4IUSA

Gcn5-related n-acetyltransferase from kribbella flavida.
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
259
structure length
257
Chain Sequence
AMGIAARIASAQLQGLVRSRRQVVAGPLVGLLHDEDVWFLSRAVAAEPGVPFDPAEVPWALETIRKAFAAEDRWLSAELVEEANPGLAYVLVEHGMTIVSRPPLLAVEPGDLLVPEFPAGVTAAVVASAEEQEAANAIAGDAYETDASPFQPEPADGGAVLIRMDGVPVATAAWTAIADGVTEVAGVGTLHSHRRQGLGALATAYATQQAFEVGGATLAWLTPGDDGADRIYRRLGYEPKATAVHLGDPGGHLADLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title GCN5-related N-acetyltransferase from Kribbella flavida.
rcsb
source organism Kribbella flavida
molecule tags Transferase
molecule keywords GCN5-related N-acetyltransferase
total genus 76
structure length 257
sequence length 259
ec nomenclature ec 2.3.1.128: Transferred entry: 2.3.1.267.
pdb deposition date 2013-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4iusA00
4KOTA 2HUZA 4KOUA 1Z4EA 2JDDA 3R96A 2FE7A 5H86A 2R7HA 4CAVA 4CAXA 2HQYA 4NF1A 4LUAA 1LRZA 4HNYB 4AVBA 2ARHA 2O28A 4RI1A 4UWJA 4AG9A 5KTAA 5J8FA 2QIRA 1M4GA 5H84A 1S60A 2J8NA 4KZTA 3R9EA 3GKRA 4MBUA 2OB0A 3F8KA 3TOAA 2Q44A 1IB1E 2ZW5A 2Q4VA 4FD7A 1XEBA 1XMTA 4U9YA 2GE3A 3GYAA 4MY0A 1IYKA 4FD4A 3G8WA 4IUSA 1FY7A 2GIVA 5DWNA 1S7NA 2AE6A 3JUWA 4X5KA 1XIXA 2FSRA 4XPDC 4CAWA 5KTCA 2I79A 2D4PA 2Z10A 4JJXA 5C88A 4K30A 5C82A 2ZW7A 4AVAA 4R57A 4GS4A 4DNCA 4CS0B 2ZW4A 4E8OA 4J3GA 2FXFA 2BL1A 3CXPA 2JDCA 4XNHC 2B4DA 3VWDA 4UWIA 1NMTA 1QSTA 2B4DB 3KKWA 1YR0A 1QSNA 3TFYA 5JPHA 1R57A 2GANA 5JQ4A 1S3ZA 2C27A 2R8VA 2IL4A 1WWZA 5GCNA 4RS2A 3DNSA 2CY2A 4I49A 3W6XA 2OU2A 3W6SA 4ORFA 5FVJA 4L89A 4MI4A 2P6FA 3FXTA 4NEXA 1M4IA 2OZHA 4KORA 1CM0A 1QSMA 2Q4YA 1IYLA 3I9SA 3EY5A 3BJ7A 2ZPAA 1M4DA 2B58A 4XPKA 3TTHA 3TCVA 2WPWA 2P0WA 1I1DA 1L0CA 4KVOE 3F5BA 4QBJA 3FB3A 2J8MA 4HNXB 4QUSA 2PC1A 5IB0A 5HH1A 3LODA 1V0CA 3P2HA 3TE4A 2DXQA 1GHEA 1CJWA 1S7LA 4JLYA 3UY5A 2R98A 4YGOA 3TT2A 2G0BA 2REFA 1MK4A 4KOSA 2OZUA 2G3TA 2Q0YA 4PK3A 3S6GA 2I00A 1I12A 4R3KA 3SXNA 2P6GA 3ZJ0A 3S6KA 4MHDA 2ZXVA 4EVYA 2A4NA 4JXQA 3D2MA 2ZW6A 1ON0A 1YGHA 2QECA 3QAHA 1Y7RA 4JWPA 3FRMA 3D3SA 3W91A 3T9YA 4YFJA 3DDDA 3EFAA 5I0CA 4E0AA 4H6ZA 5HMNA 5EC4A 2R1IA 3IGRA 1PU9A 4E2AA 5ISVA 4UBRA 2FCKA 4QVTA 3R9FA 2B3UA 1MJAA 4IF5A 3TO7A 4AG7A 2FIAA 3DSBA 4U9ZA 4KLWA 4OLLA 4KUBA 4Y49B 4R3LA 2Z11A 2FS5A 3D8PA 4ONUA 5F49A 1Q2YA 3RYOA 2P6EA 3SHPA 4QB9A 4PSXA 5EBVA 1TIQA 5F47A 4KOVA 2VZZA 1IICA 2CNTA 3MGDA 4KVXA 4R9MA 4JXRA 4YRHA 4FD5A 1P4NA 3WR7A 1RO5A 2PDOA 1M44A 2HV2A 1MJBA 4L8AA 4M3SA 2J8RA 2PQ8A 1VHSA 3TO9A 3CXQA 2Y0MA 3FIXA 4M85A 2VZYA 3I3GA 1BOBA 2REEA 3R95A 1SQHA 4OAEA 5CNPA 3T90A 4B5PA 1NSLA 2FIWA 3BJ8A 3VWEA 3JVNA 1Q2DA 3PP9A 4B5PB 4PSWA 4H6UA 3E0KA 4KOWA 2NMTA 5F46A 1Z9UA 1QSRA 2VI7A 4NSQA 1QSOA 1S7KA 2X7BA 5F48A 1Q2CA 3K9UA 5J8CA 1YREA 4CRYB 4U5YA 3FNCA 4JD6A 4NXYA 1S7FA 3S6FA 2Z0ZA 1B6BA 1J4JA 3NE7A 4KVME 4BMHA 2VQYA 2EUIA 4ZBGA 4KOXA 2VBQA 2VXKA 2KCWA 3IWGA 4KOYA 1OZPA 3H4QA 3P2FA 4AVCA 1XE4A 5IV0A 1YVOA 3DR6A 2JEVA 2AJ6A 1YX0A 2FT0A 5IX3A 1Y9WA 2CNMA 4OADA 4R87A 4XPLA 4B5OA 1NE9A 1Y9KA 3N7ZA 3FYNA 1YLEA 3B8GA 2F5IA 3PGPA 1KZFA 3GY9A 2B5GB 2PR8A 2OH1A 1RXTA 4LX9A 2PRBA 3EO4A 5KTDA 4PK2A 4AB7A 1XF8A 2B5GA 1IIDA 2PSWA 3BLNA 4KLVA 2OZGA 1WK4A 1Z4RA 4FD6A 4HNWB 2EVNA 2K5TA 1VKCA 3S6HA 3OWCA 3TOBA 1YK3A 2CNSA 2BUEA 3EC4A 2JLMA 4QC6A 1KUVA 2B4BA 2Q7BA 3R9GA 1YVKA 4MY3A 3CXSA 4F6AA 3SXOA 1S5KA 2D4OA 3D2PA 4II9A 1B87A 2B3VA 4NCZA 1M1DA 4H89A 2G3AA 1K4JA 4CRZB 3TO6A 1PUAA 1KUYA 4Y49C 1U6MA 3PZJA 2QMLA 3G3SA 2ATRA 3R1KA 5DWMA 1N71A 2FL4A 4KUAA 4UA3A 2PR1A 1UFHA 1P0HA 3LD2A 3ZZIA 4PV6A 5E96A 1BO4A 4MJ8A 3DR8A 3F0AA 3QB8A 3FBUA 2H5MA 2VEZA 2RC4A 4XNHB 3V8IA 4XPDB 2BEIA 1I21A 1KUXA 2Q04A 2BSWA 2WPXA 1MJ9A 4HKFA 3EXNA 3C26A 4F0YA
chains in the Genus database with same CATH superfamily
4KOTA 2HUZA 4KOUA 2DEAA 1Z4EA 5CBMA 3D7HA 2JDDA 3R96A 2FE7A 4MCQA 4P10A 5IB9A 2WZNA 3ISZA 2R7HA 4UEZA 5H86A 1OBRA 4CAVA 4CAXA 4X3RA 2HQYA 4NF1A 4LUAA 1LRZA 4F9UA 4HNYB 4ZX8A 1LAMA 4MFQA 1GYTA 2O4HA 4AVBA 2ARHA 2BCOA 3SJGA 3VARA 4A38A 3RBUA 2O28A 2XEFA 4MRIA 4CYQA 3H5ZA 4RI1A 3LMSA 4A94A 2HC9A 4UWJA 4AG9A 5KTAA 5J8FA 2QIRA 1M4GA 1Z8XA 3ISXA 3MN8A 5H84A 1S60A 3RAMA 2AFXA 2J8NA 4F9VA 4KZTA 3R9EA 3GKRA 1AMPA 3IO1A 4MBUA 4CGPA 2OB0A 5LYFA 3F8KA 3TOAA 3PB9X 2ZEDA 4R7MA 1CG2A 2Q44A 3HUVA 3L2NA 4P44A 1IB1E 2ZW5A 2EBJA 2Q4VA 4FD7A 1XEBA 1XMTA 2CF4A 4U9YA 5G21A 2GE3A 3GYAA 4MY0A 1IYKA 4FD4A 3G8WA 4IUSA 3NH8A 3D7FA 5HVGA 1ZG7A 3B3TA 4CYPA 1NSAA 1FY7A 2GIVA 5DWNA 1DTDA 1Z5RA 1S7NA 2AE6A 3JUWA 3C26A 4K3NA 4KS9A 4X5KA 5AG7A 3CPXA 5JH9A 5LRKA 1XIXA 2FSRA 4XPDC 2QYVA 1DE4C 1ARMA 2F7VA 2EWBA 4CAWA 5KTCA 3D7DA 2V8DA 4UCMA 3RZAA 5ELYA 4ZY2A 1VHEA 2I79A 2V8GA 5A28A 2PJ8A 5LYDA 5K8MA 4PQAA 4RN7A 1YLOA 2D4PA 4KSIA 3B3WA 2EK8A 3GB0A 2Z10A 4JJXA 5C88A 4K30A 3IU1A 1ELLP 2ZW7A 3B2YA 3VATA 2Q43A 4A39A 4AVAA 4NGNA 4R57A 4ZY0A 4GS4A 4DNCA 3FVLA 4CS0B 2ZEMA 5K8NA 4NGMA 2ZW4A 3NH4A 2NYQA 4E8OA 4J3GA 2FXFA 2BL1A 4UCNA 3CXPA 2JDCA 4XNHC 2B4DA 3VWDA 1IU8A 4EMEA 4UWIA 1NMTA 4A37A 1QSTA 4PPZA 3KGQA 2B4DB 3KKWA 1YR0A 2C6CA 1QSNA 4GXHA 3TFYA 4PXEA 4OC4A 1TXRA 3WC5A 1R57A 5JPHA 2GANA 3KL9A 4CGNA 5JQ4A 4P4FA 1S3ZA 2PJCA 1R3NA 5AGEA 2C27A 2R8VA 1YW4A 2IL4A 2HB6A 4UEFA 4R76A 1PCAA 1WWZA 4NFRA 5LYIA 4MCSA 3K2KA 5GCNA 1YSJA 4OKOA 4RS2A 3DNSA 2CY2A 4MHZA 3FJUA 4PXDA 4I49A 4OC3A 4MFLA 3W6XA 4ONWA 2OU2A 3W6SA 4ORFA 5THWA 3A9LA 3B7IA 1F57A 5FVJA 1A2ZA 2GREA 2CTBA 2JBKA 2PJ5A 4M6IA 4CYOA 1IY7A 4Q38A 4L89A 3RO0A 3KHXA 4MI4A 1KWMA 2P6FA 1BLLE 3FXTA 4NEXA 1M4IA 2OZHA 4CGOA 4KORA 1CM0A 2AFWA 1QSMA 2Q4YA 1IYLA 3KHZA 3N5FA 3I9SA 3EY5A 3NFZA 4UIBA 4ZX9A 1EE3P 3BJ7A 5AG4A 2ZPAA 2PJ0A 1VGYA 1M4DA 4Q36A 2B58A 8CPAA 1Y0YA 2NSMA 4XPKA 5I4MA 2ODFA 1IOFA 3KR4A 1XJOA 3IJ3A 3TTHA 2PJ6A 2F8HA 4O23A 4MFPA 3TCVA 2WPWA 2DPTA 1I1DA 1L0CA 2P0WA 4KVOE 3F5BA 2Q4ZA 4QBJA 4CGMA 3FB3A 2J8MA 4HNXB 3PB6X 1BPNA 4QUSA 2PC1A 5IB0A 1LAPA 2AFSA 2YNDA 2G9DA 3LODA 2RB7A 5HH1A 1Z8LA 1H8LA 1V0CA 3P2HA 1PYTB 4ZGYB 3TE4A 2DXQA 1GHEA 1CJWA 1S7LA 1FT7A 2PJ9A 4JLYA 3UY5A 4R8FA 4C7HA 4A2ZA 2ANPA 2R98A 1JQGA 4YGOA 3TT2A 2G0BA 5G20A 2ZENA 4NJQA 4P4IA 2REFA 1MK4A 4KOSA 4CYNA 2C1CA 3V38A 1X12A 2C6PA 4WJBA 2OZUA 2G3TA 2Q0YA 1YMEA 4PK3A 3S6GA 2GU2A 3S9LA 2I00A 1I12A 4R3KA 3SXNA 2P6GA 3H8FA 4B14A 3ZJ0A 1YQEA 3S6KA 4W9YA 3JTKA 2YNEA 4MHDA 2ZXVA 4EVYA 3PB8X 2A4NA 4JXQA 2CXAA 3SJFA 3D2MA 4ZY1A 2ZW6A 1ON0A 2AFZA 3KQZA 4OC5A 4OC2A 4OIDA 1YGHA 4R9MA 2QECA 4MCRA 3QAHA 1R43A 3IU2A 3D68A 4A95A 4MFKA 2BO9A 2Z3MA 1LANA 1VIXA 1Y7RA 3B3CA 4FWUA 1BAVA 4JWPA 1LOKA 4EWTA 3SI1A 2POKA 5HXDA 3FRMA 3HLPA 2PVWA 3D3SA 3D67A 4Q7AA 3W91A 3T9YA 4B6ZA 4YFJA 3DDDA 3EFAA 5D8NA 5I0CA 1M4LA 4X8IA 1ELMP 4DUKA 4E0AA 4H6ZA 2ZOGA 5HMNA 5EC4A 2IJZA 4ZYQA 2R1IA 2ZEOA 3IGRA 4MFZA 1PU9A 4E2AA 3FECA 3KQXA 4ZI6A 4UBRA 5ISVA 2FCKA 2ZEHA 2YNCC 3D66A 4QVTA 3R9FA 3B35A 1ZG8A 2EK9A 2B3UA 3I1UA 1CBXA 1MJAA 2PJBA 4IF5A 1ZO0A 1Y7EA 3TO7A 4AG7A 2FIAA 3DSBA 4U9ZA 4BINA 2ZELA 4KLWA 4P4JA 4OLLA 4KUBA 4Y49B 3DLJA 4R3LA 4YWYA 2Z11A 2FS5A 3D8PA 4ONUA 5F49A 1Q2YA 3RYOA 2P6EA 3SHPA 5K8PA 2WYRA 4QB9A 4PSXA 3PBEA 5C82A 2Z3OA 5EBVA 2ZEFA 1TIQA 5F47A 4KOVA 2VZZA 2I3CA 2PIYA 4GM5A 2Z3NA 1Z8TA 1IOIA 2CIJA 4UFWA 3WABA 1IICA 4P4EA 5K8OA 2CNTA 1HDQA 3MGDA 4KVXA 4JXRA 4LQGA 2DF5A 3KASA 2PJ7A 3LACA 4FD5A 4YRHA 4Z65A 2QVPA 1P4NA 3IWEA 3S9NA 3PB7X 3WR7A 1RO5A 2PDOA 4C7IA 2PCUA 3CT9A 4B13A 5LRJA 4FAIA 1M44A 2Z3PA 3PRTA 1JWQA 3PB4X 2Q51A 4P4DA 2HV2A 1MJBA 4P45A 1UWYA 4B12A 3K9TA 4L8AA 4M3SA 5J1QA 2J8RA 2PQ8A 1VHSA 3GUXA 3TO9A 4F8ZA 1F2OA 3CXQA 2Y0MA 3SJEA 3FIXA 4M85A 2VZYA 4A33A 4R6TA 3I3GA 1BOBA 2REEA 4PXBA 3R95A 3WC7A 1SQHA 2CTCA 3FF3A 4OAEA 4OC0A 3IC1A 5CNPA 3T90A 4B5PA 1NSLA 4C2YA 2FIWA 1CP7A 3BJ8A 3FX6A 3VWEA 2PE3A 3WT4A 5JGFA 3JVNA 1FNOA 4PXCA 2PJ2A 3GIUA 1Q2DA 3PP9A 2ZEPA 4B5PB 4PSWA 4HPSA 4H6UA 5A27A 3E0KA 1ARLA 1ZLIA 1QMUA 5AG6A 4KOWA 2NMTA 5F46A 3BXMA 1Z9UA 1QSRA 2AFMA 4P6YA 2VI7A 3B3VA 4NSQA 1QSOA 1S7KA 2X7BA 1HDUA 5F48A 4OIWA 1Q2CA 1TKJA 3K9UA 2Q7SA 4IAVA 5J8CA 4TWEA 1YREA 4OC1A 4CRYB 4U5YA 3FEDA 4TNUA 3FNCA 4JD6A 4MHPA 4NXYA 1S7FA 2GLJA 3S6FA 2XEJA 2Z0ZA 1B6BA 1J4JA 2RFHA 3NE7A 4KVME 4BBHA 3WC6A 3QNVA 3KI9A 4BMHA 2VQYA 2EUIA 1XRYA 4ZBGA 3VH9A 1TKFA 4KOXA 4NGSA 2JEWA 2VBQA 2VXKA 2KCWA 3IWGA 3NA6A 4F0XA 2YNCA 4KOYA 4M6HA 3DGVA 3T8WA 3JRUA 1OZPA 4MHNA 3H4QA 4JYWA 3P2FA 5AG5A 1Q7LA 2AFUA 4AVCA 2ZEGA 3BI1A 4JZ0A 1XE4A 1Y0RA 1CX8A 4KSAA 5IV0A 1IGBA 3PFOA 3IWWA 4B11A 2Z3KA 1YVOA 2V8HA 2JEVA 1HEEA 3DR6A 3LWUA 4AXVA 2AJ6A 1YX0A 2FT0A 5IX3A 3IEHA 4UIAA 1YW6A 1Y9WA 2CNMA 2ZEEA 4OADA 4R87A 4XPLA 4B5OA 2PVVA 1LCPA 1AUGA 4LQ6A 2BOAA 3MRUA 1NE9A 4CAFA 1Y9KA 5D29A 1QQ9A 2QJ8A 1ZG9A 4UCPA 1XBUA 3TC8A 3BHXA 4EFDA 1CP6A 2PJAA 4H2KA 4C2ZA 3CZXA 2J9AA 3FYNA 3IFEA 3N7ZA 3FEEA 3FMCA 1YLEA 3FH4A 4OP4A 4P4BA 5HVFA 3B8GA 2F5IA 4UF4A 2C6GA 5CPAA 3D4UA 3PGPA 3EXNA 1KZFA 2WUUA 3GY9A 3V7ZA 4MCPA 4CGLA 1AYEA 3PFEA 4MHYA 2B5GB 3D7GA 4RUHA 2GFQA 3IIBA 2PR8A 2OH1A 1RXTA 4LX9A 2PRBA 2YGWA 3EO4A 5KTDA 2ZOFA 3PEIA 4PK2A 4AB7A 1XF8A 3CDXA 2B5GA 1IIDA 2PSWA 3BLNA 3KZWA 2OZGA 4KLVA 1WK4A 4OMEA 1Z4RA 2ABZA 4FD6A 2PRQA 4HNWB 2EVNA 2K5TA 1VKCA 1Z8WA 3S6HA 3OWCA 1XMBA 1YK3A 3KR5A 2CNSA 3TOBA 1CPSA 2BUEA 3EC4A 2JLMA 4QC6A 2WSAA 4A30A 1VHOA 1KUVA 1ZLHA 4IHMA 2B4BA 2Q7BA 3S9MA 3PBBA 3R9GA 2GLFA 1YVKA 4MY3A 3CXSA 4A32A 4F6AA 2PJ1A 2XEGA 4KSFA 3SXOA 1S5KA 2D4OA 3D2PA 1XOVA 5LRGA 4II9A 4CAEA 1B87A 2B3VA 4NCZA 1M1DA 5F09A 1TKHA 2IQ6A 2V77A 1LFWA 4CPAA 4H89A 3H8EA 2G3AA 1K4JA 5G1ZA 3TO6A 4CRZB 1PUAA 3SI0A 1KUYA 1CPXA 2FVGA 6CPAA 4M6GA 3RNZA 4Y49C 1U6MA 3B3SA 3PZJA 2JBJA 2QMLA 4DJLA 4UEEA 4MFJA 4MXUA 3G3SA 4NGPA 3GLJA 5G22A 2O53A 1TF9A 2PJ3A 4IK2A 7CPAA 1Z2LA 4G1PA 3R1KA 4BD9A 3H8GA 1BPMA 3BI0A 5DWMA 1N71A 2FL4A 2PIZA 4UFXA 4KUAA 4NGQA 4UA3A 2OOTA 2PR1A 4WWVA 2V8VA 2EO8A 2OR4A 1XFOA 1F2PA 1UFHA 3CPAA 1P0HA 3LD2A 4NJRA 4MMOA 3ZZIA 4FUUA 4PV6A 5E96A 3TX8A 4A31A 1BO4A 4MJ8A 4NGTA 3DR8A 4YU9A 4C2XA 2XEIA 3F0AA 3QB8A 3SI2A 3FBUA 2H5MA 2VEZA 2RC4A 4XNHB 3V8IA 4B10A 5BWAB 2AFOA 4XPDB 4DYOA 2PJ4A 4C68A 3NH5A 5LYLA 5HVHA 2BEIA 2Z3LA 1I21A 2IMOA 1KUXA 3NE8A 2Q04A 1TF8A 2BSWA 2WPXA 5DS0A 3SJXA 2VL1A 2DPSA 3QAYA 1MJ9A 1RTQA 4NGRA 4FBEA 5EMIA 4X2TA 4HKFA 4UFVA 2ATRA 5JM6A 1X10A 4F0YA
chains in the Genus database with same CATH topology
4KOTA 2HUZA 4KOUA 1Z4EA 2JDDA 3R96A 2FE7A 5H86A 2R7HA 4CAVA 4CAXA 2HQYA 4NF1A 4LUAA 1LRZA 4HNYB 4MFQA 4AVBA 2ARHA 2O28A 4CYQA 3H5ZA 4RI1A 4UWJA 4AG9A 5KTAA 5J8FA 2QIRA 1M4GA 5H84A 1S60A 2J8NA 4KZTA 3R9EA 3GKRA 4MBUA 4CGPA 2OB0A 3F8KA 3TOAA 2Q44A 1IB1E 2ZW5A 5G21A 2Q4VA 4FD7A 1XEBA 1XMTA 4U9YA 2GE3A 3GYAA 4MY0A 1IYKA 4FD4A 3G8WA 4IUSA 4CYPA 1FY7A 2GIVA 5DWNA 1S7NA 2AE6A 3JUWA 5AG7A 4KS9A 4X5KA 1XIXA 2FSRA 4XPDC 4CAWA 5KTCA 4UCMA 5A28A 2I79A 2D4PA 2Z10A 4JJXA 5C88A 4K30A 3IU1A 5C82A 2ZW7A 4AVAA 4R57A 4GS4A 4DNCA 4CS0B 2ZW4A 4E8OA 4J3GA 2FXFA 2BL1A 4UCNA 3CXPA 2JDCA 4XNHC 2B4DA 3VWDA 4UWIA 1NMTA 1QSTA 2B4DB 3KKWA 1YR0A 1QSNA 3TFYA 5JPHA 1R57A 2GANA 4CGNA 5JQ4A 1S3ZA 5AGEA 2C27A 2R8VA 2IL4A 1WWZA 5GCNA 4RS2A 3DNSA 2CY2A 4I49A 4MFLA 3W6XA 2OU2A 3W6SA 4ORFA 3A9LA 5FVJA 4CYOA 4Q38A 4L89A 4MI4A 2P6FA 3FXTA 4NEXA 1M4IA 2OZHA 4CGOA 4KORA 1CM0A 1QSMA 2Q4YA 1IYLA 3I9SA 3EY5A 3BJ7A 5AG4A 2ZPAA 1M4DA 4Q36A 2B58A 4XPKA 3TTHA 4MFPA 3TCVA 2WPWA 2DPTA 1I1DA 1L0CA 2P0WA 4KVOE 3F5BA 4QBJA 4CGMA 3FB3A 2J8MA 4HNXB 4QUSA 2PC1A 5IB0A 2YNDA 5HH1A 3LODA 1V0CA 3P2HA 3TE4A 4ZGYB 2DXQA 1GHEA 1CJWA 1S7LA 4JLYA 3UY5A 4C7HA 4A2ZA 2R98A 4YGOA 3TT2A 2G0BA 5G20A 2REFA 1MK4A 4KOSA 4CYNA 2OZUA 2G3TA 2Q0YA 4PK3A 3S6GA 2I00A 1I12A 4R3KA 3SXNA 2P6GA 4B14A 3ZJ0A 3S6KA 3JTKA 2YNEA 4MHDA 2ZXVA 4EVYA 2A4NA 4JXQA 2CXAA 3D2MA 2ZW6A 1ON0A 1YGHA 2QECA 3QAHA 3IU2A 4A95A 4MFKA 2Z3MA 1Y7RA 4JWPA 3FRMA 3D3SA 3W91A 3T9YA 4YFJA 3DDDA 3EFAA 5I0CA 4E0AA 4H6ZA 5HMNA 5EC4A 2R1IA 3IGRA 4MFZA 1PU9A 4E2AA 5ISVA 4UBRA 2FCKA 4QVTA 2YNCC 3R9FA 2B3UA 1MJAA 4IF5A 1ZO0A 3TO7A 4AG7A 2FIAA 3DSBA 4U9ZA 4KLWA 4OLLA 4KUBA 4Y49B 4R3LA 2Z11A 2FS5A 3D8PA 4ONUA 5F49A 1Q2YA 3RYOA 2P6EA 3SHPA 4QB9A 4PSXA 2Z3OA 5EBVA 1TIQA 5F47A 4KOVA 2VZZA 2Z3NA 4UFWA 1IICA 2CNTA 3MGDA 4KVXA 4R9MA 4JXRA 4YRHA 4FD5A 1P4NA 3IWEA 3WR7A 1RO5A 2PDOA 4C7IA 4B13A 1M44A 2Z3PA 2HV2A 1MJBA 4B12A 4L8AA 4M3SA 2J8RA 2PQ8A 1VHSA 3TO9A 3CXQA 2Y0MA 3FIXA 4M85A 2VZYA 4A33A 3I3GA 1BOBA 2REEA 3R95A 1SQHA 4OAEA 5CNPA 3T90A 4B5PA 1NSLA 4C2YA 2FIWA 3BJ8A 3VWEA 3JVNA 1Q2DA 3PP9A 4B5PB 4PSWA 4H6UA 5A27A 3E0KA 5AG6A 4KOWA 2NMTA 5F46A 1Z9UA 1QSRA 2VI7A 4NSQA 1QSOA 1S7KA 2X7BA 5F48A 1Q2CA 3K9UA 5J8CA 1YREA 4CRYB 4U5YA 3FNCA 4JD6A 4NXYA 1S7FA 3S6FA 2Z0ZA 1B6BA 1J4JA 3NE7A 4KVME 4BBHA 4BMHA 2VQYA 2EUIA 4ZBGA 4KOXA 2VBQA 2VXKA 2KCWA 3IWGA 4F0XA 2YNCA 4KOYA 1OZPA 5AG5A 3H4QA 3P2FA 4AVCA 1XE4A 4KSAA 5IV0A 4B11A 2Z3KA 1YVOA 3DR6A 2JEVA 2AJ6A 1YX0A 2FT0A 5IX3A 1Y9WA 2CNMA 4OADA 4R87A 4XPLA 4B5OA 1NE9A 4CAFA 1Y9KA 4UCPA 4C2ZA 3N7ZA 3FYNA 1YLEA 3B8GA 2F5IA 3PGPA 1KZFA 2WUUA 3GY9A 4CGLA 2B5GB 2PR8A 2OH1A 1RXTA 4LX9A 2PRBA 2YGWA 3EO4A 5KTDA 4PK2A 4AB7A 1XF8A 2B5GA 1IIDA 2PSWA 3BLNA 4KLVA 2OZGA 1WK4A 1Z4RA 4FD6A 4HNWB 2EVNA 2K5TA 1VKCA 3S6HA 3OWCA 3TOBA 1YK3A 2CNSA 2BUEA 3EC4A 2JLMA 4QC6A 2WSAA 4A30A 1KUVA 2B4BA 2Q7BA 3R9GA 1YVKA 4MY3A 3CXSA 4A32A 4F6AA 4KSFA 3SXOA 1S5KA 2D4OA 3D2PA 4II9A 4CAEA 1B87A 2B3VA 4NCZA 1M1DA 4H89A 2G3AA 1K4JA 5G1ZA 3TO6A 4CRZB 1PUAA 1KUYA 4Y49C 1U6MA 3PZJA 2QMLA 4MFJA 3G3SA 5G22A 2ATRA 3R1KA 5DWMA 1N71A 2FL4A 4UFXA 4KUAA 4UA3A 2PR1A 1UFHA 1P0HA 3LD2A 3ZZIA 4PV6A 5E96A 4A31A 1BO4A 4MJ8A 3DR8A 4C2XA 3F0AA 3QB8A 3FBUA 2H5MA 2VEZA 2RC4A 4XNHB 3V8IA 4B10A 5BWAB 4XPDB 4C68A 2BEIA 2Z3LA 1I21A 1KUXA 2Q04A 2BSWA 2WPXA 2DPSA 1MJ9A 4HKFA 4UFVA 3EXNA 3C26A 4F0YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KOT A;  2HUZ A;  4KOU A;  1Z4E A;  2JDD A;  3R96 A;  2FE7 A;  5H86 A;  2R7H A;  4CAV A;  4CAX A;  2HQY A;  4NF1 A;  4LUA A;  1LRZ A;  4HNY B;  4AVB A;  2ARH A;  2O28 A;  4RI1 A;  4UWJ A;  4AG9 A;  5KTA A;  5J8F A;  2QIR A;  1M4G A;  5H84 A;  1S60 A;  2J8N A;  4KZT A;  3R9E A;  3GKR A;  4MBU A;  2OB0 A;  3F8K A;  3TOA A;  2Q44 A;  1IB1 E;  2ZW5 A;  2Q4V A;  4FD7 A;  1XEB A;  1XMT A;  4U9Y A;  2GE3 A;  3GYA A;  4MY0 A;  1IYK A;  4FD4 A;  3G8W A;  4IUS A;  1FY7 A;  2GIV A;  5DWN A;  1S7N A;  2AE6 A;  3JUW A;  4X5K A;  1XIX A;  2FSR A;  4XPD C;  4CAW A;  5KTC A;  2I79 A;  2D4P A;  2Z10 A;  4JJX A;  5C88 A;  4K30 A;  5C82 A;  2ZW7 A;  4AVA A;  4R57 A;  4GS4 A;  4DNC A;  4CS0 B;  2ZW4 A;  4E8O A;  4J3G A;  2FXF A;  2BL1 A;  3CXP A;  2JDC A;  4XNH C;  2B4D A;  3VWD A;  4UWI A;  1NMT A;  1QST A;  2B4D B;  3KKW A;  1YR0 A;  1QSN A;  3TFY A;  5JPH A;  1R57 A;  2GAN A;  5JQ4 A;  1S3Z A;  2C27 A;  2R8V A;  2IL4 A;  1WWZ A;  5GCN A;  4RS2 A;  3DNS A;  2CY2 A;  4I49 A;  3W6X A;  2OU2 A;  3W6S A;  4ORF A;  5FVJ A;  4L89 A;  4MI4 A;  2P6F A;  3FXT A;  4NEX A;  1M4I A;  2OZH A;  4KOR A;  1CM0 A;  1QSM A;  2Q4Y A;  1IYL A;  3I9S A;  3EY5 A;  3BJ7 A;  2ZPA A;  1M4D A;  2B58 A;  4XPK A;  3TTH A;  3TCV A;  2WPW A;  2P0W A;  1I1D A;  1L0C A;  4KVO E;  3F5B A;  4QBJ A;  3FB3 A;  2J8M A;  4HNX B;  4QUS A;  2PC1 A;  5IB0 A;  5HH1 A;  3LOD A;  1V0C A;  3P2H A;  3TE4 A;  2DXQ A;  1GHE A;  1CJW A;  1S7L A;  4JLY A;  3UY5 A;  2R98 A;  4YGO A;  3TT2 A;  2G0B A;  2REF A;  1MK4 A;  4KOS A;  2OZU A;  2G3T A;  2Q0Y A;  4PK3 A;  3S6G A;  2I00 A;  1I12 A;  4R3K A;  3SXN A;  2P6G A;  3ZJ0 A;  3S6K A;  4MHD A;  2ZXV A;  4EVY A;  2A4N A;  4JXQ A;  3D2M A;  2ZW6 A;  1ON0 A;  1YGH A;  2QEC A;  3QAH A;  1Y7R A;  4JWP A;  3FRM A;  3D3S A;  3W91 A;  3T9Y A;  4YFJ A;  3DDD A;  3EFA A;  5I0C A;  4E0A A;  4H6Z A;  5HMN A;  5EC4 A;  2R1I A;  3IGR A;  1PU9 A;  4E2A A;  5ISV A;  4UBR A;  2FCK A;  4QVT A;  3R9F A;  2B3U A;  1MJA A;  4IF5 A;  3TO7 A;  4AG7 A;  2FIA A;  3DSB A;  4U9Z A;  4KLW A;  4OLL A;  4KUB A;  4Y49 B;  4R3L A;  2Z11 A;  2FS5 A;  3D8P A;  4ONU A;  5F49 A;  1Q2Y A;  3RYO A;  2P6E A;  3SHP A;  4QB9 A;  4PSX A;  5EBV A;  1TIQ A;  5F47 A;  4KOV A;  2VZZ A;  1IIC A;  2CNT A;  3MGD A;  4KVX A;  4R9M A;  4JXR A;  4YRH A;  4FD5 A;  1P4N A;  3WR7 A;  1RO5 A;  2PDO A;  1M44 A;  2HV2 A;  1MJB A;  4L8A A;  4M3S A;  2J8R A;  2PQ8 A;  1VHS A;  3TO9 A;  3CXQ A;  2Y0M A;  3FIX A;  4M85 A;  2VZY A;  3I3G A;  1BOB A;  2REE A;  3R95 A;  1SQH A;  4OAE A;  5CNP A;  3T90 A;  4B5P A;  1NSL A;  2FIW A;  3BJ8 A;  3VWE A;  3JVN A;  1Q2D A;  3PP9 A;  4B5P B;  4PSW A;  4H6U A;  3E0K A;  4KOW A;  2NMT A;  5F46 A;  1Z9U A;  1QSR A;  2VI7 A;  4NSQ A;  1QSO A;  1S7K A;  2X7B A;  5F48 A;  1Q2C A;  3K9U A;  5J8C A;  1YRE A;  4CRY B;  4U5Y A;  3FNC A;  4JD6 A;  4NXY A;  1S7F A;  3S6F A;  2Z0Z A;  1B6B A;  1J4J A;  3NE7 A;  4KVM E;  4BMH A;  2VQY A;  2EUI A;  4ZBG A;  4KOX A;  2VBQ A;  2VXK A;  2KCW A;  3IWG A;  4KOY A;  1OZP A;  3H4Q A;  3P2F A;  4AVC A;  1XE4 A;  5IV0 A;  1YVO A;  3DR6 A;  2JEV A;  2AJ6 A;  1YX0 A;  2FT0 A;  5IX3 A;  1Y9W A;  2CNM A;  4OAD A;  4R87 A;  4XPL A;  4B5O A;  1NE9 A;  1Y9K A;  3N7Z A;  3FYN A;  1YLE A;  3B8G A;  2F5I A;  3PGP A;  1KZF A;  3GY9 A;  2B5G B;  2PR8 A;  2OH1 A;  1RXT A;  4LX9 A;  2PRB A;  3EO4 A;  5KTD A;  4PK2 A;  4AB7 A;  1XF8 A;  2B5G A;  1IID A;  2PSW A;  3BLN A;  4KLV A;  2OZG A;  1WK4 A;  1Z4R A;  4FD6 A;  4HNW B;  2EVN A;  2K5T A;  1VKC A;  3S6H A;  3OWC A;  3TOB A;  1YK3 A;  2CNS A;  2BUE A;  3EC4 A;  2JLM A;  4QC6 A;  1KUV A;  2B4B A;  2Q7B A;  3R9G A;  1YVK A;  4MY3 A;  3CXS A;  4F6A A;  3SXO A;  1S5K A;  2D4O A;  3D2P A;  4II9 A;  1B87 A;  2B3V A;  4NCZ A;  1M1D A;  4H89 A;  2G3A A;  1K4J A;  4CRZ B;  3TO6 A;  1PUA A;  1KUY A;  4Y49 C;  1U6M A;  3PZJ A;  2QML A;  3G3S A;  2ATR A;  3R1K A;  5DWM A;  1N71 A;  2FL4 A;  4KUA A;  4UA3 A;  2PR1 A;  1UFH A;  1P0H A;  3LD2 A;  3ZZI A;  4PV6 A;  5E96 A;  1BO4 A;  4MJ8 A;  3DR8 A;  3F0A A;  3QB8 A;  3FBU A;  2H5M A;  2VEZ A;  2RC4 A;  4XNH B;  3V8I A;  4XPD B;  2BEI A;  1I21 A;  1KUX A;  2Q04 A;  2BSW A;  2WPX A;  1MJ9 A;  4HKF A;  3EXN A;  3C26 A;  4F0Y A; 
#chains in the Genus database with same CATH topology
 4KOT A;  2HUZ A;  4KOU A;  2DEA A;  1Z4E A;  5CBM A;  3D7H A;  2JDD A;  3R96 A;  2FE7 A;  4MCQ A;  4P10 A;  5IB9 A;  2WZN A;  3ISZ A;  2R7H A;  4UEZ A;  5H86 A;  1OBR A;  4CAV A;  4CAX A;  4X3R A;  2HQY A;  4NF1 A;  4LUA A;  1LRZ A;  4F9U A;  4HNY B;  4ZX8 A;  1LAM A;  4MFQ A;  1GYT A;  2O4H A;  4AVB A;  2ARH A;  2BCO A;  3SJG A;  3VAR A;  4A38 A;  3RBU A;  2O28 A;  2XEF A;  4MRI A;  4CYQ A;  3H5Z A;  4RI1 A;  3LMS A;  4A94 A;  2HC9 A;  4UWJ A;  4AG9 A;  5KTA A;  5J8F A;  2QIR A;  1M4G A;  1Z8X A;  3ISX A;  3MN8 A;  5H84 A;  1S60 A;  3RAM A;  2AFX A;  2J8N A;  4F9V A;  4KZT A;  3R9E A;  3GKR A;  1AMP A;  3IO1 A;  4MBU A;  4CGP A;  2OB0 A;  5LYF A;  3F8K A;  3TOA A;  3PB9 X;  2ZED A;  4R7M A;  1CG2 A;  2Q44 A;  3HUV A;  3L2N A;  4P44 A;  1IB1 E;  2ZW5 A;  2EBJ A;  2Q4V A;  4FD7 A;  1XEB A;  1XMT A;  2CF4 A;  4U9Y A;  5G21 A;  2GE3 A;  3GYA A;  4MY0 A;  1IYK A;  4FD4 A;  3G8W A;  4IUS A;  3NH8 A;  3D7F A;  5HVG A;  1ZG7 A;  3B3T A;  4CYP A;  1NSA A;  1FY7 A;  2GIV A;  5DWN A;  1DTD A;  1Z5R A;  1S7N A;  2AE6 A;  3JUW A;  3C26 A;  4K3N A;  4KS9 A;  4X5K A;  5AG7 A;  3CPX A;  5JH9 A;  5LRK A;  1XIX A;  2FSR A;  4XPD C;  2QYV A;  1DE4 C;  1ARM A;  2F7V A;  2EWB A;  4CAW A;  5KTC A;  3D7D A;  2V8D A;  4UCM A;  3RZA A;  5ELY A;  4ZY2 A;  1VHE A;  2I79 A;  2V8G A;  5A28 A;  2PJ8 A;  5LYD A;  5K8M A;  4PQA A;  4RN7 A;  1YLO A;  2D4P A;  4KSI A;  3B3W A;  2EK8 A;  3GB0 A;  2Z10 A;  4JJX A;  5C88 A;  4K30 A;  3IU1 A;  1ELL P;  2ZW7 A;  3B2Y A;  3VAT A;  2Q43 A;  4A39 A;  4AVA A;  4NGN A;  4R57 A;  4ZY0 A;  4GS4 A;  4DNC A;  3FVL A;  4CS0 B;  2ZEM A;  5K8N A;  4NGM A;  2ZW4 A;  3NH4 A;  2NYQ A;  4E8O A;  4J3G A;  2FXF A;  2BL1 A;  4UCN A;  3CXP A;  2JDC A;  4XNH C;  2B4D A;  3VWD A;  1IU8 A;  4EME A;  4UWI A;  1NMT A;  4A37 A;  1QST A;  4PPZ A;  3KGQ A;  2B4D B;  3KKW A;  1YR0 A;  2C6C A;  1QSN A;  4GXH A;  3TFY A;  4PXE A;  4OC4 A;  1TXR A;  3WC5 A;  1R57 A;  5JPH A;  2GAN A;  3KL9 A;  4CGN A;  5JQ4 A;  4P4F A;  1S3Z A;  2PJC A;  1R3N A;  5AGE A;  2C27 A;  2R8V A;  1YW4 A;  2IL4 A;  2HB6 A;  4UEF A;  4R76 A;  1PCA A;  1WWZ A;  4NFR A;  5LYI A;  4MCS A;  3K2K A;  5GCN A;  1YSJ A;  4OKO A;  4RS2 A;  3DNS A;  2CY2 A;  4MHZ A;  3FJU A;  4PXD A;  4I49 A;  4OC3 A;  4MFL A;  3W6X A;  4ONW A;  2OU2 A;  3W6S A;  4ORF A;  5THW A;  3A9L A;  3B7I A;  1F57 A;  5FVJ A;  1A2Z A;  2GRE A;  2CTB A;  2JBK A;  2PJ5 A;  4M6I A;  4CYO A;  1IY7 A;  4Q38 A;  4L89 A;  3RO0 A;  3KHX A;  4MI4 A;  1KWM A;  2P6F A;  1BLL E;  3FXT A;  4NEX A;  1M4I A;  2OZH A;  4CGO A;  4KOR A;  1CM0 A;  2AFW A;  1QSM A;  2Q4Y A;  1IYL A;  3KHZ A;  3N5F A;  3I9S A;  3EY5 A;  3NFZ A;  4UIB A;  4ZX9 A;  1EE3 P;  3BJ7 A;  5AG4 A;  2ZPA A;  2PJ0 A;  1VGY A;  1M4D A;  4Q36 A;  2B58 A;  8CPA A;  1Y0Y A;  2NSM A;  4XPK A;  5I4M A;  2ODF A;  1IOF A;  3KR4 A;  1XJO A;  3IJ3 A;  3TTH A;  2PJ6 A;  2F8H A;  4O23 A;  4MFP A;  3TCV A;  2WPW A;  2DPT A;  1I1D A;  1L0C A;  2P0W A;  4KVO E;  3F5B A;  2Q4Z A;  4QBJ A;  4CGM A;  3FB3 A;  2J8M A;  4HNX B;  3PB6 X;  1BPN A;  4QUS A;  2PC1 A;  5IB0 A;  1LAP A;  2AFS A;  2YND A;  2G9D A;  3LOD A;  2RB7 A;  5HH1 A;  1Z8L A;  1H8L A;  1V0C A;  3P2H A;  1PYT B;  4ZGY B;  3TE4 A;  2DXQ A;  1GHE A;  1CJW A;  1S7L A;  1FT7 A;  2PJ9 A;  4JLY A;  3UY5 A;  4R8F A;  4C7H A;  4A2Z A;  2ANP A;  2R98 A;  1JQG A;  4YGO A;  3TT2 A;  2G0B A;  5G20 A;  2ZEN A;  4NJQ A;  4P4I A;  2REF A;  1MK4 A;  4KOS A;  4CYN A;  2C1C A;  3V38 A;  1X12 A;  2C6P A;  4WJB A;  2OZU A;  2G3T A;  2Q0Y A;  1YME A;  4PK3 A;  3S6G A;  2GU2 A;  3S9L A;  2I00 A;  1I12 A;  4R3K A;  3SXN A;  2P6G A;  3H8F A;  4B14 A;  3ZJ0 A;  1YQE A;  3S6K A;  4W9Y A;  3JTK A;  2YNE A;  4MHD A;  2ZXV A;  4EVY A;  3PB8 X;  2A4N A;  4JXQ A;  2CXA A;  3SJF A;  3D2M A;  4ZY1 A;  2ZW6 A;  1ON0 A;  2AFZ A;  3KQZ A;  4OC5 A;  4OC2 A;  4OID A;  1YGH A;  4R9M A;  2QEC A;  4MCR A;  3QAH A;  1R43 A;  3IU2 A;  3D68 A;  4A95 A;  4MFK A;  2BO9 A;  2Z3M A;  1LAN A;  1VIX A;  1Y7R A;  3B3C A;  4FWU A;  1BAV A;  4JWP A;  1LOK A;  4EWT A;  3SI1 A;  2POK A;  5HXD A;  3FRM A;  3HLP A;  2PVW A;  3D3S A;  3D67 A;  4Q7A A;  3W91 A;  3T9Y A;  4B6Z A;  4YFJ A;  3DDD A;  3EFA A;  5D8N A;  5I0C A;  1M4L A;  4X8I A;  1ELM P;  4DUK A;  4E0A A;  4H6Z A;  2ZOG A;  5HMN A;  5EC4 A;  2IJZ A;  4ZYQ A;  2R1I A;  2ZEO A;  3IGR A;  4MFZ A;  1PU9 A;  4E2A A;  3FEC A;  3KQX A;  4ZI6 A;  4UBR A;  5ISV A;  2FCK A;  2ZEH A;  2YNC C;  3D66 A;  4QVT A;  3R9F A;  3B35 A;  1ZG8 A;  2EK9 A;  2B3U A;  3I1U A;  1CBX A;  1MJA A;  2PJB A;  4IF5 A;  1ZO0 A;  1Y7E A;  3TO7 A;  4AG7 A;  2FIA A;  3DSB A;  4U9Z A;  4BIN A;  2ZEL A;  4KLW A;  4P4J A;  4OLL A;  4KUB A;  4Y49 B;  3DLJ A;  4R3L A;  4YWY A;  2Z11 A;  2FS5 A;  3D8P A;  4ONU A;  5F49 A;  1Q2Y A;  3RYO A;  2P6E A;  3SHP A;  5K8P A;  2WYR A;  4QB9 A;  4PSX A;  3PBE A;  5C82 A;  2Z3O A;  5EBV A;  2ZEF A;  1TIQ A;  5F47 A;  4KOV A;  2VZZ A;  2I3C A;  2PIY A;  4GM5 A;  2Z3N A;  1Z8T A;  1IOI A;  2CIJ A;  4UFW A;  3WAB A;  1IIC A;  4P4E A;  5K8O A;  2CNT A;  1HDQ A;  3MGD A;  4KVX A;  4JXR A;  4LQG A;  2DF5 A;  3KAS A;  2PJ7 A;  3LAC A;  4FD5 A;  4YRH A;  4Z65 A;  2QVP A;  1P4N A;  3IWE A;  3S9N A;  3PB7 X;  3WR7 A;  1RO5 A;  2PDO A;  4C7I A;  2PCU A;  3CT9 A;  4B13 A;  5LRJ A;  4FAI A;  1M44 A;  2Z3P A;  3PRT A;  1JWQ A;  3PB4 X;  2Q51 A;  4P4D A;  2HV2 A;  1MJB A;  4P45 A;  1UWY A;  4B12 A;  3K9T A;  4L8A A;  4M3S A;  5J1Q A;  2J8R A;  2PQ8 A;  1VHS A;  3GUX A;  3TO9 A;  4F8Z A;  1F2O A;  3CXQ A;  2Y0M A;  3SJE A;  3FIX A;  4M85 A;  2VZY A;  4A33 A;  4R6T A;  3I3G A;  1BOB A;  2REE A;  4PXB A;  3R95 A;  3WC7 A;  1SQH A;  2CTC A;  3FF3 A;  4OAE A;  4OC0 A;  3IC1 A;  5CNP A;  3T90 A;  4B5P A;  1NSL A;  4C2Y A;  2FIW A;  1CP7 A;  3BJ8 A;  3FX6 A;  3VWE A;  2PE3 A;  3WT4 A;  5JGF A;  3JVN A;  1FNO A;  4PXC A;  2PJ2 A;  3GIU A;  1Q2D A;  3PP9 A;  2ZEP A;  4B5P B;  4PSW A;  4HPS A;  4H6U A;  5A27 A;  3E0K A;  1ARL A;  1ZLI A;  1QMU A;  5AG6 A;  4KOW A;  2NMT A;  5F46 A;  3BXM A;  1Z9U A;  1QSR A;  2AFM A;  4P6Y A;  2VI7 A;  3B3V A;  4NSQ A;  1QSO A;  1S7K A;  2X7B A;  1HDU A;  5F48 A;  4OIW A;  1Q2C A;  1TKJ A;  3K9U A;  2Q7S A;  4IAV A;  5J8C A;  4TWE A;  1YRE A;  4OC1 A;  4CRY B;  4U5Y A;  3FED A;  4TNU A;  3FNC A;  4JD6 A;  4MHP A;  4NXY A;  1S7F A;  2GLJ A;  3S6F A;  2XEJ A;  2Z0Z A;  1B6B A;  1J4J A;  2RFH A;  3NE7 A;  4KVM E;  4BBH A;  3WC6 A;  3QNV A;  3KI9 A;  4BMH A;  2VQY A;  2EUI A;  1XRY A;  4ZBG A;  3VH9 A;  1TKF A;  4KOX A;  4NGS A;  2JEW A;  2VBQ A;  2VXK A;  2KCW A;  3IWG A;  3NA6 A;  4F0X A;  2YNC A;  4KOY A;  4M6H A;  3DGV A;  3T8W A;  3JRU A;  1OZP A;  4MHN A;  3H4Q A;  4JYW A;  3P2F A;  5AG5 A;  1Q7L A;  2AFU A;  4AVC A;  2ZEG A;  3BI1 A;  4JZ0 A;  1XE4 A;  1Y0R A;  1CX8 A;  4KSA A;  5IV0 A;  1IGB A;  3PFO A;  3IWW A;  4B11 A;  2Z3K A;  1YVO A;  2V8H A;  2JEV A;  1HEE A;  3DR6 A;  3LWU A;  4AXV A;  2AJ6 A;  1YX0 A;  2FT0 A;  5IX3 A;  3IEH A;  4UIA A;  1YW6 A;  1Y9W A;  2CNM A;  2ZEE A;  4OAD A;  4R87 A;  4XPL A;  4B5O A;  2PVV A;  1LCP A;  1AUG A;  4LQ6 A;  2BOA A;  3MRU A;  1NE9 A;  4CAF A;  1Y9K A;  5D29 A;  1QQ9 A;  2QJ8 A;  1ZG9 A;  4UCP A;  1XBU A;  3TC8 A;  3BHX A;  4EFD A;  1CP6 A;  2PJA A;  4H2K A;  4C2Z A;  3CZX A;  2J9A A;  3FYN A;  3IFE A;  3N7Z A;  3FEE A;  3FMC A;  1YLE A;  3FH4 A;  4OP4 A;  4P4B A;  5HVF A;  3B8G A;  2F5I A;  4UF4 A;  2C6G A;  5CPA A;  3D4U A;  3PGP A;  3EXN A;  1KZF A;  2WUU A;  3GY9 A;  3V7Z A;  4MCP A;  4CGL A;  1AYE A;  3PFE A;  4MHY A;  2B5G B;  3D7G A;  4RUH A;  2GFQ A;  3IIB A;  2PR8 A;  2OH1 A;  1RXT A;  4LX9 A;  2PRB A;  2YGW A;  3EO4 A;  5KTD A;  2ZOF A;  3PEI A;  4PK2 A;  4AB7 A;  1XF8 A;  3CDX A;  2B5G A;  1IID A;  2PSW A;  3BLN A;  3KZW A;  2OZG A;  4KLV A;  1WK4 A;  4OME A;  1Z4R A;  2ABZ A;  4FD6 A;  2PRQ A;  4HNW B;  2EVN A;  2K5T A;  1VKC A;  1Z8W A;  3S6H A;  3OWC A;  1XMB A;  1YK3 A;  3KR5 A;  2CNS A;  3TOB A;  1CPS A;  2BUE A;  3EC4 A;  2JLM A;  4QC6 A;  2WSA A;  4A30 A;  1VHO A;  1KUV A;  1ZLH A;  4IHM A;  2B4B A;  2Q7B A;  3S9M A;  3PBB A;  3R9G A;  2GLF A;  1YVK A;  4MY3 A;  3CXS A;  4A32 A;  4F6A A;  2PJ1 A;  2XEG A;  4KSF A;  3SXO A;  1S5K A;  2D4O A;  3D2P A;  1XOV A;  5LRG A;  4II9 A;  4CAE A;  1B87 A;  2B3V A;  4NCZ A;  1M1D A;  5F09 A;  1TKH A;  2IQ6 A;  2V77 A;  1LFW A;  4CPA A;  4H89 A;  3H8E A;  2G3A A;  1K4J A;  5G1Z A;  3TO6 A;  4CRZ B;  1PUA A;  3SI0 A;  1KUY A;  1CPX A;  2FVG A;  6CPA A;  4M6G A;  3RNZ A;  4Y49 C;  1U6M A;  3B3S A;  3PZJ A;  2JBJ A;  2QML A;  4DJL A;  4UEE A;  4MFJ A;  4MXU A;  3G3S A;  4NGP A;  3GLJ A;  5G22 A;  2O53 A;  1TF9 A;  2PJ3 A;  4IK2 A;  7CPA A;  1Z2L A;  4G1P A;  3R1K A;  4BD9 A;  3H8G A;  1BPM A;  3BI0 A;  5DWM A;  1N71 A;  2FL4 A;  2PIZ A;  4UFX A;  4KUA A;  4NGQ A;  4UA3 A;  2OOT A;  2PR1 A;  4WWV A;  2V8V A;  2EO8 A;  2OR4 A;  1XFO A;  1F2P A;  1UFH A;  3CPA A;  1P0H A;  3LD2 A;  4NJR A;  4MMO A;  3ZZI A;  4FUU A;  4PV6 A;  5E96 A;  3TX8 A;  4A31 A;  1BO4 A;  4MJ8 A;  4NGT A;  3DR8 A;  4YU9 A;  4C2X A;  2XEI A;  3F0A A;  3QB8 A;  3SI2 A;  3FBU A;  2H5M A;  2VEZ A;  2RC4 A;  4XNH B;  3V8I A;  4B10 A;  5BWA B;  2AFO A;  4XPD B;  4DYO A;  2PJ4 A;  4C68 A;  3NH5 A;  5LYL A;  5HVH A;  2BEI A;  2Z3L A;  1I21 A;  2IMO A;  1KUX A;  3NE8 A;  2Q04 A;  1TF8 A;  2BSW A;  2WPX A;  5DS0 A;  3SJX A;  2VL1 A;  2DPS A;  3QAY A;  1MJ9 A;  1RTQ A;  4NGR A;  4FBE A;  5EMI A;  4X2T A;  4HKF A;  4UFV A;  2ATR A;  5JM6 A;  1X10 A;  4F0Y A; 
#chains in the Genus database with same CATH homology
 4KOT A;  2HUZ A;  4KOU A;  1Z4E A;  2JDD A;  3R96 A;  2FE7 A;  5H86 A;  2R7H A;  4CAV A;  4CAX A;  2HQY A;  4NF1 A;  4LUA A;  1LRZ A;  4HNY B;  4MFQ A;  4AVB A;  2ARH A;  2O28 A;  4CYQ A;  3H5Z A;  4RI1 A;  4UWJ A;  4AG9 A;  5KTA A;  5J8F A;  2QIR A;  1M4G A;  5H84 A;  1S60 A;  2J8N A;  4KZT A;  3R9E A;  3GKR A;  4MBU A;  4CGP A;  2OB0 A;  3F8K A;  3TOA A;  2Q44 A;  1IB1 E;  2ZW5 A;  5G21 A;  2Q4V A;  4FD7 A;  1XEB A;  1XMT A;  4U9Y A;  2GE3 A;  3GYA A;  4MY0 A;  1IYK A;  4FD4 A;  3G8W A;  4IUS A;  4CYP A;  1FY7 A;  2GIV A;  5DWN A;  1S7N A;  2AE6 A;  3JUW A;  5AG7 A;  4KS9 A;  4X5K A;  1XIX A;  2FSR A;  4XPD C;  4CAW A;  5KTC A;  4UCM A;  5A28 A;  2I79 A;  2D4P A;  2Z10 A;  4JJX A;  5C88 A;  4K30 A;  3IU1 A;  5C82 A;  2ZW7 A;  4AVA A;  4R57 A;  4GS4 A;  4DNC A;  4CS0 B;  2ZW4 A;  4E8O A;  4J3G A;  2FXF A;  2BL1 A;  4UCN A;  3CXP A;  2JDC A;  4XNH C;  2B4D A;  3VWD A;  4UWI A;  1NMT A;  1QST A;  2B4D B;  3KKW A;  1YR0 A;  1QSN A;  3TFY A;  5JPH A;  1R57 A;  2GAN A;  4CGN A;  5JQ4 A;  1S3Z A;  5AGE A;  2C27 A;  2R8V A;  2IL4 A;  1WWZ A;  5GCN A;  4RS2 A;  3DNS A;  2CY2 A;  4I49 A;  4MFL A;  3W6X A;  2OU2 A;  3W6S A;  4ORF A;  3A9L A;  5FVJ A;  4CYO A;  4Q38 A;  4L89 A;  4MI4 A;  2P6F A;  3FXT A;  4NEX A;  1M4I A;  2OZH A;  4CGO A;  4KOR A;  1CM0 A;  1QSM A;  2Q4Y A;  1IYL A;  3I9S A;  3EY5 A;  3BJ7 A;  5AG4 A;  2ZPA A;  1M4D A;  4Q36 A;  2B58 A;  4XPK A;  3TTH A;  4MFP A;  3TCV A;  2WPW A;  2DPT A;  1I1D A;  1L0C A;  2P0W A;  4KVO E;  3F5B A;  4QBJ A;  4CGM A;  3FB3 A;  2J8M A;  4HNX B;  4QUS A;  2PC1 A;  5IB0 A;  2YND A;  5HH1 A;  3LOD A;  1V0C A;  3P2H A;  3TE4 A;  4ZGY B;  2DXQ A;  1GHE A;  1CJW A;  1S7L A;  4JLY A;  3UY5 A;  4C7H A;  4A2Z A;  2R98 A;  4YGO A;  3TT2 A;  2G0B A;  5G20 A;  2REF A;  1MK4 A;  4KOS A;  4CYN A;  2OZU A;  2G3T A;  2Q0Y A;  4PK3 A;  3S6G A;  2I00 A;  1I12 A;  4R3K A;  3SXN A;  2P6G A;  4B14 A;  3ZJ0 A;  3S6K A;  3JTK A;  2YNE A;  4MHD A;  2ZXV A;  4EVY A;  2A4N A;  4JXQ A;  2CXA A;  3D2M A;  2ZW6 A;  1ON0 A;  1YGH A;  2QEC A;  3QAH A;  3IU2 A;  4A95 A;  4MFK A;  2Z3M A;  1Y7R A;  4JWP A;  3FRM A;  3D3S A;  3W91 A;  3T9Y A;  4YFJ A;  3DDD A;  3EFA A;  5I0C A;  4E0A A;  4H6Z A;  5HMN A;  5EC4 A;  2R1I A;  3IGR A;  4MFZ A;  1PU9 A;  4E2A A;  5ISV A;  4UBR A;  2FCK A;  4QVT A;  2YNC C;  3R9F A;  2B3U A;  1MJA A;  4IF5 A;  1ZO0 A;  3TO7 A;  4AG7 A;  2FIA A;  3DSB A;  4U9Z A;  4KLW A;  4OLL A;  4KUB A;  4Y49 B;  4R3L A;  2Z11 A;  2FS5 A;  3D8P A;  4ONU A;  5F49 A;  1Q2Y A;  3RYO A;  2P6E A;  3SHP A;  4QB9 A;  4PSX A;  2Z3O A;  5EBV A;  1TIQ A;  5F47 A;  4KOV A;  2VZZ A;  2Z3N A;  4UFW A;  1IIC A;  2CNT A;  3MGD A;  4KVX A;  4R9M A;  4JXR A;  4YRH A;  4FD5 A;  1P4N A;  3IWE A;  3WR7 A;  1RO5 A;  2PDO A;  4C7I A;  4B13 A;  1M44 A;  2Z3P A;  2HV2 A;  1MJB A;  4B12 A;  4L8A A;  4M3S A;  2J8R A;  2PQ8 A;  1VHS A;  3TO9 A;  3CXQ A;  2Y0M A;  3FIX A;  4M85 A;  2VZY A;  4A33 A;  3I3G A;  1BOB A;  2REE A;  3R95 A;  1SQH A;  4OAE A;  5CNP A;  3T90 A;  4B5P A;  1NSL A;  4C2Y A;  2FIW A;  3BJ8 A;  3VWE A;  3JVN A;  1Q2D A;  3PP9 A;  4B5P B;  4PSW A;  4H6U A;  5A27 A;  3E0K A;  5AG6 A;  4KOW A;  2NMT A;  5F46 A;  1Z9U A;  1QSR A;  2VI7 A;  4NSQ A;  1QSO A;  1S7K A;  2X7B A;  5F48 A;  1Q2C A;  3K9U A;  5J8C A;  1YRE A;  4CRY B;  4U5Y A;  3FNC A;  4JD6 A;  4NXY A;  1S7F A;  3S6F A;  2Z0Z A;  1B6B A;  1J4J A;  3NE7 A;  4KVM E;  4BBH A;  4BMH A;  2VQY A;  2EUI A;  4ZBG A;  4KOX A;  2VBQ A;  2VXK A;  2KCW A;  3IWG A;  4F0X A;  2YNC A;  4KOY A;  1OZP A;  5AG5 A;  3H4Q A;  3P2F A;  4AVC A;  1XE4 A;  4KSA A;  5IV0 A;  4B11 A;  2Z3K A;  1YVO A;  3DR6 A;  2JEV A;  2AJ6 A;  1YX0 A;  2FT0 A;  5IX3 A;  1Y9W A;  2CNM A;  4OAD A;  4R87 A;  4XPL A;  4B5O A;  1NE9 A;  4CAF A;  1Y9K A;  4UCP A;  4C2Z A;  3N7Z A;  3FYN A;  1YLE A;  3B8G A;  2F5I A;  3PGP A;  1KZF A;  2WUU A;  3GY9 A;  4CGL A;  2B5G B;  2PR8 A;  2OH1 A;  1RXT A;  4LX9 A;  2PRB A;  2YGW A;  3EO4 A;  5KTD A;  4PK2 A;  4AB7 A;  1XF8 A;  2B5G A;  1IID A;  2PSW A;  3BLN A;  4KLV A;  2OZG A;  1WK4 A;  1Z4R A;  4FD6 A;  4HNW B;  2EVN A;  2K5T A;  1VKC A;  3S6H A;  3OWC A;  3TOB A;  1YK3 A;  2CNS A;  2BUE A;  3EC4 A;  2JLM A;  4QC6 A;  2WSA A;  4A30 A;  1KUV A;  2B4B A;  2Q7B A;  3R9G A;  1YVK A;  4MY3 A;  3CXS A;  4A32 A;  4F6A A;  4KSF A;  3SXO A;  1S5K A;  2D4O A;  3D2P A;  4II9 A;  4CAE A;  1B87 A;  2B3V A;  4NCZ A;  1M1D A;  4H89 A;  2G3A A;  1K4J A;  5G1Z A;  3TO6 A;  4CRZ B;  1PUA A;  1KUY A;  4Y49 C;  1U6M A;  3PZJ A;  2QML A;  4MFJ A;  3G3S A;  5G22 A;  2ATR A;  3R1K A;  5DWM A;  1N71 A;  2FL4 A;  4UFX A;  4KUA A;  4UA3 A;  2PR1 A;  1UFH A;  1P0H A;  3LD2 A;  3ZZI A;  4PV6 A;  5E96 A;  4A31 A;  1BO4 A;  4MJ8 A;  3DR8 A;  4C2X A;  3F0A A;  3QB8 A;  3FBU A;  2H5M A;  2VEZ A;  2RC4 A;  4XNH B;  3V8I A;  4B10 A;  5BWA B;  4XPD B;  4C68 A;  2BEI A;  2Z3L A;  1I21 A;  1KUX A;  2Q04 A;  2BSW A;  2WPX A;  2DPS A;  1MJ9 A;  4HKF A;  4UFV A;  3EXN A;  3C26 A;  4F0Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...