4H2KA

Crystal structure of the catalytic domain of succinyl-diaminopimelate desuccinylase from haemophilus influenzae
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
266
structure length
258
Chain Sequence
NAMKEKVVSLAQDLIRRPSISPNDEGCQQIIAERLEKLGFQIEWMPFNDTLNLWAKHGTSEPVIAFAGHTDVVPTGDENQWSSPPFSAEIIDGMLYGRGAADMKGSLAAMIVAAEEYVKANPNHKGTIALLITSDEEATAKDGTIHVVETLMARDEKITYCMVGEPSSAKNLGDVVKNGRRGGGKLLDSITSAIEETIGITPKAETGTSDGRFIALMGAEVVEFGPLNSTIHKVNECVSVEDLGKCGEIYHKMLVNLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Succinyl-diaminopimelate desuccinylase
publication title The dimerization domain in DapE enzymes is required for catalysis.
pubmed doi rcsb
source organism Haemophilus influenzae
molecule tags Hydrolase
total genus 92
structure length 258
sequence length 266
chains with identical sequence B
ec nomenclature ec 3.5.1.18: Succinyl-diaminopimelate desuccinylase.
pdb deposition date 2012-09-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01546 Peptidase_M20 Peptidase family M20/M25/M40
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 4h2kA00
4A38A 4FWUA 4PXBA 4O23A 1M4LA 2EK8A 1HDUA 4OIDA 3LMSA 1TXRA 4DYOA 1HEEA 3WC6A 4B6ZA 3BXMA 4YWYA 3NH5A 3PBBA 7CPAA 1ELLP 4TWEA 1UWYA 3SI1A 5J1QA 5THWA 4UEEA 3K2KA 1CG2A 1IGBA 3SI2A 3MN8A 1Y0YA 4NGSA 4OC1A 2ZELA 8CPAA 2ZOFA 1RTQA 4ZI6A 1CP7A 1R3NA 3D4UA 1LAPA 4ZX9A 2J9AA 4P4JA 2WZNA 1AYEA 1Z2LA 4UIAA 1ARLA 1YMEA 3S9LA 2V8VA 3IWWA 2V77A 1VHOA 1ZG9A 2PJ2A 3IEHA 1TKHA 4ZX8A 1F2PA 1XRYA 2CIJA 4P45A 4P6YA 2ZENA 1R43A 3B3VA 2C1CA 3PB4X 3H8FA 4P10A 5K8NA 2PIZA 4OKOA 2I3CA 3KZWA 1H8LA 2IMOA 2C6GA 4ZY0A 5D8NA 4UEFA 4MCPA 4NJRA 3T8WA 1BPNA 5LYLA 2ZEPA 2PJ9A 3D7GA 2EK9A 3D66A 3KL9A 3JRUA 3VATA 4MRIA 4OC4A 3SJGA 2PJ5A 3VARA 3B2YA 2F8HA 4ZYQA 4FBEA 4MHZA 3B3CA 4LQGA 2ZEGA 3FEDA 3WABA 1TKFA 4P4EA 4NGNA 4IHMA 3FJUA 4P4DA 3DGVA 2AFZA 5JH9A 4FAIA 4NJQA 2QVPA 1IY7A 2ZEFA 5CBMA 4MHNA 1Z5RA 1CX8A 3RBUA 2Q43A 5LRGA 2PE3A 2AFXA 3V38A 3B3SA 1VIXA 2AFMA 5JM6A 1AMPA 4P4FA 2C6PA 1GYTA 3PEIA 1CPSA 3MRUA 2NYQA 1HDQA 3CDXA 4IK2A 3V7ZA 2QJ8A 1YW4A 1LANA 4MCSA 3D7DA 2ABZA 3BI0A 1Z8LA 3CPAA 1VHEA 2XEGA 2AFSA 3FEEA 3PBEA 2RFHA 3IFEA 5LRJA 3CPXA 3PRTA 4NGPA 2FVGA 3NFZA 4NGTA 3BI1A 3KR4A 4DUKA 1LAMA 3IO1A 3FMCA 3HLPA 4JYWA 2BOAA 2V8GA 3TC8A 4EWTA 3PFOA 1YSJA 2HB6A 5F09A 3KHZA 4PPZA 5LYDA 3LWUA 4ONWA 1NSAA 2GU2A 2XEFA 2AFOA 1FT7A 3K9TA 3FH4A 4Z65A 4MXUA 2PVWA 2PVVA 4MHYA 1BPMA 5K8PA 3DLJA 4Q7AA 2PCUA 2VL1A 5HVHA 1OBRA 1YW6A 3IIBA 3ISXA 2WYRA 3B3WA 1DTDA 1XBUA 2IQ6A 4R8FA 2PJAA 3PB7X 2JEWA 4A94A 1ZLHA 4TNUA 4PQAA 3D7HA 4P44A 2Q4ZA 2AFUA 3QNVA 3SJFA 4OIWA 3H8GA 1PYTB 3L2NA 3D68A 4NGMA 4RUHA 4UF4A 4WJBA 5I4MA 2PRQA 2ZEMA 3PB9X 3PB6X 1QMUA 2ZEHA 2O53A 2C6CA 3RZAA 1F2OA 1F57A 3WC7A 2POKA 4R6TA 2JBKA 2V8DA 4X3RA 5D29A 1Y0RA 3SI0A 3WC5A 3VH9A 2PJCA 4OC3A 4X8IA 4A39A 4F9VA 2PJ3A 1ARMA 4BD9A 1EE3P 4MHPA 4UIBA 2XEIA 1CPXA 4OMEA 4F9UA 3I1UA 5LYIA 1FNOA 2OR4A 2PIYA 2EWBA 3KI9A 3FECA 4AXVA 2ANPA 2GREA 4H2KA 2CTBA 4NGRA 4GM5A 1TF8A 1KWMA 4ZY2A 2BO9A 4WWVA 2XEJA 4P4BA 4EMEA 5HXDA 2ZOGA 2G9DA 2V8HA 1JQGA 5K8MA 3CT9A 4F8ZA 4OC2A 1LCPA 1BLLE 2ZEDA 4MMOA 4X2TA 3KQZA 4YU9A 2PJ8A 1XMBA 1CBXA 2QYVA 5ELYA 1LFWA 1ZG8A 5DS0A 2JBJA 2RB7A 4OC0A 3GB0A 4CPAA 5HVGA 1Q7LA 3SJXA 3HUVA 3PFEA 5IB9A 2NSMA 1DE4C 3FVLA 4KSIA 3IJ3A 4EFDA 3S9NA 2ZEEA 4K3NA 1TKJA 3PB8X 4NFRA 4P4IA 2PJ6A 4PXDA 5JGFA 3NH4A 3N5FA 3H8EA 1LOKA 2BCOA 4R7MA 2PJ0A 3B3TA 2ZEOA 4OP4A 4MCRA 3ISZA 3S9MA 3FX6A 1BAVA 2CTCA 2F7VA 2CF4A 3GLJA 4JZ0A 3KASA 2AFWA 3KQXA 1ZG7A 4NGQA 1YLOA 3KGQA 3GUXA 3NH8A 3TX8A 5LRKA 1TF9A 4R76A 2GLFA 4UEZA 3SJEA 2IJZA 1PCAA 4OC5A 4ZY1A 3B7IA 4DJLA 2PJ7A 4IAVA 3B35A 3FF3A 1ELMP 3RAMA 2Q51A 3D67A 1CP6A 4FUUA 3NA6A 3D7FA 3IC1A 2PJBA 4G1PA 1VGYA 4MCQA 1XJOA 4W9YA 5K8OA 3BHXA 2OOTA 1ZLIA 2PJ4A 2HC9A 5CPAA 3KHXA 6CPAA 3KR5A 1QQ9A 5LYFA 2PJ1A 1XFOA 1Y7EA 5HVFA 2DEAA 3WT4A 2GLJA 4PXCA 4A37A 2O4HA 4PXEA
chains in the Genus database with same CATH superfamily
4A38A 4FWUA 4M3SA 2F5IA 4E2AA 4IF5A 3CXPA 4PXBA 1YX0A 4O23A 1M4LA 2EK8A 1HDUA 4DNCA 4OIDA 3FNCA 3LMSA 1TXRA 2ZW6A 3S6GA 4DYOA 1HEEA 4ONUA 4NSQA 2ZW4A 5H84A 3WC6A 4B6ZA 3BXMA 1M4GA 1RO5A 2QECA 3H4QA 4AG7A 2WSAA 1S7KA 2PR8A 1QSMA 1Z8WA 4YWYA 3JUWA 4CYQA 3WR7A 2AE6A 3NH5A 3FYNA 3PBBA 1ELLP 4NEXA 7CPAA 4TWEA 1UWYA 2YNCC 3SI1A 4CAXA 3DR8A 5J1QA 3D3SA 5THWA 2OB0A 5KTDA 4UEEA 3K2KA 2CNTA 1CG2A 3FRMA 4A33A 1IGBA 2PC1A 3SI2A 3MN8A 2FIAA 3N7ZA 1Y0YA 4KORA 3W6SA 4NGSA 2DPTA 4OC1A 2DF5A 2AJ6A 4PV6A 2Z3MA 4FD4A 2ZELA 4XPDB 8CPAA 3TO7A 1CJWA 2ZOFA 3JTKA 1RTQA 5G22A 2CNMA 2OZGA 1CP7A 3ZJ0A 4ZI6A 2VEZA 1R3NA 3D4UA 1LAPA 4ZX9A 2J9AA 4RS2A 4HNWB 3TOBA 2OZHA 1JWQA 4MFZA 4P4JA 5HH1A 2WZNA 4F0XA 1RXTA 1AYEA 1Z2LA 4UIAA 1IICA 1ARLA 1YMEA 3S9LA 4PSXA 4HNXB 4KSAA 2V8VA 3IWWA 4LQ6A 5F47A 2V77A 2HQYA 2ZW5A 3IU1A 1YVOA 1VHOA 1ZG9A 4BINA 2PJ2A 3IEHA 2I79A 4H89A 1TKHA 1Q2CA 1Z4RA 1FY7A 4ZX8A 3I3GA 2KCWA 3IWGA 1F2PA 1XRYA 2G0BA 1MK4A 2CIJA 2VZYA 4P45A 4P6YA 2ZENA 1R43A 3B3VA 5A28A 4A31A 2C1CA 3PB4X 4CYPA 3H8FA 4P10A 2YNDA 5K8NA 2PIZA 4OKOA 2WPWA 5J8CA 2I3CA 3KZWA 1H8LA 2IMOA 3LD2A 4KOTA 4M6GA 2C6GA 5F49A 2J8NA 5FVJA 4QUSA 4XPDC 4CGNA 4ZY0A 1IYLA 2R8VA 2EO8A 4UEFA 5D8NA 1KUYA 4MCPA 4NJRA 4H6ZA 1BPNA 2WUUA 3T8WA 4KUAA 5LYLA 4CAFA 2ZEPA 5A27A 3QAHA 2PJ9A 4MBUA 5IB0A 5F46A 4R9MA 4HKFA 3D7GA 4C2ZA 2EK9A 3D66A 3KL9A 3JRUA 2O28A 3VATA 4MRIA 1YREA 4OC4A 4UA3A 3S6KA 5J8FA 2I00A 1B87A 1VKCA 2QIRA 3SJGA 2Q04A 2PJ5A 3R1KA 4YGOA 5DWMA 3VARA 5BWAB 3B2YA 3S6FA 3GY9A 3C26A 4ZBGA 2F8HA 4ZYQA 2B5GB 4FBEA 1VHSA 1KUXA 4B5OA 5IV0A 4X5KA 3B3CA 4MHZA 2J8MA 3CZXA 4YFJA 4C2XA 4LQGA 2ZEGA 5CNPA 3FEDA 4JJXA 3WABA 2P6EA 1TKFA 4P4EA 4NGNA 1NSLA 4IHMA 3FJUA 1Q2YA 4P4DA 4UWIA 3DGVA 2FXFA 2AFZA 2DPSA 4LX9A 4M85A 1R57A 4NF1A 4FAIA 4NJQA 5JH9A 2QVPA 3EXNA 1IY7A 1IIDA 2ZEFA 5CBMA 4MHNA 2QMLA 1Z5RA 2FE7A 1CX8A 3RBUA 2Q43A 2BEIA 4CYNA 5LRGA 3IWEA 3D2PA 2PQ8A 2Z0ZA 2PE3A 4MHDA 2AFXA 3V38A 4CS0B 3B3SA 1VIXA 4CGPA 2AFMA 5JM6A 3IGRA 1KZFA 1M1DA 1I21A 4BMHA 1AMPA 2BSWA 4P4FA 4JXRA 2C6PA 1GYTA 3PEIA 4QB9A 4E8OA 1CPSA 3MRUA 4GS4A 2ATRA 5AG5A 2NYQA 1HDQA 1A2ZA 1S7NA 3CDXA 4IK2A 4QBJA 3V7ZA 4KOWA 2QJ8A 4A95A 1YW4A 2VZZA 4MFJA 3DSBA 5C82A 2Z3OA 1YK3A 4KVME 1LANA 4MCSA 3D7DA 2GE3A 2ZW7A 2ABZA 2J8RA 5AG7A 3BI0A 1Z8LA 4CAVA 1V0CA 3CPAA 2VBQA 1VHEA 2XEGA 2AFSA 2R98A 3FEEA 3PBEA 2RFHA 3IFEA 1J4JA 3CPXA 3CXQA 4UFXA 5LRJA 3PRTA 3DR6A 4NGPA 1YLEA 3VWDA 4A30A 5G21A 4E0AA 4CAEA 4K30A 3RYOA 2FVGA 4A2ZA 3NFZA 2Z11A 4MJ8A 3D8PA 1S60A 3JVNA 4LUAA 4NGTA 4R3LA 3BI1A 3KR4A 3PZJA 4U5YA 4HPSA 4FD5A 4AVAA 4JLYA 3P2HA 2CY2A 2JLMA 4R87A 4M6IA 1YR0A 4DUKA 4JXQA 4FD7A 2RC4A 1LAMA 1MJAA 3D2MA 3IO1A 4U9ZA 3FMCA 3T90A 3HLPA 4JYWA 4Q38A 3EC4A 2CNSA 3TO9A 5JQ4A 1U6MA 1XEBA 2BOAA 4M6HA 4OADA 2V8GA 1Y9WA 3TC8A 4EWTA 2R7HA 3PFOA 1YSJA 2HB6A 5F09A 3KHZA 4PPZA 5LYDA 5IX3A 2Q0YA 3LWUA 4ONWA 1NSAA 2GU2A 3VWEA 3GKRA 2XEFA 2AFOA 4UCPA 1FT7A 3K9TA 4JWPA 5G1ZA 1XF8A 2G3TA 2Z3NA 3EY5A 1BOBA 3F8KA 3FH4A 4Z65A 4L8AA 4MXUA 3RO0A 2OU2A 3G8WA 4MFLA 2PVWA 2PVVA 4MHYA 1BPMA 5K8PA 4B14A 2FIWA 3DLJA 2FT0A 4Q7AA 2PCUA 1ON0A 2VL1A 3R9EA 2P6FA 3CXSA 1OBRA 1YW6A 5EBVA 5AG6A 1ZO0A 5HVHA 5LRKA 3IIBA 3ISXA 1S7LA 2WYRA 3B3WA 1M4DA 1IOFA 1DTDA 1XBUA 2HUZA 2FS5A 4MFQA 2IQ6A 2P6GA 4R8FA 1Y7RA 4BBHA 4EVYA 2PJAA 4KUBA 3EFAA 1K4JA 3PB7X 2HV2A 2JEWA 1ZLHA 4A94A 4C68A 4TNUA 4NCZA 3BJ8A 3D7HA 4PQAA 4P44A 1YVKA 4MFKA 2ODFA 2ARHA 3W6XA 2Q4ZA 3NE8A 1WWZA 2AFUA 3QNVA 3SJFA 4OIWA 4XPKA 2FL4A 2B58A 1M4IA 4F0YA 1S7FA 3NE7A 3H8GA 1PYTB 2B3UA 3L2NA 4KVXA 3D68A 4NGMA 4RUHA 4R57A 4PSWA 1QSTA 4UF4A 3TOAA 4WJBA 3R96A 3LODA 5I4MA 3TO6A 2PRQA 2ZEMA 4C7IA 2Q7SA 1QSRA 2D4PA 2IL4A 3PB9X 3PB6X 4B5PA 1QMUA 1L0CA 2CXAA 2G3AA 2Y0MA 2EVNA 2ZEHA 1Z8XA 3B8GA 2O53A 4B5PB 2C6CA 3RZAA 4YRHA 1S5KA 1F2OA 1F57A 3FXTA 2POKA 4R6TA 3R9GA 2JBKA 2V8DA 4L89A 4X3RA 5D29A 4UFWA 3TFYA 1Y0RA 3SI0A 4HNYB 3WC5A 4CGOA 2YGWA 3VH9A 3R9FA 2PJCA 3SXOA 3BJ7A 5AGEA 4KLVA 5EC4A 4Q36A 4KOVA 2EUIA 4OAEA 4OC3A 4KOXA 4X8IA 3IU2A 3FB3A 4A39A 4F9VA 2PJ3A 1ARMA 3OWCA 2NMTA 2JEVA 4BD9A 1XE4A 1EE3P 3QAYA 4I49A 3UY5A 2VI7A 3MGDA 4MHPA 4UIBA 2XEIA 1Q2DA 1TIQA 1CPXA 2BL1A 3I9SA 4OMEA 4F9UA 3I1UA 4UCMA 1I1DA 5LYIA 5KTCA 2OZUA 1FNOA 2OR4A 2PIYA 2EWBA 2R1IA 3KI9A 4ZGYB 4KSFA 4JD6A 4U9YA 4KZTA 3FECA 4AXVA 2ANPA 2GREA 2JDDA 2GFQA 1GHEA 1XIXA 4H2KA 4RI1A 2B4BA 2CTBA 4NGRA 2PRBA 1PU9A 1TF8A 4GM5A 1KWMA 3F5BA 4ZY2A 4CYOA 2BO9A 1X12A 1OZPA 4WWVA 2XEJA 4UBRA 4P4BA 4EMEA 2B4DA 5HXDA 3K9UA 4Y49B 3F0AA 2GIVA 2ZOGA 2A4NA 2G9DA 2B4DB 5AG4A 4XPLA 1P0HA 4KOSA 2H5MA 5H86A 1S3ZA 3WC7A 2V8HA 1JQGA 2Z10A 4XNHB 3CT9A 3H5ZA 4F8ZA 5K8MA 4CAWA 4OC2A 1LCPA 1BLLE 4B10A 4KS9A 2ZEDA 4KOYA 4MMOA 5KTAA 4C7HA 3E0KA 2Q4VA 4X2TA 5EMIA 2Q4YA 3KQZA 3S6HA 4CGMA 1NMTA 3ZZIA 2YNEA 4YU9A 2PJ8A 2DXQA 1XMBA 1CBXA 2QYVA 1X10A 1Z8TA 1SQHA 4AB7A 5ELYA 1YGHA 4OLLA 4QC6A 2P0WA 5F48A 4J3GA 1LFWA 1ZG8A 1I12A 5I0CA 2BUEA 5DS0A 2JBJA 1IB1E 2WPXA 2RB7A 5JPHA 4OC0A 2PDOA 4IUSA 3GB0A 2Z3KA 4CPAA 5HVGA 4KVOE 5ISVA 1MJBA 2FSRA 1Z4EA 1Q7LA 4FD6A 3SJXA 3HUVA 3G3SA 3PFEA 5IB9A 2ZPAA 2NSMA 1DE4C 3FVLA 4KSIA 4R3KA 3IJ3A 1IU8A 1CM0A 2PR1A 4EFDA 3S9NA 2ZEEA 4K3NA 4Y49C 1TKJA 3PB8X 4MY0A 3P2FA 4NFRA 4P4IA 2OH1A 2Z3PA 3LACA 2PJ6A 5HMNA 4PXDA 5JGFA 3NH4A 3N5FA 3H8EA 4KOUA 1LOKA 4AG9A 4XNHC 4F6AA 2BCOA 4R7MA 2PJ0A 3B3TA 2ZEOA 1KUVA 4OP4A 4C2YA 1Z9UA 5E96A 4MCRA 3ISZA 3KKWA 3S9MA 1B6BA 1BAVA 2CTCA 3FX6A 2F7VA 3A9LA 2CF4A 3SXNA 1QSOA 3GLJA 4JZ0A 3KASA 1M44A 4II9A 1AUGA 1N71A 1IOIA 2AFWA 1ZG7A 3KQXA 4NGQA 2C27A 1YLOA 3GYAA 3GUXA 3KGQA 3NH8A 2REEA 1TF9A 1NE9A 4UFVA 3TX8A 4B12A 4CRYB 4R76A 4PK2A 2GLFA 4UEZA 4ORFA 1BO4A 3SJEA 5GCNA 2IJZA 1PUAA 2Z3LA 4UCNA 1PCAA 3FIXA 4B11A 4OC5A 4ZY1A 3T9YA 1QSNA 1Y9KA 2GANA 1LRZA 2PSWA 4RN7A 3B7IA 4DJLA 4NXYA 2PJ7A 1XMTA 2FCKA 3W91A 3TTHA 3TT2A 4IAVA 2Q44A 3B35A 1ELMP 3FF3A 3RAMA 2Q51A 4MFPA 3QB8A 3GIUA 2X7BA 3D67A 2Q7BA 2B5GA 1CP6A 4QVTA 2ZXVA 3BLNA 2VQYA 4FUUA 3NA6A 3PP9A 1WK4A 2VXKA 4CRZB 2REFA 3TE4A 4KLWA 3SHPA 3D7FA 3IC1A 2K5TA 2B3VA 5C88A 2PJBA 2JDCA 4G1PA 4GXHA 1VGYA 1UFHA 4A32A 3R95A 1P4NA 4H6UA 1XJOA 4MCQA 5DWNA 4PK3A 2YNCA 3DNSA 1XOVA 3EO4A 4W9YA 3BHXA 4MI4A 2OOTA 1ZLIA 2PJ4A 5K8OA 3PGPA 2HC9A 5CPAA 3KHXA 3TCVA 6CPAA 3KR5A 1IYKA 3FBUA 1QQ9A 4MY3A 5LYFA 2D4OA 2PJ1A 1XFOA 4B13A 1Y7EA 5HVFA 4AVBA 2DEAA 3WT4A 2GLJA 3V8IA 2EBJA 4AVCA 4PXCA 4A37A 4UWJA 1YQEA 3DDDA 1MJ9A 2O4HA 5G20A 3RNZA 4CGLA 4PXEA
chains in the Genus database with same CATH topology
4A38A 4FWUA 4PXBA 4O23A 1M4LA 2EK8A 1HDUA 4OIDA 3LMSA 1TXRA 4DYOA 1HEEA 3WC6A 4B6ZA 3BXMA 4YWYA 3NH5A 3PBBA 7CPAA 1ELLP 4TWEA 1UWYA 3SI1A 5J1QA 5THWA 4UEEA 3K2KA 1CG2A 1IGBA 3SI2A 3MN8A 1Y0YA 4NGSA 4OC1A 2ZELA 8CPAA 2ZOFA 1RTQA 4ZI6A 1CP7A 1R3NA 3D4UA 1LAPA 4ZX9A 2J9AA 4P4JA 2WZNA 1AYEA 1Z2LA 4UIAA 1ARLA 1YMEA 3S9LA 2V8VA 3IWWA 2V77A 1VHOA 1ZG9A 2PJ2A 3IEHA 1TKHA 4ZX8A 1F2PA 1XRYA 2CIJA 4P45A 4P6YA 2ZENA 1R43A 3B3VA 2C1CA 3PB4X 3H8FA 4P10A 5K8NA 2PIZA 4OKOA 2I3CA 3KZWA 1H8LA 2IMOA 2C6GA 4ZY0A 5D8NA 4UEFA 4MCPA 4NJRA 3T8WA 1BPNA 5LYLA 2ZEPA 2PJ9A 3D7GA 2EK9A 3D66A 3KL9A 3JRUA 3VATA 4MRIA 4OC4A 3SJGA 2PJ5A 3VARA 3B2YA 2F8HA 4ZYQA 4FBEA 4MHZA 3B3CA 4LQGA 2ZEGA 3FEDA 3WABA 1TKFA 4P4EA 4NGNA 4IHMA 3FJUA 4P4DA 3DGVA 2AFZA 5JH9A 4FAIA 4NJQA 2QVPA 1IY7A 2ZEFA 5CBMA 4MHNA 1Z5RA 1CX8A 3RBUA 2Q43A 5LRGA 2PE3A 2AFXA 3V38A 3B3SA 1VIXA 2AFMA 5JM6A 1AMPA 4P4FA 2C6PA 1GYTA 3PEIA 1CPSA 3MRUA 2NYQA 1HDQA 3CDXA 4IK2A 3V7ZA 2QJ8A 1YW4A 1LANA 4MCSA 3D7DA 2ABZA 3BI0A 1Z8LA 3CPAA 1VHEA 2XEGA 2AFSA 3FEEA 3PBEA 2RFHA 3IFEA 5LRJA 3CPXA 3PRTA 4NGPA 2FVGA 3NFZA 4NGTA 3BI1A 3KR4A 4DUKA 1LAMA 3IO1A 3FMCA 3HLPA 4JYWA 2BOAA 2V8GA 3TC8A 4EWTA 3PFOA 1YSJA 2HB6A 5F09A 3KHZA 4PPZA 5LYDA 3LWUA 4ONWA 1NSAA 2GU2A 2XEFA 2AFOA 1FT7A 3K9TA 3FH4A 4Z65A 4MXUA 2PVWA 2PVVA 4MHYA 1BPMA 5K8PA 3DLJA 4Q7AA 2PCUA 2VL1A 5HVHA 1OBRA 1YW6A 3IIBA 3ISXA 2WYRA 3B3WA 1DTDA 1XBUA 2IQ6A 4R8FA 2PJAA 3PB7X 2JEWA 4A94A 1ZLHA 4TNUA 4PQAA 3D7HA 4P44A 2Q4ZA 2AFUA 3QNVA 3SJFA 4OIWA 3H8GA 1PYTB 3L2NA 3D68A 4NGMA 4RUHA 4UF4A 4WJBA 5I4MA 2PRQA 2ZEMA 3PB9X 3PB6X 1QMUA 2ZEHA 2O53A 2C6CA 3RZAA 1F2OA 1F57A 3WC7A 2POKA 4R6TA 2JBKA 2V8DA 4X3RA 5D29A 1Y0RA 3SI0A 3WC5A 3VH9A 2PJCA 4OC3A 4X8IA 4A39A 4F9VA 2PJ3A 1ARMA 4BD9A 1EE3P 4MHPA 4UIBA 2XEIA 1CPXA 4OMEA 4F9UA 3I1UA 5LYIA 1FNOA 2OR4A 2PIYA 2EWBA 3KI9A 3FECA 4AXVA 2ANPA 2GREA 4H2KA 2CTBA 4NGRA 4GM5A 1TF8A 1KWMA 4ZY2A 2BO9A 4WWVA 2XEJA 4P4BA 4EMEA 5HXDA 2ZOGA 2G9DA 2V8HA 1JQGA 5K8MA 3CT9A 4F8ZA 4OC2A 1LCPA 1BLLE 2ZEDA 4MMOA 4X2TA 3KQZA 4YU9A 2PJ8A 1XMBA 1CBXA 2QYVA 5ELYA 1LFWA 1ZG8A 5DS0A 2JBJA 2RB7A 4OC0A 3GB0A 4CPAA 5HVGA 1Q7LA 3SJXA 3HUVA 3PFEA 5IB9A 2NSMA 1DE4C 3FVLA 4KSIA 3IJ3A 4EFDA 3S9NA 2ZEEA 4K3NA 1TKJA 3PB8X 4NFRA 4P4IA 2PJ6A 4PXDA 5JGFA 3NH4A 3N5FA 3H8EA 1LOKA 2BCOA 4R7MA 2PJ0A 3B3TA 2ZEOA 4OP4A 4MCRA 3ISZA 3S9MA 3FX6A 1BAVA 2CTCA 2F7VA 2CF4A 3GLJA 4JZ0A 3KASA 2AFWA 3KQXA 1ZG7A 4NGQA 1YLOA 3KGQA 3GUXA 3NH8A 3TX8A 5LRKA 1TF9A 4R76A 2GLFA 4UEZA 3SJEA 2IJZA 1PCAA 4OC5A 4ZY1A 3B7IA 4DJLA 2PJ7A 4IAVA 3B35A 3FF3A 1ELMP 3RAMA 2Q51A 3D67A 1CP6A 4FUUA 3NA6A 3D7FA 3IC1A 2PJBA 4G1PA 1VGYA 4MCQA 1XJOA 4W9YA 5K8OA 3BHXA 2OOTA 1ZLIA 2PJ4A 2HC9A 5CPAA 3KHXA 6CPAA 3KR5A 1QQ9A 5LYFA 2PJ1A 1XFOA 1Y7EA 5HVFA 2DEAA 3WT4A 2GLJA 4PXCA 4A37A 2O4HA 4PXEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A38 A;  4FWU A;  4PXB A;  4O23 A;  1M4L A;  2EK8 A;  1HDU A;  4OID A;  3LMS A;  1TXR A;  4DYO A;  1HEE A;  3WC6 A;  4B6Z A;  3BXM A;  4YWY A;  3NH5 A;  3PBB A;  7CPA A;  1ELL P;  4TWE A;  1UWY A;  3SI1 A;  5J1Q A;  5THW A;  4UEE A;  3K2K A;  1CG2 A;  1IGB A;  3SI2 A;  3MN8 A;  1Y0Y A;  4NGS A;  4OC1 A;  2ZEL A;  8CPA A;  2ZOF A;  1RTQ A;  4ZI6 A;  1CP7 A;  1R3N A;  3D4U A;  1LAP A;  4ZX9 A;  2J9A A;  4P4J A;  2WZN A;  1AYE A;  1Z2L A;  4UIA A;  1ARL A;  1YME A;  3S9L A;  2V8V A;  3IWW A;  2V77 A;  1VHO A;  1ZG9 A;  2PJ2 A;  3IEH A;  1TKH A;  4ZX8 A;  1F2P A;  1XRY A;  2CIJ A;  4P45 A;  4P6Y A;  2ZEN A;  1R43 A;  3B3V A;  2C1C A;  3PB4 X;  3H8F A;  4P10 A;  5K8N A;  2PIZ A;  4OKO A;  2I3C A;  3KZW A;  1H8L A;  2IMO A;  2C6G A;  4ZY0 A;  5D8N A;  4UEF A;  4MCP A;  4NJR A;  3T8W A;  1BPN A;  5LYL A;  2ZEP A;  2PJ9 A;  3D7G A;  2EK9 A;  3D66 A;  3KL9 A;  3JRU A;  3VAT A;  4MRI A;  4OC4 A;  3SJG A;  2PJ5 A;  3VAR A;  3B2Y A;  2F8H A;  4ZYQ A;  4FBE A;  4MHZ A;  3B3C A;  4LQG A;  2ZEG A;  3FED A;  3WAB A;  1TKF A;  4P4E A;  4NGN A;  4IHM A;  3FJU A;  4P4D A;  3DGV A;  2AFZ A;  5JH9 A;  4FAI A;  4NJQ A;  2QVP A;  1IY7 A;  2ZEF A;  5CBM A;  4MHN A;  1Z5R A;  1CX8 A;  3RBU A;  2Q43 A;  5LRG A;  2PE3 A;  2AFX A;  3V38 A;  3B3S A;  1VIX A;  2AFM A;  5JM6 A;  1AMP A;  4P4F A;  2C6P A;  1GYT A;  3PEI A;  1CPS A;  3MRU A;  2NYQ A;  1HDQ A;  3CDX A;  4IK2 A;  3V7Z A;  2QJ8 A;  1YW4 A;  1LAN A;  4MCS A;  3D7D A;  2ABZ A;  3BI0 A;  1Z8L A;  3CPA A;  1VHE A;  2XEG A;  2AFS A;  3FEE A;  3PBE A;  2RFH A;  3IFE A;  5LRJ A;  3CPX A;  3PRT A;  4NGP A;  2FVG A;  3NFZ A;  4NGT A;  3BI1 A;  3KR4 A;  4DUK A;  1LAM A;  3IO1 A;  3FMC A;  3HLP A;  4JYW A;  2BOA A;  2V8G A;  3TC8 A;  4EWT A;  3PFO A;  1YSJ A;  2HB6 A;  5F09 A;  3KHZ A;  4PPZ A;  5LYD A;  3LWU A;  4ONW A;  1NSA A;  2GU2 A;  2XEF A;  2AFO A;  1FT7 A;  3K9T A;  3FH4 A;  4Z65 A;  4MXU A;  2PVW A;  2PVV A;  4MHY A;  1BPM A;  5K8P A;  3DLJ A;  4Q7A A;  2PCU A;  2VL1 A;  5HVH A;  1OBR A;  1YW6 A;  3IIB A;  3ISX A;  2WYR A;  3B3W A;  1DTD A;  1XBU A;  2IQ6 A;  4R8F A;  2PJA A;  3PB7 X;  2JEW A;  4A94 A;  1ZLH A;  4TNU A;  4PQA A;  3D7H A;  4P44 A;  2Q4Z A;  2AFU A;  3QNV A;  3SJF A;  4OIW A;  3H8G A;  1PYT B;  3L2N A;  3D68 A;  4NGM A;  4RUH A;  4UF4 A;  4WJB A;  5I4M A;  2PRQ A;  2ZEM A;  3PB9 X;  3PB6 X;  1QMU A;  2ZEH A;  2O53 A;  2C6C A;  3RZA A;  1F2O A;  1F57 A;  3WC7 A;  2POK A;  4R6T A;  2JBK A;  2V8D A;  4X3R A;  5D29 A;  1Y0R A;  3SI0 A;  3WC5 A;  3VH9 A;  2PJC A;  4OC3 A;  4X8I A;  4A39 A;  4F9V A;  2PJ3 A;  1ARM A;  4BD9 A;  1EE3 P;  4MHP A;  4UIB A;  2XEI A;  1CPX A;  4OME A;  4F9U A;  3I1U A;  5LYI A;  1FNO A;  2OR4 A;  2PIY A;  2EWB A;  3KI9 A;  3FEC A;  4AXV A;  2ANP A;  2GRE A;  4H2K A;  2CTB A;  4NGR A;  4GM5 A;  1TF8 A;  1KWM A;  4ZY2 A;  2BO9 A;  4WWV A;  2XEJ A;  4P4B A;  4EME A;  5HXD A;  2ZOG A;  2G9D A;  2V8H A;  1JQG A;  5K8M A;  3CT9 A;  4F8Z A;  4OC2 A;  1LCP A;  1BLL E;  2ZED A;  4MMO A;  4X2T A;  3KQZ A;  4YU9 A;  2PJ8 A;  1XMB A;  1CBX A;  2QYV A;  5ELY A;  1LFW A;  1ZG8 A;  5DS0 A;  2JBJ A;  2RB7 A;  4OC0 A;  3GB0 A;  4CPA A;  5HVG A;  1Q7L A;  3SJX A;  3HUV A;  3PFE A;  5IB9 A;  2NSM A;  1DE4 C;  3FVL A;  4KSI A;  3IJ3 A;  4EFD A;  3S9N A;  2ZEE A;  4K3N A;  1TKJ A;  3PB8 X;  4NFR A;  4P4I A;  2PJ6 A;  4PXD A;  5JGF A;  3NH4 A;  3N5F A;  3H8E A;  1LOK A;  2BCO A;  4R7M A;  2PJ0 A;  3B3T A;  2ZEO A;  4OP4 A;  4MCR A;  3ISZ A;  3S9M A;  3FX6 A;  1BAV A;  2CTC A;  2F7V A;  2CF4 A;  3GLJ A;  4JZ0 A;  3KAS A;  2AFW A;  3KQX A;  1ZG7 A;  4NGQ A;  1YLO A;  3KGQ A;  3GUX A;  3NH8 A;  3TX8 A;  5LRK A;  1TF9 A;  4R76 A;  2GLF A;  4UEZ A;  3SJE A;  2IJZ A;  1PCA A;  4OC5 A;  4ZY1 A;  3B7I A;  4DJL A;  2PJ7 A;  4IAV A;  3B35 A;  3FF3 A;  1ELM P;  3RAM A;  2Q51 A;  3D67 A;  1CP6 A;  4FUU A;  3NA6 A;  3D7F A;  3IC1 A;  2PJB A;  4G1P A;  1VGY A;  4MCQ A;  1XJO A;  4W9Y A;  5K8O A;  3BHX A;  2OOT A;  1ZLI A;  2PJ4 A;  2HC9 A;  5CPA A;  3KHX A;  6CPA A;  3KR5 A;  1QQ9 A;  5LYF A;  2PJ1 A;  1XFO A;  1Y7E A;  5HVF A;  2DEA A;  3WT4 A;  2GLJ A;  4PXC A;  4A37 A;  2O4H A;  4PXE A; 
#chains in the Genus database with same CATH topology
 4A38 A;  4FWU A;  4M3S A;  2F5I A;  4E2A A;  4IF5 A;  3CXP A;  4PXB A;  1YX0 A;  4O23 A;  1M4L A;  2EK8 A;  1HDU A;  4DNC A;  4OID A;  3FNC A;  3LMS A;  1TXR A;  2ZW6 A;  3S6G A;  4DYO A;  1HEE A;  4ONU A;  4NSQ A;  2ZW4 A;  5H84 A;  3WC6 A;  4B6Z A;  3BXM A;  1M4G A;  1RO5 A;  2QEC A;  3H4Q A;  4AG7 A;  2WSA A;  1S7K A;  2PR8 A;  1QSM A;  1Z8W A;  4YWY A;  3JUW A;  4CYQ A;  3WR7 A;  2AE6 A;  3NH5 A;  3FYN A;  3PBB A;  1ELL P;  4NEX A;  7CPA A;  4TWE A;  1UWY A;  2YNC C;  3SI1 A;  4CAX A;  3DR8 A;  5J1Q A;  3D3S A;  5THW A;  2OB0 A;  5KTD A;  4UEE A;  3K2K A;  2CNT A;  1CG2 A;  3FRM A;  4A33 A;  1IGB A;  2PC1 A;  3SI2 A;  3MN8 A;  2FIA A;  3N7Z A;  1Y0Y A;  4KOR A;  3W6S A;  4NGS A;  2DPT A;  4OC1 A;  2DF5 A;  2AJ6 A;  4PV6 A;  2Z3M A;  4FD4 A;  2ZEL A;  4XPD B;  8CPA A;  3TO7 A;  1CJW A;  2ZOF A;  3JTK A;  1RTQ A;  5G22 A;  2CNM A;  2OZG A;  1CP7 A;  3ZJ0 A;  4ZI6 A;  2VEZ A;  1R3N A;  3D4U A;  1LAP A;  4ZX9 A;  2J9A A;  4RS2 A;  4HNW B;  3TOB A;  2OZH A;  1JWQ A;  4MFZ A;  4P4J A;  5HH1 A;  2WZN A;  4F0X A;  1RXT A;  1AYE A;  1Z2L A;  4UIA A;  1IIC A;  1ARL A;  1YME A;  3S9L A;  4PSX A;  4HNX B;  4KSA A;  2V8V A;  3IWW A;  4LQ6 A;  5F47 A;  2V77 A;  2HQY A;  2ZW5 A;  3IU1 A;  1YVO A;  1VHO A;  1ZG9 A;  4BIN A;  2PJ2 A;  3IEH A;  2I79 A;  4H89 A;  1TKH A;  1Q2C A;  1Z4R A;  1FY7 A;  4ZX8 A;  3I3G A;  2KCW A;  3IWG A;  1F2P A;  1XRY A;  2G0B A;  1MK4 A;  2CIJ A;  2VZY A;  4P45 A;  4P6Y A;  2ZEN A;  1R43 A;  3B3V A;  5A28 A;  4A31 A;  2C1C A;  3PB4 X;  4CYP A;  3H8F A;  4P10 A;  2YND A;  5K8N A;  2PIZ A;  4OKO A;  2WPW A;  5J8C A;  2I3C A;  3KZW A;  1H8L A;  2IMO A;  3LD2 A;  4KOT A;  4M6G A;  2C6G A;  5F49 A;  2J8N A;  5FVJ A;  4QUS A;  4XPD C;  4CGN A;  4ZY0 A;  1IYL A;  2R8V A;  2EO8 A;  4UEF A;  5D8N A;  1KUY A;  4MCP A;  4NJR A;  4H6Z A;  1BPN A;  2WUU A;  3T8W A;  4KUA A;  5LYL A;  4CAF A;  2ZEP A;  5A27 A;  3QAH A;  2PJ9 A;  4MBU A;  5IB0 A;  5F46 A;  4R9M A;  4HKF A;  3D7G A;  4C2Z A;  2EK9 A;  3D66 A;  3KL9 A;  3JRU A;  2O28 A;  3VAT A;  4MRI A;  1YRE A;  4OC4 A;  4UA3 A;  3S6K A;  5J8F A;  2I00 A;  1B87 A;  1VKC A;  2QIR A;  3SJG A;  2Q04 A;  2PJ5 A;  3R1K A;  4YGO A;  5DWM A;  3VAR A;  5BWA B;  3B2Y A;  3S6F A;  3GY9 A;  3C26 A;  4ZBG A;  2F8H A;  4ZYQ A;  2B5G B;  4FBE A;  1VHS A;  1KUX A;  4B5O A;  5IV0 A;  4X5K A;  3B3C A;  4MHZ A;  2J8M A;  3CZX A;  4YFJ A;  4C2X A;  4LQG A;  2ZEG A;  5CNP A;  3FED A;  4JJX A;  3WAB A;  2P6E A;  1TKF A;  4P4E A;  4NGN A;  1NSL A;  4IHM A;  3FJU A;  1Q2Y A;  4P4D A;  4UWI A;  3DGV A;  2FXF A;  2AFZ A;  2DPS A;  4LX9 A;  4M85 A;  1R57 A;  4NF1 A;  4FAI A;  4NJQ A;  5JH9 A;  2QVP A;  3EXN A;  1IY7 A;  1IID A;  2ZEF A;  5CBM A;  4MHN A;  2QML A;  1Z5R A;  2FE7 A;  1CX8 A;  3RBU A;  2Q43 A;  2BEI A;  4CYN A;  5LRG A;  3IWE A;  3D2P A;  2PQ8 A;  2Z0Z A;  2PE3 A;  4MHD A;  2AFX A;  3V38 A;  4CS0 B;  3B3S A;  1VIX A;  4CGP A;  2AFM A;  5JM6 A;  3IGR A;  1KZF A;  1M1D A;  1I21 A;  4BMH A;  1AMP A;  2BSW A;  4P4F A;  4JXR A;  2C6P A;  1GYT A;  3PEI A;  4QB9 A;  4E8O A;  1CPS A;  3MRU A;  4GS4 A;  2ATR A;  5AG5 A;  2NYQ A;  1HDQ A;  1A2Z A;  1S7N A;  3CDX A;  4IK2 A;  4QBJ A;  3V7Z A;  4KOW A;  2QJ8 A;  4A95 A;  1YW4 A;  2VZZ A;  4MFJ A;  3DSB A;  5C82 A;  2Z3O A;  1YK3 A;  4KVM E;  1LAN A;  4MCS A;  3D7D A;  2GE3 A;  2ZW7 A;  2ABZ A;  2J8R A;  5AG7 A;  3BI0 A;  1Z8L A;  4CAV A;  1V0C A;  3CPA A;  2VBQ A;  1VHE A;  2XEG A;  2AFS A;  2R98 A;  3FEE A;  3PBE A;  2RFH A;  3IFE A;  1J4J A;  3CPX A;  3CXQ A;  4UFX A;  5LRJ A;  3PRT A;  3DR6 A;  4NGP A;  1YLE A;  3VWD A;  4A30 A;  5G21 A;  4E0A A;  4CAE A;  4K30 A;  3RYO A;  2FVG A;  4A2Z A;  3NFZ A;  2Z11 A;  4MJ8 A;  3D8P A;  1S60 A;  3JVN A;  4LUA A;  4NGT A;  4R3L A;  3BI1 A;  3KR4 A;  3PZJ A;  4U5Y A;  4HPS A;  4FD5 A;  4AVA A;  4JLY A;  3P2H A;  2CY2 A;  2JLM A;  4R87 A;  4M6I A;  1YR0 A;  4DUK A;  4JXQ A;  4FD7 A;  2RC4 A;  1LAM A;  1MJA A;  3D2M A;  3IO1 A;  4U9Z A;  3FMC A;  3T90 A;  3HLP A;  4JYW A;  4Q38 A;  3EC4 A;  2CNS A;  3TO9 A;  5JQ4 A;  1U6M A;  1XEB A;  2BOA A;  4M6H A;  4OAD A;  2V8G A;  1Y9W A;  3TC8 A;  4EWT A;  2R7H A;  3PFO A;  1YSJ A;  2HB6 A;  5F09 A;  3KHZ A;  4PPZ A;  5LYD A;  5IX3 A;  2Q0Y A;  3LWU A;  4ONW A;  1NSA A;  2GU2 A;  3VWE A;  3GKR A;  2XEF A;  2AFO A;  4UCP A;  1FT7 A;  3K9T A;  4JWP A;  5G1Z A;  1XF8 A;  2G3T A;  2Z3N A;  3EY5 A;  1BOB A;  3F8K A;  3FH4 A;  4Z65 A;  4L8A A;  4MXU A;  3RO0 A;  2OU2 A;  3G8W A;  4MFL A;  2PVW A;  2PVV A;  4MHY A;  1BPM A;  5K8P A;  4B14 A;  2FIW A;  3DLJ A;  2FT0 A;  4Q7A A;  2PCU A;  1ON0 A;  2VL1 A;  3R9E A;  2P6F A;  3CXS A;  1OBR A;  1YW6 A;  5EBV A;  5AG6 A;  1ZO0 A;  5HVH A;  5LRK A;  3IIB A;  3ISX A;  1S7L A;  2WYR A;  3B3W A;  1M4D A;  1IOF A;  1DTD A;  1XBU A;  2HUZ A;  2FS5 A;  4MFQ A;  2IQ6 A;  2P6G A;  4R8F A;  1Y7R A;  4BBH A;  4EVY A;  2PJA A;  4KUB A;  3EFA A;  1K4J A;  3PB7 X;  2HV2 A;  2JEW A;  1ZLH A;  4A94 A;  4C68 A;  4TNU A;  4NCZ A;  3BJ8 A;  3D7H A;  4PQA A;  4P44 A;  1YVK A;  4MFK A;  2ODF A;  2ARH A;  3W6X A;  2Q4Z A;  3NE8 A;  1WWZ A;  2AFU A;  3QNV A;  3SJF A;  4OIW A;  4XPK A;  2FL4 A;  2B58 A;  1M4I A;  4F0Y A;  1S7F A;  3NE7 A;  3H8G A;  1PYT B;  2B3U A;  3L2N A;  4KVX A;  3D68 A;  4NGM A;  4RUH A;  4R57 A;  4PSW A;  1QST A;  4UF4 A;  3TOA A;  4WJB A;  3R96 A;  3LOD A;  5I4M A;  3TO6 A;  2PRQ A;  2ZEM A;  4C7I A;  2Q7S A;  1QSR A;  2D4P A;  2IL4 A;  3PB9 X;  3PB6 X;  4B5P A;  1QMU A;  1L0C A;  2CXA A;  2G3A A;  2Y0M A;  2EVN A;  2ZEH A;  1Z8X A;  3B8G A;  2O53 A;  4B5P B;  2C6C A;  3RZA A;  4YRH A;  1S5K A;  1F2O A;  1F57 A;  3FXT A;  2POK A;  4R6T A;  3R9G A;  2JBK A;  2V8D A;  4L89 A;  4X3R A;  5D29 A;  4UFW A;  3TFY A;  1Y0R A;  3SI0 A;  4HNY B;  3WC5 A;  4CGO A;  2YGW A;  3VH9 A;  3R9F A;  2PJC A;  3SXO A;  3BJ7 A;  5AGE A;  4KLV A;  5EC4 A;  4Q36 A;  4KOV A;  2EUI A;  4OAE A;  4OC3 A;  4KOX A;  4X8I A;  3IU2 A;  3FB3 A;  4A39 A;  4F9V A;  2PJ3 A;  1ARM A;  3OWC A;  2NMT A;  2JEV A;  4BD9 A;  1XE4 A;  1EE3 P;  3QAY A;  4I49 A;  3UY5 A;  2VI7 A;  3MGD A;  4MHP A;  4UIB A;  2XEI A;  1Q2D A;  1TIQ A;  1CPX A;  2BL1 A;  3I9S A;  4OME A;  4F9U A;  3I1U A;  4UCM A;  1I1D A;  5LYI A;  5KTC A;  2OZU A;  1FNO A;  2OR4 A;  2PIY A;  2EWB A;  2R1I A;  3KI9 A;  4ZGY B;  4KSF A;  4JD6 A;  4U9Y A;  4KZT A;  3FEC A;  4AXV A;  2ANP A;  2GRE A;  2JDD A;  2GFQ A;  1GHE A;  1XIX A;  4H2K A;  4RI1 A;  2B4B A;  2CTB A;  4NGR A;  2PRB A;  1PU9 A;  1TF8 A;  4GM5 A;  1KWM A;  3F5B A;  4ZY2 A;  4CYO A;  2BO9 A;  1X12 A;  1OZP A;  4WWV A;  2XEJ A;  4UBR A;  4P4B A;  4EME A;  2B4D A;  5HXD A;  3K9U A;  4Y49 B;  3F0A A;  2GIV A;  2ZOG A;  2A4N A;  2G9D A;  2B4D B;  5AG4 A;  4XPL A;  1P0H A;  4KOS A;  2H5M A;  5H86 A;  1S3Z A;  3WC7 A;  2V8H A;  1JQG A;  2Z10 A;  4XNH B;  3CT9 A;  3H5Z A;  4F8Z A;  5K8M A;  4CAW A;  4OC2 A;  1LCP A;  1BLL E;  4B10 A;  4KS9 A;  2ZED A;  4KOY A;  4MMO A;  5KTA A;  4C7H A;  3E0K A;  2Q4V A;  4X2T A;  5EMI A;  2Q4Y A;  3KQZ A;  3S6H A;  4CGM A;  1NMT A;  3ZZI A;  2YNE A;  4YU9 A;  2PJ8 A;  2DXQ A;  1XMB A;  1CBX A;  2QYV A;  1X10 A;  1Z8T A;  1SQH A;  4AB7 A;  5ELY A;  1YGH A;  4OLL A;  4QC6 A;  2P0W A;  5F48 A;  4J3G A;  1LFW A;  1ZG8 A;  1I12 A;  5I0C A;  2BUE A;  5DS0 A;  2JBJ A;  1IB1 E;  2WPX A;  2RB7 A;  5JPH A;  4OC0 A;  2PDO A;  4IUS A;  3GB0 A;  2Z3K A;  4CPA A;  5HVG A;  4KVO E;  5ISV A;  1MJB A;  2FSR A;  1Z4E A;  1Q7L A;  4FD6 A;  3SJX A;  3HUV A;  3G3S A;  3PFE A;  5IB9 A;  2ZPA A;  2NSM A;  1DE4 C;  3FVL A;  4KSI A;  4R3K A;  3IJ3 A;  1IU8 A;  1CM0 A;  2PR1 A;  4EFD A;  3S9N A;  2ZEE A;  4K3N A;  4Y49 C;  1TKJ A;  3PB8 X;  4MY0 A;  3P2F A;  4NFR A;  4P4I A;  2OH1 A;  2Z3P A;  3LAC A;  2PJ6 A;  5HMN A;  4PXD A;  5JGF A;  3NH4 A;  3N5F A;  3H8E A;  4KOU A;  1LOK A;  4AG9 A;  4XNH C;  4F6A A;  2BCO A;  4R7M A;  2PJ0 A;  3B3T A;  2ZEO A;  1KUV A;  4OP4 A;  4C2Y A;  1Z9U A;  5E96 A;  4MCR A;  3ISZ A;  3KKW A;  3S9M A;  1B6B A;  1BAV A;  2CTC A;  3FX6 A;  2F7V A;  3A9L A;  2CF4 A;  3SXN A;  1QSO A;  3GLJ A;  4JZ0 A;  3KAS A;  1M44 A;  4II9 A;  1AUG A;  1N71 A;  1IOI A;  2AFW A;  1ZG7 A;  3KQX A;  4NGQ A;  2C27 A;  1YLO A;  3GYA A;  3GUX A;  3KGQ A;  3NH8 A;  2REE A;  1TF9 A;  1NE9 A;  4UFV A;  3TX8 A;  4B12 A;  4CRY B;  4R76 A;  4PK2 A;  2GLF A;  4UEZ A;  4ORF A;  1BO4 A;  3SJE A;  5GCN A;  2IJZ A;  1PUA A;  2Z3L A;  4UCN A;  1PCA A;  3FIX A;  4B11 A;  4OC5 A;  4ZY1 A;  3T9Y A;  1QSN A;  1Y9K A;  2GAN A;  1LRZ A;  2PSW A;  4RN7 A;  3B7I A;  4DJL A;  4NXY A;  2PJ7 A;  1XMT A;  2FCK A;  3W91 A;  3TTH A;  3TT2 A;  4IAV A;  2Q44 A;  3B35 A;  1ELM P;  3FF3 A;  3RAM A;  2Q51 A;  4MFP A;  3QB8 A;  3GIU A;  2X7B A;  3D67 A;  2Q7B A;  2B5G A;  1CP6 A;  4QVT A;  2ZXV A;  3BLN A;  2VQY A;  4FUU A;  3NA6 A;  3PP9 A;  1WK4 A;  2VXK A;  4CRZ B;  2REF A;  3TE4 A;  4KLW A;  3SHP A;  3D7F A;  3IC1 A;  2K5T A;  2B3V A;  5C88 A;  2PJB A;  2JDC A;  4G1P A;  4GXH A;  1VGY A;  1UFH A;  4A32 A;  3R95 A;  1P4N A;  4H6U A;  1XJO A;  4MCQ A;  5DWN A;  4PK3 A;  2YNC A;  3DNS A;  1XOV A;  3EO4 A;  4W9Y A;  3BHX A;  4MI4 A;  2OOT A;  1ZLI A;  2PJ4 A;  5K8O A;  3PGP A;  2HC9 A;  5CPA A;  3KHX A;  3TCV A;  6CPA A;  3KR5 A;  1IYK A;  3FBU A;  1QQ9 A;  4MY3 A;  5LYF A;  2D4O A;  2PJ1 A;  1XFO A;  4B13 A;  1Y7E A;  5HVF A;  4AVB A;  2DEA A;  3WT4 A;  2GLJ A;  3V8I A;  2EBJ A;  4AVC A;  4PXC A;  4A37 A;  4UWJ A;  1YQE A;  3DDD A;  1MJ9 A;  2O4H A;  5G20 A;  3RNZ A;  4CGL A;  4PXE A; 
#chains in the Genus database with same CATH homology
 4A38 A;  4FWU A;  4PXB A;  4O23 A;  1M4L A;  2EK8 A;  1HDU A;  4OID A;  3LMS A;  1TXR A;  4DYO A;  1HEE A;  3WC6 A;  4B6Z A;  3BXM A;  4YWY A;  3NH5 A;  3PBB A;  7CPA A;  1ELL P;  4TWE A;  1UWY A;  3SI1 A;  5J1Q A;  5THW A;  4UEE A;  3K2K A;  1CG2 A;  1IGB A;  3SI2 A;  3MN8 A;  1Y0Y A;  4NGS A;  4OC1 A;  2ZEL A;  8CPA A;  2ZOF A;  1RTQ A;  4ZI6 A;  1CP7 A;  1R3N A;  3D4U A;  1LAP A;  4ZX9 A;  2J9A A;  4P4J A;  2WZN A;  1AYE A;  1Z2L A;  4UIA A;  1ARL A;  1YME A;  3S9L A;  2V8V A;  3IWW A;  2V77 A;  1VHO A;  1ZG9 A;  2PJ2 A;  3IEH A;  1TKH A;  4ZX8 A;  1F2P A;  1XRY A;  2CIJ A;  4P45 A;  4P6Y A;  2ZEN A;  1R43 A;  3B3V A;  2C1C A;  3PB4 X;  3H8F A;  4P10 A;  5K8N A;  2PIZ A;  4OKO A;  2I3C A;  3KZW A;  1H8L A;  2IMO A;  2C6G A;  4ZY0 A;  5D8N A;  4UEF A;  4MCP A;  4NJR A;  3T8W A;  1BPN A;  5LYL A;  2ZEP A;  2PJ9 A;  3D7G A;  2EK9 A;  3D66 A;  3KL9 A;  3JRU A;  3VAT A;  4MRI A;  4OC4 A;  3SJG A;  2PJ5 A;  3VAR A;  3B2Y A;  2F8H A;  4ZYQ A;  4FBE A;  4MHZ A;  3B3C A;  4LQG A;  2ZEG A;  3FED A;  3WAB A;  1TKF A;  4P4E A;  4NGN A;  4IHM A;  3FJU A;  4P4D A;  3DGV A;  2AFZ A;  5JH9 A;  4FAI A;  4NJQ A;  2QVP A;  1IY7 A;  2ZEF A;  5CBM A;  4MHN A;  1Z5R A;  1CX8 A;  3RBU A;  2Q43 A;  5LRG A;  2PE3 A;  2AFX A;  3V38 A;  3B3S A;  1VIX A;  2AFM A;  5JM6 A;  1AMP A;  4P4F A;  2C6P A;  1GYT A;  3PEI A;  1CPS A;  3MRU A;  2NYQ A;  1HDQ A;  3CDX A;  4IK2 A;  3V7Z A;  2QJ8 A;  1YW4 A;  1LAN A;  4MCS A;  3D7D A;  2ABZ A;  3BI0 A;  1Z8L A;  3CPA A;  1VHE A;  2XEG A;  2AFS A;  3FEE A;  3PBE A;  2RFH A;  3IFE A;  5LRJ A;  3CPX A;  3PRT A;  4NGP A;  2FVG A;  3NFZ A;  4NGT A;  3BI1 A;  3KR4 A;  4DUK A;  1LAM A;  3IO1 A;  3FMC A;  3HLP A;  4JYW A;  2BOA A;  2V8G A;  3TC8 A;  4EWT A;  3PFO A;  1YSJ A;  2HB6 A;  5F09 A;  3KHZ A;  4PPZ A;  5LYD A;  3LWU A;  4ONW A;  1NSA A;  2GU2 A;  2XEF A;  2AFO A;  1FT7 A;  3K9T A;  3FH4 A;  4Z65 A;  4MXU A;  2PVW A;  2PVV A;  4MHY A;  1BPM A;  5K8P A;  3DLJ A;  4Q7A A;  2PCU A;  2VL1 A;  5HVH A;  1OBR A;  1YW6 A;  3IIB A;  3ISX A;  2WYR A;  3B3W A;  1DTD A;  1XBU A;  2IQ6 A;  4R8F A;  2PJA A;  3PB7 X;  2JEW A;  4A94 A;  1ZLH A;  4TNU A;  4PQA A;  3D7H A;  4P44 A;  2Q4Z A;  2AFU A;  3QNV A;  3SJF A;  4OIW A;  3H8G A;  1PYT B;  3L2N A;  3D68 A;  4NGM A;  4RUH A;  4UF4 A;  4WJB A;  5I4M A;  2PRQ A;  2ZEM A;  3PB9 X;  3PB6 X;  1QMU A;  2ZEH A;  2O53 A;  2C6C A;  3RZA A;  1F2O A;  1F57 A;  3WC7 A;  2POK A;  4R6T A;  2JBK A;  2V8D A;  4X3R A;  5D29 A;  1Y0R A;  3SI0 A;  3WC5 A;  3VH9 A;  2PJC A;  4OC3 A;  4X8I A;  4A39 A;  4F9V A;  2PJ3 A;  1ARM A;  4BD9 A;  1EE3 P;  4MHP A;  4UIB A;  2XEI A;  1CPX A;  4OME A;  4F9U A;  3I1U A;  5LYI A;  1FNO A;  2OR4 A;  2PIY A;  2EWB A;  3KI9 A;  3FEC A;  4AXV A;  2ANP A;  2GRE A;  4H2K A;  2CTB A;  4NGR A;  4GM5 A;  1TF8 A;  1KWM A;  4ZY2 A;  2BO9 A;  4WWV A;  2XEJ A;  4P4B A;  4EME A;  5HXD A;  2ZOG A;  2G9D A;  2V8H A;  1JQG A;  5K8M A;  3CT9 A;  4F8Z A;  4OC2 A;  1LCP A;  1BLL E;  2ZED A;  4MMO A;  4X2T A;  3KQZ A;  4YU9 A;  2PJ8 A;  1XMB A;  1CBX A;  2QYV A;  5ELY A;  1LFW A;  1ZG8 A;  5DS0 A;  2JBJ A;  2RB7 A;  4OC0 A;  3GB0 A;  4CPA A;  5HVG A;  1Q7L A;  3SJX A;  3HUV A;  3PFE A;  5IB9 A;  2NSM A;  1DE4 C;  3FVL A;  4KSI A;  3IJ3 A;  4EFD A;  3S9N A;  2ZEE A;  4K3N A;  1TKJ A;  3PB8 X;  4NFR A;  4P4I A;  2PJ6 A;  4PXD A;  5JGF A;  3NH4 A;  3N5F A;  3H8E A;  1LOK A;  2BCO A;  4R7M A;  2PJ0 A;  3B3T A;  2ZEO A;  4OP4 A;  4MCR A;  3ISZ A;  3S9M A;  3FX6 A;  1BAV A;  2CTC A;  2F7V A;  2CF4 A;  3GLJ A;  4JZ0 A;  3KAS A;  2AFW A;  3KQX A;  1ZG7 A;  4NGQ A;  1YLO A;  3KGQ A;  3GUX A;  3NH8 A;  3TX8 A;  5LRK A;  1TF9 A;  4R76 A;  2GLF A;  4UEZ A;  3SJE A;  2IJZ A;  1PCA A;  4OC5 A;  4ZY1 A;  3B7I A;  4DJL A;  2PJ7 A;  4IAV A;  3B35 A;  3FF3 A;  1ELM P;  3RAM A;  2Q51 A;  3D67 A;  1CP6 A;  4FUU A;  3NA6 A;  3D7F A;  3IC1 A;  2PJB A;  4G1P A;  1VGY A;  4MCQ A;  1XJO A;  4W9Y A;  5K8O A;  3BHX A;  2OOT A;  1ZLI A;  2PJ4 A;  2HC9 A;  5CPA A;  3KHX A;  6CPA A;  3KR5 A;  1QQ9 A;  5LYF A;  2PJ1 A;  1XFO A;  1Y7E A;  5HVF A;  2DEA A;  3WT4 A;  2GLJ A;  4PXC A;  4A37 A;  2O4H A;  4PXE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...