2NYQA

Structure of vibrio proteolyticus aminopeptidase with a bound trp fragment of dlwcf
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
291
structure length
291
Chain Sequence
MPPITQQATVTAWLPQVDASQITGTISSLESFTNRFYTTTSGAQASDWIASEWQALSASLPNASVKQVSHSGYNQKSVVMTITGSEAPDEWIVIGGHLDSTIGSHTNEQSVAPGADDDASGIAAVTEVIRVLSENNFQPKRSIAFMAYAAEEVGLRGSQDLANQYKSEGKNVVSALQLDMTNYKGSAQDVVFITDYTDSNFTQYLTQLMDEYLPSLTYGFDTCGYACSDHASWHNAGYPAAMPFESKFNDYNPRIHTTQDTLANSDPTGSHAKKFTQLGLAYAIEMGSATG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aminopeptidase
publication title Substrate recognition by the leucine aminopeptidase from Vibrio proteolyticus
rcsb
molecule tags Hydrolase
total genus 111
structure length 291
sequence length 291
ec nomenclature ec 3.4.11.10: Bacterial leucyl aminopeptidase.
pdb deposition date 2006-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 2nyqA00
5I4MA 1KWMA 2ZEHA 1Q7LA 4OC3A 4TNUA 2ZEMA 5IB9A 2GU2A 3GUXA 3CT9A 2PJ5A 3SJXA 3NFZA 4IHMA 2DEAA 3NA6A 1FT7A 1ZG8A 2C6GA 4P44A 3PFOA 1Y0YA 3BXMA 3WABA 2JEWA 3PB8X 4R8FA 3D68A 2NSMA 1OBRA 3KZWA 4P6YA 3KHXA 3IIBA 2PJCA 2G9DA 2AFSA 3D4UA 1LOKA 1XMBA 5ELYA 2ZENA 2PJ3A 4ZY2A 5JM6A 4OC4A 4R76A 3TX8A 3L2NA 3S9LA 4PXDA 3NH5A 4MHPA 1LAPA 5HVHA 4GM5A 5CBMA 4UEFA 5K8NA 2PIZA 4P10A 3H8FA 1ZLHA 4K3NA 1AYEA 4MRIA 4AXVA 3KGQA 5D29A 4A94A 5CPAA 5LRGA 2QYVA 3PB7X 4JZ0A 3VH9A 5D8NA 4NFRA 2CIJA 4W9YA 3SJGA 3TC8A 3CDXA 3GB0A 3LWUA 3SJEA 4F9UA 2PJ8A 2BCOA 2V77A 2QVPA 4P4IA 3VATA 4FWUA 2ZEDA 5LRKA 2AFZA 2V8GA 2Q51A 2XEIA 2ZEFA 3RAMA 1F57A 1LFWA 4MCRA 3B3TA 3RZAA 5J1QA 4NJRA 2PJ7A 2POKA 3KL9A 1RTQA 4OC1A 1ELLP 4NGRA 2BO9A 3FJUA 1EE3P 1TKJA 4ZX8A 4P4EA 4JYWA 3D7DA 3KR5A 3I1UA 3QNVA 3NH4A 4EMEA 1YMEA 1ARMA 3DGVA 4F8ZA 1YW4A 3NH8A 4Z65A 4LQGA 2PJ1A 4BD9A 3KQZA 4UIAA 4B6ZA 1JQGA 3B3VA 3SI0A 4OIDA 3T8WA 3CPXA 4X8IA 1F2OA 4UEEA 1TKHA 4ZY1A 1IGBA 4Q7AA 3D7FA 5JGFA 4PXEA 2AFUA 3IFEA 2WYRA 4ONWA 4R7MA 2J9AA 4P4FA 2O4HA 2CTCA 5DS0A 4DYOA 1ZG9A 4P4JA 2OOTA 4PPZA 3S9NA 4OIWA 3DLJA 3PBBA 3WC7A 4MCQA 2JBKA 1BAVA 2XEGA 3ISXA 3KHZA 4OC2A 4P4DA 4IK2A 1Y7EA 1FNOA 7CPAA 3K9TA 2C6PA 4MCSA 1CX8A 2IMOA 2F8HA 4MCPA 2AFOA 1IY7A 2PJ4A 5LYIA 4UEZA 3K2KA 3FEEA 4OP4A 1BPNA 4NJQA 4R6TA 1Z8LA 3N5FA 3H8EA 1UWYA 1R43A 4FUUA 2PJBA 3V7ZA 4G1PA 2EK9A 2ZOFA 3B2YA 2AFXA 3WC5A 1AMPA 3PB6X 4EWTA 3BHXA 5K8MA 2PCUA 2VL1A 3KASA 5LYFA 4X3RA 2AFMA 1VGYA 3ISZA 3GLJA 1DTDA 2PJAA 3B35A 3WT4A 2NYQA 3V38A 4OKOA 2PJ6A 4NGMA 3LMSA 1ARLA 4ZYQA 4YU9A 4WWVA 1TF9A 2ZOGA 2AFWA 2CTBA 3IWWA 5HVFA 2QJ8A 4MHYA 4MHNA 4F9VA 3VARA 2EWBA 2F7VA 1TKFA 1XFOA 4MHZA 4ZX9A 3B7IA 3IEHA 1CPXA 3BI0A 3IJ3A 1YW6A 1H8LA 3RBUA 4IAVA 3FF3A 1LAMA 4P45A 4PXCA 1HDQA 4MMOA 5K8PA 6CPAA 1ZLIA 5LYDA 1BLLE 2ZELA 1CP7A 3CPAA 3PEIA 5K8OA 3D7HA 3S9MA 3PRTA 4NGNA 1DE4C 2RFHA 5F09A 2PVWA 1CG2A 4NGTA 1ELMP 2XEFA 1HEEA 2WZNA 4NGQA 2RB7A 1VHEA 4FAIA 4EFDA 2PRQA 2PJ2A 4RUHA 1XJOA 4OC0A 4ZI6A 5LYLA 3PB4X 1GYTA 3KR4A 1QQ9A 3FX6A 3D7GA 1PCAA 3SJFA 1R3NA 3BI1A 4A38A 2ZEGA 1CP6A 4OMEA 1CBXA 3FVLA 2I3CA 2PIYA 3IO1A 5HXDA 3KI9A 4OC5A 4KSIA 1LANA 8CPAA 1XBUA 4NGPA 1TF8A 3HLPA 4NGSA 2C6CA 2HC9A 2V8HA 2PE3A 1LCPA 3B3SA 4X2TA 3B3CA 4PXBA 2ANPA 1Y0RA 4O23A 1PYTB 1YSJA 2GLFA 4PQAA 4WJBA 4CPAA 3FECA 2ABZA 1VHOA 3HUVA 2Q43A 2PVVA 2V8DA 3KQXA 3SI1A 2IJZA 1TXRA 4H2KA 2FVGA 2XEJA 1BPMA 3D66A 2V8VA 5THWA 2BOAA 3FEDA 2CF4A 5LRJA 3SI2A 2EK8A 2ZEPA 2Q4ZA 1QMUA 3PBEA 2ZEOA 4YWYA 4A37A 4DUKA 2OR4A 4ZY0A 2PJ9A 3PFEA 2O53A 3JRUA 1NSAA 1YLOA 4FBEA 1M4LA 3IC1A 4DJLA 1HDUA 5HVGA 1Z2LA 4UIBA 3MN8A 2PJ0A 3WC6A 1ZG7A 4TWEA 3PB9X 2GLJA 4P4BA 1VIXA 1Z5RA 2HB6A 2IQ6A 2C1CA 4MXUA 4UF4A 4A39A 3B3WA 1XRYA 5JH9A 2GREA 3FMCA 2JBJA 1F2PA 3D67A 3H8GA 1CPSA 3FH4A 2ZEEA 3MRUA
chains in the Genus database with same CATH superfamily
2P6GA 1VKCA 4C2XA 2CNTA 4R87A 5I4MA 1KWMA 2ZEHA 4M6GA 4MFJA 5E96A 4E0AA 1Q7LA 4OC3A 1Q2DA 3A9LA 4TNUA 2ZEMA 4C68A 3IGRA 2FXFA 2GU2A 3GUXA 3CXPA 3CT9A 2PJ5A 4H6UA 3SJXA 3NFZA 3TO9A 4IHMA 2AE6A 1MJ9A 4FD7A 2DEAA 4L8AA 3NA6A 4KOTA 1FT7A 4KVOE 5IB0A 1ZG8A 3T90A 2C6GA 3KKWA 4P44A 3IWGA 2ZW7A 3PFOA 1Y0YA 4YGOA 1NSLA 3BXMA 4ORFA 1IYLA 2JEWA 3P2FA 3WABA 1UFHA 3PB8X 3TE4A 2REFA 4R8FA 3D68A 2QECA 4MY0A 4UFVA 2NSMA 2Z11A 3K9UA 1OBRA 2OH1A 2VQYA 3KZWA 5AGEA 4JWPA 4P6YA 1S60A 3KHXA 3IIBA 3DR6A 3DNSA 2PJCA 2DPSA 2G9DA 2ZW4A 4RI1A 2AFSA 3E0KA 4Y49C 3D4UA 1LOKA 4UA3A 1XMBA 5ELYA 2B4DA 2ZENA 5GCNA 2PJ3A 4ZY2A 4HNXB 3EFAA 4C2ZA 3LD2A 5JM6A 4UFXA 3TT2A 4BINA 2FCKA 2B4DB 4GS4A 4OC4A 4R76A 2H5MA 1LRZA 1Z8WA 3TX8A 1ON0A 3L2NA 1S7LA 3BJ8A 3S9LA 3R1KA 3TTHA 4PXDA 3NH5A 1GHEA 4MHPA 3PGPA 2DPTA 1LAPA 5HVHA 1KUVA 2CY2A 4GM5A 4KUAA 3QB8A 2B4BA 5F46A 1XIXA 2ODFA 5CBMA 4UEFA 5K8NA 2X7BA 4CGOA 3DR8A 2CNSA 3H5ZA 2F5IA 2PIZA 4P10A 1YQEA 2PR8A 4A2ZA 3H8FA 4BMHA 1ZLHA 4K3NA 3TFYA 2G3TA 2G0BA 3IU1A 3D2MA 5G20A 1KUYA 3ZZIA 3JVNA 1AYEA 4MFPA 3TOAA 2R7HA 4MRIA 4AXVA 3KGQA 1XE4A 3F5BA 4A32A 5D29A 2A4NA 2OZGA 5KTAA 4A94A 5CPAA 1KZFA 5LRGA 4KSFA 2QYVA 4F0XA 3S6GA 2B58A 3PB7X 2Q04A 1A2ZA 2WPXA 5IX3A 4PK2A 5F47A 2ZW5A 3F0AA 5A28A 4JZ0A 3D8PA 3VH9A 5D8NA 4ONUA 1X12A 2WSAA 1YGHA 4NFRA 3GIUA 3I3GA 3LACA 2CIJA 1IB1E 3S6FA 4W9YA 2FIWA 3W6SA 4KLWA 3SJGA 3TC8A 3CDXA 3GB0A 3LWUA 3SJEA 1M44A 2HQYA 2PJ8A 4F9UA 1L0CA 4R9MA 5F49A 2BCOA 3QAYA 2V77A 1V0CA 1B6BA 2QVPA 5G1ZA 3R9FA 4P4IA 2K5TA 2YNCC 3VATA 4FWUA 2ZEDA 4CYNA 4OADA 5LRKA 1S5KA 1M4IA 3FYNA 2AFZA 2V8GA 4CAFA 5G22A 1IIDA 3S6HA 2Q51A 4PK3A 2XEIA 1BO4A 2FL4A 2ZEFA 5I0CA 1I21A 4B13A 3G8WA 1WK4A 1JWQA 3RAMA 2CNMA 4C2YA 2ZW6A 3FB3A 4R57A 1F57A 4YFJA 1LFWA 4MCRA 3B3TA 1YVOA 2Z10A 3RZAA 5J1QA 4NJRA 4AG9A 3DSBA 1WWZA 2PJ7A 3FXTA 2R8VA 2POKA 2EBJA 2Q7SA 3KL9A 4KLVA 4F6AA 2P6EA 3FRMA 2PR1A 3RNZA 4E2AA 1RTQA 4QB9A 4OC1A 1ELLP 1IOFA 4NEXA 4NGRA 2BO9A 2ZPAA 4XNHB 3FJUA 1EE3P 1TKJA 2B3UA 3MGDA 4ZX8A 4P4EA 2ARHA 4JYWA 3D7DA 3KR5A 3I1UA 3QNVA 1K4JA 4HPSA 4CRZB 3BJ7A 3NH4A 4JJXA 3SXOA 4EMEA 2CXAA 1YMEA 2R1IA 1ARMA 3DGVA 4F8ZA 5C82A 1YW4A 4HKFA 4DNCA 4ZGYB 4Q38A 3R96A 1YR0A 3NH8A 5G21A 4Z65A 2J8NA 4LQGA 4CGMA 1VHSA 2PJ1A 2PSWA 2VZZA 4BD9A 4HNYB 1YX0A 3KQZA 5HH1A 4UIAA 1Q2YA 3P2HA 4B6ZA 1JQGA 2YGWA 3B3VA 1Z9UA 3TO7A 2AJ6A 3IWEA 4FD6A 2VXKA 1Q2CA 3SI0A 4AG7A 1XMTA 4OIDA 2Z0ZA 3T8WA 3CPXA 4B12A 4KOVA 4JD6A 3PZJA 4X8IA 1F2OA 1N71A 4UEEA 1TKHA 1S7KA 1CM0A 4KOYA 4UCNA 1IGBA 4B5PA 4ZY1A 3OWCA 4CGLA 4KOXA 4Q7AA 2ZXVA 3B8GA 3D7FA 4AVCA 4PXEA 5JGFA 2FIAA 3SXNA 2AFUA 3IFEA 4B5OA 2WYRA 4ONWA 4QVTA 4R7MA 4B5PB 2J9AA 1P4NA 5DWMA 4P4FA 3NE8A 5H86A 3WR7A 2O4HA 2Q0YA 2CTCA 5DS0A 4DYOA 1NMTA 1ZG9A 4P4JA 2EUIA 5F09A 2OOTA 2I79A 4PPZA 4OLLA 4KS9A 3S9NA 3FNCA 4OIWA 3FBUA 1R57A 3DLJA 3LODA 3PBBA 3WC7A 4MCQA 2JBKA 1BAVA 2XEGA 3ISXA 5KTCA 4JXQA 3KHZA 4OC2A 4P4DA 4IK2A 4PSWA 1Y7EA 1FNOA 7CPAA 2WUUA 2Z3OA 3FIXA 3K9TA 2C6PA 3F8KA 1B87A 4MCSA 2OU2A 5EMIA 2Y0MA 1CX8A 2IMOA 2F8HA 2VEZA 1Z4RA 3IU2A 4MCPA 4NXYA 5J8CA 1S7FA 1I1DA 2AFOA 1IY7A 2PJ4A 2GIVA 5AG7A 5LYIA 1IICA 4UEZA 1YK3A 3K2KA 3FEEA 4OP4A 4Q36A 1BPNA 4M6IA 1IYKA 4NJQA 4QBJA 4R6TA 1M4GA 1Z8LA 4FD4A 2GE3A 4KVXA 1U6MA 4GXHA 3N5FA 4Y49B 5EC4A 3H8EA 1UWYA 1R43A 4H6ZA 4FUUA 4M6HA 1NE9A 2PJBA 4G1PA 4U5YA 4H89A 2EK9A 3V7ZA 2ZOFA 3B2YA 2AFXA 3WC5A 1AMPA 2OZHA 1P0HA 4UCPA 4YRHA 1QSMA 3PB6X 4EWTA 4C7IA 3BHXA 3R9GA 2FE7A 4MFLA 2J8RA 5K8MA 2YNDA 2PCUA 2VL1A 3KASA 4CYOA 5LYFA 1AUGA 4X3RA 4QUSA 4UWJA 4PV6A 2AFMA 1VGYA 1TIQA 2BSWA 2QIRA 4CAEA 4XPLA 3ISZA 2O28A 2PRBA 3GLJA 4CGPA 4B11A 4JLYA 4U9ZA 4J3GA 1DTDA 2PJAA 3B35A 2JDDA 3WT4A 2Q4VA 2NYQA 1X10A 3V38A 4A95A 2PDOA 2OZUA 4MBUA 2IL4A 4OKOA 3W6XA 2PJ6A 2P0WA 1QSOA 4A31A 1MJBA 4NGMA 3LMSA 1ARLA 5AG5A 4E8OA 3GKRA 2Z3PA 4ZYQA 2OB0A 2EVNA 4YU9A 4WWVA 1TF9A 2JLMA 2ZOGA 2AFWA 2CTBA 3GY9A 3IWWA 2QJ8A 4MHYA 5HVFA 3R9EA 3CXQA 1Z8TA 4KOSA 2HV2A 4MHNA 1Y9KA 4IF5A 3VARA 4F9VA 5BWAB 5IB9A 2EWBA 3H4QA 2D4PA 5HMNA 1IU8A 2F7VA 1YLEA 4CS0B 2YNEA 3I9SA 1TKFA 1XFOA 4MHZA 4ZX9A 3B7IA 1QSRA 3IEHA 1QSNA 2VI7A 1CPXA 3BI0A 3IJ3A 4KZTA 1YW6A 1H8LA 3RBUA 4IAVA 1FY7A 3DDDA 1YVKA 2QMLA 1LAMA 3FF3A 4OAEA 4P45A 1SQHA 4PXCA 4XPKA 1HDQA 4MMOA 3BLNA 5A27A 5K8PA 6CPAA 4RS2A 5AG4A 4KOUA 1ZLIA 4KORA 2YNCA 4R3KA 5LYDA 1BLLE 5KTDA 1XOVA 2ZELA 3JUWA 1BOBA 3D2PA 1CP7A 3CPAA 3PEIA 5K8OA 5AG6A 3D7HA 3D3SA 3VWDA 4CAWA 5DWNA 3S9MA 2BUEA 3PRTA 4NGNA 4CYQA 1DE4C 1Z4EA 2B5GA 1M4DA 2PVWA 1CG2A 2RFHA 2VZYA 2JEVA 4NGTA 3TCVA 4ZY0A 3EO4A 1ELMP 2XEFA 4C7HA 1HEEA 2WZNA 2B5GB 4KSAA 4NGQA 4CGNA 2RB7A 1VHEA 2Z3MA 3RYOA 4KUBA 4KOWA 4MJ8A 4FAIA 4CAVA 2PQ8A 4EFDA 2PRQA 1MJAA 2PJ2A 4RUHA 1XJOA 4OC0A 4ZI6A 5LYLA 4L89A 3PB4X 1GYTA 4UWIA 3KR4A 4MFQA 1QQ9A 4CYPA 3FX6A 4MFZA 4R3LA 3D7GA 1PCAA 4MFKA 3SJFA 2JDCA 1R3NA 3BI1A 4A38A 2BL1A 2ZEGA 4FD5A 1CP6A 4OMEA 4AVAA 1CBXA 4QC6A 2GFQA 3RO0A 3FVLA 2DF5A 4CRYB 2I3CA 2PIYA 2Z3LA 3IO1A 4A33A 5HXDA 5IV0A 5C88A 3KI9A 4OC5A 5ISVA 2ATRA 5H84A 1XEBA 3S6KA 4KSIA 3ZJ0A 1LANA 8CPAA 1XBUA 2FSRA 2GANA 4NF1A 1TF8A 4NGPA 4MI4A 4EVYA 3HLPA 4NGSA 2C6CA 3EXNA 2HC9A 2R98A 4K30A 4UFWA 1Z8XA 2PC1A 2V8HA 1PU9A 2PE3A 4XPDC 1LCPA 3B3SA 3NE7A 3B3CA 2P6FA 4X2TA 1ZO0A 4NSQA 2Q7BA 4PXBA 2ANPA 5FVJA 1Y0RA 4O23A 1PYTB 1S3ZA 1YSJA 2Z3NA 2GLFA 3G3SA 4PQAA 4WJBA 4I49A 1Y7RA 4CPAA 4MY3A 3FECA 4B14A 3T9YA 2ABZA 4IUSA 1QSTA 1VHOA 1YREA 2Q43A 3C26A 3HUVA 2PVVA 2G3AA 2V8DA 3KQXA 3SI1A 3W91A 2VBQA 2IJZA 5EBVA 1TXRA 4H2KA 2FVGA 2XEJA 2KCWA 2Z3KA 1BPMA 3D66A 1I12A 4MHDA 2FT0A 4PSXA 5CNPA 2REEA 2V8VA 4AVBA 4KVME 5THWA 3CZXA 2BOAA 3FEDA 2CF4A 2EO8A 5LRJA 3SI2A 3TO6A 2EK8A 1S7NA 1RO5A 2ZEPA 2Q44A 2Q4ZA 1QMUA 5JPHA 4AB7A 3R95A 3PBEA 3PP9A 2NMTA 2B3VA 2ZEOA 4YWYA 4XNHC 3N7ZA 3GYAA 4A37A 1IOIA 4CAXA 5JQ4A 4DUKA 1KUXA 2OR4A 2PJ9A 3PFEA 1Y9WA 2O53A 3JRUA 1NSAA 1YLOA 4NCZA 3V8IA 4FBEA 1M4LA 2HUZA 4UCMA 3IC1A 2FS5A 4B10A 1HDUA 4DJLA 5HVGA 4M85A 2DXQA 1Z2LA 3SHPA 4II9A 4XPDB 2Q4YA 4M3SA 4UIBA 3MN8A 1OZPA 4A30A 4BBHA 3UY5A 2I00A 3EY5A 3JTKA 2PJ0A 3QAHA 3WC6A 1PUAA 1CJWA 1XF8A 4UBRA 1ZG7A 4TWEA 1M1DA 4U9YA 5J8FA 5F48A 1MK4A 2D4OA 3PB9X 3EC4A 1J4JA 4HNWB 4LQ6A 2WPWA 2GLJA 4P4BA 2BEIA 2J8MA 4F0YA 1VIXA 1Z5RA 2HB6A 2IQ6A 2RC4A 2C1CA 4MXUA 3VWEA 3TOBA 4UF4A 4LUAA 4A39A 3B3WA 1XRYA 5JH9A 2GREA 3FMCA 4ZBGA 2JBJA 1F2PA 3D67A 2C27A 4X5KA 3H8GA 1CPSA 4JXRA 3FH4A 2ZEEA 3MRUA 4LX9A 3CXSA 4RN7A 1RXTA
chains in the Genus database with same CATH topology
5I4MA 1KWMA 2ZEHA 1Q7LA 4OC3A 4TNUA 2ZEMA 5IB9A 2GU2A 3GUXA 3CT9A 2PJ5A 3SJXA 3NFZA 4IHMA 2DEAA 3NA6A 1FT7A 1ZG8A 2C6GA 4P44A 3PFOA 1Y0YA 3BXMA 3WABA 2JEWA 3PB8X 4R8FA 3D68A 2NSMA 1OBRA 3KZWA 4P6YA 3KHXA 3IIBA 2PJCA 2G9DA 2AFSA 3D4UA 1LOKA 1XMBA 5ELYA 2ZENA 2PJ3A 4ZY2A 5JM6A 4OC4A 4R76A 3TX8A 3L2NA 3S9LA 4PXDA 3NH5A 4MHPA 1LAPA 5HVHA 4GM5A 5CBMA 4UEFA 5K8NA 2PIZA 4P10A 3H8FA 1ZLHA 4K3NA 1AYEA 4MRIA 4AXVA 3KGQA 5D29A 4A94A 5CPAA 5LRGA 2QYVA 3PB7X 4JZ0A 3VH9A 5D8NA 4NFRA 2CIJA 4W9YA 3SJGA 3TC8A 3CDXA 3GB0A 3LWUA 3SJEA 4F9UA 2PJ8A 2BCOA 2V77A 2QVPA 4P4IA 3VATA 4FWUA 2ZEDA 5LRKA 2AFZA 2V8GA 2Q51A 2XEIA 2ZEFA 3RAMA 1F57A 1LFWA 4MCRA 3B3TA 3RZAA 5J1QA 4NJRA 2PJ7A 2POKA 3KL9A 1RTQA 4OC1A 1ELLP 4NGRA 2BO9A 3FJUA 1EE3P 1TKJA 4ZX8A 4P4EA 4JYWA 3D7DA 3KR5A 3I1UA 3QNVA 3NH4A 4EMEA 1YMEA 1ARMA 3DGVA 4F8ZA 1YW4A 3NH8A 4Z65A 4LQGA 2PJ1A 4BD9A 3KQZA 4UIAA 4B6ZA 1JQGA 3B3VA 3SI0A 4OIDA 3T8WA 3CPXA 4X8IA 1F2OA 4UEEA 1TKHA 4ZY1A 1IGBA 4Q7AA 3D7FA 5JGFA 4PXEA 2AFUA 3IFEA 2WYRA 4ONWA 4R7MA 2J9AA 4P4FA 2O4HA 2CTCA 5DS0A 4DYOA 1ZG9A 4P4JA 2OOTA 4PPZA 3S9NA 4OIWA 3DLJA 3PBBA 3WC7A 4MCQA 2JBKA 1BAVA 2XEGA 3ISXA 3KHZA 4OC2A 4P4DA 4IK2A 1Y7EA 1FNOA 7CPAA 3K9TA 2C6PA 4MCSA 1CX8A 2IMOA 2F8HA 4MCPA 2AFOA 1IY7A 2PJ4A 5LYIA 4UEZA 3K2KA 3FEEA 4OP4A 1BPNA 4NJQA 4R6TA 1Z8LA 3N5FA 3H8EA 1UWYA 1R43A 4FUUA 2PJBA 3V7ZA 4G1PA 2EK9A 2ZOFA 3B2YA 2AFXA 3WC5A 1AMPA 3PB6X 4EWTA 3BHXA 5K8MA 2PCUA 2VL1A 3KASA 5LYFA 4X3RA 2AFMA 1VGYA 3ISZA 3GLJA 1DTDA 2PJAA 3B35A 3WT4A 2NYQA 3V38A 4OKOA 2PJ6A 4NGMA 3LMSA 1ARLA 4ZYQA 4YU9A 4WWVA 1TF9A 2ZOGA 2AFWA 2CTBA 3IWWA 5HVFA 2QJ8A 4MHYA 4MHNA 4F9VA 3VARA 2EWBA 2F7VA 1TKFA 1XFOA 4MHZA 4ZX9A 3B7IA 3IEHA 1CPXA 3BI0A 3IJ3A 1YW6A 1H8LA 3RBUA 4IAVA 3FF3A 1LAMA 4P45A 4PXCA 1HDQA 4MMOA 5K8PA 6CPAA 1ZLIA 5LYDA 1BLLE 2ZELA 1CP7A 3CPAA 3PEIA 5K8OA 3D7HA 3S9MA 3PRTA 4NGNA 1DE4C 2RFHA 5F09A 2PVWA 1CG2A 4NGTA 1ELMP 2XEFA 1HEEA 2WZNA 4NGQA 2RB7A 1VHEA 4FAIA 4EFDA 2PRQA 2PJ2A 4RUHA 1XJOA 4OC0A 4ZI6A 5LYLA 3PB4X 1GYTA 3KR4A 1QQ9A 3FX6A 3D7GA 1PCAA 3SJFA 1R3NA 3BI1A 4A38A 2ZEGA 1CP6A 4OMEA 1CBXA 3FVLA 2I3CA 2PIYA 3IO1A 5HXDA 3KI9A 4OC5A 4KSIA 1LANA 8CPAA 1XBUA 4NGPA 1TF8A 3HLPA 4NGSA 2C6CA 2HC9A 2V8HA 2PE3A 1LCPA 3B3SA 4X2TA 3B3CA 4PXBA 2ANPA 1Y0RA 4O23A 1PYTB 1YSJA 2GLFA 4PQAA 4WJBA 4CPAA 3FECA 2ABZA 1VHOA 3HUVA 2Q43A 2PVVA 2V8DA 3KQXA 3SI1A 2IJZA 1TXRA 4H2KA 2FVGA 2XEJA 1BPMA 3D66A 2V8VA 5THWA 2BOAA 3FEDA 2CF4A 5LRJA 3SI2A 2EK8A 2ZEPA 2Q4ZA 1QMUA 3PBEA 2ZEOA 4YWYA 4A37A 4DUKA 2OR4A 4ZY0A 2PJ9A 3PFEA 2O53A 3JRUA 1NSAA 1YLOA 4FBEA 1M4LA 3IC1A 4DJLA 1HDUA 5HVGA 1Z2LA 4UIBA 3MN8A 2PJ0A 3WC6A 1ZG7A 4TWEA 3PB9X 2GLJA 4P4BA 1VIXA 1Z5RA 2HB6A 2IQ6A 2C1CA 4MXUA 4UF4A 4A39A 3B3WA 1XRYA 5JH9A 2GREA 3FMCA 2JBJA 1F2PA 3D67A 3H8GA 1CPSA 3FH4A 2ZEEA 3MRUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5I4M A;  1KWM A;  2ZEH A;  1Q7L A;  4OC3 A;  4TNU A;  2ZEM A;  5IB9 A;  2GU2 A;  3GUX A;  3CT9 A;  2PJ5 A;  3SJX A;  3NFZ A;  4IHM A;  2DEA A;  3NA6 A;  1FT7 A;  1ZG8 A;  2C6G A;  4P44 A;  3PFO A;  1Y0Y A;  3BXM A;  3WAB A;  2JEW A;  3PB8 X;  4R8F A;  3D68 A;  2NSM A;  1OBR A;  3KZW A;  4P6Y A;  3KHX A;  3IIB A;  2PJC A;  2G9D A;  2AFS A;  3D4U A;  1LOK A;  1XMB A;  5ELY A;  2ZEN A;  2PJ3 A;  4ZY2 A;  5JM6 A;  4OC4 A;  4R76 A;  3TX8 A;  3L2N A;  3S9L A;  4PXD A;  3NH5 A;  4MHP A;  1LAP A;  5HVH A;  4GM5 A;  5CBM A;  4UEF A;  5K8N A;  2PIZ A;  4P10 A;  3H8F A;  1ZLH A;  4K3N A;  1AYE A;  4MRI A;  4AXV A;  3KGQ A;  5D29 A;  4A94 A;  5CPA A;  5LRG A;  2QYV A;  3PB7 X;  4JZ0 A;  3VH9 A;  5D8N A;  4NFR A;  2CIJ A;  4W9Y A;  3SJG A;  3TC8 A;  3CDX A;  3GB0 A;  3LWU A;  3SJE A;  4F9U A;  2PJ8 A;  2BCO A;  2V77 A;  2QVP A;  4P4I A;  3VAT A;  4FWU A;  2ZED A;  5LRK A;  2AFZ A;  2V8G A;  2Q51 A;  2XEI A;  2ZEF A;  3RAM A;  1F57 A;  1LFW A;  4MCR A;  3B3T A;  3RZA A;  5J1Q A;  4NJR A;  2PJ7 A;  2POK A;  3KL9 A;  1RTQ A;  4OC1 A;  1ELL P;  4NGR A;  2BO9 A;  3FJU A;  1EE3 P;  1TKJ A;  4ZX8 A;  4P4E A;  4JYW A;  3D7D A;  3KR5 A;  3I1U A;  3QNV A;  3NH4 A;  4EME A;  1YME A;  1ARM A;  3DGV A;  4F8Z A;  1YW4 A;  3NH8 A;  4Z65 A;  4LQG A;  2PJ1 A;  4BD9 A;  3KQZ A;  4UIA A;  4B6Z A;  1JQG A;  3B3V A;  3SI0 A;  4OID A;  3T8W A;  3CPX A;  4X8I A;  1F2O A;  4UEE A;  1TKH A;  4ZY1 A;  1IGB A;  4Q7A A;  3D7F A;  5JGF A;  4PXE A;  2AFU A;  3IFE A;  2WYR A;  4ONW A;  4R7M A;  2J9A A;  4P4F A;  2O4H A;  2CTC A;  5DS0 A;  4DYO A;  1ZG9 A;  4P4J A;  2OOT A;  4PPZ A;  3S9N A;  4OIW A;  3DLJ A;  3PBB A;  3WC7 A;  4MCQ A;  2JBK A;  1BAV A;  2XEG A;  3ISX A;  3KHZ A;  4OC2 A;  4P4D A;  4IK2 A;  1Y7E A;  1FNO A;  7CPA A;  3K9T A;  2C6P A;  4MCS A;  1CX8 A;  2IMO A;  2F8H A;  4MCP A;  2AFO A;  1IY7 A;  2PJ4 A;  5LYI A;  4UEZ A;  3K2K A;  3FEE A;  4OP4 A;  1BPN A;  4NJQ A;  4R6T A;  1Z8L A;  3N5F A;  3H8E A;  1UWY A;  1R43 A;  4FUU A;  2PJB A;  3V7Z A;  4G1P A;  2EK9 A;  2ZOF A;  3B2Y A;  2AFX A;  3WC5 A;  1AMP A;  3PB6 X;  4EWT A;  3BHX A;  5K8M A;  2PCU A;  2VL1 A;  3KAS A;  5LYF A;  4X3R A;  2AFM A;  1VGY A;  3ISZ A;  3GLJ A;  1DTD A;  2PJA A;  3B35 A;  3WT4 A;  2NYQ A;  3V38 A;  4OKO A;  2PJ6 A;  4NGM A;  3LMS A;  1ARL A;  4ZYQ A;  4YU9 A;  4WWV A;  1TF9 A;  2ZOG A;  2AFW A;  2CTB A;  3IWW A;  5HVF A;  2QJ8 A;  4MHY A;  4MHN A;  4F9V A;  3VAR A;  2EWB A;  2F7V A;  1TKF A;  1XFO A;  4MHZ A;  4ZX9 A;  3B7I A;  3IEH A;  1CPX A;  3BI0 A;  3IJ3 A;  1YW6 A;  1H8L A;  3RBU A;  4IAV A;  3FF3 A;  1LAM A;  4P45 A;  4PXC A;  1HDQ A;  4MMO A;  5K8P A;  6CPA A;  1ZLI A;  5LYD A;  1BLL E;  2ZEL A;  1CP7 A;  3CPA A;  3PEI A;  5K8O A;  3D7H A;  3S9M A;  3PRT A;  4NGN A;  1DE4 C;  2RFH A;  5F09 A;  2PVW A;  1CG2 A;  4NGT A;  1ELM P;  2XEF A;  1HEE A;  2WZN A;  4NGQ A;  2RB7 A;  1VHE A;  4FAI A;  4EFD A;  2PRQ A;  2PJ2 A;  4RUH A;  1XJO A;  4OC0 A;  4ZI6 A;  5LYL A;  3PB4 X;  1GYT A;  3KR4 A;  1QQ9 A;  3FX6 A;  3D7G A;  1PCA A;  3SJF A;  1R3N A;  3BI1 A;  4A38 A;  2ZEG A;  1CP6 A;  4OME A;  1CBX A;  3FVL A;  2I3C A;  2PIY A;  3IO1 A;  5HXD A;  3KI9 A;  4OC5 A;  4KSI A;  1LAN A;  8CPA A;  1XBU A;  4NGP A;  1TF8 A;  3HLP A;  4NGS A;  2C6C A;  2HC9 A;  2V8H A;  2PE3 A;  1LCP A;  3B3S A;  4X2T A;  3B3C A;  4PXB A;  2ANP A;  1Y0R A;  4O23 A;  1PYT B;  1YSJ A;  2GLF A;  4PQA A;  4WJB A;  4CPA A;  3FEC A;  2ABZ A;  1VHO A;  3HUV A;  2Q43 A;  2PVV A;  2V8D A;  3KQX A;  3SI1 A;  2IJZ A;  1TXR A;  4H2K A;  2FVG A;  2XEJ A;  1BPM A;  3D66 A;  2V8V A;  5THW A;  2BOA A;  3FED A;  2CF4 A;  5LRJ A;  3SI2 A;  2EK8 A;  2ZEP A;  2Q4Z A;  1QMU A;  3PBE A;  2ZEO A;  4YWY A;  4A37 A;  4DUK A;  2OR4 A;  4ZY0 A;  2PJ9 A;  3PFE A;  2O53 A;  3JRU A;  1NSA A;  1YLO A;  4FBE A;  1M4L A;  3IC1 A;  4DJL A;  1HDU A;  5HVG A;  1Z2L A;  4UIB A;  3MN8 A;  2PJ0 A;  3WC6 A;  1ZG7 A;  4TWE A;  3PB9 X;  2GLJ A;  4P4B A;  1VIX A;  1Z5R A;  2HB6 A;  2IQ6 A;  2C1C A;  4MXU A;  4UF4 A;  4A39 A;  3B3W A;  1XRY A;  5JH9 A;  2GRE A;  3FMC A;  2JBJ A;  1F2P A;  3D67 A;  3H8G A;  1CPS A;  3FH4 A;  2ZEE A;  3MRU A; 
#chains in the Genus database with same CATH topology
 2P6G A;  1VKC A;  4C2X A;  2CNT A;  4R87 A;  5I4M A;  1KWM A;  2ZEH A;  4M6G A;  4MFJ A;  5E96 A;  4E0A A;  1Q7L A;  4OC3 A;  1Q2D A;  3A9L A;  4TNU A;  2ZEM A;  4C68 A;  3IGR A;  2FXF A;  2GU2 A;  3GUX A;  3CXP A;  3CT9 A;  2PJ5 A;  4H6U A;  3SJX A;  3NFZ A;  3TO9 A;  4IHM A;  2AE6 A;  1MJ9 A;  4FD7 A;  2DEA A;  4L8A A;  3NA6 A;  4KOT A;  1FT7 A;  4KVO E;  5IB0 A;  1ZG8 A;  3T90 A;  2C6G A;  3KKW A;  4P44 A;  3IWG A;  2ZW7 A;  3PFO A;  1Y0Y A;  4YGO A;  1NSL A;  3BXM A;  4ORF A;  1IYL A;  2JEW A;  3P2F A;  3WAB A;  1UFH A;  3PB8 X;  3TE4 A;  2REF A;  4R8F A;  3D68 A;  2QEC A;  4MY0 A;  4UFV A;  2NSM A;  2Z11 A;  3K9U A;  1OBR A;  2OH1 A;  2VQY A;  3KZW A;  5AGE A;  4JWP A;  4P6Y A;  1S60 A;  3KHX A;  3IIB A;  3DR6 A;  3DNS A;  2PJC A;  2DPS A;  2G9D A;  2ZW4 A;  4RI1 A;  2AFS A;  3E0K A;  4Y49 C;  3D4U A;  1LOK A;  4UA3 A;  1XMB A;  5ELY A;  2B4D A;  2ZEN A;  5GCN A;  2PJ3 A;  4ZY2 A;  4HNX B;  3EFA A;  4C2Z A;  3LD2 A;  5JM6 A;  4UFX A;  3TT2 A;  4BIN A;  2FCK A;  2B4D B;  4GS4 A;  4OC4 A;  4R76 A;  2H5M A;  1LRZ A;  1Z8W A;  3TX8 A;  1ON0 A;  3L2N A;  1S7L A;  3BJ8 A;  3S9L A;  3R1K A;  3TTH A;  4PXD A;  3NH5 A;  1GHE A;  4MHP A;  3PGP A;  2DPT A;  1LAP A;  5HVH A;  1KUV A;  2CY2 A;  4GM5 A;  4KUA A;  3QB8 A;  2B4B A;  5F46 A;  1XIX A;  2ODF A;  5CBM A;  4UEF A;  5K8N A;  2X7B A;  4CGO A;  3DR8 A;  2CNS A;  3H5Z A;  2F5I A;  2PIZ A;  4P10 A;  1YQE A;  2PR8 A;  4A2Z A;  3H8F A;  4BMH A;  1ZLH A;  4K3N A;  3TFY A;  2G3T A;  2G0B A;  3IU1 A;  3D2M A;  5G20 A;  1KUY A;  3ZZI A;  3JVN A;  1AYE A;  4MFP A;  3TOA A;  2R7H A;  4MRI A;  4AXV A;  3KGQ A;  1XE4 A;  3F5B A;  4A32 A;  5D29 A;  2A4N A;  2OZG A;  5KTA A;  4A94 A;  5CPA A;  1KZF A;  5LRG A;  4KSF A;  2QYV A;  4F0X A;  3S6G A;  2B58 A;  3PB7 X;  2Q04 A;  1A2Z A;  2WPX A;  5IX3 A;  4PK2 A;  5F47 A;  2ZW5 A;  3F0A A;  5A28 A;  4JZ0 A;  3D8P A;  3VH9 A;  5D8N A;  4ONU A;  1X12 A;  2WSA A;  1YGH A;  4NFR A;  3GIU A;  3I3G A;  3LAC A;  2CIJ A;  1IB1 E;  3S6F A;  4W9Y A;  2FIW A;  3W6S A;  4KLW A;  3SJG A;  3TC8 A;  3CDX A;  3GB0 A;  3LWU A;  3SJE A;  1M44 A;  2HQY A;  2PJ8 A;  4F9U A;  1L0C A;  4R9M A;  5F49 A;  2BCO A;  3QAY A;  2V77 A;  1V0C A;  1B6B A;  2QVP A;  5G1Z A;  3R9F A;  4P4I A;  2K5T A;  2YNC C;  3VAT A;  4FWU A;  2ZED A;  4CYN A;  4OAD A;  5LRK A;  1S5K A;  1M4I A;  3FYN A;  2AFZ A;  2V8G A;  4CAF A;  5G22 A;  1IID A;  3S6H A;  2Q51 A;  4PK3 A;  2XEI A;  1BO4 A;  2FL4 A;  2ZEF A;  5I0C A;  1I21 A;  4B13 A;  3G8W A;  1WK4 A;  1JWQ A;  3RAM A;  2CNM A;  4C2Y A;  2ZW6 A;  3FB3 A;  4R57 A;  1F57 A;  4YFJ A;  1LFW A;  4MCR A;  3B3T A;  1YVO A;  2Z10 A;  3RZA A;  5J1Q A;  4NJR A;  4AG9 A;  3DSB A;  1WWZ A;  2PJ7 A;  3FXT A;  2R8V A;  2POK A;  2EBJ A;  2Q7S A;  3KL9 A;  4KLV A;  4F6A A;  2P6E A;  3FRM A;  2PR1 A;  3RNZ A;  4E2A A;  1RTQ A;  4QB9 A;  4OC1 A;  1ELL P;  1IOF A;  4NEX A;  4NGR A;  2BO9 A;  2ZPA A;  4XNH B;  3FJU A;  1EE3 P;  1TKJ A;  2B3U A;  3MGD A;  4ZX8 A;  4P4E A;  2ARH A;  4JYW A;  3D7D A;  3KR5 A;  3I1U A;  3QNV A;  1K4J A;  4HPS A;  4CRZ B;  3BJ7 A;  3NH4 A;  4JJX A;  3SXO A;  4EME A;  2CXA A;  1YME A;  2R1I A;  1ARM A;  3DGV A;  4F8Z A;  5C82 A;  1YW4 A;  4HKF A;  4DNC A;  4ZGY B;  4Q38 A;  3R96 A;  1YR0 A;  3NH8 A;  5G21 A;  4Z65 A;  2J8N A;  4LQG A;  4CGM A;  1VHS A;  2PJ1 A;  2PSW A;  2VZZ A;  4BD9 A;  4HNY B;  1YX0 A;  3KQZ A;  5HH1 A;  4UIA A;  1Q2Y A;  3P2H A;  4B6Z A;  1JQG A;  2YGW A;  3B3V A;  1Z9U A;  3TO7 A;  2AJ6 A;  3IWE A;  4FD6 A;  2VXK A;  1Q2C A;  3SI0 A;  4AG7 A;  1XMT A;  4OID A;  2Z0Z A;  3T8W A;  3CPX A;  4B12 A;  4KOV A;  4JD6 A;  3PZJ A;  4X8I A;  1F2O A;  1N71 A;  4UEE A;  1TKH A;  1S7K A;  1CM0 A;  4KOY A;  4UCN A;  1IGB A;  4B5P A;  4ZY1 A;  3OWC A;  4CGL A;  4KOX A;  4Q7A A;  2ZXV A;  3B8G A;  3D7F A;  4AVC A;  4PXE A;  5JGF A;  2FIA A;  3SXN A;  2AFU A;  3IFE A;  4B5O A;  2WYR A;  4ONW A;  4QVT A;  4R7M A;  4B5P B;  2J9A A;  1P4N A;  5DWM A;  4P4F A;  3NE8 A;  5H86 A;  3WR7 A;  2O4H A;  2Q0Y A;  2CTC A;  5DS0 A;  4DYO A;  1NMT A;  1ZG9 A;  4P4J A;  2EUI A;  5F09 A;  2OOT A;  2I79 A;  4PPZ A;  4OLL A;  4KS9 A;  3S9N A;  3FNC A;  4OIW A;  3FBU A;  1R57 A;  3DLJ A;  3LOD A;  3PBB A;  3WC7 A;  4MCQ A;  2JBK A;  1BAV A;  2XEG A;  3ISX A;  5KTC A;  4JXQ A;  3KHZ A;  4OC2 A;  4P4D A;  4IK2 A;  4PSW A;  1Y7E A;  1FNO A;  7CPA A;  2WUU A;  2Z3O A;  3FIX A;  3K9T A;  2C6P A;  3F8K A;  1B87 A;  4MCS A;  2OU2 A;  5EMI A;  2Y0M A;  1CX8 A;  2IMO A;  2F8H A;  2VEZ A;  1Z4R A;  3IU2 A;  4MCP A;  4NXY A;  5J8C A;  1S7F A;  1I1D A;  2AFO A;  1IY7 A;  2PJ4 A;  2GIV A;  5AG7 A;  5LYI A;  1IIC A;  4UEZ A;  1YK3 A;  3K2K A;  3FEE A;  4OP4 A;  4Q36 A;  1BPN A;  4M6I A;  1IYK A;  4NJQ A;  4QBJ A;  4R6T A;  1M4G A;  1Z8L A;  4FD4 A;  2GE3 A;  4KVX A;  1U6M A;  4GXH A;  3N5F A;  4Y49 B;  5EC4 A;  3H8E A;  1UWY A;  1R43 A;  4H6Z A;  4FUU A;  4M6H A;  1NE9 A;  2PJB A;  4G1P A;  4U5Y A;  4H89 A;  2EK9 A;  3V7Z A;  2ZOF A;  3B2Y A;  2AFX A;  3WC5 A;  1AMP A;  2OZH A;  1P0H A;  4UCP A;  4YRH A;  1QSM A;  3PB6 X;  4EWT A;  4C7I A;  3BHX A;  3R9G A;  2FE7 A;  4MFL A;  2J8R A;  5K8M A;  2YND A;  2PCU A;  2VL1 A;  3KAS A;  4CYO A;  5LYF A;  1AUG A;  4X3R A;  4QUS A;  4UWJ A;  4PV6 A;  2AFM A;  1VGY A;  1TIQ A;  2BSW A;  2QIR A;  4CAE A;  4XPL A;  3ISZ A;  2O28 A;  2PRB A;  3GLJ A;  4CGP A;  4B11 A;  4JLY A;  4U9Z A;  4J3G A;  1DTD A;  2PJA A;  3B35 A;  2JDD A;  3WT4 A;  2Q4V A;  2NYQ A;  1X10 A;  3V38 A;  4A95 A;  2PDO A;  2OZU A;  4MBU A;  2IL4 A;  4OKO A;  3W6X A;  2PJ6 A;  2P0W A;  1QSO A;  4A31 A;  1MJB A;  4NGM A;  3LMS A;  1ARL A;  5AG5 A;  4E8O A;  3GKR A;  2Z3P A;  4ZYQ A;  2OB0 A;  2EVN A;  4YU9 A;  4WWV A;  1TF9 A;  2JLM A;  2ZOG A;  2AFW A;  2CTB A;  3GY9 A;  3IWW A;  2QJ8 A;  4MHY A;  5HVF A;  3R9E A;  3CXQ A;  1Z8T A;  4KOS A;  2HV2 A;  4MHN A;  1Y9K A;  4IF5 A;  3VAR A;  4F9V A;  5BWA B;  5IB9 A;  2EWB A;  3H4Q A;  2D4P A;  5HMN A;  1IU8 A;  2F7V A;  1YLE A;  4CS0 B;  2YNE A;  3I9S A;  1TKF A;  1XFO A;  4MHZ A;  4ZX9 A;  3B7I A;  1QSR A;  3IEH A;  1QSN A;  2VI7 A;  1CPX A;  3BI0 A;  3IJ3 A;  4KZT A;  1YW6 A;  1H8L A;  3RBU A;  4IAV A;  1FY7 A;  3DDD A;  1YVK A;  2QML A;  1LAM A;  3FF3 A;  4OAE A;  4P45 A;  1SQH A;  4PXC A;  4XPK A;  1HDQ A;  4MMO A;  3BLN A;  5A27 A;  5K8P A;  6CPA A;  4RS2 A;  5AG4 A;  4KOU A;  1ZLI A;  4KOR A;  2YNC A;  4R3K A;  5LYD A;  1BLL E;  5KTD A;  1XOV A;  2ZEL A;  3JUW A;  1BOB A;  3D2P A;  1CP7 A;  3CPA A;  3PEI A;  5K8O A;  5AG6 A;  3D7H A;  3D3S A;  3VWD A;  4CAW A;  5DWN A;  3S9M A;  2BUE A;  3PRT A;  4NGN A;  4CYQ A;  1DE4 C;  1Z4E A;  2B5G A;  1M4D A;  2PVW A;  1CG2 A;  2RFH A;  2VZY A;  2JEV A;  4NGT A;  3TCV A;  4ZY0 A;  3EO4 A;  1ELM P;  2XEF A;  4C7H A;  1HEE A;  2WZN A;  2B5G B;  4KSA A;  4NGQ A;  4CGN A;  2RB7 A;  1VHE A;  2Z3M A;  3RYO A;  4KUB A;  4KOW A;  4MJ8 A;  4FAI A;  4CAV A;  2PQ8 A;  4EFD A;  2PRQ A;  1MJA A;  2PJ2 A;  4RUH A;  1XJO A;  4OC0 A;  4ZI6 A;  5LYL A;  4L89 A;  3PB4 X;  1GYT A;  4UWI A;  3KR4 A;  4MFQ A;  1QQ9 A;  4CYP A;  3FX6 A;  4MFZ A;  4R3L A;  3D7G A;  1PCA A;  4MFK A;  3SJF A;  2JDC A;  1R3N A;  3BI1 A;  4A38 A;  2BL1 A;  2ZEG A;  4FD5 A;  1CP6 A;  4OME A;  4AVA A;  1CBX A;  4QC6 A;  2GFQ A;  3RO0 A;  3FVL A;  2DF5 A;  4CRY B;  2I3C A;  2PIY A;  2Z3L A;  3IO1 A;  4A33 A;  5HXD A;  5IV0 A;  5C88 A;  3KI9 A;  4OC5 A;  5ISV A;  2ATR A;  5H84 A;  1XEB A;  3S6K A;  4KSI A;  3ZJ0 A;  1LAN A;  8CPA A;  1XBU A;  2FSR A;  2GAN A;  4NF1 A;  1TF8 A;  4NGP A;  4MI4 A;  4EVY A;  3HLP A;  4NGS A;  2C6C A;  3EXN A;  2HC9 A;  2R98 A;  4K30 A;  4UFW A;  1Z8X A;  2PC1 A;  2V8H A;  1PU9 A;  2PE3 A;  4XPD C;  1LCP A;  3B3S A;  3NE7 A;  3B3C A;  2P6F A;  4X2T A;  1ZO0 A;  4NSQ A;  2Q7B A;  4PXB A;  2ANP A;  5FVJ A;  1Y0R A;  4O23 A;  1PYT B;  1S3Z A;  1YSJ A;  2Z3N A;  2GLF A;  3G3S A;  4PQA A;  4WJB A;  4I49 A;  1Y7R A;  4CPA A;  4MY3 A;  3FEC A;  4B14 A;  3T9Y A;  2ABZ A;  4IUS A;  1QST A;  1VHO A;  1YRE A;  2Q43 A;  3C26 A;  3HUV A;  2PVV A;  2G3A A;  2V8D A;  3KQX A;  3SI1 A;  3W91 A;  2VBQ A;  2IJZ A;  5EBV A;  1TXR A;  4H2K A;  2FVG A;  2XEJ A;  2KCW A;  2Z3K A;  1BPM A;  3D66 A;  1I12 A;  4MHD A;  2FT0 A;  4PSX A;  5CNP A;  2REE A;  2V8V A;  4AVB A;  4KVM E;  5THW A;  3CZX A;  2BOA A;  3FED A;  2CF4 A;  2EO8 A;  5LRJ A;  3SI2 A;  3TO6 A;  2EK8 A;  1S7N A;  1RO5 A;  2ZEP A;  2Q44 A;  2Q4Z A;  1QMU A;  5JPH A;  4AB7 A;  3R95 A;  3PBE A;  3PP9 A;  2NMT A;  2B3V A;  2ZEO A;  4YWY A;  4XNH C;  3N7Z A;  3GYA A;  4A37 A;  1IOI A;  4CAX A;  5JQ4 A;  4DUK A;  1KUX A;  2OR4 A;  2PJ9 A;  3PFE A;  1Y9W A;  2O53 A;  3JRU A;  1NSA A;  1YLO A;  4NCZ A;  3V8I A;  4FBE A;  1M4L A;  2HUZ A;  4UCM A;  3IC1 A;  2FS5 A;  4B10 A;  1HDU A;  4DJL A;  5HVG A;  4M85 A;  2DXQ A;  1Z2L A;  3SHP A;  4II9 A;  4XPD B;  2Q4Y A;  4M3S A;  4UIB A;  3MN8 A;  1OZP A;  4A30 A;  4BBH A;  3UY5 A;  2I00 A;  3EY5 A;  3JTK A;  2PJ0 A;  3QAH A;  3WC6 A;  1PUA A;  1CJW A;  1XF8 A;  4UBR A;  1ZG7 A;  4TWE A;  1M1D A;  4U9Y A;  5J8F A;  5F48 A;  1MK4 A;  2D4O A;  3PB9 X;  3EC4 A;  1J4J A;  4HNW B;  4LQ6 A;  2WPW A;  2GLJ A;  4P4B A;  2BEI A;  2J8M A;  4F0Y A;  1VIX A;  1Z5R A;  2HB6 A;  2IQ6 A;  2RC4 A;  2C1C A;  4MXU A;  3VWE A;  3TOB A;  4UF4 A;  4LUA A;  4A39 A;  3B3W A;  1XRY A;  5JH9 A;  2GRE A;  3FMC A;  4ZBG A;  2JBJ A;  1F2P A;  3D67 A;  2C27 A;  4X5K A;  3H8G A;  1CPS A;  4JXR A;  3FH4 A;  2ZEE A;  3MRU A;  4LX9 A;  3CXS A;  4RN7 A;  1RXT A; 
#chains in the Genus database with same CATH homology
 5I4M A;  1KWM A;  2ZEH A;  1Q7L A;  4OC3 A;  4TNU A;  2ZEM A;  5IB9 A;  2GU2 A;  3GUX A;  3CT9 A;  2PJ5 A;  3SJX A;  3NFZ A;  4IHM A;  2DEA A;  3NA6 A;  1FT7 A;  1ZG8 A;  2C6G A;  4P44 A;  3PFO A;  1Y0Y A;  3BXM A;  3WAB A;  2JEW A;  3PB8 X;  4R8F A;  3D68 A;  2NSM A;  1OBR A;  3KZW A;  4P6Y A;  3KHX A;  3IIB A;  2PJC A;  2G9D A;  2AFS A;  3D4U A;  1LOK A;  1XMB A;  5ELY A;  2ZEN A;  2PJ3 A;  4ZY2 A;  5JM6 A;  4OC4 A;  4R76 A;  3TX8 A;  3L2N A;  3S9L A;  4PXD A;  3NH5 A;  4MHP A;  1LAP A;  5HVH A;  4GM5 A;  5CBM A;  4UEF A;  5K8N A;  2PIZ A;  4P10 A;  3H8F A;  1ZLH A;  4K3N A;  1AYE A;  4MRI A;  4AXV A;  3KGQ A;  5D29 A;  4A94 A;  5CPA A;  5LRG A;  2QYV A;  3PB7 X;  4JZ0 A;  3VH9 A;  5D8N A;  4NFR A;  2CIJ A;  4W9Y A;  3SJG A;  3TC8 A;  3CDX A;  3GB0 A;  3LWU A;  3SJE A;  4F9U A;  2PJ8 A;  2BCO A;  2V77 A;  2QVP A;  4P4I A;  3VAT A;  4FWU A;  2ZED A;  5LRK A;  2AFZ A;  2V8G A;  2Q51 A;  2XEI A;  2ZEF A;  3RAM A;  1F57 A;  1LFW A;  4MCR A;  3B3T A;  3RZA A;  5J1Q A;  4NJR A;  2PJ7 A;  2POK A;  3KL9 A;  1RTQ A;  4OC1 A;  1ELL P;  4NGR A;  2BO9 A;  3FJU A;  1EE3 P;  1TKJ A;  4ZX8 A;  4P4E A;  4JYW A;  3D7D A;  3KR5 A;  3I1U A;  3QNV A;  3NH4 A;  4EME A;  1YME A;  1ARM A;  3DGV A;  4F8Z A;  1YW4 A;  3NH8 A;  4Z65 A;  4LQG A;  2PJ1 A;  4BD9 A;  3KQZ A;  4UIA A;  4B6Z A;  1JQG A;  3B3V A;  3SI0 A;  4OID A;  3T8W A;  3CPX A;  4X8I A;  1F2O A;  4UEE A;  1TKH A;  4ZY1 A;  1IGB A;  4Q7A A;  3D7F A;  5JGF A;  4PXE A;  2AFU A;  3IFE A;  2WYR A;  4ONW A;  4R7M A;  2J9A A;  4P4F A;  2O4H A;  2CTC A;  5DS0 A;  4DYO A;  1ZG9 A;  4P4J A;  2OOT A;  4PPZ A;  3S9N A;  4OIW A;  3DLJ A;  3PBB A;  3WC7 A;  4MCQ A;  2JBK A;  1BAV A;  2XEG A;  3ISX A;  3KHZ A;  4OC2 A;  4P4D A;  4IK2 A;  1Y7E A;  1FNO A;  7CPA A;  3K9T A;  2C6P A;  4MCS A;  1CX8 A;  2IMO A;  2F8H A;  4MCP A;  2AFO A;  1IY7 A;  2PJ4 A;  5LYI A;  4UEZ A;  3K2K A;  3FEE A;  4OP4 A;  1BPN A;  4NJQ A;  4R6T A;  1Z8L A;  3N5F A;  3H8E A;  1UWY A;  1R43 A;  4FUU A;  2PJB A;  3V7Z A;  4G1P A;  2EK9 A;  2ZOF A;  3B2Y A;  2AFX A;  3WC5 A;  1AMP A;  3PB6 X;  4EWT A;  3BHX A;  5K8M A;  2PCU A;  2VL1 A;  3KAS A;  5LYF A;  4X3R A;  2AFM A;  1VGY A;  3ISZ A;  3GLJ A;  1DTD A;  2PJA A;  3B35 A;  3WT4 A;  2NYQ A;  3V38 A;  4OKO A;  2PJ6 A;  4NGM A;  3LMS A;  1ARL A;  4ZYQ A;  4YU9 A;  4WWV A;  1TF9 A;  2ZOG A;  2AFW A;  2CTB A;  3IWW A;  5HVF A;  2QJ8 A;  4MHY A;  4MHN A;  4F9V A;  3VAR A;  2EWB A;  2F7V A;  1TKF A;  1XFO A;  4MHZ A;  4ZX9 A;  3B7I A;  3IEH A;  1CPX A;  3BI0 A;  3IJ3 A;  1YW6 A;  1H8L A;  3RBU A;  4IAV A;  3FF3 A;  1LAM A;  4P45 A;  4PXC A;  1HDQ A;  4MMO A;  5K8P A;  6CPA A;  1ZLI A;  5LYD A;  1BLL E;  2ZEL A;  1CP7 A;  3CPA A;  3PEI A;  5K8O A;  3D7H A;  3S9M A;  3PRT A;  4NGN A;  1DE4 C;  2RFH A;  5F09 A;  2PVW A;  1CG2 A;  4NGT A;  1ELM P;  2XEF A;  1HEE A;  2WZN A;  4NGQ A;  2RB7 A;  1VHE A;  4FAI A;  4EFD A;  2PRQ A;  2PJ2 A;  4RUH A;  1XJO A;  4OC0 A;  4ZI6 A;  5LYL A;  3PB4 X;  1GYT A;  3KR4 A;  1QQ9 A;  3FX6 A;  3D7G A;  1PCA A;  3SJF A;  1R3N A;  3BI1 A;  4A38 A;  2ZEG A;  1CP6 A;  4OME A;  1CBX A;  3FVL A;  2I3C A;  2PIY A;  3IO1 A;  5HXD A;  3KI9 A;  4OC5 A;  4KSI A;  1LAN A;  8CPA A;  1XBU A;  4NGP A;  1TF8 A;  3HLP A;  4NGS A;  2C6C A;  2HC9 A;  2V8H A;  2PE3 A;  1LCP A;  3B3S A;  4X2T A;  3B3C A;  4PXB A;  2ANP A;  1Y0R A;  4O23 A;  1PYT B;  1YSJ A;  2GLF A;  4PQA A;  4WJB A;  4CPA A;  3FEC A;  2ABZ A;  1VHO A;  3HUV A;  2Q43 A;  2PVV A;  2V8D A;  3KQX A;  3SI1 A;  2IJZ A;  1TXR A;  4H2K A;  2FVG A;  2XEJ A;  1BPM A;  3D66 A;  2V8V A;  5THW A;  2BOA A;  3FED A;  2CF4 A;  5LRJ A;  3SI2 A;  2EK8 A;  2ZEP A;  2Q4Z A;  1QMU A;  3PBE A;  2ZEO A;  4YWY A;  4A37 A;  4DUK A;  2OR4 A;  4ZY0 A;  2PJ9 A;  3PFE A;  2O53 A;  3JRU A;  1NSA A;  1YLO A;  4FBE A;  1M4L A;  3IC1 A;  4DJL A;  1HDU A;  5HVG A;  1Z2L A;  4UIB A;  3MN8 A;  2PJ0 A;  3WC6 A;  1ZG7 A;  4TWE A;  3PB9 X;  2GLJ A;  4P4B A;  1VIX A;  1Z5R A;  2HB6 A;  2IQ6 A;  2C1C A;  4MXU A;  4UF4 A;  4A39 A;  3B3W A;  1XRY A;  5JH9 A;  2GRE A;  3FMC A;  2JBJ A;  1F2P A;  3D67 A;  3H8G A;  1CPS A;  3FH4 A;  2ZEE A;  3MRU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...