4H2KA

Crystal structure of the catalytic domain of succinyl-diaminopimelate desuccinylase from haemophilus influenzae
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
266
structure length
258
Chain Sequence
NAMKEKVVSLAQDLIRRPSISPNDEGCQQIIAERLEKLGFQIEWMPFNDTLNLWAKHGTSEPVIAFAGHTDVVPTGDENQWSSPPFSAEIIDGMLYGRGAADMKGSLAAMIVAAEEYVKANPNHKGTIALLITSDEEATAKDGTIHVVETLMARDEKITYCMVGEPSSAKNLGDVVKNGRRGGGKLLDSITSAIEETIGITPKAETGTSDGRFIALMGAEVVEFGPLNSTIHKVNECVSVEDLGKCGEIYHKMLVNLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The dimerization domain in DapE enzymes is required for catalysis.
pubmed doi rcsb
source organism Haemophilus influenzae
molecule tags Hydrolase
molecule keywords Succinyl-diaminopimelate desuccinylase
total genus 92
structure length 258
sequence length 266
chains with identical sequence B
ec nomenclature ec 3.5.1.18: Succinyl-diaminopimelate desuccinylase.
pdb deposition date 2012-09-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01546 Peptidase_M20 Peptidase family M20/M25/M40
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 4h2kA00
1YW4A 4LQGA 2PJ8A 4Q7AA 3SI0A 1TF8A 2V77A 2ZEOA 2ZOFA 2PJ3A 3PB9X 5LYLA 3IO1A 4AXVA 4OMEA 4WWVA 1PCAA 3B3WA 4NGTA 3VARA 1TKJA 4MCRA 3D4UA 4ZY1A 1QQ9A 3K9TA 3BI1A 2PJCA 1ELLP 2NYQA 3PB6X 2V8DA 4A37A 4TWEA 2AFZA 3CDXA 1VHOA 3LMSA 4PXCA 3QNVA 4P4JA 4X2TA 4ZX9A 5IB9A 1FNOA 2JBKA 1YMEA 2PVVA 4JYWA 3WC7A 4P6YA 4OC2A 4R6TA 8CPAA 2IJZA 2VL1A 4PQAA 2PJBA 2WYRA 2PJ7A 3RBUA 4RUHA 3SI1A 2I3CA 2POKA 1ZG7A 3B7IA 1FT7A 3IEHA 2ABZA 3B3TA 3FECA 4UEZA 3NH4A 3GLJA 1CPSA 4UF4A 2EWBA 2JBJA 4NGSA 3FX6A 3B3CA 1RTQA 2C6CA 6CPAA 2CTBA 3KHZA 4MXUA 3H8FA 1YW6A 3H8GA 4R8FA 2AFSA 5LYIA 3FH4A 1ARMA 3K2KA 5LRKA 1ARLA 1XBUA 3D66A 2PJAA 2AFWA 1TKFA 5LYDA 2F8HA 2ZELA 2PJ5A 4MMOA 3VATA 4NGRA 4NFRA 1YLOA 1CX8A 2AFXA 2BCOA 2NSMA 3KI9A 4JZ0A 1CP6A 3B2YA 4MHPA 4NGNA 2J9AA 3ISZA 3WABA 3PRTA 3KQZA 3KQXA 1Y0YA 3PBBA 1LFWA 4A39A 1R43A 2HC9A 1HEEA 1XFOA 5K8PA 2EK8A 2ZENA 2F7VA 4A38A 1LANA 2HB6A 2V8HA 3CT9A 2Q51A 2IMOA 2PIYA 4ZYQA 2JEWA 2PRQA 2EK9A 1DE4C 2ANPA 4P4DA 3RZAA 3FF3A 3CPXA 2FVGA 1XRYA 5CPAA 3KZWA 3KL9A 5D8NA 3IWWA 3WC6A 2C6GA 4PXDA 1ZG8A 4IK2A 4P44A 1Z2LA 2Q4ZA 1KWMA 2OOTA 3L2NA 4TNUA 1CBXA 4R76A 2DEAA 4Z65A 1LOKA 1M4LA 5HVHA 3SJXA 3B3SA 4YU9A 2XEGA 4UIBA 1XJOA 2PJ4A 1DTDA 3FJUA 2XEFA 4FWUA 3TX8A 3DGVA 4R7MA 2PJ2A 4O23A 1GYTA 2GLFA 4OC5A 1UWYA 4FAIA 3S9NA 3H8EA 5K8OA 3BI0A 3PBEA 2V8VA 4OC4A 1BAVA 1H8LA 2AFUA 3HUVA 1VGYA 2BOAA 3PFOA 3LWUA 4F9UA 3GB0A 2XEIA 1CPXA 3PB4X 4ZI6A 2QVPA 1Y7EA 4OIWA 4DUKA 3NA6A 5HVFA 3RAMA 4ZY2A 4EFDA 1BLLE 5K8NA 3NH8A 1HDQA 5JH9A 1BPNA 1IY7A 2ZEGA 4MCPA 4F9VA 2GREA 1Y0RA 1ZLHA 4FUUA 4P4BA 4UEEA 3PB8X 4OC0A 2PCUA 4P4EA 3FEDA 3D7DA 5HVGA 4MRIA 3IJ3A 1ZLIA 4CPAA 4MHNA 3IFEA 3SI2A 2C1CA 5K8MA 2PE3A 3D7HA 2PIZA 1IGBA 3GUXA 2XEJA 1ZG9A 1F2OA 5CBMA 3N5FA 4DYOA 2RFHA 5LRJA 3TC8A 4ZY0A 2CIJA 5JGFA 1AYEA 4H2KA 4X3RA 4PXBA 4EWTA 1F2PA 3I1UA 3BXMA 3T8WA 2QYVA 2PJ1A 1TXRA 2AFMA 4OKOA 3JRUA 4NGQA 3KR4A 2IQ6A 4ONWA 3HLPA 4W9YA 4NGMA 3IC1A 3FMCA 3B35A 2ZEDA 3B3VA 3KGQA 3PFEA 1EE3P 3D7FA 4YWYA 2CTCA 2ZOGA 1PYTB 5ELYA 4B6ZA 2GLJA 4KSIA 5DS0A 4MCSA 2PJ9A 3DLJA 4X8IA 3IIBA 4P10A 4NJRA 4BD9A 3V7ZA 1QMUA 3D67A 4EMEA 2O4HA 3SJEA 1NSAA 3BHXA 2ZEMA 2OR4A 1LCPA 3FEEA 3FVLA 4UIAA 1Z8LA 5HXDA 2ZEFA 2WZNA 1LAPA 2RB7A 2BO9A 3KASA 2QJ8A 2G9DA 4FBEA 4WJBA 1Z5RA 7CPAA 1HDUA 4OC3A 1TKHA 4OP4A 3SJGA 4DJLA 1Q7LA 1F57A 3NH5A 1BPMA 2V8GA 4P45A 1CP7A 1LAMA 4F8ZA 1XMBA 2C6PA 3PEIA 4PPZA 4A94A 3KHXA 2GU2A 3PB7X 3WT4A 4MHZA 5LRGA 3D7GA 1TF9A 4OIDA 1ELMP 5I4MA 3MRUA 4IHMA 4NGPA 1VIXA 4PXEA 5J1QA 1CG2A 5D29A 2ZEPA 2AFOA 1OBRA 4ZX8A 3NFZA 4NJQA 2PJ6A 3S9MA 3CPAA 3KR5A 3WC5A 1YSJA 4MHYA 4P4IA 4MCQA 3S9LA 4UEFA 1AMPA 5THWA 3SJFA 2O53A 2PJ0A 4K3NA 4OC1A 2ZEHA 1R3NA 3ISXA 1JQGA 3MN8A 4IAVA 2ZEEA 3V38A 3VH9A 5JM6A 2CF4A 1VHEA 5F09A 4G1PA 4P4FA 4GM5A 2PVWA 5LYFA 3D68A 2Q43A
chains in the Genus database with same CATH superfamily
1YW4A 4LQGA 2PJ8A 1MK4A 4Q7AA 1B6BA 4U5YA 4C68A 5F48A 3IU1A 2Q4VA 1Q2DA 3DDDA 3QAYA 5G1ZA 3SI0A 1TF8A 3T9YA 3TOBA 2V77A 2ZEOA 2ZOFA 2PJ3A 3PB9X 5LYLA 3IO1A 3GIUA 4AXVA 4OMEA 4WWVA 1PCAA 2PSWA 3B3WA 4NGTA 3VARA 1TKJA 2IL4A 4MCRA 3D4UA 4ZY1A 1QQ9A 4UFXA 3K9TA 5E96A 2Q04A 2B3UA 4CGLA 3BI1A 2PJCA 1ELLP 2B3VA 1X10A 3D3SA 4AG7A 2NYQA 1RXTA 3PB6X 5EBVA 3R95A 2V8DA 3EXNA 1M44A 1XEBA 3DSBA 4IUSA 3JUWA 4KSAA 4TWEA 4A37A 2AFZA 2ODFA 2OZUA 1TIQA 3CDXA 1VHOA 4R3LA 3LMSA 1M4DA 4MHDA 4PXCA 3QNVA 1KUYA 3GKRA 4P4JA 3JVNA 4X2TA 2GFQA 3SHPA 4ZX9A 5IB9A 1FNOA 1P0HA 2JBKA 1YMEA 2PVVA 2BL1A 4JYWA 3WC7A 4B11A 4P6YA 4OC2A 4E2AA 4KS9A 4R6TA 8CPAA 2QIRA 2IJZA 1J4JA 2VL1A 5DWMA 2R98A 4PQAA 2WSAA 2VXKA 3CXQA 2PJBA 4NSQA 4QBJA 2B5GB 1VKCA 2PJ7A 2WYRA 3RBUA 5KTDA 4RUHA 3SI1A 2I3CA 2POKA 1ZG7A 4B5PB 3B7IA 1FT7A 4MFJA 2BSWA 3IEHA 1YVOA 1M1DA 2ABZA 2YNDA 4KLVA 3B3TA 1QSRA 3FECA 4UEZA 4FD4A 1S7NA 1X12A 2B4DA 2C27A 3IGRA 3NH4A 3GLJA 2D4OA 3S6FA 5J8CA 4MFZA 1CPSA 4UF4A 2WPXA 4ZBGA 1N71A 2EWBA 1LRZA 4QVTA 2JBJA 4JLYA 4NGSA 4XPDB 5DWNA 3T90A 3FX6A 3R96A 3B3CA 2X7BA 3D8PA 1RTQA 2C6CA 4CAEA 1YK3A 6CPAA 2CTBA 2G0BA 4PV6A 4CS0B 2J8NA 3SXNA 3KHZA 4NCZA 2EVNA 4MXUA 3H8FA 2ZW5A 2REFA 3C26A 1YW6A 3H8GA 2FT0A 1Z8WA 4R8FA 2AFSA 3RYOA 5LYIA 3FH4A 1ARMA 4UFVA 4B5PA 5A28A 3K2KA 4KLWA 2H5MA 2WUUA 5LRKA 1ARLA 1XBUA 1Z4EA 4J3GA 3D66A 2PJAA 2AFWA 2B4DB 1A2ZA 2Q4YA 1TKFA 3CXSA 2F8HA 4PK3A 2Z3MA 3G3SA 3IWGA 2ZELA 2PJ5A 4MMOA 4RS2A 3FYNA 4UWJA 4NGRA 3VATA 4PK2A 4A95A 3A9LA 4NFRA 1YLOA 2NMTA 3S6GA 1CX8A 2AFXA 2BCOA 4H89A 4A32A 4OLLA 1Z9UA 2NSMA 1S7FA 5AG6A 3KI9A 4II9A 1Z8TA 2BUEA 4JZ0A 3K9UA 4MFKA 1CP6A 1RO5A 2G3AA 3B2YA 4MHPA 4NGNA 2ARHA 2J9AA 2ZW6A 5F46A 4UCMA 3ISZA 3R1KA 3WABA 1XF8A 4KOXA 3N7ZA 3BLNA 3DNSA 4U9YA 2P6EA 4X5KA 3PRTA 4CAFA 3DR6A 3KQZA 3KQXA 1Y0YA 3PBBA 1LFWA 4A39A 1S7KA 1Q2CA 1R43A 2HC9A 4KOWA 5AGEA 1YX0A 3BJ8A 2DPSA 5KTCA 1XIXA 1Q2YA 3KKWA 1HEEA 1XFOA 1MJAA 4CGPA 5K8PA 3F0AA 4C2YA 2EK8A 4F0XA 2ZENA 2F7VA 5HH1A 1LANA 2HB6A 2V8HA 4A38A 3IWEA 1MJ9A 3CT9A 2Q51A 1AUGA 2IMOA 1ZO0A 4NXYA 2PIYA 2AJ6A 4U9ZA 4ZYQA 3FBUA 2JEWA 3D2PA 4R87A 4HNWB 2PRQA 2PR1A 4KUAA 2EK9A 4MI4A 4RN7A 1DE4C 2ANPA 4P4DA 4XPLA 3RZAA 5J8FA 3QB8A 3FF3A 3CPXA 4HNYB 2FVGA 2PR8A 2R7HA 3R9GA 1XRYA 2Z10A 5CPAA 2RC4A 3KZWA 1NE9A 4A33A 3KL9A 5D8NA 3IWWA 3WC6A 2C6GA 4PXDA 2Q7BA 3CXPA 5JQ4A 4KVME 1GHEA 1ZG8A 4IK2A 4JXQA 2EBJA 4PSXA 4UCPA 1V0CA 4KOVA 4P44A 2J8RA 1Z2LA 1S5KA 1WWZA 1IOIA 1I1DA 2Q4ZA 4HPSA 1KWMA 2OZGA 2R8VA 2OOTA 3RO0A 4M6IA 3L2NA 5AG5A 4TNUA 3JTKA 1MJBA 1CBXA 4R76A 1QSMA 4RI1A 2OB0A 2DEAA 4Z65A 1KUXA 1LOKA 1I12A 1M4LA 5HVHA 3SJXA 3B3SA 4YU9A 5G20A 2VQYA 2XEGA 4UIBA 1IOFA 1XJOA 1BOBA 2PJ4A 1DTDA 3FJUA 4AVCA 2XEFA 3W6SA 1UFHA 4FWUA 4ZGYB 3TX8A 3DGVA 4R9MA 4MJ8A 1YR0A 4R7MA 3NE7A 2PJ2A 4O23A 1GYTA 4ONUA 2GLFA 4CYPA 4OC5A 1UWYA 4FAIA 4A2ZA 1KUVA 5FVJA 3S9NA 3H8EA 5K8OA 3BI0A 3GY9A 4LUAA 3PBEA 5IB0A 3VWEA 2V8VA 3FRMA 4OC4A 1BAVA 1H8LA 1KZFA 2AFUA 2CY2A 3HUVA 5H84A 4CYNA 3TCVA 4UCNA 1VGYA 2Y0MA 2BOAA 2I79A 3PFOA 4MY3A 3LWUA 4NF1A 4F9UA 4XPDC 3GB0A 2JLMA 3LACA 4B14A 3GYAA 2XEIA 1S7LA 5AG7A 1CPXA 3H5ZA 3PB4X 4QC6A 2ZW4A 4NEXA 4ZI6A 2QVPA 4C7IA 4MFQA 3S6KA 1Y7EA 4OIWA 4YGOA 4DUKA 3NA6A 5HVFA 1Y7RA 3RAMA 2OZHA 4ZY2A 3P2HA 4UBRA 4EFDA 3EY5A 2JDDA 1BLLE 5K8NA 3NH8A 1HDQA 4AB7A 2WPWA 5JH9A 5HMNA 1FY7A 2I00A 2PDOA 4KVOE 1BPNA 1IICA 1IY7A 2ZEGA 2YNEA 1B87A 4MCPA 2JEVA 4F9VA 2GREA 4BINA 4Q38A 3LODA 1Y0RA 1ZLHA 2R1IA 4DNCA 1XOVA 1XMTA 2KCWA 1CM0A 4Q36A 3TO9A 4JD6A 1YVKA 2VBQA 4FUUA 4F6AA 5C88A 1WK4A 4P4BA 2CXAA 4UEEA 3PB8X 2OU2A 4OC0A 4GXHA 2PCUA 3G8WA 4P4EA 4YRHA 2Z3KA 3FEDA 3D7DA 4FD6A 4M85A 3B8GA 2Q0YA 4M6GA 4QB9A 2P0WA 5HVGA 4MRIA 4ORFA 3I9SA 3IJ3A 1ZLIA 3W91A 4CPAA 5A27A 4MHNA 3IFEA 3SI2A 2C1CA 4JJXA 4JXRA 3F5BA 5K8MA 4E0AA 2PE3A 3D7HA 4CRYB 3PZJA 2PIZA 5KTAA 4MFPA 3NE8A 1IGBA 3GUXA 5I0CA 3TOAA 2XEJA 2YNCA 5EMIA 1I21A 4B10A 1ZG9A 4KOYA 1F2OA 4HNXB 3W6XA 4E8OA 5C82A 4KVXA 4KSFA 3R9EA 4UFWA 2A4NA 2CNSA 3E0KA 3N5FA 5CBMA 3LD2A 4DYOA 2RFHA 1IYKA 4Y49C 3FNCA 5LRJA 2PC1A 3TC8A 4ZY0A 2CIJA 4JWPA 1AYEA 4R57A 4H2KA 3D2MA 5JGFA 4X3RA 2FIAA 4KZTA 4H6UA 2QMLA 3I3GA 4PXBA 4EWTA 1F2PA 3I1UA 3BXMA 2Q44A 3T8WA 4KUBA 4CAVA 2QYVA 1M4GA 2VEZA 2PJ1A 2VI7A 3RNZA 1TXRA 1IB1E 2Z3PA 3EFAA 3PP9A 1L0CA 2DPTA 2AFMA 4OKOA 1SQHA 3JRUA 1XE4A 4NGQA 3KR4A 4CGOA 2IQ6A 4ONWA 4AG9A 3HLPA 4C2ZA 2P6GA 4W9YA 4NGMA 1IIDA 3V8IA 3IC1A 4OAEA 4M3SA 3FMCA 2GIVA 2O28A 3B35A 3TE4A 2ZEDA 5LYDA 3B3VA 2YGWA 3KGQA 3PFEA 5IX3A 4C7HA 1IU8A 1EE3P 3D7FA 2FS5A 2ZPAA 2CTCA 2ZOGA 4YWYA 4UA3A 1PYTB 1YREA 5ELYA 1QSOA 4B6ZA 1YLEA 4R3KA 4XPKA 2GLJA 1QSNA 2HUZA 2B4BA 1PU9A 4XNHB 3CZXA 4KSIA 5DS0A 4MCSA 4EVYA 2PJ9A 3DLJA 4MBUA 3FXTA 4C2XA 4X8IA 4CGMA 3IIBA 2DXQA 4OADA 4NJRA 4P10A 1P4NA 4BD9A 3V7ZA 2YNCC 1QMUA 3D67A 4HKFA 4IF5A 2Z3NA 4EMEA 3TO6A 4L8AA 2O4HA 2FXFA 3SJEA 3ZJ0A 1NSAA 3BHXA 2K5TA 2ZEMA 2OR4A 1S3ZA 1LCPA 1Z4RA 2VZZA 4Y49B 5ISVA 3FEEA 2ZXVA 1QSTA 2CNTA 1IYLA 2F5IA 3QAHA 3FVLA 4KOSA 4UIAA 3R9FA 1Z8LA 2FE7A 2HV2A 5CNPA 5HXDA 2B5GA 1NMTA 2ZEFA 3SXOA 2WZNA 1LAPA 1VHSA 5F47A 2RB7A 4M6HA 1CJWA 1NSLA 1YQEA 2BO9A 3KASA 2QJ8A 3MGDA 1PUAA 2G9DA 4FBEA 4WJBA 2FL4A 2PRBA 4CRZB 1Z5RA 7CPAA 1HDUA 1Y9KA 3TTHA 2Z11A 2EUIA 4KOUA 4OC3A 1TKHA 2FSRA 2ATRA 1Y9WA 4CYQA 4OP4A 3SJGA 4KORA 4DJLA 4B12A 3BJ7A 3S6HA 2DF5A 1Q7LA 4MY0A 3OWCA 1F57A 3NH5A 1BPMA 1OZPA 2HQYA 3PGPA 2V8GA 4CYOA 4P45A 1CP7A 5AG4A 1LAMA 4F8ZA 1XMBA 2C6PA 3PEIA 2B58A 2VZYA 4PPZA 5H86A 2Z3OA 4H6ZA 2GANA 4A94A 3FIXA 3KHXA 2P6FA 4CAXA 1BO4A 2GU2A 3EC4A 2D4PA 3PB7X 4BMHA 3TFYA 4L89A 3WT4A 3FB3A 4CGNA 4MHZA 4QUSA 5LRGA 1M4IA 1JWQA 4CAWA 3D7GA 4FD7A 1TF9A 4AVBA 4OIDA 2CNMA 1ELMP 5I4MA 3MRUA 4IHMA 4NGPA 1VIXA 1K4JA 2JDCA 4PXEA 4AVAA 5JPHA 2Q7SA 3UY5A 4UWIA 4YFJA 5G22A 4B5OA 5J1QA 1CG2A 5D29A 2ZEPA 2AFOA 1OBRA 2FCKA 2Z0ZA 4KOTA 4ZX8A 3NFZA 1S60A 4NJQA 4F0YA 2PJ6A 2GE3A 3S9MA 3CPAA 3KR5A 4FD5A 3WC5A 3F8KA 3P2FA 5G21A 1YSJA 3DR8A 2EO8A 3TO7A 4MHYA 4P4IA 4MCQA 3S9LA 4K30A 4UEFA 1AMPA 3WR7A 5THWA 3SJFA 3EO4A 3H4QA 4LQ6A 2O53A 2PJ0A 2QECA 4K3NA 4OC1A 2OH1A 4A30A 2ZEHA 1R3NA 3ISXA 1JQGA 2REEA 2AE6A 2G3TA 3VWDA 3MN8A 4B13A 4IAVA 3ZZIA 1Z8XA 2ZEEA 2J8MA 1U6MA 2BEIA 3V38A 3VH9A 2FIWA 3IU2A 5JM6A 2CF4A 5F49A 4XNHC 1R57A 4GS4A 1VHEA 5F09A 4G1PA 4BBHA 5IV0A 2Z3LA 4P4FA 4GM5A 5EC4A 4PSWA 1YGHA 4A31A 2PQ8A 2PVWA 4MFLA 1ON0A 5BWAB 5LYFA 2ZW7A 2Q43A 3D68A 4I49A 5GCNA 3TT2A 4LX9A
chains in the Genus database with same CATH topology
1YW4A 4LQGA 2PJ8A 4Q7AA 3SI0A 1TF8A 2V77A 2ZEOA 2ZOFA 2PJ3A 3PB9X 5LYLA 3IO1A 4AXVA 4OMEA 4WWVA 1PCAA 3B3WA 4NGTA 3VARA 1TKJA 4MCRA 3D4UA 4ZY1A 1QQ9A 3K9TA 3BI1A 2PJCA 1ELLP 2NYQA 3PB6X 2V8DA 4A37A 4TWEA 2AFZA 3CDXA 1VHOA 3LMSA 4PXCA 3QNVA 4P4JA 4X2TA 4ZX9A 5IB9A 1FNOA 2JBKA 1YMEA 2PVVA 4JYWA 3WC7A 4P6YA 4OC2A 4R6TA 8CPAA 2IJZA 2VL1A 4PQAA 2PJBA 2WYRA 2PJ7A 3RBUA 4RUHA 3SI1A 2I3CA 2POKA 1ZG7A 3B7IA 1FT7A 3IEHA 2ABZA 3B3TA 3FECA 4UEZA 3NH4A 3GLJA 1CPSA 4UF4A 2EWBA 2JBJA 4NGSA 3FX6A 3B3CA 1RTQA 2C6CA 6CPAA 2CTBA 3KHZA 4MXUA 3H8FA 1YW6A 3H8GA 4R8FA 2AFSA 5LYIA 3FH4A 1ARMA 3K2KA 5LRKA 1ARLA 1XBUA 3D66A 2PJAA 2AFWA 1TKFA 5LYDA 2F8HA 2ZELA 2PJ5A 4MMOA 3VATA 4NGRA 4NFRA 1YLOA 1CX8A 2AFXA 2BCOA 2NSMA 3KI9A 4JZ0A 1CP6A 3B2YA 4MHPA 4NGNA 2J9AA 3ISZA 3WABA 3PRTA 3KQZA 3KQXA 1Y0YA 3PBBA 1LFWA 4A39A 1R43A 2HC9A 1HEEA 1XFOA 5K8PA 2EK8A 2ZENA 2F7VA 4A38A 1LANA 2HB6A 2V8HA 3CT9A 2Q51A 2IMOA 2PIYA 4ZYQA 2JEWA 2PRQA 2EK9A 1DE4C 2ANPA 4P4DA 3RZAA 3FF3A 3CPXA 2FVGA 1XRYA 5CPAA 3KZWA 3KL9A 5D8NA 3IWWA 3WC6A 2C6GA 4PXDA 1ZG8A 4IK2A 4P44A 1Z2LA 2Q4ZA 1KWMA 2OOTA 3L2NA 4TNUA 1CBXA 4R76A 2DEAA 4Z65A 1LOKA 1M4LA 5HVHA 3SJXA 3B3SA 4YU9A 2XEGA 4UIBA 1XJOA 2PJ4A 1DTDA 3FJUA 2XEFA 4FWUA 3TX8A 3DGVA 4R7MA 2PJ2A 4O23A 1GYTA 2GLFA 4OC5A 1UWYA 4FAIA 3S9NA 3H8EA 5K8OA 3BI0A 3PBEA 2V8VA 4OC4A 1BAVA 1H8LA 2AFUA 3HUVA 1VGYA 2BOAA 3PFOA 3LWUA 4F9UA 3GB0A 2XEIA 1CPXA 3PB4X 4ZI6A 2QVPA 1Y7EA 4OIWA 4DUKA 3NA6A 5HVFA 3RAMA 4ZY2A 4EFDA 1BLLE 5K8NA 3NH8A 1HDQA 5JH9A 1BPNA 1IY7A 2ZEGA 4MCPA 4F9VA 2GREA 1Y0RA 1ZLHA 4FUUA 4P4BA 4UEEA 3PB8X 4OC0A 2PCUA 4P4EA 3FEDA 3D7DA 5HVGA 4MRIA 3IJ3A 1ZLIA 4CPAA 4MHNA 3IFEA 3SI2A 2C1CA 5K8MA 2PE3A 3D7HA 2PIZA 1IGBA 3GUXA 2XEJA 1ZG9A 1F2OA 5CBMA 3N5FA 4DYOA 2RFHA 5LRJA 3TC8A 4ZY0A 2CIJA 5JGFA 1AYEA 4H2KA 4X3RA 4PXBA 4EWTA 1F2PA 3I1UA 3BXMA 3T8WA 2QYVA 2PJ1A 1TXRA 2AFMA 4OKOA 3JRUA 4NGQA 3KR4A 2IQ6A 4ONWA 3HLPA 4W9YA 4NGMA 3IC1A 3FMCA 3B35A 2ZEDA 3B3VA 3KGQA 3PFEA 1EE3P 3D7FA 4YWYA 2CTCA 2ZOGA 1PYTB 5ELYA 4B6ZA 2GLJA 4KSIA 5DS0A 4MCSA 2PJ9A 3DLJA 4X8IA 3IIBA 4P10A 4NJRA 4BD9A 3V7ZA 1QMUA 3D67A 4EMEA 2O4HA 3SJEA 1NSAA 3BHXA 2ZEMA 2OR4A 1LCPA 3FEEA 3FVLA 4UIAA 1Z8LA 5HXDA 2ZEFA 2WZNA 1LAPA 2RB7A 2BO9A 3KASA 2QJ8A 2G9DA 4FBEA 4WJBA 1Z5RA 7CPAA 1HDUA 4OC3A 1TKHA 4OP4A 3SJGA 4DJLA 1Q7LA 1F57A 3NH5A 1BPMA 2V8GA 4P45A 1CP7A 1LAMA 4F8ZA 1XMBA 2C6PA 3PEIA 4PPZA 4A94A 3KHXA 2GU2A 3PB7X 3WT4A 4MHZA 5LRGA 3D7GA 1TF9A 4OIDA 1ELMP 5I4MA 3MRUA 4IHMA 4NGPA 1VIXA 4PXEA 5J1QA 1CG2A 5D29A 2ZEPA 2AFOA 1OBRA 4ZX8A 3NFZA 4NJQA 2PJ6A 3S9MA 3CPAA 3KR5A 3WC5A 1YSJA 4MHYA 4P4IA 4MCQA 3S9LA 4UEFA 1AMPA 5THWA 3SJFA 2O53A 2PJ0A 4K3NA 4OC1A 2ZEHA 1R3NA 3ISXA 1JQGA 3MN8A 4IAVA 2ZEEA 3V38A 3VH9A 5JM6A 2CF4A 1VHEA 5F09A 4G1PA 4P4FA 4GM5A 2PVWA 5LYFA 3D68A 2Q43A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YW4 A;  4LQG A;  2PJ8 A;  4Q7A A;  3SI0 A;  1TF8 A;  2V77 A;  2ZEO A;  2ZOF A;  2PJ3 A;  3PB9 X;  5LYL A;  3IO1 A;  4AXV A;  4OME A;  4WWV A;  1PCA A;  3B3W A;  4NGT A;  3VAR A;  1TKJ A;  4MCR A;  3D4U A;  4ZY1 A;  1QQ9 A;  3K9T A;  3BI1 A;  2PJC A;  1ELL P;  2NYQ A;  3PB6 X;  2V8D A;  4A37 A;  4TWE A;  2AFZ A;  3CDX A;  1VHO A;  3LMS A;  4PXC A;  3QNV A;  4P4J A;  4X2T A;  4ZX9 A;  5IB9 A;  1FNO A;  2JBK A;  1YME A;  2PVV A;  4JYW A;  3WC7 A;  4P6Y A;  4OC2 A;  4R6T A;  8CPA A;  2IJZ A;  2VL1 A;  4PQA A;  2PJB A;  2WYR A;  2PJ7 A;  3RBU A;  4RUH A;  3SI1 A;  2I3C A;  2POK A;  1ZG7 A;  3B7I A;  1FT7 A;  3IEH A;  2ABZ A;  3B3T A;  3FEC A;  4UEZ A;  3NH4 A;  3GLJ A;  1CPS A;  4UF4 A;  2EWB A;  2JBJ A;  4NGS A;  3FX6 A;  3B3C A;  1RTQ A;  2C6C A;  6CPA A;  2CTB A;  3KHZ A;  4MXU A;  3H8F A;  1YW6 A;  3H8G A;  4R8F A;  2AFS A;  5LYI A;  3FH4 A;  1ARM A;  3K2K A;  5LRK A;  1ARL A;  1XBU A;  3D66 A;  2PJA A;  2AFW A;  1TKF A;  5LYD A;  2F8H A;  2ZEL A;  2PJ5 A;  4MMO A;  3VAT A;  4NGR A;  4NFR A;  1YLO A;  1CX8 A;  2AFX A;  2BCO A;  2NSM A;  3KI9 A;  4JZ0 A;  1CP6 A;  3B2Y A;  4MHP A;  4NGN A;  2J9A A;  3ISZ A;  3WAB A;  3PRT A;  3KQZ A;  3KQX A;  1Y0Y A;  3PBB A;  1LFW A;  4A39 A;  1R43 A;  2HC9 A;  1HEE A;  1XFO A;  5K8P A;  2EK8 A;  2ZEN A;  2F7V A;  4A38 A;  1LAN A;  2HB6 A;  2V8H A;  3CT9 A;  2Q51 A;  2IMO A;  2PIY A;  4ZYQ A;  2JEW A;  2PRQ A;  2EK9 A;  1DE4 C;  2ANP A;  4P4D A;  3RZA A;  3FF3 A;  3CPX A;  2FVG A;  1XRY A;  5CPA A;  3KZW A;  3KL9 A;  5D8N A;  3IWW A;  3WC6 A;  2C6G A;  4PXD A;  1ZG8 A;  4IK2 A;  4P44 A;  1Z2L A;  2Q4Z A;  1KWM A;  2OOT A;  3L2N A;  4TNU A;  1CBX A;  4R76 A;  2DEA A;  4Z65 A;  1LOK A;  1M4L A;  5HVH A;  3SJX A;  3B3S A;  4YU9 A;  2XEG A;  4UIB A;  1XJO A;  2PJ4 A;  1DTD A;  3FJU A;  2XEF A;  4FWU A;  3TX8 A;  3DGV A;  4R7M A;  2PJ2 A;  4O23 A;  1GYT A;  2GLF A;  4OC5 A;  1UWY A;  4FAI A;  3S9N A;  3H8E A;  5K8O A;  3BI0 A;  3PBE A;  2V8V A;  4OC4 A;  1BAV A;  1H8L A;  2AFU A;  3HUV A;  1VGY A;  2BOA A;  3PFO A;  3LWU A;  4F9U A;  3GB0 A;  2XEI A;  1CPX A;  3PB4 X;  4ZI6 A;  2QVP A;  1Y7E A;  4OIW A;  4DUK A;  3NA6 A;  5HVF A;  3RAM A;  4ZY2 A;  4EFD A;  1BLL E;  5K8N A;  3NH8 A;  1HDQ A;  5JH9 A;  1BPN A;  1IY7 A;  2ZEG A;  4MCP A;  4F9V A;  2GRE A;  1Y0R A;  1ZLH A;  4FUU A;  4P4B A;  4UEE A;  3PB8 X;  4OC0 A;  2PCU A;  4P4E A;  3FED A;  3D7D A;  5HVG A;  4MRI A;  3IJ3 A;  1ZLI A;  4CPA A;  4MHN A;  3IFE A;  3SI2 A;  2C1C A;  5K8M A;  2PE3 A;  3D7H A;  2PIZ A;  1IGB A;  3GUX A;  2XEJ A;  1ZG9 A;  1F2O A;  5CBM A;  3N5F A;  4DYO A;  2RFH A;  5LRJ A;  3TC8 A;  4ZY0 A;  2CIJ A;  5JGF A;  1AYE A;  4H2K A;  4X3R A;  4PXB A;  4EWT A;  1F2P A;  3I1U A;  3BXM A;  3T8W A;  2QYV A;  2PJ1 A;  1TXR A;  2AFM A;  4OKO A;  3JRU A;  4NGQ A;  3KR4 A;  2IQ6 A;  4ONW A;  3HLP A;  4W9Y A;  4NGM A;  3IC1 A;  3FMC A;  3B35 A;  2ZED A;  3B3V A;  3KGQ A;  3PFE A;  1EE3 P;  3D7F A;  4YWY A;  2CTC A;  2ZOG A;  1PYT B;  5ELY A;  4B6Z A;  2GLJ A;  4KSI A;  5DS0 A;  4MCS A;  2PJ9 A;  3DLJ A;  4X8I A;  3IIB A;  4P10 A;  4NJR A;  4BD9 A;  3V7Z A;  1QMU A;  3D67 A;  4EME A;  2O4H A;  3SJE A;  1NSA A;  3BHX A;  2ZEM A;  2OR4 A;  1LCP A;  3FEE A;  3FVL A;  4UIA A;  1Z8L A;  5HXD A;  2ZEF A;  2WZN A;  1LAP A;  2RB7 A;  2BO9 A;  3KAS A;  2QJ8 A;  2G9D A;  4FBE A;  4WJB A;  1Z5R A;  7CPA A;  1HDU A;  4OC3 A;  1TKH A;  4OP4 A;  3SJG A;  4DJL A;  1Q7L A;  1F57 A;  3NH5 A;  1BPM A;  2V8G A;  4P45 A;  1CP7 A;  1LAM A;  4F8Z A;  1XMB A;  2C6P A;  3PEI A;  4PPZ A;  4A94 A;  3KHX A;  2GU2 A;  3PB7 X;  3WT4 A;  4MHZ A;  5LRG A;  3D7G A;  1TF9 A;  4OID A;  1ELM P;  5I4M A;  3MRU A;  4IHM A;  4NGP A;  1VIX A;  4PXE A;  5J1Q A;  1CG2 A;  5D29 A;  2ZEP A;  2AFO A;  1OBR A;  4ZX8 A;  3NFZ A;  4NJQ A;  2PJ6 A;  3S9M A;  3CPA A;  3KR5 A;  3WC5 A;  1YSJ A;  4MHY A;  4P4I A;  4MCQ A;  3S9L A;  4UEF A;  1AMP A;  5THW A;  3SJF A;  2O53 A;  2PJ0 A;  4K3N A;  4OC1 A;  2ZEH A;  1R3N A;  3ISX A;  1JQG A;  3MN8 A;  4IAV A;  2ZEE A;  3V38 A;  3VH9 A;  5JM6 A;  2CF4 A;  1VHE A;  5F09 A;  4G1P A;  4P4F A;  4GM5 A;  2PVW A;  5LYF A;  3D68 A;  2Q43 A; 
#chains in the Genus database with same CATH topology
 1YW4 A;  4LQG A;  2PJ8 A;  1MK4 A;  4Q7A A;  1B6B A;  4U5Y A;  4C68 A;  5F48 A;  3IU1 A;  2Q4V A;  1Q2D A;  3DDD A;  3QAY A;  5G1Z A;  3SI0 A;  1TF8 A;  3T9Y A;  3TOB A;  2V77 A;  2ZEO A;  2ZOF A;  2PJ3 A;  3PB9 X;  5LYL A;  3IO1 A;  3GIU A;  4AXV A;  4OME A;  4WWV A;  1PCA A;  2PSW A;  3B3W A;  4NGT A;  3VAR A;  1TKJ A;  2IL4 A;  4MCR A;  3D4U A;  4ZY1 A;  1QQ9 A;  4UFX A;  3K9T A;  5E96 A;  2Q04 A;  2B3U A;  4CGL A;  3BI1 A;  2PJC A;  1ELL P;  2B3V A;  1X10 A;  3D3S A;  4AG7 A;  2NYQ A;  1RXT A;  3PB6 X;  5EBV A;  3R95 A;  2V8D A;  3EXN A;  1M44 A;  1XEB A;  3DSB A;  4IUS A;  3JUW A;  4KSA A;  4TWE A;  4A37 A;  2AFZ A;  2ODF A;  2OZU A;  1TIQ A;  3CDX A;  1VHO A;  4R3L A;  3LMS A;  1M4D A;  4MHD A;  4PXC A;  3QNV A;  1KUY A;  3GKR A;  4P4J A;  3JVN A;  4X2T A;  2GFQ A;  3SHP A;  4ZX9 A;  5IB9 A;  1FNO A;  1P0H A;  2JBK A;  1YME A;  2PVV A;  2BL1 A;  4JYW A;  3WC7 A;  4B11 A;  4P6Y A;  4OC2 A;  4E2A A;  4KS9 A;  4R6T A;  8CPA A;  2QIR A;  2IJZ A;  1J4J A;  2VL1 A;  5DWM A;  2R98 A;  4PQA A;  2WSA A;  2VXK A;  3CXQ A;  2PJB A;  4NSQ A;  4QBJ A;  2B5G B;  1VKC A;  2PJ7 A;  2WYR A;  3RBU A;  5KTD A;  4RUH A;  3SI1 A;  2I3C A;  2POK A;  1ZG7 A;  4B5P B;  3B7I A;  1FT7 A;  4MFJ A;  2BSW A;  3IEH A;  1YVO A;  1M1D A;  2ABZ A;  2YND A;  4KLV A;  3B3T A;  1QSR A;  3FEC A;  4UEZ A;  4FD4 A;  1S7N A;  1X12 A;  2B4D A;  2C27 A;  3IGR A;  3NH4 A;  3GLJ A;  2D4O A;  3S6F A;  5J8C A;  4MFZ A;  1CPS A;  4UF4 A;  2WPX A;  4ZBG A;  1N71 A;  2EWB A;  1LRZ A;  4QVT A;  2JBJ A;  4JLY A;  4NGS A;  4XPD B;  5DWN A;  3T90 A;  3FX6 A;  3R96 A;  3B3C A;  2X7B A;  3D8P A;  1RTQ A;  2C6C A;  4CAE A;  1YK3 A;  6CPA A;  2CTB A;  2G0B A;  4PV6 A;  4CS0 B;  2J8N A;  3SXN A;  3KHZ A;  4NCZ A;  2EVN A;  4MXU A;  3H8F A;  2ZW5 A;  2REF A;  3C26 A;  1YW6 A;  3H8G A;  2FT0 A;  1Z8W A;  4R8F A;  2AFS A;  3RYO A;  5LYI A;  3FH4 A;  1ARM A;  4UFV A;  4B5P A;  5A28 A;  3K2K A;  4KLW A;  2H5M A;  2WUU A;  5LRK A;  1ARL A;  1XBU A;  1Z4E A;  4J3G A;  3D66 A;  2PJA A;  2AFW A;  2B4D B;  1A2Z A;  2Q4Y A;  1TKF A;  3CXS A;  2F8H A;  4PK3 A;  2Z3M A;  3G3S A;  3IWG A;  2ZEL A;  2PJ5 A;  4MMO A;  4RS2 A;  3FYN A;  4UWJ A;  4NGR A;  3VAT A;  4PK2 A;  4A95 A;  3A9L A;  4NFR A;  1YLO A;  2NMT A;  3S6G A;  1CX8 A;  2AFX A;  2BCO A;  4H89 A;  4A32 A;  4OLL A;  1Z9U A;  2NSM A;  1S7F A;  5AG6 A;  3KI9 A;  4II9 A;  1Z8T A;  2BUE A;  4JZ0 A;  3K9U A;  4MFK A;  1CP6 A;  1RO5 A;  2G3A A;  3B2Y A;  4MHP A;  4NGN A;  2ARH A;  2J9A A;  2ZW6 A;  5F46 A;  4UCM A;  3ISZ A;  3R1K A;  3WAB A;  1XF8 A;  4KOX A;  3N7Z A;  3BLN A;  3DNS A;  4U9Y A;  2P6E A;  4X5K A;  3PRT A;  4CAF A;  3DR6 A;  3KQZ A;  3KQX A;  1Y0Y A;  3PBB A;  1LFW A;  4A39 A;  1S7K A;  1Q2C A;  1R43 A;  2HC9 A;  4KOW A;  5AGE A;  1YX0 A;  3BJ8 A;  2DPS A;  5KTC A;  1XIX A;  1Q2Y A;  3KKW A;  1HEE A;  1XFO A;  1MJA A;  4CGP A;  5K8P A;  3F0A A;  4C2Y A;  2EK8 A;  4F0X A;  2ZEN A;  2F7V A;  5HH1 A;  1LAN A;  2HB6 A;  2V8H A;  4A38 A;  3IWE A;  1MJ9 A;  3CT9 A;  2Q51 A;  1AUG A;  2IMO A;  1ZO0 A;  4NXY A;  2PIY A;  2AJ6 A;  4U9Z A;  4ZYQ A;  3FBU A;  2JEW A;  3D2P A;  4R87 A;  4HNW B;  2PRQ A;  2PR1 A;  4KUA A;  2EK9 A;  4MI4 A;  4RN7 A;  1DE4 C;  2ANP A;  4P4D A;  4XPL A;  3RZA A;  5J8F A;  3QB8 A;  3FF3 A;  3CPX A;  4HNY B;  2FVG A;  2PR8 A;  2R7H A;  3R9G A;  1XRY A;  2Z10 A;  5CPA A;  2RC4 A;  3KZW A;  1NE9 A;  4A33 A;  3KL9 A;  5D8N A;  3IWW A;  3WC6 A;  2C6G A;  4PXD A;  2Q7B A;  3CXP A;  5JQ4 A;  4KVM E;  1GHE A;  1ZG8 A;  4IK2 A;  4JXQ A;  2EBJ A;  4PSX A;  4UCP A;  1V0C A;  4KOV A;  4P44 A;  2J8R A;  1Z2L A;  1S5K A;  1WWZ A;  1IOI A;  1I1D A;  2Q4Z A;  4HPS A;  1KWM A;  2OZG A;  2R8V A;  2OOT A;  3RO0 A;  4M6I A;  3L2N A;  5AG5 A;  4TNU A;  3JTK A;  1MJB A;  1CBX A;  4R76 A;  1QSM A;  4RI1 A;  2OB0 A;  2DEA A;  4Z65 A;  1KUX A;  1LOK A;  1I12 A;  1M4L A;  5HVH A;  3SJX A;  3B3S A;  4YU9 A;  5G20 A;  2VQY A;  2XEG A;  4UIB A;  1IOF A;  1XJO A;  1BOB A;  2PJ4 A;  1DTD A;  3FJU A;  4AVC A;  2XEF A;  3W6S A;  1UFH A;  4FWU A;  4ZGY B;  3TX8 A;  3DGV A;  4R9M A;  4MJ8 A;  1YR0 A;  4R7M A;  3NE7 A;  2PJ2 A;  4O23 A;  1GYT A;  4ONU A;  2GLF A;  4CYP A;  4OC5 A;  1UWY A;  4FAI A;  4A2Z A;  1KUV A;  5FVJ A;  3S9N A;  3H8E A;  5K8O A;  3BI0 A;  3GY9 A;  4LUA A;  3PBE A;  5IB0 A;  3VWE A;  2V8V A;  3FRM A;  4OC4 A;  1BAV A;  1H8L A;  1KZF A;  2AFU A;  2CY2 A;  3HUV A;  5H84 A;  4CYN A;  3TCV A;  4UCN A;  1VGY A;  2Y0M A;  2BOA A;  2I79 A;  3PFO A;  4MY3 A;  3LWU A;  4NF1 A;  4F9U A;  4XPD C;  3GB0 A;  2JLM A;  3LAC A;  4B14 A;  3GYA A;  2XEI A;  1S7L A;  5AG7 A;  1CPX A;  3H5Z A;  3PB4 X;  4QC6 A;  2ZW4 A;  4NEX A;  4ZI6 A;  2QVP A;  4C7I A;  4MFQ A;  3S6K A;  1Y7E A;  4OIW A;  4YGO A;  4DUK A;  3NA6 A;  5HVF A;  1Y7R A;  3RAM A;  2OZH A;  4ZY2 A;  3P2H A;  4UBR A;  4EFD A;  3EY5 A;  2JDD A;  1BLL E;  5K8N A;  3NH8 A;  1HDQ A;  4AB7 A;  2WPW A;  5JH9 A;  5HMN A;  1FY7 A;  2I00 A;  2PDO A;  4KVO E;  1BPN A;  1IIC A;  1IY7 A;  2ZEG A;  2YNE A;  1B87 A;  4MCP A;  2JEV A;  4F9V A;  2GRE A;  4BIN A;  4Q38 A;  3LOD A;  1Y0R A;  1ZLH A;  2R1I A;  4DNC A;  1XOV A;  1XMT A;  2KCW A;  1CM0 A;  4Q36 A;  3TO9 A;  4JD6 A;  1YVK A;  2VBQ A;  4FUU A;  4F6A A;  5C88 A;  1WK4 A;  4P4B A;  2CXA A;  4UEE A;  3PB8 X;  2OU2 A;  4OC0 A;  4GXH A;  2PCU A;  3G8W A;  4P4E A;  4YRH A;  2Z3K A;  3FED A;  3D7D A;  4FD6 A;  4M85 A;  3B8G A;  2Q0Y A;  4M6G A;  4QB9 A;  2P0W A;  5HVG A;  4MRI A;  4ORF A;  3I9S A;  3IJ3 A;  1ZLI A;  3W91 A;  4CPA A;  5A27 A;  4MHN A;  3IFE A;  3SI2 A;  2C1C A;  4JJX A;  4JXR A;  3F5B A;  5K8M A;  4E0A A;  2PE3 A;  3D7H A;  4CRY B;  3PZJ A;  2PIZ A;  5KTA A;  4MFP A;  3NE8 A;  1IGB A;  3GUX A;  5I0C A;  3TOA A;  2XEJ A;  2YNC A;  5EMI A;  1I21 A;  4B10 A;  1ZG9 A;  4KOY A;  1F2O A;  4HNX B;  3W6X A;  4E8O A;  5C82 A;  4KVX A;  4KSF A;  3R9E A;  4UFW A;  2A4N A;  2CNS A;  3E0K A;  3N5F A;  5CBM A;  3LD2 A;  4DYO A;  2RFH A;  1IYK A;  4Y49 C;  3FNC A;  5LRJ A;  2PC1 A;  3TC8 A;  4ZY0 A;  2CIJ A;  4JWP A;  1AYE A;  4R57 A;  4H2K A;  3D2M A;  5JGF A;  4X3R A;  2FIA A;  4KZT A;  4H6U A;  2QML A;  3I3G A;  4PXB A;  4EWT A;  1F2P A;  3I1U A;  3BXM A;  2Q44 A;  3T8W A;  4KUB A;  4CAV A;  2QYV A;  1M4G A;  2VEZ A;  2PJ1 A;  2VI7 A;  3RNZ A;  1TXR A;  1IB1 E;  2Z3P A;  3EFA A;  3PP9 A;  1L0C A;  2DPT A;  2AFM A;  4OKO A;  1SQH A;  3JRU A;  1XE4 A;  4NGQ A;  3KR4 A;  4CGO A;  2IQ6 A;  4ONW A;  4AG9 A;  3HLP A;  4C2Z A;  2P6G A;  4W9Y A;  4NGM A;  1IID A;  3V8I A;  3IC1 A;  4OAE A;  4M3S A;  3FMC A;  2GIV A;  2O28 A;  3B35 A;  3TE4 A;  2ZED A;  5LYD A;  3B3V A;  2YGW A;  3KGQ A;  3PFE A;  5IX3 A;  4C7H A;  1IU8 A;  1EE3 P;  3D7F A;  2FS5 A;  2ZPA A;  2CTC A;  2ZOG A;  4YWY A;  4UA3 A;  1PYT B;  1YRE A;  5ELY A;  1QSO A;  4B6Z A;  1YLE A;  4R3K A;  4XPK A;  2GLJ A;  1QSN A;  2HUZ A;  2B4B A;  1PU9 A;  4XNH B;  3CZX A;  4KSI A;  5DS0 A;  4MCS A;  4EVY A;  2PJ9 A;  3DLJ A;  4MBU A;  3FXT A;  4C2X A;  4X8I A;  4CGM A;  3IIB A;  2DXQ A;  4OAD A;  4NJR A;  4P10 A;  1P4N A;  4BD9 A;  3V7Z A;  2YNC C;  1QMU A;  3D67 A;  4HKF A;  4IF5 A;  2Z3N A;  4EME A;  3TO6 A;  4L8A A;  2O4H A;  2FXF A;  3SJE A;  3ZJ0 A;  1NSA A;  3BHX A;  2K5T A;  2ZEM A;  2OR4 A;  1S3Z A;  1LCP A;  1Z4R A;  2VZZ A;  4Y49 B;  5ISV A;  3FEE A;  2ZXV A;  1QST A;  2CNT A;  1IYL A;  2F5I A;  3QAH A;  3FVL A;  4KOS A;  4UIA A;  3R9F A;  1Z8L A;  2FE7 A;  2HV2 A;  5CNP A;  5HXD A;  2B5G A;  1NMT A;  2ZEF A;  3SXO A;  2WZN A;  1LAP A;  1VHS A;  5F47 A;  2RB7 A;  4M6H A;  1CJW A;  1NSL A;  1YQE A;  2BO9 A;  3KAS A;  2QJ8 A;  3MGD A;  1PUA A;  2G9D A;  4FBE A;  4WJB A;  2FL4 A;  2PRB A;  4CRZ B;  1Z5R A;  7CPA A;  1HDU A;  1Y9K A;  3TTH A;  2Z11 A;  2EUI A;  4KOU A;  4OC3 A;  1TKH A;  2FSR A;  2ATR A;  1Y9W A;  4CYQ A;  4OP4 A;  3SJG A;  4KOR A;  4DJL A;  4B12 A;  3BJ7 A;  3S6H A;  2DF5 A;  1Q7L A;  4MY0 A;  3OWC A;  1F57 A;  3NH5 A;  1BPM A;  1OZP A;  2HQY A;  3PGP A;  2V8G A;  4CYO A;  4P45 A;  1CP7 A;  5AG4 A;  1LAM A;  4F8Z A;  1XMB A;  2C6P A;  3PEI A;  2B58 A;  2VZY A;  4PPZ A;  5H86 A;  2Z3O A;  4H6Z A;  2GAN A;  4A94 A;  3FIX A;  3KHX A;  2P6F A;  4CAX A;  1BO4 A;  2GU2 A;  3EC4 A;  2D4P A;  3PB7 X;  4BMH A;  3TFY A;  4L89 A;  3WT4 A;  3FB3 A;  4CGN A;  4MHZ A;  4QUS A;  5LRG A;  1M4I A;  1JWQ A;  4CAW A;  3D7G A;  4FD7 A;  1TF9 A;  4AVB A;  4OID A;  2CNM A;  1ELM P;  5I4M A;  3MRU A;  4IHM A;  4NGP A;  1VIX A;  1K4J A;  2JDC A;  4PXE A;  4AVA A;  5JPH A;  2Q7S A;  3UY5 A;  4UWI A;  4YFJ A;  5G22 A;  4B5O A;  5J1Q A;  1CG2 A;  5D29 A;  2ZEP A;  2AFO A;  1OBR A;  2FCK A;  2Z0Z A;  4KOT A;  4ZX8 A;  3NFZ A;  1S60 A;  4NJQ A;  4F0Y A;  2PJ6 A;  2GE3 A;  3S9M A;  3CPA A;  3KR5 A;  4FD5 A;  3WC5 A;  3F8K A;  3P2F A;  5G21 A;  1YSJ A;  3DR8 A;  2EO8 A;  3TO7 A;  4MHY A;  4P4I A;  4MCQ A;  3S9L A;  4K30 A;  4UEF A;  1AMP A;  3WR7 A;  5THW A;  3SJF A;  3EO4 A;  3H4Q A;  4LQ6 A;  2O53 A;  2PJ0 A;  2QEC A;  4K3N A;  4OC1 A;  2OH1 A;  4A30 A;  2ZEH A;  1R3N A;  3ISX A;  1JQG A;  2REE A;  2AE6 A;  2G3T A;  3VWD A;  3MN8 A;  4B13 A;  4IAV A;  3ZZI A;  1Z8X A;  2ZEE A;  2J8M A;  1U6M A;  2BEI A;  3V38 A;  3VH9 A;  2FIW A;  3IU2 A;  5JM6 A;  2CF4 A;  5F49 A;  4XNH C;  1R57 A;  4GS4 A;  1VHE A;  5F09 A;  4G1P A;  4BBH A;  5IV0 A;  2Z3L A;  4P4F A;  4GM5 A;  5EC4 A;  4PSW A;  1YGH A;  4A31 A;  2PQ8 A;  2PVW A;  4MFL A;  1ON0 A;  5BWA B;  5LYF A;  2ZW7 A;  2Q43 A;  3D68 A;  4I49 A;  5GCN A;  3TT2 A;  4LX9 A; 
#chains in the Genus database with same CATH homology
 1YW4 A;  4LQG A;  2PJ8 A;  4Q7A A;  3SI0 A;  1TF8 A;  2V77 A;  2ZEO A;  2ZOF A;  2PJ3 A;  3PB9 X;  5LYL A;  3IO1 A;  4AXV A;  4OME A;  4WWV A;  1PCA A;  3B3W A;  4NGT A;  3VAR A;  1TKJ A;  4MCR A;  3D4U A;  4ZY1 A;  1QQ9 A;  3K9T A;  3BI1 A;  2PJC A;  1ELL P;  2NYQ A;  3PB6 X;  2V8D A;  4A37 A;  4TWE A;  2AFZ A;  3CDX A;  1VHO A;  3LMS A;  4PXC A;  3QNV A;  4P4J A;  4X2T A;  4ZX9 A;  5IB9 A;  1FNO A;  2JBK A;  1YME A;  2PVV A;  4JYW A;  3WC7 A;  4P6Y A;  4OC2 A;  4R6T A;  8CPA A;  2IJZ A;  2VL1 A;  4PQA A;  2PJB A;  2WYR A;  2PJ7 A;  3RBU A;  4RUH A;  3SI1 A;  2I3C A;  2POK A;  1ZG7 A;  3B7I A;  1FT7 A;  3IEH A;  2ABZ A;  3B3T A;  3FEC A;  4UEZ A;  3NH4 A;  3GLJ A;  1CPS A;  4UF4 A;  2EWB A;  2JBJ A;  4NGS A;  3FX6 A;  3B3C A;  1RTQ A;  2C6C A;  6CPA A;  2CTB A;  3KHZ A;  4MXU A;  3H8F A;  1YW6 A;  3H8G A;  4R8F A;  2AFS A;  5LYI A;  3FH4 A;  1ARM A;  3K2K A;  5LRK A;  1ARL A;  1XBU A;  3D66 A;  2PJA A;  2AFW A;  1TKF A;  5LYD A;  2F8H A;  2ZEL A;  2PJ5 A;  4MMO A;  3VAT A;  4NGR A;  4NFR A;  1YLO A;  1CX8 A;  2AFX A;  2BCO A;  2NSM A;  3KI9 A;  4JZ0 A;  1CP6 A;  3B2Y A;  4MHP A;  4NGN A;  2J9A A;  3ISZ A;  3WAB A;  3PRT A;  3KQZ A;  3KQX A;  1Y0Y A;  3PBB A;  1LFW A;  4A39 A;  1R43 A;  2HC9 A;  1HEE A;  1XFO A;  5K8P A;  2EK8 A;  2ZEN A;  2F7V A;  4A38 A;  1LAN A;  2HB6 A;  2V8H A;  3CT9 A;  2Q51 A;  2IMO A;  2PIY A;  4ZYQ A;  2JEW A;  2PRQ A;  2EK9 A;  1DE4 C;  2ANP A;  4P4D A;  3RZA A;  3FF3 A;  3CPX A;  2FVG A;  1XRY A;  5CPA A;  3KZW A;  3KL9 A;  5D8N A;  3IWW A;  3WC6 A;  2C6G A;  4PXD A;  1ZG8 A;  4IK2 A;  4P44 A;  1Z2L A;  2Q4Z A;  1KWM A;  2OOT A;  3L2N A;  4TNU A;  1CBX A;  4R76 A;  2DEA A;  4Z65 A;  1LOK A;  1M4L A;  5HVH A;  3SJX A;  3B3S A;  4YU9 A;  2XEG A;  4UIB A;  1XJO A;  2PJ4 A;  1DTD A;  3FJU A;  2XEF A;  4FWU A;  3TX8 A;  3DGV A;  4R7M A;  2PJ2 A;  4O23 A;  1GYT A;  2GLF A;  4OC5 A;  1UWY A;  4FAI A;  3S9N A;  3H8E A;  5K8O A;  3BI0 A;  3PBE A;  2V8V A;  4OC4 A;  1BAV A;  1H8L A;  2AFU A;  3HUV A;  1VGY A;  2BOA A;  3PFO A;  3LWU A;  4F9U A;  3GB0 A;  2XEI A;  1CPX A;  3PB4 X;  4ZI6 A;  2QVP A;  1Y7E A;  4OIW A;  4DUK A;  3NA6 A;  5HVF A;  3RAM A;  4ZY2 A;  4EFD A;  1BLL E;  5K8N A;  3NH8 A;  1HDQ A;  5JH9 A;  1BPN A;  1IY7 A;  2ZEG A;  4MCP A;  4F9V A;  2GRE A;  1Y0R A;  1ZLH A;  4FUU A;  4P4B A;  4UEE A;  3PB8 X;  4OC0 A;  2PCU A;  4P4E A;  3FED A;  3D7D A;  5HVG A;  4MRI A;  3IJ3 A;  1ZLI A;  4CPA A;  4MHN A;  3IFE A;  3SI2 A;  2C1C A;  5K8M A;  2PE3 A;  3D7H A;  2PIZ A;  1IGB A;  3GUX A;  2XEJ A;  1ZG9 A;  1F2O A;  5CBM A;  3N5F A;  4DYO A;  2RFH A;  5LRJ A;  3TC8 A;  4ZY0 A;  2CIJ A;  5JGF A;  1AYE A;  4H2K A;  4X3R A;  4PXB A;  4EWT A;  1F2P A;  3I1U A;  3BXM A;  3T8W A;  2QYV A;  2PJ1 A;  1TXR A;  2AFM A;  4OKO A;  3JRU A;  4NGQ A;  3KR4 A;  2IQ6 A;  4ONW A;  3HLP A;  4W9Y A;  4NGM A;  3IC1 A;  3FMC A;  3B35 A;  2ZED A;  3B3V A;  3KGQ A;  3PFE A;  1EE3 P;  3D7F A;  4YWY A;  2CTC A;  2ZOG A;  1PYT B;  5ELY A;  4B6Z A;  2GLJ A;  4KSI A;  5DS0 A;  4MCS A;  2PJ9 A;  3DLJ A;  4X8I A;  3IIB A;  4P10 A;  4NJR A;  4BD9 A;  3V7Z A;  1QMU A;  3D67 A;  4EME A;  2O4H A;  3SJE A;  1NSA A;  3BHX A;  2ZEM A;  2OR4 A;  1LCP A;  3FEE A;  3FVL A;  4UIA A;  1Z8L A;  5HXD A;  2ZEF A;  2WZN A;  1LAP A;  2RB7 A;  2BO9 A;  3KAS A;  2QJ8 A;  2G9D A;  4FBE A;  4WJB A;  1Z5R A;  7CPA A;  1HDU A;  4OC3 A;  1TKH A;  4OP4 A;  3SJG A;  4DJL A;  1Q7L A;  1F57 A;  3NH5 A;  1BPM A;  2V8G A;  4P45 A;  1CP7 A;  1LAM A;  4F8Z A;  1XMB A;  2C6P A;  3PEI A;  4PPZ A;  4A94 A;  3KHX A;  2GU2 A;  3PB7 X;  3WT4 A;  4MHZ A;  5LRG A;  3D7G A;  1TF9 A;  4OID A;  1ELM P;  5I4M A;  3MRU A;  4IHM A;  4NGP A;  1VIX A;  4PXE A;  5J1Q A;  1CG2 A;  5D29 A;  2ZEP A;  2AFO A;  1OBR A;  4ZX8 A;  3NFZ A;  4NJQ A;  2PJ6 A;  3S9M A;  3CPA A;  3KR5 A;  3WC5 A;  1YSJ A;  4MHY A;  4P4I A;  4MCQ A;  3S9L A;  4UEF A;  1AMP A;  5THW A;  3SJF A;  2O53 A;  2PJ0 A;  4K3N A;  4OC1 A;  2ZEH A;  1R3N A;  3ISX A;  1JQG A;  3MN8 A;  4IAV A;  2ZEE A;  3V38 A;  3VH9 A;  5JM6 A;  2CF4 A;  1VHE A;  5F09 A;  4G1P A;  4P4F A;  4GM5 A;  2PVW A;  5LYF A;  3D68 A;  2Q43 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...