4IUSA

Gcn5-related n-acetyltransferase from kribbella flavida.
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
259
structure length
257
Chain Sequence
AMGIAARIASAQLQGLVRSRRQVVAGPLVGLLHDEDVWFLSRAVAAEPGVPFDPAEVPWALETIRKAFAAEDRWLSAELVEEANPGLAYVLVEHGMTIVSRPPLLAVEPGDLLVPEFPAGVTAAVVASAEEQEAANAIAGDAYETDASPFQPEPADGGAVLIRMDGVPVATAAWTAIADGVTEVAGVGTLHSHRRQGLGALATAYATQQAFEVGGATLAWLTPGDDGADRIYRRLGYEPKATAVHLGDPGGHLADLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords GCN5-related N-acetyltransferase
publication title GCN5-related N-acetyltransferase from Kribbella flavida.
rcsb
source organism Kribbella flavida
total genus 76
structure length 257
sequence length 259
ec nomenclature ec 2.3.1.128: Transferred entry: 2.3.1.267.
pdb deposition date 2013-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4iusA00
5DWMA 1XEBA 2P6FA 3VWEA 5ISVA 3DNSA 3ZJ0A 5EC4A 3DR6A 3FXTA 4XPKA 1Q2DA 4UWIA 2PR1A 4H89A 3FYNA 2G0BA 2B3VA 4AVBA 1V0CA 1I1DA 4XNHB 3V8IA 5C82A 1P0HA 2F5IA 5JPHA 4MY3A 5F49A 1QSRA 2Q7BA 3BLNA 4X5KA 2PRBA 4XPDC 3RYOA 4DNCA 3IWGA 4AG9A 3QAHA 3H4QA 1Z4RA 2AE6A 3G3SA 3IGRA 1QSNA 4CAVA 2JDDA 3KKWA 2OU2A 1ON0A 5F46A 2EUIA 1VHSA 5HMNA 4MI4A 4CAXA 2ATRA 1NMTA 4Y49C 2G3TA 4LX9A 1UFHA 1IICA 4GS4A 1S60A 2ZW4A 3R9GA 3DSBA 4M3SA 4KOYA 4YRHA 1WK4A 4IUSA 4U9ZA 2REEA 4PK2A 3LD2A 2Q0YA 1IB1E 4I49A 4KLVA 2R98A 1YGHA 3SXOA 2QMLA 4KOSA 1Y9WA 4AVCA 1MJAA 4PV6A 3SHPA 2HUZA 1RO5A 2GANA 2R8VA 2OH1A 1R57A 4KVXA 1KZFA 2OZUA 5KTCA 2HV2A 2DXQA 4FD7A 2OZHA 4PSWA 2BUEA 4RS2A 2D4OA 2A4NA 4CAWA 4CRZB 3FBUA 4AG7A 2EVNA 1SQHA 2H5MA 4BMHA 2Z10A 3SXNA 4E0AA 3LODA 2Q4VA 3P2HA 5DWNA 3S6GA 5J8FA 4KOUA 2C27A 2HQYA 2VI7A 3TO9A 4U5YA 1XIXA 1J4JA 4R57A 1IYKA 2CNTA 5JQ4A 2PSWA 2B58A 2K5TA 1Y7RA 2B4DB 4FD5A 4YFJA 1CJWA 2FIAA 4QB9A 4L8AA 1TIQA 4QC6A 5H86A 4XNHC 4B5OA 1WWZA 4HKFA 1Q2CA 1S3ZA 4FD6A 4NF1A 2VQYA 2Z0ZA 5HH1A 3WR7A 2GE3A 4KOWA 4RI1A 5C88A 3TOBA 1M1DA 4KOXA 2P6EA 1XMTA 3F8KA 1BOBA 1YX0A 5H84A 1YR0A 3W91A 4JXRA 1M4GA 2P6GA 2Z11A 3I9SA 4KORA 3GYAA 4NXYA 4KUAA 3FRMA 4J3GA 5IV0A 3TFYA 1B6BA 5CNPA 3DDDA 2QECA 2R1IA 4KVME 3K9UA 4ONUA 3EO4A 1QSOA 5F48A 3GKRA 3MGDA 3S6HA 1Z4EA 2B5GB 2GIVA 5J8CA 2B3UA 3TO6A 2FIWA 4HNXB 4MJ8A 3D2PA 1S5KA 1Q2YA 3FIXA 5GCNA 5IB0A 3CXSA 4JXQA 4KOTA 3EFAA 2PR8A 2FCKA 2WPXA 2ZW6A 3TCVA 5KTAA 3G8WA 4R3LA 4EVYA 4PSXA 1K4JA 3D8PA 2BL1A 3CXPA 2KCWA 1P4NA 1S7FA 4XPDB 1KUXA 5KTDA 3D3SA 4AVAA 5F47A 1QSTA 5IX3A 1N71A 1FY7A 4II9A 4KVOE 2J8RA 4R87A 2VZYA 4H6UA 2VXKA 1MJ9A 3GY9A 2FE7A 2PDOA 4L89A 4JJXA 3PZJA 1CM0A 1YVKA 1IIDA 1I12A 1M4IA 2JLMA 3QB8A 3B8GA 3OWCA 4OLLA 2PC1A 3TOAA 2CY2A 3BJ8A 3EXNA 3S6KA 3F5BA 3BJ7A 4QVTA 4KZTA 1MK4A 1NE9A 2I00A 3PGPA 2FT0A 1I21A 1Y9KA 4YGOA 3N7ZA 1B87A 3W6SA 3JUWA 1RXTA 2BEIA 4IF5A 3C26A 2G3AA 1L0CA 4B5PA 4NEXA 1NSLA 2ZPAA 4UWJA 1BO4A 1IYLA 1S7NA 2J8NA 1U6MA 2VBQA 4M85A 1M4DA 1LRZA 2I79A 4R3KA 1S7KA 2J8MA 2CNMA 4OADA 4UBRA 3JVNA 1XF8A 2OB0A 2R7HA 2Q04A 4NSQA 4E2AA 1PUAA 3P2FA 2PQ8A 4XPLA 3UY5A 2B4BA 2NMTA 3T90A 4F6AA 3EY5A 3F0AA 1YREA 2B4DA 4ZBGA 1YVOA 4FD4A 1VKCA 1GHEA 4K30A 3TTHA 1Z9UA 3FNCA 4JLYA 2BSWA 3D2MA 3PP9A 3R9EA 4KUBA 3TT2A 2Y0MA 3S6FA 3R96A 2Q4YA 2OZGA 2VEZA 2JEVA 2FS5A 4ORFA 4F0YA 4NCZA 2CNSA 5EBVA 3I3GA 1YK3A 4UA3A 3W6XA 3ZZIA 4AB7A 3DR8A 5FVJA 2D4PA 2JDCA 2IL4A 2AJ6A 2B5GA 2ZW7A 1KUYA 4E8OA 4JWPA 3VWDA 2ZXVA 3R1KA 4MHDA 3EC4A 5I0CA 2QIRA 4Y49B 2FL4A 1YLEA 4PK3A 2REFA 3NE7A 1M44A 1S7LA 2Q44A 3FB3A 4CRYB 1MJBA 2WPWA 2FSRA 1OZPA 2P0WA 4KOVA 4JD6A 2ARHA 4B5PB 2O28A 2FXFA 4QUSA 3E0KA 3T9YA 4HNYB 1XE4A 4U9YA 4MY0A 3CXQA 4H6ZA 4OAEA 4QBJA 4HNWB 4MBUA 2VZZA 2X7BA 1PU9A 3R9FA 3R95A 2ZW5A 3TO7A 2RC4A 5E96A 4KLWA 3TE4A 1KUVA 4LUAA 4R9MA 4CS0B 1QSMA
chains in the Genus database with same CATH superfamily
5DWMA 1HDQA 4Q7AA 1XEBA 3FVLA 3H8EA 2F8HA 2P6FA 2GREA 4NGRA 3VWEA 5ISVA 4H2KA 2DPSA 3DNSA 3ISZA 4RN7A 4PQAA 3TX8A 3ZJ0A 1ZG8A 3DR6A 5EC4A 3A9LA 3FXTA 3PEIA 4XPKA 4Q36A 1Q2DA 5AG5A 4UWIA 5LRJA 2JBJA 2PR1A 2BO9A 4H89A 1Z5RA 3FYNA 2G0BA 2B3VA 3BHXA 2Z3OA 3T8WA 4IHMA 4MHZA 3RAMA 4MXUA 5BWAB 1CPSA 4AVBA 1X10A 3DLJA 1XJOA 1ELMP 4ZX9A 1V0CA 1I1DA 4MRIA 4UFXA 2PJ8A 4XNHB 2HC9A 1VHOA 3V8IA 3B3VA 5C82A 1P0HA 3KGQA 2F5IA 3IU1A 4GXHA 3PB7X 4MY3A 5JPHA 5F49A 4A31A 4Z65A 1QSRA 3KI9A 4M6IA 2GU2A 3CDXA 1HEEA 2Q7BA 3NE8A 5HXDA 3BLNA 1CG2A 4B11A 3QAYA 4F9UA 2ZOFA 4X5KA 2PRBA 3FJUA 4XPDC 3RYOA 2QVPA 4DNCA 3IWGA 3PFEA 4AG9A 4ZGYB 3QAHA 2EK8A 3H4QA 1Z4RA 2AE6A 3G3SA 3IGRA 1JQGA 4YWYA 4FUUA 3IWEA 1QSNA 4R8FA 4CAVA 2EBJA 4DYOA 3BI1A 2JDDA 2Q7SA 3KKWA 2OU2A 4UIBA 4MFZA 1ON0A 4R7MA 1LAPA 2CXAA 2DF5A 5F46A 4CYQA 4KSAA 2EUIA 4EWTA 2PE3A 2FVGA 1VHSA 2DEAA 5HMNA 5HVGA 3SJXA 4A38A 4P4BA 4ZY2A 4MFKA 4MI4A 3VH9A 4CAXA 2ATRA 1NMTA 4Y49C 3KZWA 2G3TA 2V8VA 4LX9A 1UFHA 1IICA 4C2YA 3K2KA 1OBRA 4GS4A 1S60A 2ZW4A 4A30A 3R9GA 3DSBA 1Q7LA 4M3SA 2O4HA 1TF8A 4KOYA 4YRHA 3D7DA 4Q38A 1Y0RA 4MCRA 4CYOA 1WK4A 4IUSA 3S9LA 4U9ZA 2IMOA 2IQ6A 2REEA 4PK2A 3LD2A 4F0XA 2Q0YA 1IB1E 2PJ3A 2F7VA 4P45A 5K8NA 5F09A 4I49A 4KLVA 1F2PA 1Y0YA 2VL1A 2R98A 1YGHA 3SXOA 2QMLA 2BOAA 4UCNA 4NFRA 4KOSA 1Y9WA 1YW6A 3PFOA 4AVCA 4C2XA 4BINA 1MJAA 4PV6A 2YNCC 1X12A 2YNDA 3SHPA 5LYLA 2HUZA 4EFDA 1RO5A 4P6YA 1LCPA 2RFHA 2GANA 2R8VA 2OH1A 4R76A 3JRUA 1R57A 3B35A 5K8OA 3KQZA 4KVXA 1KZFA 3B3SA 2OZUA 5KTCA 4NGNA 4A94A 3LWUA 2HV2A 2DXQA 4CGLA 4FD7A 1F2OA 2OZHA 2ZELA 2BUEA 4PSWA 4RS2A 2D4OA 2A4NA 2Z3KA 1TKFA 4BBHA 4C68A 3V38A 4CAWA 4CRZB 3FBUA 4AG7A 2EVNA 1SQHA 2H5MA 4BMHA 4WJBA 2Z10A 4MFJA 1DE4C 3IC1A 3SXNA 4E0AA 4OC0A 3PRTA 4NJRA 2BCOA 2PIZA 2Q4VA 3LODA 2V77A 3P2HA 5DWNA 3S6GA 4ZY0A 5J8FA 3FECA 5G22A 4KOUA 1CX8A 2C27A 2HQYA 2VI7A 2QJ8A 1Z8WA 4U5YA 3TO9A 3D67A 1XIXA 4UCMA 3D66A 2IJZA 1XBUA 1J4JA 4R57A 4K3NA 4FWUA 2RB7A 1ARMA 1IYKA 1VGYA 2CNTA 2PJBA 3TC8A 3CPAA 4A32A 5JQ4A 2PSWA 2B58A 2K5TA 1Y7RA 2B4DB 2ODFA 2JBKA 4FD5A 1Z2LA 5LYDA 4YFJA 2Z3MA 1CJWA 3PBBA 4MMOA 2FIAA 4QB9A 3PB4X 4L8AA 1TIQA 1PCAA 4QC6A 3N5FA 2QYVA 5H86A 3VATA 2GLFA 4XNHC 3IIBA 4MCPA 4B5OA 4KS9A 1WWZA 2V8GA 4HKFA 4TNUA 4UF4A 5HVFA 5THWA 5EMIA 1Q2CA 1A2ZA 3GUXA 1S3ZA 2AFXA 4FD6A 4NF1A 4PXEA 2VQYA 2Z0ZA 5HH1A 3WR7A 4ZY1A 2GE3A 1CPXA 4KOWA 3NH4A 4RI1A 5C88A 3TOBA 1M1DA 4KOXA 4CPAA 2P6EA 1XMTA 2EK9A 1BOBA 1YX0A 3D7GA 3F8KA 3FMCA 1YR0A 5D8NA 5H84A 4TWEA 3W91A 4EMEA 4JXRA 3IO1A 1M4GA 2P6GA 2Z11A 3KHZA 2JEWA 2PJ6A 5AG6A 3I9SA 4KORA 5LYIA 3SI2A 5G21A 3GYAA 4NXYA 4KUAA 4OC3A 3CZXA 3FRMA 4J3GA 4UFVA 4UFWA 3DGVA 4ONWA 2ZEDA 5IV0A 1TXRA 1ZG9A 1CBXA 4C7HA 1B6BA 3TFYA 4IAVA 5CNPA 3FH4A 3DDDA 5CBMA 1LANA 2QECA 4C7IA 4MHPA 2R1IA 3IFEA 3ISXA 3B7IA 4KVME 2WUUA 3K9UA 1VIXA 3EO4A 4ONUA 2V8HA 1QSOA 5F48A 3GKRA 3MGDA 3RZAA 3S6HA 3B2YA 1Z4EA 2B5GB 2GIVA 2Q43A 5J8CA 2B3UA 3TO6A 2G9DA 4B12A 2FIWA 3S9NA 2ZEEA 4PPZA 7CPAA 4MHYA 1Y7EA 2J9AA 3HUVA 4HNXB 4AXVA 5J1QA 4MJ8A 3D2PA 1S5KA 1Q2YA 3CT9A 3FIXA 5GCNA 2AFUA 5IB0A 1YLOA 2PJ4A 2Z3LA 3CXSA 5JH9A 4JXQA 3WC6A 4KOTA 4UIAA 3KASA 3EFAA 2PR8A 2FCKA 2WPXA 2ZW6A 3TCVA 5KTAA 4B6ZA 4ZYQA 1CP7A 3G8WA 2I3CA 4R3LA 4CYNA 2HB6A 4PSXA 4EVYA 1K4JA 5LRGA 2BL1A 3CXPA 3D8PA 5G1ZA 2PJCA 2KCWA 1P4NA 1S7FA 4XPDB 1KUXA 4A2ZA 3D3SA 4AVAA 4FBEA 5KTDA 4UEZA 1QSTA 5F47A 3PB8X 5IX3A 3KL9A 1N71A 1YQEA 1FY7A 4C2ZA 4KVOE 2J8RA 2NYQA 3KR4A 4OC1A 4II9A 3B3TA 4UEFA 2EO8A 4R87A 2VZYA 3K9TA 3SJGA 5LRKA 4X3RA 2OOTA 1AMPA 4H6UA 2ZEMA 1BAVA 3IEHA 4OMEA 1NSAA 1Z8XA 2VXKA 1MJ9A 3GY9A 2FE7A 2PDOA 8CPAA 1RTQA 4CAFA 4CGNA 1R3NA 4OC4A 4L89A 4JJXA 3PZJA 3WABA 1CM0A 1YVKA 4F9VA 1IIDA 3GB0A 2GLJA 1I12A 2PJ9A 1M4IA 4M6HA 1ARLA 1Z8LA 1PYTB 2JLMA 3B8GA 3OWCA 2Z3PA 3QB8A 4MFQA 4A33A 4OLLA 2PC1A 3TOAA 2CY2A 3RBUA 3BJ8A 3EXNA 3S6KA 3F5BA 3BJ7A 4QVTA 3SJEA 1LFWA 2ZEOA 4KZTA 1MK4A 3NA6A 1QMUA 1NE9A 2I00A 3SJFA 3PGPA 2FT0A 3D7HA 1I21A 3IWWA 4P44A 3GLJA 1Y9KA 4YGOA 1IGBA 3N7ZA 1B87A 1YW4A 2PVVA 3NH8A 3JUWA 1RXTA 3W6SA 2BEIA 4IF5A 3C26A 2G3AA 1L0CA 3D4UA 3KQXA 4B5PA 2ANPA 4NEXA 3KR5A 1NSLA 2YGWA 2Q51A 2ZPAA 4CGOA 1IOFA 3B3WA 4KSIA 1BO4A 1IYLA 4UWJA 1S7NA 5JGFA 4F8ZA 1H8LA 2J8NA 1U6MA 2VBQA 3QNVA 1BPMA 4M85A 1M4DA 2XEFA 1LRZA 2YNCA 4B14A 2I79A 4DJLA 3B3CA 4R3KA 1ZO0A 1LOKA 2GFQA 4M6GA 4HPSA 4B13A 1S7KA 3H8FA 2DPTA 2J8MA 2CNMA 5A27A 2XEGA 4OADA 1EE3P 4UBRA 3JVNA 1XF8A 2OB0A 1ZLHA 2R7HA 4B10A 2CIJA 3H8GA 2PIYA 3LMSA 2Q04A 4NSQA 4OIDA 3PB9X 4CAEA 4E2AA 1PUAA 3D68A 3P2FA 2PQ8A 4NGQA 4XPLA 4W9YA 3UY5A 2B4BA 2NMTA 1Z8TA 1ZG7A 5A28A 5I4MA 2PJ0A 3VARA 4A95A 3WC5A 4OC2A 3T90A 4MFLA 4P4DA 3NH5A 4F6AA 4DUKA 4PXBA 3EY5A 3F0AA 1XRYA 5AGEA 3PB6X 4UEEA 1DTDA 1IU8A 1TKHA 1YREA 2XEIA 5HVHA 5K8PA 5JM6A 2B4DA 4ZBGA 5CPAA 1YVOA 2ZEFA 1TF9A 4FD4A 4P4JA 3KHXA 1YMEA 1VKCA 1GHEA 2Z3NA 3GIUA 4K30A 3TTHA 1Z9UA 3FNCA 4MFPA 4JYWA 3H5ZA 1M4LA 2WYRA 2ZEPA 2O53A 4JLYA 4JZ0A 2BSWA 2ZEGA 4R6TA 2V8DA 4PXDA 4KSFA 1LAMA 3D2MA 1ZLIA 3PP9A 3WT4A 3R9EA 2PRQA 4KUBA 3TT2A 5D29A 5G20A 2Y0MA 3S6FA 3R96A 2Q4YA 2ABZA 2OZGA 2PVWA 2ZEHA 1FNOA 2PCUA 3CPXA 2VEZA 1GYTA 2JEVA 2PJ7A 3D7FA 1XFOA 1BLLE 2FS5A 4RUHA 4ORFA 2WZNA 4F0YA 4NCZA 5IB9A 2CNSA 2PJ1A 3IJ3A 3I3GA 3MN8A 4P4EA 5EBVA 1YK3A 4UA3A 1YSJA 2C6GA 3W6XA 4OC5A 3ZZIA 4AB7A 3DR8A 4WWVA 3SI1A 3V7ZA 2EWBA 5FVJA 3BXMA 4OP4A 2D4PA 3FEDA 2AFOA 1QQ9A 1F57A 4PXCA 3RO0A 2JDCA 2IL4A 5LYFA 2CTCA 2AJ6A 3LACA 2AFWA 3BI0A 3JTKA 2PJAA 2B5GA 2ZW7A 1ELLP 1KUYA 4G1PA 4E8OA 3FF3A 4JWPA 4NGPA 2CF4A 2Q4ZA 5DS0A 3VWDA 2AFZA 4ZX8A 1R43A 1IY7A 2XEJA 2ZXVA 3R1KA 4P4FA 4MHDA 4YU9A 4A37A 2C6CA 3EC4A 1JWQA 4P10A 2QIRA 3S9MA 4Y49B 2FL4A 5I0CA 4BD9A 1YLEA 2CTBA 4PK3A 2REFA 5K8MA 2YNEA 3MRUA 3NE7A 4LQ6A 4UCPA 1M44A 1S7LA 2WSAA 2Q44A 4X2TA 3FB3A 4MHNA 4CRYB 1MJBA 1CP6A 2WPWA 3FEEA 4OIWA 3L2NA 4MCQA 1BPNA 2FSRA 1OZPA 2C6PA 2P0WA 4NJQA 3IU2A 1FT7A 4KOVA 2C1CA 4CGMA 2OR4A 4JD6A 2ARHA 4B5PB 1VHEA 2O28A 3I1UA 1XOVA 4OKOA 4GM5A 3WC7A 2ZOGA 2FXFA 4QUSA 3E0KA 4MCSA 4ZI6A 3T9YA 4HNYB 3PBEA 4NGSA 1XE4A 4U9YA 4MY0A 3CXQA 2PJ2A 4H6ZA 2ZENA 4OAEA 4QBJA 4CGPA 4HNWB 4MBUA 4NGTA 5AG4A 5ELYA 5AG7A 1TKJA 1HDUA 2VZZA 6CPAA 2X7BA 1PU9A 1IOIA 3RNZA 3HLPA 4NGMA 2AFSA 3FX6A 4IK2A 2NSMA 3NFZA 4A39A 2PJ5A 4CYPA 3R9FA 3R95A 2ZW5A 3TO7A 2RC4A 1AYEA 1UWYA 4KLWA 5E96A 3TE4A 4P4IA 1KWMA 1KUVA 2AFMA 3SI0A 4X8IA 4LUAA 2POKA 1AUGA 4FAIA 4R9MA 4CS0B 4O23A 1QSMA 4LQGA 1XMBA
chains in the Genus database with same CATH topology
5DWMA 1XEBA 2P6FA 3VWEA 5ISVA 2DPSA 3DNSA 3ZJ0A 5EC4A 3DR6A 3A9LA 3FXTA 4XPKA 4Q36A 1Q2DA 5AG5A 4UWIA 2PR1A 4H89A 3FYNA 2G0BA 2B3VA 2Z3OA 5BWAB 4AVBA 1V0CA 1I1DA 4UFXA 4XNHB 3V8IA 5C82A 1P0HA 2F5IA 3IU1A 5JPHA 4MY3A 5F49A 4A31A 1QSRA 2Q7BA 3BLNA 4B11A 4X5KA 2PRBA 4XPDC 3RYOA 4DNCA 3IWGA 4AG9A 4ZGYB 3QAHA 3H4QA 1Z4RA 2AE6A 3G3SA 3IGRA 3IWEA 1QSNA 4CAVA 2JDDA 3KKWA 2OU2A 4MFZA 1ON0A 2CXAA 5F46A 4CYQA 4KSAA 2EUIA 1VHSA 5HMNA 4MFKA 4MI4A 4CAXA 2ATRA 1NMTA 4Y49C 2G3TA 4LX9A 1UFHA 1IICA 4C2YA 4GS4A 1S60A 2ZW4A 4A30A 3R9GA 3DSBA 4M3SA 4KOYA 4YRHA 4CYOA 4Q38A 1WK4A 4IUSA 4U9ZA 2REEA 4PK2A 4F0XA 3LD2A 2Q0YA 1IB1E 4I49A 4KLVA 2R98A 1YGHA 3SXOA 2QMLA 4UCNA 4KOSA 1Y9WA 4AVCA 4C2XA 1MJAA 4PV6A 2YNCC 2YNDA 3SHPA 2HUZA 1RO5A 2GANA 2R8VA 2OH1A 1R57A 4KVXA 1KZFA 2OZUA 5KTCA 2HV2A 2DXQA 4CGLA 4FD7A 2OZHA 4PSWA 2BUEA 4RS2A 2D4OA 2A4NA 2Z3KA 4BBHA 4C68A 4CAWA 4CRZB 3FBUA 4AG7A 2EVNA 1SQHA 2H5MA 4BMHA 2Z10A 4MFJA 3SXNA 4E0AA 3LODA 2Q4VA 3P2HA 5DWNA 3S6GA 5J8FA 5G22A 4KOUA 2C27A 2HQYA 2VI7A 3TO9A 4U5YA 1XIXA 4UCMA 1J4JA 4R57A 1IYKA 2CNTA 4A32A 5JQ4A 2PSWA 2B58A 2K5TA 1Y7RA 2B4DB 4FD5A 4YFJA 2Z3MA 1CJWA 2FIAA 4QB9A 4L8AA 1TIQA 4QC6A 5H86A 4XNHC 4B5OA 4KS9A 1WWZA 4HKFA 1Q2CA 1S3ZA 4FD6A 4NF1A 2VQYA 2Z0ZA 5HH1A 3WR7A 2GE3A 4KOWA 4RI1A 5C88A 3TOBA 1M1DA 4KOXA 2P6EA 1XMTA 3F8KA 1BOBA 1YX0A 5H84A 1YR0A 3W91A 4JXRA 1M4GA 2P6GA 2Z11A 5AG6A 3I9SA 4KORA 5G21A 3GYAA 4NXYA 4KUAA 3FRMA 4J3GA 4UFVA 4UFWA 5IV0A 3TFYA 4C7HA 1B6BA 5CNPA 3DDDA 2QECA 4C7IA 2R1IA 4KVME 2WUUA 3K9UA 4ONUA 3EO4A 1QSOA 5F48A 3GKRA 3MGDA 3S6HA 1Z4EA 2B5GB 2GIVA 5J8CA 2B3UA 3TO6A 4B12A 2FIWA 4HNXB 4MJ8A 3D2PA 1S5KA 1Q2YA 3FIXA 5GCNA 5IB0A 3CXSA 2Z3LA 4JXQA 4KOTA 3EFAA 2PR8A 2FCKA 2WPXA 2ZW6A 3TCVA 5KTAA 3G8WA 4R3LA 4CYNA 4EVYA 4PSXA 1K4JA 3D8PA 2BL1A 3CXPA 5G1ZA 2KCWA 1P4NA 1S7FA 4XPDB 1KUXA 4A2ZA 3D3SA 4AVAA 5KTDA 5F47A 1QSTA 5IX3A 1N71A 1FY7A 4C2ZA 4KVOE 2J8RA 4II9A 4R87A 2VZYA 4H6UA 2VXKA 1MJ9A 3GY9A 2FE7A 2PDOA 4CAFA 4CGNA 4L89A 4JJXA 3PZJA 1CM0A 1YVKA 1IIDA 1I12A 1M4IA 2JLMA 3QB8A 3B8GA 3OWCA 4MFQA 2Z3PA 4A33A 4OLLA 2PC1A 3TOAA 2CY2A 3BJ8A 3EXNA 3S6KA 3F5BA 3BJ7A 4QVTA 4KZTA 1MK4A 1NE9A 2I00A 3PGPA 2FT0A 1I21A 1Y9KA 4YGOA 3N7ZA 1B87A 3W6SA 3JUWA 1RXTA 2BEIA 4IF5A 3C26A 2G3AA 1L0CA 4B5PA 4NEXA 1NSLA 2YGWA 2ZPAA 4CGOA 4UWJA 1BO4A 1IYLA 1S7NA 2J8NA 1U6MA 2VBQA 4M85A 1M4DA 1LRZA 2YNCA 4B14A 2I79A 4R3KA 1ZO0A 4B13A 1S7KA 2DPTA 2J8MA 2CNMA 5A27A 4OADA 4UBRA 3JVNA 1XF8A 2OB0A 2R7HA 4B10A 2Q04A 4NSQA 4CAEA 4E2AA 1PUAA 3P2FA 2PQ8A 4XPLA 3UY5A 2B4BA 2NMTA 5A28A 4A95A 3T90A 4MFLA 4F6AA 3EY5A 3F0AA 5AGEA 1YREA 2B4DA 4ZBGA 1YVOA 4FD4A 1VKCA 1GHEA 2Z3NA 4K30A 3TTHA 1Z9UA 3FNCA 4MFPA 3H5ZA 4JLYA 2BSWA 4KSFA 3D2MA 3PP9A 3R9EA 4KUBA 3TT2A 5G20A 2Y0MA 3S6FA 3R96A 2Q4YA 2OZGA 2VEZA 2JEVA 2FS5A 4ORFA 4F0YA 4NCZA 2CNSA 5EBVA 3I3GA 1YK3A 4UA3A 3W6XA 3ZZIA 4AB7A 3DR8A 5FVJA 2D4PA 2JDCA 2IL4A 2AJ6A 3JTKA 2B5GA 2ZW7A 1KUYA 4E8OA 4JWPA 3VWDA 2ZXVA 3R1KA 4MHDA 3EC4A 5I0CA 2QIRA 4Y49B 2FL4A 1YLEA 4PK3A 2REFA 2YNEA 3NE7A 4UCPA 1M44A 1S7LA 2WSAA 2Q44A 3FB3A 4CRYB 1MJBA 2WPWA 2FSRA 1OZPA 2P0WA 3IU2A 4KOVA 4CGMA 4JD6A 2ARHA 4B5PB 2O28A 2FXFA 4QUSA 3E0KA 3T9YA 4HNYB 1XE4A 4U9YA 4MY0A 3CXQA 4H6ZA 4OAEA 4QBJA 4CGPA 4HNWB 4MBUA 5AG4A 5AG7A 2VZZA 2X7BA 1PU9A 4CYPA 3R9FA 3R95A 2ZW5A 3TO7A 2RC4A 5E96A 4KLWA 3TE4A 1KUVA 4LUAA 4R9MA 4CS0B 1QSMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5DWM A;  1XEB A;  2P6F A;  3VWE A;  5ISV A;  3DNS A;  3ZJ0 A;  5EC4 A;  3DR6 A;  3FXT A;  4XPK A;  1Q2D A;  4UWI A;  2PR1 A;  4H89 A;  3FYN A;  2G0B A;  2B3V A;  4AVB A;  1V0C A;  1I1D A;  4XNH B;  3V8I A;  5C82 A;  1P0H A;  2F5I A;  5JPH A;  4MY3 A;  5F49 A;  1QSR A;  2Q7B A;  3BLN A;  4X5K A;  2PRB A;  4XPD C;  3RYO A;  4DNC A;  3IWG A;  4AG9 A;  3QAH A;  3H4Q A;  1Z4R A;  2AE6 A;  3G3S A;  3IGR A;  1QSN A;  4CAV A;  2JDD A;  3KKW A;  2OU2 A;  1ON0 A;  5F46 A;  2EUI A;  1VHS A;  5HMN A;  4MI4 A;  4CAX A;  2ATR A;  1NMT A;  4Y49 C;  2G3T A;  4LX9 A;  1UFH A;  1IIC A;  4GS4 A;  1S60 A;  2ZW4 A;  3R9G A;  3DSB A;  4M3S A;  4KOY A;  4YRH A;  1WK4 A;  4IUS A;  4U9Z A;  2REE A;  4PK2 A;  3LD2 A;  2Q0Y A;  1IB1 E;  4I49 A;  4KLV A;  2R98 A;  1YGH A;  3SXO A;  2QML A;  4KOS A;  1Y9W A;  4AVC A;  1MJA A;  4PV6 A;  3SHP A;  2HUZ A;  1RO5 A;  2GAN A;  2R8V A;  2OH1 A;  1R57 A;  4KVX A;  1KZF A;  2OZU A;  5KTC A;  2HV2 A;  2DXQ A;  4FD7 A;  2OZH A;  4PSW A;  2BUE A;  4RS2 A;  2D4O A;  2A4N A;  4CAW A;  4CRZ B;  3FBU A;  4AG7 A;  2EVN A;  1SQH A;  2H5M A;  4BMH A;  2Z10 A;  3SXN A;  4E0A A;  3LOD A;  2Q4V A;  3P2H A;  5DWN A;  3S6G A;  5J8F A;  4KOU A;  2C27 A;  2HQY A;  2VI7 A;  3TO9 A;  4U5Y A;  1XIX A;  1J4J A;  4R57 A;  1IYK A;  2CNT A;  5JQ4 A;  2PSW A;  2B58 A;  2K5T A;  1Y7R A;  2B4D B;  4FD5 A;  4YFJ A;  1CJW A;  2FIA A;  4QB9 A;  4L8A A;  1TIQ A;  4QC6 A;  5H86 A;  4XNH C;  4B5O A;  1WWZ A;  4HKF A;  1Q2C A;  1S3Z A;  4FD6 A;  4NF1 A;  2VQY A;  2Z0Z A;  5HH1 A;  3WR7 A;  2GE3 A;  4KOW A;  4RI1 A;  5C88 A;  3TOB A;  1M1D A;  4KOX A;  2P6E A;  1XMT A;  3F8K A;  1BOB A;  1YX0 A;  5H84 A;  1YR0 A;  3W91 A;  4JXR A;  1M4G A;  2P6G A;  2Z11 A;  3I9S A;  4KOR A;  3GYA A;  4NXY A;  4KUA A;  3FRM A;  4J3G A;  5IV0 A;  3TFY A;  1B6B A;  5CNP A;  3DDD A;  2QEC A;  2R1I A;  4KVM E;  3K9U A;  4ONU A;  3EO4 A;  1QSO A;  5F48 A;  3GKR A;  3MGD A;  3S6H A;  1Z4E A;  2B5G B;  2GIV A;  5J8C A;  2B3U A;  3TO6 A;  2FIW A;  4HNX B;  4MJ8 A;  3D2P A;  1S5K A;  1Q2Y A;  3FIX A;  5GCN A;  5IB0 A;  3CXS A;  4JXQ A;  4KOT A;  3EFA A;  2PR8 A;  2FCK A;  2WPX A;  2ZW6 A;  3TCV A;  5KTA A;  3G8W A;  4R3L A;  4EVY A;  4PSX A;  1K4J A;  3D8P A;  2BL1 A;  3CXP A;  2KCW A;  1P4N A;  1S7F A;  4XPD B;  1KUX A;  5KTD A;  3D3S A;  4AVA A;  5F47 A;  1QST A;  5IX3 A;  1N71 A;  1FY7 A;  4II9 A;  4KVO E;  2J8R A;  4R87 A;  2VZY A;  4H6U A;  2VXK A;  1MJ9 A;  3GY9 A;  2FE7 A;  2PDO A;  4L89 A;  4JJX A;  3PZJ A;  1CM0 A;  1YVK A;  1IID A;  1I12 A;  1M4I A;  2JLM A;  3QB8 A;  3B8G A;  3OWC A;  4OLL A;  2PC1 A;  3TOA A;  2CY2 A;  3BJ8 A;  3EXN A;  3S6K A;  3F5B A;  3BJ7 A;  4QVT A;  4KZT A;  1MK4 A;  1NE9 A;  2I00 A;  3PGP A;  2FT0 A;  1I21 A;  1Y9K A;  4YGO A;  3N7Z A;  1B87 A;  3W6S A;  3JUW A;  1RXT A;  2BEI A;  4IF5 A;  3C26 A;  2G3A A;  1L0C A;  4B5P A;  4NEX A;  1NSL A;  2ZPA A;  4UWJ A;  1BO4 A;  1IYL A;  1S7N A;  2J8N A;  1U6M A;  2VBQ A;  4M85 A;  1M4D A;  1LRZ A;  2I79 A;  4R3K A;  1S7K A;  2J8M A;  2CNM A;  4OAD A;  4UBR A;  3JVN A;  1XF8 A;  2OB0 A;  2R7H A;  2Q04 A;  4NSQ A;  4E2A A;  1PUA A;  3P2F A;  2PQ8 A;  4XPL A;  3UY5 A;  2B4B A;  2NMT A;  3T90 A;  4F6A A;  3EY5 A;  3F0A A;  1YRE A;  2B4D A;  4ZBG A;  1YVO A;  4FD4 A;  1VKC A;  1GHE A;  4K30 A;  3TTH A;  1Z9U A;  3FNC A;  4JLY A;  2BSW A;  3D2M A;  3PP9 A;  3R9E A;  4KUB A;  3TT2 A;  2Y0M A;  3S6F A;  3R96 A;  2Q4Y A;  2OZG A;  2VEZ A;  2JEV A;  2FS5 A;  4ORF A;  4F0Y A;  4NCZ A;  2CNS A;  5EBV A;  3I3G A;  1YK3 A;  4UA3 A;  3W6X A;  3ZZI A;  4AB7 A;  3DR8 A;  5FVJ A;  2D4P A;  2JDC A;  2IL4 A;  2AJ6 A;  2B5G A;  2ZW7 A;  1KUY A;  4E8O A;  4JWP A;  3VWD A;  2ZXV A;  3R1K A;  4MHD A;  3EC4 A;  5I0C A;  2QIR A;  4Y49 B;  2FL4 A;  1YLE A;  4PK3 A;  2REF A;  3NE7 A;  1M44 A;  1S7L A;  2Q44 A;  3FB3 A;  4CRY B;  1MJB A;  2WPW A;  2FSR A;  1OZP A;  2P0W A;  4KOV A;  4JD6 A;  2ARH A;  4B5P B;  2O28 A;  2FXF A;  4QUS A;  3E0K A;  3T9Y A;  4HNY B;  1XE4 A;  4U9Y A;  4MY0 A;  3CXQ A;  4H6Z A;  4OAE A;  4QBJ A;  4HNW B;  4MBU A;  2VZZ A;  2X7B A;  1PU9 A;  3R9F A;  3R95 A;  2ZW5 A;  3TO7 A;  2RC4 A;  5E96 A;  4KLW A;  3TE4 A;  1KUV A;  4LUA A;  4R9M A;  4CS0 B;  1QSM A; 
#chains in the Genus database with same CATH topology
 5DWM A;  1HDQ A;  4Q7A A;  1XEB A;  3FVL A;  3H8E A;  2F8H A;  2P6F A;  2GRE A;  4NGR A;  3VWE A;  5ISV A;  4H2K A;  2DPS A;  3DNS A;  3ISZ A;  4RN7 A;  4PQA A;  3TX8 A;  3ZJ0 A;  1ZG8 A;  3DR6 A;  5EC4 A;  3A9L A;  3FXT A;  3PEI A;  4XPK A;  4Q36 A;  1Q2D A;  5AG5 A;  4UWI A;  5LRJ A;  2JBJ A;  2PR1 A;  2BO9 A;  4H89 A;  1Z5R A;  3FYN A;  2G0B A;  2B3V A;  3BHX A;  2Z3O A;  3T8W A;  4IHM A;  4MHZ A;  3RAM A;  4MXU A;  5BWA B;  1CPS A;  4AVB A;  1X10 A;  3DLJ A;  1XJO A;  1ELM P;  4ZX9 A;  1V0C A;  1I1D A;  4MRI A;  4UFX A;  2PJ8 A;  4XNH B;  2HC9 A;  1VHO A;  3V8I A;  3B3V A;  5C82 A;  1P0H A;  3KGQ A;  2F5I A;  3IU1 A;  4GXH A;  3PB7 X;  4MY3 A;  5JPH A;  5F49 A;  4A31 A;  4Z65 A;  1QSR A;  3KI9 A;  4M6I A;  2GU2 A;  3CDX A;  1HEE A;  2Q7B A;  3NE8 A;  5HXD A;  3BLN A;  1CG2 A;  4B11 A;  3QAY A;  4F9U A;  2ZOF A;  4X5K A;  2PRB A;  3FJU A;  4XPD C;  3RYO A;  2QVP A;  4DNC A;  3IWG A;  3PFE A;  4AG9 A;  4ZGY B;  3QAH A;  2EK8 A;  3H4Q A;  1Z4R A;  2AE6 A;  3G3S A;  3IGR A;  1JQG A;  4YWY A;  4FUU A;  3IWE A;  1QSN A;  4R8F A;  4CAV A;  2EBJ A;  4DYO A;  3BI1 A;  2JDD A;  2Q7S A;  3KKW A;  2OU2 A;  4UIB A;  4MFZ A;  1ON0 A;  4R7M A;  1LAP A;  2CXA A;  2DF5 A;  5F46 A;  4CYQ A;  4KSA A;  2EUI A;  4EWT A;  2PE3 A;  2FVG A;  1VHS A;  2DEA A;  5HMN A;  5HVG A;  3SJX A;  4A38 A;  4P4B A;  4ZY2 A;  4MFK A;  4MI4 A;  3VH9 A;  4CAX A;  2ATR A;  1NMT A;  4Y49 C;  3KZW A;  2G3T A;  2V8V A;  4LX9 A;  1UFH A;  1IIC A;  4C2Y A;  3K2K A;  1OBR A;  4GS4 A;  1S60 A;  2ZW4 A;  4A30 A;  3R9G A;  3DSB A;  1Q7L A;  4M3S A;  2O4H A;  1TF8 A;  4KOY A;  4YRH A;  3D7D A;  4Q38 A;  1Y0R A;  4MCR A;  4CYO A;  1WK4 A;  4IUS A;  3S9L A;  4U9Z A;  2IMO A;  2IQ6 A;  2REE A;  4PK2 A;  3LD2 A;  4F0X A;  2Q0Y A;  1IB1 E;  2PJ3 A;  2F7V A;  4P45 A;  5K8N A;  5F09 A;  4I49 A;  4KLV A;  1F2P A;  1Y0Y A;  2VL1 A;  2R98 A;  1YGH A;  3SXO A;  2QML A;  2BOA A;  4UCN A;  4NFR A;  4KOS A;  1Y9W A;  1YW6 A;  3PFO A;  4AVC A;  4C2X A;  4BIN A;  1MJA A;  4PV6 A;  2YNC C;  1X12 A;  2YND A;  3SHP A;  5LYL A;  2HUZ A;  4EFD A;  1RO5 A;  4P6Y A;  1LCP A;  2RFH A;  2GAN A;  2R8V A;  2OH1 A;  4R76 A;  3JRU A;  1R57 A;  3B35 A;  5K8O A;  3KQZ A;  4KVX A;  1KZF A;  3B3S A;  2OZU A;  5KTC A;  4NGN A;  4A94 A;  3LWU A;  2HV2 A;  2DXQ A;  4CGL A;  4FD7 A;  1F2O A;  2OZH A;  2ZEL A;  2BUE A;  4PSW A;  4RS2 A;  2D4O A;  2A4N A;  2Z3K A;  1TKF A;  4BBH A;  4C68 A;  3V38 A;  4CAW A;  4CRZ B;  3FBU A;  4AG7 A;  2EVN A;  1SQH A;  2H5M A;  4BMH A;  4WJB A;  2Z10 A;  4MFJ A;  1DE4 C;  3IC1 A;  3SXN A;  4E0A A;  4OC0 A;  3PRT A;  4NJR A;  2BCO A;  2PIZ A;  2Q4V A;  3LOD A;  2V77 A;  3P2H A;  5DWN A;  3S6G A;  4ZY0 A;  5J8F A;  3FEC A;  5G22 A;  4KOU A;  1CX8 A;  2C27 A;  2HQY A;  2VI7 A;  2QJ8 A;  1Z8W A;  4U5Y A;  3TO9 A;  3D67 A;  1XIX A;  4UCM A;  3D66 A;  2IJZ A;  1XBU A;  1J4J A;  4R57 A;  4K3N A;  4FWU A;  2RB7 A;  1ARM A;  1IYK A;  1VGY A;  2CNT A;  2PJB A;  3TC8 A;  3CPA A;  4A32 A;  5JQ4 A;  2PSW A;  2B58 A;  2K5T A;  1Y7R A;  2B4D B;  2ODF A;  2JBK A;  4FD5 A;  1Z2L A;  5LYD A;  4YFJ A;  2Z3M A;  1CJW A;  3PBB A;  4MMO A;  2FIA A;  4QB9 A;  3PB4 X;  4L8A A;  1TIQ A;  1PCA A;  4QC6 A;  3N5F A;  2QYV A;  5H86 A;  3VAT A;  2GLF A;  4XNH C;  3IIB A;  4MCP A;  4B5O A;  4KS9 A;  1WWZ A;  2V8G A;  4HKF A;  4TNU A;  4UF4 A;  5HVF A;  5THW A;  5EMI A;  1Q2C A;  1A2Z A;  3GUX A;  1S3Z A;  2AFX A;  4FD6 A;  4NF1 A;  4PXE A;  2VQY A;  2Z0Z A;  5HH1 A;  3WR7 A;  4ZY1 A;  2GE3 A;  1CPX A;  4KOW A;  3NH4 A;  4RI1 A;  5C88 A;  3TOB A;  1M1D A;  4KOX A;  4CPA A;  2P6E A;  1XMT A;  2EK9 A;  1BOB A;  1YX0 A;  3D7G A;  3F8K A;  3FMC A;  1YR0 A;  5D8N A;  5H84 A;  4TWE A;  3W91 A;  4EME A;  4JXR A;  3IO1 A;  1M4G A;  2P6G A;  2Z11 A;  3KHZ A;  2JEW A;  2PJ6 A;  5AG6 A;  3I9S A;  4KOR A;  5LYI A;  3SI2 A;  5G21 A;  3GYA A;  4NXY A;  4KUA A;  4OC3 A;  3CZX A;  3FRM A;  4J3G A;  4UFV A;  4UFW A;  3DGV A;  4ONW A;  2ZED A;  5IV0 A;  1TXR A;  1ZG9 A;  1CBX A;  4C7H A;  1B6B A;  3TFY A;  4IAV A;  5CNP A;  3FH4 A;  3DDD A;  5CBM A;  1LAN A;  2QEC A;  4C7I A;  4MHP A;  2R1I A;  3IFE A;  3ISX A;  3B7I A;  4KVM E;  2WUU A;  3K9U A;  1VIX A;  3EO4 A;  4ONU A;  2V8H A;  1QSO A;  5F48 A;  3GKR A;  3MGD A;  3RZA A;  3S6H A;  3B2Y A;  1Z4E A;  2B5G B;  2GIV A;  2Q43 A;  5J8C A;  2B3U A;  3TO6 A;  2G9D A;  4B12 A;  2FIW A;  3S9N A;  2ZEE A;  4PPZ A;  7CPA A;  4MHY A;  1Y7E A;  2J9A A;  3HUV A;  4HNX B;  4AXV A;  5J1Q A;  4MJ8 A;  3D2P A;  1S5K A;  1Q2Y A;  3CT9 A;  3FIX A;  5GCN A;  2AFU A;  5IB0 A;  1YLO A;  2PJ4 A;  2Z3L A;  3CXS A;  5JH9 A;  4JXQ A;  3WC6 A;  4KOT A;  4UIA A;  3KAS A;  3EFA A;  2PR8 A;  2FCK A;  2WPX A;  2ZW6 A;  3TCV A;  5KTA A;  4B6Z A;  4ZYQ A;  1CP7 A;  3G8W A;  2I3C A;  4R3L A;  4CYN A;  2HB6 A;  4PSX A;  4EVY A;  1K4J A;  5LRG A;  2BL1 A;  3CXP A;  3D8P A;  5G1Z A;  2PJC A;  2KCW A;  1P4N A;  1S7F A;  4XPD B;  1KUX A;  4A2Z A;  3D3S A;  4AVA A;  4FBE A;  5KTD A;  4UEZ A;  1QST A;  5F47 A;  3PB8 X;  5IX3 A;  3KL9 A;  1N71 A;  1YQE A;  1FY7 A;  4C2Z A;  4KVO E;  2J8R A;  2NYQ A;  3KR4 A;  4OC1 A;  4II9 A;  3B3T A;  4UEF A;  2EO8 A;  4R87 A;  2VZY A;  3K9T A;  3SJG A;  5LRK A;  4X3R A;  2OOT A;  1AMP A;  4H6U A;  2ZEM A;  1BAV A;  3IEH A;  4OME A;  1NSA A;  1Z8X A;  2VXK A;  1MJ9 A;  3GY9 A;  2FE7 A;  2PDO A;  8CPA A;  1RTQ A;  4CAF A;  4CGN A;  1R3N A;  4OC4 A;  4L89 A;  4JJX A;  3PZJ A;  3WAB A;  1CM0 A;  1YVK A;  4F9V A;  1IID A;  3GB0 A;  2GLJ A;  1I12 A;  2PJ9 A;  1M4I A;  4M6H A;  1ARL A;  1Z8L A;  1PYT B;  2JLM A;  3B8G A;  3OWC A;  2Z3P A;  3QB8 A;  4MFQ A;  4A33 A;  4OLL A;  2PC1 A;  3TOA A;  2CY2 A;  3RBU A;  3BJ8 A;  3EXN A;  3S6K A;  3F5B A;  3BJ7 A;  4QVT A;  3SJE A;  1LFW A;  2ZEO A;  4KZT A;  1MK4 A;  3NA6 A;  1QMU A;  1NE9 A;  2I00 A;  3SJF A;  3PGP A;  2FT0 A;  3D7H A;  1I21 A;  3IWW A;  4P44 A;  3GLJ A;  1Y9K A;  4YGO A;  1IGB A;  3N7Z A;  1B87 A;  1YW4 A;  2PVV A;  3NH8 A;  3JUW A;  1RXT A;  3W6S A;  2BEI A;  4IF5 A;  3C26 A;  2G3A A;  1L0C A;  3D4U A;  3KQX A;  4B5P A;  2ANP A;  4NEX A;  3KR5 A;  1NSL A;  2YGW A;  2Q51 A;  2ZPA A;  4CGO A;  1IOF A;  3B3W A;  4KSI A;  1BO4 A;  1IYL A;  4UWJ A;  1S7N A;  5JGF A;  4F8Z A;  1H8L A;  2J8N A;  1U6M A;  2VBQ A;  3QNV A;  1BPM A;  4M85 A;  1M4D A;  2XEF A;  1LRZ A;  2YNC A;  4B14 A;  2I79 A;  4DJL A;  3B3C A;  4R3K A;  1ZO0 A;  1LOK A;  2GFQ A;  4M6G A;  4HPS A;  4B13 A;  1S7K A;  3H8F A;  2DPT A;  2J8M A;  2CNM A;  5A27 A;  2XEG A;  4OAD A;  1EE3 P;  4UBR A;  3JVN A;  1XF8 A;  2OB0 A;  1ZLH A;  2R7H A;  4B10 A;  2CIJ A;  3H8G A;  2PIY A;  3LMS A;  2Q04 A;  4NSQ A;  4OID A;  3PB9 X;  4CAE A;  4E2A A;  1PUA A;  3D68 A;  3P2F A;  2PQ8 A;  4NGQ A;  4XPL A;  4W9Y A;  3UY5 A;  2B4B A;  2NMT A;  1Z8T A;  1ZG7 A;  5A28 A;  5I4M A;  2PJ0 A;  3VAR A;  4A95 A;  3WC5 A;  4OC2 A;  3T90 A;  4MFL A;  4P4D A;  3NH5 A;  4F6A A;  4DUK A;  4PXB A;  3EY5 A;  3F0A A;  1XRY A;  5AGE A;  3PB6 X;  4UEE A;  1DTD A;  1IU8 A;  1TKH A;  1YRE A;  2XEI A;  5HVH A;  5K8P A;  5JM6 A;  2B4D A;  4ZBG A;  5CPA A;  1YVO A;  2ZEF A;  1TF9 A;  4FD4 A;  4P4J A;  3KHX A;  1YME A;  1VKC A;  1GHE A;  2Z3N A;  3GIU A;  4K30 A;  3TTH A;  1Z9U A;  3FNC A;  4MFP A;  4JYW A;  3H5Z A;  1M4L A;  2WYR A;  2ZEP A;  2O53 A;  4JLY A;  4JZ0 A;  2BSW A;  2ZEG A;  4R6T A;  2V8D A;  4PXD A;  4KSF A;  1LAM A;  3D2M A;  1ZLI A;  3PP9 A;  3WT4 A;  3R9E A;  2PRQ A;  4KUB A;  3TT2 A;  5D29 A;  5G20 A;  2Y0M A;  3S6F A;  3R96 A;  2Q4Y A;  2ABZ A;  2OZG A;  2PVW A;  2ZEH A;  1FNO A;  2PCU A;  3CPX A;  2VEZ A;  1GYT A;  2JEV A;  2PJ7 A;  3D7F A;  1XFO A;  1BLL E;  2FS5 A;  4RUH A;  4ORF A;  2WZN A;  4F0Y A;  4NCZ A;  5IB9 A;  2CNS A;  2PJ1 A;  3IJ3 A;  3I3G A;  3MN8 A;  4P4E A;  5EBV A;  1YK3 A;  4UA3 A;  1YSJ A;  2C6G A;  3W6X A;  4OC5 A;  3ZZI A;  4AB7 A;  3DR8 A;  4WWV A;  3SI1 A;  3V7Z A;  2EWB A;  5FVJ A;  3BXM A;  4OP4 A;  2D4P A;  3FED A;  2AFO A;  1QQ9 A;  1F57 A;  4PXC A;  3RO0 A;  2JDC A;  2IL4 A;  5LYF A;  2CTC A;  2AJ6 A;  3LAC A;  2AFW A;  3BI0 A;  3JTK A;  2PJA A;  2B5G A;  2ZW7 A;  1ELL P;  1KUY A;  4G1P A;  4E8O A;  3FF3 A;  4JWP A;  4NGP A;  2CF4 A;  2Q4Z A;  5DS0 A;  3VWD A;  2AFZ A;  4ZX8 A;  1R43 A;  1IY7 A;  2XEJ A;  2ZXV A;  3R1K A;  4P4F A;  4MHD A;  4YU9 A;  4A37 A;  2C6C A;  3EC4 A;  1JWQ A;  4P10 A;  2QIR A;  3S9M A;  4Y49 B;  2FL4 A;  5I0C A;  4BD9 A;  1YLE A;  2CTB A;  4PK3 A;  2REF A;  5K8M A;  2YNE A;  3MRU A;  3NE7 A;  4LQ6 A;  4UCP A;  1M44 A;  1S7L A;  2WSA A;  2Q44 A;  4X2T A;  3FB3 A;  4MHN A;  4CRY B;  1MJB A;  1CP6 A;  2WPW A;  3FEE A;  4OIW A;  3L2N A;  4MCQ A;  1BPN A;  2FSR A;  1OZP A;  2C6P A;  2P0W A;  4NJQ A;  3IU2 A;  1FT7 A;  4KOV A;  2C1C A;  4CGM A;  2OR4 A;  4JD6 A;  2ARH A;  4B5P B;  1VHE A;  2O28 A;  3I1U A;  1XOV A;  4OKO A;  4GM5 A;  3WC7 A;  2ZOG A;  2FXF A;  4QUS A;  3E0K A;  4MCS A;  4ZI6 A;  3T9Y A;  4HNY B;  3PBE A;  4NGS A;  1XE4 A;  4U9Y A;  4MY0 A;  3CXQ A;  2PJ2 A;  4H6Z A;  2ZEN A;  4OAE A;  4QBJ A;  4CGP A;  4HNW B;  4MBU A;  4NGT A;  5AG4 A;  5ELY A;  5AG7 A;  1TKJ A;  1HDU A;  2VZZ A;  6CPA A;  2X7B A;  1PU9 A;  1IOI A;  3RNZ A;  3HLP A;  4NGM A;  2AFS A;  3FX6 A;  4IK2 A;  2NSM A;  3NFZ A;  4A39 A;  2PJ5 A;  4CYP A;  3R9F A;  3R95 A;  2ZW5 A;  3TO7 A;  2RC4 A;  1AYE A;  1UWY A;  4KLW A;  5E96 A;  3TE4 A;  4P4I A;  1KWM A;  1KUV A;  2AFM A;  3SI0 A;  4X8I A;  4LUA A;  2POK A;  1AUG A;  4FAI A;  4R9M A;  4CS0 B;  4O23 A;  1QSM A;  4LQG A;  1XMB A; 
#chains in the Genus database with same CATH homology
 5DWM A;  1XEB A;  2P6F A;  3VWE A;  5ISV A;  2DPS A;  3DNS A;  3ZJ0 A;  5EC4 A;  3DR6 A;  3A9L A;  3FXT A;  4XPK A;  4Q36 A;  1Q2D A;  5AG5 A;  4UWI A;  2PR1 A;  4H89 A;  3FYN A;  2G0B A;  2B3V A;  2Z3O A;  5BWA B;  4AVB A;  1V0C A;  1I1D A;  4UFX A;  4XNH B;  3V8I A;  5C82 A;  1P0H A;  2F5I A;  3IU1 A;  5JPH A;  4MY3 A;  5F49 A;  4A31 A;  1QSR A;  2Q7B A;  3BLN A;  4B11 A;  4X5K A;  2PRB A;  4XPD C;  3RYO A;  4DNC A;  3IWG A;  4AG9 A;  4ZGY B;  3QAH A;  3H4Q A;  1Z4R A;  2AE6 A;  3G3S A;  3IGR A;  3IWE A;  1QSN A;  4CAV A;  2JDD A;  3KKW A;  2OU2 A;  4MFZ A;  1ON0 A;  2CXA A;  5F46 A;  4CYQ A;  4KSA A;  2EUI A;  1VHS A;  5HMN A;  4MFK A;  4MI4 A;  4CAX A;  2ATR A;  1NMT A;  4Y49 C;  2G3T A;  4LX9 A;  1UFH A;  1IIC A;  4C2Y A;  4GS4 A;  1S60 A;  2ZW4 A;  4A30 A;  3R9G A;  3DSB A;  4M3S A;  4KOY A;  4YRH A;  4CYO A;  4Q38 A;  1WK4 A;  4IUS A;  4U9Z A;  2REE A;  4PK2 A;  4F0X A;  3LD2 A;  2Q0Y A;  1IB1 E;  4I49 A;  4KLV A;  2R98 A;  1YGH A;  3SXO A;  2QML A;  4UCN A;  4KOS A;  1Y9W A;  4AVC A;  4C2X A;  1MJA A;  4PV6 A;  2YNC C;  2YND A;  3SHP A;  2HUZ A;  1RO5 A;  2GAN A;  2R8V A;  2OH1 A;  1R57 A;  4KVX A;  1KZF A;  2OZU A;  5KTC A;  2HV2 A;  2DXQ A;  4CGL A;  4FD7 A;  2OZH A;  4PSW A;  2BUE A;  4RS2 A;  2D4O A;  2A4N A;  2Z3K A;  4BBH A;  4C68 A;  4CAW A;  4CRZ B;  3FBU A;  4AG7 A;  2EVN A;  1SQH A;  2H5M A;  4BMH A;  2Z10 A;  4MFJ A;  3SXN A;  4E0A A;  3LOD A;  2Q4V A;  3P2H A;  5DWN A;  3S6G A;  5J8F A;  5G22 A;  4KOU A;  2C27 A;  2HQY A;  2VI7 A;  3TO9 A;  4U5Y A;  1XIX A;  4UCM A;  1J4J A;  4R57 A;  1IYK A;  2CNT A;  4A32 A;  5JQ4 A;  2PSW A;  2B58 A;  2K5T A;  1Y7R A;  2B4D B;  4FD5 A;  4YFJ A;  2Z3M A;  1CJW A;  2FIA A;  4QB9 A;  4L8A A;  1TIQ A;  4QC6 A;  5H86 A;  4XNH C;  4B5O A;  4KS9 A;  1WWZ A;  4HKF A;  1Q2C A;  1S3Z A;  4FD6 A;  4NF1 A;  2VQY A;  2Z0Z A;  5HH1 A;  3WR7 A;  2GE3 A;  4KOW A;  4RI1 A;  5C88 A;  3TOB A;  1M1D A;  4KOX A;  2P6E A;  1XMT A;  3F8K A;  1BOB A;  1YX0 A;  5H84 A;  1YR0 A;  3W91 A;  4JXR A;  1M4G A;  2P6G A;  2Z11 A;  5AG6 A;  3I9S A;  4KOR A;  5G21 A;  3GYA A;  4NXY A;  4KUA A;  3FRM A;  4J3G A;  4UFV A;  4UFW A;  5IV0 A;  3TFY A;  4C7H A;  1B6B A;  5CNP A;  3DDD A;  2QEC A;  4C7I A;  2R1I A;  4KVM E;  2WUU A;  3K9U A;  4ONU A;  3EO4 A;  1QSO A;  5F48 A;  3GKR A;  3MGD A;  3S6H A;  1Z4E A;  2B5G B;  2GIV A;  5J8C A;  2B3U A;  3TO6 A;  4B12 A;  2FIW A;  4HNX B;  4MJ8 A;  3D2P A;  1S5K A;  1Q2Y A;  3FIX A;  5GCN A;  5IB0 A;  3CXS A;  2Z3L A;  4JXQ A;  4KOT A;  3EFA A;  2PR8 A;  2FCK A;  2WPX A;  2ZW6 A;  3TCV A;  5KTA A;  3G8W A;  4R3L A;  4CYN A;  4EVY A;  4PSX A;  1K4J A;  3D8P A;  2BL1 A;  3CXP A;  5G1Z A;  2KCW A;  1P4N A;  1S7F A;  4XPD B;  1KUX A;  4A2Z A;  3D3S A;  4AVA A;  5KTD A;  5F47 A;  1QST A;  5IX3 A;  1N71 A;  1FY7 A;  4C2Z A;  4KVO E;  2J8R A;  4II9 A;  4R87 A;  2VZY A;  4H6U A;  2VXK A;  1MJ9 A;  3GY9 A;  2FE7 A;  2PDO A;  4CAF A;  4CGN A;  4L89 A;  4JJX A;  3PZJ A;  1CM0 A;  1YVK A;  1IID A;  1I12 A;  1M4I A;  2JLM A;  3QB8 A;  3B8G A;  3OWC A;  4MFQ A;  2Z3P A;  4A33 A;  4OLL A;  2PC1 A;  3TOA A;  2CY2 A;  3BJ8 A;  3EXN A;  3S6K A;  3F5B A;  3BJ7 A;  4QVT A;  4KZT A;  1MK4 A;  1NE9 A;  2I00 A;  3PGP A;  2FT0 A;  1I21 A;  1Y9K A;  4YGO A;  3N7Z A;  1B87 A;  3W6S A;  3JUW A;  1RXT A;  2BEI A;  4IF5 A;  3C26 A;  2G3A A;  1L0C A;  4B5P A;  4NEX A;  1NSL A;  2YGW A;  2ZPA A;  4CGO A;  4UWJ A;  1BO4 A;  1IYL A;  1S7N A;  2J8N A;  1U6M A;  2VBQ A;  4M85 A;  1M4D A;  1LRZ A;  2YNC A;  4B14 A;  2I79 A;  4R3K A;  1ZO0 A;  4B13 A;  1S7K A;  2DPT A;  2J8M A;  2CNM A;  5A27 A;  4OAD A;  4UBR A;  3JVN A;  1XF8 A;  2OB0 A;  2R7H A;  4B10 A;  2Q04 A;  4NSQ A;  4CAE A;  4E2A A;  1PUA A;  3P2F A;  2PQ8 A;  4XPL A;  3UY5 A;  2B4B A;  2NMT A;  5A28 A;  4A95 A;  3T90 A;  4MFL A;  4F6A A;  3EY5 A;  3F0A A;  5AGE A;  1YRE A;  2B4D A;  4ZBG A;  1YVO A;  4FD4 A;  1VKC A;  1GHE A;  2Z3N A;  4K30 A;  3TTH A;  1Z9U A;  3FNC A;  4MFP A;  3H5Z A;  4JLY A;  2BSW A;  4KSF A;  3D2M A;  3PP9 A;  3R9E A;  4KUB A;  3TT2 A;  5G20 A;  2Y0M A;  3S6F A;  3R96 A;  2Q4Y A;  2OZG A;  2VEZ A;  2JEV A;  2FS5 A;  4ORF A;  4F0Y A;  4NCZ A;  2CNS A;  5EBV A;  3I3G A;  1YK3 A;  4UA3 A;  3W6X A;  3ZZI A;  4AB7 A;  3DR8 A;  5FVJ A;  2D4P A;  2JDC A;  2IL4 A;  2AJ6 A;  3JTK A;  2B5G A;  2ZW7 A;  1KUY A;  4E8O A;  4JWP A;  3VWD A;  2ZXV A;  3R1K A;  4MHD A;  3EC4 A;  5I0C A;  2QIR A;  4Y49 B;  2FL4 A;  1YLE A;  4PK3 A;  2REF A;  2YNE A;  3NE7 A;  4UCP A;  1M44 A;  1S7L A;  2WSA A;  2Q44 A;  3FB3 A;  4CRY B;  1MJB A;  2WPW A;  2FSR A;  1OZP A;  2P0W A;  3IU2 A;  4KOV A;  4CGM A;  4JD6 A;  2ARH A;  4B5P B;  2O28 A;  2FXF A;  4QUS A;  3E0K A;  3T9Y A;  4HNY B;  1XE4 A;  4U9Y A;  4MY0 A;  3CXQ A;  4H6Z A;  4OAE A;  4QBJ A;  4CGP A;  4HNW B;  4MBU A;  5AG4 A;  5AG7 A;  2VZZ A;  2X7B A;  1PU9 A;  4CYP A;  3R9F A;  3R95 A;  2ZW5 A;  3TO7 A;  2RC4 A;  5E96 A;  4KLW A;  3TE4 A;  1KUV A;  4LUA A;  4R9M A;  4CS0 B;  1QSM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...