5KTCA

Fdhc with bound products: coenzyme a and 3-[(r)-3-hydroxybutanoylamino]-3,6-dideoxy-d-galactose
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
187
structure length
187
Chain Sequence
VNFNLKANTTYLRLVEENDAEFICTLRNNDKLNTYISKSTGDIKSQAEWIRNYKNRENNGEEYYFIIFRSDDQSPIGTVRLYDFHENPKSFCWGSWILNEHKTKYAAVESALLVYEAGFSTLGFEQSHFEVMKGNDKVHSFHLKMGAQKISEDDENIYYIFPKSKYKENKIQYARFLGKLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FdhC
publication title Structural and Functional Investigation of FdhC from Acinetobacter nosocomialis: A Sugar N-Acyltransferase Belonging to the GNAT Superfamily.
pubmed doi rcsb
source organism Acinetobacter nosocomialis
molecule tags Transferase
total genus 61
structure length 187
sequence length 187
ec nomenclature
pdb deposition date 2016-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13302 Acetyltransf_3 Acetyltransferase (GNAT) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 5ktcA00
4XPKA 3TO7A 2PDOA 4H89A 4HNXB 3BJ7A 3TOBA 1S60A 2ZW7A 3PGPA 3EXNA 4KVXA 2VXKA 3S6GA 5J8FA 2J8MA 1XF8A 3F5BA 3BLNA 4U5YA 2JDDA 4RS2A 3D2MA 3SHPA 3R9FA 2O28A 4AG9A 4GS4A 1SQHA 5HH1A 5E96A 2ZW4A 5I0CA 1S7LA 2R7HA 2HQYA 1S5KA 2ZW6A 2K5TA 4R87A 4L89A 4F6AA 2NMTA 5F46A 1NMTA 1Y9WA 3R9GA 2F5IA 1PU9A 2B5GA 3GY9A 5FVJA 1QSNA 1CJWA 1PUAA 2HUZA 2FE7A 1IYLA 3F0AA 3EC4A 4MY0A 4II9A 4CRZB 3R9EA 2X7BA 4OAEA 4KOSA 2G3TA 2CNMA 4KLWA 2QECA 3JUWA 4NCZA 4KOVA 2GE3A 4NF1A 4JJXA 3K9UA 4B5PB 4Y49C 1Q2DA 2CY2A 2VBQA 4YGOA 2KCWA 2OU2A 2BL1A 5C82A 3C26A 4NSQA 4PV6A 2OZUA 2G0BA 1XE4A 2FIWA 3IGRA 1OZPA 2DXQA 1Y9KA 1K4JA 5DWMA 1P4NA 2JLMA 2QMLA 2Q4YA 2REEA 4HNWB 4XNHB 2D4PA 1U6MA 4AVCA 1MJ9A 2B4DB 3R1KA 3P2HA 4I49A 4PSXA 1NSLA 5H86A 4XNHC 2VZYA 4FD5A 2Z10A 2P6GA 1RXTA 3T9YA 4KZTA 4M85A 4XPDB 4KOUA 3VWDA 4MHDA 3S6HA 1VKCA 1V0CA 4B5OA 4BMHA 3LD2A 1QSTA 4EVYA 5F49A 2B3VA 5C88A 4KOTA 3ZJ0A 4E0AA 4JLYA 3V8IA 2EUIA 3ZZIA 4K30A 4UWIA 4AB7A 3QB8A 3TTHA 1RO5A 1UFHA 2ARHA 3EO4A 4CS0B 2ZW5A 3DSBA 1S7FA 1YK3A 4FD6A 3WR7A 2B5GB 1YX0A 4NXYA 4U9ZA 2Y0MA 2ATRA 2P6FA 3QAHA 4KOYA 2Q0YA 2FCKA 3T90A 3FXTA 3DR8A 4J3GA 2BSWA 5H84A 4UBRA 1Y7RA 4R9MA 4KORA 1WK4A 3DR6A 1YREA 2REFA 1I21A 1YGHA 2FSRA 3P2FA 4LUAA 2I00A 4MJ8A 4AG7A 4XPLA 4M3SA 3TFYA 2D4OA 2A4NA 4R3KA 4QB9A 2FXFA 2EVNA 3TT2A 1WWZA 3E0KA 3UY5A 1KUXA 2OB0A 4CRYB 3LODA 2ZXVA 1TIQA 1YVOA 3FB3A 1L0CA 4JXQA 3KKWA 2FL4A 3D2PA 3GKRA 1XEBA 3R95A 4E2AA 4PK2A 1MK4A 4QUSA 2PC1A 2B58A 2PR8A 2GANA 4HNYB 2FS5A 3I3GA 2FIAA 2RC4A 1M4DA 2PSWA 2QIRA 4MI4A 4L8AA 2OZGA 3OWCA 3BJ8A 4QBJA 3CXQA 4HKFA 2CNTA 2OZHA 1M4GA 1S7KA 5IB0A 4KUBA 3S6KA 2R1IA 2J8NA 4F0YA 2HV2A 1XMTA 3JVNA 3G8WA 3PZJA 3W6SA 1XIXA 3W6XA 4KUAA 1B87A 2B4BA 2FT0A 3EFAA 4XPDC 2PR1A 1YR0A 4CAWA 1Z4RA 3FBUA 5KTAA 1VHSA 4UWJA 1BOBA 1YLEA 1Q2CA 2VI7A 1S3ZA 2P6EA 1Q2YA 4FD7A 3I9SA 2OH1A 4NEXA 4PK3A 3TO6A 4R57A 1MJAA 1FY7A 3D8PA 3TE4A 2PRBA 3H4QA 4MY3A 4KLVA 4U9YA 1B6BA 1N71A 2BUEA 3W91A 2R8VA 5IX3A 2P0WA 1KUYA 1M4IA 5CNPA 2Z11A 1ON0A 4RI1A 2R98A 1KZFA 4E8OA 4ZBGA 4YFJA 3PP9A 2JDCA 2G3AA 5HMNA 1CM0A 2VEZA 1IIDA 1P0HA 2Q4VA 4LX9A 4OLLA 5KTCA 4ORFA 4JXRA 3D3SA 4H6ZA 5F47A 2WPWA 2Z0ZA 4AVAA 4UA3A 2I79A 1IICA 5F48A 3FYNA 4DNCA 5IV0A 4KVOE 3TOAA 4AVBA 4R3LA 3CXPA 2PQ8A 2AE6A 4QC6A 5J8CA 5DWNA 5ISVA 4IF5A 5GCNA 3SXNA 2CNSA 2ZPAA 3IWGA 4Y49B 1S7NA 2Q44A 1GHEA 3FRMA 1BO4A 3FNCA 5KTDA 1QSRA 4IUSA 1M44A 3G3SA 2JEVA 1I1DA 1M1DA 5EC4A 2GIVA 4ONUA 4X5KA 4YRHA 5JQ4A 1KUVA 4JWPA 2AJ6A 1I12A 5JPHA 4CAVA 1Z4EA 3CXSA 1YVKA 4H6UA 4B5PA 3EY5A 3DDDA 3F8KA 2H5MA 2IL4A 3DNSA 1IYKA 3RYOA 4FD4A 4KOXA 2BEIA 4JD6A 4KVME 4KOWA 1R57A 3TO9A 2C27A 1QSOA 4MBUA 1NE9A 3S6FA 2Q7BA 4CAXA 2VZZA 2B4DA 3GYAA 5EBVA 2B3UA 3NE7A 1IB1E 3TCVA 4PSWA 1J4JA 1LRZA 1MJBA 3MGDA 3SXOA 3R96A 1Z9UA 2J8RA 2VQYA 2WPXA 4OADA 4QVTA 2Q04A 3N7ZA 3VWEA 3FIXA 1QSMA 3B8GA
chains in the Genus database with same CATH superfamily
4XPKA 1AMPA 3TO7A 2PDOA 4H89A 4HNXB 3BJ7A 3TOBA 4C2XA 1S60A 2ZW7A 3PGPA 2PJBA 3EXNA 4KVXA 2VXKA 3S6GA 4CAEA 4MHZA 2BOAA 3D67A 4OC0A 5J8FA 3FECA 2J8MA 1XF8A 3F5BA 4B14A 2QJ8A 3BLNA 4U5YA 3SJGA 3FEEA 1X10A 2JDDA 2PJ4A 2V8DA 3D2MA 4RS2A 1Z5RA 3JRUA 3KHZA 3R9FA 2O28A 3SHPA 3WC5A 4AG9A 4IAVA 3RBUA 1ARLA 3DLJA 4C68A 4GS4A 3D7HA 5HXDA 2AFUA 3WT4A 4R7MA 1VHEA 1SQHA 5AG5A 3MN8A 3B3WA 5E96A 2ZW4A 5HH1A 5I0CA 4MFZA 1S7LA 5HVFA 2R7HA 4LQ6A 1Z8TA 3WC7A 4ZY0A 4PQAA 2HQYA 4CGMA 1S5KA 2ZW6A 2DEAA 2K5TA 4P4IA 4R6TA 4R87A 4MHPA 2Z3NA 4L89A 5F09A 2YGWA 4F8ZA 5A28A 1M4LA 4F6AA 2NMTA 5F46A 1NMTA 1Y9WA 4P4FA 3R9GA 4A37A 2F5IA 1PU9A 2PJ1A 2B5GA 3GY9A 5FVJA 1IGBA 2ZELA 2PJ9A 3B3VA 1QSNA 4ZY2A 1CJWA 2Q43A 1PUAA 2DPSA 4NGNA 2HUZA 2FE7A 3PBBA 2Z3MA 1AUGA 1IYLA 3F0AA 3EC4A 3JTKA 4MY0A 2AFXA 4II9A 2POKA 4CRZB 3R9EA 2X7BA 3DGVA 4OAEA 5LYDA 2VL1A 4KOSA 4CAFA 2G3TA 2CNMA 3D7FA 2QECA 2V8VA 3FJUA 3JUWA 4KLWA 4P45A 1TXRA 4UF4A 4NCZA 5AG7A 4ZI6A 3SI1A 4KOVA 3QNVA 2PIZA 2GE3A 4MHNA 4NF1A 4ZX8A 4JJXA 2C6PA 2G9DA 3K9UA 4MCPA 4Y49C 1Q2DA 2CY2A 4MCRA 5ELYA 2VBQA 3N5FA 3SJFA 4MRIA 5AGEA 4OIDA 4YGOA 4M6IA 1JQGA 2KCWA 3B3CA 4KSAA 4OIWA 2OU2A 2BL1A 4UCNA 3IIBA 4ZYQA 3IO1A 1FNOA 2ZOFA 3C26A 1XOVA 3B35A 4K3NA 4NSQA 4A30A 5C82A 4A31A 4PV6A 4MFJA 4GXHA 2OZUA 1LOKA 2G0BA 2ZEPA 3FVLA 1XE4A 3KL9A 1UWYA 1XFOA 1CPSA 2FIWA 2PJ6A 3IGRA 2BCOA 4MCSA 1OZPA 2DXQA 1Y9KA 3A9LA 4ZGYB 1K4JA 2JEWA 5DWMA 1P4NA 2JLMA 2QMLA 2Q4YA 2REEA 4HNWB 4XNHB 2D4PA 1U6MA 2V8HA 4AVCA 1DTDA 1CP7A 1CX8A 1A2ZA 1MJ9A 2B4DB 3R1KA 3P2HA 4I49A 1HEEA 4HPSA 4PSXA 4YWYA 1NSLA 4MFQA 5H86A 3K2KA 2NYQA 3SI2A 4XNHC 6CPAA 1CBXA 2VZYA 4W9YA 1X12A 4FD5A 2Z10A 2P6GA 4X8IA 1RXTA 4F9VA 1KWMA 1ARMA 2YNCA 4KZTA 3T9YA 3TX8A 2CF4A 4M85A 4XPDB 4KOUA 4YU9A 2AFMA 3VWDA 4MHDA 2PIYA 3S6HA 5K8NA 2PCUA 2ABZA 3K9TA 4OP4A 1VKCA 3KGQA 4C2ZA 1V0CA 3BI1A 4B5OA 2EK9A 2Q51A 3LD2A 4BMHA 5CBMA 4MFKA 2ZEGA 1QSTA 2HB6A 4UFWA 4EVYA 1XBUA 5G20A 5F49A 2ZOGA 2B3VA 3T8WA 5LRKA 4EFDA 3H8EA 4OC1A 2C6CA 5C88A 4KOTA 3ZJ0A 4E0AA 4JLYA 2ZEOA 4MFLA 1LAMA 3D7DA 4NJRA 3V8IA 3B2YA 2EUIA 3IC1A 3H8FA 4OC4A 3ZZIA 4K30A 4UWIA 5HVGA 4AB7A 4GM5A 3QB8A 3TTHA 4P4EA 5JGFA 3LMSA 2PJ2A 4DUKA 4PPZA 1RO5A 1UFHA 5G22A 2ARHA 3EO4A 3SJEA 1Y0YA 2ZW5A 2O53A 3DSBA 4UFVA 1FT7A 4UEEA 4CS0B 3B3TA 1S7FA 1YK3A 4KS9A 3D7GA 4FD6A 1Z8WA 3WR7A 4A32A 2B5GB 3CPAA 1YW6A 2EWBA 1YX0A 4NXYA 4U9ZA 4F9UA 2Y0MA 4IK2A 2ATRA 4BINA 5K8OA 3KZWA 2P6FA 1LCPA 3QAHA 4KOYA 2Q0YA 5JH9A 2FCKA 3IEHA 3T90A 5I4MA 2WYRA 3FXTA 3DR8A 4J3GA 2BSWA 2F8HA 1CPXA 4B13A 4P6YA 5H84A 4UBRA 1Y7RA 3IWWA 2NSMA 3PB7X 2ZEEA 4R9MA 3ISXA 4KORA 1WK4A 2PE3A 3DR6A 2V8GA 1YREA 4C2YA 2REFA 3B3SA 4UIBA 1I21A 1YGHA 2FSRA 3P2FA 3BXMA 2CXAA 4LUAA 2I00A 4X3RA 4MJ8A 2OOTA 4P44A 3PB8X 4AG7A 3H8GA 4XPLA 4UCPA 4M3SA 3VARA 3TFYA 1IOIA 4OC2A 2D4OA 1R43A 2A4NA 4R3KA 4UEZA 2YNDA 4QB9A 3NH8A 2FXFA 4NGPA 2XEIA 3D68A 2EVNA 3TT2A 2Q7SA 2RB7A 3IWEA 3TC8A 1WWZA 3IU1A 4OC5A 3E0KA 4P4BA 3UY5A 3H5ZA 1LANA 1KUXA 2CIJA 2XEJA 4PXEA 2OB0A 1Y0RA 1YSJA 3LODA 4NGQA 4CRYB 3GB0A 2BO9A 2PJ7A 5DS0A 3NH4A 2ZXVA 4CGLA 1TIQA 1YVOA 3GLJA 4Z65A 1H8LA 3FB3A 4NJQA 1ZG7A 1L0CA 2Z3KA 4JXQA 4X2TA 3KKWA 1IU8A 2WSAA 3MRUA 4NFRA 2FL4A 3D2PA 3GKRA 3RO0A 1XEBA 3NH5A 3R95A 3VATA 4E2AA 4PK2A 2Z3OA 1MK4A 2PJAA 4QUSA 4M6HA 2JBJA 2PC1A 2B58A 2PR8A 4FAIA 2GANA 4P10A 4MCQA 5G21A 4HNYB 4MFPA 1TF9A 1PYTB 2FS5A 3I3GA 1Y7EA 2FIAA 2RC4A 5K8MA 2IMOA 1M4DA 2PSWA 2QIRA 4MI4A 1HDUA 1PCAA 1F57A 4L8AA 5THWA 2OZGA 3PFEA 5AG6A 3OWCA 3BJ8A 4WWVA 2ZEFA 4QBJA 2V77A 1ZG8A 1F2PA 2ODFA 4KSIA 4A95A 2ZEDA 5CPAA 3CXQA 4HKFA 2CNTA 1BPMA 2OZHA 1M4GA 4Q7AA 1S7KA 3ISZA 5IB0A 2EBJA 4FWUA 4KUBA 3S6KA 2R1IA 2J8NA 4F0YA 4EMEA 1YW4A 2PJ0A 4OC3A 3BI0A 7CPAA 2HV2A 1XMTA 1CP6A 3JVNA 2EK8A 3G8WA 3IU2A 3PZJA 3BHXA 4NGTA 2OR4A 3W6SA 1XIXA 1YMEA 4JZ0A 2EO8A 2HC9A 4KUAA 3CPXA 1B87A 3W6XA 1AYEA 1Z2LA 1Z8LA 4H2KA 4A2ZA 2B4BA 2FT0A 4CYNA 2PVVA 2WUUA 5G1ZA 3EFAA 3S9MA 4PXDA 4XPDC 2PR1A 1F2OA 4LQGA 2C1CA 1YR0A 4CAWA 5K8PA 1Z4RA 3FBUA 4A33A 5KTAA 1VHSA 2PJ3A 3KR5A 4UWJA 1BOBA 4R8FA 3FF3A 3PFOA 1YLEA 1DE4C 1Q2CA 2VI7A 2XEGA 1S3ZA 3FX6A 1LAPA 1EE3P 2QYVA 2Z3LA 1BAVA 2P6EA 1Q2YA 3HLPA 3NFZA 2ZEHA 4FD7A 3I9SA 4P4JA 1IOFA 2DF5A 4NGMA 2OH1A 4NEXA 2Z3PA 4PK3A 3TO6A 2GU2A 4CGPA 2PVWA 3NE8A 2GLFA 4R57A 2XEFA 4MXUA 1JWQA 1MJAA 3LWUA 1FY7A 2IQ6A 1QQ9A 4DYOA 3D8PA 3KQXA 2CTCA 4CYPA 3TE4A 2PRBA 1RTQA 4B6ZA 4EWTA 4M6GA 3H4QA 4MY3A 4KLVA 4U9YA 1ZO0A 1B6BA 1N71A 2BUEA 3D66A 3FMCA 5D29A 2R8VA 1IY7A 2FVGA 3W91A 2P0WA 4FBEA 5IX3A 4P4DA 3I1UA 3V38A 1KUYA 1M4IA 2WZNA 2Z11A 4OKOA 5CNPA 1ON0A 4RI1A 4UEFA 2R98A 1KZFA 2AFWA 4B12A 4CPAA 4E8OA 3LACA 4ZBGA 2ANPA 4R76A 4YFJA 4G1PA 1BPNA 3PP9A 5LYFA 2JDCA 2G3AA 4A38A 5HMNA 1ZLIA 1CM0A 4Q36A 2VEZA 1IIDA 1P0HA 2Q4VA 4LX9A 4OLLA 5LYIA 5LYLA 3S9LA 3RAMA 5KTCA 4ORFA 3CDXA 4CYQA 4JXRA 3IJ3A 3D3SA 4H6ZA 5F47A 2WPWA 2Z0ZA 3WABA 4AVAA 4CGOA 1CG2A 4UA3A 5JM6A 4Q38A 4CGNA 2DPTA 5AG4A 4FUUA 2I79A 1IICA 5F48A 2IJZA 1OBRA 3CT9A 4BD9A 3PRTA 4AXVA 3FYNA 3PB4X 4DNCA 1NSAA 3PB9X 2F7VA 5IV0A 4KVOE 1GYTA 1Q7LA 3TOAA 4AVBA 1TKHA 4R3LA 3CXPA 2PQ8A 2AE6A 2J9AA 4A39A 4QC6A 4ZY1A 2O4HA 3SJXA 5J8CA 5DWNA 3SI0A 4BBHA 3QAYA 5ISVA 2GREA 1Z8XA 2Q4ZA 3KHXA 4IF5A 4UIAA 5GCNA 3SXNA 3D4UA 4MHYA 2CNSA 2ZPAA 1VGYA 4UFXA 3IWGA 4Y49B 4NGRA 4PXCA 1R3NA 1S7NA 4RUHA 1TKJA 2Q44A 8CPAA 1GHEA 3FRMA 1BO4A 3FNCA 5KTDA 1QSRA 4B10A 4IUSA 2PRQA 1M44A 3G3SA 4UCMA 3VH9A 5BWAB 2PJ8A 2JEVA 1I1DA 1M1DA 2ZEMA 1ELMP 5EC4A 3RNZA 2GIVA 4ONUA 4X5KA 4YRHA 5JQ4A 3CZXA 5A27A 3RZAA 3B7IA 1KUVA 2RFHA 4JWPA 2AJ6A 1BLLE 3V7ZA 1I12A 5JPHA 1YQEA 2CTBA 4CAVA 1Z4EA 5J1QA 3CXSA 1YVKA 4H6UA 2YNCC 2GFQA 3FEDA 4B5PA 3EY5A 1QMUA 2PJ5A 3DDDA 3HUVA 4TNUA 2C6GA 3F8KA 3PEIA 3S9NA 3GUXA 2AFSA 2H5MA 2IL4A 3DNSA 1IYKA 1TF8A 3RYOA 1XMBA 1HDQA 4FD4A 4KOXA 2BEIA 2I3CA 3KI9A 4JD6A 4KVME 4KOWA 1R57A 3TO9A 2C27A 4KSFA 4OMEA 1QSOA 1ZLHA 2GLJA 1NE9A 4MBUA 4MMOA 4B11A 3S6FA 2Q7BA 5LRGA 4PXBA 4CAXA 4A94A 4CYOA 2VZZA 3KASA 4C7HA 4NGSA 4RN7A 3NA6A 4TWEA 4ONWA 2JBKA 5EMIA 4C7IA 5IB9A 5LRJA 2B4DA 2AFOA 3GYAA 3PB6X 5EBVA 1YLOA 2B3UA 1XRYA 1ELLP 3NE7A 1IB1E 1TKFA 3TCVA 1VIXA 4PSWA 4DJLA 5HVHA 1J4JA 1LRZA 1MJBA 4F0XA 3KR4A 3KQZA 3MGDA 3SXOA 4JYWA 3R96A 4B5PB 1Z9UA 2J8RA 2VQYA 2WPXA 5D8NA 4WJBA 3IFEA 2PJCA 4OADA 1VHOA 2Q04A 3N7ZA 4QVTA 3VWEA 1XJOA 2YNEA 1ZG9A 2AFZA 2QVPA 3FH4A 3FIXA 3WC6A 1LFWA 1QSMA 4O23A 2ZENA 4ZX9A 3GIUA 3L2NA 3PBEA 3B8GA 4IHMA
chains in the Genus database with same CATH topology
4XPKA 3TO7A 2PDOA 4H89A 4HNXB 3BJ7A 3TOBA 4C2XA 1S60A 2ZW7A 3PGPA 3EXNA 4KVXA 2VXKA 3S6GA 4CAEA 5J8FA 2J8MA 1XF8A 3F5BA 4B14A 3BLNA 4U5YA 2JDDA 4RS2A 3D2MA 3SHPA 3R9FA 2O28A 4AG9A 4C68A 4GS4A 1SQHA 5AG5A 5HH1A 5E96A 2ZW4A 5I0CA 4MFZA 1S7LA 2R7HA 2HQYA 4CGMA 1S5KA 2ZW6A 2K5TA 4R87A 2Z3NA 4L89A 2YGWA 5A28A 4F6AA 2NMTA 5F46A 1NMTA 1Y9WA 3R9GA 2F5IA 1PU9A 2B5GA 3GY9A 5FVJA 1QSNA 1CJWA 1PUAA 2DPSA 2HUZA 2FE7A 2Z3MA 1IYLA 3F0AA 3JTKA 3EC4A 4MY0A 4II9A 4CRZB 3R9EA 2X7BA 4OAEA 4KOSA 4CAFA 2G3TA 2CNMA 4KLWA 2QECA 3JUWA 5AG7A 4NCZA 4KOVA 2GE3A 4NF1A 4JJXA 3K9UA 4B5PB 4Y49C 1Q2DA 2CY2A 2VBQA 5AGEA 4YGOA 2KCWA 4KSAA 2OU2A 2BL1A 4UCNA 5C82A 3C26A 4NSQA 4A30A 4A31A 4PV6A 4MFJA 2OZUA 2G0BA 1XE4A 2FIWA 3IGRA 4ZGYB 1OZPA 2DXQA 1Y9KA 3A9LA 1K4JA 5DWMA 1P4NA 2JLMA 2QMLA 2Q4YA 2REEA 4HNWB 4XNHB 2D4PA 1U6MA 4AVCA 1MJ9A 2B4DB 3R1KA 3P2HA 4I49A 4PSXA 1NSLA 4MFQA 5H86A 4XNHC 2VZYA 4FD5A 2Z10A 2P6GA 1RXTA 3T9YA 2YNCA 4KZTA 4M85A 4XPDB 4KOUA 3VWDA 4MHDA 3S6HA 1VKCA 4C2ZA 1V0CA 4B5OA 4BMHA 3LD2A 4MFKA 1QSTA 4UFWA 4EVYA 5G20A 5F49A 2B3VA 5C88A 4KOTA 3ZJ0A 4E0AA 4JLYA 4MFLA 3V8IA 2EUIA 3ZZIA 4K30A 4UWIA 4AB7A 3QB8A 3TTHA 1RO5A 1UFHA 5G22A 2ARHA 3EO4A 4CS0B 2ZW5A 3DSBA 4UFVA 4KS9A 1S7FA 1YK3A 4FD6A 3WR7A 4A32A 2B5GB 1YX0A 4NXYA 4U9ZA 2Y0MA 2ATRA 2P6FA 3QAHA 4KOYA 2Q0YA 2FCKA 3T90A 3FXTA 3DR8A 4J3GA 2BSWA 4B13A 5H84A 4UBRA 1Y7RA 4R9MA 4KORA 1WK4A 3DR6A 1YREA 4C2YA 2REFA 1I21A 1YGHA 2FSRA 3P2FA 2CXAA 4LUAA 2I00A 4MJ8A 4AG7A 4XPLA 4UCPA 4M3SA 3TFYA 2D4OA 2A4NA 4R3KA 2YNDA 4QB9A 2FXFA 2EVNA 3TT2A 3IWEA 1WWZA 3IU1A 3E0KA 3UY5A 3H5ZA 1KUXA 2OB0A 4CRYB 3LODA 2ZXVA 4CGLA 1TIQA 1YVOA 3FB3A 1L0CA 2Z3KA 4JXQA 3KKWA 2WSAA 2FL4A 3D2PA 3GKRA 1XEBA 3R95A 4E2AA 4PK2A 2Z3OA 1MK4A 4QUSA 2PC1A 2B58A 2PR8A 2GANA 5G21A 4HNYB 4MFPA 2FS5A 3I3GA 2FIAA 2RC4A 1M4DA 2PSWA 2QIRA 4MI4A 4L8AA 2OZGA 5AG6A 3OWCA 3BJ8A 4QBJA 4A95A 3CXQA 4HKFA 2CNTA 2OZHA 1M4GA 1S7KA 5IB0A 4KUBA 3S6KA 2R1IA 2J8NA 4F0YA 2HV2A 1XMTA 3JVNA 3G8WA 3IU2A 3PZJA 3W6SA 1XIXA 3W6XA 4KUAA 1B87A 4A2ZA 2B4BA 2FT0A 4CYNA 2WUUA 5G1ZA 3EFAA 4XPDC 2PR1A 1YR0A 4CAWA 1Z4RA 3FBUA 4A33A 5KTAA 1VHSA 4UWJA 1BOBA 1YLEA 1Q2CA 2VI7A 1S3ZA 2Z3LA 2P6EA 1Q2YA 4FD7A 3I9SA 2OH1A 4NEXA 2Z3PA 4PK3A 3TO6A 4CGPA 4R57A 1MJAA 1FY7A 3D8PA 4CYPA 3TE4A 2PRBA 3H4QA 4MY3A 4KLVA 4U9YA 1ZO0A 1B6BA 1N71A 2BUEA 3W91A 2R8VA 5IX3A 2P0WA 1KUYA 1M4IA 5CNPA 2Z11A 1ON0A 4RI1A 2R98A 1KZFA 4B12A 4E8OA 4ZBGA 4YFJA 3PP9A 2JDCA 2G3AA 5HMNA 1CM0A 4Q36A 2VEZA 1IIDA 1P0HA 2Q4VA 4LX9A 4OLLA 5KTCA 4ORFA 4CYQA 4JXRA 3D3SA 4H6ZA 5F47A 2WPWA 2Z0ZA 4AVAA 4CGOA 4UA3A 4Q38A 4CGNA 2DPTA 5AG4A 2I79A 1IICA 5F48A 3FYNA 4DNCA 5IV0A 4KVOE 3TOAA 4AVBA 4R3LA 3CXPA 2PQ8A 2AE6A 4QC6A 5J8CA 5DWNA 4BBHA 5ISVA 4IF5A 5GCNA 3SXNA 2CNSA 2ZPAA 4UFXA 3IWGA 4Y49B 1S7NA 2Q44A 1GHEA 3FRMA 1BO4A 3FNCA 5KTDA 1QSRA 4B10A 4IUSA 1M44A 3G3SA 4UCMA 5BWAB 2JEVA 1I1DA 1M1DA 5EC4A 2GIVA 4ONUA 4X5KA 4YRHA 5JQ4A 5A27A 1KUVA 4JWPA 2AJ6A 1I12A 5JPHA 4CAVA 1Z4EA 3CXSA 1YVKA 4H6UA 2YNCC 4B5PA 3EY5A 3DDDA 3F8KA 2H5MA 2IL4A 3DNSA 1IYKA 3RYOA 4FD4A 4KOXA 2BEIA 4JD6A 4KVME 4KOWA 1R57A 3TO9A 2C27A 4KSFA 1QSOA 4MBUA 1NE9A 4B11A 3S6FA 2Q7BA 4CAXA 4CYOA 2VZZA 4C7HA 4C7IA 2B4DA 3GYAA 5EBVA 2B3UA 3NE7A 1IB1E 3TCVA 4PSWA 1J4JA 1LRZA 1MJBA 4F0XA 3MGDA 3SXOA 3R96A 1Z9UA 2J8RA 2VQYA 2WPXA 4OADA 4QVTA 2Q04A 3N7ZA 3VWEA 2YNEA 3FIXA 1QSMA 3B8GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XPK A;  3TO7 A;  2PDO A;  4H89 A;  4HNX B;  3BJ7 A;  3TOB A;  1S60 A;  2ZW7 A;  3PGP A;  3EXN A;  4KVX A;  2VXK A;  3S6G A;  5J8F A;  2J8M A;  1XF8 A;  3F5B A;  3BLN A;  4U5Y A;  2JDD A;  4RS2 A;  3D2M A;  3SHP A;  3R9F A;  2O28 A;  4AG9 A;  4GS4 A;  1SQH A;  5HH1 A;  5E96 A;  2ZW4 A;  5I0C A;  1S7L A;  2R7H A;  2HQY A;  1S5K A;  2ZW6 A;  2K5T A;  4R87 A;  4L89 A;  4F6A A;  2NMT A;  5F46 A;  1NMT A;  1Y9W A;  3R9G A;  2F5I A;  1PU9 A;  2B5G A;  3GY9 A;  5FVJ A;  1QSN A;  1CJW A;  1PUA A;  2HUZ A;  2FE7 A;  1IYL A;  3F0A A;  3EC4 A;  4MY0 A;  4II9 A;  4CRZ B;  3R9E A;  2X7B A;  4OAE A;  4KOS A;  2G3T A;  2CNM A;  4KLW A;  2QEC A;  3JUW A;  4NCZ A;  4KOV A;  2GE3 A;  4NF1 A;  4JJX A;  3K9U A;  4B5P B;  4Y49 C;  1Q2D A;  2CY2 A;  2VBQ A;  4YGO A;  2KCW A;  2OU2 A;  2BL1 A;  5C82 A;  3C26 A;  4NSQ A;  4PV6 A;  2OZU A;  2G0B A;  1XE4 A;  2FIW A;  3IGR A;  1OZP A;  2DXQ A;  1Y9K A;  1K4J A;  5DWM A;  1P4N A;  2JLM A;  2QML A;  2Q4Y A;  2REE A;  4HNW B;  4XNH B;  2D4P A;  1U6M A;  4AVC A;  1MJ9 A;  2B4D B;  3R1K A;  3P2H A;  4I49 A;  4PSX A;  1NSL A;  5H86 A;  4XNH C;  2VZY A;  4FD5 A;  2Z10 A;  2P6G A;  1RXT A;  3T9Y A;  4KZT A;  4M85 A;  4XPD B;  4KOU A;  3VWD A;  4MHD A;  3S6H A;  1VKC A;  1V0C A;  4B5O A;  4BMH A;  3LD2 A;  1QST A;  4EVY A;  5F49 A;  2B3V A;  5C88 A;  4KOT A;  3ZJ0 A;  4E0A A;  4JLY A;  3V8I A;  2EUI A;  3ZZI A;  4K30 A;  4UWI A;  4AB7 A;  3QB8 A;  3TTH A;  1RO5 A;  1UFH A;  2ARH A;  3EO4 A;  4CS0 B;  2ZW5 A;  3DSB A;  1S7F A;  1YK3 A;  4FD6 A;  3WR7 A;  2B5G B;  1YX0 A;  4NXY A;  4U9Z A;  2Y0M A;  2ATR A;  2P6F A;  3QAH A;  4KOY A;  2Q0Y A;  2FCK A;  3T90 A;  3FXT A;  3DR8 A;  4J3G A;  2BSW A;  5H84 A;  4UBR A;  1Y7R A;  4R9M A;  4KOR A;  1WK4 A;  3DR6 A;  1YRE A;  2REF A;  1I21 A;  1YGH A;  2FSR A;  3P2F A;  4LUA A;  2I00 A;  4MJ8 A;  4AG7 A;  4XPL A;  4M3S A;  3TFY A;  2D4O A;  2A4N A;  4R3K A;  4QB9 A;  2FXF A;  2EVN A;  3TT2 A;  1WWZ A;  3E0K A;  3UY5 A;  1KUX A;  2OB0 A;  4CRY B;  3LOD A;  2ZXV A;  1TIQ A;  1YVO A;  3FB3 A;  1L0C A;  4JXQ A;  3KKW A;  2FL4 A;  3D2P A;  3GKR A;  1XEB A;  3R95 A;  4E2A A;  4PK2 A;  1MK4 A;  4QUS A;  2PC1 A;  2B58 A;  2PR8 A;  2GAN A;  4HNY B;  2FS5 A;  3I3G A;  2FIA A;  2RC4 A;  1M4D A;  2PSW A;  2QIR A;  4MI4 A;  4L8A A;  2OZG A;  3OWC A;  3BJ8 A;  4QBJ A;  3CXQ A;  4HKF A;  2CNT A;  2OZH A;  1M4G A;  1S7K A;  5IB0 A;  4KUB A;  3S6K A;  2R1I A;  2J8N A;  4F0Y A;  2HV2 A;  1XMT A;  3JVN A;  3G8W A;  3PZJ A;  3W6S A;  1XIX A;  3W6X A;  4KUA A;  1B87 A;  2B4B A;  2FT0 A;  3EFA A;  4XPD C;  2PR1 A;  1YR0 A;  4CAW A;  1Z4R A;  3FBU A;  5KTA A;  1VHS A;  4UWJ A;  1BOB A;  1YLE A;  1Q2C A;  2VI7 A;  1S3Z A;  2P6E A;  1Q2Y A;  4FD7 A;  3I9S A;  2OH1 A;  4NEX A;  4PK3 A;  3TO6 A;  4R57 A;  1MJA A;  1FY7 A;  3D8P A;  3TE4 A;  2PRB A;  3H4Q A;  4MY3 A;  4KLV A;  4U9Y A;  1B6B A;  1N71 A;  2BUE A;  3W91 A;  2R8V A;  5IX3 A;  2P0W A;  1KUY A;  1M4I A;  5CNP A;  2Z11 A;  1ON0 A;  4RI1 A;  2R98 A;  1KZF A;  4E8O A;  4ZBG A;  4YFJ A;  3PP9 A;  2JDC A;  2G3A A;  5HMN A;  1CM0 A;  2VEZ A;  1IID A;  1P0H A;  2Q4V A;  4LX9 A;  4OLL A;  5KTC A;  4ORF A;  4JXR A;  3D3S A;  4H6Z A;  5F47 A;  2WPW A;  2Z0Z A;  4AVA A;  4UA3 A;  2I79 A;  1IIC A;  5F48 A;  3FYN A;  4DNC A;  5IV0 A;  4KVO E;  3TOA A;  4AVB A;  4R3L A;  3CXP A;  2PQ8 A;  2AE6 A;  4QC6 A;  5J8C A;  5DWN A;  5ISV A;  4IF5 A;  5GCN A;  3SXN A;  2CNS A;  2ZPA A;  3IWG A;  4Y49 B;  1S7N A;  2Q44 A;  1GHE A;  3FRM A;  1BO4 A;  3FNC A;  5KTD A;  1QSR A;  4IUS A;  1M44 A;  3G3S A;  2JEV A;  1I1D A;  1M1D A;  5EC4 A;  2GIV A;  4ONU A;  4X5K A;  4YRH A;  5JQ4 A;  1KUV A;  4JWP A;  2AJ6 A;  1I12 A;  5JPH A;  4CAV A;  1Z4E A;  3CXS A;  1YVK A;  4H6U A;  4B5P A;  3EY5 A;  3DDD A;  3F8K A;  2H5M A;  2IL4 A;  3DNS A;  1IYK A;  3RYO A;  4FD4 A;  4KOX A;  2BEI A;  4JD6 A;  4KVM E;  4KOW A;  1R57 A;  3TO9 A;  2C27 A;  1QSO A;  4MBU A;  1NE9 A;  3S6F A;  2Q7B A;  4CAX A;  2VZZ A;  2B4D A;  3GYA A;  5EBV A;  2B3U A;  3NE7 A;  1IB1 E;  3TCV A;  4PSW A;  1J4J A;  1LRZ A;  1MJB A;  3MGD A;  3SXO A;  3R96 A;  1Z9U A;  2J8R A;  2VQY A;  2WPX A;  4OAD A;  4QVT A;  2Q04 A;  3N7Z A;  3VWE A;  3FIX A;  1QSM A;  3B8G A; 
#chains in the Genus database with same CATH topology
 4XPK A;  1AMP A;  3TO7 A;  2PDO A;  4H89 A;  4HNX B;  3BJ7 A;  3TOB A;  4C2X A;  1S60 A;  2ZW7 A;  3PGP A;  2PJB A;  3EXN A;  4KVX A;  2VXK A;  3S6G A;  4CAE A;  4MHZ A;  2BOA A;  3D67 A;  4OC0 A;  5J8F A;  3FEC A;  2J8M A;  1XF8 A;  3F5B A;  4B14 A;  2QJ8 A;  3BLN A;  4U5Y A;  3SJG A;  3FEE A;  1X10 A;  2JDD A;  2PJ4 A;  2V8D A;  3D2M A;  4RS2 A;  1Z5R A;  3JRU A;  3KHZ A;  3R9F A;  2O28 A;  3SHP A;  3WC5 A;  4AG9 A;  4IAV A;  3RBU A;  1ARL A;  3DLJ A;  4C68 A;  4GS4 A;  3D7H A;  5HXD A;  2AFU A;  3WT4 A;  4R7M A;  1VHE A;  1SQH A;  5AG5 A;  3MN8 A;  3B3W A;  5E96 A;  2ZW4 A;  5HH1 A;  5I0C A;  4MFZ A;  1S7L A;  5HVF A;  2R7H A;  4LQ6 A;  1Z8T A;  3WC7 A;  4ZY0 A;  4PQA A;  2HQY A;  4CGM A;  1S5K A;  2ZW6 A;  2DEA A;  2K5T A;  4P4I A;  4R6T A;  4R87 A;  4MHP A;  2Z3N A;  4L89 A;  5F09 A;  2YGW A;  4F8Z A;  5A28 A;  1M4L A;  4F6A A;  2NMT A;  5F46 A;  1NMT A;  1Y9W A;  4P4F A;  3R9G A;  4A37 A;  2F5I A;  1PU9 A;  2PJ1 A;  2B5G A;  3GY9 A;  5FVJ A;  1IGB A;  2ZEL A;  2PJ9 A;  3B3V A;  1QSN A;  4ZY2 A;  1CJW A;  2Q43 A;  1PUA A;  2DPS A;  4NGN A;  2HUZ A;  2FE7 A;  3PBB A;  2Z3M A;  1AUG A;  1IYL A;  3F0A A;  3EC4 A;  3JTK A;  4MY0 A;  2AFX A;  4II9 A;  2POK A;  4CRZ B;  3R9E A;  2X7B A;  3DGV A;  4OAE A;  5LYD A;  2VL1 A;  4KOS A;  4CAF A;  2G3T A;  2CNM A;  3D7F A;  2QEC A;  2V8V A;  3FJU A;  3JUW A;  4KLW A;  4P45 A;  1TXR A;  4UF4 A;  4NCZ A;  5AG7 A;  4ZI6 A;  3SI1 A;  4KOV A;  3QNV A;  2PIZ A;  2GE3 A;  4MHN A;  4NF1 A;  4ZX8 A;  4JJX A;  2C6P A;  2G9D A;  3K9U A;  4MCP A;  4Y49 C;  1Q2D A;  2CY2 A;  4MCR A;  5ELY A;  2VBQ A;  3N5F A;  3SJF A;  4MRI A;  5AGE A;  4OID A;  4YGO A;  4M6I A;  1JQG A;  2KCW A;  3B3C A;  4KSA A;  4OIW A;  2OU2 A;  2BL1 A;  4UCN A;  3IIB A;  4ZYQ A;  3IO1 A;  1FNO A;  2ZOF A;  3C26 A;  1XOV A;  3B35 A;  4K3N A;  4NSQ A;  4A30 A;  5C82 A;  4A31 A;  4PV6 A;  4MFJ A;  4GXH A;  2OZU A;  1LOK A;  2G0B A;  2ZEP A;  3FVL A;  1XE4 A;  3KL9 A;  1UWY A;  1XFO A;  1CPS A;  2FIW A;  2PJ6 A;  3IGR A;  2BCO A;  4MCS A;  1OZP A;  2DXQ A;  1Y9K A;  3A9L A;  4ZGY B;  1K4J A;  2JEW A;  5DWM A;  1P4N A;  2JLM A;  2QML A;  2Q4Y A;  2REE A;  4HNW B;  4XNH B;  2D4P A;  1U6M A;  2V8H A;  4AVC A;  1DTD A;  1CP7 A;  1CX8 A;  1A2Z A;  1MJ9 A;  2B4D B;  3R1K A;  3P2H A;  4I49 A;  1HEE A;  4HPS A;  4PSX A;  4YWY A;  1NSL A;  4MFQ A;  5H86 A;  3K2K A;  2NYQ A;  3SI2 A;  4XNH C;  6CPA A;  1CBX A;  2VZY A;  4W9Y A;  1X12 A;  4FD5 A;  2Z10 A;  2P6G A;  4X8I A;  1RXT A;  4F9V A;  1KWM A;  1ARM A;  2YNC A;  4KZT A;  3T9Y A;  3TX8 A;  2CF4 A;  4M85 A;  4XPD B;  4KOU A;  4YU9 A;  2AFM A;  3VWD A;  4MHD A;  2PIY A;  3S6H A;  5K8N A;  2PCU A;  2ABZ A;  3K9T A;  4OP4 A;  1VKC A;  3KGQ A;  4C2Z A;  1V0C A;  3BI1 A;  4B5O A;  2EK9 A;  2Q51 A;  3LD2 A;  4BMH A;  5CBM A;  4MFK A;  2ZEG A;  1QST A;  2HB6 A;  4UFW A;  4EVY A;  1XBU A;  5G20 A;  5F49 A;  2ZOG A;  2B3V A;  3T8W A;  5LRK A;  4EFD A;  3H8E A;  4OC1 A;  2C6C A;  5C88 A;  4KOT A;  3ZJ0 A;  4E0A A;  4JLY A;  2ZEO A;  4MFL A;  1LAM A;  3D7D A;  4NJR A;  3V8I A;  3B2Y A;  2EUI A;  3IC1 A;  3H8F A;  4OC4 A;  3ZZI A;  4K30 A;  4UWI A;  5HVG A;  4AB7 A;  4GM5 A;  3QB8 A;  3TTH A;  4P4E A;  5JGF A;  3LMS A;  2PJ2 A;  4DUK A;  4PPZ A;  1RO5 A;  1UFH A;  5G22 A;  2ARH A;  3EO4 A;  3SJE A;  1Y0Y A;  2ZW5 A;  2O53 A;  3DSB A;  4UFV A;  1FT7 A;  4UEE A;  4CS0 B;  3B3T A;  1S7F A;  1YK3 A;  4KS9 A;  3D7G A;  4FD6 A;  1Z8W A;  3WR7 A;  4A32 A;  2B5G B;  3CPA A;  1YW6 A;  2EWB A;  1YX0 A;  4NXY A;  4U9Z A;  4F9U A;  2Y0M A;  4IK2 A;  2ATR A;  4BIN A;  5K8O A;  3KZW A;  2P6F A;  1LCP A;  3QAH A;  4KOY A;  2Q0Y A;  5JH9 A;  2FCK A;  3IEH A;  3T90 A;  5I4M A;  2WYR A;  3FXT A;  3DR8 A;  4J3G A;  2BSW A;  2F8H A;  1CPX A;  4B13 A;  4P6Y A;  5H84 A;  4UBR A;  1Y7R A;  3IWW A;  2NSM A;  3PB7 X;  2ZEE A;  4R9M A;  3ISX A;  4KOR A;  1WK4 A;  2PE3 A;  3DR6 A;  2V8G A;  1YRE A;  4C2Y A;  2REF A;  3B3S A;  4UIB A;  1I21 A;  1YGH A;  2FSR A;  3P2F A;  3BXM A;  2CXA A;  4LUA A;  2I00 A;  4X3R A;  4MJ8 A;  2OOT A;  4P44 A;  3PB8 X;  4AG7 A;  3H8G A;  4XPL A;  4UCP A;  4M3S A;  3VAR A;  3TFY A;  1IOI A;  4OC2 A;  2D4O A;  1R43 A;  2A4N A;  4R3K A;  4UEZ A;  2YND A;  4QB9 A;  3NH8 A;  2FXF A;  4NGP A;  2XEI A;  3D68 A;  2EVN A;  3TT2 A;  2Q7S A;  2RB7 A;  3IWE A;  3TC8 A;  1WWZ A;  3IU1 A;  4OC5 A;  3E0K A;  4P4B A;  3UY5 A;  3H5Z A;  1LAN A;  1KUX A;  2CIJ A;  2XEJ A;  4PXE A;  2OB0 A;  1Y0R A;  1YSJ A;  3LOD A;  4NGQ A;  4CRY B;  3GB0 A;  2BO9 A;  2PJ7 A;  5DS0 A;  3NH4 A;  2ZXV A;  4CGL A;  1TIQ A;  1YVO A;  3GLJ A;  4Z65 A;  1H8L A;  3FB3 A;  4NJQ A;  1ZG7 A;  1L0C A;  2Z3K A;  4JXQ A;  4X2T A;  3KKW A;  1IU8 A;  2WSA A;  3MRU A;  4NFR A;  2FL4 A;  3D2P A;  3GKR A;  3RO0 A;  1XEB A;  3NH5 A;  3R95 A;  3VAT A;  4E2A A;  4PK2 A;  2Z3O A;  1MK4 A;  2PJA A;  4QUS A;  4M6H A;  2JBJ A;  2PC1 A;  2B58 A;  2PR8 A;  4FAI A;  2GAN A;  4P10 A;  4MCQ A;  5G21 A;  4HNY B;  4MFP A;  1TF9 A;  1PYT B;  2FS5 A;  3I3G A;  1Y7E A;  2FIA A;  2RC4 A;  5K8M A;  2IMO A;  1M4D A;  2PSW A;  2QIR A;  4MI4 A;  1HDU A;  1PCA A;  1F57 A;  4L8A A;  5THW A;  2OZG A;  3PFE A;  5AG6 A;  3OWC A;  3BJ8 A;  4WWV A;  2ZEF A;  4QBJ A;  2V77 A;  1ZG8 A;  1F2P A;  2ODF A;  4KSI A;  4A95 A;  2ZED A;  5CPA A;  3CXQ A;  4HKF A;  2CNT A;  1BPM A;  2OZH A;  1M4G A;  4Q7A A;  1S7K A;  3ISZ A;  5IB0 A;  2EBJ A;  4FWU A;  4KUB A;  3S6K A;  2R1I A;  2J8N A;  4F0Y A;  4EME A;  1YW4 A;  2PJ0 A;  4OC3 A;  3BI0 A;  7CPA A;  2HV2 A;  1XMT A;  1CP6 A;  3JVN A;  2EK8 A;  3G8W A;  3IU2 A;  3PZJ A;  3BHX A;  4NGT A;  2OR4 A;  3W6S A;  1XIX A;  1YME A;  4JZ0 A;  2EO8 A;  2HC9 A;  4KUA A;  3CPX A;  1B87 A;  3W6X A;  1AYE A;  1Z2L A;  1Z8L A;  4H2K A;  4A2Z A;  2B4B A;  2FT0 A;  4CYN A;  2PVV A;  2WUU A;  5G1Z A;  3EFA A;  3S9M A;  4PXD A;  4XPD C;  2PR1 A;  1F2O A;  4LQG A;  2C1C A;  1YR0 A;  4CAW A;  5K8P A;  1Z4R A;  3FBU A;  4A33 A;  5KTA A;  1VHS A;  2PJ3 A;  3KR5 A;  4UWJ A;  1BOB A;  4R8F A;  3FF3 A;  3PFO A;  1YLE A;  1DE4 C;  1Q2C A;  2VI7 A;  2XEG A;  1S3Z A;  3FX6 A;  1LAP A;  1EE3 P;  2QYV A;  2Z3L A;  1BAV A;  2P6E A;  1Q2Y A;  3HLP A;  3NFZ A;  2ZEH A;  4FD7 A;  3I9S A;  4P4J A;  1IOF A;  2DF5 A;  4NGM A;  2OH1 A;  4NEX A;  2Z3P A;  4PK3 A;  3TO6 A;  2GU2 A;  4CGP A;  2PVW A;  3NE8 A;  2GLF A;  4R57 A;  2XEF A;  4MXU A;  1JWQ A;  1MJA A;  3LWU A;  1FY7 A;  2IQ6 A;  1QQ9 A;  4DYO A;  3D8P A;  3KQX A;  2CTC A;  4CYP A;  3TE4 A;  2PRB A;  1RTQ A;  4B6Z A;  4EWT A;  4M6G A;  3H4Q A;  4MY3 A;  4KLV A;  4U9Y A;  1ZO0 A;  1B6B A;  1N71 A;  2BUE A;  3D66 A;  3FMC A;  5D29 A;  2R8V A;  1IY7 A;  2FVG A;  3W91 A;  2P0W A;  4FBE A;  5IX3 A;  4P4D A;  3I1U A;  3V38 A;  1KUY A;  1M4I A;  2WZN A;  2Z11 A;  4OKO A;  5CNP A;  1ON0 A;  4RI1 A;  4UEF A;  2R98 A;  1KZF A;  2AFW A;  4B12 A;  4CPA A;  4E8O A;  3LAC A;  4ZBG A;  2ANP A;  4R76 A;  4YFJ A;  4G1P A;  1BPN A;  3PP9 A;  5LYF A;  2JDC A;  2G3A A;  4A38 A;  5HMN A;  1ZLI A;  1CM0 A;  4Q36 A;  2VEZ A;  1IID A;  1P0H A;  2Q4V A;  4LX9 A;  4OLL A;  5LYI A;  5LYL A;  3S9L A;  3RAM A;  5KTC A;  4ORF A;  3CDX A;  4CYQ A;  4JXR A;  3IJ3 A;  3D3S A;  4H6Z A;  5F47 A;  2WPW A;  2Z0Z A;  3WAB A;  4AVA A;  4CGO A;  1CG2 A;  4UA3 A;  5JM6 A;  4Q38 A;  4CGN A;  2DPT A;  5AG4 A;  4FUU A;  2I79 A;  1IIC A;  5F48 A;  2IJZ A;  1OBR A;  3CT9 A;  4BD9 A;  3PRT A;  4AXV A;  3FYN A;  3PB4 X;  4DNC A;  1NSA A;  3PB9 X;  2F7V A;  5IV0 A;  4KVO E;  1GYT A;  1Q7L A;  3TOA A;  4AVB A;  1TKH A;  4R3L A;  3CXP A;  2PQ8 A;  2AE6 A;  2J9A A;  4A39 A;  4QC6 A;  4ZY1 A;  2O4H A;  3SJX A;  5J8C A;  5DWN A;  3SI0 A;  4BBH A;  3QAY A;  5ISV A;  2GRE A;  1Z8X A;  2Q4Z A;  3KHX A;  4IF5 A;  4UIA A;  5GCN A;  3SXN A;  3D4U A;  4MHY A;  2CNS A;  2ZPA A;  1VGY A;  4UFX A;  3IWG A;  4Y49 B;  4NGR A;  4PXC A;  1R3N A;  1S7N A;  4RUH A;  1TKJ A;  2Q44 A;  8CPA A;  1GHE A;  3FRM A;  1BO4 A;  3FNC A;  5KTD A;  1QSR A;  4B10 A;  4IUS A;  2PRQ A;  1M44 A;  3G3S A;  4UCM A;  3VH9 A;  5BWA B;  2PJ8 A;  2JEV A;  1I1D A;  1M1D A;  2ZEM A;  1ELM P;  5EC4 A;  3RNZ A;  2GIV A;  4ONU A;  4X5K A;  4YRH A;  5JQ4 A;  3CZX A;  5A27 A;  3RZA A;  3B7I A;  1KUV A;  2RFH A;  4JWP A;  2AJ6 A;  1BLL E;  3V7Z A;  1I12 A;  5JPH A;  1YQE A;  2CTB A;  4CAV A;  1Z4E A;  5J1Q A;  3CXS A;  1YVK A;  4H6U A;  2YNC C;  2GFQ A;  3FED A;  4B5P A;  3EY5 A;  1QMU A;  2PJ5 A;  3DDD A;  3HUV A;  4TNU A;  2C6G A;  3F8K A;  3PEI A;  3S9N A;  3GUX A;  2AFS A;  2H5M A;  2IL4 A;  3DNS A;  1IYK A;  1TF8 A;  3RYO A;  1XMB A;  1HDQ A;  4FD4 A;  4KOX A;  2BEI A;  2I3C A;  3KI9 A;  4JD6 A;  4KVM E;  4KOW A;  1R57 A;  3TO9 A;  2C27 A;  4KSF A;  4OME A;  1QSO A;  1ZLH A;  2GLJ A;  1NE9 A;  4MBU A;  4MMO A;  4B11 A;  3S6F A;  2Q7B A;  5LRG A;  4PXB A;  4CAX A;  4A94 A;  4CYO A;  2VZZ A;  3KAS A;  4C7H A;  4NGS A;  4RN7 A;  3NA6 A;  4TWE A;  4ONW A;  2JBK A;  5EMI A;  4C7I A;  5IB9 A;  5LRJ A;  2B4D A;  2AFO A;  3GYA A;  3PB6 X;  5EBV A;  1YLO A;  2B3U A;  1XRY A;  1ELL P;  3NE7 A;  1IB1 E;  1TKF A;  3TCV A;  1VIX A;  4PSW A;  4DJL A;  5HVH A;  1J4J A;  1LRZ A;  1MJB A;  4F0X A;  3KR4 A;  3KQZ A;  3MGD A;  3SXO A;  4JYW A;  3R96 A;  4B5P B;  1Z9U A;  2J8R A;  2VQY A;  2WPX A;  5D8N A;  4WJB A;  3IFE A;  2PJC A;  4OAD A;  1VHO A;  2Q04 A;  3N7Z A;  4QVT A;  3VWE A;  1XJO A;  2YNE A;  1ZG9 A;  2AFZ A;  2QVP A;  3FH4 A;  3FIX A;  3WC6 A;  1LFW A;  1QSM A;  4O23 A;  2ZEN A;  4ZX9 A;  3GIU A;  3L2N A;  3PBE A;  3B8G A;  4IHM A; 
#chains in the Genus database with same CATH homology
 4XPK A;  3TO7 A;  2PDO A;  4H89 A;  4HNX B;  3BJ7 A;  3TOB A;  4C2X A;  1S60 A;  2ZW7 A;  3PGP A;  3EXN A;  4KVX A;  2VXK A;  3S6G A;  4CAE A;  5J8F A;  2J8M A;  1XF8 A;  3F5B A;  4B14 A;  3BLN A;  4U5Y A;  2JDD A;  4RS2 A;  3D2M A;  3SHP A;  3R9F A;  2O28 A;  4AG9 A;  4C68 A;  4GS4 A;  1SQH A;  5AG5 A;  5HH1 A;  5E96 A;  2ZW4 A;  5I0C A;  4MFZ A;  1S7L A;  2R7H A;  2HQY A;  4CGM A;  1S5K A;  2ZW6 A;  2K5T A;  4R87 A;  2Z3N A;  4L89 A;  2YGW A;  5A28 A;  4F6A A;  2NMT A;  5F46 A;  1NMT A;  1Y9W A;  3R9G A;  2F5I A;  1PU9 A;  2B5G A;  3GY9 A;  5FVJ A;  1QSN A;  1CJW A;  1PUA A;  2DPS A;  2HUZ A;  2FE7 A;  2Z3M A;  1IYL A;  3F0A A;  3JTK A;  3EC4 A;  4MY0 A;  4II9 A;  4CRZ B;  3R9E A;  2X7B A;  4OAE A;  4KOS A;  4CAF A;  2G3T A;  2CNM A;  4KLW A;  2QEC A;  3JUW A;  5AG7 A;  4NCZ A;  4KOV A;  2GE3 A;  4NF1 A;  4JJX A;  3K9U A;  4B5P B;  4Y49 C;  1Q2D A;  2CY2 A;  2VBQ A;  5AGE A;  4YGO A;  2KCW A;  4KSA A;  2OU2 A;  2BL1 A;  4UCN A;  5C82 A;  3C26 A;  4NSQ A;  4A30 A;  4A31 A;  4PV6 A;  4MFJ A;  2OZU A;  2G0B A;  1XE4 A;  2FIW A;  3IGR A;  4ZGY B;  1OZP A;  2DXQ A;  1Y9K A;  3A9L A;  1K4J A;  5DWM A;  1P4N A;  2JLM A;  2QML A;  2Q4Y A;  2REE A;  4HNW B;  4XNH B;  2D4P A;  1U6M A;  4AVC A;  1MJ9 A;  2B4D B;  3R1K A;  3P2H A;  4I49 A;  4PSX A;  1NSL A;  4MFQ A;  5H86 A;  4XNH C;  2VZY A;  4FD5 A;  2Z10 A;  2P6G A;  1RXT A;  3T9Y A;  2YNC A;  4KZT A;  4M85 A;  4XPD B;  4KOU A;  3VWD A;  4MHD A;  3S6H A;  1VKC A;  4C2Z A;  1V0C A;  4B5O A;  4BMH A;  3LD2 A;  4MFK A;  1QST A;  4UFW A;  4EVY A;  5G20 A;  5F49 A;  2B3V A;  5C88 A;  4KOT A;  3ZJ0 A;  4E0A A;  4JLY A;  4MFL A;  3V8I A;  2EUI A;  3ZZI A;  4K30 A;  4UWI A;  4AB7 A;  3QB8 A;  3TTH A;  1RO5 A;  1UFH A;  5G22 A;  2ARH A;  3EO4 A;  4CS0 B;  2ZW5 A;  3DSB A;  4UFV A;  4KS9 A;  1S7F A;  1YK3 A;  4FD6 A;  3WR7 A;  4A32 A;  2B5G B;  1YX0 A;  4NXY A;  4U9Z A;  2Y0M A;  2ATR A;  2P6F A;  3QAH A;  4KOY A;  2Q0Y A;  2FCK A;  3T90 A;  3FXT A;  3DR8 A;  4J3G A;  2BSW A;  4B13 A;  5H84 A;  4UBR A;  1Y7R A;  4R9M A;  4KOR A;  1WK4 A;  3DR6 A;  1YRE A;  4C2Y A;  2REF A;  1I21 A;  1YGH A;  2FSR A;  3P2F A;  2CXA A;  4LUA A;  2I00 A;  4MJ8 A;  4AG7 A;  4XPL A;  4UCP A;  4M3S A;  3TFY A;  2D4O A;  2A4N A;  4R3K A;  2YND A;  4QB9 A;  2FXF A;  2EVN A;  3TT2 A;  3IWE A;  1WWZ A;  3IU1 A;  3E0K A;  3UY5 A;  3H5Z A;  1KUX A;  2OB0 A;  4CRY B;  3LOD A;  2ZXV A;  4CGL A;  1TIQ A;  1YVO A;  3FB3 A;  1L0C A;  2Z3K A;  4JXQ A;  3KKW A;  2WSA A;  2FL4 A;  3D2P A;  3GKR A;  1XEB A;  3R95 A;  4E2A A;  4PK2 A;  2Z3O A;  1MK4 A;  4QUS A;  2PC1 A;  2B58 A;  2PR8 A;  2GAN A;  5G21 A;  4HNY B;  4MFP A;  2FS5 A;  3I3G A;  2FIA A;  2RC4 A;  1M4D A;  2PSW A;  2QIR A;  4MI4 A;  4L8A A;  2OZG A;  5AG6 A;  3OWC A;  3BJ8 A;  4QBJ A;  4A95 A;  3CXQ A;  4HKF A;  2CNT A;  2OZH A;  1M4G A;  1S7K A;  5IB0 A;  4KUB A;  3S6K A;  2R1I A;  2J8N A;  4F0Y A;  2HV2 A;  1XMT A;  3JVN A;  3G8W A;  3IU2 A;  3PZJ A;  3W6S A;  1XIX A;  3W6X A;  4KUA A;  1B87 A;  4A2Z A;  2B4B A;  2FT0 A;  4CYN A;  2WUU A;  5G1Z A;  3EFA A;  4XPD C;  2PR1 A;  1YR0 A;  4CAW A;  1Z4R A;  3FBU A;  4A33 A;  5KTA A;  1VHS A;  4UWJ A;  1BOB A;  1YLE A;  1Q2C A;  2VI7 A;  1S3Z A;  2Z3L A;  2P6E A;  1Q2Y A;  4FD7 A;  3I9S A;  2OH1 A;  4NEX A;  2Z3P A;  4PK3 A;  3TO6 A;  4CGP A;  4R57 A;  1MJA A;  1FY7 A;  3D8P A;  4CYP A;  3TE4 A;  2PRB A;  3H4Q A;  4MY3 A;  4KLV A;  4U9Y A;  1ZO0 A;  1B6B A;  1N71 A;  2BUE A;  3W91 A;  2R8V A;  5IX3 A;  2P0W A;  1KUY A;  1M4I A;  5CNP A;  2Z11 A;  1ON0 A;  4RI1 A;  2R98 A;  1KZF A;  4B12 A;  4E8O A;  4ZBG A;  4YFJ A;  3PP9 A;  2JDC A;  2G3A A;  5HMN A;  1CM0 A;  4Q36 A;  2VEZ A;  1IID A;  1P0H A;  2Q4V A;  4LX9 A;  4OLL A;  5KTC A;  4ORF A;  4CYQ A;  4JXR A;  3D3S A;  4H6Z A;  5F47 A;  2WPW A;  2Z0Z A;  4AVA A;  4CGO A;  4UA3 A;  4Q38 A;  4CGN A;  2DPT A;  5AG4 A;  2I79 A;  1IIC A;  5F48 A;  3FYN A;  4DNC A;  5IV0 A;  4KVO E;  3TOA A;  4AVB A;  4R3L A;  3CXP A;  2PQ8 A;  2AE6 A;  4QC6 A;  5J8C A;  5DWN A;  4BBH A;  5ISV A;  4IF5 A;  5GCN A;  3SXN A;  2CNS A;  2ZPA A;  4UFX A;  3IWG A;  4Y49 B;  1S7N A;  2Q44 A;  1GHE A;  3FRM A;  1BO4 A;  3FNC A;  5KTD A;  1QSR A;  4B10 A;  4IUS A;  1M44 A;  3G3S A;  4UCM A;  5BWA B;  2JEV A;  1I1D A;  1M1D A;  5EC4 A;  2GIV A;  4ONU A;  4X5K A;  4YRH A;  5JQ4 A;  5A27 A;  1KUV A;  4JWP A;  2AJ6 A;  1I12 A;  5JPH A;  4CAV A;  1Z4E A;  3CXS A;  1YVK A;  4H6U A;  2YNC C;  4B5P A;  3EY5 A;  3DDD A;  3F8K A;  2H5M A;  2IL4 A;  3DNS A;  1IYK A;  3RYO A;  4FD4 A;  4KOX A;  2BEI A;  4JD6 A;  4KVM E;  4KOW A;  1R57 A;  3TO9 A;  2C27 A;  4KSF A;  1QSO A;  4MBU A;  1NE9 A;  4B11 A;  3S6F A;  2Q7B A;  4CAX A;  4CYO A;  2VZZ A;  4C7H A;  4C7I A;  2B4D A;  3GYA A;  5EBV A;  2B3U A;  3NE7 A;  1IB1 E;  3TCV A;  4PSW A;  1J4J A;  1LRZ A;  1MJB A;  4F0X A;  3MGD A;  3SXO A;  3R96 A;  1Z9U A;  2J8R A;  2VQY A;  2WPX A;  4OAD A;  4QVT A;  2Q04 A;  3N7Z A;  3VWE A;  2YNE A;  3FIX A;  1QSM A;  3B8G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...