2NYQA

Structure of vibrio proteolyticus aminopeptidase with a bound trp fragment of dlwcf
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
291
structure length
291
Chain Sequence
MPPITQQATVTAWLPQVDASQITGTISSLESFTNRFYTTTSGAQASDWIASEWQALSASLPNASVKQVSHSGYNQKSVVMTITGSEAPDEWIVIGGHLDSTIGSHTNEQSVAPGADDDASGIAAVTEVIRVLSENNFQPKRSIAFMAYAAEEVGLRGSQDLANQYKSEGKNVVSALQLDMTNYKGSAQDVVFITDYTDSNFTQYLTQLMDEYLPSLTYGFDTCGYACSDHASWHNAGYPAAMPFESKFNDYNPRIHTTQDTLANSDPTGSHAKKFTQLGLAYAIEMGSATG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aminopeptidase
publication title Substrate recognition by the leucine aminopeptidase from Vibrio proteolyticus
rcsb
molecule tags Hydrolase
total genus 111
structure length 291
sequence length 291
ec nomenclature ec 3.4.11.10: Bacterial leucyl aminopeptidase.
pdb deposition date 2006-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 2nyqA00
2V8VA 5HVHA 2PJ2A 2GLJA 4BD9A 4ONWA 1YW6A 3PB4X 2OR4A 1JQGA 5CPAA 4UIAA 5JH9A 1Y0YA 4JZ0A 3CDXA 1XMBA 3PB7X 1BLLE 4Q7AA 2F7VA 2AFUA 3B7IA 3PBEA 3B3TA 4Z65A 1CP7A 3WC5A 5LRJA 2BOAA 2ZEDA 1Z2LA 4NJRA 1OBRA 2ZEPA 4PPZA 3CPXA 3GLJA 3B3CA 3WC6A 5JGFA 3KL9A 1QQ9A 1FT7A 2PIYA 4FUUA 3RZAA 3QNVA 5LYFA 2C1CA 4P4JA 1CPXA 2JEWA 3SJXA 3D7DA 2DEAA 1H8LA 1YSJA 3S9LA 4JYWA 4OIDA 2Q51A 4PQAA 4TNUA 3H8GA 2XEIA 2CIJA 4F9UA 3N5FA 1ZG9A 4MHZA 3BXMA 3B3VA 4OC2A 3PB9X 4A37A 2BO9A 4GM5A 4OC1A 3KI9A 4P4EA 2JBKA 4MHNA 4A94A 1IY7A 2PJ0A 1ZG8A 3D67A 1YMEA 4ZY1A 4NGQA 2WZNA 1F2OA 5K8PA 2GREA 3MN8A 2PJ9A 3NH4A 3KGQA 5LYIA 1AYEA 3PEIA 1HDUA 2PCUA 3KR5A 3SI0A 2O4HA 3FJUA 3D4UA 1TKFA 3RBUA 2V8GA 5LYLA 4PXBA 4DYOA 2AFXA 3SI2A 3IC1A 3FVLA 4UEEA 1HDQA 2ZELA 4UF4A 2PVWA 4NGSA 1TKJA 3KHZA 5HVGA 3CT9A 7CPAA 3NH5A 2XEGA 3WT4A 1TXRA 2RB7A 1UWYA 2F8HA 1Q7LA 2FVGA 2ZENA 3BHXA 3PB8X 4X3RA 8CPAA 3BI0A 1TF8A 5D8NA 1ELMP 4P4FA 5IB9A 4NJQA 3PFOA 1M4LA 4OC0A 3IJ3A 3SI1A 1YW4A 2EK8A 4O23A 1R3NA 3HLPA 2WYRA 4W9YA 1ZLHA 4MCRA 4MXUA 1LAPA 4ZX9A 3KQZA 3PBBA 2NYQA 2QYVA 3V7ZA 4MCQA 4PXDA 1Y7EA 2Q43A 3B2YA 5K8NA 1Z5RA 3NA6A 4IAVA 1Z8LA 1VHEA 2ZEMA 2V8DA 1PYTB 2AFWA 1FNOA 4RUHA 3SJGA 2PJ6A 2RFHA 4OC5A 2NSMA 3ISZA 3FEDA 4NGRA 3NH8A 2IQ6A 4B6ZA 3HUVA 4FWUA 1CG2A 3FH4A 2ZEEA 1CPSA 1DE4C 5LYDA 2CTBA 3VARA 3FMCA 3FX6A 1ARLA 2PJAA 1TKHA 1HEEA 2C6CA 3FEEA 4UIBA 3D68A 1YLOA 1F57A 2AFMA 3BI1A 2JBJA 4OIWA 4R7MA 1LAMA 2ZEOA 5D29A 2PJ3A 4NGNA 4WWVA 4EMEA 5DS0A 3JRUA 4A38A 2OOTA 1LOKA 2ZOFA 2J9AA 3DLJA 2QVPA 1XRYA 1RTQA 3ISXA 3LWUA 1VGYA 3PFEA 1PCAA 3IWWA 5LRGA 3GUXA 1BPNA 2QJ8A 4OP4A 4OC4A 4ZYQA 4IHMA 4MCPA 4OKOA 2ZEGA 3WABA 4FAIA 1ZG7A 3D7HA 4MHPA 3IO1A 3DGVA 1ZLIA 2PJCA 2V8HA 4NGMA 1ELLP 3I1UA 2PJ4A 4P45A 4P44A 2ZEFA 2EWBA 1XFOA 4ZX8A 3KR4A 5K8MA 4IK2A 3VATA 3SJFA 4P10A 1KWMA 2HC9A 3RAMA 4R6TA 4YU9A 5HVFA 2AFZA 2C6GA 3TC8A 1IGBA 2PE3A 1CP6A 1DTDA 1ARMA 2PVVA 3L2NA 1GYTA 4PXEA 2BCOA 4UEZA 4MRIA 2ZEHA 2HB6A 4NGPA 1LANA 3KQXA 2CTCA 3B3SA 4EWTA 2PJBA 2I3CA 4CPAA 1EE3P 1VIXA 2PJ1A 3IIBA 4ZY2A 3K9TA 3H8EA 2G9DA 1QMUA 2EK9A 3PRTA 1LCPA 5HXDA 2V77A 1VHOA 4NFRA 2IJZA 3H8FA 2CF4A 2O53A 3S9MA 6CPAA 5K8OA 4NGTA 4P4DA 4H2KA 4ZY0A 3MRUA 3B3WA 4KSIA 1LFWA 2ABZA 1BPMA 5CBMA 3LMSA 2Q4ZA 1NSAA 5LRKA 2GU2A 4P4IA 3SJEA 4TWEA 3T8WA 4P6YA 2AFOA 5THWA 4UEFA 5ELYA 4FBEA 1AMPA 2GLFA 2PJ5A 4A39A 4G1PA 1XJOA 3K2KA 2PJ8A 4R76A 3FF3A 2AFSA 3KHXA 3D7GA 4EFDA 5F09A 5JM6A 5I4MA 3IEHA 3TX8A 1R43A 1CX8A 4OMEA 3PB6X 2PIZA 4DJLA 4LQGA 3VH9A 1F2PA 3D7FA 1Y0RA 3B35A 4YWYA 3KZWA 4MHYA 2IMOA 4AXVA 5J1QA 3CPAA 4R8FA 3FECA 3KASA 2C6PA 3V38A 1CBXA 4DUKA 3GB0A 4X2TA 1XBUA 4X8IA 2XEFA 4OC3A 4PXCA 4ZI6A 2POKA 4MCSA 1TF9A 4F8ZA 4WJBA 2XEJA 2ANPA 1BAVA 2PRQA 2VL1A 3D66A 3NFZA 4MMOA 4P4BA 4F9VA 3S9NA 4K3NA 2ZOGA 3WC7A 2PJ7A 3IFEA
chains in the Genus database with same CATH superfamily
4H6ZA 3TOAA 1MJBA 2V8VA 4FD5A 2CXAA 4J3GA 5HVHA 2PJ2A 4C2ZA 2GLJA 4MFZA 4BD9A 3R1KA 4CGMA 4ONWA 1Z4EA 1YW6A 3PB4X 2OR4A 1S3ZA 2WPWA 1JQGA 5EBVA 5CPAA 2FT0A 2EVNA 3FB3A 5A28A 5F47A 3CZXA 5H86A 4BINA 1QSTA 4HPSA 2AE6A 2OU2A 4HNYB 4UIAA 5JH9A 5J8FA 2ZW7A 1MJAA 2G3AA 1Y0YA 3F0AA 3TE4A 2QIRA 4B14A 2Y0MA 3N7ZA 4IUSA 2FE7A 4JZ0A 4AG9A 3BLNA 3CDXA 1XMBA 3PGPA 2JLMA 1S7FA 2R8VA 3PB7X 1BLLE 3DSBA 4E2AA 4UCNA 3K9UA 4Q7AA 1JWQA 3FNCA 4KOSA 1XOVA 3IU2A 2F7VA 2ZXVA 4QBJA 3SXNA 4C68A 2AFUA 1S5KA 3B7IA 4A31A 4C7IA 3PBEA 3B3TA 4CGNA 4II9A 2P0WA 4Z65A 1RO5A 1CP7A 1S7KA 3R9EA 3WC5A 2ARHA 4NXYA 5IV0A 4KOXA 3EFAA 5LRJA 4Y49B 2BOAA 2ZEDA 2GANA 1Z2LA 4NJRA 2VZYA 1OBRA 2ZEPA 4KOVA 3CPXA 3GLJA 3B3CA 4PPZA 4QB9A 4UCPA 3W6XA 3WC6A 3KL9A 1M1DA 5JGFA 2P6FA 4CAVA 2JEVA 1Q2DA 1QQ9A 1R57A 1FT7A 2PIYA 4FUUA 5FVJA 3QNVA 3D2MA 3RZAA 5LYFA 2C1CA 4KZTA 4P4JA 1CPXA 2JEWA 4GS4A 3SJXA 4F0YA 3D7DA 2DEAA 1H8LA 1YSJA 3S9LA 2CY2A 4JYWA 1Q2CA 5HMNA 4OIDA 1PU9A 1Z4RA 2B4DB 2Q51A 3D3SA 2GFQA 3H8GA 3IWGA 4PQAA 4RN7A 4TNUA 2J8RA 2OH1A 2PR8A 2B58A 2XEIA 3R9FA 2CIJA 4F9UA 3N5FA 1ZG9A 4MHZA 2WPXA 3BXMA 3B3VA 4OC2A 4FD4A 1L0CA 3PB9X 4A37A 2BO9A 2A4NA 1Z8WA 3RO0A 3IWEA 1M4DA 2G0BA 4GM5A 4OC1A 2P6GA 2B3VA 2Z11A 1I21A 5F46A 3KI9A 2CNTA 3VWDA 1YLEA 4P4EA 3W6SA 1ON0A 3PZJA 2JBKA 4MHNA 3TO7A 4ORFA 4A94A 2D4PA 5H84A 2Z3LA 5ISVA 2BL1A 4KSFA 1IY7A 2PJ0A 2QMLA 1ZG8A 3D67A 1YMEA 4ZY1A 4NGQA 4LX9A 2WZNA 1WWZA 1F2OA 2EBJA 3F8KA 5K8PA 2FL4A 2GREA 4I49A 1YK3A 3KKWA 3MN8A 4UFXA 1BO4A 2PJ9A 3NH4A 4IF5A 1IOFA 4JXRA 3KGQA 2B4BA 5LYIA 3WR7A 1AYEA 2PDOA 2OB0A 5C82A 2DPTA 3PEIA 5DWMA 1HDUA 2PCUA 4M6HA 3KR5A 2B5GB 3SI0A 2O4HA 1NE9A 3LODA 3RNZA 2C27A 3FJUA 2VXKA 3MGDA 3D4UA 4R3LA 2D4OA 3FRMA 1TKFA 3IU1A 3RBUA 5I0CA 2RC4A 3S6HA 2V8GA 2YNCC 4PXBA 4CGPA 4DYOA 5KTAA 2AFXA 5HH1A 5LYLA 4KOWA 4KVME 1WK4A 3SI2A 3IC1A 1NSLA 4CAEA 3FVLA 3UY5A 3GKRA 3VWEA 2OZUA 4UEEA 4CYOA 5F49A 1HDQA 2ZELA 4UF4A 2PVWA 4NGSA 1GHEA 1TKJA 3KHZA 1IICA 2Z0ZA 3LACA 4KSAA 5HVGA 3CT9A 4JWPA 4PK2A 7CPAA 2Q7SA 3NH5A 1ZO0A 2ODFA 2XEGA 3WT4A 1TXRA 2RB7A 5BWAB 1UWYA 1P0HA 2F8HA 1Q7LA 2FVGA 2ZENA 1B87A 3BHXA 2CNSA 3PB8X 4JJXA 4X3RA 5AG6A 8CPAA 3BI0A 1TF8A 4JD6A 2BSWA 2J8NA 4NCZA 4AB7A 5AG5A 5D8NA 2VBQA 1ELMP 3DDDA 5C88A 4P4FA 4PSXA 5IB9A 1VHSA 3BJ8A 1OZPA 4NJQA 4KLWA 2REEA 1M4LA 3LD2A 3IJ3A 3PFOA 1YW4A 4OC0A 1YVKA 2EK8A 2PC1A 1R3NA 4O23A 3HLPA 3SI1A 1MJ9A 2WYRA 4R87A 4W9YA 4A32A 4PK3A 1K4JA 1ZLHA 2I00A 3CXSA 3RYOA 4KVOE 4MCRA 2FIWA 2Q4YA 4MXUA 4A95A 1LAPA 2WSAA 4ONUA 1I12A 4ZX9A 3KQZA 3PBBA 4UWIA 2NYQA 2QYVA 2PRBA 3V7ZA 4A33A 4MCQA 4PXDA 1Y7EA 4KOYA 4KUBA 2BUEA 2Q43A 4HNWB 3B2YA 5K8NA 1Z5RA 3NA6A 4IAVA 3FBUA 4Y49C 1Z8LA 1A2ZA 4X5KA 1VHEA 2ZEMA 3R9GA 2V8DA 1PYTB 4KOTA 2AFWA 1FNOA 4B5PA 4RUHA 5IX3A 4K30A 3SJGA 2PJ6A 4C2XA 2RFHA 4KOUA 4OC5A 4CAWA 2ZW5A 4C2YA 2NSMA 2Q4VA 3ISZA 1BOBA 3P2HA 3FEDA 2Z3NA 3TT2A 4NGRA 4CYPA 3NH8A 2IQ6A 4B6ZA 2REFA 3HUVA 2Z3MA 4FWUA 1CG2A 3FH4A 3P2FA 4PSWA 4CAFA 4EVYA 2R1IA 2ZEEA 1CPSA 1DE4C 1YR0A 4NSQA 5LYDA 3R96A 2CTBA 1QSRA 4QVTA 3VARA 3FMCA 4NEXA 3FX6A 1ARLA 3NE8A 2PJAA 4U9ZA 1TKHA 1HEEA 2DXQA 5G1ZA 1XEBA 4MFJA 5JQ4A 2O28A 2C6CA 3FEEA 4OAEA 3H5ZA 4UIBA 4MI4A 3D68A 1YLOA 1F57A 2AFMA 3BI1A 2JBJA 1IU8A 1YGHA 4OIWA 4R7MA 1LAMA 1RXTA 2ZEOA 4OLLA 5GCNA 5D29A 4UBRA 4JLYA 1I1DA 4MFPA 3FIXA 4XNHC 3GIUA 2PJ3A 4NGNA 2CNMA 4WWVA 5DS0A 2FIAA 3JRUA 4U9YA 4A38A 2OOTA 4EMEA 3A9LA 1LOKA 2J8MA 4B5OA 2ZOFA 2J9AA 1M4IA 2KCWA 3DLJA 2QVPA 2FS5A 1XRYA 1RTQA 3ISXA 3LWUA 1VGYA 3PFEA 4MFQA 1PCAA 2PSWA 3IWWA 5LRGA 3GUXA 3V8IA 4F6AA 4QC6A 4FD6A 2Q0YA 2EO8A 1BPNA 2K5TA 2QJ8A 4OP4A 4OC4A 4CS0B 4ZYQA 4IHMA 2PQ8A 4MCPA 2GIVA 4OKOA 2ZEGA 3WABA 5JPHA 3ZJ0A 4RI1A 4FAIA 1ZG7A 3D7HA 3T90A 3T9YA 3SXOA 4MHPA 2Z10A 3IO1A 3DGVA 1ZLIA 2PJCA 3FXTA 2V8HA 3OWCA 1ELLP 3I1UA 3JVNA 4GXHA 2PJ4A 4NGMA 3S6KA 3TO9A 4YFJA 4P45A 4P44A 2ZEFA 2EWBA 4R3KA 4M85A 1XFOA 4XPDB 4ZX8A 4B11A 4Q36A 3KR4A 2YGWA 5K8MA 4IK2A 1XE4A 1Y7RA 4L89A 3E0KA 3G8WA 4KORA 3I9SA 5EMIA 3VATA 4AG7A 1VKCA 1Z8TA 1KUVA 4CYNA 3SJFA 4ZBGA 2WUUA 4P10A 1KWMA 2HC9A 3RAMA 3TO6A 1YREA 4MY3A 4R6TA 4YGOA 5F48A 4YU9A 2EUIA 3CXQA 3W91A 5HVFA 2AFZA 3EXNA 2C6GA 3TC8A 1IGBA 2PE3A 4MHDA 2Q7BA 4MY0A 4FD7A 1CP6A 4UWJA 1DTDA 1QSMA 4KVXA 4XPKA 4UFVA 1ARMA 2PVVA 4UCMA 3L2NA 3D8PA 1GYTA 4PXEA 4NF1A 4CRYB 2BCOA 2YNCA 4E0AA 3DNSA 4UEZA 4CGLA 1AUGA 4MRIA 5G21A 2PR1A 2ZEHA 2HB6A 4HKFA 3QAYA 2FSRA 4NGPA 2AJ6A 1LANA 3KQXA 4U5YA 5AGEA 5DWNA 2QECA 1J4JA 2R7HA 2CTCA 3B3SA 3DR8A 4B13A 4EWTA 2PJBA 2I3CA 4KS9A 4B5PB 4CPAA 1EE3P 3H4QA 1Y9KA 1VIXA 2PJ1A 3IIBA 3SHPA 1IB1E 1NMTA 4ZY2A 3C26A 5KTDA 3K9TA 1KZFA 1IYLA 1X10A 3H8EA 1Y9WA 3EY5A 2G9DA 1QMUA 1TIQA 5AG7A 2VEZA 2YNDA 3PP9A 4H89A 2EK9A 3F5BA 3PRTA 3D2PA 3NE7A 3JTKA 2FXFA 2IL4A 1LCPA 5HXDA 1LRZA 2V77A 2Q04A 1VHOA 1Z8XA 4NFRA 1UFHA 2IJZA 2CF4A 1XIXA 3H8FA 2O53A 3B8GA 3S9MA 3TTHA 4DNCA 6CPAA 3S6GA 5K8OA 4NGTA 4P4DA 4H2KA 4ZY0A 2I79A 1M44A 4L8AA 3MRUA 3B3WA 4H6UA 4KSIA 1P4NA 1LFWA 1QSOA 2ABZA 1QSNA 1BPMA 3CXPA 1XMTA 3LMSA 4HNXB 2Q4ZA 3EC4A 1NSAA 4UFWA 4AVBA 5AG4A 2GU2A 5LRKA 1IIDA 4P4IA 3SJEA 2BEIA 2P6EA 4TWEA 4R57A 5CNPA 4QUSA 3T8WA 1S7LA 1N71A 4P6YA 4UA3A 2AFOA 2ZW6A 5EC4A 5THWA 1YQEA 4XPLA 3ZZIA 4UEFA 5ELYA 4FBEA 4OADA 5E96A 1AMPA 2Z3OA 2F5IA 4CRZB 3GY9A 3I3GA 3BJ7A 2GE3A 3QB8A 2GLFA 1SQHA 4RS2A 4ZGYB 2PJ5A 4A39A 2DF5A 4C7HA 2JDCA 4G1PA 1V0CA 5IB0A 4BBHA 1X12A 5KTCA 1XJOA 3K2KA 2PJ8A 4MFLA 4AVAA 4B12A 3R95A 1S60A 4R76A 3FF3A 2AFSA 3G3SA 2X7BA 3KHXA 3D7GA 4R9MA 2B4DA 3DR6A 4EFDA 5CBMA 1YX0A 3FYNA 2VI7A 5F09A 2ATRA 4A2ZA 4AVCA 5JM6A 4A30A 5I4MA 4YRHA 5G20A 4CAXA 3IEHA 2ZW4A 3TX8A 1CM0A 2FCKA 1R43A 1CX8A 4OMEA 3PB6X 3QAHA 2PIZA 4BMHA 1Z9UA 4F0XA 1KUYA 4DJLA 4LQGA 3VH9A 1F2PA 3D7FA 1IYKA 4XNHB 1Y0RA 3B35A 2R98A 3EO4A 4LUAA 4YWYA 3GYAA 2HQYA 2JDDA 4CGOA 3KZWA 4MHYA 3TFYA 2IMOA 2OZGA 5G22A 4AXVA 5J1QA 3CPAA 4R8FA 3FECA 3KASA 5A27A 4MBUA 3TCVA 2C6PA 1Q2YA 4LQ6A 3V38A 2NMTA 5J8CA 4KLVA 4XPDC 4M6GA 1KUXA 2HV2A 1CBXA 4KUAA 1CJWA 4DUKA 3GB0A 2Z3KA 2ZPAA 1B6BA 4X2TA 3JUWA 1XBUA 4X8IA 1S7NA 2VZZA 2XEFA 3S6FA 4OC3A 3TOBA 4PV6A 4PXCA 3IGRA 4ZI6A 1U6MA 2POKA 2B5GA 1PUAA 2HUZA 4MJ8A 4MCSA 4M3SA 1TF9A 4B10A 1XF8A 4F8ZA 4Q38A 4WJBA 2OZHA 2XEJA 2ANPA 1BAVA 1YVOA 1MK4A 2G3TA 2YNEA 2Q44A 1IOIA 1FY7A 2PRQA 2VL1A 4JXQA 3D66A 3NFZA 4MMOA 4MFKA 1M4GA 2B3UA 4M6IA 2H5MA 4P4BA 4F9VA 4K3NA 2ZOGA 3WC7A 2PJ7A 4E8OA 3S9NA 2Z3PA 4CYQA 2DPSA 2VQYA 3IFEA
chains in the Genus database with same CATH topology
2V8VA 5HVHA 2PJ2A 2GLJA 4BD9A 4ONWA 1YW6A 3PB4X 2OR4A 1JQGA 5CPAA 4UIAA 5JH9A 1Y0YA 4JZ0A 3CDXA 1XMBA 3PB7X 1BLLE 4Q7AA 2F7VA 2AFUA 3B7IA 3PBEA 3B3TA 4Z65A 1CP7A 3WC5A 5LRJA 2BOAA 2ZEDA 1Z2LA 4NJRA 1OBRA 2ZEPA 4PPZA 3CPXA 3GLJA 3B3CA 3WC6A 5JGFA 3KL9A 1QQ9A 1FT7A 2PIYA 4FUUA 3RZAA 3QNVA 5LYFA 2C1CA 4P4JA 1CPXA 2JEWA 3SJXA 3D7DA 2DEAA 1H8LA 1YSJA 3S9LA 4JYWA 4OIDA 2Q51A 4PQAA 4TNUA 3H8GA 2XEIA 2CIJA 4F9UA 3N5FA 1ZG9A 4MHZA 3BXMA 3B3VA 4OC2A 3PB9X 4A37A 2BO9A 4GM5A 4OC1A 3KI9A 4P4EA 2JBKA 4MHNA 4A94A 1IY7A 2PJ0A 1ZG8A 3D67A 1YMEA 4ZY1A 4NGQA 2WZNA 1F2OA 5K8PA 2GREA 3MN8A 2PJ9A 3NH4A 3KGQA 5LYIA 1AYEA 3PEIA 1HDUA 2PCUA 3KR5A 3SI0A 2O4HA 3FJUA 3D4UA 1TKFA 3RBUA 2V8GA 5LYLA 4PXBA 4DYOA 2AFXA 3SI2A 3IC1A 3FVLA 4UEEA 1HDQA 2ZELA 4UF4A 2PVWA 4NGSA 1TKJA 3KHZA 5HVGA 3CT9A 7CPAA 3NH5A 2XEGA 3WT4A 1TXRA 2RB7A 1UWYA 2F8HA 1Q7LA 2FVGA 2ZENA 3BHXA 3PB8X 4X3RA 8CPAA 3BI0A 1TF8A 5D8NA 1ELMP 4P4FA 5IB9A 4NJQA 3PFOA 1M4LA 4OC0A 3IJ3A 3SI1A 1YW4A 2EK8A 4O23A 1R3NA 3HLPA 2WYRA 4W9YA 1ZLHA 4MCRA 4MXUA 1LAPA 4ZX9A 3KQZA 3PBBA 2NYQA 2QYVA 3V7ZA 4MCQA 4PXDA 1Y7EA 2Q43A 3B2YA 5K8NA 1Z5RA 3NA6A 4IAVA 1Z8LA 1VHEA 2ZEMA 2V8DA 1PYTB 2AFWA 1FNOA 4RUHA 3SJGA 2PJ6A 2RFHA 4OC5A 2NSMA 3ISZA 3FEDA 4NGRA 3NH8A 2IQ6A 4B6ZA 3HUVA 4FWUA 1CG2A 3FH4A 2ZEEA 1CPSA 1DE4C 5LYDA 2CTBA 3VARA 3FMCA 3FX6A 1ARLA 2PJAA 1TKHA 1HEEA 2C6CA 3FEEA 4UIBA 3D68A 1YLOA 1F57A 2AFMA 3BI1A 2JBJA 4OIWA 4R7MA 1LAMA 2ZEOA 5D29A 2PJ3A 4NGNA 4WWVA 4EMEA 5DS0A 3JRUA 4A38A 2OOTA 1LOKA 2ZOFA 2J9AA 3DLJA 2QVPA 1XRYA 1RTQA 3ISXA 3LWUA 1VGYA 3PFEA 1PCAA 3IWWA 5LRGA 3GUXA 1BPNA 2QJ8A 4OP4A 4OC4A 4ZYQA 4IHMA 4MCPA 4OKOA 2ZEGA 3WABA 4FAIA 1ZG7A 3D7HA 4MHPA 3IO1A 3DGVA 1ZLIA 2PJCA 2V8HA 4NGMA 1ELLP 3I1UA 2PJ4A 4P45A 4P44A 2ZEFA 2EWBA 1XFOA 4ZX8A 3KR4A 5K8MA 4IK2A 3VATA 3SJFA 4P10A 1KWMA 2HC9A 3RAMA 4R6TA 4YU9A 5HVFA 2AFZA 2C6GA 3TC8A 1IGBA 2PE3A 1CP6A 1DTDA 1ARMA 2PVVA 3L2NA 1GYTA 4PXEA 2BCOA 4UEZA 4MRIA 2ZEHA 2HB6A 4NGPA 1LANA 3KQXA 2CTCA 3B3SA 4EWTA 2PJBA 2I3CA 4CPAA 1EE3P 1VIXA 2PJ1A 3IIBA 4ZY2A 3K9TA 3H8EA 2G9DA 1QMUA 2EK9A 3PRTA 1LCPA 5HXDA 2V77A 1VHOA 4NFRA 2IJZA 3H8FA 2CF4A 2O53A 3S9MA 6CPAA 5K8OA 4NGTA 4P4DA 4H2KA 4ZY0A 3MRUA 3B3WA 4KSIA 1LFWA 2ABZA 1BPMA 5CBMA 3LMSA 2Q4ZA 1NSAA 5LRKA 2GU2A 4P4IA 3SJEA 4TWEA 3T8WA 4P6YA 2AFOA 5THWA 4UEFA 5ELYA 4FBEA 1AMPA 2GLFA 2PJ5A 4A39A 4G1PA 1XJOA 3K2KA 2PJ8A 4R76A 3FF3A 2AFSA 3KHXA 3D7GA 4EFDA 5F09A 5JM6A 5I4MA 3IEHA 3TX8A 1R43A 1CX8A 4OMEA 3PB6X 2PIZA 4DJLA 4LQGA 3VH9A 1F2PA 3D7FA 1Y0RA 3B35A 4YWYA 3KZWA 4MHYA 2IMOA 4AXVA 5J1QA 3CPAA 4R8FA 3FECA 3KASA 2C6PA 3V38A 1CBXA 4DUKA 3GB0A 4X2TA 1XBUA 4X8IA 2XEFA 4OC3A 4PXCA 4ZI6A 2POKA 4MCSA 1TF9A 4F8ZA 4WJBA 2XEJA 2ANPA 1BAVA 2PRQA 2VL1A 3D66A 3NFZA 4MMOA 4P4BA 4F9VA 3S9NA 4K3NA 2ZOGA 3WC7A 2PJ7A 3IFEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2V8V A;  5HVH A;  2PJ2 A;  2GLJ A;  4BD9 A;  4ONW A;  1YW6 A;  3PB4 X;  2OR4 A;  1JQG A;  5CPA A;  4UIA A;  5JH9 A;  1Y0Y A;  4JZ0 A;  3CDX A;  1XMB A;  3PB7 X;  1BLL E;  4Q7A A;  2F7V A;  2AFU A;  3B7I A;  3PBE A;  3B3T A;  4Z65 A;  1CP7 A;  3WC5 A;  5LRJ A;  2BOA A;  2ZED A;  1Z2L A;  4NJR A;  1OBR A;  2ZEP A;  4PPZ A;  3CPX A;  3GLJ A;  3B3C A;  3WC6 A;  5JGF A;  3KL9 A;  1QQ9 A;  1FT7 A;  2PIY A;  4FUU A;  3RZA A;  3QNV A;  5LYF A;  2C1C A;  4P4J A;  1CPX A;  2JEW A;  3SJX A;  3D7D A;  2DEA A;  1H8L A;  1YSJ A;  3S9L A;  4JYW A;  4OID A;  2Q51 A;  4PQA A;  4TNU A;  3H8G A;  2XEI A;  2CIJ A;  4F9U A;  3N5F A;  1ZG9 A;  4MHZ A;  3BXM A;  3B3V A;  4OC2 A;  3PB9 X;  4A37 A;  2BO9 A;  4GM5 A;  4OC1 A;  3KI9 A;  4P4E A;  2JBK A;  4MHN A;  4A94 A;  1IY7 A;  2PJ0 A;  1ZG8 A;  3D67 A;  1YME A;  4ZY1 A;  4NGQ A;  2WZN A;  1F2O A;  5K8P A;  2GRE A;  3MN8 A;  2PJ9 A;  3NH4 A;  3KGQ A;  5LYI A;  1AYE A;  3PEI A;  1HDU A;  2PCU A;  3KR5 A;  3SI0 A;  2O4H A;  3FJU A;  3D4U A;  1TKF A;  3RBU A;  2V8G A;  5LYL A;  4PXB A;  4DYO A;  2AFX A;  3SI2 A;  3IC1 A;  3FVL A;  4UEE A;  1HDQ A;  2ZEL A;  4UF4 A;  2PVW A;  4NGS A;  1TKJ A;  3KHZ A;  5HVG A;  3CT9 A;  7CPA A;  3NH5 A;  2XEG A;  3WT4 A;  1TXR A;  2RB7 A;  1UWY A;  2F8H A;  1Q7L A;  2FVG A;  2ZEN A;  3BHX A;  3PB8 X;  4X3R A;  8CPA A;  3BI0 A;  1TF8 A;  5D8N A;  1ELM P;  4P4F A;  5IB9 A;  4NJQ A;  3PFO A;  1M4L A;  4OC0 A;  3IJ3 A;  3SI1 A;  1YW4 A;  2EK8 A;  4O23 A;  1R3N A;  3HLP A;  2WYR A;  4W9Y A;  1ZLH A;  4MCR A;  4MXU A;  1LAP A;  4ZX9 A;  3KQZ A;  3PBB A;  2NYQ A;  2QYV A;  3V7Z A;  4MCQ A;  4PXD A;  1Y7E A;  2Q43 A;  3B2Y A;  5K8N A;  1Z5R A;  3NA6 A;  4IAV A;  1Z8L A;  1VHE A;  2ZEM A;  2V8D A;  1PYT B;  2AFW A;  1FNO A;  4RUH A;  3SJG A;  2PJ6 A;  2RFH A;  4OC5 A;  2NSM A;  3ISZ A;  3FED A;  4NGR A;  3NH8 A;  2IQ6 A;  4B6Z A;  3HUV A;  4FWU A;  1CG2 A;  3FH4 A;  2ZEE A;  1CPS A;  1DE4 C;  5LYD A;  2CTB A;  3VAR A;  3FMC A;  3FX6 A;  1ARL A;  2PJA A;  1TKH A;  1HEE A;  2C6C A;  3FEE A;  4UIB A;  3D68 A;  1YLO A;  1F57 A;  2AFM A;  3BI1 A;  2JBJ A;  4OIW A;  4R7M A;  1LAM A;  2ZEO A;  5D29 A;  2PJ3 A;  4NGN A;  4WWV A;  4EME A;  5DS0 A;  3JRU A;  4A38 A;  2OOT A;  1LOK A;  2ZOF A;  2J9A A;  3DLJ A;  2QVP A;  1XRY A;  1RTQ A;  3ISX A;  3LWU A;  1VGY A;  3PFE A;  1PCA A;  3IWW A;  5LRG A;  3GUX A;  1BPN A;  2QJ8 A;  4OP4 A;  4OC4 A;  4ZYQ A;  4IHM A;  4MCP A;  4OKO A;  2ZEG A;  3WAB A;  4FAI A;  1ZG7 A;  3D7H A;  4MHP A;  3IO1 A;  3DGV A;  1ZLI A;  2PJC A;  2V8H A;  4NGM A;  1ELL P;  3I1U A;  2PJ4 A;  4P45 A;  4P44 A;  2ZEF A;  2EWB A;  1XFO A;  4ZX8 A;  3KR4 A;  5K8M A;  4IK2 A;  3VAT A;  3SJF A;  4P10 A;  1KWM A;  2HC9 A;  3RAM A;  4R6T A;  4YU9 A;  5HVF A;  2AFZ A;  2C6G A;  3TC8 A;  1IGB A;  2PE3 A;  1CP6 A;  1DTD A;  1ARM A;  2PVV A;  3L2N A;  1GYT A;  4PXE A;  2BCO A;  4UEZ A;  4MRI A;  2ZEH A;  2HB6 A;  4NGP A;  1LAN A;  3KQX A;  2CTC A;  3B3S A;  4EWT A;  2PJB A;  2I3C A;  4CPA A;  1EE3 P;  1VIX A;  2PJ1 A;  3IIB A;  4ZY2 A;  3K9T A;  3H8E A;  2G9D A;  1QMU A;  2EK9 A;  3PRT A;  1LCP A;  5HXD A;  2V77 A;  1VHO A;  4NFR A;  2IJZ A;  3H8F A;  2CF4 A;  2O53 A;  3S9M A;  6CPA A;  5K8O A;  4NGT A;  4P4D A;  4H2K A;  4ZY0 A;  3MRU A;  3B3W A;  4KSI A;  1LFW A;  2ABZ A;  1BPM A;  5CBM A;  3LMS A;  2Q4Z A;  1NSA A;  5LRK A;  2GU2 A;  4P4I A;  3SJE A;  4TWE A;  3T8W A;  4P6Y A;  2AFO A;  5THW A;  4UEF A;  5ELY A;  4FBE A;  1AMP A;  2GLF A;  2PJ5 A;  4A39 A;  4G1P A;  1XJO A;  3K2K A;  2PJ8 A;  4R76 A;  3FF3 A;  2AFS A;  3KHX A;  3D7G A;  4EFD A;  5F09 A;  5JM6 A;  5I4M A;  3IEH A;  3TX8 A;  1R43 A;  1CX8 A;  4OME A;  3PB6 X;  2PIZ A;  4DJL A;  4LQG A;  3VH9 A;  1F2P A;  3D7F A;  1Y0R A;  3B35 A;  4YWY A;  3KZW A;  4MHY A;  2IMO A;  4AXV A;  5J1Q A;  3CPA A;  4R8F A;  3FEC A;  3KAS A;  2C6P A;  3V38 A;  1CBX A;  4DUK A;  3GB0 A;  4X2T A;  1XBU A;  4X8I A;  2XEF A;  4OC3 A;  4PXC A;  4ZI6 A;  2POK A;  4MCS A;  1TF9 A;  4F8Z A;  4WJB A;  2XEJ A;  2ANP A;  1BAV A;  2PRQ A;  2VL1 A;  3D66 A;  3NFZ A;  4MMO A;  4P4B A;  4F9V A;  3S9N A;  4K3N A;  2ZOG A;  3WC7 A;  2PJ7 A;  3IFE A; 
#chains in the Genus database with same CATH topology
 4H6Z A;  3TOA A;  1MJB A;  2V8V A;  4FD5 A;  2CXA A;  4J3G A;  5HVH A;  2PJ2 A;  4C2Z A;  2GLJ A;  4MFZ A;  4BD9 A;  3R1K A;  4CGM A;  4ONW A;  1Z4E A;  1YW6 A;  3PB4 X;  2OR4 A;  1S3Z A;  2WPW A;  1JQG A;  5EBV A;  5CPA A;  2FT0 A;  2EVN A;  3FB3 A;  5A28 A;  5F47 A;  3CZX A;  5H86 A;  4BIN A;  1QST A;  4HPS A;  2AE6 A;  2OU2 A;  4HNY B;  4UIA A;  5JH9 A;  5J8F A;  2ZW7 A;  1MJA A;  2G3A A;  1Y0Y A;  3F0A A;  3TE4 A;  2QIR A;  4B14 A;  2Y0M A;  3N7Z A;  4IUS A;  2FE7 A;  4JZ0 A;  4AG9 A;  3BLN A;  3CDX A;  1XMB A;  3PGP A;  2JLM A;  1S7F A;  2R8V A;  3PB7 X;  1BLL E;  3DSB A;  4E2A A;  4UCN A;  3K9U A;  4Q7A A;  1JWQ A;  3FNC A;  4KOS A;  1XOV A;  3IU2 A;  2F7V A;  2ZXV A;  4QBJ A;  3SXN A;  4C68 A;  2AFU A;  1S5K A;  3B7I A;  4A31 A;  4C7I A;  3PBE A;  3B3T A;  4CGN A;  4II9 A;  2P0W A;  4Z65 A;  1RO5 A;  1CP7 A;  1S7K A;  3R9E A;  3WC5 A;  2ARH A;  4NXY A;  5IV0 A;  4KOX A;  3EFA A;  5LRJ A;  4Y49 B;  2BOA A;  2ZED A;  2GAN A;  1Z2L A;  4NJR A;  2VZY A;  1OBR A;  2ZEP A;  4KOV A;  3CPX A;  3GLJ A;  3B3C A;  4PPZ A;  4QB9 A;  4UCP A;  3W6X A;  3WC6 A;  3KL9 A;  1M1D A;  5JGF A;  2P6F A;  4CAV A;  2JEV A;  1Q2D A;  1QQ9 A;  1R57 A;  1FT7 A;  2PIY A;  4FUU A;  5FVJ A;  3QNV A;  3D2M A;  3RZA A;  5LYF A;  2C1C A;  4KZT A;  4P4J A;  1CPX A;  2JEW A;  4GS4 A;  3SJX A;  4F0Y A;  3D7D A;  2DEA A;  1H8L A;  1YSJ A;  3S9L A;  2CY2 A;  4JYW A;  1Q2C A;  5HMN A;  4OID A;  1PU9 A;  1Z4R A;  2B4D B;  2Q51 A;  3D3S A;  2GFQ A;  3H8G A;  3IWG A;  4PQA A;  4RN7 A;  4TNU A;  2J8R A;  2OH1 A;  2PR8 A;  2B58 A;  2XEI A;  3R9F A;  2CIJ A;  4F9U A;  3N5F A;  1ZG9 A;  4MHZ A;  2WPX A;  3BXM A;  3B3V A;  4OC2 A;  4FD4 A;  1L0C A;  3PB9 X;  4A37 A;  2BO9 A;  2A4N A;  1Z8W A;  3RO0 A;  3IWE A;  1M4D A;  2G0B A;  4GM5 A;  4OC1 A;  2P6G A;  2B3V A;  2Z11 A;  1I21 A;  5F46 A;  3KI9 A;  2CNT A;  3VWD A;  1YLE A;  4P4E A;  3W6S A;  1ON0 A;  3PZJ A;  2JBK A;  4MHN A;  3TO7 A;  4ORF A;  4A94 A;  2D4P A;  5H84 A;  2Z3L A;  5ISV A;  2BL1 A;  4KSF A;  1IY7 A;  2PJ0 A;  2QML A;  1ZG8 A;  3D67 A;  1YME A;  4ZY1 A;  4NGQ A;  4LX9 A;  2WZN A;  1WWZ A;  1F2O A;  2EBJ A;  3F8K A;  5K8P A;  2FL4 A;  2GRE A;  4I49 A;  1YK3 A;  3KKW A;  3MN8 A;  4UFX A;  1BO4 A;  2PJ9 A;  3NH4 A;  4IF5 A;  1IOF A;  4JXR A;  3KGQ A;  2B4B A;  5LYI A;  3WR7 A;  1AYE A;  2PDO A;  2OB0 A;  5C82 A;  2DPT A;  3PEI A;  5DWM A;  1HDU A;  2PCU A;  4M6H A;  3KR5 A;  2B5G B;  3SI0 A;  2O4H A;  1NE9 A;  3LOD A;  3RNZ A;  2C27 A;  3FJU A;  2VXK A;  3MGD A;  3D4U A;  4R3L A;  2D4O A;  3FRM A;  1TKF A;  3IU1 A;  3RBU A;  5I0C A;  2RC4 A;  3S6H A;  2V8G A;  2YNC C;  4PXB A;  4CGP A;  4DYO A;  5KTA A;  2AFX A;  5HH1 A;  5LYL A;  4KOW A;  4KVM E;  1WK4 A;  3SI2 A;  3IC1 A;  1NSL A;  4CAE A;  3FVL A;  3UY5 A;  3GKR A;  3VWE A;  2OZU A;  4UEE A;  4CYO A;  5F49 A;  1HDQ A;  2ZEL A;  4UF4 A;  2PVW A;  4NGS A;  1GHE A;  1TKJ A;  3KHZ A;  1IIC A;  2Z0Z A;  3LAC A;  4KSA A;  5HVG A;  3CT9 A;  4JWP A;  4PK2 A;  7CPA A;  2Q7S A;  3NH5 A;  1ZO0 A;  2ODF A;  2XEG A;  3WT4 A;  1TXR A;  2RB7 A;  5BWA B;  1UWY A;  1P0H A;  2F8H A;  1Q7L A;  2FVG A;  2ZEN A;  1B87 A;  3BHX A;  2CNS A;  3PB8 X;  4JJX A;  4X3R A;  5AG6 A;  8CPA A;  3BI0 A;  1TF8 A;  4JD6 A;  2BSW A;  2J8N A;  4NCZ A;  4AB7 A;  5AG5 A;  5D8N A;  2VBQ A;  1ELM P;  3DDD A;  5C88 A;  4P4F A;  4PSX A;  5IB9 A;  1VHS A;  3BJ8 A;  1OZP A;  4NJQ A;  4KLW A;  2REE A;  1M4L A;  3LD2 A;  3IJ3 A;  3PFO A;  1YW4 A;  4OC0 A;  1YVK A;  2EK8 A;  2PC1 A;  1R3N A;  4O23 A;  3HLP A;  3SI1 A;  1MJ9 A;  2WYR A;  4R87 A;  4W9Y A;  4A32 A;  4PK3 A;  1K4J A;  1ZLH A;  2I00 A;  3CXS A;  3RYO A;  4KVO E;  4MCR A;  2FIW A;  2Q4Y A;  4MXU A;  4A95 A;  1LAP A;  2WSA A;  4ONU A;  1I12 A;  4ZX9 A;  3KQZ A;  3PBB A;  4UWI A;  2NYQ A;  2QYV A;  2PRB A;  3V7Z A;  4A33 A;  4MCQ A;  4PXD A;  1Y7E A;  4KOY A;  4KUB A;  2BUE A;  2Q43 A;  4HNW B;  3B2Y A;  5K8N A;  1Z5R A;  3NA6 A;  4IAV A;  3FBU A;  4Y49 C;  1Z8L A;  1A2Z A;  4X5K A;  1VHE A;  2ZEM A;  3R9G A;  2V8D A;  1PYT B;  4KOT A;  2AFW A;  1FNO A;  4B5P A;  4RUH A;  5IX3 A;  4K30 A;  3SJG A;  2PJ6 A;  4C2X A;  2RFH A;  4KOU A;  4OC5 A;  4CAW A;  2ZW5 A;  4C2Y A;  2NSM A;  2Q4V A;  3ISZ A;  1BOB A;  3P2H A;  3FED A;  2Z3N A;  3TT2 A;  4NGR A;  4CYP A;  3NH8 A;  2IQ6 A;  4B6Z A;  2REF A;  3HUV A;  2Z3M A;  4FWU A;  1CG2 A;  3FH4 A;  3P2F A;  4PSW A;  4CAF A;  4EVY A;  2R1I A;  2ZEE A;  1CPS A;  1DE4 C;  1YR0 A;  4NSQ A;  5LYD A;  3R96 A;  2CTB A;  1QSR A;  4QVT A;  3VAR A;  3FMC A;  4NEX A;  3FX6 A;  1ARL A;  3NE8 A;  2PJA A;  4U9Z A;  1TKH A;  1HEE A;  2DXQ A;  5G1Z A;  1XEB A;  4MFJ A;  5JQ4 A;  2O28 A;  2C6C A;  3FEE A;  4OAE A;  3H5Z A;  4UIB A;  4MI4 A;  3D68 A;  1YLO A;  1F57 A;  2AFM A;  3BI1 A;  2JBJ A;  1IU8 A;  1YGH A;  4OIW A;  4R7M A;  1LAM A;  1RXT A;  2ZEO A;  4OLL A;  5GCN A;  5D29 A;  4UBR A;  4JLY A;  1I1D A;  4MFP A;  3FIX A;  4XNH C;  3GIU A;  2PJ3 A;  4NGN A;  2CNM A;  4WWV A;  5DS0 A;  2FIA A;  3JRU A;  4U9Y A;  4A38 A;  2OOT A;  4EME A;  3A9L A;  1LOK A;  2J8M A;  4B5O A;  2ZOF A;  2J9A A;  1M4I A;  2KCW A;  3DLJ A;  2QVP A;  2FS5 A;  1XRY A;  1RTQ A;  3ISX A;  3LWU A;  1VGY A;  3PFE A;  4MFQ A;  1PCA A;  2PSW A;  3IWW A;  5LRG A;  3GUX A;  3V8I A;  4F6A A;  4QC6 A;  4FD6 A;  2Q0Y A;  2EO8 A;  1BPN A;  2K5T A;  2QJ8 A;  4OP4 A;  4OC4 A;  4CS0 B;  4ZYQ A;  4IHM A;  2PQ8 A;  4MCP A;  2GIV A;  4OKO A;  2ZEG A;  3WAB A;  5JPH A;  3ZJ0 A;  4RI1 A;  4FAI A;  1ZG7 A;  3D7H A;  3T90 A;  3T9Y A;  3SXO A;  4MHP A;  2Z10 A;  3IO1 A;  3DGV A;  1ZLI A;  2PJC A;  3FXT A;  2V8H A;  3OWC A;  1ELL P;  3I1U A;  3JVN A;  4GXH A;  2PJ4 A;  4NGM A;  3S6K A;  3TO9 A;  4YFJ A;  4P45 A;  4P44 A;  2ZEF A;  2EWB A;  4R3K A;  4M85 A;  1XFO A;  4XPD B;  4ZX8 A;  4B11 A;  4Q36 A;  3KR4 A;  2YGW A;  5K8M A;  4IK2 A;  1XE4 A;  1Y7R A;  4L89 A;  3E0K A;  3G8W A;  4KOR A;  3I9S A;  5EMI A;  3VAT A;  4AG7 A;  1VKC A;  1Z8T A;  1KUV A;  4CYN A;  3SJF A;  4ZBG A;  2WUU A;  4P10 A;  1KWM A;  2HC9 A;  3RAM A;  3TO6 A;  1YRE A;  4MY3 A;  4R6T A;  4YGO A;  5F48 A;  4YU9 A;  2EUI A;  3CXQ A;  3W91 A;  5HVF A;  2AFZ A;  3EXN A;  2C6G A;  3TC8 A;  1IGB A;  2PE3 A;  4MHD A;  2Q7B A;  4MY0 A;  4FD7 A;  1CP6 A;  4UWJ A;  1DTD A;  1QSM A;  4KVX A;  4XPK A;  4UFV A;  1ARM A;  2PVV A;  4UCM A;  3L2N A;  3D8P A;  1GYT A;  4PXE A;  4NF1 A;  4CRY B;  2BCO A;  2YNC A;  4E0A A;  3DNS A;  4UEZ A;  4CGL A;  1AUG A;  4MRI A;  5G21 A;  2PR1 A;  2ZEH A;  2HB6 A;  4HKF A;  3QAY A;  2FSR A;  4NGP A;  2AJ6 A;  1LAN A;  3KQX A;  4U5Y A;  5AGE A;  5DWN A;  2QEC A;  1J4J A;  2R7H A;  2CTC A;  3B3S A;  3DR8 A;  4B13 A;  4EWT A;  2PJB A;  2I3C A;  4KS9 A;  4B5P B;  4CPA A;  1EE3 P;  3H4Q A;  1Y9K A;  1VIX A;  2PJ1 A;  3IIB A;  3SHP A;  1IB1 E;  1NMT A;  4ZY2 A;  3C26 A;  5KTD A;  3K9T A;  1KZF A;  1IYL A;  1X10 A;  3H8E A;  1Y9W A;  3EY5 A;  2G9D A;  1QMU A;  1TIQ A;  5AG7 A;  2VEZ A;  2YND A;  3PP9 A;  4H89 A;  2EK9 A;  3F5B A;  3PRT A;  3D2P A;  3NE7 A;  3JTK A;  2FXF A;  2IL4 A;  1LCP A;  5HXD A;  1LRZ A;  2V77 A;  2Q04 A;  1VHO A;  1Z8X A;  4NFR A;  1UFH A;  2IJZ A;  2CF4 A;  1XIX A;  3H8F A;  2O53 A;  3B8G A;  3S9M A;  3TTH A;  4DNC A;  6CPA A;  3S6G A;  5K8O A;  4NGT A;  4P4D A;  4H2K A;  4ZY0 A;  2I79 A;  1M44 A;  4L8A A;  3MRU A;  3B3W A;  4H6U A;  4KSI A;  1P4N A;  1LFW A;  1QSO A;  2ABZ A;  1QSN A;  1BPM A;  3CXP A;  1XMT A;  3LMS A;  4HNX B;  2Q4Z A;  3EC4 A;  1NSA A;  4UFW A;  4AVB A;  5AG4 A;  2GU2 A;  5LRK A;  1IID A;  4P4I A;  3SJE A;  2BEI A;  2P6E A;  4TWE A;  4R57 A;  5CNP A;  4QUS A;  3T8W A;  1S7L A;  1N71 A;  4P6Y A;  4UA3 A;  2AFO A;  2ZW6 A;  5EC4 A;  5THW A;  1YQE A;  4XPL A;  3ZZI A;  4UEF A;  5ELY A;  4FBE A;  4OAD A;  5E96 A;  1AMP A;  2Z3O A;  2F5I A;  4CRZ B;  3GY9 A;  3I3G A;  3BJ7 A;  2GE3 A;  3QB8 A;  2GLF A;  1SQH A;  4RS2 A;  4ZGY B;  2PJ5 A;  4A39 A;  2DF5 A;  4C7H A;  2JDC A;  4G1P A;  1V0C A;  5IB0 A;  4BBH A;  1X12 A;  5KTC A;  1XJO A;  3K2K A;  2PJ8 A;  4MFL A;  4AVA A;  4B12 A;  3R95 A;  1S60 A;  4R76 A;  3FF3 A;  2AFS A;  3G3S A;  2X7B A;  3KHX A;  3D7G A;  4R9M A;  2B4D A;  3DR6 A;  4EFD A;  5CBM A;  1YX0 A;  3FYN A;  2VI7 A;  5F09 A;  2ATR A;  4A2Z A;  4AVC A;  5JM6 A;  4A30 A;  5I4M A;  4YRH A;  5G20 A;  4CAX A;  3IEH A;  2ZW4 A;  3TX8 A;  1CM0 A;  2FCK A;  1R43 A;  1CX8 A;  4OME A;  3PB6 X;  3QAH A;  2PIZ A;  4BMH A;  1Z9U A;  4F0X A;  1KUY A;  4DJL A;  4LQG A;  3VH9 A;  1F2P A;  3D7F A;  1IYK A;  4XNH B;  1Y0R A;  3B35 A;  2R98 A;  3EO4 A;  4LUA A;  4YWY A;  3GYA A;  2HQY A;  2JDD A;  4CGO A;  3KZW A;  4MHY A;  3TFY A;  2IMO A;  2OZG A;  5G22 A;  4AXV A;  5J1Q A;  3CPA A;  4R8F A;  3FEC A;  3KAS A;  5A27 A;  4MBU A;  3TCV A;  2C6P A;  1Q2Y A;  4LQ6 A;  3V38 A;  2NMT A;  5J8C A;  4KLV A;  4XPD C;  4M6G A;  1KUX A;  2HV2 A;  1CBX A;  4KUA A;  1CJW A;  4DUK A;  3GB0 A;  2Z3K A;  2ZPA A;  1B6B A;  4X2T A;  3JUW A;  1XBU A;  4X8I A;  1S7N A;  2VZZ A;  2XEF A;  3S6F A;  4OC3 A;  3TOB A;  4PV6 A;  4PXC A;  3IGR A;  4ZI6 A;  1U6M A;  2POK A;  2B5G A;  1PUA A;  2HUZ A;  4MJ8 A;  4MCS A;  4M3S A;  1TF9 A;  4B10 A;  1XF8 A;  4F8Z A;  4Q38 A;  4WJB A;  2OZH A;  2XEJ A;  2ANP A;  1BAV A;  1YVO A;  1MK4 A;  2G3T A;  2YNE A;  2Q44 A;  1IOI A;  1FY7 A;  2PRQ A;  2VL1 A;  4JXQ A;  3D66 A;  3NFZ A;  4MMO A;  4MFK A;  1M4G A;  2B3U A;  4M6I A;  2H5M A;  4P4B A;  4F9V A;  4K3N A;  2ZOG A;  3WC7 A;  2PJ7 A;  4E8O A;  3S9N A;  2Z3P A;  4CYQ A;  2DPS A;  2VQY A;  3IFE A; 
#chains in the Genus database with same CATH homology
 2V8V A;  5HVH A;  2PJ2 A;  2GLJ A;  4BD9 A;  4ONW A;  1YW6 A;  3PB4 X;  2OR4 A;  1JQG A;  5CPA A;  4UIA A;  5JH9 A;  1Y0Y A;  4JZ0 A;  3CDX A;  1XMB A;  3PB7 X;  1BLL E;  4Q7A A;  2F7V A;  2AFU A;  3B7I A;  3PBE A;  3B3T A;  4Z65 A;  1CP7 A;  3WC5 A;  5LRJ A;  2BOA A;  2ZED A;  1Z2L A;  4NJR A;  1OBR A;  2ZEP A;  4PPZ A;  3CPX A;  3GLJ A;  3B3C A;  3WC6 A;  5JGF A;  3KL9 A;  1QQ9 A;  1FT7 A;  2PIY A;  4FUU A;  3RZA A;  3QNV A;  5LYF A;  2C1C A;  4P4J A;  1CPX A;  2JEW A;  3SJX A;  3D7D A;  2DEA A;  1H8L A;  1YSJ A;  3S9L A;  4JYW A;  4OID A;  2Q51 A;  4PQA A;  4TNU A;  3H8G A;  2XEI A;  2CIJ A;  4F9U A;  3N5F A;  1ZG9 A;  4MHZ A;  3BXM A;  3B3V A;  4OC2 A;  3PB9 X;  4A37 A;  2BO9 A;  4GM5 A;  4OC1 A;  3KI9 A;  4P4E A;  2JBK A;  4MHN A;  4A94 A;  1IY7 A;  2PJ0 A;  1ZG8 A;  3D67 A;  1YME A;  4ZY1 A;  4NGQ A;  2WZN A;  1F2O A;  5K8P A;  2GRE A;  3MN8 A;  2PJ9 A;  3NH4 A;  3KGQ A;  5LYI A;  1AYE A;  3PEI A;  1HDU A;  2PCU A;  3KR5 A;  3SI0 A;  2O4H A;  3FJU A;  3D4U A;  1TKF A;  3RBU A;  2V8G A;  5LYL A;  4PXB A;  4DYO A;  2AFX A;  3SI2 A;  3IC1 A;  3FVL A;  4UEE A;  1HDQ A;  2ZEL A;  4UF4 A;  2PVW A;  4NGS A;  1TKJ A;  3KHZ A;  5HVG A;  3CT9 A;  7CPA A;  3NH5 A;  2XEG A;  3WT4 A;  1TXR A;  2RB7 A;  1UWY A;  2F8H A;  1Q7L A;  2FVG A;  2ZEN A;  3BHX A;  3PB8 X;  4X3R A;  8CPA A;  3BI0 A;  1TF8 A;  5D8N A;  1ELM P;  4P4F A;  5IB9 A;  4NJQ A;  3PFO A;  1M4L A;  4OC0 A;  3IJ3 A;  3SI1 A;  1YW4 A;  2EK8 A;  4O23 A;  1R3N A;  3HLP A;  2WYR A;  4W9Y A;  1ZLH A;  4MCR A;  4MXU A;  1LAP A;  4ZX9 A;  3KQZ A;  3PBB A;  2NYQ A;  2QYV A;  3V7Z A;  4MCQ A;  4PXD A;  1Y7E A;  2Q43 A;  3B2Y A;  5K8N A;  1Z5R A;  3NA6 A;  4IAV A;  1Z8L A;  1VHE A;  2ZEM A;  2V8D A;  1PYT B;  2AFW A;  1FNO A;  4RUH A;  3SJG A;  2PJ6 A;  2RFH A;  4OC5 A;  2NSM A;  3ISZ A;  3FED A;  4NGR A;  3NH8 A;  2IQ6 A;  4B6Z A;  3HUV A;  4FWU A;  1CG2 A;  3FH4 A;  2ZEE A;  1CPS A;  1DE4 C;  5LYD A;  2CTB A;  3VAR A;  3FMC A;  3FX6 A;  1ARL A;  2PJA A;  1TKH A;  1HEE A;  2C6C A;  3FEE A;  4UIB A;  3D68 A;  1YLO A;  1F57 A;  2AFM A;  3BI1 A;  2JBJ A;  4OIW A;  4R7M A;  1LAM A;  2ZEO A;  5D29 A;  2PJ3 A;  4NGN A;  4WWV A;  4EME A;  5DS0 A;  3JRU A;  4A38 A;  2OOT A;  1LOK A;  2ZOF A;  2J9A A;  3DLJ A;  2QVP A;  1XRY A;  1RTQ A;  3ISX A;  3LWU A;  1VGY A;  3PFE A;  1PCA A;  3IWW A;  5LRG A;  3GUX A;  1BPN A;  2QJ8 A;  4OP4 A;  4OC4 A;  4ZYQ A;  4IHM A;  4MCP A;  4OKO A;  2ZEG A;  3WAB A;  4FAI A;  1ZG7 A;  3D7H A;  4MHP A;  3IO1 A;  3DGV A;  1ZLI A;  2PJC A;  2V8H A;  4NGM A;  1ELL P;  3I1U A;  2PJ4 A;  4P45 A;  4P44 A;  2ZEF A;  2EWB A;  1XFO A;  4ZX8 A;  3KR4 A;  5K8M A;  4IK2 A;  3VAT A;  3SJF A;  4P10 A;  1KWM A;  2HC9 A;  3RAM A;  4R6T A;  4YU9 A;  5HVF A;  2AFZ A;  2C6G A;  3TC8 A;  1IGB A;  2PE3 A;  1CP6 A;  1DTD A;  1ARM A;  2PVV A;  3L2N A;  1GYT A;  4PXE A;  2BCO A;  4UEZ A;  4MRI A;  2ZEH A;  2HB6 A;  4NGP A;  1LAN A;  3KQX A;  2CTC A;  3B3S A;  4EWT A;  2PJB A;  2I3C A;  4CPA A;  1EE3 P;  1VIX A;  2PJ1 A;  3IIB A;  4ZY2 A;  3K9T A;  3H8E A;  2G9D A;  1QMU A;  2EK9 A;  3PRT A;  1LCP A;  5HXD A;  2V77 A;  1VHO A;  4NFR A;  2IJZ A;  3H8F A;  2CF4 A;  2O53 A;  3S9M A;  6CPA A;  5K8O A;  4NGT A;  4P4D A;  4H2K A;  4ZY0 A;  3MRU A;  3B3W A;  4KSI A;  1LFW A;  2ABZ A;  1BPM A;  5CBM A;  3LMS A;  2Q4Z A;  1NSA A;  5LRK A;  2GU2 A;  4P4I A;  3SJE A;  4TWE A;  3T8W A;  4P6Y A;  2AFO A;  5THW A;  4UEF A;  5ELY A;  4FBE A;  1AMP A;  2GLF A;  2PJ5 A;  4A39 A;  4G1P A;  1XJO A;  3K2K A;  2PJ8 A;  4R76 A;  3FF3 A;  2AFS A;  3KHX A;  3D7G A;  4EFD A;  5F09 A;  5JM6 A;  5I4M A;  3IEH A;  3TX8 A;  1R43 A;  1CX8 A;  4OME A;  3PB6 X;  2PIZ A;  4DJL A;  4LQG A;  3VH9 A;  1F2P A;  3D7F A;  1Y0R A;  3B35 A;  4YWY A;  3KZW A;  4MHY A;  2IMO A;  4AXV A;  5J1Q A;  3CPA A;  4R8F A;  3FEC A;  3KAS A;  2C6P A;  3V38 A;  1CBX A;  4DUK A;  3GB0 A;  4X2T A;  1XBU A;  4X8I A;  2XEF A;  4OC3 A;  4PXC A;  4ZI6 A;  2POK A;  4MCS A;  1TF9 A;  4F8Z A;  4WJB A;  2XEJ A;  2ANP A;  1BAV A;  2PRQ A;  2VL1 A;  3D66 A;  3NFZ A;  4MMO A;  4P4B A;  4F9V A;  3S9N A;  4K3N A;  2ZOG A;  3WC7 A;  2PJ7 A;  3IFE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...