4IUSA

Gcn5-related n-acetyltransferase from kribbella flavida.
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
259
structure length
257
Chain Sequence
b'AMGIAARIASAQLQGLVRSRRQVVAGPLVGLLHDEDVWFLSRAVAAEPGVPFDPAEVPWALETIRKAFAAEDRWLSAELVEEANPGLAYVLVEHGMTIVSRPPLLAVEPGDLLVPEFPAGVTAAVVASAEEQEAANAIAGDAYETDASPFQPEPADGGAVLIRMDGVPVATAAWTAIADGVTEVAGVGTLHSHRRQGLGALATAYATQQAFEVGGATLAWLTPGDDGADRIYRRLGYEPKATAVHLGDPGGHLADLR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GCN5-related N-acetyltransferase
publication title GCN5-related N-acetyltransferase from Kribbella flavida.
rcsb
source organism Kribbella flavida
molecule tags Transferase
total genus 76
structure length 257
sequence length 259
ec nomenclature ec 2.3.1.128: Transferred entry: 2.3.1.267.
pdb deposition date 2013-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4iusA00
1MJBA 1Q2YA 3S6GA 3GY9A 3G8WA 3CXSA 1YVOA 4F6AA 5J8FA 1QSMA 4KOVA 2P0WA 4H6UA 4AG7A 3JUWA 4JXQA 3ZZIA 1M1DA 2OH1A 4XPKA 5EBVA 4UBRA 1LRZA 3FNCA 4RS2A 3W91A 2FIAA 2AE6A 3FB3A 4QVTA 1B6BA 5KTDA 4QBJA 3S6HA 4PK3A 4AVCA 1V0CA 1XE4A 2PC1A 4UA3A 4M85A 1K4JA 3DDDA 2H5MA 4KORA 2KCWA 2CNMA 3R9EA 2D4PA 4EVYA 4CAWA 4DNCA 4E8OA 2FS5A 5DWNA 1NSLA 4QC6A 4U5YA 3D2MA 3KKWA 4B5PB 2ZW6A 4UWIA 2J8NA 1SQHA 3WR7A 2R7HA 2C27A 4KLWA 5JPHA 3C26A 4CAVA 2Q0YA 2EUIA 2ZW7A 3DR6A 2P6EA 1B87A 2O28A 5F47A 3QB8A 2B4DB 3TCVA 1BOBA 4CRZB 5F49A 4KOSA 4U9YA 3TO7A 3R95A 4NEXA 3DNSA 3H4QA 4MBUA 4YFJA 3FIXA 2Z0ZA 1PU9A 4ORFA 1NMTA 2G3AA 3IGRA 2ZPAA 1KZFA 1FY7A 3FYNA 4R87A 4MY3A 2OZHA 2R8VA 3W6XA 3CXQA 2Q04A 4OLLA 4I49A 1OZPA 4BMHA 1IYLA 3TTHA 1VHSA 1S5KA 1YVKA 4CAXA 3BLNA 3F0AA 2CNTA 4NXYA 1XEBA 1QSNA 2ARHA 4LX9A 4FD4A 4YRHA 5JQ4A 1L0CA 1S7NA 2B58A 5GCNA 3D2PA 1I12A 5IX3A 2Z10A 5F48A 4HNXB 4JWPA 4NCZA 2RC4A 5I0CA 3SXNA 1R57A 4NF1A 4MJ8A 3EY5A 2P6GA 4MI4A 2ATRA 1ON0A 4JXRA 3RYOA 4KOUA 3TOBA 3F5BA 5C82A 2FL4A 2R1IA 4YGOA 2P6FA 1BO4A 4AVBA 2PRBA 1CM0A 3N7ZA 4MY0A 4AVAA 5F46A 2GANA 4JLYA 4PSXA 3LODA 4XPLA 4E2AA 2HQYA 3BJ8A 4JJXA 2OZUA 1N71A 2WPXA 2ZXVA 2R98A 2JDDA 5IV0A 4KOXA 4RI1A 4H6ZA 4F0YA 2PSWA 2VXKA 3PGPA 4U9ZA 1M4IA 3VWDA 1S7KA 4CS0B 1WK4A 2OU2A 1S7LA 2HUZA 4HKFA 1XIXA 2VZZA 2B3VA 2B3UA 3R1KA 3S6KA 3UY5A 2FIWA 4K30A 2D4OA 2VBQA 3OWCA 4NSQA 1P4NA 2BUEA 2QIRA 1MJ9A 3EFAA 2J8RA 2REEA 1XMTA 2JEVA 1J4JA 1IB1E 3GKRA 4KZTA 2B5GB 1CJWA 2JLMA 5H86A 1YREA 2CNSA 3K9UA 1M4DA 5EC4A 2Q44A 2HV2A 3E0KA 3I3GA 5FVJA 2G3TA 2FXFA 3JVNA 5E96A 2VZYA 5J8CA 2ZW4A 5HMNA 4FD5A 3LD2A 1Z4RA 3B8GA 2PDOA 3I9SA 4R3LA 3GYAA 1S60A 2PR1A 1PUAA 1KUYA 1QSRA 4KVOE 3QAHA 3T9YA 3PP9A 4OADA 4L8AA 1XF8A 3TO9A 2FSRA 2EVNA 3W6SA 1YR0A 2I00A 4KLVA 3SHPA 4QB9A 5DWMA 4II9A 2A4NA 4FD7A 4KUAA 1I21A 1UFHA 3FRMA 4CRYB 4E0AA 3PZJA 4HNWB 2FE7A 2F5IA 1YGHA 3D3SA 2QECA 1U6MA 1Y9KA 2AJ6A 2IL4A 4R9MA 2PQ8A 2Q7BA 5CNPA 4PV6A 3P2FA 2GIVA 2VEZA 3FXTA 3P2HA 2BSWA 3NE7A 2CY2A 3EXNA 2DXQA 5C88A 4HNYB 3EC4A 4AB7A 3R9FA 4KOYA 2FCKA 1QSOA 2JDCA 2REFA 2GE3A 2OZGA 4GS4A 1YLEA 1S3ZA 3ZJ0A 1RXTA 1GHEA 2NMTA 3T90A 1P0HA 1Q2DA 3DR8A 1MK4A 3TO6A 4KVXA 1I1DA 1Z9UA 2VI7A 4KVME 1Y7RA 5H84A 4KUBA 3R9GA 4QUSA 2PR8A 4B5PA 2J8MA 3R96A 1S7FA 2ZW5A 3TT2A 3BJ7A 2FT0A 5ISVA 4UWJA 4OAEA 2Y0MA 3F8KA 1IYKA 2G0BA 4LUAA 2Z11A 4ZBGA 3MGDA 4XPDB 1IICA 2B4DA 2VQYA 1TIQA 4XPDC 3DSBA 1KUXA 1M44A 2B4BA 1M4GA 3TOAA 5KTCA 4J3GA 4R57A 4B5OA 1Z4EA 3V8IA 2B5GA 1KUVA 2BEIA 3S6FA 1Y9WA 1IIDA 4M3SA 3FBUA 4AG9A 4PSWA 2WPWA 4IF5A 2QMLA 4PK2A 3EO4A 3D8PA 4XNHB 4Y49B 1Q2CA 4MHDA 4KOTA 2K5TA 4L89A 2OB0A 1YK3A 4KOWA 4ONUA 1MJAA 4XNHC 1NE9A 1VKCA 1YX0A 4Y49C 2Q4VA 3VWEA 4X5KA 2I79A 3G3SA 5IB0A 1WWZA 1RO5A 4FD6A 4H89A 4JD6A 2Q4YA 4IUSA 3CXPA 3SXOA 1QSTA 5HH1A 4R3KA 3TFYA 2X7BA 3TE4A 3IWGA 5KTAA 2BL1A
chains in the Genus database with same CATH superfamily
1MJBA 4DJLA 4IAVA 3FVLA 1YSJA 1Q2YA 3ISZA 4NGMA 3S6GA 3GY9A 2EK9A 2Z3LA 3G8WA 1ZG8A 4MFQA 2PJ2A 3CXSA 3KHZA 1X12A 1YVOA 2XEGA 4F6AA 5J8FA 8CPAA 1QSMA 4NGSA 2FVGA 4KOVA 2P0WA 4H6UA 4AG7A 2YNCC 3JUWA 4JXQA 3ZZIA 1M1DA 2XEFA 4Q7AA 2OH1A 4XPKA 2DPTA 3L2NA 3SJFA 5EBVA 4UBRA 1LRZA 2NSMA 2Q4ZA 4OC3A 3GLJA 4GM5A 3FNCA 4RS2A 4FUUA 2F8HA 3W91A 2FIAA 1IOIA 4MCQA 2AE6A 3FB3A 3RZAA 4QVTA 1B6BA 5KTDA 5LYDA 1CPSA 4QBJA 3S6HA 4PK3A 2YGWA 4AVCA 4RUHA 1V0CA 5IB9A 1XE4A 2PC1A 4UA3A 4PPZA 1CP6A 4M85A 2AFXA 1K4JA 1Y0YA 3DDDA 1YW4A 1AMPA 2H5MA 2PCUA 2EO8A 1XRYA 1BLLE 4KORA 2KCWA 3PB9X 2CNMA 3CDXA 3R9EA 2D4PA 1XOVA 4Q38A 4EVYA 4CAWA 4C68A 4DNCA 4E8OA 2FS5A 4ZYQA 4NJRA 2PJ5A 5DWNA 2PE3A 2IMOA 1NSLA 4QC6A 4PQAA 4U5YA 1XBUA 3B35A 3D2MA 4MFKA 3KKWA 3MN8A 1FNOA 4B5PB 2ZW6A 1LAMA 4UWIA 2J8NA 1SQHA 3WR7A 2R7HA 4ZY1A 2C27A 4KLWA 5JPHA 4A31A 1HEEA 1ZO0A 3C26A 4YU9A 4CAVA 2PJAA 2Q0YA 1DTDA 1JQGA 3BI1A 4CPAA 5G20A 4C2ZA 1Y7EA 2EUIA 2ZW7A 3DR6A 1GYTA 2P6EA 3RBUA 3IEHA 1B87A 2O28A 3D7FA 5CPAA 1ELMP 5F47A 1X10A 3QB8A 2B4DB 4M6GA 1ZLIA 3LACA 3TCVA 1BOBA 1YW6A 4CRZB 2EK8A 4EWTA 3FJUA 5F49A 4KOSA 4U9YA 3TO7A 2F7VA 3SI2A 4MFPA 3R95A 4B6ZA 4NEXA 3DLJA 3DNSA 1YMEA 4TWEA 2BOAA 2ZOGA 1HDUA 2ZEDA 2PIYA 2GLJA 3FIXA 3H4QA 2Z0ZA 4MBUA 4P6YA 4YFJA 1PU9A 4ORFA 2GU2A 1NMTA 4UF4A 2G3AA 3IGRA 3NFZA 2ZPAA 3IWEA 1KZFA 4B10A 4P45A 1FY7A 3FYNA 4R87A 4MY3A 1LFWA 1CP7A 4X2TA 1AYEA 2QYVA 2OZHA 2R8VA 2Z3MA 4KSAA 5HVFA 3W6XA 4A2ZA 3CXQA 2Q04A 4OLLA 4P4IA 4UCPA 4I49A 3PFEA 1OZPA 1EE3P 4PXDA 1IGBA 2ANPA 3KI9A 4X3RA 4C2YA 4KSFA 4DYOA 4FBEA 2AFUA 3H8EA 4BMHA 1IYLA 4P10A 3TTHA 2EWBA 1VHSA 4Z65A 3FEDA 4HPSA 3FF3A 5HVHA 3PEIA 1S5KA 2PRQA 1YVKA 2Z3NA 4CAXA 4IHMA 3BLNA 1YQEA 3JRUA 4R76A 3FECA 5G22A 3RAMA 3VARA 2IJZA 3F0AA 4IK2A 2CNTA 4CGPA 4NXYA 3I1UA 1UWYA 1XEBA 1QSNA 5D8NA 3D7DA 2ARHA 2C6CA 3IWWA 4PXBA 2WSAA 3BXMA 1CBXA 4LX9A 3D66A 2XEIA 4FD4A 3CZXA 4YRHA 4ZGYB 5JQ4A 1L0CA 2JBKA 4F9UA 3QAYA 4EMEA 4P44A 1S7NA 2B58A 3PB4X 5GCNA 5G1ZA 4OMEA 2AFSA 2OOTA 3D2PA 1F57A 2AFWA 4GXHA 4F9VA 1I12A 3PRTA 5IX3A 2PJBA 2Z10A 3PB7X 5F48A 2RFHA 4HNXB 4JWPA 4AXVA 3H8FA 4NCZA 2CXAA 2RC4A 2PJ0A 5I0CA 3SXNA 4OC1A 1R57A 2ZEMA 4NF1A 3DGVA 4MJ8A 5A28A 5HXDA 2PJ7A 3EY5A 2P6GA 4MI4A 2ATRA 1TKHA 1ON0A 4JXRA 3RYOA 4KOUA 3TOBA 3N5FA 5K8PA 3F5BA 5C82A 2ZEPA 2Z3OA 3B2YA 4MHYA 4R7MA 3WABA 3IU2A 2FL4A 4P4FA 2O4HA 2R1IA 4YGOA 5K8MA 2V8DA 2P6FA 1BO4A 1Z8XA 5AG7A 4AVBA 2PRBA 4B13A 1CM0A 3N7ZA 4MY0A 4AVAA 5F46A 4A33A 2GANA 4JLYA 1VGYA 5HVGA 3CT9A 4PSXA 3LODA 4XPLA 5K8OA 4E2AA 3IJ3A 4MFLA 2HQYA 3BJ8A 4JJXA 4ZI6A 4C2XA 2CIJA 4H2KA 4FAIA 4ZY2A 3B3TA 3SI0A 2OZUA 1N71A 1BPNA 4MFJA 4PXEA 2WPXA 2ZXVA 5AGEA 2R98A 2JDDA 1QMUA 5IV0A 4KOXA 4CYNA 3S9LA 3LMSA 1ARMA 4C7IA 4RI1A 4H6ZA 2CTCA 4K3NA 2PSWA 4F0YA 7CPAA 2VXKA 3PGPA 4A38A 2BCOA 4U9ZA 1M4IA 3VWDA 1S7KA 4F8ZA 4CS0B 1AUGA 1WK4A 3D7HA 3KGQA 2OU2A 4M6IA 1S7LA 3FH4A 2HUZA 4HKFA 4NGPA 4ZX8A 3B3VA 4MHPA 3KR5A 2ZEFA 3WT4A 1Z8TA 1XIXA 5JGFA 2HC9A 2VZZA 3IU1A 5A27A 4LQGA 4NGRA 3S9NA 3IO1A 2B3VA 4DUKA 2B3UA 2YNDA 3R1KA 5LYIA 3PB6X 3S6KA 3PBEA 3UY5A 4WJBA 1IY7A 2FIWA 2Q51A 4FWUA 2DF5A 3FX6A 4K30A 1A2ZA 2D4OA 4KSIA 2VBQA 2YNEA 1F2PA 3OWCA 4NSQA 4A95A 1Y0RA 3IC1A 5EMIA 4BINA 5I4MA 1P4NA 2BUEA 2C6PA 2QIRA 4P4BA 4C7HA 2AFOA 1MJ9A 3D68A 1TF8A 3EFAA 2J8RA 2REEA 1VHOA 2GLFA 3VATA 2V8GA 1XMTA 2JEVA 1J4JA 2C6GA 1IB1E 3GKRA 3H5ZA 4KZTA 2B5GB 1CJWA 2PJ8A 4UIBA 2JLMA 3A9LA 3NA6A 5H86A 3VH9A 4A30A 5J1QA 5G21A 1Z8LA 4OIWA 1YREA 2CNSA 4M6HA 5D29A 3K9UA 2CF4A 2ZEHA 4OC5A 1M4DA 5EC4A 1CPXA 2Q44A 2ZELA 1XJOA 2HV2A 3E0KA 4F0XA 3RO0A 3V7ZA 4CYPA 1RTQA 5AG6A 1TKFA 3I3GA 5FVJA 2G3TA 2FXFA 3IIBA 3JVNA 2VZYA 3CPXA 5E96A 5J8CA 4OIDA 2ZW4A 3KQZA 4OP4A 5HMNA 4FD5A 1JWQA 4TNUA 3LD2A 2C1CA 1Z4RA 3B8GA 3TX8A 2PDOA 3B3WA 3QNVA 4MHNA 4UEEA 4W9YA 3I9SA 3K2KA 3GIUA 4R3LA 1XFOA 4MHZA 2WZNA 3GYAA 1S60A 2PR1A 2ZOFA 1PUAA 4MRIA 4CYOA 1KUYA 1QSRA 5DS0A 4KVOE 2RB7A 1ARLA 3QAHA 4UCNA 3T9YA 5LYFA 3PP9A 4OADA 4L8AA 1KWMA 1XF8A 3S9MA 2FSRA 2EVNA 3SJXA 1M4LA 2XEJA 3TO9A 3W6SA 4CAFA 3BI0A 1IOFA 4B11A 2PJ3A 2QJ8A 4ZY0A 1YR0A 4UEFA 2I00A 2OR4A 1YLOA 4KLVA 3SHPA 4QB9A 5DWMA 4II9A 2PIZA 2A4NA 1QQ9A 4FD7A 4KUAA 4MCSA 2Q7SA 1I21A 2G9DA 4G1PA 4R8FA 3T8WA 2PVWA 1UFHA 2O53A 3FRMA 4CRYB 3PZJA 4HNWB 2FE7A 4MCRA 2F5IA 4E0AA 1YGHA 2Z3PA 2YNCA 4X8IA 2QVPA 3D3SA 3D7GA 2JBJA 2QECA 1U6MA 4ONWA 4WWVA 1Y9KA 1R43A 3KASA 3PBBA 2AJ6A 2IL4A 3PB8X 4R9MA 2PQ8A 2Q7BA 3NH5A 4UFWA 5CNPA 4BD9A 4PV6A 1R3NA 2EBJA 3P2FA 2GIVA 2VEZA 3HLPA 2I3CA 2ZEOA 3B3SA 3B7IA 3FXTA 2PJ4A 3P2HA 2BSWA 3NE7A 2NYQA 4LQ6A 2CY2A 3EXNA 2DXQA 3SJEA 5C88A 6CPAA 1VIXA 4HNYB 3JTKA 3EC4A 4AB7A 3R9FA 4Q36A 3WC5A 4KOYA 4CGMA 2WYRA 2FCKA 1QSOA 5CBMA 2JDCA 3IFEA 2REFA 2PVVA 3TC8A 2GE3A 4RN7A 2OZGA 4GS4A 1YLEA 3NH4A 4NGTA 1S3ZA 2ZENA 3WC6A 1RXTA 3ZJ0A 1GHEA 2NMTA 3T90A 4CGLA 1IU8A 1PYTB 1P0HA 1Z8WA 2JEWA 1Q2DA 3DR8A 3KHXA 4YWYA 1MK4A 3TO6A 3CPAA 2GREA 3D4UA 4PXCA 4KVXA 1I1DA 3LWUA 1Z9UA 2VI7A 4A32A 1NSAA 3H8GA 3KQXA 4KVME 3KR4A 1BPMA 1Y7RA 5H84A 4KUBA 1Q7LA 3R9GA 5THWA 4NGQA 1LOKA 5F09A 3RNZA 4P4DA 4QUSA 2PR8A 4B5PA 2VL1A 2J8MA 4MMOA 3R96A 1S7FA 2ZW5A 3TT2A 3BJ7A 2FT0A 3SJGA 2V77A 5ISVA 4UWJA 4OAEA 2Y0MA 4UFXA 1ZLHA 2Q43A 3F8KA 3NH8A 3HUVA 1IYKA 3GB0A 4JZ0A 2G0BA 5AG5A 1DE4C 5JH9A 4LUAA 4EFDA 2Z11A 3KZWA 4JYWA 4ZBGA 5AG4A 3MGDA 3K9TA 2DPSA 2ODFA 4XPDB 2PJ1A 4KS9A 1TF9A 4UFVA 1IICA 1Z5RA 3GUXA 5JM6A 3PFOA 2AFZA 1CG2A 2B4DA 2VQYA 2V8VA 2J9AA 1TIQA 4XPDC 5LRGA 5LYLA 3DSBA 2WUUA 1KUXA 1M44A 2B4BA 3NE8A 4UIAA 2POKA 4ZX9A 4BBHA 1CX8A 1OBRA 2ABZA 4CAEA 3ISXA 1LCPA 3FEEA 1M4GA 1FT7A 4UEZA 4UCMA 4J3GA 3TOAA 4CGNA 5KTCA 4R57A 4B5OA 4OC4A 3V38A 2PJ6A 4P4JA 1Z4EA 3V8IA 2Z3KA 2B5GA 1KUVA 1HDQA 2ZEEA 2BEIA 1ZG9A 4OKOA 5K8NA 3S6FA 2PJCA 2AFMA 2CTBA 2DEAA 5ELYA 1Y9WA 1IIDA 2V8HA 4M3SA 4B12A 3FBUA 2GFQA 4AG9A 4PSWA 2ZEGA 1PCAA 1Z2LA 1ELLP 2PJ9A 2QMLA 2WPWA 4IF5A 3D67A 4NFRA 4MXUA 3EO4A 4PK2A 1ZG7A 3D8PA 4OC0A 4XNHB 1LANA 4NJQA 4Y49B 1Q2CA 4O23A 4MHDA 4KOTA 2K5TA 1BAVA 4L89A 2OB0A 1YK3A 4KOWA 4OC2A 3WC7A 4ONUA 1MJAA 4XNHC 1NE9A 1VKCA 1YX0A 4Y49C 4P4EA 2HB6A 4B14A 2Q4VA 5LRJA 3VWEA 4X5KA 4CYQA 2I79A 3G3SA 5IB0A 1WWZA 1RO5A 4CGOA 1F2OA 4MFZA 3FMCA 1TKJA 3BHXA 4FD6A 4H89A 5BWAB 4JD6A 4A94A 2Q4YA 2IQ6A 2BO9A 3CXPA 4IUSA 4A39A 4MCPA 3SXOA 1QSTA 5HH1A 3KL9A 3B3CA 4R3KA 1TXRA 3TFYA 2X7BA 4R6TA 5LRKA 1VHEA 3SI1A 3TE4A 3MRUA 1XMBA 4NGNA 4A37A 1LAPA 3IWGA 5KTAA 2BL1A 1H8LA
chains in the Genus database with same CATH topology
1MJBA 1Q2YA 3S6GA 3GY9A 2Z3LA 3G8WA 4MFQA 3CXSA 1YVOA 4F6AA 5J8FA 1QSMA 4KOVA 2P0WA 4H6UA 4AG7A 2YNCC 3JUWA 4JXQA 3ZZIA 1M1DA 2OH1A 4XPKA 2DPTA 5EBVA 4UBRA 1LRZA 3FNCA 4RS2A 3W91A 2FIAA 2AE6A 3FB3A 4QVTA 1B6BA 5KTDA 4QBJA 3S6HA 4PK3A 2YGWA 4AVCA 1V0CA 1XE4A 2PC1A 4UA3A 4M85A 1K4JA 3DDDA 2H5MA 4KORA 2KCWA 2CNMA 3R9EA 2D4PA 4Q38A 4EVYA 4CAWA 4C68A 4DNCA 4E8OA 2FS5A 5DWNA 1NSLA 4QC6A 4U5YA 3D2MA 4MFKA 3KKWA 4B5PB 2ZW6A 4UWIA 2J8NA 1SQHA 3WR7A 2R7HA 2C27A 4KLWA 5JPHA 4A31A 1ZO0A 3C26A 4CAVA 2Q0YA 5G20A 4C2ZA 2EUIA 2ZW7A 3DR6A 2P6EA 1B87A 2O28A 5F47A 3QB8A 2B4DB 3TCVA 1BOBA 4CRZB 5F49A 4KOSA 4U9YA 3TO7A 4MFPA 3R95A 4NEXA 3DNSA 3H4QA 4MBUA 4YFJA 3FIXA 2Z0ZA 1PU9A 4ORFA 1NMTA 2G3AA 3IGRA 2ZPAA 3IWEA 1KZFA 4B10A 1FY7A 3FYNA 4R87A 4MY3A 2OZHA 2R8VA 2Z3MA 4KSAA 3W6XA 4A2ZA 3CXQA 2Q04A 4OLLA 4UCPA 4I49A 1OZPA 4C2YA 4KSFA 4BMHA 1IYLA 3TTHA 1VHSA 1S5KA 1YVKA 2Z3NA 4CAXA 3BLNA 5G22A 3F0AA 2CNTA 4CGPA 4NXYA 1XEBA 1QSNA 2ARHA 2WSAA 4LX9A 4FD4A 4YRHA 4ZGYB 5JQ4A 1L0CA 1S7NA 2B58A 5GCNA 5G1ZA 3D2PA 1I12A 5IX3A 2Z10A 5F48A 4HNXB 4JWPA 4NCZA 2CXAA 2RC4A 5I0CA 3SXNA 1R57A 4NF1A 5A28A 4MJ8A 3EY5A 2P6GA 4MI4A 2ATRA 1ON0A 4JXRA 3RYOA 4KOUA 3TOBA 3F5BA 5C82A 2Z3OA 3IU2A 2FL4A 2R1IA 4YGOA 2P6FA 1BO4A 5AG7A 4AVBA 2PRBA 4B13A 1CM0A 3N7ZA 4MY0A 4AVAA 5F46A 4A33A 2GANA 4JLYA 4PSXA 3LODA 4XPLA 4E2AA 4MFLA 2HQYA 3BJ8A 4JJXA 4C2XA 2OZUA 1N71A 4MFJA 2WPXA 2ZXVA 5AGEA 2R98A 2JDDA 5IV0A 4KOXA 4CYNA 4C7IA 4RI1A 4H6ZA 4F0YA 2PSWA 2VXKA 3PGPA 4U9ZA 1M4IA 3VWDA 1S7KA 4CS0B 1WK4A 2OU2A 1S7LA 2HUZA 4HKFA 1XIXA 2VZZA 3IU1A 5A27A 2B3VA 2B3UA 2YNDA 3R1KA 3S6KA 3UY5A 2FIWA 4K30A 2D4OA 2VBQA 2YNEA 3OWCA 4NSQA 4A95A 1P4NA 2BUEA 2QIRA 4C7HA 1MJ9A 3EFAA 2J8RA 2REEA 1XMTA 2JEVA 1J4JA 1IB1E 3GKRA 3H5ZA 4KZTA 2B5GB 1CJWA 2JLMA 3A9LA 5H86A 4A30A 5G21A 1YREA 2CNSA 3K9UA 1M4DA 5EC4A 2Q44A 2HV2A 3E0KA 4F0XA 4CYPA 5AG6A 3I3GA 5FVJA 2G3TA 2FXFA 3JVNA 5E96A 2VZYA 5J8CA 2ZW4A 5HMNA 4FD5A 3LD2A 1Z4RA 3B8GA 2PDOA 3I9SA 4R3LA 3GYAA 1S60A 2PR1A 1PUAA 4CYOA 1KUYA 1QSRA 4KVOE 3QAHA 4UCNA 3T9YA 3PP9A 4OADA 4L8AA 1XF8A 3TO9A 2FSRA 2EVNA 3W6SA 4CAFA 4B11A 1YR0A 2I00A 4KLVA 3SHPA 4QB9A 5DWMA 4II9A 2A4NA 4FD7A 4KUAA 1I21A 1UFHA 3FRMA 4CRYB 4E0AA 3PZJA 4HNWB 2FE7A 2F5IA 1YGHA 2Z3PA 2YNCA 3D3SA 2QECA 1U6MA 1Y9KA 2AJ6A 2IL4A 4R9MA 2PQ8A 2Q7BA 4UFWA 5CNPA 4PV6A 3P2FA 2GIVA 2VEZA 3FXTA 3P2HA 2BSWA 3NE7A 2CY2A 3EXNA 2DXQA 5C88A 4HNYB 3JTKA 3EC4A 4AB7A 3R9FA 4Q36A 4KOYA 4CGMA 2FCKA 1QSOA 2JDCA 2REFA 2GE3A 2OZGA 4GS4A 1YLEA 1S3ZA 3ZJ0A 1RXTA 1GHEA 2NMTA 3T90A 4CGLA 1P0HA 1Q2DA 3DR8A 1MK4A 3TO6A 4KVXA 1I1DA 1Z9UA 2VI7A 4A32A 4KVME 1Y7RA 5H84A 4KUBA 3R9GA 4QUSA 2PR8A 4B5PA 2J8MA 3R96A 1S7FA 2ZW5A 3TT2A 3BJ7A 2FT0A 5ISVA 4UWJA 4OAEA 2Y0MA 4UFXA 3F8KA 1IYKA 2G0BA 5AG5A 4LUAA 2Z11A 4ZBGA 5AG4A 3MGDA 2DPSA 4XPDB 4KS9A 4UFVA 1IICA 2B4DA 2VQYA 1TIQA 4XPDC 3DSBA 2WUUA 1KUXA 1M44A 2B4BA 4BBHA 4CAEA 1M4GA 4CGNA 3TOAA 4UCMA 4J3GA 5KTCA 4R57A 4B5OA 1Z4EA 3V8IA 2Z3KA 2B5GA 1KUVA 2BEIA 3S6FA 1Y9WA 1IIDA 4M3SA 4B12A 3FBUA 4AG9A 4PSWA 2WPWA 4IF5A 2QMLA 4PK2A 3EO4A 3D8PA 4XNHB 4Y49B 1Q2CA 4MHDA 4KOTA 2K5TA 4L89A 2OB0A 1YK3A 4KOWA 4ONUA 1MJAA 4XNHC 1NE9A 1VKCA 1YX0A 4Y49C 4B14A 2Q4VA 3VWEA 4X5KA 4CYQA 2I79A 3G3SA 5IB0A 1WWZA 1RO5A 4CGOA 4MFZA 4FD6A 4H89A 5BWAB 4JD6A 2Q4YA 4IUSA 3CXPA 3SXOA 1QSTA 5HH1A 4R3KA 3TFYA 2X7BA 3TE4A 3IWGA 5KTAA 2BL1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MJB A;  1Q2Y A;  3S6G A;  3GY9 A;  3G8W A;  3CXS A;  1YVO A;  4F6A A;  5J8F A;  1QSM A;  4KOV A;  2P0W A;  4H6U A;  4AG7 A;  3JUW A;  4JXQ A;  3ZZI A;  1M1D A;  2OH1 A;  4XPK A;  5EBV A;  4UBR A;  1LRZ A;  3FNC A;  4RS2 A;  3W91 A;  2FIA A;  2AE6 A;  3FB3 A;  4QVT A;  1B6B A;  5KTD A;  4QBJ A;  3S6H A;  4PK3 A;  4AVC A;  1V0C A;  1XE4 A;  2PC1 A;  4UA3 A;  4M85 A;  1K4J A;  3DDD A;  2H5M A;  4KOR A;  2KCW A;  2CNM A;  3R9E A;  2D4P A;  4EVY A;  4CAW A;  4DNC A;  4E8O A;  2FS5 A;  5DWN A;  1NSL A;  4QC6 A;  4U5Y A;  3D2M A;  3KKW A;  4B5P B;  2ZW6 A;  4UWI A;  2J8N A;  1SQH A;  3WR7 A;  2R7H A;  2C27 A;  4KLW A;  5JPH A;  3C26 A;  4CAV A;  2Q0Y A;  2EUI A;  2ZW7 A;  3DR6 A;  2P6E A;  1B87 A;  2O28 A;  5F47 A;  3QB8 A;  2B4D B;  3TCV A;  1BOB A;  4CRZ B;  5F49 A;  4KOS A;  4U9Y A;  3TO7 A;  3R95 A;  4NEX A;  3DNS A;  3H4Q A;  4MBU A;  4YFJ A;  3FIX A;  2Z0Z A;  1PU9 A;  4ORF A;  1NMT A;  2G3A A;  3IGR A;  2ZPA A;  1KZF A;  1FY7 A;  3FYN A;  4R87 A;  4MY3 A;  2OZH A;  2R8V A;  3W6X A;  3CXQ A;  2Q04 A;  4OLL A;  4I49 A;  1OZP A;  4BMH A;  1IYL A;  3TTH A;  1VHS A;  1S5K A;  1YVK A;  4CAX A;  3BLN A;  3F0A A;  2CNT A;  4NXY A;  1XEB A;  1QSN A;  2ARH A;  4LX9 A;  4FD4 A;  4YRH A;  5JQ4 A;  1L0C A;  1S7N A;  2B58 A;  5GCN A;  3D2P A;  1I12 A;  5IX3 A;  2Z10 A;  5F48 A;  4HNX B;  4JWP A;  4NCZ A;  2RC4 A;  5I0C A;  3SXN A;  1R57 A;  4NF1 A;  4MJ8 A;  3EY5 A;  2P6G A;  4MI4 A;  2ATR A;  1ON0 A;  4JXR A;  3RYO A;  4KOU A;  3TOB A;  3F5B A;  5C82 A;  2FL4 A;  2R1I A;  4YGO A;  2P6F A;  1BO4 A;  4AVB A;  2PRB A;  1CM0 A;  3N7Z A;  4MY0 A;  4AVA A;  5F46 A;  2GAN A;  4JLY A;  4PSX A;  3LOD A;  4XPL A;  4E2A A;  2HQY A;  3BJ8 A;  4JJX A;  2OZU A;  1N71 A;  2WPX A;  2ZXV A;  2R98 A;  2JDD A;  5IV0 A;  4KOX A;  4RI1 A;  4H6Z A;  4F0Y A;  2PSW A;  2VXK A;  3PGP A;  4U9Z A;  1M4I A;  3VWD A;  1S7K A;  4CS0 B;  1WK4 A;  2OU2 A;  1S7L A;  2HUZ A;  4HKF A;  1XIX A;  2VZZ A;  2B3V A;  2B3U A;  3R1K A;  3S6K A;  3UY5 A;  2FIW A;  4K30 A;  2D4O A;  2VBQ A;  3OWC A;  4NSQ A;  1P4N A;  2BUE A;  2QIR A;  1MJ9 A;  3EFA A;  2J8R A;  2REE A;  1XMT A;  2JEV A;  1J4J A;  1IB1 E;  3GKR A;  4KZT A;  2B5G B;  1CJW A;  2JLM A;  5H86 A;  1YRE A;  2CNS A;  3K9U A;  1M4D A;  5EC4 A;  2Q44 A;  2HV2 A;  3E0K A;  3I3G A;  5FVJ A;  2G3T A;  2FXF A;  3JVN A;  5E96 A;  2VZY A;  5J8C A;  2ZW4 A;  5HMN A;  4FD5 A;  3LD2 A;  1Z4R A;  3B8G A;  2PDO A;  3I9S A;  4R3L A;  3GYA A;  1S60 A;  2PR1 A;  1PUA A;  1KUY A;  1QSR A;  4KVO E;  3QAH A;  3T9Y A;  3PP9 A;  4OAD A;  4L8A A;  1XF8 A;  3TO9 A;  2FSR A;  2EVN A;  3W6S A;  1YR0 A;  2I00 A;  4KLV A;  3SHP A;  4QB9 A;  5DWM A;  4II9 A;  2A4N A;  4FD7 A;  4KUA A;  1I21 A;  1UFH A;  3FRM A;  4CRY B;  4E0A A;  3PZJ A;  4HNW B;  2FE7 A;  2F5I A;  1YGH A;  3D3S A;  2QEC A;  1U6M A;  1Y9K A;  2AJ6 A;  2IL4 A;  4R9M A;  2PQ8 A;  2Q7B A;  5CNP A;  4PV6 A;  3P2F A;  2GIV A;  2VEZ A;  3FXT A;  3P2H A;  2BSW A;  3NE7 A;  2CY2 A;  3EXN A;  2DXQ A;  5C88 A;  4HNY B;  3EC4 A;  4AB7 A;  3R9F A;  4KOY A;  2FCK A;  1QSO A;  2JDC A;  2REF A;  2GE3 A;  2OZG A;  4GS4 A;  1YLE A;  1S3Z A;  3ZJ0 A;  1RXT A;  1GHE A;  2NMT A;  3T90 A;  1P0H A;  1Q2D A;  3DR8 A;  1MK4 A;  3TO6 A;  4KVX A;  1I1D A;  1Z9U A;  2VI7 A;  4KVM E;  1Y7R A;  5H84 A;  4KUB A;  3R9G A;  4QUS A;  2PR8 A;  4B5P A;  2J8M A;  3R96 A;  1S7F A;  2ZW5 A;  3TT2 A;  3BJ7 A;  2FT0 A;  5ISV A;  4UWJ A;  4OAE A;  2Y0M A;  3F8K A;  1IYK A;  2G0B A;  4LUA A;  2Z11 A;  4ZBG A;  3MGD A;  4XPD B;  1IIC A;  2B4D A;  2VQY A;  1TIQ A;  4XPD C;  3DSB A;  1KUX A;  1M44 A;  2B4B A;  1M4G A;  3TOA A;  5KTC A;  4J3G A;  4R57 A;  4B5O A;  1Z4E A;  3V8I A;  2B5G A;  1KUV A;  2BEI A;  3S6F A;  1Y9W A;  1IID A;  4M3S A;  3FBU A;  4AG9 A;  4PSW A;  2WPW A;  4IF5 A;  2QML A;  4PK2 A;  3EO4 A;  3D8P A;  4XNH B;  4Y49 B;  1Q2C A;  4MHD A;  4KOT A;  2K5T A;  4L89 A;  2OB0 A;  1YK3 A;  4KOW A;  4ONU A;  1MJA A;  4XNH C;  1NE9 A;  1VKC A;  1YX0 A;  4Y49 C;  2Q4V A;  3VWE A;  4X5K A;  2I79 A;  3G3S A;  5IB0 A;  1WWZ A;  1RO5 A;  4FD6 A;  4H89 A;  4JD6 A;  2Q4Y A;  4IUS A;  3CXP A;  3SXO A;  1QST A;  5HH1 A;  4R3K A;  3TFY A;  2X7B A;  3TE4 A;  3IWG A;  5KTA A;  2BL1 A; 
#chains in the Genus database with same CATH topology
 1MJB A;  4DJL A;  4IAV A;  3FVL A;  1YSJ A;  1Q2Y A;  3ISZ A;  4NGM A;  3S6G A;  3GY9 A;  2EK9 A;  2Z3L A;  3G8W A;  1ZG8 A;  4MFQ A;  2PJ2 A;  3CXS A;  3KHZ A;  1X12 A;  1YVO A;  2XEG A;  4F6A A;  5J8F A;  8CPA A;  1QSM A;  4NGS A;  2FVG A;  4KOV A;  2P0W A;  4H6U A;  4AG7 A;  2YNC C;  3JUW A;  4JXQ A;  3ZZI A;  1M1D A;  2XEF A;  4Q7A A;  2OH1 A;  4XPK A;  2DPT A;  3L2N A;  3SJF A;  5EBV A;  4UBR A;  1LRZ A;  2NSM A;  2Q4Z A;  4OC3 A;  3GLJ A;  4GM5 A;  3FNC A;  4RS2 A;  4FUU A;  2F8H A;  3W91 A;  2FIA A;  1IOI A;  4MCQ A;  2AE6 A;  3FB3 A;  3RZA A;  4QVT A;  1B6B A;  5KTD A;  5LYD A;  1CPS A;  4QBJ A;  3S6H A;  4PK3 A;  2YGW A;  4AVC A;  4RUH A;  1V0C A;  5IB9 A;  1XE4 A;  2PC1 A;  4UA3 A;  4PPZ A;  1CP6 A;  4M85 A;  2AFX A;  1K4J A;  1Y0Y A;  3DDD A;  1YW4 A;  1AMP A;  2H5M A;  2PCU A;  2EO8 A;  1XRY A;  1BLL E;  4KOR A;  2KCW A;  3PB9 X;  2CNM A;  3CDX A;  3R9E A;  2D4P A;  1XOV A;  4Q38 A;  4EVY A;  4CAW A;  4C68 A;  4DNC A;  4E8O A;  2FS5 A;  4ZYQ A;  4NJR A;  2PJ5 A;  5DWN A;  2PE3 A;  2IMO A;  1NSL A;  4QC6 A;  4PQA A;  4U5Y A;  1XBU A;  3B35 A;  3D2M A;  4MFK A;  3KKW A;  3MN8 A;  1FNO A;  4B5P B;  2ZW6 A;  1LAM A;  4UWI A;  2J8N A;  1SQH A;  3WR7 A;  2R7H A;  4ZY1 A;  2C27 A;  4KLW A;  5JPH A;  4A31 A;  1HEE A;  1ZO0 A;  3C26 A;  4YU9 A;  4CAV A;  2PJA A;  2Q0Y A;  1DTD A;  1JQG A;  3BI1 A;  4CPA A;  5G20 A;  4C2Z A;  1Y7E A;  2EUI A;  2ZW7 A;  3DR6 A;  1GYT A;  2P6E A;  3RBU A;  3IEH A;  1B87 A;  2O28 A;  3D7F A;  5CPA A;  1ELM P;  5F47 A;  1X10 A;  3QB8 A;  2B4D B;  4M6G A;  1ZLI A;  3LAC A;  3TCV A;  1BOB A;  1YW6 A;  4CRZ B;  2EK8 A;  4EWT A;  3FJU A;  5F49 A;  4KOS A;  4U9Y A;  3TO7 A;  2F7V A;  3SI2 A;  4MFP A;  3R95 A;  4B6Z A;  4NEX A;  3DLJ A;  3DNS A;  1YME A;  4TWE A;  2BOA A;  2ZOG A;  1HDU A;  2ZED A;  2PIY A;  2GLJ A;  3FIX A;  3H4Q A;  2Z0Z A;  4MBU A;  4P6Y A;  4YFJ A;  1PU9 A;  4ORF A;  2GU2 A;  1NMT A;  4UF4 A;  2G3A A;  3IGR A;  3NFZ A;  2ZPA A;  3IWE A;  1KZF A;  4B10 A;  4P45 A;  1FY7 A;  3FYN A;  4R87 A;  4MY3 A;  1LFW A;  1CP7 A;  4X2T A;  1AYE A;  2QYV A;  2OZH A;  2R8V A;  2Z3M A;  4KSA A;  5HVF A;  3W6X A;  4A2Z A;  3CXQ A;  2Q04 A;  4OLL A;  4P4I A;  4UCP A;  4I49 A;  3PFE A;  1OZP A;  1EE3 P;  4PXD A;  1IGB A;  2ANP A;  3KI9 A;  4X3R A;  4C2Y A;  4KSF A;  4DYO A;  4FBE A;  2AFU A;  3H8E A;  4BMH A;  1IYL A;  4P10 A;  3TTH A;  2EWB A;  1VHS A;  4Z65 A;  3FED A;  4HPS A;  3FF3 A;  5HVH A;  3PEI A;  1S5K A;  2PRQ A;  1YVK A;  2Z3N A;  4CAX A;  4IHM A;  3BLN A;  1YQE A;  3JRU A;  4R76 A;  3FEC A;  5G22 A;  3RAM A;  3VAR A;  2IJZ A;  3F0A A;  4IK2 A;  2CNT A;  4CGP A;  4NXY A;  3I1U A;  1UWY A;  1XEB A;  1QSN A;  5D8N A;  3D7D A;  2ARH A;  2C6C A;  3IWW A;  4PXB A;  2WSA A;  3BXM A;  1CBX A;  4LX9 A;  3D66 A;  2XEI A;  4FD4 A;  3CZX A;  4YRH A;  4ZGY B;  5JQ4 A;  1L0C A;  2JBK A;  4F9U A;  3QAY A;  4EME A;  4P44 A;  1S7N A;  2B58 A;  3PB4 X;  5GCN A;  5G1Z A;  4OME A;  2AFS A;  2OOT A;  3D2P A;  1F57 A;  2AFW A;  4GXH A;  4F9V A;  1I12 A;  3PRT A;  5IX3 A;  2PJB A;  2Z10 A;  3PB7 X;  5F48 A;  2RFH A;  4HNX B;  4JWP A;  4AXV A;  3H8F A;  4NCZ A;  2CXA A;  2RC4 A;  2PJ0 A;  5I0C A;  3SXN A;  4OC1 A;  1R57 A;  2ZEM A;  4NF1 A;  3DGV A;  4MJ8 A;  5A28 A;  5HXD A;  2PJ7 A;  3EY5 A;  2P6G A;  4MI4 A;  2ATR A;  1TKH A;  1ON0 A;  4JXR A;  3RYO A;  4KOU A;  3TOB A;  3N5F A;  5K8P A;  3F5B A;  5C82 A;  2ZEP A;  2Z3O A;  3B2Y A;  4MHY A;  4R7M A;  3WAB A;  3IU2 A;  2FL4 A;  4P4F A;  2O4H A;  2R1I A;  4YGO A;  5K8M A;  2V8D A;  2P6F A;  1BO4 A;  1Z8X A;  5AG7 A;  4AVB A;  2PRB A;  4B13 A;  1CM0 A;  3N7Z A;  4MY0 A;  4AVA A;  5F46 A;  4A33 A;  2GAN A;  4JLY A;  1VGY A;  5HVG A;  3CT9 A;  4PSX A;  3LOD A;  4XPL A;  5K8O A;  4E2A A;  3IJ3 A;  4MFL A;  2HQY A;  3BJ8 A;  4JJX A;  4ZI6 A;  4C2X A;  2CIJ A;  4H2K A;  4FAI A;  4ZY2 A;  3B3T A;  3SI0 A;  2OZU A;  1N71 A;  1BPN A;  4MFJ A;  4PXE A;  2WPX A;  2ZXV A;  5AGE A;  2R98 A;  2JDD A;  1QMU A;  5IV0 A;  4KOX A;  4CYN A;  3S9L A;  3LMS A;  1ARM A;  4C7I A;  4RI1 A;  4H6Z A;  2CTC A;  4K3N A;  2PSW A;  4F0Y A;  7CPA A;  2VXK A;  3PGP A;  4A38 A;  2BCO A;  4U9Z A;  1M4I A;  3VWD A;  1S7K A;  4F8Z A;  4CS0 B;  1AUG A;  1WK4 A;  3D7H A;  3KGQ A;  2OU2 A;  4M6I A;  1S7L A;  3FH4 A;  2HUZ A;  4HKF A;  4NGP A;  4ZX8 A;  3B3V A;  4MHP A;  3KR5 A;  2ZEF A;  3WT4 A;  1Z8T A;  1XIX A;  5JGF A;  2HC9 A;  2VZZ A;  3IU1 A;  5A27 A;  4LQG A;  4NGR A;  3S9N A;  3IO1 A;  2B3V A;  4DUK A;  2B3U A;  2YND A;  3R1K A;  5LYI A;  3PB6 X;  3S6K A;  3PBE A;  3UY5 A;  4WJB A;  1IY7 A;  2FIW A;  2Q51 A;  4FWU A;  2DF5 A;  3FX6 A;  4K30 A;  1A2Z A;  2D4O A;  4KSI A;  2VBQ A;  2YNE A;  1F2P A;  3OWC A;  4NSQ A;  4A95 A;  1Y0R A;  3IC1 A;  5EMI A;  4BIN A;  5I4M A;  1P4N A;  2BUE A;  2C6P A;  2QIR A;  4P4B A;  4C7H A;  2AFO A;  1MJ9 A;  3D68 A;  1TF8 A;  3EFA A;  2J8R A;  2REE A;  1VHO A;  2GLF A;  3VAT A;  2V8G A;  1XMT A;  2JEV A;  1J4J A;  2C6G A;  1IB1 E;  3GKR A;  3H5Z A;  4KZT A;  2B5G B;  1CJW A;  2PJ8 A;  4UIB A;  2JLM A;  3A9L A;  3NA6 A;  5H86 A;  3VH9 A;  4A30 A;  5J1Q A;  5G21 A;  1Z8L A;  4OIW A;  1YRE A;  2CNS A;  4M6H A;  5D29 A;  3K9U A;  2CF4 A;  2ZEH A;  4OC5 A;  1M4D A;  5EC4 A;  1CPX A;  2Q44 A;  2ZEL A;  1XJO A;  2HV2 A;  3E0K A;  4F0X A;  3RO0 A;  3V7Z A;  4CYP A;  1RTQ A;  5AG6 A;  1TKF A;  3I3G A;  5FVJ A;  2G3T A;  2FXF A;  3IIB A;  3JVN A;  2VZY A;  3CPX A;  5E96 A;  5J8C A;  4OID A;  2ZW4 A;  3KQZ A;  4OP4 A;  5HMN A;  4FD5 A;  1JWQ A;  4TNU A;  3LD2 A;  2C1C A;  1Z4R A;  3B8G A;  3TX8 A;  2PDO A;  3B3W A;  3QNV A;  4MHN A;  4UEE A;  4W9Y A;  3I9S A;  3K2K A;  3GIU A;  4R3L A;  1XFO A;  4MHZ A;  2WZN A;  3GYA A;  1S60 A;  2PR1 A;  2ZOF A;  1PUA A;  4MRI A;  4CYO A;  1KUY A;  1QSR A;  5DS0 A;  4KVO E;  2RB7 A;  1ARL A;  3QAH A;  4UCN A;  3T9Y A;  5LYF A;  3PP9 A;  4OAD A;  4L8A A;  1KWM A;  1XF8 A;  3S9M A;  2FSR A;  2EVN A;  3SJX A;  1M4L A;  2XEJ A;  3TO9 A;  3W6S A;  4CAF A;  3BI0 A;  1IOF A;  4B11 A;  2PJ3 A;  2QJ8 A;  4ZY0 A;  1YR0 A;  4UEF A;  2I00 A;  2OR4 A;  1YLO A;  4KLV A;  3SHP A;  4QB9 A;  5DWM A;  4II9 A;  2PIZ A;  2A4N A;  1QQ9 A;  4FD7 A;  4KUA A;  4MCS A;  2Q7S A;  1I21 A;  2G9D A;  4G1P A;  4R8F A;  3T8W A;  2PVW A;  1UFH A;  2O53 A;  3FRM A;  4CRY B;  3PZJ A;  4HNW B;  2FE7 A;  4MCR A;  2F5I A;  4E0A A;  1YGH A;  2Z3P A;  2YNC A;  4X8I A;  2QVP A;  3D3S A;  3D7G A;  2JBJ A;  2QEC A;  1U6M A;  4ONW A;  4WWV A;  1Y9K A;  1R43 A;  3KAS A;  3PBB A;  2AJ6 A;  2IL4 A;  3PB8 X;  4R9M A;  2PQ8 A;  2Q7B A;  3NH5 A;  4UFW A;  5CNP A;  4BD9 A;  4PV6 A;  1R3N A;  2EBJ A;  3P2F A;  2GIV A;  2VEZ A;  3HLP A;  2I3C A;  2ZEO A;  3B3S A;  3B7I A;  3FXT A;  2PJ4 A;  3P2H A;  2BSW A;  3NE7 A;  2NYQ A;  4LQ6 A;  2CY2 A;  3EXN A;  2DXQ A;  3SJE A;  5C88 A;  6CPA A;  1VIX A;  4HNY B;  3JTK A;  3EC4 A;  4AB7 A;  3R9F A;  4Q36 A;  3WC5 A;  4KOY A;  4CGM A;  2WYR A;  2FCK A;  1QSO A;  5CBM A;  2JDC A;  3IFE A;  2REF A;  2PVV A;  3TC8 A;  2GE3 A;  4RN7 A;  2OZG A;  4GS4 A;  1YLE A;  3NH4 A;  4NGT A;  1S3Z A;  2ZEN A;  3WC6 A;  1RXT A;  3ZJ0 A;  1GHE A;  2NMT A;  3T90 A;  4CGL A;  1IU8 A;  1PYT B;  1P0H A;  1Z8W A;  2JEW A;  1Q2D A;  3DR8 A;  3KHX A;  4YWY A;  1MK4 A;  3TO6 A;  3CPA A;  2GRE A;  3D4U A;  4PXC A;  4KVX A;  1I1D A;  3LWU A;  1Z9U A;  2VI7 A;  4A32 A;  1NSA A;  3H8G A;  3KQX A;  4KVM E;  3KR4 A;  1BPM A;  1Y7R A;  5H84 A;  4KUB A;  1Q7L A;  3R9G A;  5THW A;  4NGQ A;  1LOK A;  5F09 A;  3RNZ A;  4P4D A;  4QUS A;  2PR8 A;  4B5P A;  2VL1 A;  2J8M A;  4MMO A;  3R96 A;  1S7F A;  2ZW5 A;  3TT2 A;  3BJ7 A;  2FT0 A;  3SJG A;  2V77 A;  5ISV A;  4UWJ A;  4OAE A;  2Y0M A;  4UFX A;  1ZLH A;  2Q43 A;  3F8K A;  3NH8 A;  3HUV A;  1IYK A;  3GB0 A;  4JZ0 A;  2G0B A;  5AG5 A;  1DE4 C;  5JH9 A;  4LUA A;  4EFD A;  2Z11 A;  3KZW A;  4JYW A;  4ZBG A;  5AG4 A;  3MGD A;  3K9T A;  2DPS A;  2ODF A;  4XPD B;  2PJ1 A;  4KS9 A;  1TF9 A;  4UFV A;  1IIC A;  1Z5R A;  3GUX A;  5JM6 A;  3PFO A;  2AFZ A;  1CG2 A;  2B4D A;  2VQY A;  2V8V A;  2J9A A;  1TIQ A;  4XPD C;  5LRG A;  5LYL A;  3DSB A;  2WUU A;  1KUX A;  1M44 A;  2B4B A;  3NE8 A;  4UIA A;  2POK A;  4ZX9 A;  4BBH A;  1CX8 A;  1OBR A;  2ABZ A;  4CAE A;  3ISX A;  1LCP A;  3FEE A;  1M4G A;  1FT7 A;  4UEZ A;  4UCM A;  4J3G A;  3TOA A;  4CGN A;  5KTC A;  4R57 A;  4B5O A;  4OC4 A;  3V38 A;  2PJ6 A;  4P4J A;  1Z4E A;  3V8I A;  2Z3K A;  2B5G A;  1KUV A;  1HDQ A;  2ZEE A;  2BEI A;  1ZG9 A;  4OKO A;  5K8N A;  3S6F A;  2PJC A;  2AFM A;  2CTB A;  2DEA A;  5ELY A;  1Y9W A;  1IID A;  2V8H A;  4M3S A;  4B12 A;  3FBU A;  2GFQ A;  4AG9 A;  4PSW A;  2ZEG A;  1PCA A;  1Z2L A;  1ELL P;  2PJ9 A;  2QML A;  2WPW A;  4IF5 A;  3D67 A;  4NFR A;  4MXU A;  3EO4 A;  4PK2 A;  1ZG7 A;  3D8P A;  4OC0 A;  4XNH B;  1LAN A;  4NJQ A;  4Y49 B;  1Q2C A;  4O23 A;  4MHD A;  4KOT A;  2K5T A;  1BAV A;  4L89 A;  2OB0 A;  1YK3 A;  4KOW A;  4OC2 A;  3WC7 A;  4ONU A;  1MJA A;  4XNH C;  1NE9 A;  1VKC A;  1YX0 A;  4Y49 C;  4P4E A;  2HB6 A;  4B14 A;  2Q4V A;  5LRJ A;  3VWE A;  4X5K A;  4CYQ A;  2I79 A;  3G3S A;  5IB0 A;  1WWZ A;  1RO5 A;  4CGO A;  1F2O A;  4MFZ A;  3FMC A;  1TKJ A;  3BHX A;  4FD6 A;  4H89 A;  5BWA B;  4JD6 A;  4A94 A;  2Q4Y A;  2IQ6 A;  2BO9 A;  3CXP A;  4IUS A;  4A39 A;  4MCP A;  3SXO A;  1QST A;  5HH1 A;  3KL9 A;  3B3C A;  4R3K A;  1TXR A;  3TFY A;  2X7B A;  4R6T A;  5LRK A;  1VHE A;  3SI1 A;  3TE4 A;  3MRU A;  1XMB A;  4NGN A;  4A37 A;  1LAP A;  3IWG A;  5KTA A;  2BL1 A;  1H8L A; 
#chains in the Genus database with same CATH homology
 1MJB A;  1Q2Y A;  3S6G A;  3GY9 A;  2Z3L A;  3G8W A;  4MFQ A;  3CXS A;  1YVO A;  4F6A A;  5J8F A;  1QSM A;  4KOV A;  2P0W A;  4H6U A;  4AG7 A;  2YNC C;  3JUW A;  4JXQ A;  3ZZI A;  1M1D A;  2OH1 A;  4XPK A;  2DPT A;  5EBV A;  4UBR A;  1LRZ A;  3FNC A;  4RS2 A;  3W91 A;  2FIA A;  2AE6 A;  3FB3 A;  4QVT A;  1B6B A;  5KTD A;  4QBJ A;  3S6H A;  4PK3 A;  2YGW A;  4AVC A;  1V0C A;  1XE4 A;  2PC1 A;  4UA3 A;  4M85 A;  1K4J A;  3DDD A;  2H5M A;  4KOR A;  2KCW A;  2CNM A;  3R9E A;  2D4P A;  4Q38 A;  4EVY A;  4CAW A;  4C68 A;  4DNC A;  4E8O A;  2FS5 A;  5DWN A;  1NSL A;  4QC6 A;  4U5Y A;  3D2M A;  4MFK A;  3KKW A;  4B5P B;  2ZW6 A;  4UWI A;  2J8N A;  1SQH A;  3WR7 A;  2R7H A;  2C27 A;  4KLW A;  5JPH A;  4A31 A;  1ZO0 A;  3C26 A;  4CAV A;  2Q0Y A;  5G20 A;  4C2Z A;  2EUI A;  2ZW7 A;  3DR6 A;  2P6E A;  1B87 A;  2O28 A;  5F47 A;  3QB8 A;  2B4D B;  3TCV A;  1BOB A;  4CRZ B;  5F49 A;  4KOS A;  4U9Y A;  3TO7 A;  4MFP A;  3R95 A;  4NEX A;  3DNS A;  3H4Q A;  4MBU A;  4YFJ A;  3FIX A;  2Z0Z A;  1PU9 A;  4ORF A;  1NMT A;  2G3A A;  3IGR A;  2ZPA A;  3IWE A;  1KZF A;  4B10 A;  1FY7 A;  3FYN A;  4R87 A;  4MY3 A;  2OZH A;  2R8V A;  2Z3M A;  4KSA A;  3W6X A;  4A2Z A;  3CXQ A;  2Q04 A;  4OLL A;  4UCP A;  4I49 A;  1OZP A;  4C2Y A;  4KSF A;  4BMH A;  1IYL A;  3TTH A;  1VHS A;  1S5K A;  1YVK A;  2Z3N A;  4CAX A;  3BLN A;  5G22 A;  3F0A A;  2CNT A;  4CGP A;  4NXY A;  1XEB A;  1QSN A;  2ARH A;  2WSA A;  4LX9 A;  4FD4 A;  4YRH A;  4ZGY B;  5JQ4 A;  1L0C A;  1S7N A;  2B58 A;  5GCN A;  5G1Z A;  3D2P A;  1I12 A;  5IX3 A;  2Z10 A;  5F48 A;  4HNX B;  4JWP A;  4NCZ A;  2CXA A;  2RC4 A;  5I0C A;  3SXN A;  1R57 A;  4NF1 A;  5A28 A;  4MJ8 A;  3EY5 A;  2P6G A;  4MI4 A;  2ATR A;  1ON0 A;  4JXR A;  3RYO A;  4KOU A;  3TOB A;  3F5B A;  5C82 A;  2Z3O A;  3IU2 A;  2FL4 A;  2R1I A;  4YGO A;  2P6F A;  1BO4 A;  5AG7 A;  4AVB A;  2PRB A;  4B13 A;  1CM0 A;  3N7Z A;  4MY0 A;  4AVA A;  5F46 A;  4A33 A;  2GAN A;  4JLY A;  4PSX A;  3LOD A;  4XPL A;  4E2A A;  4MFL A;  2HQY A;  3BJ8 A;  4JJX A;  4C2X A;  2OZU A;  1N71 A;  4MFJ A;  2WPX A;  2ZXV A;  5AGE A;  2R98 A;  2JDD A;  5IV0 A;  4KOX A;  4CYN A;  4C7I A;  4RI1 A;  4H6Z A;  4F0Y A;  2PSW A;  2VXK A;  3PGP A;  4U9Z A;  1M4I A;  3VWD A;  1S7K A;  4CS0 B;  1WK4 A;  2OU2 A;  1S7L A;  2HUZ A;  4HKF A;  1XIX A;  2VZZ A;  3IU1 A;  5A27 A;  2B3V A;  2B3U A;  2YND A;  3R1K A;  3S6K A;  3UY5 A;  2FIW A;  4K30 A;  2D4O A;  2VBQ A;  2YNE A;  3OWC A;  4NSQ A;  4A95 A;  1P4N A;  2BUE A;  2QIR A;  4C7H A;  1MJ9 A;  3EFA A;  2J8R A;  2REE A;  1XMT A;  2JEV A;  1J4J A;  1IB1 E;  3GKR A;  3H5Z A;  4KZT A;  2B5G B;  1CJW A;  2JLM A;  3A9L A;  5H86 A;  4A30 A;  5G21 A;  1YRE A;  2CNS A;  3K9U A;  1M4D A;  5EC4 A;  2Q44 A;  2HV2 A;  3E0K A;  4F0X A;  4CYP A;  5AG6 A;  3I3G A;  5FVJ A;  2G3T A;  2FXF A;  3JVN A;  5E96 A;  2VZY A;  5J8C A;  2ZW4 A;  5HMN A;  4FD5 A;  3LD2 A;  1Z4R A;  3B8G A;  2PDO A;  3I9S A;  4R3L A;  3GYA A;  1S60 A;  2PR1 A;  1PUA A;  4CYO A;  1KUY A;  1QSR A;  4KVO E;  3QAH A;  4UCN A;  3T9Y A;  3PP9 A;  4OAD A;  4L8A A;  1XF8 A;  3TO9 A;  2FSR A;  2EVN A;  3W6S A;  4CAF A;  4B11 A;  1YR0 A;  2I00 A;  4KLV A;  3SHP A;  4QB9 A;  5DWM A;  4II9 A;  2A4N A;  4FD7 A;  4KUA A;  1I21 A;  1UFH A;  3FRM A;  4CRY B;  4E0A A;  3PZJ A;  4HNW B;  2FE7 A;  2F5I A;  1YGH A;  2Z3P A;  2YNC A;  3D3S A;  2QEC A;  1U6M A;  1Y9K A;  2AJ6 A;  2IL4 A;  4R9M A;  2PQ8 A;  2Q7B A;  4UFW A;  5CNP A;  4PV6 A;  3P2F A;  2GIV A;  2VEZ A;  3FXT A;  3P2H A;  2BSW A;  3NE7 A;  2CY2 A;  3EXN A;  2DXQ A;  5C88 A;  4HNY B;  3JTK A;  3EC4 A;  4AB7 A;  3R9F A;  4Q36 A;  4KOY A;  4CGM A;  2FCK A;  1QSO A;  2JDC A;  2REF A;  2GE3 A;  2OZG A;  4GS4 A;  1YLE A;  1S3Z A;  3ZJ0 A;  1RXT A;  1GHE A;  2NMT A;  3T90 A;  4CGL A;  1P0H A;  1Q2D A;  3DR8 A;  1MK4 A;  3TO6 A;  4KVX A;  1I1D A;  1Z9U A;  2VI7 A;  4A32 A;  4KVM E;  1Y7R A;  5H84 A;  4KUB A;  3R9G A;  4QUS A;  2PR8 A;  4B5P A;  2J8M A;  3R96 A;  1S7F A;  2ZW5 A;  3TT2 A;  3BJ7 A;  2FT0 A;  5ISV A;  4UWJ A;  4OAE A;  2Y0M A;  4UFX A;  3F8K A;  1IYK A;  2G0B A;  5AG5 A;  4LUA A;  2Z11 A;  4ZBG A;  5AG4 A;  3MGD A;  2DPS A;  4XPD B;  4KS9 A;  4UFV A;  1IIC A;  2B4D A;  2VQY A;  1TIQ A;  4XPD C;  3DSB A;  2WUU A;  1KUX A;  1M44 A;  2B4B A;  4BBH A;  4CAE A;  1M4G A;  4CGN A;  3TOA A;  4UCM A;  4J3G A;  5KTC A;  4R57 A;  4B5O A;  1Z4E A;  3V8I A;  2Z3K A;  2B5G A;  1KUV A;  2BEI A;  3S6F A;  1Y9W A;  1IID A;  4M3S A;  4B12 A;  3FBU A;  4AG9 A;  4PSW A;  2WPW A;  4IF5 A;  2QML A;  4PK2 A;  3EO4 A;  3D8P A;  4XNH B;  4Y49 B;  1Q2C A;  4MHD A;  4KOT A;  2K5T A;  4L89 A;  2OB0 A;  1YK3 A;  4KOW A;  4ONU A;  1MJA A;  4XNH C;  1NE9 A;  1VKC A;  1YX0 A;  4Y49 C;  4B14 A;  2Q4V A;  3VWE A;  4X5K A;  4CYQ A;  2I79 A;  3G3S A;  5IB0 A;  1WWZ A;  1RO5 A;  4CGO A;  4MFZ A;  4FD6 A;  4H89 A;  5BWA B;  4JD6 A;  2Q4Y A;  4IUS A;  3CXP A;  3SXO A;  1QST A;  5HH1 A;  4R3K A;  3TFY A;  2X7B A;  3TE4 A;  3IWG A;  5KTA A;  2BL1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...