2NYQA

Structure of vibrio proteolyticus aminopeptidase with a bound trp fragment of dlwcf
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
291
structure length
291
Chain Sequence
MPPITQQATVTAWLPQVDASQITGTISSLESFTNRFYTTTSGAQASDWIASEWQALSASLPNASVKQVSHSGYNQKSVVMTITGSEAPDEWIVIGGHLDSTIGSHTNEQSVAPGADDDASGIAAVTEVIRVLSENNFQPKRSIAFMAYAAEEVGLRGSQDLANQYKSEGKNVVSALQLDMTNYKGSAQDVVFITDYTDSNFTQYLTQLMDEYLPSLTYGFDTCGYACSDHASWHNAGYPAAMPFESKFNDYNPRIHTTQDTLANSDPTGSHAKKFTQLGLAYAIEMGSATG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Aminopeptidase
publication title Substrate recognition by the leucine aminopeptidase from Vibrio proteolyticus
rcsb
total genus 111
structure length 291
sequence length 291
ec nomenclature ec 3.4.11.10: Bacterial leucyl aminopeptidase.
pdb deposition date 2006-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 2nyqA00
1Z2LA 2F7VA 1JQGA 2XEGA 8CPAA 4PXEA 4TNUA 3FF3A 2O4HA 4UF4A 3D68A 3KR5A 3KASA 4EFDA 5LYDA 2PCUA 3V38A 2PJ1A 4OIDA 2XEFA 2XEIA 3V7ZA 3SI0A 3WC6A 1VHOA 1AYEA 4G1PA 2CF4A 1F2OA 3K9TA 3PEIA 1CX8A 3H8EA 3I1UA 1BAVA 2QVPA 3B35A 2FVGA 3SJFA 1BPMA 1CPSA 1CG2A 1ELLP 1YMEA 4ZY2A 2AFUA 3S9LA 4NGMA 2DEAA 3PB9X 3KGQA 4K3NA 3BI1A 1UWYA 2PJ2A 3FH4A 3LWUA 4UEZA 1YLOA 3SI1A 3D7HA 1PYTB 2PJBA 4PQAA 3B2YA 7CPAA 3WC7A 4MCQA 1ARLA 2ZEOA 3VARA 3BXMA 2AFOA 3LMSA 1HDQA 2CTBA 1CPXA 3RBUA 4OIWA 3RZAA 4IAVA 2PJCA 4W9YA 3NFZA 2AFWA 4P10A 3IFEA 2BO9A 3JRUA 4PXDA 5K8PA 3B7IA 3GUXA 2ZEEA 3IEHA 3FJUA 1YSJA 5I4MA 1IGBA 5DS0A 4PXCA 4A38A 2PIZA 5LYFA 1TXRA 1TKJA 1ZLIA 1DE4C 1XRYA 1Y7EA 2RFHA 3TX8A 3CPXA 4P4JA 2XEJA 3ISXA 1R43A 3KR4A 3B3TA 2V77A 1QMUA 1LOKA 4Z65A 1Y0RA 3SJXA 3H8GA 5LRKA 1CP6A 2OR4A 3H8FA 2EWBA 3GB0A 2ZEFA 3GLJA 1F2PA 2PJ8A 3KQZA 3WT4A 2NYQA 4DYOA 3DLJA 2Q4ZA 4EWTA 3ISZA 1BLLE 3FX6A 3K2KA 4TWEA 5F09A 4OC5A 2C6PA 2BOAA 1ARMA 3FECA 4UIBA 2V8HA 4NGNA 4OC3A 2HC9A 4NGRA 2OOTA 1TKHA 2CIJA 5IB9A 4LQGA 5HXDA 4MXUA 1ELMP 1GYTA 4DUKA 2GU2A 3DGVA 4OKOA 3IWWA 5CBMA 3IJ3A 2WYRA 1TF9A 3PFEA 4MCSA 2PRQA 4BD9A 2JBJA 3SI2A 1M4LA 4R8FA 4FBEA 2EK9A 1VIXA 4F9VA 3D4UA 1PCAA 2AFZA 2AFSA 2PJ3A 5JGFA 4P4IA 4PXBA 3D7GA 4AXVA 4OP4A 1XFOA 2JBKA 4NJRA 4OC0A 4ZYQA 4NGPA 4H2KA 2IJZA 3FEDA 2ZOFA 3IIBA 1LFWA 1QQ9A 4X3RA 5HVGA 3NH8A 4R7MA 3KHZA 2JEWA 1XBUA 4B6ZA 4IHMA 4P6YA 3NH5A 2ZENA 3D67A 4OMEA 2WZNA 4UIAA 4A39A 1HEEA 3HLPA 1LAPA 5K8OA 3S9MA 4NFRA 5J1QA 1YW4A 1CP7A 2G9DA 3IO1A 5HVHA 3PFOA 3L2NA 4MHYA 3BI0A 2ANPA 2V8VA 2C1CA 3VH9A 4KSIA 1TF8A 2Q51A 5HVFA 5D8NA 4FWUA 3KI9A 4A94A 1Y0YA 1ZLHA 5LYLA 2GLFA 3S9NA 3PB8X 4JYWA 2PJ9A 2ZELA 3PBEA 1BPNA 1XMBA 4PPZA 2PJAA 5CPAA 3TC8A 4O23A 4MRIA 2PIYA 2V8GA 2QYVA 4EMEA 1NSAA 4P4FA 1VGYA 4ZX8A 3HUVA 3PB4X 2F8HA 3NH4A 2ZOGA 4X2TA 2C6GA 4WWVA 4P4BA 2ZEMA 4FUUA 4ZY0A 4MHPA 2BCOA 5JH9A 2ABZA 4DJLA 4YWYA 3KHXA 3B3VA 3QNVA 1Z8LA 4MHZA 1LAMA 1AMPA 2IMOA 3D7DA 4OC4A 4NGSA 1DTDA 2J9AA 2PJ0A 6CPAA 3SJEA 3CPAA 3MRUA 1ZG9A 2GREA 3PB6X 4FAIA 2AFXA 3VATA 4CPAA 1ZG8A 3SJGA 2PVVA 1OBRA 2EK8A 3D7FA 1IY7A 3FEEA 2HB6A 1HDUA 2NSMA 1CBXA 3WC5A 2PJ6A 3KL9A 4R76A 1R3NA 1F57A 4ZX9A 4MCRA 2CTCA 2Q43A 2PE3A 2V8DA 2AFMA 1ZG7A 4ONWA 4NGTA 4GM5A 2GLJA 3NA6A 1LCPA 3FMCA 1Z5RA 2ZEDA 4NJQA 4X8IA 1Q7LA 3D66A 4P4EA 4UEFA 3CT9A 1FNOA 5D29A 3WABA 3IC1A 1RTQA 2VL1A 4RUHA 2I3CA 1YW6A 3B3WA 4MCPA 3PB7X 4P44A 1FT7A 4R6TA 2ZEHA 5LRGA 5THWA 4YU9A 2PJ5A 3PRTA 4NGQA 3N5FA 3MN8A 4UEEA 1KWMA 3RAMA 1VHEA 2PJ4A 3FVLA 1TKFA 1LANA 5LRJA 1XJOA 2PJ7A 5K8MA 2ZEPA 4IK2A 2QJ8A 5ELYA 4ZY1A 3CDXA 1H8LA 3B3CA 4F8ZA 2IQ6A 4OC2A 4Q7AA 4MHNA 2RB7A 4ZI6A 2POKA 3KQXA 4JZ0A 4A37A 5LYIA 3KZWA 1EE3P 4F9UA 3BHXA 4P45A 2ZEGA 3T8WA 4OC1A 5K8NA 3PBBA 2O53A 4MMOA 2PVWA 4P4DA 5JM6A 3B3SA 2C6CA 4WJBA
chains in the Genus database with same CATH superfamily
1Z2LA 5AG4A 3R9GA 2F7VA 3G3SA 1JQGA 2XEGA 3VWEA 8CPAA 4QBJA 4KOTA 1Z8TA 2F5IA 4PXEA 2Q7SA 4TNUA 4XNHB 3S6HA 3FF3A 2O4HA 4UF4A 3TO7A 5KTDA 3D68A 3KR5A 3KASA 4QUSA 1GHEA 5LYDA 4EFDA 4CAWA 4JXQA 4KLVA 2PCUA 2ATRA 3V38A 1NSLA 3IU2A 4MBUA 1FY7A 2D4OA 2PJ1A 2Z3MA 4BBHA 4OIDA 4MFZA 4U9YA 2ZPAA 1TIQA 2AE6A 1NE9A 2I79A 3RNZA 3B8GA 5J8FA 2XEFA 3FIXA 2B3VA 2XEIA 1CM0A 4KVXA 3SI0A 3V7ZA 4AG9A 2FE7A 3T90A 3WC6A 4UCMA 1VHOA 1QSTA 4JXRA 1AYEA 4G1PA 2J8NA 3TTHA 2CF4A 5C82A 1F2OA 3K9TA 2BEIA 5G1ZA 3PEIA 1CX8A 3F0AA 1B6BA 3H8EA 4MJ8A 3I1UA 4M3SA 1IIDA 1BAVA 4UCNA 4CRZB 3V8IA 4CYQA 2QVPA 1I12A 2I00A 1S3ZA 3B35A 2FVGA 4B14A 3D8PA 3SJFA 1BPMA 1CPSA 1CG2A 1ELLP 1M4DA 2VBQA 1YMEA 2CNSA 2GE3A 3CZXA 4ZY2A 3UY5A 1Q2DA 1MJBA 1XE4A 2AFUA 4HNYB 3S9LA 4NGMA 5ISVA 3TO6A 3D3SA 3P2HA 4KVOE 5C88A 5I0CA 2DEAA 3MGDA 1A2ZA 4M6HA 3PB9X 4GS4A 3BLNA 4R87A 5G21A 3KGQA 3VWDA 1L0CA 1CJWA 1Q2CA 4FD7A 2EBJA 2BUEA 4JLYA 4C2YA 5DWNA 4UA3A 1YREA 4UFXA 1Y7RA 4K3NA 3BI1A 1MJ9A 1UWYA 1AUGA 2Z3NA 4C68A 2PJ2A 3CXQA 4ZBGA 4A32A 3FH4A 2CNTA 3LWUA 4UEZA 1YLOA 2P0WA 1PU9A 1WWZA 3D7HA 3SI1A 1PYTB 1X12A 2PJBA 4PQAA 2QMLA 3B2YA 1OZPA 3ZZIA 1S7LA 1IYKA 7CPAA 4X5KA 3WC7A 4MCQA 4CYNA 2O28A 1ARLA 2PDOA 2NMTA 2ZEOA 3VARA 3BXMA 3W91A 4MHDA 2HV2A 2AFOA 3LMSA 1HDQA 2CTBA 1CPXA 3IWEA 3RBUA 2BL1A 4OIWA 4IAVA 4UFVA 4QC6A 3RZAA 2PJCA 4W9YA 4B12A 4RS2A 2REFA 4H89A 2P6FA 3F5BA 4XPDC 3FBUA 2J8RA 3NFZA 2AFWA 5HMNA 2DF5A 2PC1A 2OU2A 1KUVA 1Z9UA 4P10A 3C26A 4M85A 3IFEA 2BO9A 1S7NA 3JRUA 4PXDA 5K8PA 4UFWA 3B7IA 3TE4A 3GUXA 2ZEEA 3EC4A 2X7BA 2RC4A 1NMTA 3FB3A 2CY2A 1YSJA 2Q0YA 3FJUA 3IEHA 1IGBA 4IF5A 5I4MA 5DS0A 4PXCA 4A38A 2PIZA 1YK3A 5CNPA 2JEVA 2Y0MA 3H5ZA 5LYFA 1TXRA 1TKJA 1ZLIA 1DE4C 2OZGA 1XRYA 1Y7EA 2OH1A 3FXTA 1Y9KA 1YX0A 2JDCA 4KOWA 4AB7A 2RFHA 3I9SA 3TX8A 3CPXA 1XF8A 4YFJA 3W6XA 4NSQA 4OLLA 4P4JA 2XEJA 4B13A 2OB0A 3ISXA 3PZJA 1R43A 3KR4A 3T9YA 1YVKA 3B3TA 2V77A 1QMUA 1BOBA 1LOKA 2YGWA 4FD6A 4Z65A 1Y0RA 4XPDB 3SJXA 4MY3A 4A95A 2PR1A 3H8GA 5LRKA 1CP6A 2OR4A 2PQ8A 3H8FA 3NE7A 3TOBA 2B4DB 2EWBA 3GB0A 2ZEFA 3GLJA 4MI4A 4C2ZA 1F2PA 2PJ8A 3KQZA 4KZTA 3EY5A 4PV6A 2NYQA 4LX9A 3WT4A 4DYOA 3DLJA 4F0YA 1IYLA 2Q4ZA 2OZUA 1YVOA 4KOYA 4EWTA 3ISZA 2FIWA 2FT0A 3IU1A 4XPLA 1BLLE 4UCPA 3FX6A 5KTAA 3KKWA 3K2KA 4TWEA 5EC4A 5F09A 4OC5A 4JJXA 2C6PA 2BOAA 2ODFA 4AVBA 3H4QA 1ARMA 3JUWA 1IICA 3FECA 1XEBA 2AJ6A 2ARHA 4UIBA 2D4PA 1RXTA 2REEA 2V8HA 4OADA 4NGNA 4OC3A 2HC9A 5IX3A 1KUXA 4GXHA 4NGRA 1IOIA 2WPWA 2OOTA 4CAVA 4EVYA 3G8WA 5EMIA 1TKHA 2CIJA 5IB9A 3OWCA 1IU8A 2HUZA 4LQGA 1BO4A 4MXUA 5HXDA 1ELMP 1GYTA 3D2PA 4DUKA 2GU2A 3DGVA 4F6AA 3PP9A 3I3GA 4B5OA 3W6SA 4OKOA 3IWWA 2FCKA 4MY0A 5CBMA 4MFJA 4CGOA 4KSAA 1ZO0A 3IJ3A 2WYRA 4M6IA 1TF9A 3PFEA 4MCSA 2PRQA 4BD9A 2JBJA 2B5GB 4FD4A 4L89A 3SI2A 3R96A 1M4LA 3GKRA 2Q44A 4LUAA 3P2FA 2ZXVA 4HNXB 4R8FA 4FBEA 2EK9A 5G20A 1VIXA 1R57A 4L8AA 4JD6A 2A4NA 3D4UA 1PCAA 2AFZA 2AFSA 4F9VA 2PJ3A 5JGFA 4P4IA 4PXBA 3D7GA 4AXVA 4OP4A 1XFOA 2JLMA 1MJAA 2JBKA 3CXSA 4NJRA 4QB9A 1M44A 3GY9A 4KOSA 4OC0A 1WK4A 4NGPA 4ZYQA 1MK4A 4H2KA 4Q38A 4AG7A 2IJZA 3FEDA 4JWPA 4M6GA 2ZOFA 3IIBA 1LFWA 5AG7A 3R1KA 5IB0A 1S7KA 1QQ9A 4CAFA 3JTKA 4KOVA 4NXYA 2OZHA 4X3RA 5HVGA 2P6EA 1RO5A 2PRBA 1UFHA 2Z0ZA 3NH8A 4R7MA 4KOUA 3KHZA 4NEXA 3TT2A 2G3TA 3IGRA 4RN7A 2JEWA 1XBUA 3QAYA 4B6ZA 2ZW6A 4IHMA 4P6YA 4CYPA 3NH5A 2ZENA 3D67A 1VKCA 2WZNA 4OMEA 2VEZA 5AG6A 5JPHA 3CXPA 4UIAA 4MFLA 4A39A 1HEEA 3DR6A 4DNCA 4KVME 3HLPA 1LAPA 4U5YA 5AGEA 4E0AA 2HQYA 1QSNA 3S9MA 5K8OA 4BMHA 4NFRA 5J1QA 1YW4A 2B4DA 2DPSA 1CP7A 2G9DA 3IO1A 2B3UA 3DSBA 5HVHA 1QSMA 3PFOA 2Q04A 3L2NA 4MHYA 3GIUA 2EVNA 3BI0A 2FXFA 5HH1A 2ANPA 2V8VA 3NE8A 1LRZA 2C1CA 4FD5A 3VH9A 3R9FA 4ONUA 3S6FA 2BSWA 1TF8A 4KSIA 4NF1A 4CRYB 2Q51A 1IOFA 4U9ZA 5HVFA 1Z4EA 4KSFA 5D8NA 4E8OA 5AG5A 4FWUA 3KI9A 2QIRA 3IWGA 4A94A 1XIXA 1Y0YA 2G0BA 1ZLHA 5LYLA 2GLFA 3S9NA 3PB8X 4J3GA 4JYWA 4Y49C 1ON0A 2PJ9A 4YRHA 2ZELA 3PBEA 1BPNA 1XMBA 5H84A 4PPZA 2PJAA 2ZW4A 4IUSA 4XPKA 2EO8A 5CPAA 1M1DA 3TC8A 3QAHA 4BINA 4O23A 4MRIA 2PIYA 2V8GA 2QYVA 4A2ZA 4CGMA 1NSAA 1VHSA 4EMEA 4P4FA 5BWAB 4PK2A 1J4JA 1P4NA 1VGYA 2YNDA 4ZX8A 3A9LA 4I49A 4K30A 3HUVA 3PB4X 2F8HA 1S5KA 2ZOGA 3NH4A 4CGLA 2B5GA 4X2TA 2C6GA 4WWVA 1YLEA 3TOAA 3LODA 4UWJA 4P4BA 1V0CA 2ZEMA 2PSWA 2VI7A 1I1DA 3R95A 4FUUA 1KUYA 1M4GA 4ZY0A 2VQYA 4LQ6A 4A31A 4MHPA 2BCOA 2DXQA 3QB8A 2ABZA 5JH9A 5GCNA 4YGOA 2P6GA 3D2MA 4ORFA 4C7HA 1S7FA 3S6KA 4DJLA 4E2AA 4YWYA 4AVAA 4H6ZA 1XOVA 3KHXA 3B3VA 3QNVA 3RO0A 1Z8LA 4Y49B 4R3LA 4MHZA 2FIAA 1LAMA 1AMPA 2IMOA 3D7DA 4MFPA 4OC4A 4NGSA 4MFQA 2VZZA 1DTDA 1S60A 1YGHA 1Z4RA 2J9AA 2PJ0A 2Q4VA 6CPAA 3SJEA 3CPAA 4PSWA 4B11A 5G22A 2G3AA 4R3KA 4II9A 1XMTA 3MRUA 1ZG9A 2IL4A 2GREA 2VXKA 4KS9A 3SXNA 4PK3A 4PSXA 3FRMA 3PB6X 4FAIA 2AFXA 4B5PB 3VATA 2ZW5A 1Z8WA 2Q7BA 4CPAA 4CS0B 1ZG8A 2WUUA 3SJGA 4CYOA 2PVVA 1OBRA 2CXAA 2EK8A 1IY7A 3D7FA 2HB6A 1HDUA 3FEEA 3LACA 2NSMA 1CBXA 3WC5A 2PJ6A 1QSRA 3BJ7A 3KL9A 1R3NA 4R76A 2Z3PA 2FS5A 2PR8A 4ZGYB 1F57A 5F48A 1KZFA 4ZX9A 2GANA 1B87A 2CTCA 4MCRA 4KORA 2Q43A 2PE3A 1YR0A 2V8DA 2Z11A 2AFMA 1ZG7A 4ONWA 4NGTA 3JVNA 5A28A 4GM5A 5FVJA 3SHPA 5E96A 4KUBA 2GLJA 1QSOA 3NA6A 3F8KA 2GIVA 3EFAA 1LCPA 5IV0A 4UWIA 3FMCA 2C27A 3K9UA 3PGPA 1IB1E 5J8CA 1Z5RA 2ZEDA 2B58A 4NJQA 4X8IA 1N71A 4CGNA 3N7ZA 1Q7LA 3D66A 4P4EA 5EBVA 3LD2A 4OAEA 3DR8A 3FNCA 4UEFA 5DWMA 3E0KA 4R9MA 2WPXA 5F49A 3CT9A 1FNOA 1K4JA 4AVCA 1YQEA 5KTCA 5D29A 3WABA 3IC1A 4B10A 4R57A 4F0XA 1RTQA 1U6MA 2Z3OA 2VL1A 4RUHA 2I3CA 4H6UA 1YW6A 2Z3LA 1PUAA 3B3WA 4HKFA 3PB7X 4MCPA 2J8MA 3GYAA 3ZJ0A 1JWQA 3BJ8A 4P44A 4C2XA 1FT7A 2WSAA 4R6TA 3TCVA 2ZEHA 5LRGA 2CNMA 5THWA 5JQ4A 4YU9A 1M4IA 4CGPA 2PJ5A 3PRTA 4NGQA 2R98A 3N5FA 2B4BA 3MN8A 4A30A 4UEEA 1KWMA 2FL4A 4NCZA 2VZYA 4MFKA 3RAMA 1VHEA 2PJ4A 3FVLA 4HPSA 1TKFA 4A33A 2QECA 1LANA 2R1IA 1I21A 1Z8XA 3WR7A 4C7IA 3RYOA 3S6GA 2FSRA 5LRJA 1XJOA 4QVTA 5F46A 2PJ7A 4RI1A 1P0HA 1Y9WA 5K8MA 4KOXA 2KCWA 2ZEPA 4IK2A 5F47A 2QJ8A 5ELYA 2JDDA 4ZY1A 3CDXA 2K5TA 1Q2YA 2YNEA 1H8LA 3EO4A 3B3CA 4XNHC 4UBRA 2R7HA 2Z3KA 3TO9A 2IQ6A 2YNCA 4OC2A 4B5PA 4F8ZA 4KLWA 4Q7AA 2H5MA 4MHNA 2Q4YA 2RB7A 3R9EA 3DNSA 3EXNA 1SQHA 3FYNA 2Z10A 2POKA 1X10A 4CAEA 3KQXA 4JZ0A 4A37A 4ZI6A 5LYIA 3KZWA 1EE3P 2YNCC 3SXOA 4CAXA 4F9UA 5A27A 3BHXA 4P45A 2ZEGA 3T8WA 2ZW7A 4KUAA 3TFYA 5H86A 4OC1A 3DDDA 5K8NA 3PBBA 4Q36A 2O53A 2DPTA 4MMOA 2PVWA 4P4DA 5JM6A 2GFQA 2EUIA 3B3SA 4HNWB 2R8VA 2C6CA 4WJBA
chains in the Genus database with same CATH topology
1Z2LA 2F7VA 1JQGA 2XEGA 8CPAA 4PXEA 4TNUA 3FF3A 2O4HA 4UF4A 3D68A 3KR5A 3KASA 4EFDA 5LYDA 2PCUA 3V38A 2PJ1A 4OIDA 2XEFA 2XEIA 3V7ZA 3SI0A 3WC6A 1VHOA 1AYEA 4G1PA 2CF4A 1F2OA 3K9TA 3PEIA 1CX8A 3H8EA 3I1UA 1BAVA 2QVPA 3B35A 2FVGA 3SJFA 1BPMA 1CPSA 1CG2A 1ELLP 1YMEA 4ZY2A 2AFUA 3S9LA 4NGMA 2DEAA 3PB9X 3KGQA 4K3NA 3BI1A 1UWYA 2PJ2A 3FH4A 3LWUA 4UEZA 1YLOA 3SI1A 3D7HA 1PYTB 2PJBA 4PQAA 3B2YA 7CPAA 3WC7A 4MCQA 1ARLA 2ZEOA 3VARA 3BXMA 2AFOA 3LMSA 1HDQA 2CTBA 1CPXA 3RBUA 4OIWA 3RZAA 4IAVA 2PJCA 4W9YA 3NFZA 2AFWA 4P10A 3IFEA 2BO9A 3JRUA 4PXDA 5K8PA 3B7IA 3GUXA 2ZEEA 3IEHA 3FJUA 1YSJA 5I4MA 1IGBA 5DS0A 4PXCA 4A38A 2PIZA 5LYFA 1TXRA 1TKJA 1ZLIA 1DE4C 1XRYA 1Y7EA 2RFHA 3TX8A 3CPXA 4P4JA 2XEJA 3ISXA 1R43A 3KR4A 3B3TA 2V77A 1QMUA 1LOKA 4Z65A 1Y0RA 3SJXA 3H8GA 5LRKA 1CP6A 2OR4A 3H8FA 2EWBA 3GB0A 2ZEFA 3GLJA 1F2PA 2PJ8A 3KQZA 3WT4A 2NYQA 4DYOA 3DLJA 2Q4ZA 4EWTA 3ISZA 1BLLE 3FX6A 3K2KA 4TWEA 5F09A 4OC5A 2C6PA 2BOAA 1ARMA 3FECA 4UIBA 2V8HA 4NGNA 4OC3A 2HC9A 4NGRA 2OOTA 1TKHA 2CIJA 5IB9A 4LQGA 5HXDA 4MXUA 1ELMP 1GYTA 4DUKA 2GU2A 3DGVA 4OKOA 3IWWA 5CBMA 3IJ3A 2WYRA 1TF9A 3PFEA 4MCSA 2PRQA 4BD9A 2JBJA 3SI2A 1M4LA 4R8FA 4FBEA 2EK9A 1VIXA 4F9VA 3D4UA 1PCAA 2AFZA 2AFSA 2PJ3A 5JGFA 4P4IA 4PXBA 3D7GA 4AXVA 4OP4A 1XFOA 2JBKA 4NJRA 4OC0A 4ZYQA 4NGPA 4H2KA 2IJZA 3FEDA 2ZOFA 3IIBA 1LFWA 1QQ9A 4X3RA 5HVGA 3NH8A 4R7MA 3KHZA 2JEWA 1XBUA 4B6ZA 4IHMA 4P6YA 3NH5A 2ZENA 3D67A 4OMEA 2WZNA 4UIAA 4A39A 1HEEA 3HLPA 1LAPA 5K8OA 3S9MA 4NFRA 5J1QA 1YW4A 1CP7A 2G9DA 3IO1A 5HVHA 3PFOA 3L2NA 4MHYA 3BI0A 2ANPA 2V8VA 2C1CA 3VH9A 4KSIA 1TF8A 2Q51A 5HVFA 5D8NA 4FWUA 3KI9A 4A94A 1Y0YA 1ZLHA 5LYLA 2GLFA 3S9NA 3PB8X 4JYWA 2PJ9A 2ZELA 3PBEA 1BPNA 1XMBA 4PPZA 2PJAA 5CPAA 3TC8A 4O23A 4MRIA 2PIYA 2V8GA 2QYVA 4EMEA 1NSAA 4P4FA 1VGYA 4ZX8A 3HUVA 3PB4X 2F8HA 3NH4A 2ZOGA 4X2TA 2C6GA 4WWVA 4P4BA 2ZEMA 4FUUA 4ZY0A 4MHPA 2BCOA 5JH9A 2ABZA 4DJLA 4YWYA 3KHXA 3B3VA 3QNVA 1Z8LA 4MHZA 1LAMA 1AMPA 2IMOA 3D7DA 4OC4A 4NGSA 1DTDA 2J9AA 2PJ0A 6CPAA 3SJEA 3CPAA 3MRUA 1ZG9A 2GREA 3PB6X 4FAIA 2AFXA 3VATA 4CPAA 1ZG8A 3SJGA 2PVVA 1OBRA 2EK8A 3D7FA 1IY7A 3FEEA 2HB6A 1HDUA 2NSMA 1CBXA 3WC5A 2PJ6A 3KL9A 4R76A 1R3NA 1F57A 4ZX9A 4MCRA 2CTCA 2Q43A 2PE3A 2V8DA 2AFMA 1ZG7A 4ONWA 4NGTA 4GM5A 2GLJA 3NA6A 1LCPA 3FMCA 1Z5RA 2ZEDA 4NJQA 4X8IA 1Q7LA 3D66A 4P4EA 4UEFA 3CT9A 1FNOA 5D29A 3WABA 3IC1A 1RTQA 2VL1A 4RUHA 2I3CA 1YW6A 3B3WA 4MCPA 3PB7X 4P44A 1FT7A 4R6TA 2ZEHA 5LRGA 5THWA 4YU9A 2PJ5A 3PRTA 4NGQA 3N5FA 3MN8A 4UEEA 1KWMA 3RAMA 1VHEA 2PJ4A 3FVLA 1TKFA 1LANA 5LRJA 1XJOA 2PJ7A 5K8MA 2ZEPA 4IK2A 2QJ8A 5ELYA 4ZY1A 3CDXA 1H8LA 3B3CA 4F8ZA 2IQ6A 4OC2A 4Q7AA 4MHNA 2RB7A 4ZI6A 2POKA 3KQXA 4JZ0A 4A37A 5LYIA 3KZWA 1EE3P 4F9UA 3BHXA 4P45A 2ZEGA 3T8WA 4OC1A 5K8NA 3PBBA 2O53A 4MMOA 2PVWA 4P4DA 5JM6A 3B3SA 2C6CA 4WJBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Z2L A;  2F7V A;  1JQG A;  2XEG A;  8CPA A;  4PXE A;  4TNU A;  3FF3 A;  2O4H A;  4UF4 A;  3D68 A;  3KR5 A;  3KAS A;  4EFD A;  5LYD A;  2PCU A;  3V38 A;  2PJ1 A;  4OID A;  2XEF A;  2XEI A;  3V7Z A;  3SI0 A;  3WC6 A;  1VHO A;  1AYE A;  4G1P A;  2CF4 A;  1F2O A;  3K9T A;  3PEI A;  1CX8 A;  3H8E A;  3I1U A;  1BAV A;  2QVP A;  3B35 A;  2FVG A;  3SJF A;  1BPM A;  1CPS A;  1CG2 A;  1ELL P;  1YME A;  4ZY2 A;  2AFU A;  3S9L A;  4NGM A;  2DEA A;  3PB9 X;  3KGQ A;  4K3N A;  3BI1 A;  1UWY A;  2PJ2 A;  3FH4 A;  3LWU A;  4UEZ A;  1YLO A;  3SI1 A;  3D7H A;  1PYT B;  2PJB A;  4PQA A;  3B2Y A;  7CPA A;  3WC7 A;  4MCQ A;  1ARL A;  2ZEO A;  3VAR A;  3BXM A;  2AFO A;  3LMS A;  1HDQ A;  2CTB A;  1CPX A;  3RBU A;  4OIW A;  3RZA A;  4IAV A;  2PJC A;  4W9Y A;  3NFZ A;  2AFW A;  4P10 A;  3IFE A;  2BO9 A;  3JRU A;  4PXD A;  5K8P A;  3B7I A;  3GUX A;  2ZEE A;  3IEH A;  3FJU A;  1YSJ A;  5I4M A;  1IGB A;  5DS0 A;  4PXC A;  4A38 A;  2PIZ A;  5LYF A;  1TXR A;  1TKJ A;  1ZLI A;  1DE4 C;  1XRY A;  1Y7E A;  2RFH A;  3TX8 A;  3CPX A;  4P4J A;  2XEJ A;  3ISX A;  1R43 A;  3KR4 A;  3B3T A;  2V77 A;  1QMU A;  1LOK A;  4Z65 A;  1Y0R A;  3SJX A;  3H8G A;  5LRK A;  1CP6 A;  2OR4 A;  3H8F A;  2EWB A;  3GB0 A;  2ZEF A;  3GLJ A;  1F2P A;  2PJ8 A;  3KQZ A;  3WT4 A;  2NYQ A;  4DYO A;  3DLJ A;  2Q4Z A;  4EWT A;  3ISZ A;  1BLL E;  3FX6 A;  3K2K A;  4TWE A;  5F09 A;  4OC5 A;  2C6P A;  2BOA A;  1ARM A;  3FEC A;  4UIB A;  2V8H A;  4NGN A;  4OC3 A;  2HC9 A;  4NGR A;  2OOT A;  1TKH A;  2CIJ A;  5IB9 A;  4LQG A;  5HXD A;  4MXU A;  1ELM P;  1GYT A;  4DUK A;  2GU2 A;  3DGV A;  4OKO A;  3IWW A;  5CBM A;  3IJ3 A;  2WYR A;  1TF9 A;  3PFE A;  4MCS A;  2PRQ A;  4BD9 A;  2JBJ A;  3SI2 A;  1M4L A;  4R8F A;  4FBE A;  2EK9 A;  1VIX A;  4F9V A;  3D4U A;  1PCA A;  2AFZ A;  2AFS A;  2PJ3 A;  5JGF A;  4P4I A;  4PXB A;  3D7G A;  4AXV A;  4OP4 A;  1XFO A;  2JBK A;  4NJR A;  4OC0 A;  4ZYQ A;  4NGP A;  4H2K A;  2IJZ A;  3FED A;  2ZOF A;  3IIB A;  1LFW A;  1QQ9 A;  4X3R A;  5HVG A;  3NH8 A;  4R7M A;  3KHZ A;  2JEW A;  1XBU A;  4B6Z A;  4IHM A;  4P6Y A;  3NH5 A;  2ZEN A;  3D67 A;  4OME A;  2WZN A;  4UIA A;  4A39 A;  1HEE A;  3HLP A;  1LAP A;  5K8O A;  3S9M A;  4NFR A;  5J1Q A;  1YW4 A;  1CP7 A;  2G9D A;  3IO1 A;  5HVH A;  3PFO A;  3L2N A;  4MHY A;  3BI0 A;  2ANP A;  2V8V A;  2C1C A;  3VH9 A;  4KSI A;  1TF8 A;  2Q51 A;  5HVF A;  5D8N A;  4FWU A;  3KI9 A;  4A94 A;  1Y0Y A;  1ZLH A;  5LYL A;  2GLF A;  3S9N A;  3PB8 X;  4JYW A;  2PJ9 A;  2ZEL A;  3PBE A;  1BPN A;  1XMB A;  4PPZ A;  2PJA A;  5CPA A;  3TC8 A;  4O23 A;  4MRI A;  2PIY A;  2V8G A;  2QYV A;  4EME A;  1NSA A;  4P4F A;  1VGY A;  4ZX8 A;  3HUV A;  3PB4 X;  2F8H A;  3NH4 A;  2ZOG A;  4X2T A;  2C6G A;  4WWV A;  4P4B A;  2ZEM A;  4FUU A;  4ZY0 A;  4MHP A;  2BCO A;  5JH9 A;  2ABZ A;  4DJL A;  4YWY A;  3KHX A;  3B3V A;  3QNV A;  1Z8L A;  4MHZ A;  1LAM A;  1AMP A;  2IMO A;  3D7D A;  4OC4 A;  4NGS A;  1DTD A;  2J9A A;  2PJ0 A;  6CPA A;  3SJE A;  3CPA A;  3MRU A;  1ZG9 A;  2GRE A;  3PB6 X;  4FAI A;  2AFX A;  3VAT A;  4CPA A;  1ZG8 A;  3SJG A;  2PVV A;  1OBR A;  2EK8 A;  3D7F A;  1IY7 A;  3FEE A;  2HB6 A;  1HDU A;  2NSM A;  1CBX A;  3WC5 A;  2PJ6 A;  3KL9 A;  4R76 A;  1R3N A;  1F57 A;  4ZX9 A;  4MCR A;  2CTC A;  2Q43 A;  2PE3 A;  2V8D A;  2AFM A;  1ZG7 A;  4ONW A;  4NGT A;  4GM5 A;  2GLJ A;  3NA6 A;  1LCP A;  3FMC A;  1Z5R A;  2ZED A;  4NJQ A;  4X8I A;  1Q7L A;  3D66 A;  4P4E A;  4UEF A;  3CT9 A;  1FNO A;  5D29 A;  3WAB A;  3IC1 A;  1RTQ A;  2VL1 A;  4RUH A;  2I3C A;  1YW6 A;  3B3W A;  4MCP A;  3PB7 X;  4P44 A;  1FT7 A;  4R6T A;  2ZEH A;  5LRG A;  5THW A;  4YU9 A;  2PJ5 A;  3PRT A;  4NGQ A;  3N5F A;  3MN8 A;  4UEE A;  1KWM A;  3RAM A;  1VHE A;  2PJ4 A;  3FVL A;  1TKF A;  1LAN A;  5LRJ A;  1XJO A;  2PJ7 A;  5K8M A;  2ZEP A;  4IK2 A;  2QJ8 A;  5ELY A;  4ZY1 A;  3CDX A;  1H8L A;  3B3C A;  4F8Z A;  2IQ6 A;  4OC2 A;  4Q7A A;  4MHN A;  2RB7 A;  4ZI6 A;  2POK A;  3KQX A;  4JZ0 A;  4A37 A;  5LYI A;  3KZW A;  1EE3 P;  4F9U A;  3BHX A;  4P45 A;  2ZEG A;  3T8W A;  4OC1 A;  5K8N A;  3PBB A;  2O53 A;  4MMO A;  2PVW A;  4P4D A;  5JM6 A;  3B3S A;  2C6C A;  4WJB A; 
#chains in the Genus database with same CATH topology
 1Z2L A;  5AG4 A;  3R9G A;  2F7V A;  3G3S A;  1JQG A;  2XEG A;  3VWE A;  8CPA A;  4QBJ A;  4KOT A;  1Z8T A;  2F5I A;  4PXE A;  2Q7S A;  4TNU A;  4XNH B;  3S6H A;  3FF3 A;  2O4H A;  4UF4 A;  3TO7 A;  5KTD A;  3D68 A;  3KR5 A;  3KAS A;  4QUS A;  1GHE A;  5LYD A;  4EFD A;  4CAW A;  4JXQ A;  4KLV A;  2PCU A;  2ATR A;  3V38 A;  1NSL A;  3IU2 A;  4MBU A;  1FY7 A;  2D4O A;  2PJ1 A;  2Z3M A;  4BBH A;  4OID A;  4MFZ A;  4U9Y A;  2ZPA A;  1TIQ A;  2AE6 A;  1NE9 A;  2I79 A;  3RNZ A;  3B8G A;  5J8F A;  2XEF A;  3FIX A;  2B3V A;  2XEI A;  1CM0 A;  4KVX A;  3SI0 A;  3V7Z A;  4AG9 A;  2FE7 A;  3T90 A;  3WC6 A;  4UCM A;  1VHO A;  1QST A;  4JXR A;  1AYE A;  4G1P A;  2J8N A;  3TTH A;  2CF4 A;  5C82 A;  1F2O A;  3K9T A;  2BEI A;  5G1Z A;  3PEI A;  1CX8 A;  3F0A A;  1B6B A;  3H8E A;  4MJ8 A;  3I1U A;  4M3S A;  1IID A;  1BAV A;  4UCN A;  4CRZ B;  3V8I A;  4CYQ A;  2QVP A;  1I12 A;  2I00 A;  1S3Z A;  3B35 A;  2FVG A;  4B14 A;  3D8P A;  3SJF A;  1BPM A;  1CPS A;  1CG2 A;  1ELL P;  1M4D A;  2VBQ A;  1YME A;  2CNS A;  2GE3 A;  3CZX A;  4ZY2 A;  3UY5 A;  1Q2D A;  1MJB A;  1XE4 A;  2AFU A;  4HNY B;  3S9L A;  4NGM A;  5ISV A;  3TO6 A;  3D3S A;  3P2H A;  4KVO E;  5C88 A;  5I0C A;  2DEA A;  3MGD A;  1A2Z A;  4M6H A;  3PB9 X;  4GS4 A;  3BLN A;  4R87 A;  5G21 A;  3KGQ A;  3VWD A;  1L0C A;  1CJW A;  1Q2C A;  4FD7 A;  2EBJ A;  2BUE A;  4JLY A;  4C2Y A;  5DWN A;  4UA3 A;  1YRE A;  4UFX A;  1Y7R A;  4K3N A;  3BI1 A;  1MJ9 A;  1UWY A;  1AUG A;  2Z3N A;  4C68 A;  2PJ2 A;  3CXQ A;  4ZBG A;  4A32 A;  3FH4 A;  2CNT A;  3LWU A;  4UEZ A;  1YLO A;  2P0W A;  1PU9 A;  1WWZ A;  3D7H A;  3SI1 A;  1PYT B;  1X12 A;  2PJB A;  4PQA A;  2QML A;  3B2Y A;  1OZP A;  3ZZI A;  1S7L A;  1IYK A;  7CPA A;  4X5K A;  3WC7 A;  4MCQ A;  4CYN A;  2O28 A;  1ARL A;  2PDO A;  2NMT A;  2ZEO A;  3VAR A;  3BXM A;  3W91 A;  4MHD A;  2HV2 A;  2AFO A;  3LMS A;  1HDQ A;  2CTB A;  1CPX A;  3IWE A;  3RBU A;  2BL1 A;  4OIW A;  4IAV A;  4UFV A;  4QC6 A;  3RZA A;  2PJC A;  4W9Y A;  4B12 A;  4RS2 A;  2REF A;  4H89 A;  2P6F A;  3F5B A;  4XPD C;  3FBU A;  2J8R A;  3NFZ A;  2AFW A;  5HMN A;  2DF5 A;  2PC1 A;  2OU2 A;  1KUV A;  1Z9U A;  4P10 A;  3C26 A;  4M85 A;  3IFE A;  2BO9 A;  1S7N A;  3JRU A;  4PXD A;  5K8P A;  4UFW A;  3B7I A;  3TE4 A;  3GUX A;  2ZEE A;  3EC4 A;  2X7B A;  2RC4 A;  1NMT A;  3FB3 A;  2CY2 A;  1YSJ A;  2Q0Y A;  3FJU A;  3IEH A;  1IGB A;  4IF5 A;  5I4M A;  5DS0 A;  4PXC A;  4A38 A;  2PIZ A;  1YK3 A;  5CNP A;  2JEV A;  2Y0M A;  3H5Z A;  5LYF A;  1TXR A;  1TKJ A;  1ZLI A;  1DE4 C;  2OZG A;  1XRY A;  1Y7E A;  2OH1 A;  3FXT A;  1Y9K A;  1YX0 A;  2JDC A;  4KOW A;  4AB7 A;  2RFH A;  3I9S A;  3TX8 A;  3CPX A;  1XF8 A;  4YFJ A;  3W6X A;  4NSQ A;  4OLL A;  4P4J A;  2XEJ A;  4B13 A;  2OB0 A;  3ISX A;  3PZJ A;  1R43 A;  3KR4 A;  3T9Y A;  1YVK A;  3B3T A;  2V77 A;  1QMU A;  1BOB A;  1LOK A;  2YGW A;  4FD6 A;  4Z65 A;  1Y0R A;  4XPD B;  3SJX A;  4MY3 A;  4A95 A;  2PR1 A;  3H8G A;  5LRK A;  1CP6 A;  2OR4 A;  2PQ8 A;  3H8F A;  3NE7 A;  3TOB A;  2B4D B;  2EWB A;  3GB0 A;  2ZEF A;  3GLJ A;  4MI4 A;  4C2Z A;  1F2P A;  2PJ8 A;  3KQZ A;  4KZT A;  3EY5 A;  4PV6 A;  2NYQ A;  4LX9 A;  3WT4 A;  4DYO A;  3DLJ A;  4F0Y A;  1IYL A;  2Q4Z A;  2OZU A;  1YVO A;  4KOY A;  4EWT A;  3ISZ A;  2FIW A;  2FT0 A;  3IU1 A;  4XPL A;  1BLL E;  4UCP A;  3FX6 A;  5KTA A;  3KKW A;  3K2K A;  4TWE A;  5EC4 A;  5F09 A;  4OC5 A;  4JJX A;  2C6P A;  2BOA A;  2ODF A;  4AVB A;  3H4Q A;  1ARM A;  3JUW A;  1IIC A;  3FEC A;  1XEB A;  2AJ6 A;  2ARH A;  4UIB A;  2D4P A;  1RXT A;  2REE A;  2V8H A;  4OAD A;  4NGN A;  4OC3 A;  2HC9 A;  5IX3 A;  1KUX A;  4GXH A;  4NGR A;  1IOI A;  2WPW A;  2OOT A;  4CAV A;  4EVY A;  3G8W A;  5EMI A;  1TKH A;  2CIJ A;  5IB9 A;  3OWC A;  1IU8 A;  2HUZ A;  4LQG A;  1BO4 A;  4MXU A;  5HXD A;  1ELM P;  1GYT A;  3D2P A;  4DUK A;  2GU2 A;  3DGV A;  4F6A A;  3PP9 A;  3I3G A;  4B5O A;  3W6S A;  4OKO A;  3IWW A;  2FCK A;  4MY0 A;  5CBM A;  4MFJ A;  4CGO A;  4KSA A;  1ZO0 A;  3IJ3 A;  2WYR A;  4M6I A;  1TF9 A;  3PFE A;  4MCS A;  2PRQ A;  4BD9 A;  2JBJ A;  2B5G B;  4FD4 A;  4L89 A;  3SI2 A;  3R96 A;  1M4L A;  3GKR A;  2Q44 A;  4LUA A;  3P2F A;  2ZXV A;  4HNX B;  4R8F A;  4FBE A;  2EK9 A;  5G20 A;  1VIX A;  1R57 A;  4L8A A;  4JD6 A;  2A4N A;  3D4U A;  1PCA A;  2AFZ A;  2AFS A;  4F9V A;  2PJ3 A;  5JGF A;  4P4I A;  4PXB A;  3D7G A;  4AXV A;  4OP4 A;  1XFO A;  2JLM A;  1MJA A;  2JBK A;  3CXS A;  4NJR A;  4QB9 A;  1M44 A;  3GY9 A;  4KOS A;  4OC0 A;  1WK4 A;  4NGP A;  4ZYQ A;  1MK4 A;  4H2K A;  4Q38 A;  4AG7 A;  2IJZ A;  3FED A;  4JWP A;  4M6G A;  2ZOF A;  3IIB A;  1LFW A;  5AG7 A;  3R1K A;  5IB0 A;  1S7K A;  1QQ9 A;  4CAF A;  3JTK A;  4KOV A;  4NXY A;  2OZH A;  4X3R A;  5HVG A;  2P6E A;  1RO5 A;  2PRB A;  1UFH A;  2Z0Z A;  3NH8 A;  4R7M A;  4KOU A;  3KHZ A;  4NEX A;  3TT2 A;  2G3T A;  3IGR A;  4RN7 A;  2JEW A;  1XBU A;  3QAY A;  4B6Z A;  2ZW6 A;  4IHM A;  4P6Y A;  4CYP A;  3NH5 A;  2ZEN A;  3D67 A;  1VKC A;  2WZN A;  4OME A;  2VEZ A;  5AG6 A;  5JPH A;  3CXP A;  4UIA A;  4MFL A;  4A39 A;  1HEE A;  3DR6 A;  4DNC A;  4KVM E;  3HLP A;  1LAP A;  4U5Y A;  5AGE A;  4E0A A;  2HQY A;  1QSN A;  3S9M A;  5K8O A;  4BMH A;  4NFR A;  5J1Q A;  1YW4 A;  2B4D A;  2DPS A;  1CP7 A;  2G9D A;  3IO1 A;  2B3U A;  3DSB A;  5HVH A;  1QSM A;  3PFO A;  2Q04 A;  3L2N A;  4MHY A;  3GIU A;  2EVN A;  3BI0 A;  2FXF A;  5HH1 A;  2ANP A;  2V8V A;  3NE8 A;  1LRZ A;  2C1C A;  4FD5 A;  3VH9 A;  3R9F A;  4ONU A;  3S6F A;  2BSW A;  1TF8 A;  4KSI A;  4NF1 A;  4CRY B;  2Q51 A;  1IOF A;  4U9Z A;  5HVF A;  1Z4E A;  4KSF A;  5D8N A;  4E8O A;  5AG5 A;  4FWU A;  3KI9 A;  2QIR A;  3IWG A;  4A94 A;  1XIX A;  1Y0Y A;  2G0B A;  1ZLH A;  5LYL A;  2GLF A;  3S9N A;  3PB8 X;  4J3G A;  4JYW A;  4Y49 C;  1ON0 A;  2PJ9 A;  4YRH A;  2ZEL A;  3PBE A;  1BPN A;  1XMB A;  5H84 A;  4PPZ A;  2PJA A;  2ZW4 A;  4IUS A;  4XPK A;  2EO8 A;  5CPA A;  1M1D A;  3TC8 A;  3QAH A;  4BIN A;  4O23 A;  4MRI A;  2PIY A;  2V8G A;  2QYV A;  4A2Z A;  4CGM A;  1NSA A;  1VHS A;  4EME A;  4P4F A;  5BWA B;  4PK2 A;  1J4J A;  1P4N A;  1VGY A;  2YND A;  4ZX8 A;  3A9L A;  4I49 A;  4K30 A;  3HUV A;  3PB4 X;  2F8H A;  1S5K A;  2ZOG A;  3NH4 A;  4CGL A;  2B5G A;  4X2T A;  2C6G A;  4WWV A;  1YLE A;  3TOA A;  3LOD A;  4UWJ A;  4P4B A;  1V0C A;  2ZEM A;  2PSW A;  2VI7 A;  1I1D A;  3R95 A;  4FUU A;  1KUY A;  1M4G A;  4ZY0 A;  2VQY A;  4LQ6 A;  4A31 A;  4MHP A;  2BCO A;  2DXQ A;  3QB8 A;  2ABZ A;  5JH9 A;  5GCN A;  4YGO A;  2P6G A;  3D2M A;  4ORF A;  4C7H A;  1S7F A;  3S6K A;  4DJL A;  4E2A A;  4YWY A;  4AVA A;  4H6Z A;  1XOV A;  3KHX A;  3B3V A;  3QNV A;  3RO0 A;  1Z8L A;  4Y49 B;  4R3L A;  4MHZ A;  2FIA A;  1LAM A;  1AMP A;  2IMO A;  3D7D A;  4MFP A;  4OC4 A;  4NGS A;  4MFQ A;  2VZZ A;  1DTD A;  1S60 A;  1YGH A;  1Z4R A;  2J9A A;  2PJ0 A;  2Q4V A;  6CPA A;  3SJE A;  3CPA A;  4PSW A;  4B11 A;  5G22 A;  2G3A A;  4R3K A;  4II9 A;  1XMT A;  3MRU A;  1ZG9 A;  2IL4 A;  2GRE A;  2VXK A;  4KS9 A;  3SXN A;  4PK3 A;  4PSX A;  3FRM A;  3PB6 X;  4FAI A;  2AFX A;  4B5P B;  3VAT A;  2ZW5 A;  1Z8W A;  2Q7B A;  4CPA A;  4CS0 B;  1ZG8 A;  2WUU A;  3SJG A;  4CYO A;  2PVV A;  1OBR A;  2CXA A;  2EK8 A;  1IY7 A;  3D7F A;  2HB6 A;  1HDU A;  3FEE A;  3LAC A;  2NSM A;  1CBX A;  3WC5 A;  2PJ6 A;  1QSR A;  3BJ7 A;  3KL9 A;  1R3N A;  4R76 A;  2Z3P A;  2FS5 A;  2PR8 A;  4ZGY B;  1F57 A;  5F48 A;  1KZF A;  4ZX9 A;  2GAN A;  1B87 A;  2CTC A;  4MCR A;  4KOR A;  2Q43 A;  2PE3 A;  1YR0 A;  2V8D A;  2Z11 A;  2AFM A;  1ZG7 A;  4ONW A;  4NGT A;  3JVN A;  5A28 A;  4GM5 A;  5FVJ A;  3SHP A;  5E96 A;  4KUB A;  2GLJ A;  1QSO A;  3NA6 A;  3F8K A;  2GIV A;  3EFA A;  1LCP A;  5IV0 A;  4UWI A;  3FMC A;  2C27 A;  3K9U A;  3PGP A;  1IB1 E;  5J8C A;  1Z5R A;  2ZED A;  2B58 A;  4NJQ A;  4X8I A;  1N71 A;  4CGN A;  3N7Z A;  1Q7L A;  3D66 A;  4P4E A;  5EBV A;  3LD2 A;  4OAE A;  3DR8 A;  3FNC A;  4UEF A;  5DWM A;  3E0K A;  4R9M A;  2WPX A;  5F49 A;  3CT9 A;  1FNO A;  1K4J A;  4AVC A;  1YQE A;  5KTC A;  5D29 A;  3WAB A;  3IC1 A;  4B10 A;  4R57 A;  4F0X A;  1RTQ A;  1U6M A;  2Z3O A;  2VL1 A;  4RUH A;  2I3C A;  4H6U A;  1YW6 A;  2Z3L A;  1PUA A;  3B3W A;  4HKF A;  3PB7 X;  4MCP A;  2J8M A;  3GYA A;  3ZJ0 A;  1JWQ A;  3BJ8 A;  4P44 A;  4C2X A;  1FT7 A;  2WSA A;  4R6T A;  3TCV A;  2ZEH A;  5LRG A;  2CNM A;  5THW A;  5JQ4 A;  4YU9 A;  1M4I A;  4CGP A;  2PJ5 A;  3PRT A;  4NGQ A;  2R98 A;  3N5F A;  2B4B A;  3MN8 A;  4A30 A;  4UEE A;  1KWM A;  2FL4 A;  4NCZ A;  2VZY A;  4MFK A;  3RAM A;  1VHE A;  2PJ4 A;  3FVL A;  4HPS A;  1TKF A;  4A33 A;  2QEC A;  1LAN A;  2R1I A;  1I21 A;  1Z8X A;  3WR7 A;  4C7I A;  3RYO A;  3S6G A;  2FSR A;  5LRJ A;  1XJO A;  4QVT A;  5F46 A;  2PJ7 A;  4RI1 A;  1P0H A;  1Y9W A;  5K8M A;  4KOX A;  2KCW A;  2ZEP A;  4IK2 A;  5F47 A;  2QJ8 A;  5ELY A;  2JDD A;  4ZY1 A;  3CDX A;  2K5T A;  1Q2Y A;  2YNE A;  1H8L A;  3EO4 A;  3B3C A;  4XNH C;  4UBR A;  2R7H A;  2Z3K A;  3TO9 A;  2IQ6 A;  2YNC A;  4OC2 A;  4B5P A;  4F8Z A;  4KLW A;  4Q7A A;  2H5M A;  4MHN A;  2Q4Y A;  2RB7 A;  3R9E A;  3DNS A;  3EXN A;  1SQH A;  3FYN A;  2Z10 A;  2POK A;  1X10 A;  4CAE A;  3KQX A;  4JZ0 A;  4A37 A;  4ZI6 A;  5LYI A;  3KZW A;  1EE3 P;  2YNC C;  3SXO A;  4CAX A;  4F9U A;  5A27 A;  3BHX A;  4P45 A;  2ZEG A;  3T8W A;  2ZW7 A;  4KUA A;  3TFY A;  5H86 A;  4OC1 A;  3DDD A;  5K8N A;  3PBB A;  4Q36 A;  2O53 A;  2DPT A;  4MMO A;  2PVW A;  4P4D A;  5JM6 A;  2GFQ A;  2EUI A;  3B3S A;  4HNW B;  2R8V A;  2C6C A;  4WJB A; 
#chains in the Genus database with same CATH homology
 1Z2L A;  2F7V A;  1JQG A;  2XEG A;  8CPA A;  4PXE A;  4TNU A;  3FF3 A;  2O4H A;  4UF4 A;  3D68 A;  3KR5 A;  3KAS A;  4EFD A;  5LYD A;  2PCU A;  3V38 A;  2PJ1 A;  4OID A;  2XEF A;  2XEI A;  3V7Z A;  3SI0 A;  3WC6 A;  1VHO A;  1AYE A;  4G1P A;  2CF4 A;  1F2O A;  3K9T A;  3PEI A;  1CX8 A;  3H8E A;  3I1U A;  1BAV A;  2QVP A;  3B35 A;  2FVG A;  3SJF A;  1BPM A;  1CPS A;  1CG2 A;  1ELL P;  1YME A;  4ZY2 A;  2AFU A;  3S9L A;  4NGM A;  2DEA A;  3PB9 X;  3KGQ A;  4K3N A;  3BI1 A;  1UWY A;  2PJ2 A;  3FH4 A;  3LWU A;  4UEZ A;  1YLO A;  3SI1 A;  3D7H A;  1PYT B;  2PJB A;  4PQA A;  3B2Y A;  7CPA A;  3WC7 A;  4MCQ A;  1ARL A;  2ZEO A;  3VAR A;  3BXM A;  2AFO A;  3LMS A;  1HDQ A;  2CTB A;  1CPX A;  3RBU A;  4OIW A;  3RZA A;  4IAV A;  2PJC A;  4W9Y A;  3NFZ A;  2AFW A;  4P10 A;  3IFE A;  2BO9 A;  3JRU A;  4PXD A;  5K8P A;  3B7I A;  3GUX A;  2ZEE A;  3IEH A;  3FJU A;  1YSJ A;  5I4M A;  1IGB A;  5DS0 A;  4PXC A;  4A38 A;  2PIZ A;  5LYF A;  1TXR A;  1TKJ A;  1ZLI A;  1DE4 C;  1XRY A;  1Y7E A;  2RFH A;  3TX8 A;  3CPX A;  4P4J A;  2XEJ A;  3ISX A;  1R43 A;  3KR4 A;  3B3T A;  2V77 A;  1QMU A;  1LOK A;  4Z65 A;  1Y0R A;  3SJX A;  3H8G A;  5LRK A;  1CP6 A;  2OR4 A;  3H8F A;  2EWB A;  3GB0 A;  2ZEF A;  3GLJ A;  1F2P A;  2PJ8 A;  3KQZ A;  3WT4 A;  2NYQ A;  4DYO A;  3DLJ A;  2Q4Z A;  4EWT A;  3ISZ A;  1BLL E;  3FX6 A;  3K2K A;  4TWE A;  5F09 A;  4OC5 A;  2C6P A;  2BOA A;  1ARM A;  3FEC A;  4UIB A;  2V8H A;  4NGN A;  4OC3 A;  2HC9 A;  4NGR A;  2OOT A;  1TKH A;  2CIJ A;  5IB9 A;  4LQG A;  5HXD A;  4MXU A;  1ELM P;  1GYT A;  4DUK A;  2GU2 A;  3DGV A;  4OKO A;  3IWW A;  5CBM A;  3IJ3 A;  2WYR A;  1TF9 A;  3PFE A;  4MCS A;  2PRQ A;  4BD9 A;  2JBJ A;  3SI2 A;  1M4L A;  4R8F A;  4FBE A;  2EK9 A;  1VIX A;  4F9V A;  3D4U A;  1PCA A;  2AFZ A;  2AFS A;  2PJ3 A;  5JGF A;  4P4I A;  4PXB A;  3D7G A;  4AXV A;  4OP4 A;  1XFO A;  2JBK A;  4NJR A;  4OC0 A;  4ZYQ A;  4NGP A;  4H2K A;  2IJZ A;  3FED A;  2ZOF A;  3IIB A;  1LFW A;  1QQ9 A;  4X3R A;  5HVG A;  3NH8 A;  4R7M A;  3KHZ A;  2JEW A;  1XBU A;  4B6Z A;  4IHM A;  4P6Y A;  3NH5 A;  2ZEN A;  3D67 A;  4OME A;  2WZN A;  4UIA A;  4A39 A;  1HEE A;  3HLP A;  1LAP A;  5K8O A;  3S9M A;  4NFR A;  5J1Q A;  1YW4 A;  1CP7 A;  2G9D A;  3IO1 A;  5HVH A;  3PFO A;  3L2N A;  4MHY A;  3BI0 A;  2ANP A;  2V8V A;  2C1C A;  3VH9 A;  4KSI A;  1TF8 A;  2Q51 A;  5HVF A;  5D8N A;  4FWU A;  3KI9 A;  4A94 A;  1Y0Y A;  1ZLH A;  5LYL A;  2GLF A;  3S9N A;  3PB8 X;  4JYW A;  2PJ9 A;  2ZEL A;  3PBE A;  1BPN A;  1XMB A;  4PPZ A;  2PJA A;  5CPA A;  3TC8 A;  4O23 A;  4MRI A;  2PIY A;  2V8G A;  2QYV A;  4EME A;  1NSA A;  4P4F A;  1VGY A;  4ZX8 A;  3HUV A;  3PB4 X;  2F8H A;  3NH4 A;  2ZOG A;  4X2T A;  2C6G A;  4WWV A;  4P4B A;  2ZEM A;  4FUU A;  4ZY0 A;  4MHP A;  2BCO A;  5JH9 A;  2ABZ A;  4DJL A;  4YWY A;  3KHX A;  3B3V A;  3QNV A;  1Z8L A;  4MHZ A;  1LAM A;  1AMP A;  2IMO A;  3D7D A;  4OC4 A;  4NGS A;  1DTD A;  2J9A A;  2PJ0 A;  6CPA A;  3SJE A;  3CPA A;  3MRU A;  1ZG9 A;  2GRE A;  3PB6 X;  4FAI A;  2AFX A;  3VAT A;  4CPA A;  1ZG8 A;  3SJG A;  2PVV A;  1OBR A;  2EK8 A;  3D7F A;  1IY7 A;  3FEE A;  2HB6 A;  1HDU A;  2NSM A;  1CBX A;  3WC5 A;  2PJ6 A;  3KL9 A;  4R76 A;  1R3N A;  1F57 A;  4ZX9 A;  4MCR A;  2CTC A;  2Q43 A;  2PE3 A;  2V8D A;  2AFM A;  1ZG7 A;  4ONW A;  4NGT A;  4GM5 A;  2GLJ A;  3NA6 A;  1LCP A;  3FMC A;  1Z5R A;  2ZED A;  4NJQ A;  4X8I A;  1Q7L A;  3D66 A;  4P4E A;  4UEF A;  3CT9 A;  1FNO A;  5D29 A;  3WAB A;  3IC1 A;  1RTQ A;  2VL1 A;  4RUH A;  2I3C A;  1YW6 A;  3B3W A;  4MCP A;  3PB7 X;  4P44 A;  1FT7 A;  4R6T A;  2ZEH A;  5LRG A;  5THW A;  4YU9 A;  2PJ5 A;  3PRT A;  4NGQ A;  3N5F A;  3MN8 A;  4UEE A;  1KWM A;  3RAM A;  1VHE A;  2PJ4 A;  3FVL A;  1TKF A;  1LAN A;  5LRJ A;  1XJO A;  2PJ7 A;  5K8M A;  2ZEP A;  4IK2 A;  2QJ8 A;  5ELY A;  4ZY1 A;  3CDX A;  1H8L A;  3B3C A;  4F8Z A;  2IQ6 A;  4OC2 A;  4Q7A A;  4MHN A;  2RB7 A;  4ZI6 A;  2POK A;  3KQX A;  4JZ0 A;  4A37 A;  5LYI A;  3KZW A;  1EE3 P;  4F9U A;  3BHX A;  4P45 A;  2ZEG A;  3T8W A;  4OC1 A;  5K8N A;  3PBB A;  2O53 A;  4MMO A;  2PVW A;  4P4D A;  5JM6 A;  3B3S A;  2C6C A;  4WJB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...