4IUSA

Gcn5-related n-acetyltransferase from kribbella flavida.
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
259
structure length
257
Chain Sequence
AMGIAARIASAQLQGLVRSRRQVVAGPLVGLLHDEDVWFLSRAVAAEPGVPFDPAEVPWALETIRKAFAAEDRWLSAELVEEANPGLAYVLVEHGMTIVSRPPLLAVEPGDLLVPEFPAGVTAAVVASAEEQEAANAIAGDAYETDASPFQPEPADGGAVLIRMDGVPVATAAWTAIADGVTEVAGVGTLHSHRRQGLGALATAYATQQAFEVGGATLAWLTPGDDGADRIYRRLGYEPKATAVHLGDPGGHLADLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title GCN5-related N-acetyltransferase from Kribbella flavida.
rcsb
source organism Kribbella flavida
molecule tags Transferase
molecule keywords GCN5-related N-acetyltransferase
total genus 76
structure length 257
sequence length 259
ec nomenclature ec 2.3.1.128: Transferred entry: 2.3.1.267.
pdb deposition date 2013-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4iusA00
2QIRA 3D2PA 4R3KA 4CS0B 3FB3A 4XNHB 2VXKA 3R9EA 5F47A 5C82A 4I49A 1Z9UA 1S7NA 5KTDA 1SQHA 3F8KA 2AJ6A 3EXNA 3KKWA 1S7FA 2VQYA 2I79A 1IYLA 1MK4A 2VI7A 5HMNA 4FD4A 2CNSA 1N71A 1U6MA 1M4DA 4DNCA 4Y49B 5F48A 2B5GA 2ZW4A 3FXTA 2ZW7A 4KUBA 2B4DB 2QECA 1OZPA 3F0AA 4CRZB 2VZYA 1RO5A 2WPWA 4ORFA 4KOXA 4JWPA 5GCNA 1S60A 4CAVA 3I9SA 4YGOA 2FL4A 3R96A 2J8RA 4U9YA 3ZZIA 1K4JA 4II9A 3S6HA 1S7KA 2GE3A 2JLMA 1QSTA 1RXTA 2ARHA 2EUIA 3GY9A 4KORA 5JQ4A 4FD6A 4UBRA 5I0CA 3TFYA 1M4GA 5JPHA 1MJBA 4ONUA 1NE9A 2AE6A 5CNPA 2R1IA 3BLNA 2PSWA 4UWJA 2RC4A 2ZPAA 1VKCA 4KZTA 4XNHC 4H6ZA 1Q2CA 3SXOA 4B5PB 4AVCA 2CNMA 4AVBA 3TO7A 1I12A 3W6XA 4AB7A 4KOUA 4KLVA 1PUAA 2I00A 2JDCA 3TOBA 3FRMA 4PSXA 5DWMA 4B5OA 2FIWA 3R9GA 4AG7A 2OU2A 2B4BA 2FXFA 3T90A 1YX0A 4MY0A 1CM0A 2OB0A 3BJ8A 4Y49C 4OADA 2OH1A 2K5TA 4KOSA 1S3ZA 3QAHA 4MJ8A 3SXNA 1Y9WA 3DR8A 1Y7RA 3GKRA 4KVOE 1IYKA 4NXYA 2F5IA 4E8OA 2B3UA 3P2HA 4BMHA 1V0CA 2FE7A 1PU9A 3SHPA 1B6BA 3VWEA 3FIXA 1IB1E 2G3AA 4AVAA 2J8NA 1QSOA 4B5PA 2IL4A 1M4IA 2O28A 4M3SA 1XIXA 3CXSA 4QC6A 5KTAA 1B87A 5KTCA 4QVTA 4HNXB 3K9UA 4H6UA 4U5YA 5EC4A 4JJXA 4KUAA 4XPDC 1UFHA 1KUXA 3S6KA 4L89A 1MJAA 4K30A 4ZBGA 4GS4A 3TCVA 1YLEA 3W91A 3EY5A 3G3SA 1XMTA 4L8AA 4JLYA 3BJ7A 4NF1A 5J8CA 1YVKA 3LD2A 3JUWA 3PP9A 4IF5A 1QSNA 2QMLA 3EC4A 1NSLA 3EFAA 4AG9A 4X5KA 3D3SA 3T9YA 3H4QA 3LODA 4HNWB 1XE4A 4OAEA 2HUZA 3C26A 1I1DA 3D2MA 4OLLA 4IUSA 1Z4RA 4M85A 1KZFA 5FVJA 3RYOA 2GIVA 1QSRA 4R87A 1IIDA 4F0YA 2FS5A 1I21A 1YREA 4MI4A 2OZHA 2VEZA 4KVME 3G8WA 4MY3A 1L0CA 4FD5A 2CY2A 2C27A 3QB8A 2HQYA 2Q0YA 4NCZA 4R57A 1IICA 3MGDA 1J4JA 4JXQA 5IB0A 4R3LA 3TTHA 1BOBA 2GANA 4UWIA 2VBQA 2OZUA 4E0AA 2JEVA 4LX9A 2HV2A 2JDDA 3N7ZA 1YVOA 1P4NA 4XPDB 5H86A 2P0WA 3DR6A 4MHDA 1YGHA 2FIAA 1S7LA 1WK4A 2ZW5A 4JD6A 3S6GA 5F46A 2PQ8A 1KUVA 2PC1A 2DXQA 2Z0ZA 4XPKA 4NSQA 1M1DA 2KCWA 2NMTA 3OWCA 5F49A 5ISVA 3IWGA 4LUAA 1GHEA 4CAWA 2VZZA 4RS2A 4EVYA 5EBVA 4QBJA 2WPXA 2ZXVA 1P0HA 2FSRA 4QB9A 1MJ9A 4E2AA 4KLWA 4XPLA 4HNYB 3CXQA 2J8MA 2G0BA 3NE7A 2FCKA 3EO4A 4KOYA 3FYNA 4J3GA 2FT0A 4FD7A 1XEBA 2B3VA 4HKFA 4CRYB 3DDDA 1Z4EA 3JVNA 2BUEA 3D8PA 2H5MA 2R8VA 1Q2YA 4MBUA 2R7HA 2P6GA 2B58A 1ON0A 4QUSA 3TO9A 2A4NA 1YR0A 1LRZA 3W6SA 3TOAA 2Q4VA 3S6FA 2Q04A 1XF8A 3IGRA 3FBUA 1S5KA 3R9FA 2EVNA 3PZJA 3TO6A 2BEIA 4R9MA 2Q44A 3I3GA 5HH1A 1CJWA 3V8IA 5E96A 1Q2DA 2PDOA 2PRBA 5DWNA 4H89A 3WR7A 1NMTA 4YFJA 5J8FA 1FY7A 1YK3A 2D4PA 2R98A 2REEA 4U9ZA 2Q7BA 3R95A 4KOVA 4CAXA 2CNTA 2ZW6A 4KOTA 4PSWA 2BL1A 3ZJ0A 2X7BA 1R57A 3B8GA 4PK2A 4KOWA 5H84A 5IX3A 1TIQA 2PR1A 2B5GB 3TT2A 1VHSA 2PR8A 2D4OA 4PV6A 4UA3A 3FNCA 4RI1A 2P6FA 5IV0A 4KVXA 2G3TA 1BO4A 1WWZA 3CXPA 3VWDA 2BSWA 2Q4YA 1KUYA 1Y9KA 2Y0MA 2OZGA 4YRHA 2B4DA 1QSMA 3E0KA 3R1KA 2ATRA 3UY5A 4JXRA 2Z10A 1M44A 3P2FA 3DSBA 5C88A 3GYAA 3DNSA 3TE4A 3PGPA 3F5BA 2REFA 4NEXA 4PK3A 4F6AA 2Z11A 2P6EA
chains in the Genus database with same CATH superfamily
2QIRA 3WC7A 3D2PA 3D66A 1LAPA 1IOIA 4R3KA 4CS0B 3FB3A 2PIYA 4XNHB 3SJGA 2VXKA 4OIDA 3R9EA 3T8WA 5F47A 2J9AA 5C82A 4I49A 2BO9A 4ZY2A 1Z9UA 1IY7A 1S7NA 5KTDA 2EK9A 4NGMA 1SQHA 3F8KA 2AJ6A 3EXNA 3IU1A 4R7MA 1FT7A 3KKWA 1S7FA 2VQYA 2I79A 1IYLA 1MK4A 2QVPA 2VI7A 5HMNA 4CGOA 4FD4A 2CNSA 2ZENA 1N71A 1U6MA 4Q7AA 2ZELA 4MCRA 1M4DA 4OKOA 4DNCA 4Y49B 5F48A 2B5GA 2ZW4A 3B3WA 3FXTA 4PPZA 3LMSA 4B14A 3V38A 2ZW7A 4KUBA 4A37A 2B4DB 2QECA 1OZPA 3F0AA 4OMEA 4CRZB 2VZYA 1RO5A 2WPWA 4A95A 4ORFA 2PRQA 3NE8A 4KOXA 5AG6A 4BINA 1Y0YA 4JWPA 4P4BA 5GCNA 5AG4A 1S60A 5F09A 3PB7X 2QJ8A 4CAVA 3I9SA 4YGOA 2FL4A 3R96A 2J8RA 3NFZA 4OC1A 4U9YA 3ZZIA 2NYQA 4JZ0A 4MMOA 4JYWA 1K4JA 3PB6X 1JQGA 2RB7A 4X2TA 3JTKA 4II9A 3S6HA 1ZG8A 4R6TA 1S7KA 3IEHA 3HUVA 2GE3A 3NH4A 2JLMA 1QSTA 5A28A 1RXTA 2ARHA 2EUIA 2PVVA 3GY9A 4UCMA 4KORA 4O23A 5G20A 3PEIA 5JQ4A 3PBEA 5K8PA 4FD6A 3KI9A 4KS9A 4UBRA 5AG7A 4F9VA 3D4UA 5I0CA 5I4MA 3TFYA 2JEWA 2EWBA 4C2YA 1M4GA 4CGNA 4ZY0A 3D7GA 5JPHA 1MJBA 3TX8A 4ONUA 3FF3A 1NE9A 4A38A 1VHOA 2ZEFA 5D8NA 2AE6A 2YGWA 5CNPA 2R1IA 3BLNA 1CP7A 5DS0A 2PSWA 4UWJA 2RC4A 3D67A 2ZPAA 4W9YA 4MXUA 1Q7LA 1IGBA 4UCPA 5D29A 1VKCA 4G1PA 4C7IA 4A94A 4KZTA 1PCAA 2YNCC 2PJ7A 3ISZA 2CXAA 1VIXA 3B3CA 1Q2CA 4H6ZA 4OC4A 5A27A 3SXOA 4B5PB 1A2ZA 2EBJA 2JBJA 4AVCA 3JRUA 1TF9A 4A32A 1R3NA 1QQ9A 2CNMA 2Z3PA 4AVBA 2IMOA 4UF4A 4MRIA 2WSAA 4UFWA 3KHXA 3TO7A 1I12A 3W6XA 4AB7A 2ZOGA 4KOUA 3PBBA 1ZG7A 4UIAA 4KLVA 1PUAA 1CPXA 2I00A 4MCPA 2YNEA 2JDCA 2RFHA 3KASA 4IAVA 4BD9A 3SJEA 3TOBA 3FRMA 4PSXA 1ZG9A 5DWMA 4B5OA 2FIWA 2AFXA 3VARA 3R9GA 4AG7A 2BCOA 2OU2A 2B4BA 4MCQA 2ZEMA 2DEAA 2FXFA 2I3CA 2PJAA 3T90A 4A2ZA 1YX0A 4MY0A 4RN7A 4YU9A 1CM0A 3TC8A 4R8FA 4TWEA 4CPAA 2OB0A 3BJ8A 4PXBA 4UEZA 4Y49C 3LWUA 4OADA 4ZY1A 3RZAA 6CPAA 2OH1A 2K5TA 1TKJA 4YWYA 4KOSA 2EK8A 3RAMA 1S3ZA 3QAHA 4MJ8A 3SXNA 2F8HA 4MFKA 1Y9WA 2C1CA 4ZGYB 3DR8A 1Y7RA 1Z5RA 2PJ0A 1YMEA 1JWQA 3GKRA 4NFRA 4KVOE 2XEIA 2ZEDA 4OC3A 2PJ5A 3KHZA 4LQGA 1IYKA 1X10A 3MRUA 1ZLIA 4NXYA 3WT4A 2F5IA 2Q4ZA 2Z3NA 4C7HA 2B3UA 4E8OA 5HXDA 5JGFA 3H8GA 1TF8A 3NH5A 4H2KA 3P2HA 4BMHA 1V0CA 4CGMA 4OC2A 2FE7A 1PU9A 2C6CA 4P45A 1B6BA 3SHPA 3FIXA 3VWEA 4BBHA 3SJXA 2V8GA 2PE3A 2NSMA 1IB1E 2G3AA 2DF5A 4AVAA 1EE3P 4MFJA 2J8NA 2IJZA 5K8NA 3RO0A 4B12A 1QSOA 4B5PA 2F7VA 4NGTA 2IL4A 5G1ZA 1BPNA 1M4IA 2PJ4A 5G22A 4NGQA 2O28A 3FMCA 3B3VA 4MHZA 5BWAB 4M3SA 1XIXA 3PRTA 4X3RA 3CXSA 4QC6A 3GLJA 1Z8LA 5KTAA 1B87A 1F57A 4UFXA 5KTCA 4PXDA 4QVTA 4HNXB 3K9UA 4FUUA 1LFWA 3K9TA 4H6UA 3KGQA 4U5YA 4DJLA 3D7FA 5EC4A 7CPAA 3PB8X 4JJXA 2C6GA 3CPAA 4KUAA 1UFHA 3FH4A 4XPDC 4C68A 5ELYA 1KWMA 5JH9A 1KUXA 3S6KA 4CAFA 4L89A 1MJAA 4K30A 4P4DA 4GS4A 1YSJA 4ZBGA 5HVFA 3TCVA 3KR5A 2ZEOA 1YLEA 2PJBA 2O53A 3W91A 3EY5A 5LYIA 3NH8A 3G3SA 1QMUA 3RNZA 1XMTA 1DTDA 4L8AA 8CPAA 4JLYA 3BJ7A 4CYPA 3FVLA 4NF1A 1X12A 5J8CA 1HEEA 2PJ3A 1ARMA 3K2KA 1YVKA 4MCSA 1M4LA 1DE4C 3B2YA 3D7DA 4EWTA 2WUUA 3LD2A 4A39A 2OR4A 3JUWA 4MFQA 3H8FA 3PP9A 5AG5A 4IF5A 4NGSA 5LYLA 1QSNA 2QMLA 3EC4A 1NSLA 3EFAA 4KSAA 4AG9A 4C2XA 4X5KA 3D3SA 3T9YA 4M6GA 3IIBA 3H4QA 3CZXA 3LODA 4HNWB 1IOFA 1XE4A 2GU2A 4OAEA 2HUZA 3C26A 2V8HA 3H5ZA 1I1DA 4GXHA 4IK2A 3D2MA 3BHXA 4OLLA 4IUSA 4DUKA 1Z4RA 4M85A 1KZFA 1TKHA 5FVJA 2YNDA 5JM6A 3RYOA 1CP6A 1QSRA 2GIVA 4R87A 2PJ9A 1HDUA 1IIDA 4P10A 4F0YA 5HVGA 2JBKA 2FS5A 2Q51A 3FECA 5CPAA 1I21A 1YREA 4MI4A 2OZHA 2VEZA 3B7IA 3FEEA 3IFEA 5LYDA 4KVME 3G8WA 5LRGA 4MY3A 2ZEEA 1L0CA 4FD5A 4FWUA 2CY2A 3WC6A 1Y0RA 2CF4A 3LACA 3ISXA 1XBUA 2C27A 3QB8A 2HQYA 2Q0YA 4NCZA 3RBUA 4Z65A 4MHYA 4A30A 2EO8A 4R57A 1IICA 3MGDA 1J4JA 4JXQA 4MFPA 5IB0A 4M6IA 4R3LA 5J1QA 3KQZA 3B3SA 3TTHA 1BOBA 2PJ1A 2GANA 4UWIA 1R43A 2VBQA 1TXRA 2OZUA 4E0AA 2ANPA 2JEVA 4LX9A 3S9MA 2OOTA 2HV2A 1YW6A 2JDDA 1VGYA 3N7ZA 5EMIA 1YVOA 1BPMA 1P4NA 4WWVA 4XPDB 5H86A 1YW4A 2AFZA 2P0WA 3DR6A 4MHDA 4OIWA 2CIJA 1YGHA 2FIAA 1S7LA 1WK4A 2ZW5A 4JD6A 3S6GA 5F46A 2PQ8A 3PFOA 1KUVA 2PC1A 1RTQA 2DXQA 3BI1A 2Z0ZA 4NGNA 4XPKA 4NSQA 1M1DA 1TKFA 2KCWA 2NMTA 2V8VA 3IU2A 5LYFA 3OWCA 1LANA 1Z8WA 2AFUA 2ODFA 1HDQA 4HPSA 2XEFA 4CGLA 5F49A 5ISVA 1Z8TA 1NSAA 3IWGA 4B13A 2DPTA 3IC1A 4LQ6A 1IU8A 4LUAA 3CPXA 2GLJA 1GHEA 4AXVA 3FX6A 4ONWA 2VZZA 2C6PA 4RS2A 4P4JA 4P4FA 4UFVA 1Y7EA 5EBVA 4CAWA 4EVYA 5HVHA 5LRKA 4QBJA 1ELLP 2WPXA 2WYRA 3PB9X 2XEJA 2XEGA 3GIUA 2G9DA 2ZXVA 1P0HA 2FSRA 4M6HA 1AUGA 4QB9A 1MJ9A 3SI0A 4E2AA 2ZEPA 5AGEA 2HC9A 1ELMP 1XFOA 4KLWA 2Z3LA 4Q36A 4XPLA 4HNYB 2O4HA 3CXQA 2J8MA 4ZI6A 4F9UA 2G0BA 3NE7A 2FCKA 4B10A 3EO4A 4XNHC 4KOYA 2Z3KA 4EFDA 3PFEA 4ZYQA 1ZO0A 3FYNA 4DYOA 1F2PA 2HB6A 1Z2LA 5IB9A 4UEFA 4PQAA 4J3GA 3WABA 2FT0A 4FD7A 2PJ2A 3L2NA 1XRYA 4MFLA 1XEBA 5G21A 1OBRA 2B3VA 4HKFA 2PJ6A 4ZX8A 4CRYB 3I1UA 4K3NA 4ZX9A 3H8EA 3CDXA 3DDDA 2PCUA 1Z4EA 2GREA 2BUEA 2QYVA 3D8PA 3JVNA 4CGPA 4GM5A 1ZLHA 2H5MA 2R8VA 1Q2YA 2AFWA 4MBUA 3V7ZA 2R7HA 2P6GA 2B58A 1ON0A 1UWYA 4RUHA 4F0XA 4QUSA 3TO9A 2Q7SA 4OC5A 3D68A 1XOVA 2A4NA 2IQ6A 1YR0A 1LRZA 4NJRA 3TOAA 3W6SA 1ARLA 2Q4VA 3S6FA 3B35A 2Q04A 2DPSA 1XMBA 3IJ3A 1CX8A 1XF8A 3IGRA 4FBEA 1LAMA 1YQEA 1S5KA 3FBUA 3HLPA 4CYQA 4P4EA 4P44A 3MN8A 5THWA 3R9FA 4CYOA 4A31A 4PXCA 1VHEA 2EVNA 4X8IA 2PIZA 4UEEA 3PZJA 2ABZA 2ZOFA 3BXMA 3FEDA 3TO6A 2BEIA 3DLJA 2GLFA 4R9MA 1XJOA 2Q44A 3I3GA 5HH1A 4OP4A 1LCPA 3VH9A 1CJWA 3SI2A 3V8IA 3S9LA 4F8ZA 5E96A 1BLLE 1AMPA 1FNOA 1Q2DA 2PDOA 2PRBA 3NA6A 5DWNA 4C2ZA 4EMEA 4H89A 4B11A 4IHMA 3WR7A 1NMTA 1CG2A 2POKA 4NGPA 2Z3OA 4CYNA 2AFSA 4YFJA 1AYEA 2Z3MA 5J8FA 1FY7A 1YK3A 2VL1A 3GUXA 4MHNA 2D4PA 2CTCA 2PJCA 3S9NA 2R98A 3GB0A 3QNVA 2REEA 4U9ZA 2Q7BA 3WC5A 3R95A 4KOVA 3CT9A 3B3TA 3IWWA 2V8DA 3KQXA 3VATA 4CAEA 4CAXA 4OC0A 2CNTA 2ZW6A 4P4IA 4P6YA 5LRJA 4KOTA 1CBXA 1LOKA 4KSFA 1YLOA 1CPSA 3QAYA 5K8OA 4PSWA 2BL1A 2PVWA 3KL9A 3N5FA 2CTBA 3ZJ0A 2GFQA 2X7BA 1R57A 3B8GA 4PK2A 3KZWA 4WJBA 4KOWA 1H8LA 2ZEGA 1BAVA 4B6ZA 3BI0A 5H84A 5IX3A 1TIQA 2PR1A 4NJQA 2AFMA 2B5GB 3TT2A 1VHSA 2PR8A 2D4OA 4PV6A 4UA3A 3SI1A 3DGVA 4R76A 3FNCA 4RI1A 2P6FA 3D7HA 5IV0A 4PXEA 4KVXA 2G3TA 1BO4A 1WWZA 1GYTA 3FJUA 2BOAA 3A9LA 1Z8XA 3CXPA 4UCNA 3VWDA 2BSWA 4NGRA 3KR4A 2Q4YA 1KUYA 4A33A 1Y9KA 2Y0MA 3PB4X 2OZGA 3SJFA 4YRHA 2B4DA 4MFZA 1PYTB 2V77A 2ZEHA 1QSMA 2FVGA 2YNCA 1F2OA 3E0KA 3R1KA 2ATRA 3UY5A 3IWEA 4JXRA 2Z10A 1M44A 2PJ8A 3P2FA 5K8MA 3DSBA 4TNUA 4Q38A 2WZNA 5C88A 3GYAA 3DNSA 5CBMA 4MHPA 2AFOA 4KSIA 3TE4A 3PGPA 3F5BA 2REFA 4NEXA 4UIBA 4PK3A 4FAIA 4F6AA 2Q43A 2Z11A 3IO1A 2P6EA
chains in the Genus database with same CATH topology
2QIRA 3D2PA 4R3KA 4CS0B 3FB3A 4XNHB 2VXKA 3R9EA 5F47A 5C82A 4I49A 1Z9UA 1S7NA 5KTDA 1SQHA 3F8KA 2AJ6A 3EXNA 3IU1A 3KKWA 1S7FA 2VQYA 2I79A 1IYLA 1MK4A 2VI7A 5HMNA 4CGOA 4FD4A 2CNSA 1N71A 1U6MA 1M4DA 4DNCA 4Y49B 5F48A 2B5GA 2ZW4A 3FXTA 4B14A 2ZW7A 4KUBA 2B4DB 3F0AA 1OZPA 2QECA 4CRZB 2VZYA 1RO5A 2WPWA 4A95A 4ORFA 5AG6A 4KOXA 4JWPA 5GCNA 5AG4A 1S60A 4CAVA 3I9SA 4YGOA 2FL4A 3R96A 2J8RA 4U9YA 3ZZIA 1K4JA 3JTKA 4II9A 3S6HA 1S7KA 5A28A 2GE3A 2JLMA 1QSTA 1RXTA 2ARHA 2EUIA 3GY9A 4UCMA 4KORA 5G20A 5JQ4A 4FD6A 4KS9A 4UBRA 5AG7A 5I0CA 3TFYA 4C2YA 1M4GA 4CGNA 5JPHA 1MJBA 4ONUA 1NE9A 2AE6A 2YGWA 5CNPA 2R1IA 3BLNA 2PSWA 4UWJA 2RC4A 2ZPAA 4UCPA 4C7IA 1VKCA 4KZTA 4XNHC 2YNCC 2CXAA 5A27A 4H6ZA 1Q2CA 3SXOA 4B5PB 4AVCA 4A32A 2CNMA 2Z3PA 4AVBA 2WSAA 4UFWA 3TO7A 1I12A 3W6XA 4AB7A 4KOUA 4KLVA 1PUAA 2I00A 2YNEA 2JDCA 3TOBA 3FRMA 4PSXA 5DWMA 4B5OA 2FIWA 3R9GA 4AG7A 2OU2A 2B4BA 2FXFA 3T90A 4A2ZA 1YX0A 4MY0A 1CM0A 2OB0A 3BJ8A 4Y49C 4OADA 2OH1A 2K5TA 4KOSA 1S3ZA 3QAHA 4MJ8A 3SXNA 4MFKA 1Y9WA 4ZGYB 3DR8A 1Y7RA 3GKRA 4KVOE 1IYKA 4NXYA 4C7HA 2F5IA 2Z3NA 4E8OA 2B3UA 3P2HA 4BMHA 1V0CA 4CGMA 2FE7A 1PU9A 3SHPA 1B6BA 3VWEA 3FIXA 4BBHA 1IB1E 2G3AA 4AVAA 4MFJA 2J8NA 4B12A 1QSOA 4B5PA 2IL4A 5G1ZA 1M4IA 5G22A 2O28A 5BWAB 4M3SA 1XIXA 3CXSA 4QC6A 5KTAA 1B87A 4UFXA 5KTCA 4QVTA 4HNXB 3K9UA 4H6UA 4U5YA 5EC4A 4JJXA 4KUAA 4XPDC 4C68A 1UFHA 1KUXA 3S6KA 4CAFA 4L89A 1MJAA 4K30A 4ZBGA 4GS4A 3TCVA 1YLEA 3W91A 3EY5A 3G3SA 1XMTA 4L8AA 4JLYA 3BJ7A 4CYPA 4NF1A 5J8CA 1YVKA 2WUUA 3LD2A 3JUWA 4MFQA 3PP9A 5AG5A 4IF5A 1QSNA 2QMLA 3EC4A 1NSLA 3EFAA 4KSAA 4AG9A 4C2XA 4X5KA 3D3SA 3T9YA 3H4QA 3LODA 4HNWB 1XE4A 4OAEA 2HUZA 3C26A 3H5ZA 1I1DA 3D2MA 4OLLA 4IUSA 1Z4RA 4M85A 1KZFA 5FVJA 2YNDA 3RYOA 2GIVA 1QSRA 4R87A 1IIDA 4F0YA 2FS5A 1I21A 1YREA 4MI4A 2OZHA 2VEZA 4KVME 3G8WA 4MY3A 1L0CA 4FD5A 2CY2A 2C27A 3QB8A 2HQYA 2Q0YA 4NCZA 4A30A 4R57A 1IICA 3MGDA 1J4JA 4JXQA 4MFPA 5IB0A 4R3LA 3TTHA 1BOBA 2GANA 4UWIA 2VBQA 2OZUA 4E0AA 2JEVA 4LX9A 2HV2A 2JDDA 3N7ZA 1YVOA 1P4NA 4XPDB 5H86A 2P0WA 3DR6A 4MHDA 1YGHA 2FIAA 1S7LA 1WK4A 2ZW5A 4JD6A 3S6GA 5F46A 2PQ8A 1KUVA 2PC1A 2DXQA 2Z0ZA 4XPKA 4NSQA 1M1DA 2KCWA 2NMTA 3IU2A 3OWCA 4CGLA 5F49A 5ISVA 4B13A 3IWGA 2DPTA 4LUAA 1GHEA 4CAWA 2VZZA 4RS2A 4UFVA 4EVYA 5EBVA 4QBJA 2WPXA 2ZXVA 1P0HA 2FSRA 4QB9A 1MJ9A 4E2AA 5AGEA 4KLWA 2Z3LA 4Q36A 4XPLA 4HNYB 3CXQA 2J8MA 2G0BA 3NE7A 2FCKA 4B10A 3EO4A 4KOYA 2Z3KA 1ZO0A 3FYNA 4J3GA 2FT0A 4FD7A 4MFLA 1XEBA 5G21A 2B3VA 4HKFA 4CRYB 3DDDA 1Z4EA 3JVNA 2BUEA 3D8PA 4CGPA 2H5MA 2R8VA 1Q2YA 4MBUA 2R7HA 2P6GA 2B58A 1ON0A 4F0XA 4QUSA 3TO9A 2A4NA 1YR0A 1LRZA 3W6SA 3TOAA 2Q4VA 3S6FA 2Q04A 2DPSA 1XF8A 3IGRA 3FBUA 1S5KA 4CYQA 3R9FA 4CYOA 4A31A 2EVNA 3PZJA 3TO6A 2BEIA 4R9MA 2Q44A 3I3GA 5HH1A 1CJWA 3V8IA 5E96A 1Q2DA 2PDOA 2PRBA 5DWNA 4C2ZA 4H89A 4B11A 3WR7A 1NMTA 4CYNA 2Z3OA 4YFJA 2Z3MA 5J8FA 1FY7A 1YK3A 2D4PA 2R98A 2REEA 4U9ZA 2Q7BA 3R95A 4KOVA 4CAEA 4CAXA 2CNTA 2ZW6A 4KOTA 4KSFA 4PSWA 2BL1A 3ZJ0A 2X7BA 1R57A 3B8GA 4PK2A 4KOWA 5H84A 5IX3A 1TIQA 2PR1A 2B5GB 3TT2A 1VHSA 2PR8A 2D4OA 4PV6A 4UA3A 3FNCA 4RI1A 2P6FA 5IV0A 4KVXA 2G3TA 1BO4A 1WWZA 3A9LA 3CXPA 4UCNA 3VWDA 2BSWA 4A33A 2Q4YA 1KUYA 1Y9KA 2Y0MA 2OZGA 4YRHA 2B4DA 4MFZA 1QSMA 2YNCA 3E0KA 3R1KA 2ATRA 3UY5A 3IWEA 4JXRA 2Z10A 1M44A 3P2FA 3DSBA 4Q38A 5C88A 3GYAA 3DNSA 3TE4A 3PGPA 3F5BA 2REFA 4NEXA 4PK3A 4F6AA 2Z11A 2P6EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QIR A;  3D2P A;  4R3K A;  4CS0 B;  3FB3 A;  4XNH B;  2VXK A;  3R9E A;  5F47 A;  5C82 A;  4I49 A;  1Z9U A;  1S7N A;  5KTD A;  1SQH A;  3F8K A;  2AJ6 A;  3EXN A;  3KKW A;  1S7F A;  2VQY A;  2I79 A;  1IYL A;  1MK4 A;  2VI7 A;  5HMN A;  4FD4 A;  2CNS A;  1N71 A;  1U6M A;  1M4D A;  4DNC A;  4Y49 B;  5F48 A;  2B5G A;  2ZW4 A;  3FXT A;  2ZW7 A;  4KUB A;  2B4D B;  2QEC A;  1OZP A;  3F0A A;  4CRZ B;  2VZY A;  1RO5 A;  2WPW A;  4ORF A;  4KOX A;  4JWP A;  5GCN A;  1S60 A;  4CAV A;  3I9S A;  4YGO A;  2FL4 A;  3R96 A;  2J8R A;  4U9Y A;  3ZZI A;  1K4J A;  4II9 A;  3S6H A;  1S7K A;  2GE3 A;  2JLM A;  1QST A;  1RXT A;  2ARH A;  2EUI A;  3GY9 A;  4KOR A;  5JQ4 A;  4FD6 A;  4UBR A;  5I0C A;  3TFY A;  1M4G A;  5JPH A;  1MJB A;  4ONU A;  1NE9 A;  2AE6 A;  5CNP A;  2R1I A;  3BLN A;  2PSW A;  4UWJ A;  2RC4 A;  2ZPA A;  1VKC A;  4KZT A;  4XNH C;  4H6Z A;  1Q2C A;  3SXO A;  4B5P B;  4AVC A;  2CNM A;  4AVB A;  3TO7 A;  1I12 A;  3W6X A;  4AB7 A;  4KOU A;  4KLV A;  1PUA A;  2I00 A;  2JDC A;  3TOB A;  3FRM A;  4PSX A;  5DWM A;  4B5O A;  2FIW A;  3R9G A;  4AG7 A;  2OU2 A;  2B4B A;  2FXF A;  3T90 A;  1YX0 A;  4MY0 A;  1CM0 A;  2OB0 A;  3BJ8 A;  4Y49 C;  4OAD A;  2OH1 A;  2K5T A;  4KOS A;  1S3Z A;  3QAH A;  4MJ8 A;  3SXN A;  1Y9W A;  3DR8 A;  1Y7R A;  3GKR A;  4KVO E;  1IYK A;  4NXY A;  2F5I A;  4E8O A;  2B3U A;  3P2H A;  4BMH A;  1V0C A;  2FE7 A;  1PU9 A;  3SHP A;  1B6B A;  3VWE A;  3FIX A;  1IB1 E;  2G3A A;  4AVA A;  2J8N A;  1QSO A;  4B5P A;  2IL4 A;  1M4I A;  2O28 A;  4M3S A;  1XIX A;  3CXS A;  4QC6 A;  5KTA A;  1B87 A;  5KTC A;  4QVT A;  4HNX B;  3K9U A;  4H6U A;  4U5Y A;  5EC4 A;  4JJX A;  4KUA A;  4XPD C;  1UFH A;  1KUX A;  3S6K A;  4L89 A;  1MJA A;  4K30 A;  4ZBG A;  4GS4 A;  3TCV A;  1YLE A;  3W91 A;  3EY5 A;  3G3S A;  1XMT A;  4L8A A;  4JLY A;  3BJ7 A;  4NF1 A;  5J8C A;  1YVK A;  3LD2 A;  3JUW A;  3PP9 A;  4IF5 A;  1QSN A;  2QML A;  3EC4 A;  1NSL A;  3EFA A;  4AG9 A;  4X5K A;  3D3S A;  3T9Y A;  3H4Q A;  3LOD A;  4HNW B;  1XE4 A;  4OAE A;  2HUZ A;  3C26 A;  1I1D A;  3D2M A;  4OLL A;  4IUS A;  1Z4R A;  4M85 A;  1KZF A;  5FVJ A;  3RYO A;  2GIV A;  1QSR A;  4R87 A;  1IID A;  4F0Y A;  2FS5 A;  1I21 A;  1YRE A;  4MI4 A;  2OZH A;  2VEZ A;  4KVM E;  3G8W A;  4MY3 A;  1L0C A;  4FD5 A;  2CY2 A;  2C27 A;  3QB8 A;  2HQY A;  2Q0Y A;  4NCZ A;  4R57 A;  1IIC A;  3MGD A;  1J4J A;  4JXQ A;  5IB0 A;  4R3L A;  3TTH A;  1BOB A;  2GAN A;  4UWI A;  2VBQ A;  2OZU A;  4E0A A;  2JEV A;  4LX9 A;  2HV2 A;  2JDD A;  3N7Z A;  1YVO A;  1P4N A;  4XPD B;  5H86 A;  2P0W A;  3DR6 A;  4MHD A;  1YGH A;  2FIA A;  1S7L A;  1WK4 A;  2ZW5 A;  4JD6 A;  3S6G A;  5F46 A;  2PQ8 A;  1KUV A;  2PC1 A;  2DXQ A;  2Z0Z A;  4XPK A;  4NSQ A;  1M1D A;  2KCW A;  2NMT A;  3OWC A;  5F49 A;  5ISV A;  3IWG A;  4LUA A;  1GHE A;  4CAW A;  2VZZ A;  4RS2 A;  4EVY A;  5EBV A;  4QBJ A;  2WPX A;  2ZXV A;  1P0H A;  2FSR A;  4QB9 A;  1MJ9 A;  4E2A A;  4KLW A;  4XPL A;  4HNY B;  3CXQ A;  2J8M A;  2G0B A;  3NE7 A;  2FCK A;  3EO4 A;  4KOY A;  3FYN A;  4J3G A;  2FT0 A;  4FD7 A;  1XEB A;  2B3V A;  4HKF A;  4CRY B;  3DDD A;  1Z4E A;  3JVN A;  2BUE A;  3D8P A;  2H5M A;  2R8V A;  1Q2Y A;  4MBU A;  2R7H A;  2P6G A;  2B58 A;  1ON0 A;  4QUS A;  3TO9 A;  2A4N A;  1YR0 A;  1LRZ A;  3W6S A;  3TOA A;  2Q4V A;  3S6F A;  2Q04 A;  1XF8 A;  3IGR A;  3FBU A;  1S5K A;  3R9F A;  2EVN A;  3PZJ A;  3TO6 A;  2BEI A;  4R9M A;  2Q44 A;  3I3G A;  5HH1 A;  1CJW A;  3V8I A;  5E96 A;  1Q2D A;  2PDO A;  2PRB A;  5DWN A;  4H89 A;  3WR7 A;  1NMT A;  4YFJ A;  5J8F A;  1FY7 A;  1YK3 A;  2D4P A;  2R98 A;  2REE A;  4U9Z A;  2Q7B A;  3R95 A;  4KOV A;  4CAX A;  2CNT A;  2ZW6 A;  4KOT A;  4PSW A;  2BL1 A;  3ZJ0 A;  2X7B A;  1R57 A;  3B8G A;  4PK2 A;  4KOW A;  5H84 A;  5IX3 A;  1TIQ A;  2PR1 A;  2B5G B;  3TT2 A;  1VHS A;  2PR8 A;  2D4O A;  4PV6 A;  4UA3 A;  3FNC A;  4RI1 A;  2P6F A;  5IV0 A;  4KVX A;  2G3T A;  1BO4 A;  1WWZ A;  3CXP A;  3VWD A;  2BSW A;  2Q4Y A;  1KUY A;  1Y9K A;  2Y0M A;  2OZG A;  4YRH A;  2B4D A;  1QSM A;  3E0K A;  3R1K A;  2ATR A;  3UY5 A;  4JXR A;  2Z10 A;  1M44 A;  3P2F A;  3DSB A;  5C88 A;  3GYA A;  3DNS A;  3TE4 A;  3PGP A;  3F5B A;  2REF A;  4NEX A;  4PK3 A;  4F6A A;  2Z11 A;  2P6E A; 
#chains in the Genus database with same CATH topology
 2QIR A;  3WC7 A;  3D2P A;  3D66 A;  1LAP A;  1IOI A;  4R3K A;  4CS0 B;  3FB3 A;  2PIY A;  4XNH B;  3SJG A;  2VXK A;  4OID A;  3R9E A;  3T8W A;  5F47 A;  2J9A A;  5C82 A;  4I49 A;  2BO9 A;  4ZY2 A;  1Z9U A;  1IY7 A;  1S7N A;  5KTD A;  2EK9 A;  4NGM A;  1SQH A;  3F8K A;  2AJ6 A;  3EXN A;  3IU1 A;  4R7M A;  1FT7 A;  3KKW A;  1S7F A;  2VQY A;  2I79 A;  1IYL A;  1MK4 A;  2QVP A;  2VI7 A;  5HMN A;  4CGO A;  4FD4 A;  2CNS A;  2ZEN A;  1N71 A;  1U6M A;  4Q7A A;  2ZEL A;  4MCR A;  1M4D A;  4OKO A;  4DNC A;  4Y49 B;  5F48 A;  2B5G A;  2ZW4 A;  3B3W A;  3FXT A;  4PPZ A;  3LMS A;  4B14 A;  3V38 A;  2ZW7 A;  4KUB A;  4A37 A;  2B4D B;  2QEC A;  1OZP A;  3F0A A;  4OME A;  4CRZ B;  2VZY A;  1RO5 A;  2WPW A;  4A95 A;  4ORF A;  2PRQ A;  3NE8 A;  4KOX A;  5AG6 A;  4BIN A;  1Y0Y A;  4JWP A;  4P4B A;  5GCN A;  5AG4 A;  1S60 A;  5F09 A;  3PB7 X;  2QJ8 A;  4CAV A;  3I9S A;  4YGO A;  2FL4 A;  3R96 A;  2J8R A;  3NFZ A;  4OC1 A;  4U9Y A;  3ZZI A;  2NYQ A;  4JZ0 A;  4MMO A;  4JYW A;  1K4J A;  3PB6 X;  1JQG A;  2RB7 A;  4X2T A;  3JTK A;  4II9 A;  3S6H A;  1ZG8 A;  4R6T A;  1S7K A;  3IEH A;  3HUV A;  2GE3 A;  3NH4 A;  2JLM A;  1QST A;  5A28 A;  1RXT A;  2ARH A;  2EUI A;  2PVV A;  3GY9 A;  4UCM A;  4KOR A;  4O23 A;  5G20 A;  3PEI A;  5JQ4 A;  3PBE A;  5K8P A;  4FD6 A;  3KI9 A;  4KS9 A;  4UBR A;  5AG7 A;  4F9V A;  3D4U A;  5I0C A;  5I4M A;  3TFY A;  2JEW A;  2EWB A;  4C2Y A;  1M4G A;  4CGN A;  4ZY0 A;  3D7G A;  5JPH A;  1MJB A;  3TX8 A;  4ONU A;  3FF3 A;  1NE9 A;  4A38 A;  1VHO A;  2ZEF A;  5D8N A;  2AE6 A;  2YGW A;  5CNP A;  2R1I A;  3BLN A;  1CP7 A;  5DS0 A;  2PSW A;  4UWJ A;  2RC4 A;  3D67 A;  2ZPA A;  4W9Y A;  4MXU A;  1Q7L A;  1IGB A;  4UCP A;  5D29 A;  1VKC A;  4G1P A;  4C7I A;  4A94 A;  4KZT A;  1PCA A;  2YNC C;  2PJ7 A;  3ISZ A;  2CXA A;  1VIX A;  3B3C A;  1Q2C A;  4H6Z A;  4OC4 A;  5A27 A;  3SXO A;  4B5P B;  1A2Z A;  2EBJ A;  2JBJ A;  4AVC A;  3JRU A;  1TF9 A;  4A32 A;  1R3N A;  1QQ9 A;  2CNM A;  2Z3P A;  4AVB A;  2IMO A;  4UF4 A;  4MRI A;  2WSA A;  4UFW A;  3KHX A;  3TO7 A;  1I12 A;  3W6X A;  4AB7 A;  2ZOG A;  4KOU A;  3PBB A;  1ZG7 A;  4UIA A;  4KLV A;  1PUA A;  1CPX A;  2I00 A;  4MCP A;  2YNE A;  2JDC A;  2RFH A;  3KAS A;  4IAV A;  4BD9 A;  3SJE A;  3TOB A;  3FRM A;  4PSX A;  1ZG9 A;  5DWM A;  4B5O A;  2FIW A;  2AFX A;  3VAR A;  3R9G A;  4AG7 A;  2BCO A;  2OU2 A;  2B4B A;  4MCQ A;  2ZEM A;  2DEA A;  2FXF A;  2I3C A;  2PJA A;  3T90 A;  4A2Z A;  1YX0 A;  4MY0 A;  4RN7 A;  4YU9 A;  1CM0 A;  3TC8 A;  4R8F A;  4TWE A;  4CPA A;  2OB0 A;  3BJ8 A;  4PXB A;  4UEZ A;  4Y49 C;  3LWU A;  4OAD A;  4ZY1 A;  3RZA A;  6CPA A;  2OH1 A;  2K5T A;  1TKJ A;  4YWY A;  4KOS A;  2EK8 A;  3RAM A;  1S3Z A;  3QAH A;  4MJ8 A;  3SXN A;  2F8H A;  4MFK A;  1Y9W A;  2C1C A;  4ZGY B;  3DR8 A;  1Y7R A;  1Z5R A;  2PJ0 A;  1YME A;  1JWQ A;  3GKR A;  4NFR A;  4KVO E;  2XEI A;  2ZED A;  4OC3 A;  2PJ5 A;  3KHZ A;  4LQG A;  1IYK A;  1X10 A;  3MRU A;  1ZLI A;  4NXY A;  3WT4 A;  2F5I A;  2Q4Z A;  2Z3N A;  4C7H A;  2B3U A;  4E8O A;  5HXD A;  5JGF A;  3H8G A;  1TF8 A;  3NH5 A;  4H2K A;  3P2H A;  4BMH A;  1V0C A;  4CGM A;  4OC2 A;  2FE7 A;  1PU9 A;  2C6C A;  4P45 A;  1B6B A;  3SHP A;  3FIX A;  3VWE A;  4BBH A;  3SJX A;  2V8G A;  2PE3 A;  2NSM A;  1IB1 E;  2G3A A;  2DF5 A;  4AVA A;  1EE3 P;  4MFJ A;  2J8N A;  2IJZ A;  5K8N A;  3RO0 A;  4B12 A;  1QSO A;  4B5P A;  2F7V A;  4NGT A;  2IL4 A;  5G1Z A;  1BPN A;  1M4I A;  2PJ4 A;  5G22 A;  4NGQ A;  2O28 A;  3FMC A;  3B3V A;  4MHZ A;  5BWA B;  4M3S A;  1XIX A;  3PRT A;  4X3R A;  3CXS A;  4QC6 A;  3GLJ A;  1Z8L A;  5KTA A;  1B87 A;  1F57 A;  4UFX A;  5KTC A;  4PXD A;  4QVT A;  4HNX B;  3K9U A;  4FUU A;  1LFW A;  3K9T A;  4H6U A;  3KGQ A;  4U5Y A;  4DJL A;  3D7F A;  5EC4 A;  7CPA A;  3PB8 X;  4JJX A;  2C6G A;  3CPA A;  4KUA A;  1UFH A;  3FH4 A;  4XPD C;  4C68 A;  5ELY A;  1KWM A;  5JH9 A;  1KUX A;  3S6K A;  4CAF A;  4L89 A;  1MJA A;  4K30 A;  4P4D A;  4GS4 A;  1YSJ A;  4ZBG A;  5HVF A;  3TCV A;  3KR5 A;  2ZEO A;  1YLE A;  2PJB A;  2O53 A;  3W91 A;  3EY5 A;  5LYI A;  3NH8 A;  3G3S A;  1QMU A;  3RNZ A;  1XMT A;  1DTD A;  4L8A A;  8CPA A;  4JLY A;  3BJ7 A;  4CYP A;  3FVL A;  4NF1 A;  1X12 A;  5J8C A;  1HEE A;  2PJ3 A;  1ARM A;  3K2K A;  1YVK A;  4MCS A;  1M4L A;  1DE4 C;  3B2Y A;  3D7D A;  4EWT A;  2WUU A;  3LD2 A;  4A39 A;  2OR4 A;  3JUW A;  4MFQ A;  3H8F A;  3PP9 A;  5AG5 A;  4IF5 A;  4NGS A;  5LYL A;  1QSN A;  2QML A;  3EC4 A;  1NSL A;  3EFA A;  4KSA A;  4AG9 A;  4C2X A;  4X5K A;  3D3S A;  3T9Y A;  4M6G A;  3IIB A;  3H4Q A;  3CZX A;  3LOD A;  4HNW B;  1IOF A;  1XE4 A;  2GU2 A;  4OAE A;  2HUZ A;  3C26 A;  2V8H A;  3H5Z A;  1I1D A;  4GXH A;  4IK2 A;  3D2M A;  3BHX A;  4OLL A;  4IUS A;  4DUK A;  1Z4R A;  4M85 A;  1KZF A;  1TKH A;  5FVJ A;  2YND A;  5JM6 A;  3RYO A;  1CP6 A;  1QSR A;  2GIV A;  4R87 A;  2PJ9 A;  1HDU A;  1IID A;  4P10 A;  4F0Y A;  5HVG A;  2JBK A;  2FS5 A;  2Q51 A;  3FEC A;  5CPA A;  1I21 A;  1YRE A;  4MI4 A;  2OZH A;  2VEZ A;  3B7I A;  3FEE A;  3IFE A;  5LYD A;  4KVM E;  3G8W A;  5LRG A;  4MY3 A;  2ZEE A;  1L0C A;  4FD5 A;  4FWU A;  2CY2 A;  3WC6 A;  1Y0R A;  2CF4 A;  3LAC A;  3ISX A;  1XBU A;  2C27 A;  3QB8 A;  2HQY A;  2Q0Y A;  4NCZ A;  3RBU A;  4Z65 A;  4MHY A;  4A30 A;  2EO8 A;  4R57 A;  1IIC A;  3MGD A;  1J4J A;  4JXQ A;  4MFP A;  5IB0 A;  4M6I A;  4R3L A;  5J1Q A;  3KQZ A;  3B3S A;  3TTH A;  1BOB A;  2PJ1 A;  2GAN A;  4UWI A;  1R43 A;  2VBQ A;  1TXR A;  2OZU A;  4E0A A;  2ANP A;  2JEV A;  4LX9 A;  3S9M A;  2OOT A;  2HV2 A;  1YW6 A;  2JDD A;  1VGY A;  3N7Z A;  5EMI A;  1YVO A;  1BPM A;  1P4N A;  4WWV A;  4XPD B;  5H86 A;  1YW4 A;  2AFZ A;  2P0W A;  3DR6 A;  4MHD A;  4OIW A;  2CIJ A;  1YGH A;  2FIA A;  1S7L A;  1WK4 A;  2ZW5 A;  4JD6 A;  3S6G A;  5F46 A;  2PQ8 A;  3PFO A;  1KUV A;  2PC1 A;  1RTQ A;  2DXQ A;  3BI1 A;  2Z0Z A;  4NGN A;  4XPK A;  4NSQ A;  1M1D A;  1TKF A;  2KCW A;  2NMT A;  2V8V A;  3IU2 A;  5LYF A;  3OWC A;  1LAN A;  1Z8W A;  2AFU A;  2ODF A;  1HDQ A;  4HPS A;  2XEF A;  4CGL A;  5F49 A;  5ISV A;  1Z8T A;  1NSA A;  3IWG A;  4B13 A;  2DPT A;  3IC1 A;  4LQ6 A;  1IU8 A;  4LUA A;  3CPX A;  2GLJ A;  1GHE A;  4AXV A;  3FX6 A;  4ONW A;  2VZZ A;  2C6P A;  4RS2 A;  4P4J A;  4P4F A;  4UFV A;  1Y7E A;  5EBV A;  4CAW A;  4EVY A;  5HVH A;  5LRK A;  4QBJ A;  1ELL P;  2WPX A;  2WYR A;  3PB9 X;  2XEJ A;  2XEG A;  3GIU A;  2G9D A;  2ZXV A;  1P0H A;  2FSR A;  4M6H A;  1AUG A;  4QB9 A;  1MJ9 A;  3SI0 A;  4E2A A;  2ZEP A;  5AGE A;  2HC9 A;  1ELM P;  1XFO A;  4KLW A;  2Z3L A;  4Q36 A;  4XPL A;  4HNY B;  2O4H A;  3CXQ A;  2J8M A;  4ZI6 A;  4F9U A;  2G0B A;  3NE7 A;  2FCK A;  4B10 A;  3EO4 A;  4XNH C;  4KOY A;  2Z3K A;  4EFD A;  3PFE A;  4ZYQ A;  1ZO0 A;  3FYN A;  4DYO A;  1F2P A;  2HB6 A;  1Z2L A;  5IB9 A;  4UEF A;  4PQA A;  4J3G A;  3WAB A;  2FT0 A;  4FD7 A;  2PJ2 A;  3L2N A;  1XRY A;  4MFL A;  1XEB A;  5G21 A;  1OBR A;  2B3V A;  4HKF A;  2PJ6 A;  4ZX8 A;  4CRY B;  3I1U A;  4K3N A;  4ZX9 A;  3H8E A;  3CDX A;  3DDD A;  2PCU A;  1Z4E A;  2GRE A;  2BUE A;  2QYV A;  3D8P A;  3JVN A;  4CGP A;  4GM5 A;  1ZLH A;  2H5M A;  2R8V A;  1Q2Y A;  2AFW A;  4MBU A;  3V7Z A;  2R7H A;  2P6G A;  2B58 A;  1ON0 A;  1UWY A;  4RUH A;  4F0X A;  4QUS A;  3TO9 A;  2Q7S A;  4OC5 A;  3D68 A;  1XOV A;  2A4N A;  2IQ6 A;  1YR0 A;  1LRZ A;  4NJR A;  3TOA A;  3W6S A;  1ARL A;  2Q4V A;  3S6F A;  3B35 A;  2Q04 A;  2DPS A;  1XMB A;  3IJ3 A;  1CX8 A;  1XF8 A;  3IGR A;  4FBE A;  1LAM A;  1YQE A;  1S5K A;  3FBU A;  3HLP A;  4CYQ A;  4P4E A;  4P44 A;  3MN8 A;  5THW A;  3R9F A;  4CYO A;  4A31 A;  4PXC A;  1VHE A;  2EVN A;  4X8I A;  2PIZ A;  4UEE A;  3PZJ A;  2ABZ A;  2ZOF A;  3BXM A;  3FED A;  3TO6 A;  2BEI A;  3DLJ A;  2GLF A;  4R9M A;  1XJO A;  2Q44 A;  3I3G A;  5HH1 A;  4OP4 A;  1LCP A;  3VH9 A;  1CJW A;  3SI2 A;  3V8I A;  3S9L A;  4F8Z A;  5E96 A;  1BLL E;  1AMP A;  1FNO A;  1Q2D A;  2PDO A;  2PRB A;  3NA6 A;  5DWN A;  4C2Z A;  4EME A;  4H89 A;  4B11 A;  4IHM A;  3WR7 A;  1NMT A;  1CG2 A;  2POK A;  4NGP A;  2Z3O A;  4CYN A;  2AFS A;  4YFJ A;  1AYE A;  2Z3M A;  5J8F A;  1FY7 A;  1YK3 A;  2VL1 A;  3GUX A;  4MHN A;  2D4P A;  2CTC A;  2PJC A;  3S9N A;  2R98 A;  3GB0 A;  3QNV A;  2REE A;  4U9Z A;  2Q7B A;  3WC5 A;  3R95 A;  4KOV A;  3CT9 A;  3B3T A;  3IWW A;  2V8D A;  3KQX A;  3VAT A;  4CAE A;  4CAX A;  4OC0 A;  2CNT A;  2ZW6 A;  4P4I A;  4P6Y A;  5LRJ A;  4KOT A;  1CBX A;  1LOK A;  4KSF A;  1YLO A;  1CPS A;  3QAY A;  5K8O A;  4PSW A;  2BL1 A;  2PVW A;  3KL9 A;  3N5F A;  2CTB A;  3ZJ0 A;  2GFQ A;  2X7B A;  1R57 A;  3B8G A;  4PK2 A;  3KZW A;  4WJB A;  4KOW A;  1H8L A;  2ZEG A;  1BAV A;  4B6Z A;  3BI0 A;  5H84 A;  5IX3 A;  1TIQ A;  2PR1 A;  4NJQ A;  2AFM A;  2B5G B;  3TT2 A;  1VHS A;  2PR8 A;  2D4O A;  4PV6 A;  4UA3 A;  3SI1 A;  3DGV A;  4R76 A;  3FNC A;  4RI1 A;  2P6F A;  3D7H A;  5IV0 A;  4PXE A;  4KVX A;  2G3T A;  1BO4 A;  1WWZ A;  1GYT A;  3FJU A;  2BOA A;  3A9L A;  1Z8X A;  3CXP A;  4UCN A;  3VWD A;  2BSW A;  4NGR A;  3KR4 A;  2Q4Y A;  1KUY A;  4A33 A;  1Y9K A;  2Y0M A;  3PB4 X;  2OZG A;  3SJF A;  4YRH A;  2B4D A;  4MFZ A;  1PYT B;  2V77 A;  2ZEH A;  1QSM A;  2FVG A;  2YNC A;  1F2O A;  3E0K A;  3R1K A;  2ATR A;  3UY5 A;  3IWE A;  4JXR A;  2Z10 A;  1M44 A;  2PJ8 A;  3P2F A;  5K8M A;  3DSB A;  4TNU A;  4Q38 A;  2WZN A;  5C88 A;  3GYA A;  3DNS A;  5CBM A;  4MHP A;  2AFO A;  4KSI A;  3TE4 A;  3PGP A;  3F5B A;  2REF A;  4NEX A;  4UIB A;  4PK3 A;  4FAI A;  4F6A A;  2Q43 A;  2Z11 A;  3IO1 A;  2P6E A; 
#chains in the Genus database with same CATH homology
 2QIR A;  3D2P A;  4R3K A;  4CS0 B;  3FB3 A;  4XNH B;  2VXK A;  3R9E A;  5F47 A;  5C82 A;  4I49 A;  1Z9U A;  1S7N A;  5KTD A;  1SQH A;  3F8K A;  2AJ6 A;  3EXN A;  3IU1 A;  3KKW A;  1S7F A;  2VQY A;  2I79 A;  1IYL A;  1MK4 A;  2VI7 A;  5HMN A;  4CGO A;  4FD4 A;  2CNS A;  1N71 A;  1U6M A;  1M4D A;  4DNC A;  4Y49 B;  5F48 A;  2B5G A;  2ZW4 A;  3FXT A;  4B14 A;  2ZW7 A;  4KUB A;  2B4D B;  3F0A A;  1OZP A;  2QEC A;  4CRZ B;  2VZY A;  1RO5 A;  2WPW A;  4A95 A;  4ORF A;  5AG6 A;  4KOX A;  4JWP A;  5GCN A;  5AG4 A;  1S60 A;  4CAV A;  3I9S A;  4YGO A;  2FL4 A;  3R96 A;  2J8R A;  4U9Y A;  3ZZI A;  1K4J A;  3JTK A;  4II9 A;  3S6H A;  1S7K A;  5A28 A;  2GE3 A;  2JLM A;  1QST A;  1RXT A;  2ARH A;  2EUI A;  3GY9 A;  4UCM A;  4KOR A;  5G20 A;  5JQ4 A;  4FD6 A;  4KS9 A;  4UBR A;  5AG7 A;  5I0C A;  3TFY A;  4C2Y A;  1M4G A;  4CGN A;  5JPH A;  1MJB A;  4ONU A;  1NE9 A;  2AE6 A;  2YGW A;  5CNP A;  2R1I A;  3BLN A;  2PSW A;  4UWJ A;  2RC4 A;  2ZPA A;  4UCP A;  4C7I A;  1VKC A;  4KZT A;  4XNH C;  2YNC C;  2CXA A;  5A27 A;  4H6Z A;  1Q2C A;  3SXO A;  4B5P B;  4AVC A;  4A32 A;  2CNM A;  2Z3P A;  4AVB A;  2WSA A;  4UFW A;  3TO7 A;  1I12 A;  3W6X A;  4AB7 A;  4KOU A;  4KLV A;  1PUA A;  2I00 A;  2YNE A;  2JDC A;  3TOB A;  3FRM A;  4PSX A;  5DWM A;  4B5O A;  2FIW A;  3R9G A;  4AG7 A;  2OU2 A;  2B4B A;  2FXF A;  3T90 A;  4A2Z A;  1YX0 A;  4MY0 A;  1CM0 A;  2OB0 A;  3BJ8 A;  4Y49 C;  4OAD A;  2OH1 A;  2K5T A;  4KOS A;  1S3Z A;  3QAH A;  4MJ8 A;  3SXN A;  4MFK A;  1Y9W A;  4ZGY B;  3DR8 A;  1Y7R A;  3GKR A;  4KVO E;  1IYK A;  4NXY A;  4C7H A;  2F5I A;  2Z3N A;  4E8O A;  2B3U A;  3P2H A;  4BMH A;  1V0C A;  4CGM A;  2FE7 A;  1PU9 A;  3SHP A;  1B6B A;  3VWE A;  3FIX A;  4BBH A;  1IB1 E;  2G3A A;  4AVA A;  4MFJ A;  2J8N A;  4B12 A;  1QSO A;  4B5P A;  2IL4 A;  5G1Z A;  1M4I A;  5G22 A;  2O28 A;  5BWA B;  4M3S A;  1XIX A;  3CXS A;  4QC6 A;  5KTA A;  1B87 A;  4UFX A;  5KTC A;  4QVT A;  4HNX B;  3K9U A;  4H6U A;  4U5Y A;  5EC4 A;  4JJX A;  4KUA A;  4XPD C;  4C68 A;  1UFH A;  1KUX A;  3S6K A;  4CAF A;  4L89 A;  1MJA A;  4K30 A;  4ZBG A;  4GS4 A;  3TCV A;  1YLE A;  3W91 A;  3EY5 A;  3G3S A;  1XMT A;  4L8A A;  4JLY A;  3BJ7 A;  4CYP A;  4NF1 A;  5J8C A;  1YVK A;  2WUU A;  3LD2 A;  3JUW A;  4MFQ A;  3PP9 A;  5AG5 A;  4IF5 A;  1QSN A;  2QML A;  3EC4 A;  1NSL A;  3EFA A;  4KSA A;  4AG9 A;  4C2X A;  4X5K A;  3D3S A;  3T9Y A;  3H4Q A;  3LOD A;  4HNW B;  1XE4 A;  4OAE A;  2HUZ A;  3C26 A;  3H5Z A;  1I1D A;  3D2M A;  4OLL A;  4IUS A;  1Z4R A;  4M85 A;  1KZF A;  5FVJ A;  2YND A;  3RYO A;  2GIV A;  1QSR A;  4R87 A;  1IID A;  4F0Y A;  2FS5 A;  1I21 A;  1YRE A;  4MI4 A;  2OZH A;  2VEZ A;  4KVM E;  3G8W A;  4MY3 A;  1L0C A;  4FD5 A;  2CY2 A;  2C27 A;  3QB8 A;  2HQY A;  2Q0Y A;  4NCZ A;  4A30 A;  4R57 A;  1IIC A;  3MGD A;  1J4J A;  4JXQ A;  4MFP A;  5IB0 A;  4R3L A;  3TTH A;  1BOB A;  2GAN A;  4UWI A;  2VBQ A;  2OZU A;  4E0A A;  2JEV A;  4LX9 A;  2HV2 A;  2JDD A;  3N7Z A;  1YVO A;  1P4N A;  4XPD B;  5H86 A;  2P0W A;  3DR6 A;  4MHD A;  1YGH A;  2FIA A;  1S7L A;  1WK4 A;  2ZW5 A;  4JD6 A;  3S6G A;  5F46 A;  2PQ8 A;  1KUV A;  2PC1 A;  2DXQ A;  2Z0Z A;  4XPK A;  4NSQ A;  1M1D A;  2KCW A;  2NMT A;  3IU2 A;  3OWC A;  4CGL A;  5F49 A;  5ISV A;  4B13 A;  3IWG A;  2DPT A;  4LUA A;  1GHE A;  4CAW A;  2VZZ A;  4RS2 A;  4UFV A;  4EVY A;  5EBV A;  4QBJ A;  2WPX A;  2ZXV A;  1P0H A;  2FSR A;  4QB9 A;  1MJ9 A;  4E2A A;  5AGE A;  4KLW A;  2Z3L A;  4Q36 A;  4XPL A;  4HNY B;  3CXQ A;  2J8M A;  2G0B A;  3NE7 A;  2FCK A;  4B10 A;  3EO4 A;  4KOY A;  2Z3K A;  1ZO0 A;  3FYN A;  4J3G A;  2FT0 A;  4FD7 A;  4MFL A;  1XEB A;  5G21 A;  2B3V A;  4HKF A;  4CRY B;  3DDD A;  1Z4E A;  3JVN A;  2BUE A;  3D8P A;  4CGP A;  2H5M A;  2R8V A;  1Q2Y A;  4MBU A;  2R7H A;  2P6G A;  2B58 A;  1ON0 A;  4F0X A;  4QUS A;  3TO9 A;  2A4N A;  1YR0 A;  1LRZ A;  3W6S A;  3TOA A;  2Q4V A;  3S6F A;  2Q04 A;  2DPS A;  1XF8 A;  3IGR A;  3FBU A;  1S5K A;  4CYQ A;  3R9F A;  4CYO A;  4A31 A;  2EVN A;  3PZJ A;  3TO6 A;  2BEI A;  4R9M A;  2Q44 A;  3I3G A;  5HH1 A;  1CJW A;  3V8I A;  5E96 A;  1Q2D A;  2PDO A;  2PRB A;  5DWN A;  4C2Z A;  4H89 A;  4B11 A;  3WR7 A;  1NMT A;  4CYN A;  2Z3O A;  4YFJ A;  2Z3M A;  5J8F A;  1FY7 A;  1YK3 A;  2D4P A;  2R98 A;  2REE A;  4U9Z A;  2Q7B A;  3R95 A;  4KOV A;  4CAE A;  4CAX A;  2CNT A;  2ZW6 A;  4KOT A;  4KSF A;  4PSW A;  2BL1 A;  3ZJ0 A;  2X7B A;  1R57 A;  3B8G A;  4PK2 A;  4KOW A;  5H84 A;  5IX3 A;  1TIQ A;  2PR1 A;  2B5G B;  3TT2 A;  1VHS A;  2PR8 A;  2D4O A;  4PV6 A;  4UA3 A;  3FNC A;  4RI1 A;  2P6F A;  5IV0 A;  4KVX A;  2G3T A;  1BO4 A;  1WWZ A;  3A9L A;  3CXP A;  4UCN A;  3VWD A;  2BSW A;  4A33 A;  2Q4Y A;  1KUY A;  1Y9K A;  2Y0M A;  2OZG A;  4YRH A;  2B4D A;  4MFZ A;  1QSM A;  2YNC A;  3E0K A;  3R1K A;  2ATR A;  3UY5 A;  3IWE A;  4JXR A;  2Z10 A;  1M44 A;  3P2F A;  3DSB A;  4Q38 A;  5C88 A;  3GYA A;  3DNS A;  3TE4 A;  3PGP A;  3F5B A;  2REF A;  4NEX A;  4PK3 A;  4F6A A;  2Z11 A;  2P6E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...