4H2KA

Crystal structure of the catalytic domain of succinyl-diaminopimelate desuccinylase from haemophilus influenzae
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
266
structure length
258
Chain Sequence
NAMKEKVVSLAQDLIRRPSISPNDEGCQQIIAERLEKLGFQIEWMPFNDTLNLWAKHGTSEPVIAFAGHTDVVPTGDENQWSSPPFSAEIIDGMLYGRGAADMKGSLAAMIVAAEEYVKANPNHKGTIALLITSDEEATAKDGTIHVVETLMARDEKITYCMVGEPSSAKNLGDVVKNGRRGGGKLLDSITSAIEETIGITPKAETGTSDGRFIALMGAEVVEFGPLNSTIHKVNECVSVEDLGKCGEIYHKMLVNLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Succinyl-diaminopimelate desuccinylase
publication title The dimerization domain in DapE enzymes is required for catalysis.
pubmed doi rcsb
source organism Haemophilus influenzae
total genus 92
structure length 258
sequence length 266
chains with identical sequence B
ec nomenclature ec 3.5.1.18: Succinyl-diaminopimelate desuccinylase.
pdb deposition date 2012-09-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01546 Peptidase_M20 Peptidase family M20/M25/M40
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 4h2kA00
3FEDA 4MCQA 4X8IA 3T8WA 3KR5A 2PIZA 1CP6A 1ZLHA 1YMEA 3PRTA 1ZG7A 4FAIA 1BPMA 3D7DA 4OC1A 1XFOA 4ONWA 3NH8A 1AYEA 2ZEMA 5LRGA 5K8MA 3L2NA 1CPSA 4OP4A 2PJ2A 1DE4C 8CPAA 4ZX9A 3QNVA 4H2KA 2IJZA 1XMBA 4MHYA 5HVFA 4P4DA 2PJ1A 1Q7LA 3TC8A 4IAVA 2F7VA 4JZ0A 1TF8A 3BI1A 2AFSA 1PYTB 3KQXA 3ISZA 1UWYA 3SI1A 2Q43A 1R43A 2WZNA 1LOKA 2ZEPA 4CPAA 1KWMA 3ISXA 3KQZA 4DYOA 3S9LA 4AXVA 1LANA 3SI0A 4ZY0A 1PCAA 5LYLA 4F9UA 4NGSA 5K8OA 2J9AA 3B3WA 2FVGA 3PB9X 5CBMA 4OKOA 2HC9A 2XEIA 3CPAA 4NGTA 2EK9A 2POKA 1YLOA 4NGQA 3SJFA 4PXDA 3RAMA 1BAVA 1IY7A 3D68A 3BHXA 4OC2A 4OMEA 4LQGA 2QJ8A 4UIAA 3B3VA 2V8HA 3V7ZA 3IJ3A 3WC7A 2AFWA 5JGFA 1Y7EA 3K9TA 4MHNA 2JBJA 2BO9A 4A94A 4OC0A 4EFDA 3IFEA 4F9VA 2RB7A 4A38A 3B7IA 1LCPA 3DLJA 2Q51A 3RZAA 4NGMA 4JYWA 4EWTA 1OBRA 2GREA 4X2TA 3NH5A 4NGPA 3B35A 2XEJA 3GLJA 2OOTA 4OIDA 2I3CA 3KGQA 5JM6A 3FH4A 1Z2LA 2C6PA 2Q4ZA 2ZEEA 4OC3A 4WJBA 4MMOA 2OR4A 3BXMA 3WC5A 2AFMA 1RTQA 3N5FA 2PIYA 1HEEA 5LRKA 2IMOA 3H8GA 1TXRA 3FX6A 5HXDA 2JEWA 1FNOA 5LRJA 2ZELA 1HDQA 1CP7A 2BOAA 3B3TA 2O53A 5K8PA 4NGRA 4OC5A 2JBKA 4K3NA 2V8GA 3IIBA 4DUKA 2PJCA 2PCUA 6CPAA 3H8EA 4ZI6A 4Z65A 1BLLE 4A39A 2ABZA 3KZWA 4ZYQA 2PJ7A 2PJ6A 2BCOA 3KASA 5HVHA 3NH4A 1ZLIA 1F2PA 2VL1A 4F8ZA 3D67A 4UF4A 2V8VA 4R76A 1F57A 4GM5A 4OC4A 4O23A 1ZG8A 3D7GA 2PJ4A 5LYDA 7CPAA 3CPXA 3HUVA 5K8NA 2DEAA 2EWBA 2AFUA 2ZEDA 2PVWA 2PJ5A 4UIBA 1CX8A 3VATA 1XBUA 3CDXA 3PBEA 4IHMA 5HVGA 4FWUA 1Z5RA 1XJOA 1CG2A 3LWUA 2GU2A 3WC6A 1VGYA 4KSIA 3FVLA 3FF3A 2C1CA 2V8DA 2AFOA 3IO1A 2ZENA 4P4JA 2ZEOA 5D8NA 4MHZA 2PJ8A 4FUUA 2HB6A 3PB6X 4FBEA 1TF9A 4R8FA 1EE3P 1LAMA 2NSMA 5CPAA 1ZG9A 4NJRA 3FECA 2QYVA 4TWEA 3PB4X 1ELMP 2AFZA 4RUHA 3FEEA 5THWA 2GLJA 2QVPA 2C6CA 5ELYA 3MN8A 3FMCA 4ZY1A 3B3CA 3S9NA 3TX8A 2ZOGA 1CPXA 3GB0A 3PB7X 4DJLA 3H8FA 1GYTA 4ZY2A 2WYRA 3PFEA 2CF4A 2XEGA 3D7HA 1H8LA 4PXEA 3KI9A 4P44A 4Q7AA 2ZEFA 4YWYA 2RFHA 3MRUA 4P10A 3KHXA 1BPNA 1NSAA 3D7FA 2PE3A 1ELLP 3IWWA 3FJUA 2IQ6A 3VH9A 1TKFA 3KHZA 3B3SA 4MCRA 3GUXA 3LMSA 5J1QA 4IK2A 3JRUA 4NFRA 4TNUA 3HLPA 3S9MA 3DGVA 1LAPA 2PJBA 1IGBA 1YSJA 2PJ0A 4R6TA 1QMUA 4OIWA 5F09A 2CTCA 4P6YA 4P4IA 4EMEA 3K2KA 5JH9A 1F2OA 4MXUA 4PXBA 3I1UA 4P4FA 3VARA 4WWVA 3RBUA 3D66A 1JQGA 4W9YA 1Y0RA 4NGNA 3SJXA 2O4HA 3SI2A 3SJEA 2V77A 2PJAA 3D4UA 3NA6A 1Y0YA 1R3NA 4B6ZA 1AMPA 3WABA 4MCSA 4UEZA 4UEFA 1VHEA 4X3RA 5LYIA 5DS0A 1DTDA 2PVVA 2GLFA 4R7MA 4YU9A 3V38A 2EK8A 1Z8LA 4UEEA 4MRIA 4P4EA 5D29A 2ANPA 5IB9A 2ZOFA 4PXCA 1FT7A 1CBXA 3IC1A 1XRYA 1YW4A 2PJ3A 3SJGA 2PRQA 3PEIA 5LYFA 2CTBA 1LFWA 1VHOA 3KR4A 4PPZA 4NJQA 2PJ9A 2AFXA 2NYQA 5I4MA 4BD9A 1QQ9A 1ARLA 2C6GA 3KL9A 3WT4A 4A37A 2ZEGA 4G1PA 2CIJA 1HDUA 4P45A 1ARMA 4MCPA 4P4BA 1TKHA 3B2YA 3CT9A 3BI0A 3NFZA 1M4LA 4PQAA 2ZEHA 1TKJA 2G9DA 4MHPA 1YW6A 3PB8X 2XEFA 3PFOA 4ZX8A 3PBBA 2F8HA 1VIXA 3IEHA
chains in the Genus database with same CATH superfamily
1MK4A 3FEDA 2Z10A 4MCQA 2AJ6A 2CY2A 4X8IA 3T8WA 3KR5A 4R9MA 2J8RA 2PIZA 1CP6A 1ZLHA 2REFA 3GKRA 1YMEA 2Q7SA 3TFYA 3N7ZA 3PRTA 1ZG7A 4FAIA 1BPMA 3D7DA 5G21A 1ON0A 4OC1A 1XFOA 4ONWA 4NSQA 3NH8A 1AYEA 1CM0A 1B6BA 2GFQA 4ONUA 2ZEMA 4XPDB 5LRGA 5K8MA 3L2NA 1CPSA 1QSMA 2BEIA 4OP4A 2PJ2A 4NCZA 2ODFA 1DE4C 4FD5A 5F48A 8CPAA 4ZX9A 3QNVA 4H2KA 2IJZA 1XMBA 4MHYA 3JTKA 4R57A 5HVFA 4RS2A 4F0YA 4P4DA 2PJ1A 2PC1A 1Q7LA 5EBVA 3TC8A 3D2MA 2RC4A 2OZGA 3R95A 4IAVA 1I21A 3SHPA 2YNEA 5EC4A 2F7VA 4JZ0A 2FS5A 4QB9A 1TF8A 3BI1A 2Z3LA 4UWIA 1VHSA 2AFSA 4Y49B 2ZW4A 2F5IA 1PYTB 5H86A 3KQXA 3ISZA 1UWYA 3SI1A 3LODA 2Q43A 1R43A 2WZNA 1LOKA 3BJ7A 3I3GA 1OZPA 4OLLA 3PGPA 3FB3A 4AVCA 2ZEPA 4CPAA 1KWMA 3DDDA 3ISXA 1XIXA 3KQZA 3ZJ0A 4DYOA 3S9LA 4HNXB 4AXVA 1LRZA 4JD6A 1NMTA 1LANA 3SI0A 4ZY0A 1PCAA 4MFPA 4NF1A 1I12A 4BMHA 4F9UA 5LYLA 4II9A 2FIAA 4NGSA 5K8OA 2J9AA 3B3WA 2FVGA 3CXQA 3PB9X 1Y9KA 5CBMA 2VZZA 2Z3PA 2HC9A 2PR8A 2XEIA 3CPAA 1B87A 4OKOA 1WK4A 2OZUA 4NGTA 3FRMA 2Q0YA 2KCWA 2EK9A 5C88A 2POKA 5KTCA 1YLOA 4JWPA 4NGQA 4L8AA 3SJFA 5IX3A 4PXDA 3RAMA 1YK3A 2OB0A 1BAVA 5DWMA 1IY7A 1KUYA 2BUEA 3D68A 1K4JA 1I1DA 4QUSA 4LQ6A 3BHXA 4OC2A 5G20A 3TO7A 3EY5A 1S7KA 4MY3A 3R1KA 4K30A 4OMEA 2PQ8A 4LQGA 2FL4A 2B4DA 2QJ8A 4UIAA 2FSRA 2V8HA 3B3VA 3V7ZA 3IJ3A 3D2PA 3WC7A 2Q44A 2AFWA 4PV6A 1Z4EA 3TE4A 5JGFA 1Y7EA 3R9EA 1Q2CA 3K9TA 4MHNA 3R9GA 2JBJA 3D8PA 3PZJA 2BO9A 4A94A 2YNDA 4OC0A 4EFDA 3IFEA 4HKFA 4AVBA 4F9VA 2RB7A 4A38A 4MBUA 2QIRA 3SXOA 3B7IA 2BL1A 3EO4A 1LCPA 3LD2A 4CS0B 3DLJA 2Q51A 3RZAA 2DF5A 4M85A 1P4NA 2J8MA 3EXNA 4NGMA 5KTAA 4JYWA 4C7IA 2PSWA 4EWTA 1OBRA 2BSWA 2GREA 1M4IA 4M6HA 4X2TA 4QBJA 2G0BA 1YREA 3NH5A 2NMTA 3JVNA 3B35A 4NGPA 1S7FA 2VQYA 2XEJA 3TO9A 3H4QA 4UCMA 2EVNA 3GLJA 4UCPA 2OOTA 4OIDA 3GYAA 2I3CA 2X7BA 4KOXA 4B12A 2DXQA 4H6ZA 3KGQA 4KOTA 1VKCA 3QB8A 3FNCA 3FH4A 1Z2LA 5JM6A 2C6PA 2Q4ZA 4M6IA 4R3LA 2ZEEA 4OC3A 4WJBA 4MMOA 4KUBA 2B3UA 2B3VA 4UBRA 2QMLA 1M4GA 2OR4A 3BXMA 3WC5A 4LX9A 5C82A 4KVXA 3WR7A 2AFMA 1RTQA 3B8GA 2PIYA 1HEEA 2GIVA 3N5FA 2IMOA 1IOFA 5LRKA 2G3AA 3V8IA 3H8GA 1TXRA 5H84A 4C2XA 3FX6A 2O28A 5HXDA 4PSXA 3I9SA 3A9LA 1YVKA 2JEWA 1FNOA 5LRJA 4M6GA 2P0WA 4A30A 2ZELA 1HDQA 1PU9A 4Q36A 3RO0A 2Y0MA 1CP7A 1GHEA 2Z3OA 1SQHA 2BOAA 1XF8A 3B3TA 4OADA 4Q38A 1XMTA 1V0CA 2O53A 5E96A 5K8PA 4NGRA 4OC5A 2JBKA 4U5YA 3TT2A 2P6GA 4K3NA 4U9ZA 1L0CA 2V8GA 1A2ZA 2WSAA 3IIBA 2PJCA 4B11A 4DUKA 4ZGYB 3DR8A 4KLWA 2CNTA 3TOAA 2PCUA 1TIQA 4IUSA 6CPAA 5JQ4A 3H8EA 3G8WA 4KZTA 4ZI6A 5AG5A 3T90A 4Z65A 4PSWA 3F0AA 4MJ8A 1BLLE 4CGMA 4YFJA 4A39A 2OZHA 2ABZA 3KZWA 4ZYQA 3CXPA 2JEVA 2EUIA 2PJ7A 2PJ6A 4R87A 2BCOA 4HNYB 3W6SA 3KASA 5HVHA 4CGLA 3NH4A 4A32A 4I49A 3TO6A 1ZLIA 4KLVA 1F2PA 2VL1A 4F8ZA 3D67A 5AG6A 4MY0A 2ZPAA 1Y7RA 4UF4A 2EBJA 4KORA 1YQEA 2V8VA 3S6GA 4R76A 1F57A 4GM5A 4MFKA 1Q2DA 1S60A 4AB7A 4FD6A 4OC4A 2IL4A 3QAHA 3FBUA 2Z3MA 1ZG8A 4O23A 5AG4A 3D7GA 2PJ4A 5LYDA 3P2FA 4LUAA 7CPAA 3CPXA 3HUVA 5EMIA 1FY7A 5K8NA 4GXHA 1NE9A 4CGPA 2DEAA 2EWBA 2AFUA 2HUZA 2ZEDA 4CYNA 2PVWA 2PJ5A 3K9UA 3MGDA 4KSFA 4UIBA 1CX8A 2J8NA 2VI7A 3VATA 5IB0A 5IV0A 1XBUA 3CDXA 5AG7A 1QSRA 3IWGA 2B58A 4QC6A 3PBEA 4KSAA 4IHMA 5HVGA 1YGHA 2JDDA 2R98A 4FWUA 4B14A 5AGEA 4UFXA 1Z5RA 4B5PB 1U6MA 3W6XA 1XJOA 1CG2A 3H5ZA 3JUWA 3LWUA 2GU2A 4AG9A 4C2YA 5ISVA 3V38A 3WC6A 4E2AA 1VGYA 1IYKA 5GCNA 1Y9WA 2FCKA 2ZXVA 4KSIA 3FVLA 4ORFA 1KUXA 5A28A 3FF3A 5HMNA 5KTDA 2C27A 1JWQA 2C1CA 2V8DA 2AFOA 4KOYA 3IO1A 4B5PA 3EC4A 2ZENA 4F6AA 4P4JA 5HH1A 2ZEOA 5D8NA 4MHZA 1KUVA 2PJ8A 4FUUA 1M44A 2HB6A 3S6HA 3PB6X 3S6KA 4FBEA 2CNMA 1TF9A 1YVOA 4R8FA 1EE3P 2ZW6A 3QAYA 5BWAB 1LAMA 2VBQA 2NSMA 5CPAA 1ZG9A 3DNSA 2D4OA 1YR0A 1PUAA 3PP9A 4NJRA 3FECA 1XEBA 2GANA 1Z8TA 2PRBA 2QYVA 4TWEA 3PB4X 1ELMP 2AFZA 3GIUA 4IF5A 4RUHA 1QSNA 3FEEA 4BBHA 2ZW5A 5THWA 1X12A 2EO8A 2GLJA 1QSOA 4MI4A 1IIDA 2QVPA 4CRYB 2C6CA 3G3SA 5F47A 3UY5A 1XE4A 5ELYA 3EFAA 3MN8A 2B4BA 4KVOE 3FMCA 4ZY1A 3B3CA 4C68A 3TX8A 3S9NA 4AG7A 4JXQA 2ZOGA 1CPXA 3GB0A 4KOVA 3PB7X 4A95A 4DJLA 3H8FA 1GYTA 4DNCA 4ZY2A 1RO5A 1M4DA 2WYRA 3PFEA 1RXTA 2CF4A 4JJXA 4XPKA 1IOIA 4PK3A 4CAEA 1S7NA 2XEGA 2YNCC 4L89A 4CAXA 3F5BA 3BLNA 3D7HA 3IU1A 1H8LA 4PK2A 4CRZB 4PXEA 4U9YA 3KI9A 4P44A 4CYPA 2YGWA 5J8FA 1QSTA 4Q7AA 2FT0A 2ZEFA 4KUAA 4KOWA 4YWYA 3TCVA 4B10A 4CAVA 2RFHA 3MRUA 4P10A 3KHXA 4MHDA 4A2ZA 4AVAA 1BPNA 4JXRA 1NSAA 4GS4A 2D4PA 4EVYA 2K5TA 3S6FA 3D7FA 2PE3A 3KKWA 1ELLP 3IWWA 3NE7A 3FJUA 2IQ6A 2VZYA 3VH9A 2JDCA 1YX0A 1TKFA 3KHZA 3B3SA 3OWCA 4UFWA 4MCRA 3W91A 1Q2YA 1Z9UA 3GUXA 3LMSA 3VWDA 3TOBA 2AE6A 4UWJA 2WPXA 1BO4A 4IK2A 4XNHB 5J1QA 1P0HA 5J8CA 3JRUA 4NFRA 2ZW7A 1IYLA 3DSBA 4RI1A 4TNUA 3HLPA 4NEXA 3DGVA 3S9MA 2FE7A 1LAPA 1S7LA 5G22A 2I79A 2Q4YA 3P2HA 2DPSA 5DWNA 1Z8WA 1IB1E 2PJBA 1IGBA 1YSJA 3IGRA 2GE3A 2PJ0A 4R6TA 1QMUA 1CJWA 2H5MA 4FD7A 4CYQA 4OIWA 5F09A 2CTCA 4P6YA 1MJAA 3GY9A 2Q7BA 3FYNA 3FXTA 5I0CA 4P4IA 4HPSA 2R7HA 2CNSA 3K2KA 2PDOA 2Q4VA 4A31A 4EMEA 5JH9A 1WWZA 2FXFA 1F2OA 4MXUA 4PXBA 3I1UA 3C26A 4F0XA 3R9FA 4BINA 1N71A 4P4FA 3VARA 4R3KA 4WWVA 3TTHA 2WUUA 4FD4A 3RBUA 3LACA 4UFVA 2QECA 4MFQA 4C7HA 3D66A 1JQGA 4KVME 4W9YA 1NSLA 1MJBA 1Y0RA 4NGNA 3SJXA 2O4HA 1M1DA 3SI2A 1UFHA 2V77A 3SJEA 2Q04A 2PJAA 3D4UA 2YNCA 2P6FA 4B5OA 5CNPA 3NA6A 1Y0YA 1R3NA 4B6ZA 1AMPA 2Z3KA 1X10A 1BOBA 2B5GB 3CZXA 3VWEA 4KOSA 4X5KA 4A33A 3WABA 2PR1A 4MFLA 4MCSA 1ZO0A 2Z3NA 1MJ9A 4UEZA 1S5KA 5F49A 4UEFA 1VHEA 2OH1A 4X3RA 3DR6A 2VXKA 2B4DB 5LYIA 5DS0A 4CGNA 2VEZA 1DTDA 2PVVA 2GLFA 1J4JA 4MFZA 2R1IA 2ARHA 4JLYA 2B5GA 4R7MA 1YLEA 4YU9A 2EK8A 1Z8LA 2R8VA 4KOUA 4MRIA 4OAEA 4UEEA 3RYOA 4P4EA 4CAFA 2Z0ZA 5D29A 2ANPA 5IB9A 4UCNA 2ZOFA 3FIXA 1FT7A 4H6UA 4PXCA 1CBXA 2FIWA 4E8OA 3IC1A 3IWEA 2WPWA 4MFJA 1XRYA 1YW4A 4UA3A 5FVJA 3T9YA 2PJ3A 3SJGA 2PRQA 1XOVA 4XNHC 3PEIA 5LYFA 1S3ZA 2G3TA 2CTBA 3R96A 3SXNA 4XPDC 1LFWA 1Z4RA 2ATRA 4YGOA 1KZFA 1VHOA 2I00A 3KR4A 2JLMA 3E0KA 4PPZA 4NJQA 2PJ9A 4KS9A 2Z11A 1IICA 2AFXA 3BJ8A 2NYQA 2CXAA 2P6EA 4NXYA 4RN7A 3RNZA 5I4MA 4BD9A 5A27A 5G1ZA 1QQ9A 4ZBGA 4CAWA 1ARLA 2C6GA 3KL9A 3F8KA 3WT4A 4CGOA 3CXSA 4A37A 2ZEGA 4G1PA 2CIJA 5F46A 1HDUA 4P45A 4QVTA 5JPHA 1ARMA 4MCPA 3IU2A 4P4BA 3D3SA 1TKHA 4Y49C 3B2YA 1AUGA 3CT9A 3BI0A 2HV2A 3NFZA 1M4LA 2HQYA 2OU2A 4PQAA 4E0AA 2ZEHA 1IU8A 4C2ZA 1TKJA 2REEA 2DPTA 2G9DA 4H89A 4M3SA 4MHPA 1YW6A 3PB8X 2XEFA 3PFOA 4B13A 2A4NA 4HNWB 1Z8XA 4XPLA 3PBBA 3NE8A 4ZX8A 3ZZIA 2F8HA 1R57A 4YRHA 1VIXA 3IEHA 4J3GA 4CYOA
chains in the Genus database with same CATH topology
3FEDA 4MCQA 4X8IA 3T8WA 3KR5A 2PIZA 1CP6A 1ZLHA 1YMEA 3PRTA 1ZG7A 4FAIA 1BPMA 3D7DA 4OC1A 1XFOA 4ONWA 3NH8A 1AYEA 2ZEMA 5LRGA 5K8MA 3L2NA 1CPSA 4OP4A 2PJ2A 1DE4C 8CPAA 4ZX9A 3QNVA 4H2KA 2IJZA 1XMBA 4MHYA 5HVFA 4P4DA 2PJ1A 1Q7LA 3TC8A 4IAVA 2F7VA 4JZ0A 1TF8A 3BI1A 2AFSA 1PYTB 3KQXA 3ISZA 1UWYA 3SI1A 2Q43A 1R43A 2WZNA 1LOKA 2ZEPA 4CPAA 1KWMA 3ISXA 3KQZA 4DYOA 3S9LA 4AXVA 1LANA 3SI0A 4ZY0A 1PCAA 5LYLA 4F9UA 4NGSA 5K8OA 2J9AA 3B3WA 2FVGA 3PB9X 5CBMA 4OKOA 2HC9A 2XEIA 3CPAA 4NGTA 2EK9A 2POKA 1YLOA 4NGQA 3SJFA 4PXDA 3RAMA 1BAVA 1IY7A 3D68A 3BHXA 4OC2A 4OMEA 4LQGA 2QJ8A 4UIAA 3B3VA 2V8HA 3V7ZA 3IJ3A 3WC7A 2AFWA 5JGFA 1Y7EA 3K9TA 4MHNA 2JBJA 2BO9A 4A94A 4OC0A 4EFDA 3IFEA 4F9VA 2RB7A 4A38A 3B7IA 1LCPA 3DLJA 2Q51A 3RZAA 4NGMA 4JYWA 4EWTA 1OBRA 2GREA 4X2TA 3NH5A 4NGPA 3B35A 2XEJA 3GLJA 2OOTA 4OIDA 2I3CA 3KGQA 5JM6A 3FH4A 1Z2LA 2C6PA 2Q4ZA 2ZEEA 4OC3A 4WJBA 4MMOA 2OR4A 3BXMA 3WC5A 2AFMA 1RTQA 3N5FA 2PIYA 1HEEA 5LRKA 2IMOA 3H8GA 1TXRA 3FX6A 5HXDA 2JEWA 1FNOA 5LRJA 2ZELA 1HDQA 1CP7A 2BOAA 3B3TA 2O53A 5K8PA 4NGRA 4OC5A 2JBKA 4K3NA 2V8GA 3IIBA 4DUKA 2PJCA 2PCUA 6CPAA 3H8EA 4ZI6A 4Z65A 1BLLE 4A39A 2ABZA 3KZWA 4ZYQA 2PJ7A 2PJ6A 2BCOA 3KASA 5HVHA 3NH4A 1ZLIA 1F2PA 2VL1A 4F8ZA 3D67A 4UF4A 2V8VA 4R76A 1F57A 4GM5A 4OC4A 4O23A 1ZG8A 3D7GA 2PJ4A 5LYDA 7CPAA 3CPXA 3HUVA 5K8NA 2DEAA 2EWBA 2AFUA 2ZEDA 2PVWA 2PJ5A 4UIBA 1CX8A 3VATA 1XBUA 3CDXA 3PBEA 4IHMA 5HVGA 4FWUA 1Z5RA 1XJOA 1CG2A 3LWUA 2GU2A 3WC6A 1VGYA 4KSIA 3FVLA 3FF3A 2C1CA 2V8DA 2AFOA 3IO1A 2ZENA 4P4JA 2ZEOA 5D8NA 4MHZA 2PJ8A 4FUUA 2HB6A 3PB6X 4FBEA 1TF9A 4R8FA 1EE3P 1LAMA 2NSMA 5CPAA 1ZG9A 4NJRA 3FECA 2QYVA 4TWEA 3PB4X 1ELMP 2AFZA 4RUHA 3FEEA 5THWA 2GLJA 2QVPA 2C6CA 5ELYA 3MN8A 3FMCA 4ZY1A 3B3CA 3S9NA 3TX8A 2ZOGA 1CPXA 3GB0A 3PB7X 4DJLA 3H8FA 1GYTA 4ZY2A 2WYRA 3PFEA 2CF4A 2XEGA 3D7HA 1H8LA 4PXEA 3KI9A 4P44A 4Q7AA 2ZEFA 4YWYA 2RFHA 3MRUA 4P10A 3KHXA 1BPNA 1NSAA 3D7FA 2PE3A 1ELLP 3IWWA 3FJUA 2IQ6A 3VH9A 1TKFA 3KHZA 3B3SA 4MCRA 3GUXA 3LMSA 5J1QA 4IK2A 3JRUA 4NFRA 4TNUA 3HLPA 3S9MA 3DGVA 1LAPA 2PJBA 1IGBA 1YSJA 2PJ0A 4R6TA 1QMUA 4OIWA 5F09A 2CTCA 4P6YA 4P4IA 4EMEA 3K2KA 5JH9A 1F2OA 4MXUA 4PXBA 3I1UA 4P4FA 3VARA 4WWVA 3RBUA 3D66A 1JQGA 4W9YA 1Y0RA 4NGNA 3SJXA 2O4HA 3SI2A 3SJEA 2V77A 2PJAA 3D4UA 3NA6A 1Y0YA 1R3NA 4B6ZA 1AMPA 3WABA 4MCSA 4UEZA 4UEFA 1VHEA 4X3RA 5LYIA 5DS0A 1DTDA 2PVVA 2GLFA 4R7MA 4YU9A 3V38A 2EK8A 1Z8LA 4UEEA 4MRIA 4P4EA 5D29A 2ANPA 5IB9A 2ZOFA 4PXCA 1FT7A 1CBXA 3IC1A 1XRYA 1YW4A 2PJ3A 3SJGA 2PRQA 3PEIA 5LYFA 2CTBA 1LFWA 1VHOA 3KR4A 4PPZA 4NJQA 2PJ9A 2AFXA 2NYQA 5I4MA 4BD9A 1QQ9A 1ARLA 2C6GA 3KL9A 3WT4A 4A37A 2ZEGA 4G1PA 2CIJA 1HDUA 4P45A 1ARMA 4MCPA 4P4BA 1TKHA 3B2YA 3CT9A 3BI0A 3NFZA 1M4LA 4PQAA 2ZEHA 1TKJA 2G9DA 4MHPA 1YW6A 3PB8X 2XEFA 3PFOA 4ZX8A 3PBBA 2F8HA 1VIXA 3IEHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FED A;  4MCQ A;  4X8I A;  3T8W A;  3KR5 A;  2PIZ A;  1CP6 A;  1ZLH A;  1YME A;  3PRT A;  1ZG7 A;  4FAI A;  1BPM A;  3D7D A;  4OC1 A;  1XFO A;  4ONW A;  3NH8 A;  1AYE A;  2ZEM A;  5LRG A;  5K8M A;  3L2N A;  1CPS A;  4OP4 A;  2PJ2 A;  1DE4 C;  8CPA A;  4ZX9 A;  3QNV A;  4H2K A;  2IJZ A;  1XMB A;  4MHY A;  5HVF A;  4P4D A;  2PJ1 A;  1Q7L A;  3TC8 A;  4IAV A;  2F7V A;  4JZ0 A;  1TF8 A;  3BI1 A;  2AFS A;  1PYT B;  3KQX A;  3ISZ A;  1UWY A;  3SI1 A;  2Q43 A;  1R43 A;  2WZN A;  1LOK A;  2ZEP A;  4CPA A;  1KWM A;  3ISX A;  3KQZ A;  4DYO A;  3S9L A;  4AXV A;  1LAN A;  3SI0 A;  4ZY0 A;  1PCA A;  5LYL A;  4F9U A;  4NGS A;  5K8O A;  2J9A A;  3B3W A;  2FVG A;  3PB9 X;  5CBM A;  4OKO A;  2HC9 A;  2XEI A;  3CPA A;  4NGT A;  2EK9 A;  2POK A;  1YLO A;  4NGQ A;  3SJF A;  4PXD A;  3RAM A;  1BAV A;  1IY7 A;  3D68 A;  3BHX A;  4OC2 A;  4OME A;  4LQG A;  2QJ8 A;  4UIA A;  3B3V A;  2V8H A;  3V7Z A;  3IJ3 A;  3WC7 A;  2AFW A;  5JGF A;  1Y7E A;  3K9T A;  4MHN A;  2JBJ A;  2BO9 A;  4A94 A;  4OC0 A;  4EFD A;  3IFE A;  4F9V A;  2RB7 A;  4A38 A;  3B7I A;  1LCP A;  3DLJ A;  2Q51 A;  3RZA A;  4NGM A;  4JYW A;  4EWT A;  1OBR A;  2GRE A;  4X2T A;  3NH5 A;  4NGP A;  3B35 A;  2XEJ A;  3GLJ A;  2OOT A;  4OID A;  2I3C A;  3KGQ A;  5JM6 A;  3FH4 A;  1Z2L A;  2C6P A;  2Q4Z A;  2ZEE A;  4OC3 A;  4WJB A;  4MMO A;  2OR4 A;  3BXM A;  3WC5 A;  2AFM A;  1RTQ A;  3N5F A;  2PIY A;  1HEE A;  5LRK A;  2IMO A;  3H8G A;  1TXR A;  3FX6 A;  5HXD A;  2JEW A;  1FNO A;  5LRJ A;  2ZEL A;  1HDQ A;  1CP7 A;  2BOA A;  3B3T A;  2O53 A;  5K8P A;  4NGR A;  4OC5 A;  2JBK A;  4K3N A;  2V8G A;  3IIB A;  4DUK A;  2PJC A;  2PCU A;  6CPA A;  3H8E A;  4ZI6 A;  4Z65 A;  1BLL E;  4A39 A;  2ABZ A;  3KZW A;  4ZYQ A;  2PJ7 A;  2PJ6 A;  2BCO A;  3KAS A;  5HVH A;  3NH4 A;  1ZLI A;  1F2P A;  2VL1 A;  4F8Z A;  3D67 A;  4UF4 A;  2V8V A;  4R76 A;  1F57 A;  4GM5 A;  4OC4 A;  4O23 A;  1ZG8 A;  3D7G A;  2PJ4 A;  5LYD A;  7CPA A;  3CPX A;  3HUV A;  5K8N A;  2DEA A;  2EWB A;  2AFU A;  2ZED A;  2PVW A;  2PJ5 A;  4UIB A;  1CX8 A;  3VAT A;  1XBU A;  3CDX A;  3PBE A;  4IHM A;  5HVG A;  4FWU A;  1Z5R A;  1XJO A;  1CG2 A;  3LWU A;  2GU2 A;  3WC6 A;  1VGY A;  4KSI A;  3FVL A;  3FF3 A;  2C1C A;  2V8D A;  2AFO A;  3IO1 A;  2ZEN A;  4P4J A;  2ZEO A;  5D8N A;  4MHZ A;  2PJ8 A;  4FUU A;  2HB6 A;  3PB6 X;  4FBE A;  1TF9 A;  4R8F A;  1EE3 P;  1LAM A;  2NSM A;  5CPA A;  1ZG9 A;  4NJR A;  3FEC A;  2QYV A;  4TWE A;  3PB4 X;  1ELM P;  2AFZ A;  4RUH A;  3FEE A;  5THW A;  2GLJ A;  2QVP A;  2C6C A;  5ELY A;  3MN8 A;  3FMC A;  4ZY1 A;  3B3C A;  3S9N A;  3TX8 A;  2ZOG A;  1CPX A;  3GB0 A;  3PB7 X;  4DJL A;  3H8F A;  1GYT A;  4ZY2 A;  2WYR A;  3PFE A;  2CF4 A;  2XEG A;  3D7H A;  1H8L A;  4PXE A;  3KI9 A;  4P44 A;  4Q7A A;  2ZEF A;  4YWY A;  2RFH A;  3MRU A;  4P10 A;  3KHX A;  1BPN A;  1NSA A;  3D7F A;  2PE3 A;  1ELL P;  3IWW A;  3FJU A;  2IQ6 A;  3VH9 A;  1TKF A;  3KHZ A;  3B3S A;  4MCR A;  3GUX A;  3LMS A;  5J1Q A;  4IK2 A;  3JRU A;  4NFR A;  4TNU A;  3HLP A;  3S9M A;  3DGV A;  1LAP A;  2PJB A;  1IGB A;  1YSJ A;  2PJ0 A;  4R6T A;  1QMU A;  4OIW A;  5F09 A;  2CTC A;  4P6Y A;  4P4I A;  4EME A;  3K2K A;  5JH9 A;  1F2O A;  4MXU A;  4PXB A;  3I1U A;  4P4F A;  3VAR A;  4WWV A;  3RBU A;  3D66 A;  1JQG A;  4W9Y A;  1Y0R A;  4NGN A;  3SJX A;  2O4H A;  3SI2 A;  3SJE A;  2V77 A;  2PJA A;  3D4U A;  3NA6 A;  1Y0Y A;  1R3N A;  4B6Z A;  1AMP A;  3WAB A;  4MCS A;  4UEZ A;  4UEF A;  1VHE A;  4X3R A;  5LYI A;  5DS0 A;  1DTD A;  2PVV A;  2GLF A;  4R7M A;  4YU9 A;  3V38 A;  2EK8 A;  1Z8L A;  4UEE A;  4MRI A;  4P4E A;  5D29 A;  2ANP A;  5IB9 A;  2ZOF A;  4PXC A;  1FT7 A;  1CBX A;  3IC1 A;  1XRY A;  1YW4 A;  2PJ3 A;  3SJG A;  2PRQ A;  3PEI A;  5LYF A;  2CTB A;  1LFW A;  1VHO A;  3KR4 A;  4PPZ A;  4NJQ A;  2PJ9 A;  2AFX A;  2NYQ A;  5I4M A;  4BD9 A;  1QQ9 A;  1ARL A;  2C6G A;  3KL9 A;  3WT4 A;  4A37 A;  2ZEG A;  4G1P A;  2CIJ A;  1HDU A;  4P45 A;  1ARM A;  4MCP A;  4P4B A;  1TKH A;  3B2Y A;  3CT9 A;  3BI0 A;  3NFZ A;  1M4L A;  4PQA A;  2ZEH A;  1TKJ A;  2G9D A;  4MHP A;  1YW6 A;  3PB8 X;  2XEF A;  3PFO A;  4ZX8 A;  3PBB A;  2F8H A;  1VIX A;  3IEH A; 
#chains in the Genus database with same CATH topology
 1MK4 A;  3FED A;  2Z10 A;  4MCQ A;  2AJ6 A;  2CY2 A;  4X8I A;  3T8W A;  3KR5 A;  4R9M A;  2J8R A;  2PIZ A;  1CP6 A;  1ZLH A;  2REF A;  3GKR A;  1YME A;  2Q7S A;  3TFY A;  3N7Z A;  3PRT A;  1ZG7 A;  4FAI A;  1BPM A;  3D7D A;  5G21 A;  1ON0 A;  4OC1 A;  1XFO A;  4ONW A;  4NSQ A;  3NH8 A;  1AYE A;  1CM0 A;  1B6B A;  2GFQ A;  4ONU A;  2ZEM A;  4XPD B;  5LRG A;  5K8M A;  3L2N A;  1CPS A;  1QSM A;  2BEI A;  4OP4 A;  2PJ2 A;  4NCZ A;  2ODF A;  1DE4 C;  4FD5 A;  5F48 A;  8CPA A;  4ZX9 A;  3QNV A;  4H2K A;  2IJZ A;  1XMB A;  4MHY A;  3JTK A;  4R57 A;  5HVF A;  4RS2 A;  4F0Y A;  4P4D A;  2PJ1 A;  2PC1 A;  1Q7L A;  5EBV A;  3TC8 A;  3D2M A;  2RC4 A;  2OZG A;  3R95 A;  4IAV A;  1I21 A;  3SHP A;  2YNE A;  5EC4 A;  2F7V A;  4JZ0 A;  2FS5 A;  4QB9 A;  1TF8 A;  3BI1 A;  2Z3L A;  4UWI A;  1VHS A;  2AFS A;  4Y49 B;  2ZW4 A;  2F5I A;  1PYT B;  5H86 A;  3KQX A;  3ISZ A;  1UWY A;  3SI1 A;  3LOD A;  2Q43 A;  1R43 A;  2WZN A;  1LOK A;  3BJ7 A;  3I3G A;  1OZP A;  4OLL A;  3PGP A;  3FB3 A;  4AVC A;  2ZEP A;  4CPA A;  1KWM A;  3DDD A;  3ISX A;  1XIX A;  3KQZ A;  3ZJ0 A;  4DYO A;  3S9L A;  4HNX B;  4AXV A;  1LRZ A;  4JD6 A;  1NMT A;  1LAN A;  3SI0 A;  4ZY0 A;  1PCA A;  4MFP A;  4NF1 A;  1I12 A;  4BMH A;  4F9U A;  5LYL A;  4II9 A;  2FIA A;  4NGS A;  5K8O A;  2J9A A;  3B3W A;  2FVG A;  3CXQ A;  3PB9 X;  1Y9K A;  5CBM A;  2VZZ A;  2Z3P A;  2HC9 A;  2PR8 A;  2XEI A;  3CPA A;  1B87 A;  4OKO A;  1WK4 A;  2OZU A;  4NGT A;  3FRM A;  2Q0Y A;  2KCW A;  2EK9 A;  5C88 A;  2POK A;  5KTC A;  1YLO A;  4JWP A;  4NGQ A;  4L8A A;  3SJF A;  5IX3 A;  4PXD A;  3RAM A;  1YK3 A;  2OB0 A;  1BAV A;  5DWM A;  1IY7 A;  1KUY A;  2BUE A;  3D68 A;  1K4J A;  1I1D A;  4QUS A;  4LQ6 A;  3BHX A;  4OC2 A;  5G20 A;  3TO7 A;  3EY5 A;  1S7K A;  4MY3 A;  3R1K A;  4K30 A;  4OME A;  2PQ8 A;  4LQG A;  2FL4 A;  2B4D A;  2QJ8 A;  4UIA A;  2FSR A;  2V8H A;  3B3V A;  3V7Z A;  3IJ3 A;  3D2P A;  3WC7 A;  2Q44 A;  2AFW A;  4PV6 A;  1Z4E A;  3TE4 A;  5JGF A;  1Y7E A;  3R9E A;  1Q2C A;  3K9T A;  4MHN A;  3R9G A;  2JBJ A;  3D8P A;  3PZJ A;  2BO9 A;  4A94 A;  2YND A;  4OC0 A;  4EFD A;  3IFE A;  4HKF A;  4AVB A;  4F9V A;  2RB7 A;  4A38 A;  4MBU A;  2QIR A;  3SXO A;  3B7I A;  2BL1 A;  3EO4 A;  1LCP A;  3LD2 A;  4CS0 B;  3DLJ A;  2Q51 A;  3RZA A;  2DF5 A;  4M85 A;  1P4N A;  2J8M A;  3EXN A;  4NGM A;  5KTA A;  4JYW A;  4C7I A;  2PSW A;  4EWT A;  1OBR A;  2BSW A;  2GRE A;  1M4I A;  4M6H A;  4X2T A;  4QBJ A;  2G0B A;  1YRE A;  3NH5 A;  2NMT A;  3JVN A;  3B35 A;  4NGP A;  1S7F A;  2VQY A;  2XEJ A;  3TO9 A;  3H4Q A;  4UCM A;  2EVN A;  3GLJ A;  4UCP A;  2OOT A;  4OID A;  3GYA A;  2I3C A;  2X7B A;  4KOX A;  4B12 A;  2DXQ A;  4H6Z A;  3KGQ A;  4KOT A;  1VKC A;  3QB8 A;  3FNC A;  3FH4 A;  1Z2L A;  5JM6 A;  2C6P A;  2Q4Z A;  4M6I A;  4R3L A;  2ZEE A;  4OC3 A;  4WJB A;  4MMO A;  4KUB A;  2B3U A;  2B3V A;  4UBR A;  2QML A;  1M4G A;  2OR4 A;  3BXM A;  3WC5 A;  4LX9 A;  5C82 A;  4KVX A;  3WR7 A;  2AFM A;  1RTQ A;  3B8G A;  2PIY A;  1HEE A;  2GIV A;  3N5F A;  2IMO A;  1IOF A;  5LRK A;  2G3A A;  3V8I A;  3H8G A;  1TXR A;  5H84 A;  4C2X A;  3FX6 A;  2O28 A;  5HXD A;  4PSX A;  3I9S A;  3A9L A;  1YVK A;  2JEW A;  1FNO A;  5LRJ A;  4M6G A;  2P0W A;  4A30 A;  2ZEL A;  1HDQ A;  1PU9 A;  4Q36 A;  3RO0 A;  2Y0M A;  1CP7 A;  1GHE A;  2Z3O A;  1SQH A;  2BOA A;  1XF8 A;  3B3T A;  4OAD A;  4Q38 A;  1XMT A;  1V0C A;  2O53 A;  5E96 A;  5K8P A;  4NGR A;  4OC5 A;  2JBK A;  4U5Y A;  3TT2 A;  2P6G A;  4K3N A;  4U9Z A;  1L0C A;  2V8G A;  1A2Z A;  2WSA A;  3IIB A;  2PJC A;  4B11 A;  4DUK A;  4ZGY B;  3DR8 A;  4KLW A;  2CNT A;  3TOA A;  2PCU A;  1TIQ A;  4IUS A;  6CPA A;  5JQ4 A;  3H8E A;  3G8W A;  4KZT A;  4ZI6 A;  5AG5 A;  3T90 A;  4Z65 A;  4PSW A;  3F0A A;  4MJ8 A;  1BLL E;  4CGM A;  4YFJ A;  4A39 A;  2OZH A;  2ABZ A;  3KZW A;  4ZYQ A;  3CXP A;  2JEV A;  2EUI A;  2PJ7 A;  2PJ6 A;  4R87 A;  2BCO A;  4HNY B;  3W6S A;  3KAS A;  5HVH A;  4CGL A;  3NH4 A;  4A32 A;  4I49 A;  3TO6 A;  1ZLI A;  4KLV A;  1F2P A;  2VL1 A;  4F8Z A;  3D67 A;  5AG6 A;  4MY0 A;  2ZPA A;  1Y7R A;  4UF4 A;  2EBJ A;  4KOR A;  1YQE A;  2V8V A;  3S6G A;  4R76 A;  1F57 A;  4GM5 A;  4MFK A;  1Q2D A;  1S60 A;  4AB7 A;  4FD6 A;  4OC4 A;  2IL4 A;  3QAH A;  3FBU A;  2Z3M A;  1ZG8 A;  4O23 A;  5AG4 A;  3D7G A;  2PJ4 A;  5LYD A;  3P2F A;  4LUA A;  7CPA A;  3CPX A;  3HUV A;  5EMI A;  1FY7 A;  5K8N A;  4GXH A;  1NE9 A;  4CGP A;  2DEA A;  2EWB A;  2AFU A;  2HUZ A;  2ZED A;  4CYN A;  2PVW A;  2PJ5 A;  3K9U A;  3MGD A;  4KSF A;  4UIB A;  1CX8 A;  2J8N A;  2VI7 A;  3VAT A;  5IB0 A;  5IV0 A;  1XBU A;  3CDX A;  5AG7 A;  1QSR A;  3IWG A;  2B58 A;  4QC6 A;  3PBE A;  4KSA A;  4IHM A;  5HVG A;  1YGH A;  2JDD A;  2R98 A;  4FWU A;  4B14 A;  5AGE A;  4UFX A;  1Z5R A;  4B5P B;  1U6M A;  3W6X A;  1XJO A;  1CG2 A;  3H5Z A;  3JUW A;  3LWU A;  2GU2 A;  4AG9 A;  4C2Y A;  5ISV A;  3V38 A;  3WC6 A;  4E2A A;  1VGY A;  1IYK A;  5GCN A;  1Y9W A;  2FCK A;  2ZXV A;  4KSI A;  3FVL A;  4ORF A;  1KUX A;  5A28 A;  3FF3 A;  5HMN A;  5KTD A;  2C27 A;  1JWQ A;  2C1C A;  2V8D A;  2AFO A;  4KOY A;  3IO1 A;  4B5P A;  3EC4 A;  2ZEN A;  4F6A A;  4P4J A;  5HH1 A;  2ZEO A;  5D8N A;  4MHZ A;  1KUV A;  2PJ8 A;  4FUU A;  1M44 A;  2HB6 A;  3S6H A;  3PB6 X;  3S6K A;  4FBE A;  2CNM A;  1TF9 A;  1YVO A;  4R8F A;  1EE3 P;  2ZW6 A;  3QAY A;  5BWA B;  1LAM A;  2VBQ A;  2NSM A;  5CPA A;  1ZG9 A;  3DNS A;  2D4O A;  1YR0 A;  1PUA A;  3PP9 A;  4NJR A;  3FEC A;  1XEB A;  2GAN A;  1Z8T A;  2PRB A;  2QYV A;  4TWE A;  3PB4 X;  1ELM P;  2AFZ A;  3GIU A;  4IF5 A;  4RUH A;  1QSN A;  3FEE A;  4BBH A;  2ZW5 A;  5THW A;  1X12 A;  2EO8 A;  2GLJ A;  1QSO A;  4MI4 A;  1IID A;  2QVP A;  4CRY B;  2C6C A;  3G3S A;  5F47 A;  3UY5 A;  1XE4 A;  5ELY A;  3EFA A;  3MN8 A;  2B4B A;  4KVO E;  3FMC A;  4ZY1 A;  3B3C A;  4C68 A;  3TX8 A;  3S9N A;  4AG7 A;  4JXQ A;  2ZOG A;  1CPX A;  3GB0 A;  4KOV A;  3PB7 X;  4A95 A;  4DJL A;  3H8F A;  1GYT A;  4DNC A;  4ZY2 A;  1RO5 A;  1M4D A;  2WYR A;  3PFE A;  1RXT A;  2CF4 A;  4JJX A;  4XPK A;  1IOI A;  4PK3 A;  4CAE A;  1S7N A;  2XEG A;  2YNC C;  4L89 A;  4CAX A;  3F5B A;  3BLN A;  3D7H A;  3IU1 A;  1H8L A;  4PK2 A;  4CRZ B;  4PXE A;  4U9Y A;  3KI9 A;  4P44 A;  4CYP A;  2YGW A;  5J8F A;  1QST A;  4Q7A A;  2FT0 A;  2ZEF A;  4KUA A;  4KOW A;  4YWY A;  3TCV A;  4B10 A;  4CAV A;  2RFH A;  3MRU A;  4P10 A;  3KHX A;  4MHD A;  4A2Z A;  4AVA A;  1BPN A;  4JXR A;  1NSA A;  4GS4 A;  2D4P A;  4EVY A;  2K5T A;  3S6F A;  3D7F A;  2PE3 A;  3KKW A;  1ELL P;  3IWW A;  3NE7 A;  3FJU A;  2IQ6 A;  2VZY A;  3VH9 A;  2JDC A;  1YX0 A;  1TKF A;  3KHZ A;  3B3S A;  3OWC A;  4UFW A;  4MCR A;  3W91 A;  1Q2Y A;  1Z9U A;  3GUX A;  3LMS A;  3VWD A;  3TOB A;  2AE6 A;  4UWJ A;  2WPX A;  1BO4 A;  4IK2 A;  4XNH B;  5J1Q A;  1P0H A;  5J8C A;  3JRU A;  4NFR A;  2ZW7 A;  1IYL A;  3DSB A;  4RI1 A;  4TNU A;  3HLP A;  4NEX A;  3DGV A;  3S9M A;  2FE7 A;  1LAP A;  1S7L A;  5G22 A;  2I79 A;  2Q4Y A;  3P2H A;  2DPS A;  5DWN A;  1Z8W A;  1IB1 E;  2PJB A;  1IGB A;  1YSJ A;  3IGR A;  2GE3 A;  2PJ0 A;  4R6T A;  1QMU A;  1CJW A;  2H5M A;  4FD7 A;  4CYQ A;  4OIW A;  5F09 A;  2CTC A;  4P6Y A;  1MJA A;  3GY9 A;  2Q7B A;  3FYN A;  3FXT A;  5I0C A;  4P4I A;  4HPS A;  2R7H A;  2CNS A;  3K2K A;  2PDO A;  2Q4V A;  4A31 A;  4EME A;  5JH9 A;  1WWZ A;  2FXF A;  1F2O A;  4MXU A;  4PXB A;  3I1U A;  3C26 A;  4F0X A;  3R9F A;  4BIN A;  1N71 A;  4P4F A;  3VAR A;  4R3K A;  4WWV A;  3TTH A;  2WUU A;  4FD4 A;  3RBU A;  3LAC A;  4UFV A;  2QEC A;  4MFQ A;  4C7H A;  3D66 A;  1JQG A;  4KVM E;  4W9Y A;  1NSL A;  1MJB A;  1Y0R A;  4NGN A;  3SJX A;  2O4H A;  1M1D A;  3SI2 A;  1UFH A;  2V77 A;  3SJE A;  2Q04 A;  2PJA A;  3D4U A;  2YNC A;  2P6F A;  4B5O A;  5CNP A;  3NA6 A;  1Y0Y A;  1R3N A;  4B6Z A;  1AMP A;  2Z3K A;  1X10 A;  1BOB A;  2B5G B;  3CZX A;  3VWE A;  4KOS A;  4X5K A;  4A33 A;  3WAB A;  2PR1 A;  4MFL A;  4MCS A;  1ZO0 A;  2Z3N A;  1MJ9 A;  4UEZ A;  1S5K A;  5F49 A;  4UEF A;  1VHE A;  2OH1 A;  4X3R A;  3DR6 A;  2VXK A;  2B4D B;  5LYI A;  5DS0 A;  4CGN A;  2VEZ A;  1DTD A;  2PVV A;  2GLF A;  1J4J A;  4MFZ A;  2R1I A;  2ARH A;  4JLY A;  2B5G A;  4R7M A;  1YLE A;  4YU9 A;  2EK8 A;  1Z8L A;  2R8V A;  4KOU A;  4MRI A;  4OAE A;  4UEE A;  3RYO A;  4P4E A;  4CAF A;  2Z0Z A;  5D29 A;  2ANP A;  5IB9 A;  4UCN A;  2ZOF A;  3FIX A;  1FT7 A;  4H6U A;  4PXC A;  1CBX A;  2FIW A;  4E8O A;  3IC1 A;  3IWE A;  2WPW A;  4MFJ A;  1XRY A;  1YW4 A;  4UA3 A;  5FVJ A;  3T9Y A;  2PJ3 A;  3SJG A;  2PRQ A;  1XOV A;  4XNH C;  3PEI A;  5LYF A;  1S3Z A;  2G3T A;  2CTB A;  3R96 A;  3SXN A;  4XPD C;  1LFW A;  1Z4R A;  2ATR A;  4YGO A;  1KZF A;  1VHO A;  2I00 A;  3KR4 A;  2JLM A;  3E0K A;  4PPZ A;  4NJQ A;  2PJ9 A;  4KS9 A;  2Z11 A;  1IIC A;  2AFX A;  3BJ8 A;  2NYQ A;  2CXA A;  2P6E A;  4NXY A;  4RN7 A;  3RNZ A;  5I4M A;  4BD9 A;  5A27 A;  5G1Z A;  1QQ9 A;  4ZBG A;  4CAW A;  1ARL A;  2C6G A;  3KL9 A;  3F8K A;  3WT4 A;  4CGO A;  3CXS A;  4A37 A;  2ZEG A;  4G1P A;  2CIJ A;  5F46 A;  1HDU A;  4P45 A;  4QVT A;  5JPH A;  1ARM A;  4MCP A;  3IU2 A;  4P4B A;  3D3S A;  1TKH A;  4Y49 C;  3B2Y A;  1AUG A;  3CT9 A;  3BI0 A;  2HV2 A;  3NFZ A;  1M4L A;  2HQY A;  2OU2 A;  4PQA A;  4E0A A;  2ZEH A;  1IU8 A;  4C2Z A;  1TKJ A;  2REE A;  2DPT A;  2G9D A;  4H89 A;  4M3S A;  4MHP A;  1YW6 A;  3PB8 X;  2XEF A;  3PFO A;  4B13 A;  2A4N A;  4HNW B;  1Z8X A;  4XPL A;  3PBB A;  3NE8 A;  4ZX8 A;  3ZZI A;  2F8H A;  1R57 A;  4YRH A;  1VIX A;  3IEH A;  4J3G A;  4CYO A; 
#chains in the Genus database with same CATH homology
 3FED A;  4MCQ A;  4X8I A;  3T8W A;  3KR5 A;  2PIZ A;  1CP6 A;  1ZLH A;  1YME A;  3PRT A;  1ZG7 A;  4FAI A;  1BPM A;  3D7D A;  4OC1 A;  1XFO A;  4ONW A;  3NH8 A;  1AYE A;  2ZEM A;  5LRG A;  5K8M A;  3L2N A;  1CPS A;  4OP4 A;  2PJ2 A;  1DE4 C;  8CPA A;  4ZX9 A;  3QNV A;  4H2K A;  2IJZ A;  1XMB A;  4MHY A;  5HVF A;  4P4D A;  2PJ1 A;  1Q7L A;  3TC8 A;  4IAV A;  2F7V A;  4JZ0 A;  1TF8 A;  3BI1 A;  2AFS A;  1PYT B;  3KQX A;  3ISZ A;  1UWY A;  3SI1 A;  2Q43 A;  1R43 A;  2WZN A;  1LOK A;  2ZEP A;  4CPA A;  1KWM A;  3ISX A;  3KQZ A;  4DYO A;  3S9L A;  4AXV A;  1LAN A;  3SI0 A;  4ZY0 A;  1PCA A;  5LYL A;  4F9U A;  4NGS A;  5K8O A;  2J9A A;  3B3W A;  2FVG A;  3PB9 X;  5CBM A;  4OKO A;  2HC9 A;  2XEI A;  3CPA A;  4NGT A;  2EK9 A;  2POK A;  1YLO A;  4NGQ A;  3SJF A;  4PXD A;  3RAM A;  1BAV A;  1IY7 A;  3D68 A;  3BHX A;  4OC2 A;  4OME A;  4LQG A;  2QJ8 A;  4UIA A;  3B3V A;  2V8H A;  3V7Z A;  3IJ3 A;  3WC7 A;  2AFW A;  5JGF A;  1Y7E A;  3K9T A;  4MHN A;  2JBJ A;  2BO9 A;  4A94 A;  4OC0 A;  4EFD A;  3IFE A;  4F9V A;  2RB7 A;  4A38 A;  3B7I A;  1LCP A;  3DLJ A;  2Q51 A;  3RZA A;  4NGM A;  4JYW A;  4EWT A;  1OBR A;  2GRE A;  4X2T A;  3NH5 A;  4NGP A;  3B35 A;  2XEJ A;  3GLJ A;  2OOT A;  4OID A;  2I3C A;  3KGQ A;  5JM6 A;  3FH4 A;  1Z2L A;  2C6P A;  2Q4Z A;  2ZEE A;  4OC3 A;  4WJB A;  4MMO A;  2OR4 A;  3BXM A;  3WC5 A;  2AFM A;  1RTQ A;  3N5F A;  2PIY A;  1HEE A;  5LRK A;  2IMO A;  3H8G A;  1TXR A;  3FX6 A;  5HXD A;  2JEW A;  1FNO A;  5LRJ A;  2ZEL A;  1HDQ A;  1CP7 A;  2BOA A;  3B3T A;  2O53 A;  5K8P A;  4NGR A;  4OC5 A;  2JBK A;  4K3N A;  2V8G A;  3IIB A;  4DUK A;  2PJC A;  2PCU A;  6CPA A;  3H8E A;  4ZI6 A;  4Z65 A;  1BLL E;  4A39 A;  2ABZ A;  3KZW A;  4ZYQ A;  2PJ7 A;  2PJ6 A;  2BCO A;  3KAS A;  5HVH A;  3NH4 A;  1ZLI A;  1F2P A;  2VL1 A;  4F8Z A;  3D67 A;  4UF4 A;  2V8V A;  4R76 A;  1F57 A;  4GM5 A;  4OC4 A;  4O23 A;  1ZG8 A;  3D7G A;  2PJ4 A;  5LYD A;  7CPA A;  3CPX A;  3HUV A;  5K8N A;  2DEA A;  2EWB A;  2AFU A;  2ZED A;  2PVW A;  2PJ5 A;  4UIB A;  1CX8 A;  3VAT A;  1XBU A;  3CDX A;  3PBE A;  4IHM A;  5HVG A;  4FWU A;  1Z5R A;  1XJO A;  1CG2 A;  3LWU A;  2GU2 A;  3WC6 A;  1VGY A;  4KSI A;  3FVL A;  3FF3 A;  2C1C A;  2V8D A;  2AFO A;  3IO1 A;  2ZEN A;  4P4J A;  2ZEO A;  5D8N A;  4MHZ A;  2PJ8 A;  4FUU A;  2HB6 A;  3PB6 X;  4FBE A;  1TF9 A;  4R8F A;  1EE3 P;  1LAM A;  2NSM A;  5CPA A;  1ZG9 A;  4NJR A;  3FEC A;  2QYV A;  4TWE A;  3PB4 X;  1ELM P;  2AFZ A;  4RUH A;  3FEE A;  5THW A;  2GLJ A;  2QVP A;  2C6C A;  5ELY A;  3MN8 A;  3FMC A;  4ZY1 A;  3B3C A;  3S9N A;  3TX8 A;  2ZOG A;  1CPX A;  3GB0 A;  3PB7 X;  4DJL A;  3H8F A;  1GYT A;  4ZY2 A;  2WYR A;  3PFE A;  2CF4 A;  2XEG A;  3D7H A;  1H8L A;  4PXE A;  3KI9 A;  4P44 A;  4Q7A A;  2ZEF A;  4YWY A;  2RFH A;  3MRU A;  4P10 A;  3KHX A;  1BPN A;  1NSA A;  3D7F A;  2PE3 A;  1ELL P;  3IWW A;  3FJU A;  2IQ6 A;  3VH9 A;  1TKF A;  3KHZ A;  3B3S A;  4MCR A;  3GUX A;  3LMS A;  5J1Q A;  4IK2 A;  3JRU A;  4NFR A;  4TNU A;  3HLP A;  3S9M A;  3DGV A;  1LAP A;  2PJB A;  1IGB A;  1YSJ A;  2PJ0 A;  4R6T A;  1QMU A;  4OIW A;  5F09 A;  2CTC A;  4P6Y A;  4P4I A;  4EME A;  3K2K A;  5JH9 A;  1F2O A;  4MXU A;  4PXB A;  3I1U A;  4P4F A;  3VAR A;  4WWV A;  3RBU A;  3D66 A;  1JQG A;  4W9Y A;  1Y0R A;  4NGN A;  3SJX A;  2O4H A;  3SI2 A;  3SJE A;  2V77 A;  2PJA A;  3D4U A;  3NA6 A;  1Y0Y A;  1R3N A;  4B6Z A;  1AMP A;  3WAB A;  4MCS A;  4UEZ A;  4UEF A;  1VHE A;  4X3R A;  5LYI A;  5DS0 A;  1DTD A;  2PVV A;  2GLF A;  4R7M A;  4YU9 A;  3V38 A;  2EK8 A;  1Z8L A;  4UEE A;  4MRI A;  4P4E A;  5D29 A;  2ANP A;  5IB9 A;  2ZOF A;  4PXC A;  1FT7 A;  1CBX A;  3IC1 A;  1XRY A;  1YW4 A;  2PJ3 A;  3SJG A;  2PRQ A;  3PEI A;  5LYF A;  2CTB A;  1LFW A;  1VHO A;  3KR4 A;  4PPZ A;  4NJQ A;  2PJ9 A;  2AFX A;  2NYQ A;  5I4M A;  4BD9 A;  1QQ9 A;  1ARL A;  2C6G A;  3KL9 A;  3WT4 A;  4A37 A;  2ZEG A;  4G1P A;  2CIJ A;  1HDU A;  4P45 A;  1ARM A;  4MCP A;  4P4B A;  1TKH A;  3B2Y A;  3CT9 A;  3BI0 A;  3NFZ A;  1M4L A;  4PQA A;  2ZEH A;  1TKJ A;  2G9D A;  4MHP A;  1YW6 A;  3PB8 X;  2XEF A;  3PFO A;  4ZX8 A;  3PBB A;  2F8H A;  1VIX A;  3IEH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...