2NYQA

Structure of vibrio proteolyticus aminopeptidase with a bound trp fragment of dlwcf
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
291
structure length
291
Chain Sequence
b'MPPITQQATVTAWLPQVDASQITGTISSLESFTNRFYTTTSGAQASDWIASEWQALSASLPNASVKQVSHSGYNQKSVVMTITGSEAPDEWIVIGGHLDSTIGSHTNEQSVAPGADDDASGIAAVTEVIRVLSENNFQPKRSIAFMAYAAEEVGLRGSQDLANQYKSEGKNVVSALQLDMTNYKGSAQDVVFITDYTDSNFTQYLTQLMDEYLPSLTYGFDTCGYACSDHASWHNAGYPAAMPFESKFNDYNPRIHTTQDTLANSDPTGSHAKKFTQLGLAYAIEMGSATG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aminopeptidase
publication title Substrate recognition by the leucine aminopeptidase from Vibrio proteolyticus
rcsb
molecule tags Hydrolase
total genus 111
structure length 291
sequence length 291
ec nomenclature ec 3.4.11.10: Bacterial leucyl aminopeptidase.
pdb deposition date 2006-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 2nyqA00
3B3VA 7CPAA 2C6CA 3N5FA 4PXEA 2JBJA 2XEFA 1ZLIA 1FNOA 5HVHA 2ZOGA 3NH5A 2ZENA 4GM5A 2PCUA 4UIBA 1TKFA 4OP4A 4NGNA 4NGMA 2PJAA 5I4MA 5LYDA 5JGFA 3D4UA 2PJ4A 3KGQA 2HC9A 3SI0A 2ZEEA 2PJCA 1HEEA 3SJXA 4DYOA 1JQGA 3TX8A 3FEEA 1ARMA 3B35A 2PIZA 4IAVA 3B3WA 3CDXA 2PJ0A 2XEIA 4OC5A 1YW6A 3SI2A 1BPNA 1IY7A 2G9DA 1YLOA 3ISXA 3WC7A 3I1UA 3S9NA 3FEDA 4H2KA 3D7FA 4FWUA 3PB8X 3B3TA 4KSIA 4NJQA 3D7DA 5K8MA 4A39A 3CT9A 4R7MA 1GYTA 1KWMA 1XMBA 2I3CA 5ELYA 4OC0A 2XEGA 5HVGA 4ONWA 4A37A 3D7GA 3RBUA 1LAMA 3GLJA 3KL9A 3B3CA 5LYIA 3ISZA 3SI1A 4F9UA 2CTCA 4EMEA 3S9MA 1CP7A 2NYQA 3PBEA 4ZX8A 3KASA 5JH9A 3DLJA 4P4BA 3PB9X 1CPSA 2GU2A 4R8FA 3HLPA 4B6ZA 2C6GA 1UWYA 1F2PA 4WWVA 4W9YA 1VGYA 5K8PA 2AFMA 1XFOA 4LQGA 5J1QA 4NGSA 3PB4X 2JEWA 4K3NA 4MHYA 2GREA 3FH4A 4A94A 4OKOA 2QJ8A 8CPAA 2PJ8A 4O23A 4TNUA 3V7ZA 4G1PA 4CPAA 2F7VA 3K2KA 5D8NA 3IFEA 6CPAA 1NSAA 1ARLA 4NGTA 4NJRA 1FT7A 2DEAA 1HDUA 4FAIA 1Z5RA 2V8DA 3PRTA 3D67A 1BAVA 3VATA 4BD9A 4MCQA 3PBBA 2ZEDA 4UEEA 3HUVA 3KHZA 4F9VA 4OC4A 3L2NA 4OC2A 2Q51A 5D29A 4FBEA 3FJUA 2AFWA 3IO1A 4DJLA 3KQXA 4P6YA 2IQ6A 1ELMP 3CPXA 2PJ7A 3JRUA 2NSMA 3MN8A 3VARA 1CBXA 1ELLP 2POKA 4JZ0A 3RAMA 4ZI6A 3V38A 1ZG7A 3KZWA 4ZY0A 2ZEGA 3BHXA 3WABA 4X3RA 2F8HA 2OR4A 2ZOFA 3PB6X 3FMCA 4ZX9A 4R6TA 5HVFA 1HDQA 3NH4A 4X2TA 3IEHA 4UEFA 2PJ9A 1VHOA 5DS0A 2PJBA 3BI0A 5F09A 2C6PA 4IK2A 4MHNA 3KI9A 1H8LA 4P10A 4P4FA 2AFXA 3H8EA 4MMOA 4RUHA 4JYWA 3PEIA 5LRJA 2BO9A 4Z65A 2ZEFA 2BOAA 3IC1A 3SJGA 4PXBA 2CTBA 1LFWA 3WC6A 5LRGA 1LOKA 4AXVA 1DTDA 2PIYA 4NGRA 4OMEA 1AYEA 2FVGA 3GUXA 3LWUA 4YU9A 3MRUA 2BCOA 2V8HA 1Z2LA 4TWEA 2XEJA 5K8OA 1Q7LA 3D68A 5K8NA 3H8FA 3D66A 1QMUA 3S9LA 5CPAA 3NH8A 2VL1A 3NA6A 1F2OA 1TKJA 1R43A 2C1CA 2GLJA 2IJZA 3RZAA 3NFZA 2AFOA 2WZNA 3QNVA 2QVPA 4PXDA 1PYTB 4X8IA 2QYVA 4UEZA 1VIXA 2O4HA 4NGQA 2ZEMA 1LANA 2O53A 2CF4A 3B3SA 4NGPA 2ZEHA 2CIJA 1BPMA 4PXCA 1YSJA 1F57A 2Q4ZA 4MCSA 1XRYA 2GLFA 4EFDA 1IGBA 4Q7AA 3FF3A 1CX8A 2IMOA 4ZYQA 2EK9A 2AFSA 2V8GA 3CPAA 3GB0A 3D7HA 5LYFA 4UF4A 3FVLA 4MXUA 3B2YA 4P4JA 1PCAA 1CPXA 2J9AA 4P44A 5HXDA 4MHZA 2EK8A 1TF8A 1TF9A 4NFRA 3B7IA 4EWTA 2PVWA 1TXRA 2JBKA 1XBUA 2AFZA 3FX6A 2ABZA 4DUKA 3BI1A 3IWWA 1LAPA 3KHXA 1YMEA 3TC8A 1R3NA 4R76A 4PPZA 4ZY1A 1ZG9A 4OC1A 4F8ZA 1EE3P 2WYRA 1XJOA 2PJ1A 2RB7A 4OC3A 5LRKA 3KR5A 5THWA 4P4DA 3BXMA 2AFUA 3T8WA 4P45A 4IHMA 1TKHA 2PRQA 2OOTA 1ZLHA 3IIBA 3WC5A 3SJFA 2PJ2A 2V8VA 4OIDA 2EWBA 4MCPA 2ZEOA 3FECA 5IB9A 2ZEPA 4PQAA 4WJBA 3VH9A 4MRIA 5JM6A 1RTQA 4OIWA 4P4EA 1DE4C 1CP6A 3PB7X 1OBRA 4FUUA 1ZG8A 3KQZA 2RFHA 3IJ3A 3KR4A 1QQ9A 2PJ6A 2PJ3A 2PJ5A 1M4LA 1Z8LA 4YWYA 2PVVA 5CBMA 1AMPA 1Y0RA 1CG2A 3K9TA 1YW4A 1LCPA 2PE3A 4MHPA 4P4IA 1VHEA 3WT4A 4ZY2A 3PFEA 4UIAA 2HB6A 3LMSA 5LYLA 3H8GA 3PFOA 2V77A 3SJEA 2Q43A 1Y0YA 2ANPA 4A38A 2ZELA 1BLLE 3DGVA 1Y7EA 4MCRA
chains in the Genus database with same CATH superfamily
4XPDC 3OWCA 3B3VA 4A2ZA 5G20A 7CPAA 1M4DA 2C6CA 2FSRA 3H5ZA 2R98A 3N5FA 4PXEA 2JBJA 2XEFA 1ZLIA 1FNOA 5HVHA 3QB8A 2ZOGA 2CNMA 4NXYA 2J8MA 3NH5A 1YR0A 2DPSA 5IX3A 2Z3OA 1Z9UA 2ZENA 2CY2A 4GM5A 5F49A 2PCUA 2ZW5A 1XMTA 4UIBA 4LX9A 1QSTA 2Z3PA 4GS4A 2B4DB 4M6IA 2EBJA 1TKFA 2Z3MA 4OP4A 4NGNA 4NGMA 2PJAA 3S6HA 4KLVA 4CYOA 1QSOA 5LYDA 4CGPA 5I4MA 5JGFA 2P0WA 2VBQA 2ATRA 2PJ4A 3D4UA 4UBRA 3KGQA 2HC9A 2BL1A 4QVTA 2G3TA 2D4OA 2ZEEA 3SI0A 1Z8TA 2PJCA 2WSAA 2FE7A 5FVJA 4B5PB 2B3VA 2YNCA 4CAXA 1HEEA 3FIXA 3SJXA 2JDCA 4DYOA 4QBJA 1JQGA 1MJAA 1UFHA 1YLEA 3EXNA 3TX8A 3FEEA 4B5OA 3TOBA 4C68A 4CAEA 4KOYA 4AG7A 1ARMA 3TO9A 4PV6A 3B35A 1S7LA 5CNPA 2PIZA 4IAVA 4UFVA 3B3WA 5EBVA 3SXNA 4CGLA 3CDXA 2PJ0A 2XEIA 4GXHA 4OC5A 1YW6A 5G21A 3SI2A 4XNHB 1BPNA 1IY7A 2G9DA 1YLOA 3ISXA 4M3SA 3WC7A 3I1UA 4MJ8A 3FEDA 4H2KA 4A95A 3S9NA 2B58A 2PR8A 3D7FA 4NSQA 4AVAA 4FWUA 4KORA 3PB8X 3B3TA 5C88A 4KSIA 1Y9KA 1Z4RA 4CGNA 4NJQA 3D7DA 1NE9A 4R3KA 5K8MA 2X7BA 4A39A 3SXOA 3CT9A 4H6ZA 4R7MA 1GYTA 2KCWA 2Z11A 4U5YA 1KWMA 4KOSA 1XMBA 4CYPA 4KOVA 4CRZB 1I1DA 2I3CA 5ELYA 2Q7BA 2CNTA 4OC0A 2XEGA 3F8KA 5HVGA 4ONWA 4A37A 3A9LA 3D7GA 3RBUA 4E2AA 1LAMA 4JXRA 2B5GA 3GLJA 1P4NA 3KL9A 3R1KA 1Z8XA 4QUSA 3B3CA 5LYIA 3ISZA 3SI1A 4C2ZA 4MFPA 4F9UA 3CZXA 3S6GA 2CTCA 3S6KA 4E0AA 4EMEA 3S9MA 1M4IA 1CP7A 2NYQA 4X5KA 3PBEA 2EO8A 4QC6A 3W6XA 5IB0A 4ZX8A 2ZW6A 4B14A 1KUXA 4MI4A 3TE4A 3IWEA 3KASA 2P6EA 5JH9A 1CM0A 3DLJA 4P4BA 3PB9X 5GCNA 3TT2A 1CPSA 4B12A 3BJ8A 2GU2A 2FS5A 3HLPA 4R8FA 4U9ZA 4B6ZA 4F6AA 2C6GA 3FB3A 2BSWA 1M1DA 1F2PA 1UWYA 5KTCA 4WWVA 4W9YA 4ONUA 2NMTA 1VKCA 1VGYA 2B4BA 2EUIA 2ZW7A 4UCMA 5K8PA 2FIWA 2AFMA 2BUEA 4MBUA 1XFOA 4OADA 5AGEA 4LQGA 5J1QA 5C82A 4NGSA 3PB4X 2JEWA 3IWGA 4K3NA 4MHYA 5DWMA 4KSFA 2GREA 3EFAA 3FH4A 4A94A 3GY9A 4OKOA 2QJ8A 1N71A 3JTKA 2PJ8A 4JLYA 4O23A 4TNUA 3V7ZA 8CPAA 4G1PA 2PRBA 5H86A 1PU9A 4KUAA 4CPAA 2F7VA 3K2KA 1Q2YA 1J4JA 5D8NA 1X10A 2DF5A 5EC4A 3IFEA 4R87A 4KZTA 6CPAA 4KVOE 2OZGA 1S3ZA 4JXQA 1NSAA 3I3GA 1ARLA 4NGTA 2BEIA 4NJRA 1FT7A 1PUAA 3N7ZA 2DEAA 4UCNA 1KZFA 3LACA 2OB0A 1HDUA 3DDDA 4FAIA 1Z5RA 2V8DA 4PK3A 4FD6A 4LQ6A 1M4GA 3DR8A 4UCPA 3PRTA 4Q38A 3D67A 4BBHA 2K5TA 2VZYA 1BAVA 3UY5A 3VATA 4BD9A 2FXFA 4MCQA 3DSBA 2Y0MA 1MK4A 2R7HA 3PBBA 1IU8A 1TIQA 4FD5A 2ZEDA 4UEEA 3DNSA 2JEVA 3HUVA 3KHZA 4XNHC 3JUWA 3R9GA 4F9VA 1Z8WA 3R95A 4OC4A 4QB9A 4IF5A 3L2NA 3ZZIA 4OC2A 2Q51A 5D29A 4FBEA 4PSXA 4Y49B 3FJUA 5AG6A 2AFWA 2PR1A 3IO1A 1QSMA 3GKRA 2A4NA 4UFXA 4DNCA 1S7KA 1XE4A 3KQXA 4P6YA 4PSWA 2IQ6A 4AG9A 4A33A 4F0YA 1ELMP 3B8GA 3CPXA 3ZJ0A 2PJ7A 3JRUA 3WR7A 3FRMA 1QSRA 2Z0ZA 4OLLA 3PZJA 3S6FA 2NSMA 3MN8A 3VARA 2QMLA 5AG4A 4KVXA 1CBXA 1ELLP 2POKA 3JVNA 1NMTA 2HV2A 4JZ0A 3RAMA 2ARHA 4ZBGA 1BO4A 2YGWA 4ZI6A 4XPLA 3V38A 1ZG7A 3KZWA 5F47A 2C27A 4M6GA 2GFQA 4ZY0A 4YGOA 2D4PA 2ZEGA 3KKWA 3BHXA 3WABA 4X3RA 4L8AA 4KSAA 2F8HA 2RC4A 2VQYA 2OR4A 2ZOFA 3DR6A 3PB6X 3RO0A 3G3SA 3FMCA 4ZX9A 2O28A 4B11A 4R6TA 3EY5A 5BWAB 4LUAA 5HVFA 1X12A 3E0KA 3R9FA 1MJBA 2YNDA 4PK2A 1HDQA 5EMIA 1ON0A 3NH4A 4MHDA 3FBUA 3W91A 4X2TA 3IEHA 3F0AA 3R96A 4HKFA 1P0HA 2JLMA 1VHOA 2PJ9A 4UEFA 2PJBA 3BI0A 5DS0A 3VWEA 5F09A 1IYLA 5J8CA 1OZPA 2C6PA 4IK2A 2ZPAA 4MHNA 5I0CA 3KI9A 1H8LA 4P10A 2F5IA 4P4FA 1WK4A 2AFXA 3H8EA 4MMOA 4RUHA 1KUVA 3CXQA 4JYWA 2QECA 2JDDA 3PEIA 5LRJA 3VWDA 2Q7SA 1I12A 4DJLA 2BO9A 4KUBA 1NSLA 5AG7A 4A30A 1Z4EA 1XOVA 2Z3NA 3MGDA 4KOUA 4CGMA 1Q2DA 4C2XA 4Z65A 2ZEFA 2BOAA 2J8NA 1B6BA 4MFZA 3RYOA 3IC1A 4JWPA 2B4DA 4NF1A 3SJGA 1S5KA 3QAHA 4PXBA 3FXTA 2PSWA 3BLNA 2CTBA 1FY7A 1LFWA 4R57A 3WC6A 4JD6A 4KVME 1GHEA 5LRGA 1BOBA 2ZXVA 4AVBA 1LOKA 4B5PA 3TTHA 3H4QA 1DTDA 4AXVA 4FD4A 4II9A 3IGRA 2OZHA 2PIYA 4NGRA 1IYKA 1IOIA 4UFWA 4OMEA 1AYEA 2FVGA 2HQYA 1K4JA 3GUXA 3LWUA 4BMHA 4NCZA 2FT0A 2GE3A 3MRUA 4RN7A 1IB1E 4YU9A 2BCOA 2V8HA 1Z2LA 2PDOA 5A27A 4TWEA 2XEJA 5K8OA 4HNYB 3EO4A 2DPTA 1RO5A 1Q7LA 2Q44A 2VZZA 3D68A 5K8NA 4Q36A 1RXTA 3H8FA 3D66A 4XPKA 1QMUA 3S9LA 2I00A 4H89A 2CNSA 3CXSA 1LRZA 4Y49C 3NH8A 5CPAA 5E96A 4AB7A 2VL1A 3K9UA 4I49A 2GANA 1M44A 3NA6A 4AVCA 4B10A 1F2OA 1TKJA 5ISVA 1R43A 1V0CA 2C1CA 2GLJA 4A31A 2AE6A 2IJZA 3RZAA 3IU1A 3NFZA 2AFOA 3W6SA 4UWIA 3TCVA 2WZNA 3QNVA 2QVPA 4BINA 2PC1A 3D2MA 4PXDA 1PYTB 4X8IA 3V8IA 1YQEA 2OZUA 2FCKA 2QYVA 4UEZA 1VIXA 2O4HA 4EVYA 2H5MA 5A28A 3CXPA 1AUGA 5KTDA 3GIUA 1IOFA 3I9SA 4NGQA 2ZEMA 1LANA 2O53A 4HNWB 4RI1A 2Q4YA 2WUUA 2CF4A 1WWZA 3B3SA 4NGPA 2ZEHA 2CIJA 2FIAA 2R8VA 1BPMA 5DWNA 4PXCA 1YVKA 1F57A 1YSJA 2Q4ZA 4H6UA 4OAEA 4ZGYB 3BJ7A 4MCSA 2DXQA 1XRYA 2VXKA 4CAWA 2GLFA 1S7FA 4CS0B 2IL4A 4EFDA 2B5GB 1IGBA 2Q0YA 2FL4A 4Q7AA 5IV0A 4NEXA 3FF3A 1CX8A 1YVOA 2IMOA 3GYAA 3NE8A 1ZO0A 3G8WA 4ZYQA 3PGPA 2EK9A 2QIRA 2AFSA 2V8GA 4KOWA 3CPAA 2Z3LA 3GB0A 3D7HA 5LYFA 4KLWA 5H84A 2G0BA 4UF4A 4KOTA 3FVLA 4MXUA 3TOAA 3B2YA 3EC4A 4P4JA 4CGOA 2I79A 1PCAA 1S60A 1CPXA 4IUSA 2J9AA 4P44A 5HXDA 1VHSA 3FNCA 2VEZA 5G1ZA 2P6GA 4MHZA 5HH1A 2EK8A 1TF8A 1TF9A 4NFRA 3SHPA 3TO6A 4C2YA 5G22A 1XEBA 3LODA 1Y9WA 2EVNA 1YREA 3B7IA 4XPDB 4EWTA 5F46A 2PVWA 3P2FA 5AG5A 2WPWA 1TXRA 2WPXA 4J3GA 4UA3A 5JPHA 1YX0A 2JBKA 3C26A 1XBUA 2AFZA 3FX6A 4HPSA 3RNZA 2ABZA 4DUKA 2AJ6A 3BI1A 3IWWA 1MJ9A 1LAPA 1YGHA 3KHXA 4MFQA 4CAVA 1YMEA 4YFJA 3TC8A 1R57A 1R3NA 3QAYA 4R76A 4PPZA 4ZY1A 5F48A 1ZG9A 4OC1A 4F8ZA 1EE3P 2YNCC 5HMNA 1KUYA 3D2PA 3TFYA 2WYRA 2YNEA 2Q4VA 1XJOA 4KS9A 2GIVA 2OH1A 2PJ1A 2RB7A 1S7NA 4OC3A 5LRKA 4RS2A 1B87A 3KR5A 4MY3A 5THWA 4R9MA 4CAFA 3PP9A 1I21A 3P2HA 3T90A 4CYQA 4P4DA 3BXMA 2AFUA 2G3AA 3T8WA 4P45A 4IHMA 1IIDA 1TKHA 2PRQA 4M6HA 4MFJA 1ZLHA 3IIBA 2OOTA 1A2ZA 3WC5A 3SJFA 2PJ2A 4KOXA 3IU2A 3TO7A 2V8VA 4OIDA 4B13A 2EWBA 4MCPA 2ZEOA 3FECA 5IB9A 2ZEPA 4PQAA 4WJBA 2OU2A 2Z3KA 4F0XA 1YK3A 2B3UA 4MRIA 3VH9A 4E8OA 3FYNA 4YRHA 1RTQA 4OIWA 2ODFA 5JM6A 4C7HA 4P4EA 1DE4C 1CP6A 1Q2CA 3PB7X 1OBRA 4FUUA 1ZG8A 4K30A 4MFLA 3KQZA 2R1IA 1L0CA 4U9YA 2RFHA 4M85A 3IJ3A 3LD2A 5JQ4A 3KR4A 5J8FA 1SQHA 2VI7A 1QQ9A 1QSNA 2PJ6A 4A32A 5KTAA 2PJ3A 4HNXB 2PJ5A 3F5BA 1M4LA 1Z8LA 4YWYA 4R3LA 2PVVA 5CBMA 1AMPA 1Y0RA 2ZW4A 3NE7A 1CG2A 3D8PA 4ORFA 3T9YA 3K9TA 1YW4A 2REFA 1LCPA 4MFKA 1CJWA 2REEA 2PE3A 4MHPA 2P6FA 4P4IA 1VHEA 3WT4A 1Y7RA 4UWJA 2Z10A 4ZY2A 3PFEA 2PQ8A 2HUZA 3D3SA 4FD7A 4UIAA 1IICA 2HB6A 2Q04A 3LMSA 1U6MA 4JJXA 5LYLA 3H8GA 1JWQA 3PFOA 4CRYB 1XF8A 3R9EA 2CXAA 2V77A 4L89A 3SJEA 4CYNA 2Q43A 2J8RA 1Y0YA 2ANPA 4MY0A 4A38A 2ZELA 1BLLE 3DGVA 1Y7EA 4MCRA 1XIXA 4C7IA
chains in the Genus database with same CATH topology
3B3VA 7CPAA 2C6CA 3N5FA 4PXEA 2JBJA 2XEFA 1ZLIA 1FNOA 5HVHA 2ZOGA 3NH5A 2ZENA 4GM5A 2PCUA 4UIBA 1TKFA 4OP4A 4NGNA 4NGMA 2PJAA 5I4MA 5LYDA 5JGFA 3D4UA 2PJ4A 3KGQA 2HC9A 3SI0A 2ZEEA 2PJCA 1HEEA 3SJXA 4DYOA 1JQGA 3TX8A 3FEEA 1ARMA 3B35A 2PIZA 4IAVA 3B3WA 3CDXA 2PJ0A 2XEIA 4OC5A 1YW6A 3SI2A 1BPNA 1IY7A 2G9DA 1YLOA 3ISXA 3WC7A 3I1UA 3S9NA 3FEDA 4H2KA 3D7FA 4FWUA 3PB8X 3B3TA 4KSIA 4NJQA 3D7DA 5K8MA 4A39A 3CT9A 4R7MA 1GYTA 1KWMA 1XMBA 2I3CA 5ELYA 4OC0A 2XEGA 5HVGA 4ONWA 4A37A 3D7GA 3RBUA 1LAMA 3GLJA 3KL9A 3B3CA 5LYIA 3ISZA 3SI1A 4F9UA 2CTCA 4EMEA 3S9MA 1CP7A 2NYQA 3PBEA 4ZX8A 3KASA 5JH9A 3DLJA 4P4BA 3PB9X 1CPSA 2GU2A 4R8FA 3HLPA 4B6ZA 2C6GA 1UWYA 1F2PA 4WWVA 4W9YA 1VGYA 5K8PA 2AFMA 1XFOA 4LQGA 5J1QA 4NGSA 3PB4X 2JEWA 4K3NA 4MHYA 2GREA 3FH4A 4A94A 4OKOA 2QJ8A 8CPAA 2PJ8A 4O23A 4TNUA 3V7ZA 4G1PA 4CPAA 2F7VA 3K2KA 5D8NA 3IFEA 6CPAA 1NSAA 1ARLA 4NGTA 4NJRA 1FT7A 2DEAA 1HDUA 4FAIA 1Z5RA 2V8DA 3PRTA 3D67A 1BAVA 3VATA 4BD9A 4MCQA 3PBBA 2ZEDA 4UEEA 3HUVA 3KHZA 4F9VA 4OC4A 3L2NA 4OC2A 2Q51A 5D29A 4FBEA 3FJUA 2AFWA 3IO1A 4DJLA 3KQXA 4P6YA 2IQ6A 1ELMP 3CPXA 2PJ7A 3JRUA 2NSMA 3MN8A 3VARA 1CBXA 1ELLP 2POKA 4JZ0A 3RAMA 4ZI6A 3V38A 1ZG7A 3KZWA 4ZY0A 2ZEGA 3BHXA 3WABA 4X3RA 2F8HA 2OR4A 2ZOFA 3PB6X 3FMCA 4ZX9A 4R6TA 5HVFA 1HDQA 3NH4A 4X2TA 3IEHA 4UEFA 2PJ9A 1VHOA 5DS0A 2PJBA 3BI0A 5F09A 2C6PA 4IK2A 4MHNA 3KI9A 1H8LA 4P10A 4P4FA 2AFXA 3H8EA 4MMOA 4RUHA 4JYWA 3PEIA 5LRJA 2BO9A 4Z65A 2ZEFA 2BOAA 3IC1A 3SJGA 4PXBA 2CTBA 1LFWA 3WC6A 5LRGA 1LOKA 4AXVA 1DTDA 2PIYA 4NGRA 4OMEA 1AYEA 2FVGA 3GUXA 3LWUA 4YU9A 3MRUA 2BCOA 2V8HA 1Z2LA 4TWEA 2XEJA 5K8OA 1Q7LA 3D68A 5K8NA 3H8FA 3D66A 1QMUA 3S9LA 5CPAA 3NH8A 2VL1A 3NA6A 1F2OA 1TKJA 1R43A 2C1CA 2GLJA 2IJZA 3RZAA 3NFZA 2AFOA 2WZNA 3QNVA 2QVPA 4PXDA 1PYTB 4X8IA 2QYVA 4UEZA 1VIXA 2O4HA 4NGQA 2ZEMA 1LANA 2O53A 2CF4A 3B3SA 4NGPA 2ZEHA 2CIJA 1BPMA 4PXCA 1YSJA 1F57A 2Q4ZA 4MCSA 1XRYA 2GLFA 4EFDA 1IGBA 4Q7AA 3FF3A 1CX8A 2IMOA 4ZYQA 2EK9A 2AFSA 2V8GA 3CPAA 3GB0A 3D7HA 5LYFA 4UF4A 3FVLA 4MXUA 3B2YA 4P4JA 1PCAA 1CPXA 2J9AA 4P44A 5HXDA 4MHZA 2EK8A 1TF8A 1TF9A 4NFRA 3B7IA 4EWTA 2PVWA 1TXRA 2JBKA 1XBUA 2AFZA 3FX6A 2ABZA 4DUKA 3BI1A 3IWWA 1LAPA 3KHXA 1YMEA 3TC8A 1R3NA 4R76A 4PPZA 4ZY1A 1ZG9A 4OC1A 4F8ZA 1EE3P 2WYRA 1XJOA 2PJ1A 2RB7A 4OC3A 5LRKA 3KR5A 5THWA 4P4DA 3BXMA 2AFUA 3T8WA 4P45A 4IHMA 1TKHA 2PRQA 2OOTA 1ZLHA 3IIBA 3WC5A 3SJFA 2PJ2A 2V8VA 4OIDA 2EWBA 4MCPA 2ZEOA 3FECA 5IB9A 2ZEPA 4PQAA 4WJBA 3VH9A 4MRIA 5JM6A 1RTQA 4OIWA 4P4EA 1DE4C 1CP6A 3PB7X 1OBRA 4FUUA 1ZG8A 3KQZA 2RFHA 3IJ3A 3KR4A 1QQ9A 2PJ6A 2PJ3A 2PJ5A 1M4LA 1Z8LA 4YWYA 2PVVA 5CBMA 1AMPA 1Y0RA 1CG2A 3K9TA 1YW4A 1LCPA 2PE3A 4MHPA 4P4IA 1VHEA 3WT4A 4ZY2A 3PFEA 4UIAA 2HB6A 3LMSA 5LYLA 3H8GA 3PFOA 2V77A 3SJEA 2Q43A 1Y0YA 2ANPA 4A38A 2ZELA 1BLLE 3DGVA 1Y7EA 4MCRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3B3V A;  7CPA A;  2C6C A;  3N5F A;  4PXE A;  2JBJ A;  2XEF A;  1ZLI A;  1FNO A;  5HVH A;  2ZOG A;  3NH5 A;  2ZEN A;  4GM5 A;  2PCU A;  4UIB A;  1TKF A;  4OP4 A;  4NGN A;  4NGM A;  2PJA A;  5I4M A;  5LYD A;  5JGF A;  3D4U A;  2PJ4 A;  3KGQ A;  2HC9 A;  3SI0 A;  2ZEE A;  2PJC A;  1HEE A;  3SJX A;  4DYO A;  1JQG A;  3TX8 A;  3FEE A;  1ARM A;  3B35 A;  2PIZ A;  4IAV A;  3B3W A;  3CDX A;  2PJ0 A;  2XEI A;  4OC5 A;  1YW6 A;  3SI2 A;  1BPN A;  1IY7 A;  2G9D A;  1YLO A;  3ISX A;  3WC7 A;  3I1U A;  3S9N A;  3FED A;  4H2K A;  3D7F A;  4FWU A;  3PB8 X;  3B3T A;  4KSI A;  4NJQ A;  3D7D A;  5K8M A;  4A39 A;  3CT9 A;  4R7M A;  1GYT A;  1KWM A;  1XMB A;  2I3C A;  5ELY A;  4OC0 A;  2XEG A;  5HVG A;  4ONW A;  4A37 A;  3D7G A;  3RBU A;  1LAM A;  3GLJ A;  3KL9 A;  3B3C A;  5LYI A;  3ISZ A;  3SI1 A;  4F9U A;  2CTC A;  4EME A;  3S9M A;  1CP7 A;  2NYQ A;  3PBE A;  4ZX8 A;  3KAS A;  5JH9 A;  3DLJ A;  4P4B A;  3PB9 X;  1CPS A;  2GU2 A;  4R8F A;  3HLP A;  4B6Z A;  2C6G A;  1UWY A;  1F2P A;  4WWV A;  4W9Y A;  1VGY A;  5K8P A;  2AFM A;  1XFO A;  4LQG A;  5J1Q A;  4NGS A;  3PB4 X;  2JEW A;  4K3N A;  4MHY A;  2GRE A;  3FH4 A;  4A94 A;  4OKO A;  2QJ8 A;  8CPA A;  2PJ8 A;  4O23 A;  4TNU A;  3V7Z A;  4G1P A;  4CPA A;  2F7V A;  3K2K A;  5D8N A;  3IFE A;  6CPA A;  1NSA A;  1ARL A;  4NGT A;  4NJR A;  1FT7 A;  2DEA A;  1HDU A;  4FAI A;  1Z5R A;  2V8D A;  3PRT A;  3D67 A;  1BAV A;  3VAT A;  4BD9 A;  4MCQ A;  3PBB A;  2ZED A;  4UEE A;  3HUV A;  3KHZ A;  4F9V A;  4OC4 A;  3L2N A;  4OC2 A;  2Q51 A;  5D29 A;  4FBE A;  3FJU A;  2AFW A;  3IO1 A;  4DJL A;  3KQX A;  4P6Y A;  2IQ6 A;  1ELM P;  3CPX A;  2PJ7 A;  3JRU A;  2NSM A;  3MN8 A;  3VAR A;  1CBX A;  1ELL P;  2POK A;  4JZ0 A;  3RAM A;  4ZI6 A;  3V38 A;  1ZG7 A;  3KZW A;  4ZY0 A;  2ZEG A;  3BHX A;  3WAB A;  4X3R A;  2F8H A;  2OR4 A;  2ZOF A;  3PB6 X;  3FMC A;  4ZX9 A;  4R6T A;  5HVF A;  1HDQ A;  3NH4 A;  4X2T A;  3IEH A;  4UEF A;  2PJ9 A;  1VHO A;  5DS0 A;  2PJB A;  3BI0 A;  5F09 A;  2C6P A;  4IK2 A;  4MHN A;  3KI9 A;  1H8L A;  4P10 A;  4P4F A;  2AFX A;  3H8E A;  4MMO A;  4RUH A;  4JYW A;  3PEI A;  5LRJ A;  2BO9 A;  4Z65 A;  2ZEF A;  2BOA A;  3IC1 A;  3SJG A;  4PXB A;  2CTB A;  1LFW A;  3WC6 A;  5LRG A;  1LOK A;  4AXV A;  1DTD A;  2PIY A;  4NGR A;  4OME A;  1AYE A;  2FVG A;  3GUX A;  3LWU A;  4YU9 A;  3MRU A;  2BCO A;  2V8H A;  1Z2L A;  4TWE A;  2XEJ A;  5K8O A;  1Q7L A;  3D68 A;  5K8N A;  3H8F A;  3D66 A;  1QMU A;  3S9L A;  5CPA A;  3NH8 A;  2VL1 A;  3NA6 A;  1F2O A;  1TKJ A;  1R43 A;  2C1C A;  2GLJ A;  2IJZ A;  3RZA A;  3NFZ A;  2AFO A;  2WZN A;  3QNV A;  2QVP A;  4PXD A;  1PYT B;  4X8I A;  2QYV A;  4UEZ A;  1VIX A;  2O4H A;  4NGQ A;  2ZEM A;  1LAN A;  2O53 A;  2CF4 A;  3B3S A;  4NGP A;  2ZEH A;  2CIJ A;  1BPM A;  4PXC A;  1YSJ A;  1F57 A;  2Q4Z A;  4MCS A;  1XRY A;  2GLF A;  4EFD A;  1IGB A;  4Q7A A;  3FF3 A;  1CX8 A;  2IMO A;  4ZYQ A;  2EK9 A;  2AFS A;  2V8G A;  3CPA A;  3GB0 A;  3D7H A;  5LYF A;  4UF4 A;  3FVL A;  4MXU A;  3B2Y A;  4P4J A;  1PCA A;  1CPX A;  2J9A A;  4P44 A;  5HXD A;  4MHZ A;  2EK8 A;  1TF8 A;  1TF9 A;  4NFR A;  3B7I A;  4EWT A;  2PVW A;  1TXR A;  2JBK A;  1XBU A;  2AFZ A;  3FX6 A;  2ABZ A;  4DUK A;  3BI1 A;  3IWW A;  1LAP A;  3KHX A;  1YME A;  3TC8 A;  1R3N A;  4R76 A;  4PPZ A;  4ZY1 A;  1ZG9 A;  4OC1 A;  4F8Z A;  1EE3 P;  2WYR A;  1XJO A;  2PJ1 A;  2RB7 A;  4OC3 A;  5LRK A;  3KR5 A;  5THW A;  4P4D A;  3BXM A;  2AFU A;  3T8W A;  4P45 A;  4IHM A;  1TKH A;  2PRQ A;  2OOT A;  1ZLH A;  3IIB A;  3WC5 A;  3SJF A;  2PJ2 A;  2V8V A;  4OID A;  2EWB A;  4MCP A;  2ZEO A;  3FEC A;  5IB9 A;  2ZEP A;  4PQA A;  4WJB A;  3VH9 A;  4MRI A;  5JM6 A;  1RTQ A;  4OIW A;  4P4E A;  1DE4 C;  1CP6 A;  3PB7 X;  1OBR A;  4FUU A;  1ZG8 A;  3KQZ A;  2RFH A;  3IJ3 A;  3KR4 A;  1QQ9 A;  2PJ6 A;  2PJ3 A;  2PJ5 A;  1M4L A;  1Z8L A;  4YWY A;  2PVV A;  5CBM A;  1AMP A;  1Y0R A;  1CG2 A;  3K9T A;  1YW4 A;  1LCP A;  2PE3 A;  4MHP A;  4P4I A;  1VHE A;  3WT4 A;  4ZY2 A;  3PFE A;  4UIA A;  2HB6 A;  3LMS A;  5LYL A;  3H8G A;  3PFO A;  2V77 A;  3SJE A;  2Q43 A;  1Y0Y A;  2ANP A;  4A38 A;  2ZEL A;  1BLL E;  3DGV A;  1Y7E A;  4MCR A; 
#chains in the Genus database with same CATH topology
 4XPD C;  3OWC A;  3B3V A;  4A2Z A;  5G20 A;  7CPA A;  1M4D A;  2C6C A;  2FSR A;  3H5Z A;  2R98 A;  3N5F A;  4PXE A;  2JBJ A;  2XEF A;  1ZLI A;  1FNO A;  5HVH A;  3QB8 A;  2ZOG A;  2CNM A;  4NXY A;  2J8M A;  3NH5 A;  1YR0 A;  2DPS A;  5IX3 A;  2Z3O A;  1Z9U A;  2ZEN A;  2CY2 A;  4GM5 A;  5F49 A;  2PCU A;  2ZW5 A;  1XMT A;  4UIB A;  4LX9 A;  1QST A;  2Z3P A;  4GS4 A;  2B4D B;  4M6I A;  2EBJ A;  1TKF A;  2Z3M A;  4OP4 A;  4NGN A;  4NGM A;  2PJA A;  3S6H A;  4KLV A;  4CYO A;  1QSO A;  5LYD A;  4CGP A;  5I4M A;  5JGF A;  2P0W A;  2VBQ A;  2ATR A;  2PJ4 A;  3D4U A;  4UBR A;  3KGQ A;  2HC9 A;  2BL1 A;  4QVT A;  2G3T A;  2D4O A;  2ZEE A;  3SI0 A;  1Z8T A;  2PJC A;  2WSA A;  2FE7 A;  5FVJ A;  4B5P B;  2B3V A;  2YNC A;  4CAX A;  1HEE A;  3FIX A;  3SJX A;  2JDC A;  4DYO A;  4QBJ A;  1JQG A;  1MJA A;  1UFH A;  1YLE A;  3EXN A;  3TX8 A;  3FEE A;  4B5O A;  3TOB A;  4C68 A;  4CAE A;  4KOY A;  4AG7 A;  1ARM A;  3TO9 A;  4PV6 A;  3B35 A;  1S7L A;  5CNP A;  2PIZ A;  4IAV A;  4UFV A;  3B3W A;  5EBV A;  3SXN A;  4CGL A;  3CDX A;  2PJ0 A;  2XEI A;  4GXH A;  4OC5 A;  1YW6 A;  5G21 A;  3SI2 A;  4XNH B;  1BPN A;  1IY7 A;  2G9D A;  1YLO A;  3ISX A;  4M3S A;  3WC7 A;  3I1U A;  4MJ8 A;  3FED A;  4H2K A;  4A95 A;  3S9N A;  2B58 A;  2PR8 A;  3D7F A;  4NSQ A;  4AVA A;  4FWU A;  4KOR A;  3PB8 X;  3B3T A;  5C88 A;  4KSI A;  1Y9K A;  1Z4R A;  4CGN A;  4NJQ A;  3D7D A;  1NE9 A;  4R3K A;  5K8M A;  2X7B A;  4A39 A;  3SXO A;  3CT9 A;  4H6Z A;  4R7M A;  1GYT A;  2KCW A;  2Z11 A;  4U5Y A;  1KWM A;  4KOS A;  1XMB A;  4CYP A;  4KOV A;  4CRZ B;  1I1D A;  2I3C A;  5ELY A;  2Q7B A;  2CNT A;  4OC0 A;  2XEG A;  3F8K A;  5HVG A;  4ONW A;  4A37 A;  3A9L A;  3D7G A;  3RBU A;  4E2A A;  1LAM A;  4JXR A;  2B5G A;  3GLJ A;  1P4N A;  3KL9 A;  3R1K A;  1Z8X A;  4QUS A;  3B3C A;  5LYI A;  3ISZ A;  3SI1 A;  4C2Z A;  4MFP A;  4F9U A;  3CZX A;  3S6G A;  2CTC A;  3S6K A;  4E0A A;  4EME A;  3S9M A;  1M4I A;  1CP7 A;  2NYQ A;  4X5K A;  3PBE A;  2EO8 A;  4QC6 A;  3W6X A;  5IB0 A;  4ZX8 A;  2ZW6 A;  4B14 A;  1KUX A;  4MI4 A;  3TE4 A;  3IWE A;  3KAS A;  2P6E A;  5JH9 A;  1CM0 A;  3DLJ A;  4P4B A;  3PB9 X;  5GCN A;  3TT2 A;  1CPS A;  4B12 A;  3BJ8 A;  2GU2 A;  2FS5 A;  3HLP A;  4R8F A;  4U9Z A;  4B6Z A;  4F6A A;  2C6G A;  3FB3 A;  2BSW A;  1M1D A;  1F2P A;  1UWY A;  5KTC A;  4WWV A;  4W9Y A;  4ONU A;  2NMT A;  1VKC A;  1VGY A;  2B4B A;  2EUI A;  2ZW7 A;  4UCM A;  5K8P A;  2FIW A;  2AFM A;  2BUE A;  4MBU A;  1XFO A;  4OAD A;  5AGE A;  4LQG A;  5J1Q A;  5C82 A;  4NGS A;  3PB4 X;  2JEW A;  3IWG A;  4K3N A;  4MHY A;  5DWM A;  4KSF A;  2GRE A;  3EFA A;  3FH4 A;  4A94 A;  3GY9 A;  4OKO A;  2QJ8 A;  1N71 A;  3JTK A;  2PJ8 A;  4JLY A;  4O23 A;  4TNU A;  3V7Z A;  8CPA A;  4G1P A;  2PRB A;  5H86 A;  1PU9 A;  4KUA A;  4CPA A;  2F7V A;  3K2K A;  1Q2Y A;  1J4J A;  5D8N A;  1X10 A;  2DF5 A;  5EC4 A;  3IFE A;  4R87 A;  4KZT A;  6CPA A;  4KVO E;  2OZG A;  1S3Z A;  4JXQ A;  1NSA A;  3I3G A;  1ARL A;  4NGT A;  2BEI A;  4NJR A;  1FT7 A;  1PUA A;  3N7Z A;  2DEA A;  4UCN A;  1KZF A;  3LAC A;  2OB0 A;  1HDU A;  3DDD A;  4FAI A;  1Z5R A;  2V8D A;  4PK3 A;  4FD6 A;  4LQ6 A;  1M4G A;  3DR8 A;  4UCP A;  3PRT A;  4Q38 A;  3D67 A;  4BBH A;  2K5T A;  2VZY A;  1BAV A;  3UY5 A;  3VAT A;  4BD9 A;  2FXF A;  4MCQ A;  3DSB A;  2Y0M A;  1MK4 A;  2R7H A;  3PBB A;  1IU8 A;  1TIQ A;  4FD5 A;  2ZED A;  4UEE A;  3DNS A;  2JEV A;  3HUV A;  3KHZ A;  4XNH C;  3JUW A;  3R9G A;  4F9V A;  1Z8W A;  3R95 A;  4OC4 A;  4QB9 A;  4IF5 A;  3L2N A;  3ZZI A;  4OC2 A;  2Q51 A;  5D29 A;  4FBE A;  4PSX A;  4Y49 B;  3FJU A;  5AG6 A;  2AFW A;  2PR1 A;  3IO1 A;  1QSM A;  3GKR A;  2A4N A;  4UFX A;  4DNC A;  1S7K A;  1XE4 A;  3KQX A;  4P6Y A;  4PSW A;  2IQ6 A;  4AG9 A;  4A33 A;  4F0Y A;  1ELM P;  3B8G A;  3CPX A;  3ZJ0 A;  2PJ7 A;  3JRU A;  3WR7 A;  3FRM A;  1QSR A;  2Z0Z A;  4OLL A;  3PZJ A;  3S6F A;  2NSM A;  3MN8 A;  3VAR A;  2QML A;  5AG4 A;  4KVX A;  1CBX A;  1ELL P;  2POK A;  3JVN A;  1NMT A;  2HV2 A;  4JZ0 A;  3RAM A;  2ARH A;  4ZBG A;  1BO4 A;  2YGW A;  4ZI6 A;  4XPL A;  3V38 A;  1ZG7 A;  3KZW A;  5F47 A;  2C27 A;  4M6G A;  2GFQ A;  4ZY0 A;  4YGO A;  2D4P A;  2ZEG A;  3KKW A;  3BHX A;  3WAB A;  4X3R A;  4L8A A;  4KSA A;  2F8H A;  2RC4 A;  2VQY A;  2OR4 A;  2ZOF A;  3DR6 A;  3PB6 X;  3RO0 A;  3G3S A;  3FMC A;  4ZX9 A;  2O28 A;  4B11 A;  4R6T A;  3EY5 A;  5BWA B;  4LUA A;  5HVF A;  1X12 A;  3E0K A;  3R9F A;  1MJB A;  2YND A;  4PK2 A;  1HDQ A;  5EMI A;  1ON0 A;  3NH4 A;  4MHD A;  3FBU A;  3W91 A;  4X2T A;  3IEH A;  3F0A A;  3R96 A;  4HKF A;  1P0H A;  2JLM A;  1VHO A;  2PJ9 A;  4UEF A;  2PJB A;  3BI0 A;  5DS0 A;  3VWE A;  5F09 A;  1IYL A;  5J8C A;  1OZP A;  2C6P A;  4IK2 A;  2ZPA A;  4MHN A;  5I0C A;  3KI9 A;  1H8L A;  4P10 A;  2F5I A;  4P4F A;  1WK4 A;  2AFX A;  3H8E A;  4MMO A;  4RUH A;  1KUV A;  3CXQ A;  4JYW A;  2QEC A;  2JDD A;  3PEI A;  5LRJ A;  3VWD A;  2Q7S A;  1I12 A;  4DJL A;  2BO9 A;  4KUB A;  1NSL A;  5AG7 A;  4A30 A;  1Z4E A;  1XOV A;  2Z3N A;  3MGD A;  4KOU A;  4CGM A;  1Q2D A;  4C2X A;  4Z65 A;  2ZEF A;  2BOA A;  2J8N A;  1B6B A;  4MFZ A;  3RYO A;  3IC1 A;  4JWP A;  2B4D A;  4NF1 A;  3SJG A;  1S5K A;  3QAH A;  4PXB A;  3FXT A;  2PSW A;  3BLN A;  2CTB A;  1FY7 A;  1LFW A;  4R57 A;  3WC6 A;  4JD6 A;  4KVM E;  1GHE A;  5LRG A;  1BOB A;  2ZXV A;  4AVB A;  1LOK A;  4B5P A;  3TTH A;  3H4Q A;  1DTD A;  4AXV A;  4FD4 A;  4II9 A;  3IGR A;  2OZH A;  2PIY A;  4NGR A;  1IYK A;  1IOI A;  4UFW A;  4OME A;  1AYE A;  2FVG A;  2HQY A;  1K4J A;  3GUX A;  3LWU A;  4BMH A;  4NCZ A;  2FT0 A;  2GE3 A;  3MRU A;  4RN7 A;  1IB1 E;  4YU9 A;  2BCO A;  2V8H A;  1Z2L A;  2PDO A;  5A27 A;  4TWE A;  2XEJ A;  5K8O A;  4HNY B;  3EO4 A;  2DPT A;  1RO5 A;  1Q7L A;  2Q44 A;  2VZZ A;  3D68 A;  5K8N A;  4Q36 A;  1RXT A;  3H8F A;  3D66 A;  4XPK A;  1QMU A;  3S9L A;  2I00 A;  4H89 A;  2CNS A;  3CXS A;  1LRZ A;  4Y49 C;  3NH8 A;  5CPA A;  5E96 A;  4AB7 A;  2VL1 A;  3K9U A;  4I49 A;  2GAN A;  1M44 A;  3NA6 A;  4AVC A;  4B10 A;  1F2O A;  1TKJ A;  5ISV A;  1R43 A;  1V0C A;  2C1C A;  2GLJ A;  4A31 A;  2AE6 A;  2IJZ A;  3RZA A;  3IU1 A;  3NFZ A;  2AFO A;  3W6S A;  4UWI A;  3TCV A;  2WZN A;  3QNV A;  2QVP A;  4BIN A;  2PC1 A;  3D2M A;  4PXD A;  1PYT B;  4X8I A;  3V8I A;  1YQE A;  2OZU A;  2FCK A;  2QYV A;  4UEZ A;  1VIX A;  2O4H A;  4EVY A;  2H5M A;  5A28 A;  3CXP A;  1AUG A;  5KTD A;  3GIU A;  1IOF A;  3I9S A;  4NGQ A;  2ZEM A;  1LAN A;  2O53 A;  4HNW B;  4RI1 A;  2Q4Y A;  2WUU A;  2CF4 A;  1WWZ A;  3B3S A;  4NGP A;  2ZEH A;  2CIJ A;  2FIA A;  2R8V A;  1BPM A;  5DWN A;  4PXC A;  1YVK A;  1F57 A;  1YSJ A;  2Q4Z A;  4H6U A;  4OAE A;  4ZGY B;  3BJ7 A;  4MCS A;  2DXQ A;  1XRY A;  2VXK A;  4CAW A;  2GLF A;  1S7F A;  4CS0 B;  2IL4 A;  4EFD A;  2B5G B;  1IGB A;  2Q0Y A;  2FL4 A;  4Q7A A;  5IV0 A;  4NEX A;  3FF3 A;  1CX8 A;  1YVO A;  2IMO A;  3GYA A;  3NE8 A;  1ZO0 A;  3G8W A;  4ZYQ A;  3PGP A;  2EK9 A;  2QIR A;  2AFS A;  2V8G A;  4KOW A;  3CPA A;  2Z3L A;  3GB0 A;  3D7H A;  5LYF A;  4KLW A;  5H84 A;  2G0B A;  4UF4 A;  4KOT A;  3FVL A;  4MXU A;  3TOA A;  3B2Y A;  3EC4 A;  4P4J A;  4CGO A;  2I79 A;  1PCA A;  1S60 A;  1CPX A;  4IUS A;  2J9A A;  4P44 A;  5HXD A;  1VHS A;  3FNC A;  2VEZ A;  5G1Z A;  2P6G A;  4MHZ A;  5HH1 A;  2EK8 A;  1TF8 A;  1TF9 A;  4NFR A;  3SHP A;  3TO6 A;  4C2Y A;  5G22 A;  1XEB A;  3LOD A;  1Y9W A;  2EVN A;  1YRE A;  3B7I A;  4XPD B;  4EWT A;  5F46 A;  2PVW A;  3P2F A;  5AG5 A;  2WPW A;  1TXR A;  2WPX A;  4J3G A;  4UA3 A;  5JPH A;  1YX0 A;  2JBK A;  3C26 A;  1XBU A;  2AFZ A;  3FX6 A;  4HPS A;  3RNZ A;  2ABZ A;  4DUK A;  2AJ6 A;  3BI1 A;  3IWW A;  1MJ9 A;  1LAP A;  1YGH A;  3KHX A;  4MFQ A;  4CAV A;  1YME A;  4YFJ A;  3TC8 A;  1R57 A;  1R3N A;  3QAY A;  4R76 A;  4PPZ A;  4ZY1 A;  5F48 A;  1ZG9 A;  4OC1 A;  4F8Z A;  1EE3 P;  2YNC C;  5HMN A;  1KUY A;  3D2P A;  3TFY A;  2WYR A;  2YNE A;  2Q4V A;  1XJO A;  4KS9 A;  2GIV A;  2OH1 A;  2PJ1 A;  2RB7 A;  1S7N A;  4OC3 A;  5LRK A;  4RS2 A;  1B87 A;  3KR5 A;  4MY3 A;  5THW A;  4R9M A;  4CAF A;  3PP9 A;  1I21 A;  3P2H A;  3T90 A;  4CYQ A;  4P4D A;  3BXM A;  2AFU A;  2G3A A;  3T8W A;  4P45 A;  4IHM A;  1IID A;  1TKH A;  2PRQ A;  4M6H A;  4MFJ A;  1ZLH A;  3IIB A;  2OOT A;  1A2Z A;  3WC5 A;  3SJF A;  2PJ2 A;  4KOX A;  3IU2 A;  3TO7 A;  2V8V A;  4OID A;  4B13 A;  2EWB A;  4MCP A;  2ZEO A;  3FEC A;  5IB9 A;  2ZEP A;  4PQA A;  4WJB A;  2OU2 A;  2Z3K A;  4F0X A;  1YK3 A;  2B3U A;  4MRI A;  3VH9 A;  4E8O A;  3FYN A;  4YRH A;  1RTQ A;  4OIW A;  2ODF A;  5JM6 A;  4C7H A;  4P4E A;  1DE4 C;  1CP6 A;  1Q2C A;  3PB7 X;  1OBR A;  4FUU A;  1ZG8 A;  4K30 A;  4MFL A;  3KQZ A;  2R1I A;  1L0C A;  4U9Y A;  2RFH A;  4M85 A;  3IJ3 A;  3LD2 A;  5JQ4 A;  3KR4 A;  5J8F A;  1SQH A;  2VI7 A;  1QQ9 A;  1QSN A;  2PJ6 A;  4A32 A;  5KTA A;  2PJ3 A;  4HNX B;  2PJ5 A;  3F5B A;  1M4L A;  1Z8L A;  4YWY A;  4R3L A;  2PVV A;  5CBM A;  1AMP A;  1Y0R A;  2ZW4 A;  3NE7 A;  1CG2 A;  3D8P A;  4ORF A;  3T9Y A;  3K9T A;  1YW4 A;  2REF A;  1LCP A;  4MFK A;  1CJW A;  2REE A;  2PE3 A;  4MHP A;  2P6F A;  4P4I A;  1VHE A;  3WT4 A;  1Y7R A;  4UWJ A;  2Z10 A;  4ZY2 A;  3PFE A;  2PQ8 A;  2HUZ A;  3D3S A;  4FD7 A;  4UIA A;  1IIC A;  2HB6 A;  2Q04 A;  3LMS A;  1U6M A;  4JJX A;  5LYL A;  3H8G A;  1JWQ A;  3PFO A;  4CRY B;  1XF8 A;  3R9E A;  2CXA A;  2V77 A;  4L89 A;  3SJE A;  4CYN A;  2Q43 A;  2J8R A;  1Y0Y A;  2ANP A;  4MY0 A;  4A38 A;  2ZEL A;  1BLL E;  3DGV A;  1Y7E A;  4MCR A;  1XIX A;  4C7I A; 
#chains in the Genus database with same CATH homology
 3B3V A;  7CPA A;  2C6C A;  3N5F A;  4PXE A;  2JBJ A;  2XEF A;  1ZLI A;  1FNO A;  5HVH A;  2ZOG A;  3NH5 A;  2ZEN A;  4GM5 A;  2PCU A;  4UIB A;  1TKF A;  4OP4 A;  4NGN A;  4NGM A;  2PJA A;  5I4M A;  5LYD A;  5JGF A;  3D4U A;  2PJ4 A;  3KGQ A;  2HC9 A;  3SI0 A;  2ZEE A;  2PJC A;  1HEE A;  3SJX A;  4DYO A;  1JQG A;  3TX8 A;  3FEE A;  1ARM A;  3B35 A;  2PIZ A;  4IAV A;  3B3W A;  3CDX A;  2PJ0 A;  2XEI A;  4OC5 A;  1YW6 A;  3SI2 A;  1BPN A;  1IY7 A;  2G9D A;  1YLO A;  3ISX A;  3WC7 A;  3I1U A;  3S9N A;  3FED A;  4H2K A;  3D7F A;  4FWU A;  3PB8 X;  3B3T A;  4KSI A;  4NJQ A;  3D7D A;  5K8M A;  4A39 A;  3CT9 A;  4R7M A;  1GYT A;  1KWM A;  1XMB A;  2I3C A;  5ELY A;  4OC0 A;  2XEG A;  5HVG A;  4ONW A;  4A37 A;  3D7G A;  3RBU A;  1LAM A;  3GLJ A;  3KL9 A;  3B3C A;  5LYI A;  3ISZ A;  3SI1 A;  4F9U A;  2CTC A;  4EME A;  3S9M A;  1CP7 A;  2NYQ A;  3PBE A;  4ZX8 A;  3KAS A;  5JH9 A;  3DLJ A;  4P4B A;  3PB9 X;  1CPS A;  2GU2 A;  4R8F A;  3HLP A;  4B6Z A;  2C6G A;  1UWY A;  1F2P A;  4WWV A;  4W9Y A;  1VGY A;  5K8P A;  2AFM A;  1XFO A;  4LQG A;  5J1Q A;  4NGS A;  3PB4 X;  2JEW A;  4K3N A;  4MHY A;  2GRE A;  3FH4 A;  4A94 A;  4OKO A;  2QJ8 A;  8CPA A;  2PJ8 A;  4O23 A;  4TNU A;  3V7Z A;  4G1P A;  4CPA A;  2F7V A;  3K2K A;  5D8N A;  3IFE A;  6CPA A;  1NSA A;  1ARL A;  4NGT A;  4NJR A;  1FT7 A;  2DEA A;  1HDU A;  4FAI A;  1Z5R A;  2V8D A;  3PRT A;  3D67 A;  1BAV A;  3VAT A;  4BD9 A;  4MCQ A;  3PBB A;  2ZED A;  4UEE A;  3HUV A;  3KHZ A;  4F9V A;  4OC4 A;  3L2N A;  4OC2 A;  2Q51 A;  5D29 A;  4FBE A;  3FJU A;  2AFW A;  3IO1 A;  4DJL A;  3KQX A;  4P6Y A;  2IQ6 A;  1ELM P;  3CPX A;  2PJ7 A;  3JRU A;  2NSM A;  3MN8 A;  3VAR A;  1CBX A;  1ELL P;  2POK A;  4JZ0 A;  3RAM A;  4ZI6 A;  3V38 A;  1ZG7 A;  3KZW A;  4ZY0 A;  2ZEG A;  3BHX A;  3WAB A;  4X3R A;  2F8H A;  2OR4 A;  2ZOF A;  3PB6 X;  3FMC A;  4ZX9 A;  4R6T A;  5HVF A;  1HDQ A;  3NH4 A;  4X2T A;  3IEH A;  4UEF A;  2PJ9 A;  1VHO A;  5DS0 A;  2PJB A;  3BI0 A;  5F09 A;  2C6P A;  4IK2 A;  4MHN A;  3KI9 A;  1H8L A;  4P10 A;  4P4F A;  2AFX A;  3H8E A;  4MMO A;  4RUH A;  4JYW A;  3PEI A;  5LRJ A;  2BO9 A;  4Z65 A;  2ZEF A;  2BOA A;  3IC1 A;  3SJG A;  4PXB A;  2CTB A;  1LFW A;  3WC6 A;  5LRG A;  1LOK A;  4AXV A;  1DTD A;  2PIY A;  4NGR A;  4OME A;  1AYE A;  2FVG A;  3GUX A;  3LWU A;  4YU9 A;  3MRU A;  2BCO A;  2V8H A;  1Z2L A;  4TWE A;  2XEJ A;  5K8O A;  1Q7L A;  3D68 A;  5K8N A;  3H8F A;  3D66 A;  1QMU A;  3S9L A;  5CPA A;  3NH8 A;  2VL1 A;  3NA6 A;  1F2O A;  1TKJ A;  1R43 A;  2C1C A;  2GLJ A;  2IJZ A;  3RZA A;  3NFZ A;  2AFO A;  2WZN A;  3QNV A;  2QVP A;  4PXD A;  1PYT B;  4X8I A;  2QYV A;  4UEZ A;  1VIX A;  2O4H A;  4NGQ A;  2ZEM A;  1LAN A;  2O53 A;  2CF4 A;  3B3S A;  4NGP A;  2ZEH A;  2CIJ A;  1BPM A;  4PXC A;  1YSJ A;  1F57 A;  2Q4Z A;  4MCS A;  1XRY A;  2GLF A;  4EFD A;  1IGB A;  4Q7A A;  3FF3 A;  1CX8 A;  2IMO A;  4ZYQ A;  2EK9 A;  2AFS A;  2V8G A;  3CPA A;  3GB0 A;  3D7H A;  5LYF A;  4UF4 A;  3FVL A;  4MXU A;  3B2Y A;  4P4J A;  1PCA A;  1CPX A;  2J9A A;  4P44 A;  5HXD A;  4MHZ A;  2EK8 A;  1TF8 A;  1TF9 A;  4NFR A;  3B7I A;  4EWT A;  2PVW A;  1TXR A;  2JBK A;  1XBU A;  2AFZ A;  3FX6 A;  2ABZ A;  4DUK A;  3BI1 A;  3IWW A;  1LAP A;  3KHX A;  1YME A;  3TC8 A;  1R3N A;  4R76 A;  4PPZ A;  4ZY1 A;  1ZG9 A;  4OC1 A;  4F8Z A;  1EE3 P;  2WYR A;  1XJO A;  2PJ1 A;  2RB7 A;  4OC3 A;  5LRK A;  3KR5 A;  5THW A;  4P4D A;  3BXM A;  2AFU A;  3T8W A;  4P45 A;  4IHM A;  1TKH A;  2PRQ A;  2OOT A;  1ZLH A;  3IIB A;  3WC5 A;  3SJF A;  2PJ2 A;  2V8V A;  4OID A;  2EWB A;  4MCP A;  2ZEO A;  3FEC A;  5IB9 A;  2ZEP A;  4PQA A;  4WJB A;  3VH9 A;  4MRI A;  5JM6 A;  1RTQ A;  4OIW A;  4P4E A;  1DE4 C;  1CP6 A;  3PB7 X;  1OBR A;  4FUU A;  1ZG8 A;  3KQZ A;  2RFH A;  3IJ3 A;  3KR4 A;  1QQ9 A;  2PJ6 A;  2PJ3 A;  2PJ5 A;  1M4L A;  1Z8L A;  4YWY A;  2PVV A;  5CBM A;  1AMP A;  1Y0R A;  1CG2 A;  3K9T A;  1YW4 A;  1LCP A;  2PE3 A;  4MHP A;  4P4I A;  1VHE A;  3WT4 A;  4ZY2 A;  3PFE A;  4UIA A;  2HB6 A;  3LMS A;  5LYL A;  3H8G A;  3PFO A;  2V77 A;  3SJE A;  2Q43 A;  1Y0Y A;  2ANP A;  4A38 A;  2ZEL A;  1BLL E;  3DGV A;  1Y7E A;  4MCR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...