0 A;  4MI4 A;  5AG7 A;  2PQ8 A;  3R1K A;  4XNH C;  1QSM A;  4KOS A;  4PSX A;  1S3Z A;  4HNW B;  3S6G A;  5GCN A;  2G0B A;  4KLV A;  5G22 A;  2PDO A;  4PK2 A;  4QBJ A;  1S7N A;  2J8N A;  3VWE A;  3KKW A;  2FIA A;  3SXO A;  4QC6 A;  2P0W A;  4QVT A;  3T9Y A;  2CXA A;  2ZXV A;  4R3K A;  2ZW5 A;  1YVO A;  3EFA A;  1CM0 A;  2B58 A;  3SXN A;  2YGW A;  2YNE A;  4CGN A;  1Q2C A;  1WWZ A;  4XPD B;  1PUA A;  1QSN A;  4XPD C;  1QST A;  2WPX A;  3JVN A;  5KTD A;  4KZT A;  4KS9 A;  1LRZ A;  2JDD A;  4MFJ A;  2WUU A;  2AJ6 A;  2X7B A;  3DR6 A;  3W91 A;  2CY2 A;  4B5P B;  2G3T A;  3EC4 A;  3N7Z A;  2F5I A;  4UFV A;  3EY5 A;  1B6B A;  3DR8 A;  2VXK A;  3TCV A;  2Y0M A;  2BUE A;  2VI7 A;  2Z3M A;  3QB8 A;  4C7I A;  1RXT A;  2Z3L A;  3FYN A;  2Q04 A;  4NF1 A;  4F6A A;  5JPH A;  3F0A A;  3UY5 A;  4MJ8 A;  1WK4 A;  3P2F A;  2Q44 A;  4JJX A;  4KOV A;  3FRM A;  3TO6 A;  3H4Q A;  1Z4R A;  2ARH A;  2YNC C;  4CAV A;  4CYN A;  3TOA A;  4R3L A;  1IIC A;  2B5G B;  3GKR A;  4UFW A;  4MY3 A;  4CGM A;  3IU2 A;  4PSW A;  4A30 A;  1Z9U A;  5ISV A;  1M4G A;  2O28 A;  2HV2 A;  5C88 A;  4JXQ A;  3R9E A;  3G3S A;  4CGL A;  2PR8 A;  5BWA B;  1Y7R A;  2QEC A;  3LOD A;  3JUW A;  4UCP A;  5FVJ A;  2I79 A;  3R95 A;  2Q4V A;  3FNC A;  4UWJ A;  2JEV A;  5DWM A;  3V8I A;  4DNC A;  3K9U A;  2Z10 A;  4H6Z A;  2Z0Z A;  2HUZ A;  4UWI A;  4FD6 A;  4CAF A;  3T90 A;  4CGO A;  2P6E A;  1BO4 A;  3BJ7 A;  2Z3K A;  3VWD A;  5H84 A;  2R98 A;  1TIQ A;  4MFP A;  1K4J A;  2RC4 A;  2A4N A;  4L89 A;  5KTA A;  1KUY A;  2REE A;  3IWG A;  3E0K A;  2VQY A;  2D4O A;  3TOB A;  2Z3O A;  1MJA A;  4M3S A;  1YLE A;  2R7H A;  3S6F A;  2GAN A;  1YGH A;  1VKC A;  4B14 A;  1QSO A;  2K5T A;  3JTK A;  3RYO A;  4X5K A;  4RI1 A;  1YX0 A;  4Q38 A;  1NE9 A;  1I1D A;  1M1D A;  3BLN A;  5E96 A;  4II9 A;  4HKF A;  2BL1 A;  4NSQ A;  2Q7B A;  1L0C A;  4KUA A;  2DPT A;  4KSA A;  1Q2Y A;  4YRH A;  3TE4 A;  2DXQ A;  5J8C A;  2AE6 A;  1XIX A;  4B13 A;  1KZF A;  4NXY A;  2FE7 A;  1BOB A;  2J8R A;  4YFJ A;  3TO7 A;  5F49 A;  3NE7 A;  4OAD A;  5KTC A;  3F5B A;  4K30 A;  4RS2 A;  4KOX A;  4B10 A;  4A95 A;  4CRY B;  2PSW A;  5G21 A;  2PC1 A;  3I3G A;  4JLY A;  1S7F A;  4UCN A;  4ONU A;  1VHS A;  2Q4Y A;  4CAW A;  2B5G A;  4J3G A;  4CS0 B;  2JDC A;  3QAH A;  5HH1 A;  4KOR A;  4AVA A;  2B3V A;  4XPL A;  1S7L A;  5AG5 A;  3CXS A;  5IB0 A;  3B8G A;  2FCK A;  4UCM A;  3EXN A;  1GHE A;  5F48 A;  2Z3N A;  3G8W A;  4U9Z A;  1MJ9 A;  2CNM A;  4MY0 A;  2J8M A;  2OB0 A;  2CNS A;  3IWE A;  1YRE A;  4R57 A;  2KCW A;  4BMH A;  1Y9K A;  4UBR A;  4H89 A;  2OH1 A;  5G1Z A;  4LX9 A;  3S6K A;  3D2P A;  3WR7 A;  1RO5 A;  4AG7 A;  3PGP A;  3CXP A;  4YGO A;  1N71 A;  1S60 A;  2P6F A;  4A32 A;  4KSF A;  2B3U A;  2R1I A;  3DSB A;  3ZZI A;  2OZH A;  3R96 A;  3D3S A;  1IYK A;  3EO4 A;  4C2Z A;  3W6S A;  4C2Y A;  5AG4 A;  1NSL A;  2FS5 A;  2B4D B;  4CGP A;  2ZW4 A;  4UA3 A;  2ATR A;  4KLW A;  4IUS A;  2ZPA A;  2VBQ A;  5IV0 A;  4KVX A;  4KOY A;  4AG9 A;  4QB9 A;  3MGD A;  5EC4 A;  1PU9 A;  2Z3P A;  5EBV A;  4L8A A;  1B87 A;  4FD4 A;  1P4N A;  2VEZ A;  4CYQ A;  4ZGY B;  2QML A;  4JWP A;  1SQH A;  3FIX A;  4A33 A;  4ZBG A;  2REF A;  2YNC A;  2OZG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...