2NYQA

Structure of vibrio proteolyticus aminopeptidase with a bound trp fragment of dlwcf
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
291
structure length
291
Chain Sequence
MPPITQQATVTAWLPQVDASQITGTISSLESFTNRFYTTTSGAQASDWIASEWQALSASLPNASVKQVSHSGYNQKSVVMTITGSEAPDEWIVIGGHLDSTIGSHTNEQSVAPGADDDASGIAAVTEVIRVLSENNFQPKRSIAFMAYAAEEVGLRGSQDLANQYKSEGKNVVSALQLDMTNYKGSAQDVVFITDYTDSNFTQYLTQLMDEYLPSLTYGFDTCGYACSDHASWHNAGYPAAMPFESKFNDYNPRIHTTQDTLANSDPTGSHAKKFTQLGLAYAIEMGSATG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Substrate recognition by the leucine aminopeptidase from Vibrio proteolyticus
rcsb
molecule tags Hydrolase
molecule keywords Aminopeptidase
total genus 111
structure length 291
sequence length 291
ec nomenclature ec 3.4.11.10: Bacterial leucyl aminopeptidase.
pdb deposition date 2006-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 2nyqA00
3PB9X 4YWYA 2ZEEA 1XMBA 1VHOA 5LRJA 6CPAA 1ARMA 3GLJA 1HDUA 4OMEA 4IAVA 3SJGA 2C6PA 3PB4X 1R43A 4O23A 5HVHA 2ZENA 1HEEA 1VGYA 3GB0A 1YSJA 2PRQA 4NGRA 4OC1A 3KR4A 4YU9A 5HVFA 4MCRA 1Z5RA 1FT7A 4ZX9A 3KL9A 5K8OA 1YLOA 1LAMA 4ONWA 8CPAA 2BO9A 3T8WA 5LYFA 2ZEDA 3V38A 4FAIA 1CG2A 3FEEA 4R8FA 3SJFA 3FF3A 5K8MA 1Z8LA 1XRYA 4MXUA 1LCPA 2J9AA 3PFOA 4P44A 3CDXA 3BI0A 2AFOA 2Q51A 4NGTA 2AFXA 4WJBA 2AFSA 4A94A 4PPZA 2ZEHA 4MHNA 3SI0A 2C1CA 2NYQA 1IGBA 5LYLA 4A37A 3SJXA 1CPXA 1VHEA 4BD9A 3WC5A 4NGNA 3PB7X 3NH4A 4OIWA 3IFEA 2PJ0A 4ZYQA 3IJ3A 1AMPA 3CPXA 4DYOA 4UIBA 1ZG8A 4P6YA 3MRUA 1ELLP 4G1PA 4W9YA 2IJZA 1KWMA 1FNOA 4UF4A 3KHZA 3D7GA 2PJAA 3PB6X 4NGSA 4UEEA 1Q7LA 3PRTA 2XEFA 1XJOA 3B2YA 3IO1A 4OC5A 5CPAA 4IHMA 2RFHA 4NGPA 2IMOA 3MN8A 1ZG7A 4JZ0A 3LWUA 3LMSA 2GU2A 2POKA 4UEZA 5HVGA 1QQ9A 1XFOA 3FEDA 4P4DA 4R7MA 5LYIA 2WYRA 2OR4A 1LFWA 3KQXA 2OOTA 3H8EA 5THWA 3D7FA 3KZWA 3PBBA 5DS0A 1UWYA 5JGFA 2Q43A 2V8GA 1TXRA 3B7IA 5JM6A 1ZLHA 3IWWA 1XBUA 5D8NA 4K3NA 3D67A 3KHXA 3KQZA 2O4HA 1VIXA 2QVPA 1BAVA 2GREA 1ZG9A 4JYWA 4MHYA 2PIZA 4MCPA 1BPMA 3K9TA 2ZOGA 1M4LA 1Y7EA 2FVGA 5LRKA 4MHPA 1Z2LA 2XEJA 2PVVA 4PXBA 4WWVA 3WT4A 1ARLA 3NA6A 2ZELA 4ZX8A 3ISXA 2AFUA 3I1UA 4UEFA 2Q4ZA 4OC0A 3S9MA 4EMEA 4FUUA 2ZEPA 3H8FA 2F7VA 3IEHA 3SJEA 4X2TA 4CPAA 4PQAA 2PJ4A 4MCQA 4X8IA 2PJ6A 1CBXA 4ZI6A 3QNVA 1LANA 3PB8X 4EFDA 4DUKA 2C6GA 1JQGA 4P45A 4F8ZA 1CP7A 1PCAA 1GYTA 3DLJA 1DE4C 2G9DA 1BLLE 3BHXA 1YMEA 3BXMA 1AYEA 2ZEMA 4A38A 4P4IA 4OC3A 2QJ8A 2AFZA 1Y0RA 4NJRA 2ZEFA 2PJ1A 4P4JA 1RTQA 2NSMA 1CX8A 4NJQA 1TKFA 3SI2A 3RAMA 2V8DA 5LYDA 5F09A 4AXVA 2PE3A 3GUXA 2VL1A 3PFEA 2PJ7A 3FVLA 4MHZA 2ZEGA 1TF9A 2PIYA 1BPNA 4MMOA 3SI1A 2CTBA 3B3VA 2QYVA 2PJCA 3H8GA 1HDQA 3KASA 2ABZA 2HC9A 1LAPA 3ISZA 4FWUA 1CPSA 3BI1A 2EWBA 3IIBA 2BOAA 5LRGA 3D68A 3RBUA 1F57A 2IQ6A 4FBEA 4KSIA 5K8NA 2V8VA 1TKHA 1OBRA 2GLJA 4UIAA 3FECA 4P10A 3RZAA 5ELYA 3WC6A 4F9UA 2PJ9A 4OC4A 4ZY2A 2PJ5A 4B6ZA 4IK2A 1H8LA 4R6TA 3FX6A 3KGQA 3KR5A 3HUVA 2I3CA 2PJ2A 3NH8A 3B3SA 3VH9A 3FH4A 2DEAA 4DJLA 7CPAA 1LOKA 3FJUA 4PXCA 2CIJA 1EE3P 3B3TA 2XEIA 4ZY1A 3VARA 1ZLIA 4P4EA 3HLPA 4A39A 3B35A 5J1QA 2EK8A 2ANPA 2PJ3A 4OC2A 2PVWA 3D7DA 3JRUA 1IY7A 4NFRA 5I4MA 1DTDA 1YW6A 4NGQA 1CP6A 1NSAA 2PCUA 2HB6A 3WC7A 3S9LA 3KI9A 2ZOFA 1QMUA 3K2KA 3S9NA 4RUHA 5D29A 1Y0YA 5K8PA 1F2PA 4OP4A 4TWEA 2AFMA 4MCSA 1YW4A 2V77A 3NH5A 2JEWA 2PJBA 3VATA 3B3WA 4PXDA 1R3NA 3DGVA 3IC1A 3L2NA 2RB7A 1F2OA 3NFZA 2V8HA 4F9VA 3WABA 2PJ8A 2ZEOA 3D66A 2O53A 2XEGA 1PYTB 4R76A 3TX8A 3D7HA 5CBMA 3TC8A 3N5FA 3CPAA 4P4BA 4EWTA 2EK9A 3PEIA 2BCOA 5HXDA 4MRIA 4P4FA 4H2KA 4NGMA 1TKJA 4OKOA 3FMCA 3PBEA 2AFWA 3B3CA 2WZNA 4PXEA 4TNUA 2JBKA 3D4UA 2F8HA 4LQGA 4GM5A 1TF8A 4ZY0A 4X3RA 4OIDA 2C6CA 2GLFA 4Z65A 5JH9A 3CT9A 1ELMP 2JBJA 2CTCA 2CF4A 4Q7AA 5IB9A 3V7ZA
chains in the Genus database with same CATH superfamily
3PB9X 1S3ZA 4YWYA 2ZEEA 1XMBA 1B6BA 1VHOA 5LRJA 4B5PB 2AJ6A 4NEXA 6CPAA 2R1IA 1ARMA 1X10A 3GLJA 1HDUA 4OMEA 2Q4VA 4IAVA 3SJGA 2C6PA 3PB4X 1R43A 4M6GA 4R9MA 3T90A 4O23A 5HVHA 2ZENA 1YLEA 5J8CA 1HEEA 1VGYA 4KSAA 3GB0A 1YSJA 4M85A 2PRQA 4CYPA 4KOSA 1YR0A 4NGRA 4B5OA 3BJ7A 1QSNA 1QSRA 1R57A 4OC1A 2GFQA 2P6FA 3KR4A 4YU9A 5HVFA 1XEBA 2BUEA 2VEZA 4MCRA 2FS5A 3R95A 1Z5RA 1IYLA 1FT7A 5CNPA 4ZX9A 1IB1E 3KL9A 2OB0A 3FXTA 3ZJ0A 4FD5A 5K8OA 2EVNA 1X12A 1YLOA 2DPTA 1LAMA 2P6EA 3IWEA 1Y7RA 4ONWA 2O28A 8CPAA 2BO9A 3DDDA 3OWCA 1YVKA 4MFKA 5AG5A 2I79A 3T8WA 3V8IA 5LYFA 2ZEDA 3V38A 2JDDA 4FAIA 1CG2A 1OZPA 5IX3A 4NSQA 3BLNA 3QAYA 4AG7A 3FEEA 4R8FA 3SJFA 3TTHA 3FF3A 4E2AA 2R98A 5K8MA 1Z8LA 1XRYA 1IYKA 3VWDA 4MI4A 3N7ZA 1S60A 4MXUA 1Y9WA 1LCPA 5FVJA 2P0WA 3W91A 2J9AA 2FXFA 3CDXA 3PFOA 4P44A 3BI0A 2AFOA 5G22A 2KCWA 4L89A 2Q51A 4A30A 4NGTA 2AFXA 1I12A 2WUUA 2G3TA 4WJBA 3D2MA 2AFSA 3GY9A 3LODA 4A94A 4PPZA 2OH1A 4Q36A 2ZEHA 4MHDA 3D3SA 4MHNA 3SI0A 4KOWA 2OU2A 2C1CA 2NYQA 2Z3MA 1XIXA 2OZUA 2PR1A 4C2ZA 1IGBA 2VXKA 4KUBA 4B11A 4CS0B 5LYLA 1AUGA 4MFQA 3KKWA 2YNCC 5AGEA 2JLMA 4C7IA 4A37A 1QSMA 3SJXA 1XE4A 1CPXA 1VHEA 2CNMA 2JDCA 3DNSA 3JVNA 4BD9A 1Y9KA 4NGNA 1WWZA 3WC5A 3PB7X 2FE7A 4Y49B 3NH4A 2VZYA 3TO7A 3DR8A 4OIWA 3IFEA 2PJ0A 4ZYQA 3IJ3A 1AMPA 4X5KA 3CPXA 1YREA 2Z3PA 4I49A 4ZGYB 4CAWA 2DF5A 2DPSA 4DYOA 4C7HA 4UIBA 1ZG8A 5I0CA 1YQEA 4JXRA 4P6YA 4KORA 4E8OA 4YRHA 4KOUA 5KTDA 3MRUA 1ELLP 4G1PA 4W9YA 2IJZA 3P2FA 1KWMA 1FNOA 3CXSA 4UF4A 4JXQA 3KHZA 3D7GA 2PJAA 3PB6X 4K30A 3SXOA 4KOVA 4NGSA 2B4DB 4UEEA 1Q7LA 3PRTA 3VWEA 5F47A 3F8KA 1XJOA 2XEFA 3B2YA 3IO1A 4CAFA 5AG4A 4KVXA 4OC5A 5CPAA 4B13A 1Q2CA 2Z3LA 4IHMA 4MJ8A 2QIRA 4CGMA 2WSAA 2RFHA 4NGPA 3PGPA 4UCPA 4DNCA 2EUIA 2IMOA 3FB3A 1ZG7A 3MN8A 4UBRA 4JZ0A 3LWUA 3LMSA 2GU2A 2POKA 4UEZA 3S6HA 2DXQA 1QQ9A 5HVGA 1XFOA 3FEDA 4UFVA 2EBJA 3R96A 4P4DA 4AB7A 4R7MA 2ZPAA 5LYIA 2WYRA 3BJ8A 4UFWA 2OR4A 1LFWA 3QAHA 1IOIA 3KQXA 4XPDC 4U5YA 2OOTA 5JQ4A 3H8EA 1YVOA 4CGLA 5THWA 2Z0ZA 1BOBA 4CRYB 1Z8WA 3D7FA 3KZWA 4C2XA 3RNZA 1XF8A 2FT0A 3PBBA 1KUVA 2Z10A 4IF5A 5DS0A 1KUXA 1UWYA 2Y0MA 5JGFA 2Q43A 1KZFA 2PR8A 3PP9A 4CYOA 2V8GA 1TXRA 2Q7SA 3B7IA 3GYAA 1RO5A 3I3GA 5JM6A 3B8GA 2GE3A 1ZLHA 3IWWA 4PSWA 4R57A 3ZZIA 1XBUA 5F46A 5D8NA 3W6SA 4FD4A 4K3NA 3D67A 1GHEA 1Z8XA 4FD6A 5H84A 3KHXA 3KQZA 2ZXVA 2IL4A 1VIXA 2O4HA 1BAVA 2GREA 1ZG9A 2QVPA 4JYWA 2PIZA 4MHYA 4MCPA 1S7NA 4B14A 2Q04A 1PU9A 3FNCA 2VBQA 3TO6A 1BPMA 2Z11A 3K9TA 4QVTA 2ZOGA 3RO0A 1M4LA 2YGWA 1Y7EA 2FVGA 5H86A 5LRKA 4RI1A 2CNSA 2ZW6A 4MBUA 1Z2LA 2RC4A 4MHPA 2XEJA 2PVVA 4MFPA 4PXBA 4WWVA 3WT4A 2Q44A 4M6HA 1YK3A 3EO4A 4JLYA 1ARLA 4EVYA 3NA6A 4CGPA 2ZELA 5C82A 4ZX8A 3H5ZA 2C27A 1B87A 4LQ6A 3F5BA 3ISXA 1IOFA 4CYNA 4GS4A 3H4QA 2AFUA 3I1UA 4KVME 2ZW5A 2D4OA 2GIVA 4UEFA 3I9SA 2Q4ZA 4OC0A 2WPWA 3S9MA 3JUWA 4EMEA 2Q7BA 2B4DA 4FUUA 2ZEPA 3H8FA 4RN7A 1PUAA 4UCMA 2F7VA 4HNWB 5EMIA 3TT2A 2PSWA 3IEHA 3S6GA 1WK4A 3SJEA 4X2TA 4B12A 4CPAA 4PQAA 3D2PA 4JD6A 5F49A 2PJ4A 4MCQA 4A95A 5ISVA 3UY5A 2CNTA 4X8IA 2PJ6A 1CBXA 4M6IA 4ZI6A 3QNVA 1LANA 3PB8X 4EFDA 4DUKA 1L0CA 3F0AA 5DWMA 4KZTA 1VHSA 2C6GA 5HH1A 1JQGA 1QSOA 4P45A 4RS2A 5EBVA 1S7FA 4F8ZA 2OZGA 1K4JA 4MFLA 1CP7A 3TOBA 1PCAA 1GYTA 4XPDB 3IGRA 3DLJA 1DE4C 1IU8A 4JWPA 2G9DA 2REFA 1V0CA 4KS9A 1BLLE 1Z9UA 1TIQA 2WPXA 3BHXA 3CZXA 4KUAA 5G21A 4XPLA 1YMEA 3BXMA 5BWAB 2FCKA 1AYEA 2P6GA 1JWQA 2ZEMA 4A38A 4P4IA 4PK2A 2J8NA 4UWJA 1MJ9A 4OC3A 4KSFA 4CAVA 2QJ8A 2G3AA 3IWGA 3P2HA 2AFZA 2PDOA 4LUAA 1Y0RA 4NJRA 4UCNA 1IIDA 3TFYA 3FBUA 2Q4YA 1NSLA 2BSWA 2ZEFA 2PJ1A 3S6FA 1IICA 3R9FA 4P4JA 4KLVA 1RTQA 1P4NA 2ATRA 2NSMA 1N71A 4XNHC 2B3UA 3G8WA 1CX8A 4NJQA 3EXNA 5F48A 4BBHA 1TKFA 1XMTA 3SI2A 2FIWA 2B4BA 4M3SA 3R9EA 3RAMA 2V8DA 5LYDA 3W6XA 5F09A 4CAEA 4AXVA 2PE3A 2J8RA 3SXNA 3GUXA 2VL1A 1I21A 3DSBA 3PFEA 2ODFA 2PJ7A 4YGOA 1SQHA 3TO9A 3TE4A 4GXHA 4UFXA 3FVLA 2YNEA 4MHZA 5C88A 2EO8A 2ZEGA 4Y49C 1NE9A 2VI7A 2PRBA 1TF9A 1XOVA 2QECA 4Q38A 2PIYA 1BPNA 4MMOA 3SI1A 2J8MA 4CYQA 3RYOA 2CTBA 4PV6A 3B3VA 4XNHB 4E0AA 2QYVA 2PJCA 3T9YA 2B5GA 3NE7A 2REEA 3H8GA 1BO4A 4FD7A 1U6MA 1HDQA 3KASA 2ABZA 2HC9A 1LAPA 3D8PA 4R87A 3ISZA 4QUSA 4FWUA 3S6KA 1KUYA 2OZHA 1CPSA 3BI1A 4KVOE 1I1DA 2EWBA 3IIBA 2BOAA 2YNDA 5LRGA 4OAEA 3D68A 3QB8A 3R1KA 3RBUA 1F57A 4ZBGA 3C26A 4MY0A 2IQ6A 1MK4A 4F0XA 3IU1A 4FBEA 4B10A 5KTAA 4KSIA 4CAXA 4AVCA 4AG9A 5HMNA 5K8NA 2V8VA 4KOXA 1TKHA 1OBRA 1S7KA 4KOTA 4MFZA 4XPKA 1NMTA 2I00A 2GLJA 4UIAA 3FECA 4P10A 5DWNA 3RZAA 4QBJA 1ON0A 3IU2A 3CXQA 5ELYA 3WC6A 5JPHA 4U9YA 4F9UA 2PJ9A 4OC4A 2A4NA 4ZY2A 2PJ5A 4B6ZA 1M4DA 4BMHA 4IK2A 4ORFA 1QSTA 2PQ8A 1H8LA 3PZJA 4R6TA 4UWIA 2HV2A 3FX6A 1RXTA 1UFHA 3KGQA 2BEIA 2GANA 3KR5A 1Q2YA 3HUVA 4HPSA 2I3CA 4QB9A 2PJ2A 3NH8A 1Z4RA 3B3SA 4L8AA 3VH9A 4CGNA 3FH4A 2DEAA 4QC6A 4DJLA 1LOKA 3FJUA 4PXCA 7CPAA 2CIJA 2ZW4A 1EE3P 5E96A 5IV0A 3B3TA 1MJAA 2XEIA 4ZY1A 1LRZA 4H6UA 3EY5A 3VARA 4CGOA 1ZLIA 5J8FA 4P4EA 3HLPA 4ONUA 4BINA 2FSRA 2Z3KA 3JTKA 3R9GA 4OADA 1M1DA 4A39A 3B35A 5J1QA 2EK8A 2ANPA 2HUZA 2PJ3A 5KTCA 4OC2A 4F0YA 2YNCA 1CJWA 2PVWA 3CXPA 3D7DA 4AVBA 4JJXA 1CM0A 3FIXA 3JRUA 2Z3OA 4H6ZA 4R3KA 1IY7A 2HQYA 3WR7A 4NFRA 4B5PA 2B5GB 1S5KA 5I4MA 1DTDA 1YW6A 3A9LA 2H5MA 3LD2A 4NGQA 1CP6A 2QMLA 2VQYA 4HNYB 4HNXB 4AVAA 1NSAA 5GCNA 2PCUA 2HB6A 2R8VA 1S7LA 3WC7A 2K5TA 3S9LA 4KLWA 1VKCA 3KI9A 1YGHA 2ZOFA 5A27A 4IUSA 1QMUA 3K2KA 3S9NA 1J4JA 2R7HA 4RUHA 4C2YA 4MFJA 5D29A 1Y0YA 2CXAA 5EC4A 2PC1A 4NCZA 5K8PA 1F2PA 3E0KA 4OP4A 4TWEA 2AFMA 4MCSA 1YW4A 2V77A 3NH5A 2JEWA 4A33A 1Z4EA 2PJBA 1MJBA 3VATA 3B3WA 4PXDA 1R3NA 2JEVA 2Z3NA 3DGVA 3IC1A 3L2NA 2RB7A 4F6AA 1F2OA 3NFZA 5G1ZA 2G0BA 2V8HA 5A28A 2CY2A 1Q2DA 2B58A 3EC4A 4F9VA 4HKFA 2AE6A 3WABA 2PJ8A 2ZEOA 1M44A 3NE8A 3D66A 2O53A 1M4GA 4MY3A 3SHPA 2XEGA 1PYTB 2FL4A 3GKRA 3TCVA 2ZW7A 4R76A 4U9ZA 3TX8A 4A31A 3D7HA 5CBMA 3TC8A 3K9UA 2F5IA 3N5FA 3CPAA 4P4BA 4EWTA 2EK9A 3EFAA 2X7BA 3PEIA 3DR6A 4J3GA 2BCOA 5HXDA 2NMTA 3GIUA 4MRIA 3G3SA 4H2KA 4NGMA 2FIAA 4P4FA 4R3LA 5AG7A 2ARHA 1TKJA 4OKOA 4II9A 4C68A 4UA3A 3FMCA 4LX9A 4PSXA 3FRMA 3PBEA 4A32A 1Z8TA 3FYNA 1ZO0A 2AFWA 3B3CA 2WZNA 4NF1A 4PXEA 4NXYA 4YFJA 2D4PA 4TNUA 2JBKA 3TOAA 3D4UA 4A2ZA 2F8HA 4LQGA 4GM5A 1TF8A 2B3VA 4CRZB 5AG6A 4ZY0A 2BL1A 4X3RA 4OIDA 5G20A 2C6CA 2GLFA 4Z65A 5JH9A 1P0HA 1FY7A 1YX0A 2VZZA 4KOYA 3CT9A 1ELMP 4OLLA 2JBJA 2CTCA 1M4IA 3LACA 2CF4A 2Q0YA 3MGDA 4H89A 4Q7AA 1A2ZA 5IB9A 5IB0A 4PK3A 3V7ZA
chains in the Genus database with same CATH topology
3PB9X 4YWYA 2ZEEA 1XMBA 1VHOA 5LRJA 6CPAA 1ARMA 3GLJA 1HDUA 4OMEA 4IAVA 3SJGA 2C6PA 3PB4X 1R43A 4O23A 5HVHA 2ZENA 1HEEA 1VGYA 3GB0A 1YSJA 2PRQA 4NGRA 4OC1A 3KR4A 4YU9A 5HVFA 4MCRA 1Z5RA 1FT7A 4ZX9A 3KL9A 5K8OA 1YLOA 1LAMA 4ONWA 8CPAA 2BO9A 3T8WA 5LYFA 2ZEDA 3V38A 4FAIA 1CG2A 3FEEA 4R8FA 3SJFA 3FF3A 5K8MA 1Z8LA 1XRYA 4MXUA 1LCPA 2J9AA 3PFOA 4P44A 3CDXA 3BI0A 2AFOA 2Q51A 4NGTA 2AFXA 4WJBA 2AFSA 4A94A 4PPZA 2ZEHA 4MHNA 3SI0A 2C1CA 2NYQA 1IGBA 5LYLA 4A37A 3SJXA 1CPXA 1VHEA 4BD9A 3WC5A 4NGNA 3PB7X 3NH4A 4OIWA 3IFEA 2PJ0A 4ZYQA 3IJ3A 1AMPA 3CPXA 4DYOA 4UIBA 1ZG8A 4P6YA 3MRUA 1ELLP 4G1PA 4W9YA 2IJZA 1KWMA 1FNOA 4UF4A 3KHZA 3D7GA 2PJAA 3PB6X 4NGSA 4UEEA 1Q7LA 3PRTA 2XEFA 1XJOA 3B2YA 3IO1A 4OC5A 5CPAA 4IHMA 2RFHA 4NGPA 2IMOA 3MN8A 1ZG7A 4JZ0A 3LWUA 3LMSA 2GU2A 2POKA 4UEZA 5HVGA 1QQ9A 1XFOA 3FEDA 4P4DA 4R7MA 5LYIA 2WYRA 2OR4A 1LFWA 3KQXA 2OOTA 3H8EA 5THWA 3D7FA 3KZWA 3PBBA 5DS0A 1UWYA 5JGFA 2Q43A 2V8GA 1TXRA 3B7IA 5JM6A 1ZLHA 3IWWA 1XBUA 5D8NA 4K3NA 3D67A 3KHXA 3KQZA 2O4HA 1VIXA 2QVPA 1BAVA 2GREA 1ZG9A 4JYWA 4MHYA 2PIZA 4MCPA 1BPMA 3K9TA 2ZOGA 1M4LA 1Y7EA 2FVGA 5LRKA 4MHPA 1Z2LA 2XEJA 2PVVA 4PXBA 4WWVA 3WT4A 1ARLA 3NA6A 2ZELA 4ZX8A 3ISXA 2AFUA 3I1UA 4UEFA 2Q4ZA 4OC0A 3S9MA 4EMEA 4FUUA 2ZEPA 3H8FA 2F7VA 3IEHA 3SJEA 4X2TA 4CPAA 4PQAA 2PJ4A 4MCQA 4X8IA 2PJ6A 1CBXA 4ZI6A 3QNVA 1LANA 3PB8X 4EFDA 4DUKA 2C6GA 1JQGA 4P45A 4F8ZA 1CP7A 1PCAA 1GYTA 3DLJA 1DE4C 2G9DA 1BLLE 3BHXA 1YMEA 3BXMA 1AYEA 2ZEMA 4A38A 4P4IA 4OC3A 2QJ8A 2AFZA 1Y0RA 4NJRA 2ZEFA 2PJ1A 4P4JA 1RTQA 2NSMA 1CX8A 4NJQA 1TKFA 3SI2A 3RAMA 2V8DA 5LYDA 5F09A 4AXVA 2PE3A 3GUXA 2VL1A 3PFEA 2PJ7A 3FVLA 4MHZA 2ZEGA 1TF9A 2PIYA 1BPNA 4MMOA 3SI1A 2CTBA 3B3VA 2QYVA 2PJCA 3H8GA 1HDQA 3KASA 2ABZA 2HC9A 1LAPA 3ISZA 4FWUA 1CPSA 3BI1A 2EWBA 3IIBA 2BOAA 5LRGA 3D68A 3RBUA 1F57A 2IQ6A 4FBEA 4KSIA 5K8NA 2V8VA 1TKHA 1OBRA 2GLJA 4UIAA 3FECA 4P10A 3RZAA 5ELYA 3WC6A 4F9UA 2PJ9A 4OC4A 4ZY2A 2PJ5A 4B6ZA 4IK2A 1H8LA 4R6TA 3FX6A 3KGQA 3KR5A 3HUVA 2I3CA 2PJ2A 3NH8A 3B3SA 3VH9A 3FH4A 2DEAA 4DJLA 7CPAA 1LOKA 3FJUA 4PXCA 2CIJA 1EE3P 3B3TA 2XEIA 4ZY1A 3VARA 1ZLIA 4P4EA 3HLPA 4A39A 3B35A 5J1QA 2EK8A 2ANPA 2PJ3A 4OC2A 2PVWA 3D7DA 3JRUA 1IY7A 4NFRA 5I4MA 1DTDA 1YW6A 4NGQA 1CP6A 1NSAA 2PCUA 2HB6A 3WC7A 3S9LA 3KI9A 2ZOFA 1QMUA 3K2KA 3S9NA 4RUHA 5D29A 1Y0YA 5K8PA 1F2PA 4OP4A 4TWEA 2AFMA 4MCSA 1YW4A 2V77A 3NH5A 2JEWA 2PJBA 3VATA 3B3WA 4PXDA 1R3NA 3DGVA 3IC1A 3L2NA 2RB7A 1F2OA 3NFZA 2V8HA 4F9VA 3WABA 2PJ8A 2ZEOA 3D66A 2O53A 2XEGA 1PYTB 4R76A 3TX8A 3D7HA 5CBMA 3TC8A 3N5FA 3CPAA 4P4BA 4EWTA 2EK9A 3PEIA 2BCOA 5HXDA 4MRIA 4P4FA 4H2KA 4NGMA 1TKJA 4OKOA 3FMCA 3PBEA 2AFWA 3B3CA 2WZNA 4PXEA 4TNUA 2JBKA 3D4UA 2F8HA 4LQGA 4GM5A 1TF8A 4ZY0A 4X3RA 4OIDA 2C6CA 2GLFA 4Z65A 5JH9A 3CT9A 1ELMP 2JBJA 2CTCA 2CF4A 4Q7AA 5IB9A 3V7ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PB9 X;  4YWY A;  2ZEE A;  1XMB A;  1VHO A;  5LRJ A;  6CPA A;  1ARM A;  3GLJ A;  1HDU A;  4OME A;  4IAV A;  3SJG A;  2C6P A;  3PB4 X;  1R43 A;  4O23 A;  5HVH A;  2ZEN A;  1HEE A;  1VGY A;  3GB0 A;  1YSJ A;  2PRQ A;  4NGR A;  4OC1 A;  3KR4 A;  4YU9 A;  5HVF A;  4MCR A;  1Z5R A;  1FT7 A;  4ZX9 A;  3KL9 A;  5K8O A;  1YLO A;  1LAM A;  4ONW A;  8CPA A;  2BO9 A;  3T8W A;  5LYF A;  2ZED A;  3V38 A;  4FAI A;  1CG2 A;  3FEE A;  4R8F A;  3SJF A;  3FF3 A;  5K8M A;  1Z8L A;  1XRY A;  4MXU A;  1LCP A;  2J9A A;  3PFO A;  4P44 A;  3CDX A;  3BI0 A;  2AFO A;  2Q51 A;  4NGT A;  2AFX A;  4WJB A;  2AFS A;  4A94 A;  4PPZ A;  2ZEH A;  4MHN A;  3SI0 A;  2C1C A;  2NYQ A;  1IGB A;  5LYL A;  4A37 A;  3SJX A;  1CPX A;  1VHE A;  4BD9 A;  3WC5 A;  4NGN A;  3PB7 X;  3NH4 A;  4OIW A;  3IFE A;  2PJ0 A;  4ZYQ A;  3IJ3 A;  1AMP A;  3CPX A;  4DYO A;  4UIB A;  1ZG8 A;  4P6Y A;  3MRU A;  1ELL P;  4G1P A;  4W9Y A;  2IJZ A;  1KWM A;  1FNO A;  4UF4 A;  3KHZ A;  3D7G A;  2PJA A;  3PB6 X;  4NGS A;  4UEE A;  1Q7L A;  3PRT A;  2XEF A;  1XJO A;  3B2Y A;  3IO1 A;  4OC5 A;  5CPA A;  4IHM A;  2RFH A;  4NGP A;  2IMO A;  3MN8 A;  1ZG7 A;  4JZ0 A;  3LWU A;  3LMS A;  2GU2 A;  2POK A;  4UEZ A;  5HVG A;  1QQ9 A;  1XFO A;  3FED A;  4P4D A;  4R7M A;  5LYI A;  2WYR A;  2OR4 A;  1LFW A;  3KQX A;  2OOT A;  3H8E A;  5THW A;  3D7F A;  3KZW A;  3PBB A;  5DS0 A;  1UWY A;  5JGF A;  2Q43 A;  2V8G A;  1TXR A;  3B7I A;  5JM6 A;  1ZLH A;  3IWW A;  1XBU A;  5D8N A;  4K3N A;  3D67 A;  3KHX A;  3KQZ A;  2O4H A;  1VIX A;  2QVP A;  1BAV A;  2GRE A;  1ZG9 A;  4JYW A;  4MHY A;  2PIZ A;  4MCP A;  1BPM A;  3K9T A;  2ZOG A;  1M4L A;  1Y7E A;  2FVG A;  5LRK A;  4MHP A;  1Z2L A;  2XEJ A;  2PVV A;  4PXB A;  4WWV A;  3WT4 A;  1ARL A;  3NA6 A;  2ZEL A;  4ZX8 A;  3ISX A;  2AFU A;  3I1U A;  4UEF A;  2Q4Z A;  4OC0 A;  3S9M A;  4EME A;  4FUU A;  2ZEP A;  3H8F A;  2F7V A;  3IEH A;  3SJE A;  4X2T A;  4CPA A;  4PQA A;  2PJ4 A;  4MCQ A;  4X8I A;  2PJ6 A;  1CBX A;  4ZI6 A;  3QNV A;  1LAN A;  3PB8 X;  4EFD A;  4DUK A;  2C6G A;  1JQG A;  4P45 A;  4F8Z A;  1CP7 A;  1PCA A;  1GYT A;  3DLJ A;  1DE4 C;  2G9D A;  1BLL E;  3BHX A;  1YME A;  3BXM A;  1AYE A;  2ZEM A;  4A38 A;  4P4I A;  4OC3 A;  2QJ8 A;  2AFZ A;  1Y0R A;  4NJR A;  2ZEF A;  2PJ1 A;  4P4J A;  1RTQ A;  2NSM A;  1CX8 A;  4NJQ A;  1TKF A;  3SI2 A;  3RAM A;  2V8D A;  5LYD A;  5F09 A;  4AXV A;  2PE3 A;  3GUX A;  2VL1 A;  3PFE A;  2PJ7 A;  3FVL A;  4MHZ A;  2ZEG A;  1TF9 A;  2PIY A;  1BPN A;  4MMO A;  3SI1 A;  2CTB A;  3B3V A;  2QYV A;  2PJC A;  3H8G A;  1HDQ A;  3KAS A;  2ABZ A;  2HC9 A;  1LAP A;  3ISZ A;  4FWU A;  1CPS A;  3BI1 A;  2EWB A;  3IIB A;  2BOA A;  5LRG A;  3D68 A;  3RBU A;  1F57 A;  2IQ6 A;  4FBE A;  4KSI A;  5K8N A;  2V8V A;  1TKH A;  1OBR A;  2GLJ A;  4UIA A;  3FEC A;  4P10 A;  3RZA A;  5ELY A;  3WC6 A;  4F9U A;  2PJ9 A;  4OC4 A;  4ZY2 A;  2PJ5 A;  4B6Z A;  4IK2 A;  1H8L A;  4R6T A;  3FX6 A;  3KGQ A;  3KR5 A;  3HUV A;  2I3C A;  2PJ2 A;  3NH8 A;  3B3S A;  3VH9 A;  3FH4 A;  2DEA A;  4DJL A;  7CPA A;  1LOK A;  3FJU A;  4PXC A;  2CIJ A;  1EE3 P;  3B3T A;  2XEI A;  4ZY1 A;  3VAR A;  1ZLI A;  4P4E A;  3HLP A;  4A39 A;  3B35 A;  5J1Q A;  2EK8 A;  2ANP A;  2PJ3 A;  4OC2 A;  2PVW A;  3D7D A;  3JRU A;  1IY7 A;  4NFR A;  5I4M A;  1DTD A;  1YW6 A;  4NGQ A;  1CP6 A;  1NSA A;  2PCU A;  2HB6 A;  3WC7 A;  3S9L A;  3KI9 A;  2ZOF A;  1QMU A;  3K2K A;  3S9N A;  4RUH A;  5D29 A;  1Y0Y A;  5K8P A;  1F2P A;  4OP4 A;  4TWE A;  2AFM A;  4MCS A;  1YW4 A;  2V77 A;  3NH5 A;  2JEW A;  2PJB A;  3VAT A;  3B3W A;  4PXD A;  1R3N A;  3DGV A;  3IC1 A;  3L2N A;  2RB7 A;  1F2O A;  3NFZ A;  2V8H A;  4F9V A;  3WAB A;  2PJ8 A;  2ZEO A;  3D66 A;  2O53 A;  2XEG A;  1PYT B;  4R76 A;  3TX8 A;  3D7H A;  5CBM A;  3TC8 A;  3N5F A;  3CPA A;  4P4B A;  4EWT A;  2EK9 A;  3PEI A;  2BCO A;  5HXD A;  4MRI A;  4P4F A;  4H2K A;  4NGM A;  1TKJ A;  4OKO A;  3FMC A;  3PBE A;  2AFW A;  3B3C A;  2WZN A;  4PXE A;  4TNU A;  2JBK A;  3D4U A;  2F8H A;  4LQG A;  4GM5 A;  1TF8 A;  4ZY0 A;  4X3R A;  4OID A;  2C6C A;  2GLF A;  4Z65 A;  5JH9 A;  3CT9 A;  1ELM P;  2JBJ A;  2CTC A;  2CF4 A;  4Q7A A;  5IB9 A;  3V7Z A; 
#chains in the Genus database with same CATH topology
 3PB9 X;  1S3Z A;  4YWY A;  2ZEE A;  1XMB A;  1B6B A;  1VHO A;  5LRJ A;  4B5P B;  2AJ6 A;  4NEX A;  6CPA A;  2R1I A;  1ARM A;  1X10 A;  3GLJ A;  1HDU A;  4OME A;  2Q4V A;  4IAV A;  3SJG A;  2C6P A;  3PB4 X;  1R43 A;  4M6G A;  4R9M A;  3T90 A;  4O23 A;  5HVH A;  2ZEN A;  1YLE A;  5J8C A;  1HEE A;  1VGY A;  4KSA A;  3GB0 A;  1YSJ A;  4M85 A;  2PRQ A;  4CYP A;  4KOS A;  1YR0 A;  4NGR A;  4B5O A;  3BJ7 A;  1QSN A;  1QSR A;  1R57 A;  4OC1 A;  2GFQ A;  2P6F A;  3KR4 A;  4YU9 A;  5HVF A;  1XEB A;  2BUE A;  2VEZ A;  4MCR A;  2FS5 A;  3R95 A;  1Z5R A;  1IYL A;  1FT7 A;  5CNP A;  4ZX9 A;  1IB1 E;  3KL9 A;  2OB0 A;  3FXT A;  3ZJ0 A;  4FD5 A;  5K8O A;  2EVN A;  1X12 A;  1YLO A;  2DPT A;  1LAM A;  2P6E A;  3IWE A;  1Y7R A;  4ONW A;  2O28 A;  8CPA A;  2BO9 A;  3DDD A;  3OWC A;  1YVK A;  4MFK A;  5AG5 A;  2I79 A;  3T8W A;  3V8I A;  5LYF A;  2ZED A;  3V38 A;  2JDD A;  4FAI A;  1CG2 A;  1OZP A;  5IX3 A;  4NSQ A;  3BLN A;  3QAY A;  4AG7 A;  3FEE A;  4R8F A;  3SJF A;  3TTH A;  3FF3 A;  4E2A A;  2R98 A;  5K8M A;  1Z8L A;  1XRY A;  1IYK A;  3VWD A;  4MI4 A;  3N7Z A;  1S60 A;  4MXU A;  1Y9W A;  1LCP A;  5FVJ A;  2P0W A;  3W91 A;  2J9A A;  2FXF A;  3CDX A;  3PFO A;  4P44 A;  3BI0 A;  2AFO A;  5G22 A;  2KCW A;  4L89 A;  2Q51 A;  4A30 A;  4NGT A;  2AFX A;  1I12 A;  2WUU A;  2G3T A;  4WJB A;  3D2M A;  2AFS A;  3GY9 A;  3LOD A;  4A94 A;  4PPZ A;  2OH1 A;  4Q36 A;  2ZEH A;  4MHD A;  3D3S A;  4MHN A;  3SI0 A;  4KOW A;  2OU2 A;  2C1C A;  2NYQ A;  2Z3M A;  1XIX A;  2OZU A;  2PR1 A;  4C2Z A;  1IGB A;  2VXK A;  4KUB A;  4B11 A;  4CS0 B;  5LYL A;  1AUG A;  4MFQ A;  3KKW A;  2YNC C;  5AGE A;  2JLM A;  4C7I A;  4A37 A;  1QSM A;  3SJX A;  1XE4 A;  1CPX A;  1VHE A;  2CNM A;  2JDC A;  3DNS A;  3JVN A;  4BD9 A;  1Y9K A;  4NGN A;  1WWZ A;  3WC5 A;  3PB7 X;  2FE7 A;  4Y49 B;  3NH4 A;  2VZY A;  3TO7 A;  3DR8 A;  4OIW A;  3IFE A;  2PJ0 A;  4ZYQ A;  3IJ3 A;  1AMP A;  4X5K A;  3CPX A;  1YRE A;  2Z3P A;  4I49 A;  4ZGY B;  4CAW A;  2DF5 A;  2DPS A;  4DYO A;  4C7H A;  4UIB A;  1ZG8 A;  5I0C A;  1YQE A;  4JXR A;  4P6Y A;  4KOR A;  4E8O A;  4YRH A;  4KOU A;  5KTD A;  3MRU A;  1ELL P;  4G1P A;  4W9Y A;  2IJZ A;  3P2F A;  1KWM A;  1FNO A;  3CXS A;  4UF4 A;  4JXQ A;  3KHZ A;  3D7G A;  2PJA A;  3PB6 X;  4K30 A;  3SXO A;  4KOV A;  4NGS A;  2B4D B;  4UEE A;  1Q7L A;  3PRT A;  3VWE A;  5F47 A;  3F8K A;  1XJO A;  2XEF A;  3B2Y A;  3IO1 A;  4CAF A;  5AG4 A;  4KVX A;  4OC5 A;  5CPA A;  4B13 A;  1Q2C A;  2Z3L A;  4IHM A;  4MJ8 A;  2QIR A;  4CGM A;  2WSA A;  2RFH A;  4NGP A;  3PGP A;  4UCP A;  4DNC A;  2EUI A;  2IMO A;  3FB3 A;  1ZG7 A;  3MN8 A;  4UBR A;  4JZ0 A;  3LWU A;  3LMS A;  2GU2 A;  2POK A;  4UEZ A;  3S6H A;  2DXQ A;  1QQ9 A;  5HVG A;  1XFO A;  3FED A;  4UFV A;  2EBJ A;  3R96 A;  4P4D A;  4AB7 A;  4R7M A;  2ZPA A;  5LYI A;  2WYR A;  3BJ8 A;  4UFW A;  2OR4 A;  1LFW A;  3QAH A;  1IOI A;  3KQX A;  4XPD C;  4U5Y A;  2OOT A;  5JQ4 A;  3H8E A;  1YVO A;  4CGL A;  5THW A;  2Z0Z A;  1BOB A;  4CRY B;  1Z8W A;  3D7F A;  3KZW A;  4C2X A;  3RNZ A;  1XF8 A;  2FT0 A;  3PBB A;  1KUV A;  2Z10 A;  4IF5 A;  5DS0 A;  1KUX A;  1UWY A;  2Y0M A;  5JGF A;  2Q43 A;  1KZF A;  2PR8 A;  3PP9 A;  4CYO A;  2V8G A;  1TXR A;  2Q7S A;  3B7I A;  3GYA A;  1RO5 A;  3I3G A;  5JM6 A;  3B8G A;  2GE3 A;  1ZLH A;  3IWW A;  4PSW A;  4R57 A;  3ZZI A;  1XBU A;  5F46 A;  5D8N A;  3W6S A;  4FD4 A;  4K3N A;  3D67 A;  1GHE A;  1Z8X A;  4FD6 A;  5H84 A;  3KHX A;  3KQZ A;  2ZXV A;  2IL4 A;  1VIX A;  2O4H A;  1BAV A;  2GRE A;  1ZG9 A;  2QVP A;  4JYW A;  2PIZ A;  4MHY A;  4MCP A;  1S7N A;  4B14 A;  2Q04 A;  1PU9 A;  3FNC A;  2VBQ A;  3TO6 A;  1BPM A;  2Z11 A;  3K9T A;  4QVT A;  2ZOG A;  3RO0 A;  1M4L A;  2YGW A;  1Y7E A;  2FVG A;  5H86 A;  5LRK A;  4RI1 A;  2CNS A;  2ZW6 A;  4MBU A;  1Z2L A;  2RC4 A;  4MHP A;  2XEJ A;  2PVV A;  4MFP A;  4PXB A;  4WWV A;  3WT4 A;  2Q44 A;  4M6H A;  1YK3 A;  3EO4 A;  4JLY A;  1ARL A;  4EVY A;  3NA6 A;  4CGP A;  2ZEL A;  5C82 A;  4ZX8 A;  3H5Z A;  2C27 A;  1B87 A;  4LQ6 A;  3F5B A;  3ISX A;  1IOF A;  4CYN A;  4GS4 A;  3H4Q A;  2AFU A;  3I1U A;  4KVM E;  2ZW5 A;  2D4O A;  2GIV A;  4UEF A;  3I9S A;  2Q4Z A;  4OC0 A;  2WPW A;  3S9M A;  3JUW A;  4EME A;  2Q7B A;  2B4D A;  4FUU A;  2ZEP A;  3H8F A;  4RN7 A;  1PUA A;  4UCM A;  2F7V A;  4HNW B;  5EMI A;  3TT2 A;  2PSW A;  3IEH A;  3S6G A;  1WK4 A;  3SJE A;  4X2T A;  4B12 A;  4CPA A;  4PQA A;  3D2P A;  4JD6 A;  5F49 A;  2PJ4 A;  4MCQ A;  4A95 A;  5ISV A;  3UY5 A;  2CNT A;  4X8I A;  2PJ6 A;  1CBX A;  4M6I A;  4ZI6 A;  3QNV A;  1LAN A;  3PB8 X;  4EFD A;  4DUK A;  1L0C A;  3F0A A;  5DWM A;  4KZT A;  1VHS A;  2C6G A;  5HH1 A;  1JQG A;  1QSO A;  4P45 A;  4RS2 A;  5EBV A;  1S7F A;  4F8Z A;  2OZG A;  1K4J A;  4MFL A;  1CP7 A;  3TOB A;  1PCA A;  1GYT A;  4XPD B;  3IGR A;  3DLJ A;  1DE4 C;  1IU8 A;  4JWP A;  2G9D A;  2REF A;  1V0C A;  4KS9 A;  1BLL E;  1Z9U A;  1TIQ A;  2WPX A;  3BHX A;  3CZX A;  4KUA A;  5G21 A;  4XPL A;  1YME A;  3BXM A;  5BWA B;  2FCK A;  1AYE A;  2P6G A;  1JWQ A;  2ZEM A;  4A38 A;  4P4I A;  4PK2 A;  2J8N A;  4UWJ A;  1MJ9 A;  4OC3 A;  4KSF A;  4CAV A;  2QJ8 A;  2G3A A;  3IWG A;  3P2H A;  2AFZ A;  2PDO A;  4LUA A;  1Y0R A;  4NJR A;  4UCN A;  1IID A;  3TFY A;  3FBU A;  2Q4Y A;  1NSL A;  2BSW A;  2ZEF A;  2PJ1 A;  3S6F A;  1IIC A;  3R9F A;  4P4J A;  4KLV A;  1RTQ A;  1P4N A;  2ATR A;  2NSM A;  1N71 A;  4XNH C;  2B3U A;  3G8W A;  1CX8 A;  4NJQ A;  3EXN A;  5F48 A;  4BBH A;  1TKF A;  1XMT A;  3SI2 A;  2FIW A;  2B4B A;  4M3S A;  3R9E A;  3RAM A;  2V8D A;  5LYD A;  3W6X A;  5F09 A;  4CAE A;  4AXV A;  2PE3 A;  2J8R A;  3SXN A;  3GUX A;  2VL1 A;  1I21 A;  3DSB A;  3PFE A;  2ODF A;  2PJ7 A;  4YGO A;  1SQH A;  3TO9 A;  3TE4 A;  4GXH A;  4UFX A;  3FVL A;  2YNE A;  4MHZ A;  5C88 A;  2EO8 A;  2ZEG A;  4Y49 C;  1NE9 A;  2VI7 A;  2PRB A;  1TF9 A;  1XOV A;  2QEC A;  4Q38 A;  2PIY A;  1BPN A;  4MMO A;  3SI1 A;  2J8M A;  4CYQ A;  3RYO A;  2CTB A;  4PV6 A;  3B3V A;  4XNH B;  4E0A A;  2QYV A;  2PJC A;  3T9Y A;  2B5G A;  3NE7 A;  2REE A;  3H8G A;  1BO4 A;  4FD7 A;  1U6M A;  1HDQ A;  3KAS A;  2ABZ A;  2HC9 A;  1LAP A;  3D8P A;  4R87 A;  3ISZ A;  4QUS A;  4FWU A;  3S6K A;  1KUY A;  2OZH A;  1CPS A;  3BI1 A;  4KVO E;  1I1D A;  2EWB A;  3IIB A;  2BOA A;  2YND A;  5LRG A;  4OAE A;  3D68 A;  3QB8 A;  3R1K A;  3RBU A;  1F57 A;  4ZBG A;  3C26 A;  4MY0 A;  2IQ6 A;  1MK4 A;  4F0X A;  3IU1 A;  4FBE A;  4B10 A;  5KTA A;  4KSI A;  4CAX A;  4AVC A;  4AG9 A;  5HMN A;  5K8N A;  2V8V A;  4KOX A;  1TKH A;  1OBR A;  1S7K A;  4KOT A;  4MFZ A;  4XPK A;  1NMT A;  2I00 A;  2GLJ A;  4UIA A;  3FEC A;  4P10 A;  5DWN A;  3RZA A;  4QBJ A;  1ON0 A;  3IU2 A;  3CXQ A;  5ELY A;  3WC6 A;  5JPH A;  4U9Y A;  4F9U A;  2PJ9 A;  4OC4 A;  2A4N A;  4ZY2 A;  2PJ5 A;  4B6Z A;  1M4D A;  4BMH A;  4IK2 A;  4ORF A;  1QST A;  2PQ8 A;  1H8L A;  3PZJ A;  4R6T A;  4UWI A;  2HV2 A;  3FX6 A;  1RXT A;  1UFH A;  3KGQ A;  2BEI A;  2GAN A;  3KR5 A;  1Q2Y A;  3HUV A;  4HPS A;  2I3C A;  4QB9 A;  2PJ2 A;  3NH8 A;  1Z4R A;  3B3S A;  4L8A A;  3VH9 A;  4CGN A;  3FH4 A;  2DEA A;  4QC6 A;  4DJL A;  1LOK A;  3FJU A;  4PXC A;  7CPA A;  2CIJ A;  2ZW4 A;  1EE3 P;  5E96 A;  5IV0 A;  3B3T A;  1MJA A;  2XEI A;  4ZY1 A;  1LRZ A;  4H6U A;  3EY5 A;  3VAR A;  4CGO A;  1ZLI A;  5J8F A;  4P4E A;  3HLP A;  4ONU A;  4BIN A;  2FSR A;  2Z3K A;  3JTK A;  3R9G A;  4OAD A;  1M1D A;  4A39 A;  3B35 A;  5J1Q A;  2EK8 A;  2ANP A;  2HUZ A;  2PJ3 A;  5KTC A;  4OC2 A;  4F0Y A;  2YNC A;  1CJW A;  2PVW A;  3CXP A;  3D7D A;  4AVB A;  4JJX A;  1CM0 A;  3FIX A;  3JRU A;  2Z3O A;  4H6Z A;  4R3K A;  1IY7 A;  2HQY A;  3WR7 A;  4NFR A;  4B5P A;  2B5G B;  1S5K A;  5I4M A;  1DTD A;  1YW6 A;  3A9L A;  2H5M A;  3LD2 A;  4NGQ A;  1CP6 A;  2QML A;  2VQY A;  4HNY B;  4HNX B;  4AVA A;  1NSA A;  5GCN A;  2PCU A;  2HB6 A;  2R8V A;  1S7L A;  3WC7 A;  2K5T A;  3S9L A;  4KLW A;  1VKC A;  3KI9 A;  1YGH A;  2ZOF A;  5A27 A;  4IUS A;  1QMU A;  3K2K A;  3S9N A;  1J4J A;  2R7H A;  4RUH A;  4C2Y A;  4MFJ A;  5D29 A;  1Y0Y A;  2CXA A;  5EC4 A;  2PC1 A;  4NCZ A;  5K8P A;  1F2P A;  3E0K A;  4OP4 A;  4TWE A;  2AFM A;  4MCS A;  1YW4 A;  2V77 A;  3NH5 A;  2JEW A;  4A33 A;  1Z4E A;  2PJB A;  1MJB A;  3VAT A;  3B3W A;  4PXD A;  1R3N A;  2JEV A;  2Z3N A;  3DGV A;  3IC1 A;  3L2N A;  2RB7 A;  4F6A A;  1F2O A;  3NFZ A;  5G1Z A;  2G0B A;  2V8H A;  5A28 A;  2CY2 A;  1Q2D A;  2B58 A;  3EC4 A;  4F9V A;  4HKF A;  2AE6 A;  3WAB A;  2PJ8 A;  2ZEO A;  1M44 A;  3NE8 A;  3D66 A;  2O53 A;  1M4G A;  4MY3 A;  3SHP A;  2XEG A;  1PYT B;  2FL4 A;  3GKR A;  3TCV A;  2ZW7 A;  4R76 A;  4U9Z A;  3TX8 A;  4A31 A;  3D7H A;  5CBM A;  3TC8 A;  3K9U A;  2F5I A;  3N5F A;  3CPA A;  4P4B A;  4EWT A;  2EK9 A;  3EFA A;  2X7B A;  3PEI A;  3DR6 A;  4J3G A;  2BCO A;  5HXD A;  2NMT A;  3GIU A;  4MRI A;  3G3S A;  4H2K A;  4NGM A;  2FIA A;  4P4F A;  4R3L A;  5AG7 A;  2ARH A;  1TKJ A;  4OKO A;  4II9 A;  4C68 A;  4UA3 A;  3FMC A;  4LX9 A;  4PSX A;  3FRM A;  3PBE A;  4A32 A;  1Z8T A;  3FYN A;  1ZO0 A;  2AFW A;  3B3C A;  2WZN A;  4NF1 A;  4PXE A;  4NXY A;  4YFJ A;  2D4P A;  4TNU A;  2JBK A;  3TOA A;  3D4U A;  4A2Z A;  2F8H A;  4LQG A;  4GM5 A;  1TF8 A;  2B3V A;  4CRZ B;  5AG6 A;  4ZY0 A;  2BL1 A;  4X3R A;  4OID A;  5G20 A;  2C6C A;  2GLF A;  4Z65 A;  5JH9 A;  1P0H A;  1FY7 A;  1YX0 A;  2VZZ A;  4KOY A;  3CT9 A;  1ELM P;  4OLL A;  2JBJ A;  2CTC A;  1M4I A;  3LAC A;  2CF4 A;  2Q0Y A;  3MGD A;  4H89 A;  4Q7A A;  1A2Z A;  5IB9 A;  5IB0 A;  4PK3 A;  3V7Z A; 
#chains in the Genus database with same CATH homology
 3PB9 X;  4YWY A;  2ZEE A;  1XMB A;  1VHO A;  5LRJ A;  6CPA A;  1ARM A;  3GLJ A;  1HDU A;  4OME A;  4IAV A;  3SJG A;  2C6P A;  3PB4 X;  1R43 A;  4O23 A;  5HVH A;  2ZEN A;  1HEE A;  1VGY A;  3GB0 A;  1YSJ A;  2PRQ A;  4NGR A;  4OC1 A;  3KR4 A;  4YU9 A;  5HVF A;  4MCR A;  1Z5R A;  1FT7 A;  4ZX9 A;  3KL9 A;  5K8O A;  1YLO A;  1LAM A;  4ONW A;  8CPA A;  2BO9 A;  3T8W A;  5LYF A;  2ZED A;  3V38 A;  4FAI A;  1CG2 A;  3FEE A;  4R8F A;  3SJF A;  3FF3 A;  5K8M A;  1Z8L A;  1XRY A;  4MXU A;  1LCP A;  2J9A A;  3PFO A;  4P44 A;  3CDX A;  3BI0 A;  2AFO A;  2Q51 A;  4NGT A;  2AFX A;  4WJB A;  2AFS A;  4A94 A;  4PPZ A;  2ZEH A;  4MHN A;  3SI0 A;  2C1C A;  2NYQ A;  1IGB A;  5LYL A;  4A37 A;  3SJX A;  1CPX A;  1VHE A;  4BD9 A;  3WC5 A;  4NGN A;  3PB7 X;  3NH4 A;  4OIW A;  3IFE A;  2PJ0 A;  4ZYQ A;  3IJ3 A;  1AMP A;  3CPX A;  4DYO A;  4UIB A;  1ZG8 A;  4P6Y A;  3MRU A;  1ELL P;  4G1P A;  4W9Y A;  2IJZ A;  1KWM A;  1FNO A;  4UF4 A;  3KHZ A;  3D7G A;  2PJA A;  3PB6 X;  4NGS A;  4UEE A;  1Q7L A;  3PRT A;  2XEF A;  1XJO A;  3B2Y A;  3IO1 A;  4OC5 A;  5CPA A;  4IHM A;  2RFH A;  4NGP A;  2IMO A;  3MN8 A;  1ZG7 A;  4JZ0 A;  3LWU A;  3LMS A;  2GU2 A;  2POK A;  4UEZ A;  5HVG A;  1QQ9 A;  1XFO A;  3FED A;  4P4D A;  4R7M A;  5LYI A;  2WYR A;  2OR4 A;  1LFW A;  3KQX A;  2OOT A;  3H8E A;  5THW A;  3D7F A;  3KZW A;  3PBB A;  5DS0 A;  1UWY A;  5JGF A;  2Q43 A;  2V8G A;  1TXR A;  3B7I A;  5JM6 A;  1ZLH A;  3IWW A;  1XBU A;  5D8N A;  4K3N A;  3D67 A;  3KHX A;  3KQZ A;  2O4H A;  1VIX A;  2QVP A;  1BAV A;  2GRE A;  1ZG9 A;  4JYW A;  4MHY A;  2PIZ A;  4MCP A;  1BPM A;  3K9T A;  2ZOG A;  1M4L A;  1Y7E A;  2FVG A;  5LRK A;  4MHP A;  1Z2L A;  2XEJ A;  2PVV A;  4PXB A;  4WWV A;  3WT4 A;  1ARL A;  3NA6 A;  2ZEL A;  4ZX8 A;  3ISX A;  2AFU A;  3I1U A;  4UEF A;  2Q4Z A;  4OC0 A;  3S9M A;  4EME A;  4FUU A;  2ZEP A;  3H8F A;  2F7V A;  3IEH A;  3SJE A;  4X2T A;  4CPA A;  4PQA A;  2PJ4 A;  4MCQ A;  4X8I A;  2PJ6 A;  1CBX A;  4ZI6 A;  3QNV A;  1LAN A;  3PB8 X;  4EFD A;  4DUK A;  2C6G A;  1JQG A;  4P45 A;  4F8Z A;  1CP7 A;  1PCA A;  1GYT A;  3DLJ A;  1DE4 C;  2G9D A;  1BLL E;  3BHX A;  1YME A;  3BXM A;  1AYE A;  2ZEM A;  4A38 A;  4P4I A;  4OC3 A;  2QJ8 A;  2AFZ A;  1Y0R A;  4NJR A;  2ZEF A;  2PJ1 A;  4P4J A;  1RTQ A;  2NSM A;  1CX8 A;  4NJQ A;  1TKF A;  3SI2 A;  3RAM A;  2V8D A;  5LYD A;  5F09 A;  4AXV A;  2PE3 A;  3GUX A;  2VL1 A;  3PFE A;  2PJ7 A;  3FVL A;  4MHZ A;  2ZEG A;  1TF9 A;  2PIY A;  1BPN A;  4MMO A;  3SI1 A;  2CTB A;  3B3V A;  2QYV A;  2PJC A;  3H8G A;  1HDQ A;  3KAS A;  2ABZ A;  2HC9 A;  1LAP A;  3ISZ A;  4FWU A;  1CPS A;  3BI1 A;  2EWB A;  3IIB A;  2BOA A;  5LRG A;  3D68 A;  3RBU A;  1F57 A;  2IQ6 A;  4FBE A;  4KSI A;  5K8N A;  2V8V A;  1TKH A;  1OBR A;  2GLJ A;  4UIA A;  3FEC A;  4P10 A;  3RZA A;  5ELY A;  3WC6 A;  4F9U A;  2PJ9 A;  4OC4 A;  4ZY2 A;  2PJ5 A;  4B6Z A;  4IK2 A;  1H8L A;  4R6T A;  3FX6 A;  3KGQ A;  3KR5 A;  3HUV A;  2I3C A;  2PJ2 A;  3NH8 A;  3B3S A;  3VH9 A;  3FH4 A;  2DEA A;  4DJL A;  7CPA A;  1LOK A;  3FJU A;  4PXC A;  2CIJ A;  1EE3 P;  3B3T A;  2XEI A;  4ZY1 A;  3VAR A;  1ZLI A;  4P4E A;  3HLP A;  4A39 A;  3B35 A;  5J1Q A;  2EK8 A;  2ANP A;  2PJ3 A;  4OC2 A;  2PVW A;  3D7D A;  3JRU A;  1IY7 A;  4NFR A;  5I4M A;  1DTD A;  1YW6 A;  4NGQ A;  1CP6 A;  1NSA A;  2PCU A;  2HB6 A;  3WC7 A;  3S9L A;  3KI9 A;  2ZOF A;  1QMU A;  3K2K A;  3S9N A;  4RUH A;  5D29 A;  1Y0Y A;  5K8P A;  1F2P A;  4OP4 A;  4TWE A;  2AFM A;  4MCS A;  1YW4 A;  2V77 A;  3NH5 A;  2JEW A;  2PJB A;  3VAT A;  3B3W A;  4PXD A;  1R3N A;  3DGV A;  3IC1 A;  3L2N A;  2RB7 A;  1F2O A;  3NFZ A;  2V8H A;  4F9V A;  3WAB A;  2PJ8 A;  2ZEO A;  3D66 A;  2O53 A;  2XEG A;  1PYT B;  4R76 A;  3TX8 A;  3D7H A;  5CBM A;  3TC8 A;  3N5F A;  3CPA A;  4P4B A;  4EWT A;  2EK9 A;  3PEI A;  2BCO A;  5HXD A;  4MRI A;  4P4F A;  4H2K A;  4NGM A;  1TKJ A;  4OKO A;  3FMC A;  3PBE A;  2AFW A;  3B3C A;  2WZN A;  4PXE A;  4TNU A;  2JBK A;  3D4U A;  2F8H A;  4LQG A;  4GM5 A;  1TF8 A;  4ZY0 A;  4X3R A;  4OID A;  2C6C A;  2GLF A;  4Z65 A;  5JH9 A;  3CT9 A;  1ELM P;  2JBJ A;  2CTC A;  2CF4 A;  4Q7A A;  5IB9 A;  3V7Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...