4IUSA

Gcn5-related n-acetyltransferase from kribbella flavida.
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
259
structure length
257
Chain Sequence
AMGIAARIASAQLQGLVRSRRQVVAGPLVGLLHDEDVWFLSRAVAAEPGVPFDPAEVPWALETIRKAFAAEDRWLSAELVEEANPGLAYVLVEHGMTIVSRPPLLAVEPGDLLVPEFPAGVTAAVVASAEEQEAANAIAGDAYETDASPFQPEPADGGAVLIRMDGVPVATAAWTAIADGVTEVAGVGTLHSHRRQGLGALATAYATQQAFEVGGATLAWLTPGDDGADRIYRRLGYEPKATAVHLGDPGGHLADLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GCN5-related N-acetyltransferase
publication title GCN5-related N-acetyltransferase from Kribbella flavida.
rcsb
source organism Kribbella flavida
molecule tags Transferase
total genus 76
structure length 257
sequence length 259
ec nomenclature ec 2.3.1.128: Transferred entry: 2.3.1.267.
pdb deposition date 2013-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4iusA00
1S7LA 2Q4YA 2QMLA 4R3KA 4MBUA 3W6XA 4QUSA 4R9MA 5CNPA 3FIXA 4CAWA 2VEZA 2FXFA 4J3GA 5JQ4A 2CNSA 3F8KA 2D4OA 1XF8A 2BL1A 4HNXB 1CJWA 4KVXA 3CXPA 5I0CA 2J8NA 1Z4RA 3V8IA 2WPWA 4ZBGA 3TFYA 4QBJA 3FXTA 4NEXA 2FT0A 3B8GA 4KLWA 3I9SA 2F5IA 4YRHA 4MI4A 4RI1A 2DXQA 4HNWB 2FE7A 4JD6A 2G0BA 4KUAA 4F0YA 2B4DA 3MGDA 4KOYA 4NXYA 3S6GA 3DDDA 2VXKA 5HMNA 1NSLA 2J8RA 3EXNA 4IUSA 4R57A 3D2PA 3IWGA 1YGHA 4L89A 3H4QA 3R96A 5KTDA 4OADA 3CXQA 1Q2CA 4UBRA 4PSWA 1QSMA 1L0CA 3IGRA 4CRYB 2R8VA 1XIXA 3G8WA 1BO4A 4QC6A 2KCWA 2RC4A 3ZJ0A 3EO4A 3UY5A 1PUAA 2D4PA 3D3SA 4CAXA 2Q7BA 3FYNA 2OB0A 2OZHA 3OWCA 2ZW4A 1TIQA 5J8FA 4R3LA 3GYAA 3PP9A 3W6SA 4L8AA 1R57A 4RS2A 3DNSA 2OZUA 2I79A 2PQ8A 4HKFA 3C26A 4MY3A 4KORA 3D8PA 3GY9A 2EVNA 4OLLA 1S60A 4AB7A 2VZZA 1QSTA 1Q2DA 1I1DA 2FL4A 4YFJA 4NF1A 2REEA 1M1DA 4NSQA 3TE4A 2JDDA 4B5PB 1WWZA 3RYOA 3TOAA 5KTAA 5HH1A 3R1KA 1NE9A 2FS5A 4KOWA 4GS4A 5H84A 4E0AA 2G3TA 2PR1A 5EBVA 2ATRA 4KOTA 3R95A 2ZPAA 4FD7A 2B3VA 2ARHA 3JVNA 2K5TA 4K30A 3T9YA 4F6AA 1OZPA 2P0WA 2P6EA 1CM0A 4XNHB 2B58A 4FD5A 2EUIA 1IICA 5F49A 4JLYA 4H6UA 4NCZA 2Y0MA 4JXRA 1YX0A 3DR8A 2FIAA 4LUAA 2CY2A 2AJ6A 3EC4A 1QSNA 2HQYA 4KZTA 4CAVA 2AE6A 1Y9WA 2PDOA 1J4JA 4EVYA 5EC4A 1S7NA 1V0CA 4E2AA 4Y49B 4U9ZA 1PU9A 3P2HA 2FIWA 2QECA 1YLEA 2O28A 1S3ZA 1YR0A 3QB8A 4XPDB 3CXSA 5IB0A 2NMTA 4M85A 1MK4A 2FSRA 2CNTA 4U5YA 4H6ZA 5IV0A 3TTHA 3D2MA 3W91A 1XEBA 2BSWA 2ZW7A 2P6FA 3SHPA 3VWEA 5J8CA 1ON0A 4QB9A 4KOUA 2R98A 1M44A 5E96A 5DWNA 3FNCA 3K9UA 2JLMA 2OH1A 3PZJA 2C27A 1KUVA 3I3GA 1LRZA 4X5KA 2Q0YA 1VKCA 2ZW6A 2HV2A 4KOVA 3SXOA 2B5GA 4UA3A 3FB3A 3GKRA 1MJAA 1IYLA 1YK3A 1I21A 5F47A 3T90A 3TO6A 5C88A 2VQYA 2GIVA 2BEIA 4E8OA 4CS0B 2Z10A 3WR7A 1NMTA 1Y7RA 3E0KA 1M4GA 5F46A 3BJ7A 2I00A 1SQHA 4AVCA 3FBUA 4UWIA 1XE4A 3G3SA 2A4NA 2ZW5A 1Z4EA 2REFA 4AVBA 1U6MA 4B5OA 1FY7A 3TCVA 1Y9KA 4AG9A 1KZFA 2JDCA 3R9FA 1IYKA 3R9GA 1Q2YA 2R7HA 1QSRA 2PRBA 3NE7A 1M4IA 3TOBA 2Z11A 1QSOA 2QIRA 1YVKA 1WK4A 1XMTA 1P4NA 2CNMA 4PK2A 4KLVA 1KUXA 4FD4A 2PSWA 4PSXA 1BOBA 1KUYA 4B5PA 3SXNA 4AVAA 2P6GA 5KTCA 2J8MA 4UWJA 2IL4A 2BUEA 2GANA 4FD6A 5C82A 4JJXA 3EFAA 3FRMA 1IB1E 2VBQA 3BLNA 2B4DB 4JWPA 4XPLA 3TO9A 1B87A 4KOXA 3DSBA 4HNYB 2R1IA 4QVTA 5IX3A 1B6BA 5DWMA 2Q44A 4MJ8A 3N7ZA 1RXTA 4KVOE 3KKWA 4MHDA 3JUWA 3ZZIA 1P0HA 2ZXVA 3DR6A 3BJ8A 1YREA 1I12A 2JEVA 4MY0A 3EY5A 3S6FA 3LODA 5F48A 1VHSA 5FVJA 5GCNA 5JPHA 3PGPA 3S6KA 3VWDA 4IF5A 3R9EA 3F5BA 2FCKA 1S7KA 1YVOA 4JXQA 2VZYA 4KUBA 2B5GB 2WPXA 3P2FA 4OAEA 4KVME 2H5MA 3F0AA 4LX9A 4H89A 2OZGA 2GE3A 3LD2A 4XNHC 4BMHA 2Z0ZA 2B3UA 1S7FA 4U9YA 4DNCA 2HUZA 1UFHA 1N71A 4KOSA 2PC1A 4R87A 1Z9UA 4ORFA 3TT2A 4M3SA 2Q04A 4II9A 1M4DA 1K4JA 1GHEA 2OU2A 1MJ9A 5H86A 3QAHA 1IIDA 5ISVA 4Y49C 2X7BA 2VI7A 1S5KA 2G3AA 4PV6A 1RO5A 4I49A 4YGOA 4AG7A 3S6HA 4PK3A 4ONUA 4XPDC 4CRZB 3TO7A 2PR8A 1MJBA 2Q4VA 4XPKA 2B4BA
chains in the Genus database with same CATH superfamily
3IIBA 4A31A 3PBBA 1S7LA 3SJGA 3S9LA 2EK8A 4B13A 2Q4YA 4CGOA 2QMLA 4R3KA 2AFSA 2PJ8A 4MBUA 3B3CA 3W6XA 4QUSA 3BI0A 1Z8TA 4R9MA 5CNPA 1ZG7A 3FIXA 3FX6A 3H8EA 3NA6A 4Q38A 5CPAA 2PJ3A 4CAEA 2VEZA 3BI1A 4CAWA 2FXFA 4M6HA 5LRGA 1F2PA 2ZENA 3KZWA 3CPXA 4J3GA 5JQ4A 2CNSA 3F8KA 2GU2A 2AFZA 3KR5A 4B11A 2D4OA 1XF8A 2BL1A 4HNXB 1CJWA 4KVXA 3CXPA 5I0CA 1R43A 4A30A 2J8NA 4MCQA 3V7ZA 1Z4RA 2PJ2A 2JEWA 3V8IA 2WPWA 4ZBGA 5F09A 3TFYA 3VARA 4A37A 4QBJA 3FXTA 4NEXA 4OP4A 2FT0A 2F7VA 3FMCA 3ISZA 2Q7SA 5EMIA 2EBJA 2ZOGA 3B8GA 2NSMA 4C7IA 2IMOA 3KQZA 4KLWA 4W9YA 3I9SA 2F5IA 5LYDA 3SJFA 4YRHA 1BPNA 3SI0A 3VH9A 2AFUA 4MI4A 4R7MA 4RI1A 2DXQA 3FH4A 4ONWA 4HNWB 4F0XA 5HVHA 3GLJA 2FE7A 4JD6A 2QVPA 2G0BA 5D8NA 4B14A 4KUAA 1ARLA 4F0YA 3KHZA 4Z65A 4X3RA 2B4DA 4ZX8A 1JWQA 2FVGA 3MGDA 4KOYA 1R3NA 1YSJA 4NXYA 2PIYA 1LANA 3S6GA 3DDDA 3ISXA 2VXKA 5HMNA 2JBJA 1NSLA 2J8RA 4ZGYB 4MXUA 3EXNA 3H8GA 4IUSA 4R57A 3D2PA 4HPSA 3GUXA 4Q36A 3IWGA 5LRJA 3B3WA 2WYRA 2ZEMA 1ELMP 1IOIA 2IQ6A 2EK9A 4MRIA 1YGHA 4L89A 3H4QA 3R96A 3RZAA 2ZEEA 4OADA 5KTDA 3CXQA 1Q2CA 5JH9A 1ELLP 4UBRA 4PSWA 1Z8LA 1QSMA 3K9TA 4PQAA 1L0CA 3IGRA 3FEEA 5IB9A 2VL1A 4CRYB 2R8VA 5G22A 1XIXA 3G8WA 1YW4A 1BO4A 4QC6A 2KCWA 1H8LA 1AYEA 2PIZA 2RC4A 1BLLE 3ZJ0A 1QMUA 2Z3OA 4UEEA 4OC5A 3EO4A 1LAPA 1CPSA 2C6GA 3NE8A 4FWUA 3UY5A 1TF9A 1PUAA 2CF4A 2CXAA 2D4PA 3D3SA 4UEZA 4CAXA 4F8ZA 2Q7BA 3FYNA 2PJ9A 2OB0A 2OZHA 3OWCA 1IGBA 2ZW4A 3B3SA 4R6TA 2PJCA 2BCOA 3WT4A 2V8GA 5LRKA 1TIQA 4M6IA 5ELYA 3SI1A 5J8FA 4R3LA 1EE3P 3GYAA 4A94A 3N5FA 3PP9A 3W6SA 4L8AA 1R57A 4RS2A 4MFKA 3DNSA 2OZUA 2RB7A 2I79A 2PQ8A 2XEGA 3C26A 4HKFA 4C2XA 2Q4ZA 4MY3A 4KORA 3D8PA 3GY9A 2EVNA 1Q7LA 3D4UA 4OLLA 1S60A 4AB7A 3D7DA 4DUKA 2VZZA 1QSTA 1YLOA 2O4HA 4MHPA 5HVGA 1Q2DA 1I1DA 4A95A 2FL4A 1CP6A 1DE4C 3SJEA 4YFJA 4LQ6A 2DEAA 3IEHA 4NF1A 4Q7AA 2REEA 1OBRA 4OC4A 1M1DA 4NSQA 4EMEA 3TE4A 2JDDA 2CTBA 4NGSA 2BOAA 3FF3A 4B5PB 1Y0YA 2I3CA 4UFXA 1WWZA 1F2OA 3RYOA 4TNUA 3TOAA 5KTAA 5HH1A 4NGMA 3R1KA 1NE9A 1IU8A 2FS5A 4C2YA 4KOWA 4GS4A 5H84A 4E0AA 2AFXA 2G3TA 2PR1A 5EBVA 2ATRA 4OIWA 4FBEA 5K8NA 2QYVA 2PJ5A 4NGNA 4JZ0A 4KOTA 3R95A 2ZPAA 4FD7A 3WC5A 2B3VA 2ARHA 3PEIA 3JVNA 2K5TA 2PJ4A 4K30A 3T9YA 4F6AA 1BPMA 4A2ZA 1OZPA 2P0WA 3RO0A 2P6EA 4BBHA 1CP7A 2J9AA 3LMSA 4TWEA 1CM0A 1LCPA 1Z8XA 2IJZA 2PJAA 1XBUA 2B58A 3KL9A 3NH8A 4FD5A 2EUIA 1IICA 4DJLA 1PYTB 5F49A 2EWBA 4JLYA 1IOFA 4H6UA 4NCZA 4PXDA 2Y0MA 4JXRA 1CBXA 3KQXA 1YX0A 3DR8A 2FIAA 1VIXA 4LUAA 1HEEA 2CY2A 4X2TA 1TF8A 5LYIA 2AJ6A 2PJ0A 2Q51A 3CDXA 1QSNA 3EC4A 2HQYA 4KZTA 3FVLA 4CAVA 4EWTA 1KWMA 3IU1A 2AE6A 1Y9WA 2EO8A 2PDOA 1J4JA 1TXRA 2V8DA 3KASA 4EVYA 4X8IA 1AMPA 5EC4A 3A9LA 1S7NA 1VHOA 1V0CA 4E2AA 4OC3A 4Y49B 4U9ZA 1PU9A 1NSAA 4P4BA 3P2HA 4FAIA 3S9MA 2XEJA 2FIWA 2QECA 2ZELA 1FNOA 2YGWA 1Z2LA 4EFDA 1YLEA 2O28A 1S3ZA 1YR0A 3QB8A 4MFZA 4XPDB 3CXSA 2YNEA 5IB0A 1XJOA 2NMTA 4M85A 2CIJA 5K8PA 3KGQA 4XNHB 4C2ZA 2PJ7A 1MK4A 2O53A 2FSRA 1JQGA 2CNTA 4P4DA 4UCPA 4R76A 2ZOFA 4YWYA 4CGPA 4U5YA 1Y0RA 2C6PA 4H6ZA 3H5ZA 2PVWA 5AG6A 2C1CA 5IV0A 1CG2A 3TTHA 5G20A 3D2MA 3W91A 3PBEA 1X12A 1XEBA 1ZG9A 2BSWA 3D7GA 2ZW7A 3PFEA 2P6FA 2WSAA 4F9VA 3SHPA 3VWEA 5DS0A 5J8CA 1ON0A 4QB9A 4A39A 4WWVA 4UIBA 4GXHA 5HVFA 2V8HA 2GLFA 4KOUA 4ZI6A 2R98A 1M44A 3IC1A 4CGNA 1ZO0A 5E96A 5DWNA 4KSIA 3FNCA 3K9UA 2JLMA 2PE3A 2Q43A 3HUVA 4A38A 2Z3MA 8CPAA 1Z8WA 2QJ8A 5AG7A 1Y7EA 2OH1A 3PZJA 4C7HA 4OC2A 5AGEA 2C27A 1KUVA 4F9UA 3KR4A 4B10A 2XEIA 4BD9A 3I3GA 1LRZA 4OC0A 3IJ3A 4UF4A 4X5KA 2Q0YA 2BO9A 1Z5RA 2WZNA 1VKCA 2ZW6A 2CTCA 2HV2A 4KOVA 7CPAA 1YW6A 3SXOA 2B5GA 4UA3A 3FB3A 3PFOA 3WABA 4OKOA 4CYOA 1LAMA 2V8VA 3GKRA 2Z3PA 1MJAA 1IYLA 1YK3A 4JYWA 4OIDA 1I21A 5F47A 4MMOA 4P4IA 3T90A 2VQYA 3TO6A 5C88A 4UIAA 2GIVA 2BEIA 3D7FA 4ZY0A 4E8OA 4CS0B 2Z10A 4PXBA 3WR7A 1NMTA 1Y7RA 3E0KA 1M4GA 5F46A 3BJ7A 1TKJA 2I00A 3PB7X 3QNVA 3V38A 3QAYA 1SQHA 4R8FA 4AVCA 3DGVA 3FBUA 3NH4A 4P10A 4UWIA 1XE4A 3G3SA 2A4NA 3BXMA 2Z3KA 2ZW5A 2PVVA 1TKHA 1Z4EA 2REFA 4FUUA 4AVBA 2DPTA 1U6MA 3VATA 5HXDA 1ARMA 3FECA 4O23A 5BWAB 2PJ6A 2YNCA 1FY7A 4B5OA 4RN7A 3TCVA 4H2KA 1Y9KA 4AG9A 1KZFA 2JDCA 3FJUA 3R9FA 1IYKA 3R9GA 1Q2YA 2V77A 2R7HA 1QSRA 2PRBA 3NE7A 4MHNA 1M4IA 3TOBA 2Z11A 3TC8A 5G21A 1QSOA 3RNZA 4CYQA 4NJQA 2QIRA 2DF5A 4P4JA 5LYLA 1YVKA 1QQ9A 1WK4A 1XMTA 4KSFA 1P4NA 4YU9A 2CNMA 4PK2A 4KLVA 3PRTA 5K8OA 1FT7A 1KUXA 4MFQA 4FD4A 4DNCA 2PSWA 4UCMA 3K2KA 4PSXA 4PPZA 1BOBA 1KUYA 1LFWA 4NFRA 4B5PA 3SXNA 4AVAA 2P6GA 5KTCA 3LWUA 5JM6A 2J8MA 1HDUA 4UWJA 2IL4A 2GREA 2BUEA 4MFJA 5AG5A 3T8WA 5LYFA 4CGMA 2GANA 4RUHA 4FD6A 5C82A 3D67A 4JJXA 3EFAA 3FRMA 1BAVA 1IB1E 4OC1A 3WC6A 2DPSA 1XFOA 3LACA 3NFZA 2VBQA 3B3VA 3BLNA 2B4DB 4JWPA 3CPAA 3JTKA 4XPLA 2HC9A 1VHEA 2WUUA 1VGYA 3TO9A 2Z3LA 1B87A 4WJBA 1X10A 3B3TA 4KOXA 3DSBA 2ANPA 4HNYB 4CYNA 3CZXA 3D7HA 2R1IA 3HLPA 2GFQA 2ZEPA 4QVTA 5IX3A 1B6BA 5J1QA 3D68A 2F8HA 4MHYA 3JRUA 4NGRA 4CAFA 4PXCA 3B2YA 4KSAA 2YNCC 3PB4X 5DWMA 4ZY1A 3NH5A 1F57A 5K8MA 1XOVA 2Q44A 2HB6A 4UFVA 4MJ8A 3N7ZA 1RXTA 4KVOE 3KKWA 4MHDA 1YMEA 4OMEA 4DYOA 1GYTA 3JUWA 5G1ZA 3ZZIA 1ZLIA 1P0HA 2ZXVA 4CPAA 3DR6A 3BJ8A 1PCAA 2PJ1A 1YREA 2AFMA 1I12A 1AUGA 2JEVA 3PB6X 4MY0A 3EY5A 3S6FA 4NJRA 3CT9A 4NGPA 3LODA 1IY7A 4A33A 3PB8X 3IWWA 3PB9X 1CX8A 5F48A 5AG4A 4CGLA 1LOKA 2ZEFA 1VHSA 5JGFA 5FVJA 5GCNA 3GB0A 5JPHA 3PGPA 4K3NA 2ABZA 4IAVA 3KHXA 4UCNA 4PXEA 3S6KA 3VWDA 2ODFA 2ZEHA 4IF5A 3R9EA 4MCSA 2NYQA 2OR4A 3F5BA 3B7IA 2POKA 3RAMA 2FCKA 2PRQA 4NGTA 2AFOA 1ZLHA 1S7KA 1TKFA 1YVOA 3SI2A 4JXQA 2VZYA 2XEFA 4UEFA 4KUBA 3DLJA 2B5GB 2WPXA 3P2FA 4B6ZA 4P4FA 5D29A 4OAEA 1RTQA 4KVME 2H5MA 3F0AA 2JBKA 4LX9A 4H89A 2GLJA 3BHXA 5CBMA 5I4MA 4IHMA 2OZGA 4P44A 3B35A 4MFLA 2GE3A 6CPAA 3L2NA 4AXVA 2G9DA 3LD2A 4XNHC 3RBUA 4BMHA 2Z0ZA 2B3UA 4CYPA 1DTDA 1S7FA 4U9YA 3FEDA 4M6GA 2AFWA 2HUZA 4LQGA 3WC7A 1UFHA 1N71A 4KOSA 4ZY2A 2PC1A 4G1PA 2PJBA 1Z9UA 4R87A 4ORFA 3TT2A 4M3SA 2Q04A 4B12A 1UWYA 4GM5A 2ZEOA 1M4DA 2C6CA 1K4JA 3MN8A 4II9A 3IFEA 4MHZA 1GHEA 1HDQA 2OU2A 1ZG8A 2ZEDA 1MJ9A 5THWA 3SJXA 3IO1A 5H86A 2RFHA 3QAHA 1IIDA 4P6YA 3TX8A 4ZX9A 4P45A 4UFWA 5ISVA 4Y49C 2X7BA 1A2ZA 2ZEGA 2VI7A 1S5KA 2G3AA 4MFPA 3IU2A 3H8FA 4PV6A 1RO5A 2Z3NA 4I49A 2OOTA 4P4EA 2PCUA 4YGOA 4AG7A 3S6HA 2YNDA 4IK2A 4NGQA 1CPXA 4PK3A 4A32A 4MCPA 4ZYQA 4ONUA 4XPDC 3D66A 3IWEA 4CRZB 5A28A 4MCRA 2PR8A 3TO7A 1MJBA 2Q4VA 3KI9A 3I1UA 3GIUA 1YQEA 4XPKA 4C68A 4BINA 2B4BA 4KS9A 5A27A 1XRYA 3MRUA 3S9NA 1XMBA 1M4LA
chains in the Genus database with same CATH topology
4A31A 1S7LA 4B13A 2Q4YA 4CGOA 2QMLA 4R3KA 4MBUA 3W6XA 4QUSA 4R9MA 5CNPA 3FIXA 4CAEA 4Q38A 4CAWA 2VEZA 2FXFA 4J3GA 5JQ4A 2CNSA 3F8KA 4B11A 2D4OA 1XF8A 2BL1A 4HNXB 1CJWA 4KVXA 3CXPA 5I0CA 4A30A 2J8NA 1Z4RA 3V8IA 2WPWA 4ZBGA 3TFYA 4QBJA 3FXTA 4NEXA 2FT0A 3B8GA 4C7IA 4KLWA 3I9SA 2F5IA 4YRHA 4MI4A 4RI1A 2DXQA 4F0XA 4HNWB 2FE7A 4JD6A 2G0BA 4B14A 4KUAA 4F0YA 2B4DA 3MGDA 4KOYA 4NXYA 3S6GA 3DDDA 2VXKA 5HMNA 1NSLA 2J8RA 4ZGYB 3EXNA 4IUSA 4R57A 3D2PA 3IWGA 1YGHA 4L89A 3H4QA 3R96A 5KTDA 4OADA 3CXQA 1Q2CA 4UBRA 4PSWA 1QSMA 1L0CA 3IGRA 4CRYB 2R8VA 5G22A 1XIXA 3G8WA 1BO4A 4QC6A 2KCWA 2RC4A 3ZJ0A 2Z3OA 3EO4A 3UY5A 1PUAA 2CXAA 2D4PA 3D3SA 4CAXA 2Q7BA 3FYNA 2OB0A 2OZHA 3OWCA 2ZW4A 1TIQA 5J8FA 4R3LA 3GYAA 3PP9A 3W6SA 4L8AA 1R57A 4RS2A 4MFKA 3DNSA 2OZUA 2I79A 2PQ8A 4HKFA 3C26A 4C2XA 4MY3A 4KORA 3D8PA 3GY9A 2EVNA 4OLLA 1S60A 4AB7A 2VZZA 1QSTA 1Q2DA 1I1DA 4A95A 2FL4A 4YFJA 4NF1A 2REEA 1M1DA 4NSQA 3TE4A 2JDDA 4B5PB 4UFXA 1WWZA 3RYOA 3TOAA 5KTAA 5HH1A 3R1KA 1NE9A 2FS5A 4C2YA 4KOWA 4GS4A 5H84A 4E0AA 2G3TA 2PR1A 5EBVA 2ATRA 4KOTA 3R95A 2ZPAA 4FD7A 2B3VA 2ARHA 3JVNA 2K5TA 4K30A 3T9YA 4F6AA 4A2ZA 1OZPA 2P0WA 2P6EA 4BBHA 4C68A 1CM0A 4Q36A 4XNHB 2B58A 4FD5A 2EUIA 1IICA 5F49A 4JLYA 4H6UA 4NCZA 2Y0MA 4JXRA 1YX0A 3DR8A 2FIAA 4LUAA 2CY2A 2AJ6A 3EC4A 1QSNA 2HQYA 4KZTA 4CAVA 3IU1A 2AE6A 1Y9WA 2PDOA 1J4JA 4EVYA 5EC4A 3A9LA 1S7NA 1V0CA 4E2AA 4Y49B 4U9ZA 1PU9A 3P2HA 2FIWA 2QECA 2YGWA 1YLEA 2O28A 1S3ZA 1YR0A 3QB8A 4MFZA 4XPDB 3CXSA 2YNEA 5IB0A 2NMTA 4M85A 4C2ZA 1MK4A 2FSRA 2CNTA 4CGPA 4UCPA 4U5YA 4H6ZA 3H5ZA 5AG6A 5IV0A 3TTHA 5G20A 3D2MA 3W91A 1XEBA 2BSWA 2ZW7A 2P6FA 2WSAA 3SHPA 3VWEA 5J8CA 1ON0A 4QB9A 4KOUA 2R98A 1M44A 4CGNA 1ZO0A 5E96A 5DWNA 3FNCA 3K9UA 2JLMA 2Z3MA 5AG7A 2OH1A 3PZJA 4C7HA 5AGEA 2C27A 1KUVA 4B10A 3I3GA 1LRZA 4X5KA 2Q0YA 1VKCA 2ZW6A 2HV2A 4KOVA 3SXOA 2B5GA 4UA3A 3FB3A 4CYOA 3GKRA 2Z3PA 1MJAA 1IYLA 1YK3A 1I21A 5F47A 3T90A 3TO6A 5C88A 2VQYA 2GIVA 2BEIA 4E8OA 4CS0B 2Z10A 3WR7A 1NMTA 1Y7RA 3E0KA 1M4GA 5F46A 3BJ7A 2I00A 1SQHA 4AVCA 3FBUA 4UWIA 1XE4A 3G3SA 2A4NA 2Z3KA 2ZW5A 1Z4EA 2REFA 4AVBA 2DPTA 1U6MA 5BWAB 4B5OA 2YNCA 1FY7A 3TCVA 1Y9KA 4AG9A 1KZFA 2JDCA 3R9FA 1IYKA 3R9GA 1Q2YA 2R7HA 1QSRA 2PRBA 3NE7A 1M4IA 3TOBA 2Z11A 5G21A 1QSOA 4CYQA 2QIRA 1YVKA 1WK4A 1XMTA 4KSFA 1P4NA 2CNMA 4PK2A 4KLVA 1KUXA 4MFQA 4FD4A 2PSWA 4UCMA 4PSXA 1BOBA 1KUYA 4B5PA 3SXNA 4AVAA 2P6GA 5KTCA 2J8MA 4UWJA 2IL4A 2BUEA 4MFJA 5AG5A 4CGMA 2GANA 4FD6A 5C82A 4JJXA 3EFAA 3FRMA 1IB1E 2DPSA 2VBQA 3BLNA 2B4DB 4JWPA 4XPLA 3JTKA 2WUUA 3TO9A 2Z3LA 1B87A 4KOXA 3DSBA 4HNYB 4CYNA 2R1IA 4QVTA 5IX3A 1B6BA 4CAFA 4KSAA 2YNCC 5DWMA 2Q44A 4UFVA 4MJ8A 3N7ZA 1RXTA 4KVOE 3KKWA 4MHDA 3JUWA 5G1ZA 3ZZIA 1P0HA 2ZXVA 3DR6A 3BJ8A 1YREA 1I12A 2JEVA 4MY0A 3EY5A 3S6FA 3LODA 4A33A 5F48A 5AG4A 4CGLA 1VHSA 5FVJA 5GCNA 5JPHA 3PGPA 4UCNA 3S6KA 3VWDA 4IF5A 3R9EA 3F5BA 2FCKA 1S7KA 1YVOA 4JXQA 2VZYA 4KUBA 2B5GB 2WPXA 3P2FA 4OAEA 4KVME 2H5MA 3F0AA 4LX9A 4H89A 2OZGA 4MFLA 2GE3A 3LD2A 4XNHC 4BMHA 2Z0ZA 2B3UA 4CYPA 1S7FA 4U9YA 4DNCA 2HUZA 1UFHA 1N71A 4KOSA 2PC1A 4R87A 1Z9UA 4ORFA 3TT2A 4M3SA 2Q04A 4B12A 4II9A 1M4DA 1K4JA 1GHEA 2OU2A 1MJ9A 5H86A 3QAHA 1IIDA 4UFWA 5ISVA 4Y49C 2X7BA 2VI7A 1S5KA 2G3AA 4MFPA 3IU2A 4PV6A 1RO5A 2Z3NA 4I49A 4YGOA 4AG7A 3S6HA 2YNDA 4A32A 4PK3A 4ONUA 4XPDC 4CRZB 3IWEA 5A28A 3TO7A 2PR8A 1MJBA 2Q4VA 4XPKA 2B4BA 4KS9A 5A27A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1S7L A;  2Q4Y A;  2QML A;  4R3K A;  4MBU A;  3W6X A;  4QUS A;  4R9M A;  5CNP A;  3FIX A;  4CAW A;  2VEZ A;  2FXF A;  4J3G A;  5JQ4 A;  2CNS A;  3F8K A;  2D4O A;  1XF8 A;  2BL1 A;  4HNX B;  1CJW A;  4KVX A;  3CXP A;  5I0C A;  2J8N A;  1Z4R A;  3V8I A;  2WPW A;  4ZBG A;  3TFY A;  4QBJ A;  3FXT A;  4NEX A;  2FT0 A;  3B8G A;  4KLW A;  3I9S A;  2F5I A;  4YRH A;  4MI4 A;  4RI1 A;  2DXQ A;  4HNW B;  2FE7 A;  4JD6 A;  2G0B A;  4KUA A;  4F0Y A;  2B4D A;  3MGD A;  4KOY A;  4NXY A;  3S6G A;  3DDD A;  2VXK A;  5HMN A;  1NSL A;  2J8R A;  3EXN A;  4IUS A;  4R57 A;  3D2P A;  3IWG A;  1YGH A;  4L89 A;  3H4Q A;  3R96 A;  5KTD A;  4OAD A;  3CXQ A;  1Q2C A;  4UBR A;  4PSW A;  1QSM A;  1L0C A;  3IGR A;  4CRY B;  2R8V A;  1XIX A;  3G8W A;  1BO4 A;  4QC6 A;  2KCW A;  2RC4 A;  3ZJ0 A;  3EO4 A;  3UY5 A;  1PUA A;  2D4P A;  3D3S A;  4CAX A;  2Q7B A;  3FYN A;  2OB0 A;  2OZH A;  3OWC A;  2ZW4 A;  1TIQ A;  5J8F A;  4R3L A;  3GYA A;  3PP9 A;  3W6S A;  4L8A A;  1R57 A;  4RS2 A;  3DNS A;  2OZU A;  2I79 A;  2PQ8 A;  4HKF A;  3C26 A;  4MY3 A;  4KOR A;  3D8P A;  3GY9 A;  2EVN A;  4OLL A;  1S60 A;  4AB7 A;  2VZZ A;  1QST A;  1Q2D A;  1I1D A;  2FL4 A;  4YFJ A;  4NF1 A;  2REE A;  1M1D A;  4NSQ A;  3TE4 A;  2JDD A;  4B5P B;  1WWZ A;  3RYO A;  3TOA A;  5KTA A;  5HH1 A;  3R1K A;  1NE9 A;  2FS5 A;  4KOW A;  4GS4 A;  5H84 A;  4E0A A;  2G3T A;  2PR1 A;  5EBV A;  2ATR A;  4KOT A;  3R95 A;  2ZPA A;  4FD7 A;  2B3V A;  2ARH A;  3JVN A;  2K5T A;  4K30 A;  3T9Y A;  4F6A A;  1OZP A;  2P0W A;  2P6E A;  1CM0 A;  4XNH B;  2B58 A;  4FD5 A;  2EUI A;  1IIC A;  5F49 A;  4JLY A;  4H6U A;  4NCZ A;  2Y0M A;  4JXR A;  1YX0 A;  3DR8 A;  2FIA A;  4LUA A;  2CY2 A;  2AJ6 A;  3EC4 A;  1QSN A;  2HQY A;  4KZT A;  4CAV A;  2AE6 A;  1Y9W A;  2PDO A;  1J4J A;  4EVY A;  5EC4 A;  1S7N A;  1V0C A;  4E2A A;  4Y49 B;  4U9Z A;  1PU9 A;  3P2H A;  2FIW A;  2QEC A;  1YLE A;  2O28 A;  1S3Z A;  1YR0 A;  3QB8 A;  4XPD B;  3CXS A;  5IB0 A;  2NMT A;  4M85 A;  1MK4 A;  2FSR A;  2CNT A;  4U5Y A;  4H6Z A;  5IV0 A;  3TTH A;  3D2M A;  3W91 A;  1XEB A;  2BSW A;  2ZW7 A;  2P6F A;  3SHP A;  3VWE A;  5J8C A;  1ON0 A;  4QB9 A;  4KOU A;  2R98 A;  1M44 A;  5E96 A;  5DWN A;  3FNC A;  3K9U A;  2JLM A;  2OH1 A;  3PZJ A;  2C27 A;  1KUV A;  3I3G A;  1LRZ A;  4X5K A;  2Q0Y A;  1VKC A;  2ZW6 A;  2HV2 A;  4KOV A;  3SXO A;  2B5G A;  4UA3 A;  3FB3 A;  3GKR A;  1MJA A;  1IYL A;  1YK3 A;  1I21 A;  5F47 A;  3T90 A;  3TO6 A;  5C88 A;  2VQY A;  2GIV A;  2BEI A;  4E8O A;  4CS0 B;  2Z10 A;  3WR7 A;  1NMT A;  1Y7R A;  3E0K A;  1M4G A;  5F46 A;  3BJ7 A;  2I00 A;  1SQH A;  4AVC A;  3FBU A;  4UWI A;  1XE4 A;  3G3S A;  2A4N A;  2ZW5 A;  1Z4E A;  2REF A;  4AVB A;  1U6M A;  4B5O A;  1FY7 A;  3TCV A;  1Y9K A;  4AG9 A;  1KZF A;  2JDC A;  3R9F A;  1IYK A;  3R9G A;  1Q2Y A;  2R7H A;  1QSR A;  2PRB A;  3NE7 A;  1M4I A;  3TOB A;  2Z11 A;  1QSO A;  2QIR A;  1YVK A;  1WK4 A;  1XMT A;  1P4N A;  2CNM A;  4PK2 A;  4KLV A;  1KUX A;  4FD4 A;  2PSW A;  4PSX A;  1BOB A;  1KUY A;  4B5P A;  3SXN A;  4AVA A;  2P6G A;  5KTC A;  2J8M A;  4UWJ A;  2IL4 A;  2BUE A;  2GAN A;  4FD6 A;  5C82 A;  4JJX A;  3EFA A;  3FRM A;  1IB1 E;  2VBQ A;  3BLN A;  2B4D B;  4JWP A;  4XPL A;  3TO9 A;  1B87 A;  4KOX A;  3DSB A;  4HNY B;  2R1I A;  4QVT A;  5IX3 A;  1B6B A;  5DWM A;  2Q44 A;  4MJ8 A;  3N7Z A;  1RXT A;  4KVO E;  3KKW A;  4MHD A;  3JUW A;  3ZZI A;  1P0H A;  2ZXV A;  3DR6 A;  3BJ8 A;  1YRE A;  1I12 A;  2JEV A;  4MY0 A;  3EY5 A;  3S6F A;  3LOD A;  5F48 A;  1VHS A;  5FVJ A;  5GCN A;  5JPH A;  3PGP A;  3S6K A;  3VWD A;  4IF5 A;  3R9E A;  3F5B A;  2FCK A;  1S7K A;  1YVO A;  4JXQ A;  2VZY A;  4KUB A;  2B5G B;  2WPX A;  3P2F A;  4OAE A;  4KVM E;  2H5M A;  3F0A A;  4LX9 A;  4H89 A;  2OZG A;  2GE3 A;  3LD2 A;  4XNH C;  4BMH A;  2Z0Z A;  2B3U A;  1S7F A;  4U9Y A;  4DNC A;  2HUZ A;  1UFH A;  1N71 A;  4KOS A;  2PC1 A;  4R87 A;  1Z9U A;  4ORF A;  3TT2 A;  4M3S A;  2Q04 A;  4II9 A;  1M4D A;  1K4J A;  1GHE A;  2OU2 A;  1MJ9 A;  5H86 A;  3QAH A;  1IID A;  5ISV A;  4Y49 C;  2X7B A;  2VI7 A;  1S5K A;  2G3A A;  4PV6 A;  1RO5 A;  4I49 A;  4YGO A;  4AG7 A;  3S6H A;  4PK3 A;  4ONU A;  4XPD C;  4CRZ B;  3TO7 A;  2PR8 A;  1MJB A;  2Q4V A;  4XPK A;  2B4B A; 
#chains in the Genus database with same CATH topology
 3IIB A;  4A31 A;  3PBB A;  1S7L A;  3SJG A;  3S9L A;  2EK8 A;  4B13 A;  2Q4Y A;  4CGO A;  2QML A;  4R3K A;  2AFS A;  2PJ8 A;  4MBU A;  3B3C A;  3W6X A;  4QUS A;  3BI0 A;  1Z8T A;  4R9M A;  5CNP A;  1ZG7 A;  3FIX A;  3FX6 A;  3H8E A;  3NA6 A;  4Q38 A;  5CPA A;  2PJ3 A;  4CAE A;  2VEZ A;  3BI1 A;  4CAW A;  2FXF A;  4M6H A;  5LRG A;  1F2P A;  2ZEN A;  3KZW A;  3CPX A;  4J3G A;  5JQ4 A;  2CNS A;  3F8K A;  2GU2 A;  2AFZ A;  3KR5 A;  4B11 A;  2D4O A;  1XF8 A;  2BL1 A;  4HNX B;  1CJW A;  4KVX A;  3CXP A;  5I0C A;  1R43 A;  4A30 A;  2J8N A;  4MCQ A;  3V7Z A;  1Z4R A;  2PJ2 A;  2JEW A;  3V8I A;  2WPW A;  4ZBG A;  5F09 A;  3TFY A;  3VAR A;  4A37 A;  4QBJ A;  3FXT A;  4NEX A;  4OP4 A;  2FT0 A;  2F7V A;  3FMC A;  3ISZ A;  2Q7S A;  5EMI A;  2EBJ A;  2ZOG A;  3B8G A;  2NSM A;  4C7I A;  2IMO A;  3KQZ A;  4KLW A;  4W9Y A;  3I9S A;  2F5I A;  5LYD A;  3SJF A;  4YRH A;  1BPN A;  3SI0 A;  3VH9 A;  2AFU A;  4MI4 A;  4R7M A;  4RI1 A;  2DXQ A;  3FH4 A;  4ONW A;  4HNW B;  4F0X A;  5HVH A;  3GLJ A;  2FE7 A;  4JD6 A;  2QVP A;  2G0B A;  5D8N A;  4B14 A;  4KUA A;  1ARL A;  4F0Y A;  3KHZ A;  4Z65 A;  4X3R A;  2B4D A;  4ZX8 A;  1JWQ A;  2FVG A;  3MGD A;  4KOY A;  1R3N A;  1YSJ A;  4NXY A;  2PIY A;  1LAN A;  3S6G A;  3DDD A;  3ISX A;  2VXK A;  5HMN A;  2JBJ A;  1NSL A;  2J8R A;  4ZGY B;  4MXU A;  3EXN A;  3H8G A;  4IUS A;  4R57 A;  3D2P A;  4HPS A;  3GUX A;  4Q36 A;  3IWG A;  5LRJ A;  3B3W A;  2WYR A;  2ZEM A;  1ELM P;  1IOI A;  2IQ6 A;  2EK9 A;  4MRI A;  1YGH A;  4L89 A;  3H4Q A;  3R96 A;  3RZA A;  2ZEE A;  4OAD A;  5KTD A;  3CXQ A;  1Q2C A;  5JH9 A;  1ELL P;  4UBR A;  4PSW A;  1Z8L A;  1QSM A;  3K9T A;  4PQA A;  1L0C A;  3IGR A;  3FEE A;  5IB9 A;  2VL1 A;  4CRY B;  2R8V A;  5G22 A;  1XIX A;  3G8W A;  1YW4 A;  1BO4 A;  4QC6 A;  2KCW A;  1H8L A;  1AYE A;  2PIZ A;  2RC4 A;  1BLL E;  3ZJ0 A;  1QMU A;  2Z3O A;  4UEE A;  4OC5 A;  3EO4 A;  1LAP A;  1CPS A;  2C6G A;  3NE8 A;  4FWU A;  3UY5 A;  1TF9 A;  1PUA A;  2CF4 A;  2CXA A;  2D4P A;  3D3S A;  4UEZ A;  4CAX A;  4F8Z A;  2Q7B A;  3FYN A;  2PJ9 A;  2OB0 A;  2OZH A;  3OWC A;  1IGB A;  2ZW4 A;  3B3S A;  4R6T A;  2PJC A;  2BCO A;  3WT4 A;  2V8G A;  5LRK A;  1TIQ A;  4M6I A;  5ELY A;  3SI1 A;  5J8F A;  4R3L A;  1EE3 P;  3GYA A;  4A94 A;  3N5F A;  3PP9 A;  3W6S A;  4L8A A;  1R57 A;  4RS2 A;  4MFK A;  3DNS A;  2OZU A;  2RB7 A;  2I79 A;  2PQ8 A;  2XEG A;  3C26 A;  4HKF A;  4C2X A;  2Q4Z A;  4MY3 A;  4KOR A;  3D8P A;  3GY9 A;  2EVN A;  1Q7L A;  3D4U A;  4OLL A;  1S60 A;  4AB7 A;  3D7D A;  4DUK A;  2VZZ A;  1QST A;  1YLO A;  2O4H A;  4MHP A;  5HVG A;  1Q2D A;  1I1D A;  4A95 A;  2FL4 A;  1CP6 A;  1DE4 C;  3SJE A;  4YFJ A;  4LQ6 A;  2DEA A;  3IEH A;  4NF1 A;  4Q7A A;  2REE A;  1OBR A;  4OC4 A;  1M1D A;  4NSQ A;  4EME A;  3TE4 A;  2JDD A;  2CTB A;  4NGS A;  2BOA A;  3FF3 A;  4B5P B;  1Y0Y A;  2I3C A;  4UFX A;  1WWZ A;  1F2O A;  3RYO A;  4TNU A;  3TOA A;  5KTA A;  5HH1 A;  4NGM A;  3R1K A;  1NE9 A;  1IU8 A;  2FS5 A;  4C2Y A;  4KOW A;  4GS4 A;  5H84 A;  4E0A A;  2AFX A;  2G3T A;  2PR1 A;  5EBV A;  2ATR A;  4OIW A;  4FBE A;  5K8N A;  2QYV A;  2PJ5 A;  4NGN A;  4JZ0 A;  4KOT A;  3R95 A;  2ZPA A;  4FD7 A;  3WC5 A;  2B3V A;  2ARH A;  3PEI A;  3JVN A;  2K5T A;  2PJ4 A;  4K30 A;  3T9Y A;  4F6A A;  1BPM A;  4A2Z A;  1OZP A;  2P0W A;  3RO0 A;  2P6E A;  4BBH A;  1CP7 A;  2J9A A;  3LMS A;  4TWE A;  1CM0 A;  1LCP A;  1Z8X A;  2IJZ A;  2PJA A;  1XBU A;  2B58 A;  3KL9 A;  3NH8 A;  4FD5 A;  2EUI A;  1IIC A;  4DJL A;  1PYT B;  5F49 A;  2EWB A;  4JLY A;  1IOF A;  4H6U A;  4NCZ A;  4PXD A;  2Y0M A;  4JXR A;  1CBX A;  3KQX A;  1YX0 A;  3DR8 A;  2FIA A;  1VIX A;  4LUA A;  1HEE A;  2CY2 A;  4X2T A;  1TF8 A;  5LYI A;  2AJ6 A;  2PJ0 A;  2Q51 A;  3CDX A;  1QSN A;  3EC4 A;  2HQY A;  4KZT A;  3FVL A;  4CAV A;  4EWT A;  1KWM A;  3IU1 A;  2AE6 A;  1Y9W A;  2EO8 A;  2PDO A;  1J4J A;  1TXR A;  2V8D A;  3KAS A;  4EVY A;  4X8I A;  1AMP A;  5EC4 A;  3A9L A;  1S7N A;  1VHO A;  1V0C A;  4E2A A;  4OC3 A;  4Y49 B;  4U9Z A;  1PU9 A;  1NSA A;  4P4B A;  3P2H A;  4FAI A;  3S9M A;  2XEJ A;  2FIW A;  2QEC A;  2ZEL A;  1FNO A;  2YGW A;  1Z2L A;  4EFD A;  1YLE A;  2O28 A;  1S3Z A;  1YR0 A;  3QB8 A;  4MFZ A;  4XPD B;  3CXS A;  2YNE A;  5IB0 A;  1XJO A;  2NMT A;  4M85 A;  2CIJ A;  5K8P A;  3KGQ A;  4XNH B;  4C2Z A;  2PJ7 A;  1MK4 A;  2O53 A;  2FSR A;  1JQG A;  2CNT A;  4P4D A;  4UCP A;  4R76 A;  2ZOF A;  4YWY A;  4CGP A;  4U5Y A;  1Y0R A;  2C6P A;  4H6Z A;  3H5Z A;  2PVW A;  5AG6 A;  2C1C A;  5IV0 A;  1CG2 A;  3TTH A;  5G20 A;  3D2M A;  3W91 A;  3PBE A;  1X12 A;  1XEB A;  1ZG9 A;  2BSW A;  3D7G A;  2ZW7 A;  3PFE A;  2P6F A;  2WSA A;  4F9V A;  3SHP A;  3VWE A;  5DS0 A;  5J8C A;  1ON0 A;  4QB9 A;  4A39 A;  4WWV A;  4UIB A;  4GXH A;  5HVF A;  2V8H A;  2GLF A;  4KOU A;  4ZI6 A;  2R98 A;  1M44 A;  3IC1 A;  4CGN A;  1ZO0 A;  5E96 A;  5DWN A;  4KSI A;  3FNC A;  3K9U A;  2JLM A;  2PE3 A;  2Q43 A;  3HUV A;  4A38 A;  2Z3M A;  8CPA A;  1Z8W A;  2QJ8 A;  5AG7 A;  1Y7E A;  2OH1 A;  3PZJ A;  4C7H A;  4OC2 A;  5AGE A;  2C27 A;  1KUV A;  4F9U A;  3KR4 A;  4B10 A;  2XEI A;  4BD9 A;  3I3G A;  1LRZ A;  4OC0 A;  3IJ3 A;  4UF4 A;  4X5K A;  2Q0Y A;  2BO9 A;  1Z5R A;  2WZN A;  1VKC A;  2ZW6 A;  2CTC A;  2HV2 A;  4KOV A;  7CPA A;  1YW6 A;  3SXO A;  2B5G A;  4UA3 A;  3FB3 A;  3PFO A;  3WAB A;  4OKO A;  4CYO A;  1LAM A;  2V8V A;  3GKR A;  2Z3P A;  1MJA A;  1IYL A;  1YK3 A;  4JYW A;  4OID A;  1I21 A;  5F47 A;  4MMO A;  4P4I A;  3T90 A;  2VQY A;  3TO6 A;  5C88 A;  4UIA A;  2GIV A;  2BEI A;  3D7F A;  4ZY0 A;  4E8O A;  4CS0 B;  2Z10 A;  4PXB A;  3WR7 A;  1NMT A;  1Y7R A;  3E0K A;  1M4G A;  5F46 A;  3BJ7 A;  1TKJ A;  2I00 A;  3PB7 X;  3QNV A;  3V38 A;  3QAY A;  1SQH A;  4R8F A;  4AVC A;  3DGV A;  3FBU A;  3NH4 A;  4P10 A;  4UWI A;  1XE4 A;  3G3S A;  2A4N A;  3BXM A;  2Z3K A;  2ZW5 A;  2PVV A;  1TKH A;  1Z4E A;  2REF A;  4FUU A;  4AVB A;  2DPT A;  1U6M A;  3VAT A;  5HXD A;  1ARM A;  3FEC A;  4O23 A;  5BWA B;  2PJ6 A;  2YNC A;  1FY7 A;  4B5O A;  4RN7 A;  3TCV A;  4H2K A;  1Y9K A;  4AG9 A;  1KZF A;  2JDC A;  3FJU A;  3R9F A;  1IYK A;  3R9G A;  1Q2Y A;  2V77 A;  2R7H A;  1QSR A;  2PRB A;  3NE7 A;  4MHN A;  1M4I A;  3TOB A;  2Z11 A;  3TC8 A;  5G21 A;  1QSO A;  3RNZ A;  4CYQ A;  4NJQ A;  2QIR A;  2DF5 A;  4P4J A;  5LYL A;  1YVK A;  1QQ9 A;  1WK4 A;  1XMT A;  4KSF A;  1P4N A;  4YU9 A;  2CNM A;  4PK2 A;  4KLV A;  3PRT A;  5K8O A;  1FT7 A;  1KUX A;  4MFQ A;  4FD4 A;  4DNC A;  2PSW A;  4UCM A;  3K2K A;  4PSX A;  4PPZ A;  1BOB A;  1KUY A;  1LFW A;  4NFR A;  4B5P A;  3SXN A;  4AVA A;  2P6G A;  5KTC A;  3LWU A;  5JM6 A;  2J8M A;  1HDU A;  4UWJ A;  2IL4 A;  2GRE A;  2BUE A;  4MFJ A;  5AG5 A;  3T8W A;  5LYF A;  4CGM A;  2GAN A;  4RUH A;  4FD6 A;  5C82 A;  3D67 A;  4JJX A;  3EFA A;  3FRM A;  1BAV A;  1IB1 E;  4OC1 A;  3WC6 A;  2DPS A;  1XFO A;  3LAC A;  3NFZ A;  2VBQ A;  3B3V A;  3BLN A;  2B4D B;  4JWP A;  3CPA A;  3JTK A;  4XPL A;  2HC9 A;  1VHE A;  2WUU A;  1VGY A;  3TO9 A;  2Z3L A;  1B87 A;  4WJB A;  1X10 A;  3B3T A;  4KOX A;  3DSB A;  2ANP A;  4HNY B;  4CYN A;  3CZX A;  3D7H A;  2R1I A;  3HLP A;  2GFQ A;  2ZEP A;  4QVT A;  5IX3 A;  1B6B A;  5J1Q A;  3D68 A;  2F8H A;  4MHY A;  3JRU A;  4NGR A;  4CAF A;  4PXC A;  3B2Y A;  4KSA A;  2YNC C;  3PB4 X;  5DWM A;  4ZY1 A;  3NH5 A;  1F57 A;  5K8M A;  1XOV A;  2Q44 A;  2HB6 A;  4UFV A;  4MJ8 A;  3N7Z A;  1RXT A;  4KVO E;  3KKW A;  4MHD A;  1YME A;  4OME A;  4DYO A;  1GYT A;  3JUW A;  5G1Z A;  3ZZI A;  1ZLI A;  1P0H A;  2ZXV A;  4CPA A;  3DR6 A;  3BJ8 A;  1PCA A;  2PJ1 A;  1YRE A;  2AFM A;  1I12 A;  1AUG A;  2JEV A;  3PB6 X;  4MY0 A;  3EY5 A;  3S6F A;  4NJR A;  3CT9 A;  4NGP A;  3LOD A;  1IY7 A;  4A33 A;  3PB8 X;  3IWW A;  3PB9 X;  1CX8 A;  5F48 A;  5AG4 A;  4CGL A;  1LOK A;  2ZEF A;  1VHS A;  5JGF A;  5FVJ A;  5GCN A;  3GB0 A;  5JPH A;  3PGP A;  4K3N A;  2ABZ A;  4IAV A;  3KHX A;  4UCN A;  4PXE A;  3S6K A;  3VWD A;  2ODF A;  2ZEH A;  4IF5 A;  3R9E A;  4MCS A;  2NYQ A;  2OR4 A;  3F5B A;  3B7I A;  2POK A;  3RAM A;  2FCK A;  2PRQ A;  4NGT A;  2AFO A;  1ZLH A;  1S7K A;  1TKF A;  1YVO A;  3SI2 A;  4JXQ A;  2VZY A;  2XEF A;  4UEF A;  4KUB A;  3DLJ A;  2B5G B;  2WPX A;  3P2F A;  4B6Z A;  4P4F A;  5D29 A;  4OAE A;  1RTQ A;  4KVM E;  2H5M A;  3F0A A;  2JBK A;  4LX9 A;  4H89 A;  2GLJ A;  3BHX A;  5CBM A;  5I4M A;  4IHM A;  2OZG A;  4P44 A;  3B35 A;  4MFL A;  2GE3 A;  6CPA A;  3L2N A;  4AXV A;  2G9D A;  3LD2 A;  4XNH C;  3RBU A;  4BMH A;  2Z0Z A;  2B3U A;  4CYP A;  1DTD A;  1S7F A;  4U9Y A;  3FED A;  4M6G A;  2AFW A;  2HUZ A;  4LQG A;  3WC7 A;  1UFH A;  1N71 A;  4KOS A;  4ZY2 A;  2PC1 A;  4G1P A;  2PJB A;  1Z9U A;  4R87 A;  4ORF A;  3TT2 A;  4M3S A;  2Q04 A;  4B12 A;  1UWY A;  4GM5 A;  2ZEO A;  1M4D A;  2C6C A;  1K4J A;  3MN8 A;  4II9 A;  3IFE A;  4MHZ A;  1GHE A;  1HDQ A;  2OU2 A;  1ZG8 A;  2ZED A;  1MJ9 A;  5THW A;  3SJX A;  3IO1 A;  5H86 A;  2RFH A;  3QAH A;  1IID A;  4P6Y A;  3TX8 A;  4ZX9 A;  4P45 A;  4UFW A;  5ISV A;  4Y49 C;  2X7B A;  1A2Z A;  2ZEG A;  2VI7 A;  1S5K A;  2G3A A;  4MFP A;  3IU2 A;  3H8F A;  4PV6 A;  1RO5 A;  2Z3N A;  4I49 A;  2OOT A;  4P4E A;  2PCU A;  4YGO A;  4AG7 A;  3S6H A;  2YND A;  4IK2 A;  4NGQ A;  1CPX A;  4PK3 A;  4A32 A;  4MCP A;  4ZYQ A;  4ONU A;  4XPD C;  3D66 A;  3IWE A;  4CRZ B;  5A28 A;  4MCR A;  2PR8 A;  3TO7 A;  1MJB A;  2Q4V A;  3KI9 A;  3I1U A;  3GIU A;  1YQE A;  4XPK A;  4C68 A;  4BIN A;  2B4B A;  4KS9 A;  5A27 A;  1XRY A;  3MRU A;  3S9N A;  1XMB A;  1M4L A; 
#chains in the Genus database with same CATH homology
 4A31 A;  1S7L A;  4B13 A;  2Q4Y A;  4CGO A;  2QML A;  4R3K A;  4MBU A;  3W6X A;  4QUS A;  4R9M A;  5CNP A;  3FIX A;  4CAE A;  4Q38 A;  4CAW A;  2VEZ A;  2FXF A;  4J3G A;  5JQ4 A;  2CNS A;  3F8K A;  4B11 A;  2D4O A;  1XF8 A;  2BL1 A;  4HNX B;  1CJW A;  4KVX A;  3CXP A;  5I0C A;  4A30 A;  2J8N A;  1Z4R A;  3V8I A;  2WPW A;  4ZBG A;  3TFY A;  4QBJ A;  3FXT A;  4NEX A;  2FT0 A;  3B8G A;  4C7I A;  4KLW A;  3I9S A;  2F5I A;  4YRH A;  4MI4 A;  4RI1 A;  2DXQ A;  4F0X A;  4HNW B;  2FE7 A;  4JD6 A;  2G0B A;  4B14 A;  4KUA A;  4F0Y A;  2B4D A;  3MGD A;  4KOY A;  4NXY A;  3S6G A;  3DDD A;  2VXK A;  5HMN A;  1NSL A;  2J8R A;  4ZGY B;  3EXN A;  4IUS A;  4R57 A;  3D2P A;  3IWG A;  1YGH A;  4L89 A;  3H4Q A;  3R96 A;  5KTD A;  4OAD A;  3CXQ A;  1Q2C A;  4UBR A;  4PSW A;  1QSM A;  1L0C A;  3IGR A;  4CRY B;  2R8V A;  5G22 A;  1XIX A;  3G8W A;  1BO4 A;  4QC6 A;  2KCW A;  2RC4 A;  3ZJ0 A;  2Z3O A;  3EO4 A;  3UY5 A;  1PUA A;  2CXA A;  2D4P A;  3D3S A;  4CAX A;  2Q7B A;  3FYN A;  2OB0 A;  2OZH A;  3OWC A;  2ZW4 A;  1TIQ A;  5J8F A;  4R3L A;  3GYA A;  3PP9 A;  3W6S A;  4L8A A;  1R57 A;  4RS2 A;  4MFK A;  3DNS A;  2OZU A;  2I79 A;  2PQ8 A;  4HKF A;  3C26 A;  4C2X A;  4MY3 A;  4KOR A;  3D8P A;  3GY9 A;  2EVN A;  4OLL A;  1S60 A;  4AB7 A;  2VZZ A;  1QST A;  1Q2D A;  1I1D A;  4A95 A;  2FL4 A;  4YFJ A;  4NF1 A;  2REE A;  1M1D A;  4NSQ A;  3TE4 A;  2JDD A;  4B5P B;  4UFX A;  1WWZ A;  3RYO A;  3TOA A;  5KTA A;  5HH1 A;  3R1K A;  1NE9 A;  2FS5 A;  4C2Y A;  4KOW A;  4GS4 A;  5H84 A;  4E0A A;  2G3T A;  2PR1 A;  5EBV A;  2ATR A;  4KOT A;  3R95 A;  2ZPA A;  4FD7 A;  2B3V A;  2ARH A;  3JVN A;  2K5T A;  4K30 A;  3T9Y A;  4F6A A;  4A2Z A;  1OZP A;  2P0W A;  2P6E A;  4BBH A;  4C68 A;  1CM0 A;  4Q36 A;  4XNH B;  2B58 A;  4FD5 A;  2EUI A;  1IIC A;  5F49 A;  4JLY A;  4H6U A;  4NCZ A;  2Y0M A;  4JXR A;  1YX0 A;  3DR8 A;  2FIA A;  4LUA A;  2CY2 A;  2AJ6 A;  3EC4 A;  1QSN A;  2HQY A;  4KZT A;  4CAV A;  3IU1 A;  2AE6 A;  1Y9W A;  2PDO A;  1J4J A;  4EVY A;  5EC4 A;  3A9L A;  1S7N A;  1V0C A;  4E2A A;  4Y49 B;  4U9Z A;  1PU9 A;  3P2H A;  2FIW A;  2QEC A;  2YGW A;  1YLE A;  2O28 A;  1S3Z A;  1YR0 A;  3QB8 A;  4MFZ A;  4XPD B;  3CXS A;  2YNE A;  5IB0 A;  2NMT A;  4M85 A;  4C2Z A;  1MK4 A;  2FSR A;  2CNT A;  4CGP A;  4UCP A;  4U5Y A;  4H6Z A;  3H5Z A;  5AG6 A;  5IV0 A;  3TTH A;  5G20 A;  3D2M A;  3W91 A;  1XEB A;  2BSW A;  2ZW7 A;  2P6F A;  2WSA A;  3SHP A;  3VWE A;  5J8C A;  1ON0 A;  4QB9 A;  4KOU A;  2R98 A;  1M44 A;  4CGN A;  1ZO0 A;  5E96 A;  5DWN A;  3FNC A;  3K9U A;  2JLM A;  2Z3M A;  5AG7 A;  2OH1 A;  3PZJ A;  4C7H A;  5AGE A;  2C27 A;  1KUV A;  4B10 A;  3I3G A;  1LRZ A;  4X5K A;  2Q0Y A;  1VKC A;  2ZW6 A;  2HV2 A;  4KOV A;  3SXO A;  2B5G A;  4UA3 A;  3FB3 A;  4CYO A;  3GKR A;  2Z3P A;  1MJA A;  1IYL A;  1YK3 A;  1I21 A;  5F47 A;  3T90 A;  3TO6 A;  5C88 A;  2VQY A;  2GIV A;  2BEI A;  4E8O A;  4CS0 B;  2Z10 A;  3WR7 A;  1NMT A;  1Y7R A;  3E0K A;  1M4G A;  5F46 A;  3BJ7 A;  2I00 A;  1SQH A;  4AVC A;  3FBU A;  4UWI A;  1XE4 A;  3G3S A;  2A4N A;  2Z3K A;  2ZW5 A;  1Z4E A;  2REF A;  4AVB A;  2DPT A;  1U6M A;  5BWA B;  4B5O A;  2YNC A;  1FY7 A;  3TCV A;  1Y9K A;  4AG9 A;  1KZF A;  2JDC A;  3R9F A;  1IYK A;  3R9G A;  1Q2Y A;  2R7H A;  1QSR A;  2PRB A;  3NE7 A;  1M4I A;  3TOB A;  2Z11 A;  5G21 A;  1QSO A;  4CYQ A;  2QIR A;  1YVK A;  1WK4 A;  1XMT A;  4KSF A;  1P4N A;  2CNM A;  4PK2 A;  4KLV A;  1KUX A;  4MFQ A;  4FD4 A;  2PSW A;  4UCM A;  4PSX A;  1BOB A;  1KUY A;  4B5P A;  3SXN A;  4AVA A;  2P6G A;  5KTC A;  2J8M A;  4UWJ A;  2IL4 A;  2BUE A;  4MFJ A;  5AG5 A;  4CGM A;  2GAN A;  4FD6 A;  5C82 A;  4JJX A;  3EFA A;  3FRM A;  1IB1 E;  2DPS A;  2VBQ A;  3BLN A;  2B4D B;  4JWP A;  4XPL A;  3JTK A;  2WUU A;  3TO9 A;  2Z3L A;  1B87 A;  4KOX A;  3DSB A;  4HNY B;  4CYN A;  2R1I A;  4QVT A;  5IX3 A;  1B6B A;  4CAF A;  4KSA A;  2YNC C;  5DWM A;  2Q44 A;  4UFV A;  4MJ8 A;  3N7Z A;  1RXT A;  4KVO E;  3KKW A;  4MHD A;  3JUW A;  5G1Z A;  3ZZI A;  1P0H A;  2ZXV A;  3DR6 A;  3BJ8 A;  1YRE A;  1I12 A;  2JEV A;  4MY0 A;  3EY5 A;  3S6F A;  3LOD A;  4A33 A;  5F48 A;  5AG4 A;  4CGL A;  1VHS A;  5FVJ A;  5GCN A;  5JPH A;  3PGP A;  4UCN A;  3S6K A;  3VWD A;  4IF5 A;  3R9E A;  3F5B A;  2FCK A;  1S7K A;  1YVO A;  4JXQ A;  2VZY A;  4KUB A;  2B5G B;  2WPX A;  3P2F A;  4OAE A;  4KVM E;  2H5M A;  3F0A A;  4LX9 A;  4H89 A;  2OZG A;  4MFL A;  2GE3 A;  3LD2 A;  4XNH C;  4BMH A;  2Z0Z A;  2B3U A;  4CYP A;  1S7F A;  4U9Y A;  4DNC A;  2HUZ A;  1UFH A;  1N71 A;  4KOS A;  2PC1 A;  4R87 A;  1Z9U A;  4ORF A;  3TT2 A;  4M3S A;  2Q04 A;  4B12 A;  4II9 A;  1M4D A;  1K4J A;  1GHE A;  2OU2 A;  1MJ9 A;  5H86 A;  3QAH A;  1IID A;  4UFW A;  5ISV A;  4Y49 C;  2X7B A;  2VI7 A;  1S5K A;  2G3A A;  4MFP A;  3IU2 A;  4PV6 A;  1RO5 A;  2Z3N A;  4I49 A;  4YGO A;  4AG7 A;  3S6H A;  2YND A;  4A32 A;  4PK3 A;  4ONU A;  4XPD C;  4CRZ B;  3IWE A;  5A28 A;  3TO7 A;  2PR8 A;  1MJB A;  2Q4V A;  4XPK A;  2B4B A;  4KS9 A;  5A27 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...