2NYQA

Structure of vibrio proteolyticus aminopeptidase with a bound trp fragment of dlwcf
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
291
structure length
291
Chain Sequence
MPPITQQATVTAWLPQVDASQITGTISSLESFTNRFYTTTSGAQASDWIASEWQALSASLPNASVKQVSHSGYNQKSVVMTITGSEAPDEWIVIGGHLDSTIGSHTNEQSVAPGADDDASGIAAVTEVIRVLSENNFQPKRSIAFMAYAAEEVGLRGSQDLANQYKSEGKNVVSALQLDMTNYKGSAQDVVFITDYTDSNFTQYLTQLMDEYLPSLTYGFDTCGYACSDHASWHNAGYPAAMPFESKFNDYNPRIHTTQDTLANSDPTGSHAKKFTQLGLAYAIEMGSATG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Substrate recognition by the leucine aminopeptidase from Vibrio proteolyticus
rcsb
molecule tags Hydrolase
molecule keywords Aminopeptidase
total genus 111
structure length 291
sequence length 291
ec nomenclature ec 3.4.11.10: Bacterial leucyl aminopeptidase.
pdb deposition date 2006-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 2nyqA00
4UEZA 1DTDA 3CPAA 2QJ8A 3D68A 4A37A 3NFZA 3SJGA 1VHOA 3KI9A 3ISXA 2PJ7A 4ZI6A 2XEIA 4Q7AA 3LWUA 2C1CA 2FVGA 2POKA 5CPAA 4MHNA 2AFWA 4GM5A 1ZG8A 3H8GA 1YW4A 1LOKA 1JQGA 3QNVA 1LAPA 4FUUA 2V8VA 4DJLA 4Z65A 2PJ4A 3IIBA 4WWVA 1YSJA 4MHYA 4ZX8A 2BCOA 3S9NA 4OC2A 2PJ3A 3KASA 2PIYA 2AFSA 2RB7A 3DLJA 2PJAA 5K8OA 3D7GA 4OKOA 5J1QA 2GREA 4IK2A 3NH5A 4ZY1A 2PJBA 4X8IA 1LFWA 4MCQA 2XEFA 4P10A 4FWUA 4OC0A 3SJFA 3MN8A 1RTQA 4NGTA 2ZOFA 3LMSA 4UIBA 1CPXA 7CPAA 4PXCA 4MHZA 4G1PA 5HVFA 5K8MA 2V77A 2EK9A 1VHEA 2PJ2A 4OIDA 4PXEA 1CP7A 3CPXA 3FEDA 5CBMA 4OC1A 1ARMA 3B2YA 1F57A 2C6PA 2I3CA 2V8DA 2GLJA 3NA6A 4UIAA 1VIXA 4OC4A 3IWWA 2ZELA 3FH4A 4B6ZA 1H8LA 3RAMA 1BLLE 4H2KA 4OC5A 2WZNA 2ZEGA 2CIJA 2PVWA 3VATA 3WT4A 1R43A 4IAVA 3WC6A 5LRJA 2ZEPA 1R3NA 1ZLHA 1Z2LA 1LCPA 5JH9A 4X2TA 3VARA 3NH4A 3ISZA 4NGRA 1Y0YA 1TKJA 3IC1A 5D29A 1BPMA 4ONWA 2PJCA 4TNUA 3SI2A 2PCUA 3PB6X 3NH8A 4UEEA 2Q43A 1CX8A 2PJ6A 3B3CA 4WJBA 1EE3P 3GLJA 1XFOA 3FMCA 1AMPA 4OP4A 3BI0A 2JBKA 3SJEA 1FT7A 4PXBA 3KZWA 3PB8X 4AXVA 2V8HA 4MCRA 1PYTB 1TKFA 1YMEA 4UEFA 6CPAA 1LANA 4F9VA 1Z5RA 2CTBA 2AFOA 3PEIA 1UWYA 5F09A 5ELYA 4P6YA 3D7FA 1XBUA 5HVGA 1XMBA 1ELMP 4EFDA 3SJXA 1CPSA 3DGVA 3FJUA 4EWTA 3TX8A 2OOTA 5THWA 4MXUA 4OC3A 4OIWA 4TWEA 4X3RA 2GU2A 1AYEA 4P4DA 2AFUA 3L2NA 3KGQA 4UF4A 5LYLA 4FBEA 3BXMA 2PJ0A 2EWBA 5DS0A 2Q51A 3KHXA 3PFOA 3KQZA 4ZYQA 2XEJA 4P4JA 4NJRA 1CP6A 4ZX9A 5LRGA 3KL9A 1ZG7A 2BOAA 5HXDA 2ZENA 3FEEA 1ZG9A 5HVHA 3D4UA 2PJ9A 2O4HA 5K8NA 3FECA 4CPAA 4P4FA 4DUKA 1CG2A 4NGPA 3D7HA 2ZEEA 3MRUA 2Q4ZA 3BI1A 2V8GA 3V7ZA 3CDXA 5LYIA 4MMOA 4P4EA 3VH9A 3D67A 1KWMA 1Z8LA 3FF3A 4ZY0A 3PB9X 4F9UA 2AFZA 3PFEA 4R6TA 5LYFA 3GB0A 4JYWA 2PJ1A 3HLPA 5LYDA 1TF9A 3D66A 4A39A 1Y0RA 3S9MA 3JRUA 3PRTA 4MCSA 3PB4X 4KSIA 1ARLA 2ZEFA 3B7IA 4JZ0A 3CT9A 1IY7A 2ANPA 1IGBA 3B3VA 1CBXA 2WYRA 4BD9A 2RFHA 3GUXA 3B3WA 2AFMA 2IMOA 3K2KA 2PIZA 2C6GA 2G9DA 3WC7A 3D7DA 1DE4C 2CF4A 1Y7EA 3KHZA 1LAMA 3IO1A 5JGFA 4NGMA 4NFRA 3RZAA 4NGSA 1Q7LA 4PXDA 1HEEA 4P45A 3B3TA 3SI1A 2IJZA 2CTCA 3B3SA 2PRQA 2ZEHA 3KR4A 4O23A 3K9TA 4OMEA 1NSAA 1TKHA 2JEWA 2PJ5A 3KR5A 2C6CA 1HDUA 1YLOA 1HDQA 1TXRA 5LRKA 1TF8A 2BO9A 3PBBA 5K8PA 4IHMA 2JBJA 3PBEA 3HUVA 4EMEA 4MCPA 4P4BA 4YU9A 2IQ6A 3IEHA 2O53A 5D8NA 2ZOGA 1XJOA 4A38A 5JM6A 3WC5A 1F2PA 4P44A 2J9AA 3FX6A 1XRYA 3PB7X 2EK8A 4R76A 2ABZA 2QVPA 1BAVA 2NSMA 2PJ8A 4FAIA 4NJQA 2F8HA 1QMUA 3KQXA 4P4IA 2AFXA 3BHXA 2ZEDA 4W9YA 2VL1A 2PE3A 2ZEMA 1PCAA 3I1UA 4F8ZA 4R8FA 3H8FA 3B35A 1YW6A 4LQGA 4NGQA 2F7VA 2NYQA 1ZLIA 2PVVA 3H8EA 3T8WA 1ELLP 4PPZA 2HC9A 1BPNA 2GLFA 2HB6A 3SI0A 4YWYA 3WABA 4MHPA 4PQAA 4MRIA 4K3NA 2OR4A 3S9LA 1F2OA 4R7MA 1FNOA 3N5FA 4RUHA 5IB9A 2ZEOA 1OBRA 2QYVA 1M4LA 1GYTA 4DYOA 3IFEA 3TC8A 1QQ9A 1VGYA 3IJ3A 3V38A 8CPAA 3RBUA 4ZY2A 3FVLA 2XEGA 4A94A 5I4MA 2DEAA 4NGNA
chains in the Genus database with same CATH superfamily
1IOIA 1Q2YA 2BSWA 4UEZA 1DTDA 2ZW4A 1QSTA 5C82A 3CPAA 2QJ8A 2YNEA 3EXNA 4MFZA 3D68A 4A37A 2VI7A 3T9YA 3NFZA 3SJGA 1VHOA 2VEZA 3KI9A 2FT0A 2Z10A 2WPXA 2PJ7A 3ISXA 4ZI6A 4L8AA 1XF8A 3P2FA 2BEIA 4YRHA 4M6GA 4B11A 1IYLA 2XEIA 1YLEA 3LWUA 4Q7AA 5G22A 2C1CA 2FVGA 1FY7A 1QSMA 2POKA 5CPAA 4F0YA 1S7LA 2AFWA 4GM5A 4MHNA 1ZG8A 2VZYA 1SQHA 2JEVA 3DNSA 1ON0A 3DR6A 3H8GA 1YW4A 1YR0A 2Q7SA 1LOKA 1JQGA 3QNVA 4LQ6A 4CGPA 3CXSA 4Y49B 1LAPA 3SXOA 2JDCA 4CAEA 3TOAA 5J8FA 4FUUA 2V8VA 1QSRA 3QAHA 1LRZA 4B12A 1M4DA 4DJLA 4BINA 4Z65A 2FIAA 2PJ4A 3IIBA 4WWVA 1YSJA 4MHYA 4ZX8A 2BCOA 3P2HA 4OC2A 4AVBA 3S9NA 2PJ3A 3KASA 2WUUA 4A33A 2PIYA 2AFSA 2YNDA 2RB7A 4MHDA 1K4JA 3DLJA 1PU9A 2PJAA 3D7GA 5K8OA 4OKOA 4KVXA 5J1QA 1B87A 1IOFA 4ZGYB 2GREA 1I12A 3I9SA 4NSQA 1Y7RA 4QUSA 4AVCA 2OH1A 4IK2A 4GS4A 1XIXA 2PRBA 3NH5A 4ZY1A 2KCWA 4KZTA 2PJBA 3KKWA 4X8IA 3FYNA 1LFWA 1XEBA 4MCQA 1P4NA 2XEFA 4P10A 4XNHB 3TE4A 2H5MA 2Z3OA 4FWUA 2QIRA 1B6BA 2OZHA 2ZW7A 4H6UA 4M6HA 4OC0A 2EBJA 2VXKA 3SJFA 3W91A 2YNCC 3MN8A 4CGLA 1RTQA 4NGTA 2Q4VA 2ZXVA 2VQYA 2ZOFA 3LMSA 4JD6A 4KUAA 4UIBA 4GXHA 4C68A 3CXQA 1CPXA 5F46A 2B4DB 4PK3A 4CGMA 4JJXA 5J8CA 7CPAA 4B5OA 5CNPA 3F5BA 4PXCA 4MHZA 4G1PA 1AUGA 4FD4A 5HVFA 4XPKA 3B8GA 4R9MA 2Z3LA 3CXPA 5K8MA 2V77A 2EK9A 1VHEA 2PJ2A 4OIDA 3FNCA 4PXEA 2HUZA 5C88A 1CP7A 2DXQA 3CPXA 5KTAA 3MGDA 2Z3PA 3FEDA 4KLVA 5CBMA 4OC1A 3BJ7A 3TTHA 1ARMA 3B2YA 4U9ZA 4CGNA 2FXFA 1F57A 1KUXA 2C6PA 1M1DA 2I3CA 3D2PA 3TO9A 4Y49C 2V8DA 2GLJA 1CJWA 3NA6A 4ZBGA 4UIAA 2PQ8A 1VIXA 4OC4A 3D2MA 3I3GA 2B58A 3IWWA 1KZFA 3DSBA 2ZELA 3FH4A 3R9GA 4OLLA 2VZZA 4B6ZA 3EFAA 1H8LA 2Q7BA 4E2AA 1IU8A 3RAMA 1BLLE 2FSRA 4H2KA 4JXRA 3VWEA 4FD5A 4OC5A 4II9A 4X5KA 2WZNA 5IV0A 4HKFA 2R1IA 3ZZIA 1U6MA 2ZEGA 2CIJA 2PVWA 4UFXA 5AGEA 4CGOA 4XPDB 3VATA 1I1DA 3WT4A 3C26A 1R43A 2C27A 4IAVA 3RNZA 3TT2A 3WC6A 1PUAA 2G3TA 5LRJA 2ZEPA 3SXNA 1R3NA 1ZLHA 5BWAB 4Q38A 1Z2LA 4MI4A 1M4GA 2B5GB 1LCPA 3OWCA 5DWMA 5JH9A 4MY3A 4A32A 4X2TA 3VARA 1UFHA 2R8VA 3NH4A 3LACA 3ISZA 4NGRA 1TKJA 1Y0YA 3W6SA 3TO7A 3IC1A 5H86A 4HNXB 1Z9UA 2REEA 4JLYA 5D29A 4NF1A 1BPMA 4ONWA 2A4NA 2PJCA 4TNUA 2PCUA 3PB6X 3NH8A 3SI2A 1Z8XA 4PSXA 2B5GA 4UEEA 2Q43A 1CX8A 2PJ6A 3B3CA 4WJBA 4C2YA 1EE3P 3GLJA 1XFOA 1OZPA 5G21A 3FMCA 1AMPA 4OP4A 2HQYA 3BI0A 2JBKA 2Z3KA 3SJEA 1FT7A 4PXBA 3KZWA 3PB8X 4AXVA 2PDOA 3FB3A 2V8HA 4MCRA 1BO4A 1PYTB 1TKFA 1YMEA 2OU2A 5FVJA 4UEFA 4CRYB 4CYNA 4E8OA 1LANA 3G8WA 3RYOA 4EVYA 3RO0A 6CPAA 2JDDA 4U5YA 2ARHA 4C7HA 5A28A 2P6FA 4F9VA 1Z5RA 1S3ZA 2CTBA 5JPHA 2AFOA 1S7FA 1UWYA 3PEIA 5F09A 2I79A 4KOUA 2D4OA 3JTKA 1N71A 5A27A 1XE4A 1P0HA 2PR8A 5ELYA 4P6YA 4LUAA 3R9EA 3D7FA 1X12A 2OZGA 4HPSA 1XBUA 4XPLA 1IB1E 2FE7A 3IWGA 5HVGA 1XMBA 1WWZA 2EUIA 4NEXA 1ELMP 4Q36A 2VBQA 3D8PA 4PV6A 1TIQA 3BJ8A 3W6XA 2P6GA 4EFDA 1IYKA 5IX3A 1YQEA 3SJXA 1CPSA 3DGVA 2EVNA 3FJUA 4MY0A 4R3LA 2PR1A 5DWNA 4CRZB 4EWTA 1GHEA 4PSWA 3TX8A 2OOTA 1I21A 4UBRA 5THWA 1MK4A 1J4JA 4MXUA 2YGWA 2OZUA 4OC3A 2BUEA 4OIWA 4TWEA 4BBHA 4X3RA 2GU2A 1AYEA 4P4DA 2AFUA 4RI1A 3L2NA 4UFWA 4CAXA 3KGQA 4QVTA 4R3KA 4UFVA 4UF4A 4QB9A 5LYLA 4F0XA 4FBEA 3BXMA 2PJ0A 3S6KA 2EWBA 2FS5A 3PGPA 5DS0A 2Q51A 3GKRA 4C2XA 4CS0B 4KVOE 3KHXA 3PFOA 5F48A 1R57A 3KQZA 3K9UA 4A2ZA 5G20A 4E0AA 4ZYQA 2XEJA 4P4JA 5EBVA 4NJRA 1CP6A 4JWPA 1MJ9A 4ZX9A 4KOVA 5LRGA 4CAWA 4OADA 1XMTA 3KL9A 3FRMA 2JLMA 1ZG7A 2B3UA 2X7BA 2Z0ZA 1Z4EA 2BOAA 2R98A 3F0AA 5HXDA 5AG4A 2ZENA 3FEEA 1M4IA 1ZG9A 5HVHA 3D4UA 2J8NA 4U9YA 1WK4A 4CYPA 4KS9A 5H84A 2PJ9A 2O4HA 5K8NA 3FECA 3N7ZA 4CPAA 4P4FA 4XPDC 2Q04A 4FD7A 1IICA 4DUKA 1CG2A 4NGPA 2Q44A 2OB0A 3D7HA 4MFLA 2ZEEA 3MRUA 4XNHC 2Q4ZA 3BI1A 2V8GA 3V7ZA 3CDXA 3S6FA 4KORA 5LYIA 2B4BA 2FCKA 4A31A 2GIVA 4H89A 4MMOA 5HMNA 4C7IA 4KVME 4P4EA 3VH9A 2HV2A 3D67A 1KWMA 1Z8LA 3BLNA 3FF3A 4KLWA 4UWJA 2BL1A 4YGOA 2EO8A 3PB9X 4ORFA 4ZY0A 2P6EA 5AG6A 4B5PA 4F9UA 1V0CA 2AFZA 1Q2CA 3PFEA 4R6TA 4YFJA 3IWEA 3IU1A 2DF5A 3D3SA 1YGHA 5LYFA 3GB0A 4JYWA 2PJ1A 3HLPA 4QC6A 1L0CA 2CXAA 1NMTA 5LYDA 1TF9A 3DDDA 2B4DA 1YREA 1Q2DA 3EO4A 3FIXA 3JUWA 1KUYA 3D66A 4A39A 1NSLA 1Y0RA 3S9MA 3NE7A 2O28A 4B5PB 4IUSA 4CYQA 3TO6A 3JRUA 4B14A 2CNSA 3PRTA 3WR7A 2DPSA 3FXTA 4MCSA 3PB4X 4UCMA 1MJBA 4KSIA 4H6ZA 2ZW5A 3F8KA 4M3SA 1ARLA 2ZEFA 5I0CA 3B7IA 4I49A 2CNMA 4JZ0A 2G3AA 5G1ZA 3CT9A 2GANA 3GIUA 1IY7A 2ANPA 1IGBA 3B3VA 1CBXA 2WYRA 1Y9WA 4BD9A 2RFHA 5IB0A 3GUXA 3B3WA 5ISVA 2WPWA 4CYOA 2Z3MA 2AFMA 2IMOA 3K2KA 2PIZA 1A2ZA 2GE3A 4J3GA 2C6GA 1Z8TA 2G9DA 5AG7A 3WC7A 5AG5A 3D7DA 3EC4A 1DE4C 1KUVA 3TOBA 2CF4A 2NMTA 1Y7EA 4AVAA 3KHZA 1LAMA 3IO1A 2Q4YA 5HH1A 4ONUA 5JGFA 2Z11A 1Z8WA 4NFRA 4NGMA 3RZAA 4NGSA 1Q7LA 4PXDA 1HEEA 4P45A 3B3TA 5F47A 3SI1A 2IJZA 2CTCA 1S7KA 4MJ8A 2ATRA 3B3SA 2PRQA 4HNWB 1JWQA 2ZEHA 3KR4A 3DR8A 4KSFA 1QSOA 4MFJA 5F49A 4F6AA 4O23A 3K9TA 3R1KA 3VWDA 1S60A 1MJAA 2F5IA 1IIDA 2RC4A 2YNCA 1NSAA 4OMEA 1TKHA 2JEWA 2PJ5A 3KR5A 4CAFA 2C6CA 1HDUA 1YLOA 1HDQA 2WSAA 1TXRA 2CY2A 5LRKA 4MFKA 1TF8A 2BO9A 3GY9A 4C2ZA 4KOYA 3PBBA 2J8RA 4AB7A 5K8PA 4IHMA 4UCNA 2IL4A 2JBJA 2I00A 3PBEA 1NE9A 3HUVA 4FD6A 4M6IA 4EMEA 4RS2A 4MCPA 2Y0MA 1RXTA 4LX9A 4QBJA 3R9FA 4P4BA 2D4PA 4UA3A 4YU9A 2IQ6A 4M85A 3IEHA 2AE6A 2O53A 4KUBA 5D8NA 2Q0YA 2ZOGA 1XJOA 3V8IA 4A38A 2QECA 4KOSA 4L89A 5JM6A 3TCVA 3EY5A 3WC5A 2QMLA 1F2PA 4P44A 3S6GA 2CNTA 2J9AA 1YX0A 3FX6A 3T90A 1XRYA 2DPTA 5EC4A 2PC1A 1S5KA 2EK8A 3PB7X 4R76A 1Z4RA 2ABZA 4AG9A 4UCPA 2QVPA 1YVKA 4NCZA 1BAVA 3UY5A 1YVOA 2NSMA 4AG7A 4MFPA 2PJ8A 3G3SA 4FAIA 1BOBA 4KOTA 4NJQA 4A30A 2F8HA 2GFQA 2ZW6A 4NXYA 1S7NA 4BMHA 3JVNA 5JQ4A 5EMIA 1RO5A 1QMUA 4B13A 1ZO0A 2B3VA 4OAEA 3KQXA 2Z3NA 4P4IA 4A95A 3R95A 4B10A 2AFXA 4IF5A 4RN7A 2G0BA 5E96A 3BHXA 2ZEDA 4W9YA 2VL1A 1X10A 4JXQA 4UWIA 1VHSA 2PE3A 1PCAA 2PSWA 2ZEMA 3I1UA 4R8FA 3R96A 4F8ZA 3H8FA 2K5TA 3B35A 1YW6A 4LQGA 4NGQA 2F7VA 1CM0A 1VKCA 2AJ6A 3IGRA 3H4QA 1QSNA 2NYQA 5KTCA 1ZLIA 2PVVA 3H8EA 3QAYA 3T8WA 1ELLP 4PPZA 2HC9A 1BPNA 2GLFA 2HB6A 3SI0A 4YWYA 4DNCA 3WABA 3E0KA 3PP9A 4MHPA 4PQAA 1YK3A 4PK2A 4R87A 4KOWA 3QB8A 4MRIA 3PZJA 3LD2A 3FBUA 2R7HA 3A9LA 4KSAA 1XOVA 2P0WA 3LODA 3H5ZA 4K3NA 3ZJ0A 5KTDA 2ODFA 2OR4A 5GCNA 3S9LA 3NE8A 1F2OA 4MFQA 2J8MA 1Y9KA 3IU2A 4R7MA 4R57A 1FNOA 3N5FA 4RUHA 5IB9A 2ZEOA 1OBRA 3TFYA 2QYVA 1M4LA 1GYTA 4DYOA 3IFEA 4MBUA 3TC8A 1QQ9A 1M44A 1VGYA 3IJ3A 3V38A 4CAVA 8CPAA 2ZPAA 3RBUA 4ZY2A 2REFA 4K30A 3FVLA 2FL4A 3GYAA 2XEGA 4HNYB 4KOXA 3S6HA 2FIWA 4A94A 5I4MA 3SHPA 2DEAA 4NGNA 3CZXA
chains in the Genus database with same CATH topology
4UEZA 1DTDA 3CPAA 2QJ8A 3D68A 4A37A 3NFZA 3SJGA 1VHOA 3KI9A 3ISXA 2PJ7A 4ZI6A 2XEIA 4Q7AA 3LWUA 2C1CA 2FVGA 2POKA 5CPAA 4MHNA 2AFWA 4GM5A 1ZG8A 3H8GA 1YW4A 1LOKA 1JQGA 3QNVA 1LAPA 4FUUA 2V8VA 4DJLA 4Z65A 2PJ4A 3IIBA 4WWVA 1YSJA 4MHYA 4ZX8A 2BCOA 3S9NA 4OC2A 2PJ3A 3KASA 2PIYA 2AFSA 2RB7A 3DLJA 2PJAA 5K8OA 3D7GA 4OKOA 5J1QA 2GREA 4IK2A 3NH5A 4ZY1A 2PJBA 4X8IA 1LFWA 4MCQA 2XEFA 4P10A 4FWUA 4OC0A 3SJFA 3MN8A 1RTQA 4NGTA 2ZOFA 3LMSA 4UIBA 1CPXA 7CPAA 4PXCA 4MHZA 4G1PA 5HVFA 5K8MA 2V77A 2EK9A 1VHEA 2PJ2A 4OIDA 4PXEA 1CP7A 3CPXA 3FEDA 5CBMA 4OC1A 1ARMA 3B2YA 1F57A 2C6PA 2I3CA 2V8DA 2GLJA 3NA6A 4UIAA 1VIXA 4OC4A 3IWWA 2ZELA 3FH4A 4B6ZA 1H8LA 3RAMA 1BLLE 4H2KA 4OC5A 2WZNA 2ZEGA 2CIJA 2PVWA 3VATA 3WT4A 1R43A 4IAVA 3WC6A 5LRJA 2ZEPA 1R3NA 1ZLHA 1Z2LA 1LCPA 5JH9A 4X2TA 3VARA 3NH4A 3ISZA 4NGRA 1Y0YA 1TKJA 3IC1A 5D29A 1BPMA 4ONWA 2PJCA 4TNUA 3SI2A 2PCUA 3PB6X 3NH8A 4UEEA 2Q43A 1CX8A 2PJ6A 3B3CA 4WJBA 1EE3P 3GLJA 1XFOA 3FMCA 1AMPA 4OP4A 3BI0A 2JBKA 3SJEA 1FT7A 4PXBA 3KZWA 3PB8X 4AXVA 2V8HA 4MCRA 1PYTB 1TKFA 1YMEA 4UEFA 6CPAA 1LANA 4F9VA 1Z5RA 2CTBA 2AFOA 3PEIA 1UWYA 5F09A 5ELYA 4P6YA 3D7FA 1XBUA 5HVGA 1XMBA 1ELMP 4EFDA 3SJXA 1CPSA 3DGVA 3FJUA 4EWTA 3TX8A 2OOTA 5THWA 4MXUA 4OC3A 4OIWA 4TWEA 4X3RA 2GU2A 1AYEA 4P4DA 2AFUA 3L2NA 3KGQA 4UF4A 5LYLA 4FBEA 3BXMA 2PJ0A 2EWBA 5DS0A 2Q51A 3KHXA 3PFOA 3KQZA 4ZYQA 2XEJA 4P4JA 4NJRA 1CP6A 4ZX9A 5LRGA 3KL9A 1ZG7A 2BOAA 5HXDA 2ZENA 3FEEA 1ZG9A 5HVHA 3D4UA 2PJ9A 2O4HA 5K8NA 3FECA 4CPAA 4P4FA 4DUKA 1CG2A 4NGPA 3D7HA 2ZEEA 3MRUA 2Q4ZA 3BI1A 2V8GA 3V7ZA 3CDXA 5LYIA 4MMOA 4P4EA 3VH9A 3D67A 1KWMA 1Z8LA 3FF3A 4ZY0A 3PB9X 4F9UA 2AFZA 3PFEA 4R6TA 5LYFA 3GB0A 4JYWA 2PJ1A 3HLPA 5LYDA 1TF9A 3D66A 4A39A 1Y0RA 3S9MA 3JRUA 3PRTA 4MCSA 3PB4X 4KSIA 1ARLA 2ZEFA 3B7IA 4JZ0A 3CT9A 1IY7A 2ANPA 1IGBA 3B3VA 1CBXA 2WYRA 4BD9A 2RFHA 3GUXA 3B3WA 2AFMA 2IMOA 3K2KA 2PIZA 2C6GA 2G9DA 3WC7A 3D7DA 1DE4C 2CF4A 1Y7EA 3KHZA 1LAMA 3IO1A 5JGFA 4NGMA 4NFRA 3RZAA 4NGSA 1Q7LA 4PXDA 1HEEA 4P45A 3B3TA 3SI1A 2IJZA 2CTCA 3B3SA 2PRQA 2ZEHA 3KR4A 4O23A 3K9TA 4OMEA 1NSAA 1TKHA 2JEWA 2PJ5A 3KR5A 2C6CA 1HDUA 1YLOA 1HDQA 1TXRA 5LRKA 1TF8A 2BO9A 3PBBA 5K8PA 4IHMA 2JBJA 3PBEA 3HUVA 4EMEA 4MCPA 4P4BA 4YU9A 2IQ6A 3IEHA 2O53A 5D8NA 2ZOGA 1XJOA 4A38A 5JM6A 3WC5A 1F2PA 4P44A 2J9AA 3FX6A 1XRYA 3PB7X 2EK8A 4R76A 2ABZA 2QVPA 1BAVA 2NSMA 2PJ8A 4FAIA 4NJQA 2F8HA 1QMUA 3KQXA 4P4IA 2AFXA 3BHXA 2ZEDA 4W9YA 2VL1A 2PE3A 2ZEMA 1PCAA 3I1UA 4F8ZA 4R8FA 3H8FA 3B35A 1YW6A 4LQGA 4NGQA 2F7VA 2NYQA 1ZLIA 2PVVA 3H8EA 3T8WA 1ELLP 4PPZA 2HC9A 1BPNA 2GLFA 2HB6A 3SI0A 4YWYA 3WABA 4MHPA 4PQAA 4MRIA 4K3NA 2OR4A 3S9LA 1F2OA 4R7MA 1FNOA 3N5FA 4RUHA 5IB9A 2ZEOA 1OBRA 2QYVA 1M4LA 1GYTA 4DYOA 3IFEA 3TC8A 1QQ9A 1VGYA 3IJ3A 3V38A 8CPAA 3RBUA 4ZY2A 3FVLA 2XEGA 4A94A 5I4MA 2DEAA 4NGNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4UEZ A;  1DTD A;  3CPA A;  2QJ8 A;  3D68 A;  4A37 A;  3NFZ A;  3SJG A;  1VHO A;  3KI9 A;  3ISX A;  2PJ7 A;  4ZI6 A;  2XEI A;  4Q7A A;  3LWU A;  2C1C A;  2FVG A;  2POK A;  5CPA A;  4MHN A;  2AFW A;  4GM5 A;  1ZG8 A;  3H8G A;  1YW4 A;  1LOK A;  1JQG A;  3QNV A;  1LAP A;  4FUU A;  2V8V A;  4DJL A;  4Z65 A;  2PJ4 A;  3IIB A;  4WWV A;  1YSJ A;  4MHY A;  4ZX8 A;  2BCO A;  3S9N A;  4OC2 A;  2PJ3 A;  3KAS A;  2PIY A;  2AFS A;  2RB7 A;  3DLJ A;  2PJA A;  5K8O A;  3D7G A;  4OKO A;  5J1Q A;  2GRE A;  4IK2 A;  3NH5 A;  4ZY1 A;  2PJB A;  4X8I A;  1LFW A;  4MCQ A;  2XEF A;  4P10 A;  4FWU A;  4OC0 A;  3SJF A;  3MN8 A;  1RTQ A;  4NGT A;  2ZOF A;  3LMS A;  4UIB A;  1CPX A;  7CPA A;  4PXC A;  4MHZ A;  4G1P A;  5HVF A;  5K8M A;  2V77 A;  2EK9 A;  1VHE A;  2PJ2 A;  4OID A;  4PXE A;  1CP7 A;  3CPX A;  3FED A;  5CBM A;  4OC1 A;  1ARM A;  3B2Y A;  1F57 A;  2C6P A;  2I3C A;  2V8D A;  2GLJ A;  3NA6 A;  4UIA A;  1VIX A;  4OC4 A;  3IWW A;  2ZEL A;  3FH4 A;  4B6Z A;  1H8L A;  3RAM A;  1BLL E;  4H2K A;  4OC5 A;  2WZN A;  2ZEG A;  2CIJ A;  2PVW A;  3VAT A;  3WT4 A;  1R43 A;  4IAV A;  3WC6 A;  5LRJ A;  2ZEP A;  1R3N A;  1ZLH A;  1Z2L A;  1LCP A;  5JH9 A;  4X2T A;  3VAR A;  3NH4 A;  3ISZ A;  4NGR A;  1Y0Y A;  1TKJ A;  3IC1 A;  5D29 A;  1BPM A;  4ONW A;  2PJC A;  4TNU A;  3SI2 A;  2PCU A;  3PB6 X;  3NH8 A;  4UEE A;  2Q43 A;  1CX8 A;  2PJ6 A;  3B3C A;  4WJB A;  1EE3 P;  3GLJ A;  1XFO A;  3FMC A;  1AMP A;  4OP4 A;  3BI0 A;  2JBK A;  3SJE A;  1FT7 A;  4PXB A;  3KZW A;  3PB8 X;  4AXV A;  2V8H A;  4MCR A;  1PYT B;  1TKF A;  1YME A;  4UEF A;  6CPA A;  1LAN A;  4F9V A;  1Z5R A;  2CTB A;  2AFO A;  3PEI A;  1UWY A;  5F09 A;  5ELY A;  4P6Y A;  3D7F A;  1XBU A;  5HVG A;  1XMB A;  1ELM P;  4EFD A;  3SJX A;  1CPS A;  3DGV A;  3FJU A;  4EWT A;  3TX8 A;  2OOT A;  5THW A;  4MXU A;  4OC3 A;  4OIW A;  4TWE A;  4X3R A;  2GU2 A;  1AYE A;  4P4D A;  2AFU A;  3L2N A;  3KGQ A;  4UF4 A;  5LYL A;  4FBE A;  3BXM A;  2PJ0 A;  2EWB A;  5DS0 A;  2Q51 A;  3KHX A;  3PFO A;  3KQZ A;  4ZYQ A;  2XEJ A;  4P4J A;  4NJR A;  1CP6 A;  4ZX9 A;  5LRG A;  3KL9 A;  1ZG7 A;  2BOA A;  5HXD A;  2ZEN A;  3FEE A;  1ZG9 A;  5HVH A;  3D4U A;  2PJ9 A;  2O4H A;  5K8N A;  3FEC A;  4CPA A;  4P4F A;  4DUK A;  1CG2 A;  4NGP A;  3D7H A;  2ZEE A;  3MRU A;  2Q4Z A;  3BI1 A;  2V8G A;  3V7Z A;  3CDX A;  5LYI A;  4MMO A;  4P4E A;  3VH9 A;  3D67 A;  1KWM A;  1Z8L A;  3FF3 A;  4ZY0 A;  3PB9 X;  4F9U A;  2AFZ A;  3PFE A;  4R6T A;  5LYF A;  3GB0 A;  4JYW A;  2PJ1 A;  3HLP A;  5LYD A;  1TF9 A;  3D66 A;  4A39 A;  1Y0R A;  3S9M A;  3JRU A;  3PRT A;  4MCS A;  3PB4 X;  4KSI A;  1ARL A;  2ZEF A;  3B7I A;  4JZ0 A;  3CT9 A;  1IY7 A;  2ANP A;  1IGB A;  3B3V A;  1CBX A;  2WYR A;  4BD9 A;  2RFH A;  3GUX A;  3B3W A;  2AFM A;  2IMO A;  3K2K A;  2PIZ A;  2C6G A;  2G9D A;  3WC7 A;  3D7D A;  1DE4 C;  2CF4 A;  1Y7E A;  3KHZ A;  1LAM A;  3IO1 A;  5JGF A;  4NGM A;  4NFR A;  3RZA A;  4NGS A;  1Q7L A;  4PXD A;  1HEE A;  4P45 A;  3B3T A;  3SI1 A;  2IJZ A;  2CTC A;  3B3S A;  2PRQ A;  2ZEH A;  3KR4 A;  4O23 A;  3K9T A;  4OME A;  1NSA A;  1TKH A;  2JEW A;  2PJ5 A;  3KR5 A;  2C6C A;  1HDU A;  1YLO A;  1HDQ A;  1TXR A;  5LRK A;  1TF8 A;  2BO9 A;  3PBB A;  5K8P A;  4IHM A;  2JBJ A;  3PBE A;  3HUV A;  4EME A;  4MCP A;  4P4B A;  4YU9 A;  2IQ6 A;  3IEH A;  2O53 A;  5D8N A;  2ZOG A;  1XJO A;  4A38 A;  5JM6 A;  3WC5 A;  1F2P A;  4P44 A;  2J9A A;  3FX6 A;  1XRY A;  3PB7 X;  2EK8 A;  4R76 A;  2ABZ A;  2QVP A;  1BAV A;  2NSM A;  2PJ8 A;  4FAI A;  4NJQ A;  2F8H A;  1QMU A;  3KQX A;  4P4I A;  2AFX A;  3BHX A;  2ZED A;  4W9Y A;  2VL1 A;  2PE3 A;  2ZEM A;  1PCA A;  3I1U A;  4F8Z A;  4R8F A;  3H8F A;  3B35 A;  1YW6 A;  4LQG A;  4NGQ A;  2F7V A;  2NYQ A;  1ZLI A;  2PVV A;  3H8E A;  3T8W A;  1ELL P;  4PPZ A;  2HC9 A;  1BPN A;  2GLF A;  2HB6 A;  3SI0 A;  4YWY A;  3WAB A;  4MHP A;  4PQA A;  4MRI A;  4K3N A;  2OR4 A;  3S9L A;  1F2O A;  4R7M A;  1FNO A;  3N5F A;  4RUH A;  5IB9 A;  2ZEO A;  1OBR A;  2QYV A;  1M4L A;  1GYT A;  4DYO A;  3IFE A;  3TC8 A;  1QQ9 A;  1VGY A;  3IJ3 A;  3V38 A;  8CPA A;  3RBU A;  4ZY2 A;  3FVL A;  2XEG A;  4A94 A;  5I4M A;  2DEA A;  4NGN A; 
#chains in the Genus database with same CATH topology
 1IOI A;  1Q2Y A;  2BSW A;  4UEZ A;  1DTD A;  2ZW4 A;  1QST A;  5C82 A;  3CPA A;  2QJ8 A;  2YNE A;  3EXN A;  4MFZ A;  3D68 A;  4A37 A;  2VI7 A;  3T9Y A;  3NFZ A;  3SJG A;  1VHO A;  2VEZ A;  3KI9 A;  2FT0 A;  2Z10 A;  2WPX A;  2PJ7 A;  3ISX A;  4ZI6 A;  4L8A A;  1XF8 A;  3P2F A;  2BEI A;  4YRH A;  4M6G A;  4B11 A;  1IYL A;  2XEI A;  1YLE A;  3LWU A;  4Q7A A;  5G22 A;  2C1C A;  2FVG A;  1FY7 A;  1QSM A;  2POK A;  5CPA A;  4F0Y A;  1S7L A;  2AFW A;  4GM5 A;  4MHN A;  1ZG8 A;  2VZY A;  1SQH A;  2JEV A;  3DNS A;  1ON0 A;  3DR6 A;  3H8G A;  1YW4 A;  1YR0 A;  2Q7S A;  1LOK A;  1JQG A;  3QNV A;  4LQ6 A;  4CGP A;  3CXS A;  4Y49 B;  1LAP A;  3SXO A;  2JDC A;  4CAE A;  3TOA A;  5J8F A;  4FUU A;  2V8V A;  1QSR A;  3QAH A;  1LRZ A;  4B12 A;  1M4D A;  4DJL A;  4BIN A;  4Z65 A;  2FIA A;  2PJ4 A;  3IIB A;  4WWV A;  1YSJ A;  4MHY A;  4ZX8 A;  2BCO A;  3P2H A;  4OC2 A;  4AVB A;  3S9N A;  2PJ3 A;  3KAS A;  2WUU A;  4A33 A;  2PIY A;  2AFS A;  2YND A;  2RB7 A;  4MHD A;  1K4J A;  3DLJ A;  1PU9 A;  2PJA A;  3D7G A;  5K8O A;  4OKO A;  4KVX A;  5J1Q A;  1B87 A;  1IOF A;  4ZGY B;  2GRE A;  1I12 A;  3I9S A;  4NSQ A;  1Y7R A;  4QUS A;  4AVC A;  2OH1 A;  4IK2 A;  4GS4 A;  1XIX A;  2PRB A;  3NH5 A;  4ZY1 A;  2KCW A;  4KZT A;  2PJB A;  3KKW A;  4X8I A;  3FYN A;  1LFW A;  1XEB A;  4MCQ A;  1P4N A;  2XEF A;  4P10 A;  4XNH B;  3TE4 A;  2H5M A;  2Z3O A;  4FWU A;  2QIR A;  1B6B A;  2OZH A;  2ZW7 A;  4H6U A;  4M6H A;  4OC0 A;  2EBJ A;  2VXK A;  3SJF A;  3W91 A;  2YNC C;  3MN8 A;  4CGL A;  1RTQ A;  4NGT A;  2Q4V A;  2ZXV A;  2VQY A;  2ZOF A;  3LMS A;  4JD6 A;  4KUA A;  4UIB A;  4GXH A;  4C68 A;  3CXQ A;  1CPX A;  5F46 A;  2B4D B;  4PK3 A;  4CGM A;  4JJX A;  5J8C A;  7CPA A;  4B5O A;  5CNP A;  3F5B A;  4PXC A;  4MHZ A;  4G1P A;  1AUG A;  4FD4 A;  5HVF A;  4XPK A;  3B8G A;  4R9M A;  2Z3L A;  3CXP A;  5K8M A;  2V77 A;  2EK9 A;  1VHE A;  2PJ2 A;  4OID A;  3FNC A;  4PXE A;  2HUZ A;  5C88 A;  1CP7 A;  2DXQ A;  3CPX A;  5KTA A;  3MGD A;  2Z3P A;  3FED A;  4KLV A;  5CBM A;  4OC1 A;  3BJ7 A;  3TTH A;  1ARM A;  3B2Y A;  4U9Z A;  4CGN A;  2FXF A;  1F57 A;  1KUX A;  2C6P A;  1M1D A;  2I3C A;  3D2P A;  3TO9 A;  4Y49 C;  2V8D A;  2GLJ A;  1CJW A;  3NA6 A;  4ZBG A;  4UIA A;  2PQ8 A;  1VIX A;  4OC4 A;  3D2M A;  3I3G A;  2B58 A;  3IWW A;  1KZF A;  3DSB A;  2ZEL A;  3FH4 A;  3R9G A;  4OLL A;  2VZZ A;  4B6Z A;  3EFA A;  1H8L A;  2Q7B A;  4E2A A;  1IU8 A;  3RAM A;  1BLL E;  2FSR A;  4H2K A;  4JXR A;  3VWE A;  4FD5 A;  4OC5 A;  4II9 A;  4X5K A;  2WZN A;  5IV0 A;  4HKF A;  2R1I A;  3ZZI A;  1U6M A;  2ZEG A;  2CIJ A;  2PVW A;  4UFX A;  5AGE A;  4CGO A;  4XPD B;  3VAT A;  1I1D A;  3WT4 A;  3C26 A;  1R43 A;  2C27 A;  4IAV A;  3RNZ A;  3TT2 A;  3WC6 A;  1PUA A;  2G3T A;  5LRJ A;  2ZEP A;  3SXN A;  1R3N A;  1ZLH A;  5BWA B;  4Q38 A;  1Z2L A;  4MI4 A;  1M4G A;  2B5G B;  1LCP A;  3OWC A;  5DWM A;  5JH9 A;  4MY3 A;  4A32 A;  4X2T A;  3VAR A;  1UFH A;  2R8V A;  3NH4 A;  3LAC A;  3ISZ A;  4NGR A;  1TKJ A;  1Y0Y A;  3W6S A;  3TO7 A;  3IC1 A;  5H86 A;  4HNX B;  1Z9U A;  2REE A;  4JLY A;  5D29 A;  4NF1 A;  1BPM A;  4ONW A;  2A4N A;  2PJC A;  4TNU A;  2PCU A;  3PB6 X;  3NH8 A;  3SI2 A;  1Z8X A;  4PSX A;  2B5G A;  4UEE A;  2Q43 A;  1CX8 A;  2PJ6 A;  3B3C A;  4WJB A;  4C2Y A;  1EE3 P;  3GLJ A;  1XFO A;  1OZP A;  5G21 A;  3FMC A;  1AMP A;  4OP4 A;  2HQY A;  3BI0 A;  2JBK A;  2Z3K A;  3SJE A;  1FT7 A;  4PXB A;  3KZW A;  3PB8 X;  4AXV A;  2PDO A;  3FB3 A;  2V8H A;  4MCR A;  1BO4 A;  1PYT B;  1TKF A;  1YME A;  2OU2 A;  5FVJ A;  4UEF A;  4CRY B;  4CYN A;  4E8O A;  1LAN A;  3G8W A;  3RYO A;  4EVY A;  3RO0 A;  6CPA A;  2JDD A;  4U5Y A;  2ARH A;  4C7H A;  5A28 A;  2P6F A;  4F9V A;  1Z5R A;  1S3Z A;  2CTB A;  5JPH A;  2AFO A;  1S7F A;  1UWY A;  3PEI A;  5F09 A;  2I79 A;  4KOU A;  2D4O A;  3JTK A;  1N71 A;  5A27 A;  1XE4 A;  1P0H A;  2PR8 A;  5ELY A;  4P6Y A;  4LUA A;  3R9E A;  3D7F A;  1X12 A;  2OZG A;  4HPS A;  1XBU A;  4XPL A;  1IB1 E;  2FE7 A;  3IWG A;  5HVG A;  1XMB A;  1WWZ A;  2EUI A;  4NEX A;  1ELM P;  4Q36 A;  2VBQ A;  3D8P A;  4PV6 A;  1TIQ A;  3BJ8 A;  3W6X A;  2P6G A;  4EFD A;  1IYK A;  5IX3 A;  1YQE A;  3SJX A;  1CPS A;  3DGV A;  2EVN A;  3FJU A;  4MY0 A;  4R3L A;  2PR1 A;  5DWN A;  4CRZ B;  4EWT A;  1GHE A;  4PSW A;  3TX8 A;  2OOT A;  1I21 A;  4UBR A;  5THW A;  1MK4 A;  1J4J A;  4MXU A;  2YGW A;  2OZU A;  4OC3 A;  2BUE A;  4OIW A;  4TWE A;  4BBH A;  4X3R A;  2GU2 A;  1AYE A;  4P4D A;  2AFU A;  4RI1 A;  3L2N A;  4UFW A;  4CAX A;  3KGQ A;  4QVT A;  4R3K A;  4UFV A;  4UF4 A;  4QB9 A;  5LYL A;  4F0X A;  4FBE A;  3BXM A;  2PJ0 A;  3S6K A;  2EWB A;  2FS5 A;  3PGP A;  5DS0 A;  2Q51 A;  3GKR A;  4C2X A;  4CS0 B;  4KVO E;  3KHX A;  3PFO A;  5F48 A;  1R57 A;  3KQZ A;  3K9U A;  4A2Z A;  5G20 A;  4E0A A;  4ZYQ A;  2XEJ A;  4P4J A;  5EBV A;  4NJR A;  1CP6 A;  4JWP A;  1MJ9 A;  4ZX9 A;  4KOV A;  5LRG A;  4CAW A;  4OAD A;  1XMT A;  3KL9 A;  3FRM A;  2JLM A;  1ZG7 A;  2B3U A;  2X7B A;  2Z0Z A;  1Z4E A;  2BOA A;  2R98 A;  3F0A A;  5HXD A;  5AG4 A;  2ZEN A;  3FEE A;  1M4I A;  1ZG9 A;  5HVH A;  3D4U A;  2J8N A;  4U9Y A;  1WK4 A;  4CYP A;  4KS9 A;  5H84 A;  2PJ9 A;  2O4H A;  5K8N A;  3FEC A;  3N7Z A;  4CPA A;  4P4F A;  4XPD C;  2Q04 A;  4FD7 A;  1IIC A;  4DUK A;  1CG2 A;  4NGP A;  2Q44 A;  2OB0 A;  3D7H A;  4MFL A;  2ZEE A;  3MRU A;  4XNH C;  2Q4Z A;  3BI1 A;  2V8G A;  3V7Z A;  3CDX A;  3S6F A;  4KOR A;  5LYI A;  2B4B A;  2FCK A;  4A31 A;  2GIV A;  4H89 A;  4MMO A;  5HMN A;  4C7I A;  4KVM E;  4P4E A;  3VH9 A;  2HV2 A;  3D67 A;  1KWM A;  1Z8L A;  3BLN A;  3FF3 A;  4KLW A;  4UWJ A;  2BL1 A;  4YGO A;  2EO8 A;  3PB9 X;  4ORF A;  4ZY0 A;  2P6E A;  5AG6 A;  4B5P A;  4F9U A;  1V0C A;  2AFZ A;  1Q2C A;  3PFE A;  4R6T A;  4YFJ A;  3IWE A;  3IU1 A;  2DF5 A;  3D3S A;  1YGH A;  5LYF A;  3GB0 A;  4JYW A;  2PJ1 A;  3HLP A;  4QC6 A;  1L0C A;  2CXA A;  1NMT A;  5LYD A;  1TF9 A;  3DDD A;  2B4D A;  1YRE A;  1Q2D A;  3EO4 A;  3FIX A;  3JUW A;  1KUY A;  3D66 A;  4A39 A;  1NSL A;  1Y0R A;  3S9M A;  3NE7 A;  2O28 A;  4B5P B;  4IUS A;  4CYQ A;  3TO6 A;  3JRU A;  4B14 A;  2CNS A;  3PRT A;  3WR7 A;  2DPS A;  3FXT A;  4MCS A;  3PB4 X;  4UCM A;  1MJB A;  4KSI A;  4H6Z A;  2ZW5 A;  3F8K A;  4M3S A;  1ARL A;  2ZEF A;  5I0C A;  3B7I A;  4I49 A;  2CNM A;  4JZ0 A;  2G3A A;  5G1Z A;  3CT9 A;  2GAN A;  3GIU A;  1IY7 A;  2ANP A;  1IGB A;  3B3V A;  1CBX A;  2WYR A;  1Y9W A;  4BD9 A;  2RFH A;  5IB0 A;  3GUX A;  3B3W A;  5ISV A;  2WPW A;  4CYO A;  2Z3M A;  2AFM A;  2IMO A;  3K2K A;  2PIZ A;  1A2Z A;  2GE3 A;  4J3G A;  2C6G A;  1Z8T A;  2G9D A;  5AG7 A;  3WC7 A;  5AG5 A;  3D7D A;  3EC4 A;  1DE4 C;  1KUV A;  3TOB A;  2CF4 A;  2NMT A;  1Y7E A;  4AVA A;  3KHZ A;  1LAM A;  3IO1 A;  2Q4Y A;  5HH1 A;  4ONU A;  5JGF A;  2Z11 A;  1Z8W A;  4NFR A;  4NGM A;  3RZA A;  4NGS A;  1Q7L A;  4PXD A;  1HEE A;  4P45 A;  3B3T A;  5F47 A;  3SI1 A;  2IJZ A;  2CTC A;  1S7K A;  4MJ8 A;  2ATR A;  3B3S A;  2PRQ A;  4HNW B;  1JWQ A;  2ZEH A;  3KR4 A;  3DR8 A;  4KSF A;  1QSO A;  4MFJ A;  5F49 A;  4F6A A;  4O23 A;  3K9T A;  3R1K A;  3VWD A;  1S60 A;  1MJA A;  2F5I A;  1IID A;  2RC4 A;  2YNC A;  1NSA A;  4OME A;  1TKH A;  2JEW A;  2PJ5 A;  3KR5 A;  4CAF A;  2C6C A;  1HDU A;  1YLO A;  1HDQ A;  2WSA A;  1TXR A;  2CY2 A;  5LRK A;  4MFK A;  1TF8 A;  2BO9 A;  3GY9 A;  4C2Z A;  4KOY A;  3PBB A;  2J8R A;  4AB7 A;  5K8P A;  4IHM A;  4UCN A;  2IL4 A;  2JBJ A;  2I00 A;  3PBE A;  1NE9 A;  3HUV A;  4FD6 A;  4M6I A;  4EME A;  4RS2 A;  4MCP A;  2Y0M A;  1RXT A;  4LX9 A;  4QBJ A;  3R9F A;  4P4B A;  2D4P A;  4UA3 A;  4YU9 A;  2IQ6 A;  4M85 A;  3IEH A;  2AE6 A;  2O53 A;  4KUB A;  5D8N A;  2Q0Y A;  2ZOG A;  1XJO A;  3V8I A;  4A38 A;  2QEC A;  4KOS A;  4L89 A;  5JM6 A;  3TCV A;  3EY5 A;  3WC5 A;  2QML A;  1F2P A;  4P44 A;  3S6G A;  2CNT A;  2J9A A;  1YX0 A;  3FX6 A;  3T90 A;  1XRY A;  2DPT A;  5EC4 A;  2PC1 A;  1S5K A;  2EK8 A;  3PB7 X;  4R76 A;  1Z4R A;  2ABZ A;  4AG9 A;  4UCP A;  2QVP A;  1YVK A;  4NCZ A;  1BAV A;  3UY5 A;  1YVO A;  2NSM A;  4AG7 A;  4MFP A;  2PJ8 A;  3G3S A;  4FAI A;  1BOB A;  4KOT A;  4NJQ A;  4A30 A;  2F8H A;  2GFQ A;  2ZW6 A;  4NXY A;  1S7N A;  4BMH A;  3JVN A;  5JQ4 A;  5EMI A;  1RO5 A;  1QMU A;  4B13 A;  1ZO0 A;  2B3V A;  4OAE A;  3KQX A;  2Z3N A;  4P4I A;  4A95 A;  3R95 A;  4B10 A;  2AFX A;  4IF5 A;  4RN7 A;  2G0B A;  5E96 A;  3BHX A;  2ZED A;  4W9Y A;  2VL1 A;  1X10 A;  4JXQ A;  4UWI A;  1VHS A;  2PE3 A;  1PCA A;  2PSW A;  2ZEM A;  3I1U A;  4R8F A;  3R96 A;  4F8Z A;  3H8F A;  2K5T A;  3B35 A;  1YW6 A;  4LQG A;  4NGQ A;  2F7V A;  1CM0 A;  1VKC A;  2AJ6 A;  3IGR A;  3H4Q A;  1QSN A;  2NYQ A;  5KTC A;  1ZLI A;  2PVV A;  3H8E A;  3QAY A;  3T8W A;  1ELL P;  4PPZ A;  2HC9 A;  1BPN A;  2GLF A;  2HB6 A;  3SI0 A;  4YWY A;  4DNC A;  3WAB A;  3E0K A;  3PP9 A;  4MHP A;  4PQA A;  1YK3 A;  4PK2 A;  4R87 A;  4KOW A;  3QB8 A;  4MRI A;  3PZJ A;  3LD2 A;  3FBU A;  2R7H A;  3A9L A;  4KSA A;  1XOV A;  2P0W A;  3LOD A;  3H5Z A;  4K3N A;  3ZJ0 A;  5KTD A;  2ODF A;  2OR4 A;  5GCN A;  3S9L A;  3NE8 A;  1F2O A;  4MFQ A;  2J8M A;  1Y9K A;  3IU2 A;  4R7M A;  4R57 A;  1FNO A;  3N5F A;  4RUH A;  5IB9 A;  2ZEO A;  1OBR A;  3TFY A;  2QYV A;  1M4L A;  1GYT A;  4DYO A;  3IFE A;  4MBU A;  3TC8 A;  1QQ9 A;  1M44 A;  1VGY A;  3IJ3 A;  3V38 A;  4CAV A;  8CPA A;  2ZPA A;  3RBU A;  4ZY2 A;  2REF A;  4K30 A;  3FVL A;  2FL4 A;  3GYA A;  2XEG A;  4HNY B;  4KOX A;  3S6H A;  2FIW A;  4A94 A;  5I4M A;  3SHP A;  2DEA A;  4NGN A;  3CZX A; 
#chains in the Genus database with same CATH homology
 4UEZ A;  1DTD A;  3CPA A;  2QJ8 A;  3D68 A;  4A37 A;  3NFZ A;  3SJG A;  1VHO A;  3KI9 A;  3ISX A;  2PJ7 A;  4ZI6 A;  2XEI A;  4Q7A A;  3LWU A;  2C1C A;  2FVG A;  2POK A;  5CPA A;  4MHN A;  2AFW A;  4GM5 A;  1ZG8 A;  3H8G A;  1YW4 A;  1LOK A;  1JQG A;  3QNV A;  1LAP A;  4FUU A;  2V8V A;  4DJL A;  4Z65 A;  2PJ4 A;  3IIB A;  4WWV A;  1YSJ A;  4MHY A;  4ZX8 A;  2BCO A;  3S9N A;  4OC2 A;  2PJ3 A;  3KAS A;  2PIY A;  2AFS A;  2RB7 A;  3DLJ A;  2PJA A;  5K8O A;  3D7G A;  4OKO A;  5J1Q A;  2GRE A;  4IK2 A;  3NH5 A;  4ZY1 A;  2PJB A;  4X8I A;  1LFW A;  4MCQ A;  2XEF A;  4P10 A;  4FWU A;  4OC0 A;  3SJF A;  3MN8 A;  1RTQ A;  4NGT A;  2ZOF A;  3LMS A;  4UIB A;  1CPX A;  7CPA A;  4PXC A;  4MHZ A;  4G1P A;  5HVF A;  5K8M A;  2V77 A;  2EK9 A;  1VHE A;  2PJ2 A;  4OID A;  4PXE A;  1CP7 A;  3CPX A;  3FED A;  5CBM A;  4OC1 A;  1ARM A;  3B2Y A;  1F57 A;  2C6P A;  2I3C A;  2V8D A;  2GLJ A;  3NA6 A;  4UIA A;  1VIX A;  4OC4 A;  3IWW A;  2ZEL A;  3FH4 A;  4B6Z A;  1H8L A;  3RAM A;  1BLL E;  4H2K A;  4OC5 A;  2WZN A;  2ZEG A;  2CIJ A;  2PVW A;  3VAT A;  3WT4 A;  1R43 A;  4IAV A;  3WC6 A;  5LRJ A;  2ZEP A;  1R3N A;  1ZLH A;  1Z2L A;  1LCP A;  5JH9 A;  4X2T A;  3VAR A;  3NH4 A;  3ISZ A;  4NGR A;  1Y0Y A;  1TKJ A;  3IC1 A;  5D29 A;  1BPM A;  4ONW A;  2PJC A;  4TNU A;  3SI2 A;  2PCU A;  3PB6 X;  3NH8 A;  4UEE A;  2Q43 A;  1CX8 A;  2PJ6 A;  3B3C A;  4WJB A;  1EE3 P;  3GLJ A;  1XFO A;  3FMC A;  1AMP A;  4OP4 A;  3BI0 A;  2JBK A;  3SJE A;  1FT7 A;  4PXB A;  3KZW A;  3PB8 X;  4AXV A;  2V8H A;  4MCR A;  1PYT B;  1TKF A;  1YME A;  4UEF A;  6CPA A;  1LAN A;  4F9V A;  1Z5R A;  2CTB A;  2AFO A;  3PEI A;  1UWY A;  5F09 A;  5ELY A;  4P6Y A;  3D7F A;  1XBU A;  5HVG A;  1XMB A;  1ELM P;  4EFD A;  3SJX A;  1CPS A;  3DGV A;  3FJU A;  4EWT A;  3TX8 A;  2OOT A;  5THW A;  4MXU A;  4OC3 A;  4OIW A;  4TWE A;  4X3R A;  2GU2 A;  1AYE A;  4P4D A;  2AFU A;  3L2N A;  3KGQ A;  4UF4 A;  5LYL A;  4FBE A;  3BXM A;  2PJ0 A;  2EWB A;  5DS0 A;  2Q51 A;  3KHX A;  3PFO A;  3KQZ A;  4ZYQ A;  2XEJ A;  4P4J A;  4NJR A;  1CP6 A;  4ZX9 A;  5LRG A;  3KL9 A;  1ZG7 A;  2BOA A;  5HXD A;  2ZEN A;  3FEE A;  1ZG9 A;  5HVH A;  3D4U A;  2PJ9 A;  2O4H A;  5K8N A;  3FEC A;  4CPA A;  4P4F A;  4DUK A;  1CG2 A;  4NGP A;  3D7H A;  2ZEE A;  3MRU A;  2Q4Z A;  3BI1 A;  2V8G A;  3V7Z A;  3CDX A;  5LYI A;  4MMO A;  4P4E A;  3VH9 A;  3D67 A;  1KWM A;  1Z8L A;  3FF3 A;  4ZY0 A;  3PB9 X;  4F9U A;  2AFZ A;  3PFE A;  4R6T A;  5LYF A;  3GB0 A;  4JYW A;  2PJ1 A;  3HLP A;  5LYD A;  1TF9 A;  3D66 A;  4A39 A;  1Y0R A;  3S9M A;  3JRU A;  3PRT A;  4MCS A;  3PB4 X;  4KSI A;  1ARL A;  2ZEF A;  3B7I A;  4JZ0 A;  3CT9 A;  1IY7 A;  2ANP A;  1IGB A;  3B3V A;  1CBX A;  2WYR A;  4BD9 A;  2RFH A;  3GUX A;  3B3W A;  2AFM A;  2IMO A;  3K2K A;  2PIZ A;  2C6G A;  2G9D A;  3WC7 A;  3D7D A;  1DE4 C;  2CF4 A;  1Y7E A;  3KHZ A;  1LAM A;  3IO1 A;  5JGF A;  4NGM A;  4NFR A;  3RZA A;  4NGS A;  1Q7L A;  4PXD A;  1HEE A;  4P45 A;  3B3T A;  3SI1 A;  2IJZ A;  2CTC A;  3B3S A;  2PRQ A;  2ZEH A;  3KR4 A;  4O23 A;  3K9T A;  4OME A;  1NSA A;  1TKH A;  2JEW A;  2PJ5 A;  3KR5 A;  2C6C A;  1HDU A;  1YLO A;  1HDQ A;  1TXR A;  5LRK A;  1TF8 A;  2BO9 A;  3PBB A;  5K8P A;  4IHM A;  2JBJ A;  3PBE A;  3HUV A;  4EME A;  4MCP A;  4P4B A;  4YU9 A;  2IQ6 A;  3IEH A;  2O53 A;  5D8N A;  2ZOG A;  1XJO A;  4A38 A;  5JM6 A;  3WC5 A;  1F2P A;  4P44 A;  2J9A A;  3FX6 A;  1XRY A;  3PB7 X;  2EK8 A;  4R76 A;  2ABZ A;  2QVP A;  1BAV A;  2NSM A;  2PJ8 A;  4FAI A;  4NJQ A;  2F8H A;  1QMU A;  3KQX A;  4P4I A;  2AFX A;  3BHX A;  2ZED A;  4W9Y A;  2VL1 A;  2PE3 A;  2ZEM A;  1PCA A;  3I1U A;  4F8Z A;  4R8F A;  3H8F A;  3B35 A;  1YW6 A;  4LQG A;  4NGQ A;  2F7V A;  2NYQ A;  1ZLI A;  2PVV A;  3H8E A;  3T8W A;  1ELL P;  4PPZ A;  2HC9 A;  1BPN A;  2GLF A;  2HB6 A;  3SI0 A;  4YWY A;  3WAB A;  4MHP A;  4PQA A;  4MRI A;  4K3N A;  2OR4 A;  3S9L A;  1F2O A;  4R7M A;  1FNO A;  3N5F A;  4RUH A;  5IB9 A;  2ZEO A;  1OBR A;  2QYV A;  1M4L A;  1GYT A;  4DYO A;  3IFE A;  3TC8 A;  1QQ9 A;  1VGY A;  3IJ3 A;  3V38 A;  8CPA A;  3RBU A;  4ZY2 A;  3FVL A;  2XEG A;  4A94 A;  5I4M A;  2DEA A;  4NGN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...