4H2KA

Crystal structure of the catalytic domain of succinyl-diaminopimelate desuccinylase from haemophilus influenzae
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
266
structure length
258
Chain Sequence
NAMKEKVVSLAQDLIRRPSISPNDEGCQQIIAERLEKLGFQIEWMPFNDTLNLWAKHGTSEPVIAFAGHTDVVPTGDENQWSSPPFSAEIIDGMLYGRGAADMKGSLAAMIVAAEEYVKANPNHKGTIALLITSDEEATAKDGTIHVVETLMARDEKITYCMVGEPSSAKNLGDVVKNGRRGGGKLLDSITSAIEETIGITPKAETGTSDGRFIALMGAEVVEFGPLNSTIHKVNECVSVEDLGKCGEIYHKMLVNLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Succinyl-diaminopimelate desuccinylase
publication title The dimerization domain in DapE enzymes is required for catalysis.
pubmed doi rcsb
source organism Haemophilus influenzae
molecule tags Hydrolase
total genus 92
structure length 258
sequence length 266
chains with identical sequence B
ec nomenclature ec 3.5.1.18: Succinyl-diaminopimelate desuccinylase.
pdb deposition date 2012-09-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01546 Peptidase_M20 Peptidase family M20/M25/M40
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 4h2kA00
1CPXA 2ZEOA 1CPSA 1ZLHA 2VL1A 1VHEA 2PCUA 1BAVA 3DLJA 2PJ5A 1Q7LA 5LYIA 3WC6A 4UF4A 1XBUA 2ZEEA 1CBXA 2J9AA 2FVGA 2EK9A 2O4HA 1BPMA 2ZEMA 4IHMA 1YW6A 3PEIA 3D67A 4ZY2A 3SJEA 4UIAA 3B35A 3IFEA 2WYRA 3D7DA 2V8GA 4BD9A 4MHPA 2F8HA 2POKA 2Q43A 4TWEA 3CT9A 3BI1A 4FWUA 4P4IA 2IMOA 3T8WA 3ISZA 2HB6A 3PRTA 1QMUA 1XJOA 2C6GA 1PYTB 4MCQA 1TKJA 5JM6A 2PJAA 4NGSA 5DS0A 3CPAA 4OC1A 5HVFA 2JBKA 2EK8A 2ZEGA 4NGPA 2ZELA 2GLFA 5LYDA 1Y0YA 1NSAA 1TKFA 4MCPA 3IJ3A 5CPAA 3RBUA 3VATA 3WABA 2O53A 3PBEA 1QQ9A 2PJBA 4PQAA 5LRKA 2CTCA 2PJ3A 4YWYA 3H8EA 4R6TA 4ZY1A 4CPAA 1HEEA 4NGMA 4KSIA 3LMSA 5HVGA 3ISXA 1IGBA 1LAPA 3PFEA 1BLLE 4MXUA 2PJ2A 3DGVA 3B3CA 2DEAA 2PVVA 4A39A 3B3WA 1F2OA 2AFUA 2GLJA 3KR5A 2QJ8A 4TNUA 1XRYA 3IC1A 4G1PA 2PJ1A 2PJ8A 3PB8X 4A94A 3CDXA 4R7MA 3NH8A 3B3SA 3FEEA 1Z8LA 2CIJA 4OMEA 2PJ0A 7CPAA 2PJ4A 2IQ6A 3S9MA 3IO1A 5D29A 3KI9A 1YSJA 1ZLIA 4PXDA 2Q4ZA 3IEHA 2OOTA 3LWUA 1JQGA 2IJZA 1TF9A 3D7HA 3IIBA 3I1UA 4EFDA 3SI0A 4PXBA 2V77A 4P6YA 4OC4A 4LQGA 3FH4A 4A37A 2XEJA 4MHZA 4MCRA 2AFWA 3PFOA 1FNOA 4X2TA 5F09A 1Y7EA 3KL9A 1Z2LA 3FEDA 3KZWA 1RTQA 4IAVA 4OIDA 3RZAA 5HXDA 1ZG9A 1CX8A 3B2YA 2AFXA 3L2NA 2GREA 4Z65A 4ZYQA 4NGRA 4MHYA 4OC5A 2BO9A 4AXVA 1YMEA 1LAMA 2ANPA 2WZNA 3S9NA 5THWA 4NJQA 4UEEA 3PB9X 8CPAA 4OP4A 4EMEA 1OBRA 1BPNA 3SJFA 3GLJA 4DYOA 5IB9A 1LCPA 5CBMA 1LANA 1Y0RA 1ELLP 1IY7A 4OC3A 1R43A 3D68A 2CF4A 1AMPA 1YW4A 2AFMA 3NFZA 2JEWA 3KHZA 2OR4A 1PCAA 1HDQA 3SI2A 2PJ6A 3WC5A 4OIWA 5J1QA 3D7FA 1UWYA 5K8NA 4ZY0A 2PJCA 4RUHA 3V7ZA 3FF3A 3BXMA 4P44A 1XMBA 4NJRA 4DJLA 1XFOA 4P10A 4JZ0A 3MRUA 3WC7A 3GB0A 4X8IA 2QVPA 4ZI6A 3FJUA 5ELYA 2HC9A 5LYFA 2EWBA 4DUKA 1TF8A 4R8FA 1LOKA 4PXCA 3HLPA 4PXEA 3K2KA 4F8ZA 2AFSA 4WJBA 1CG2A 3KASA 1EE3P 2XEIA 3SJXA 3SJGA 3N5FA 3BHXA 1ZG8A 5JGFA 3GUXA 5K8PA 1TXRA 3TC8A 2V8DA 2ZEFA 3K9TA 4OKOA 4UEZA 1CP7A 3KGQA 2PRQA 1Z5RA 4B6ZA 3KR4A 1TKHA 2XEFA 4YU9A 4ONWA 5LRGA 4OC0A 1H8LA 1M4LA 3NA6A 2ZEPA 2NSMA 4Q7AA 1HDUA 2C1CA 1ARMA 2V8HA 3WT4A 4NGNA 4P4EA 2Q51A 4ZX9A 3H8FA 2AFOA 3SI1A 4P4BA 3FECA 2G9DA 3B7IA 2NYQA 1VIXA 2C6PA 5LYLA 4NGTA 3FMCA 5I4MA 3B3VA 2AFZA 2JBJA 2C6CA 5LRJA 1FT7A 2ZENA 2QYVA 2ZOFA 5HVHA 1F2PA 4P45A 2ABZA 3HUVA 3NH5A 3KHXA 3V38A 4F9UA 3KQZA 4MMOA 4MCSA 1AYEA 4MRIA 1ARLA 4A38A 4IK2A 4FAIA 4F9VA 3TX8A 2F7VA 4NFRA 2RB7A 3VARA 1YLOA 1KWMA 3PB7X 4P4DA 5K8OA 4MHNA 4X3RA 2PE3A 5JH9A 2GU2A 2ZEDA 4NGQA 4W9YA 3VH9A 1DE4C 3PBBA 4GM5A 1ZG7A 2XEGA 1GYTA 3FVLA 3IWWA 3BI0A 4R76A 3S9LA 2ZEHA 4JYWA 2V8VA 1VHOA 3H8GA 4H2KA 4P4FA 2PIYA 3B3TA 1F57A 4PPZA 2PJ7A 3PB4X 2PJ9A 4K3NA 3FX6A 3KQXA 1DTDA 1CP6A 4FUUA 4OC2A 4P4JA 3CPXA 1R3NA 1LFWA 1ELMP 3RAMA 3D7GA 2BOAA 3D66A 2I3CA 3MN8A 3JRUA 4ZX8A 3NH4A 2CTBA 1VGYA 3QNVA 4FBEA 5K8MA 2ZOGA 3PB6X 4EWTA 6CPAA 4UEFA 3D4UA 2PIZA 5D8NA 4UIBA 2PVWA 4WWVA 4O23A 2RFHA 2BCOA
chains in the Genus database with same CATH superfamily
2JDCA 1CPXA 2J8NA 2HV2A 2ZEOA 3JVNA 1CPSA 2DF5A 1WK4A 1BO4A 5KTDA 1ZLHA 2VL1A 1IOIA 1VHEA 4ONUA 5F47A 1YVKA 4KZTA 2EO8A 2PCUA 1BAVA 4KVOE 3DLJA 5HH1A 2PJ5A 4PK3A 1Q7LA 4JJXA 4QUSA 1V0CA 1IIDA 4B12A 1PUAA 1Q2CA 2OU2A 5G20A 5LYIA 3WC6A 4E0AA 3B8GA 1IYKA 4UF4A 1XBUA 2ZEEA 1QSMA 2WSAA 1CBXA 2ZW6A 2J9AA 4M3SA 1P0HA 4B5PB 3BJ8A 2FVGA 5JQ4A 1M4DA 1NE9A 2CXAA 2EK9A 3RO0A 1KUVA 2O4HA 2FT0A 1BPMA 2ZEMA 4IHMA 1YW6A 3A9LA 3EFAA 3PEIA 3LACA 4HNXB 4MHDA 3D67A 4ZY2A 3SJEA 4UIAA 3D2PA 2KCWA 3B35A 3MGDA 3IFEA 2WYRA 3BJ7A 5H86A 1S7LA 3D7DA 1LRZA 1XMTA 5AG5A 4XPLA 2V8GA 4UCNA 4BD9A 4MHPA 1XE4A 2F8HA 5A27A 2POKA 2Q43A 4TWEA 2B4DB 5A28A 3CT9A 3V8IA 3BI1A 4FWUA 4P4IA 3S6FA 4QBJA 2IMOA 3T8WA 3ISZA 2HB6A 3PRTA 1QMUA 2ZW7A 3GKRA 1XJOA 1YGHA 2PR8A 2C6GA 4U9ZA 1PYTB 1VHSA 4MCQA 1KZFA 1TKJA 3VWEA 5JM6A 3N7ZA 4I49A 2PJAA 2R1IA 4NGSA 5DS0A 3CPAA 4OC1A 3F5BA 5HVFA 4C2YA 4LX9A 2JBKA 3CXPA 5ISVA 1K4JA 2EK8A 2ZEGA 3LD2A 4NGPA 2ZELA 2GLFA 4GXHA 5AG6A 5LYDA 1Y0YA 1NSAA 1TKFA 4MCPA 2OZHA 3IJ3A 4M6HA 5CPAA 3RBUA 3VATA 3WABA 2O53A 3JTKA 1QQ9A 3PBEA 4JLYA 2YNDA 2PJBA 4PQAA 5LRKA 2CTCA 2PJ3A 4YWYA 1ON0A 3H8EA 2BEIA 1S7NA 3TO9A 4R6TA 1S3ZA 2VI7A 5DWNA 4ZY1A 4K30A 4J3GA 4CPAA 3EC4A 1HEEA 4NGMA 4KSIA 4KVXA 3W91A 5DWMA 4KOWA 3LMSA 3DDDA 3RYOA 1MJ9A 5HVGA 4MY0A 4QVTA 3ISXA 2OZGA 3TOAA 1IGBA 5C82A 1LAPA 3PFEA 1BLLE 1N71A 4MXUA 4ZGYB 2ARHA 2NMTA 4CAEA 2PJ2A 4CYNA 3B3CA 3DGVA 2DEAA 2PVVA 2VZYA 4A39A 1YX0A 4CGLA 4A30A 4HNWB 3B3WA 4FD7A 4AVBA 1F2OA 2AFUA 3D2MA 4UA3A 4XNHC 2GLJA 3I3GA 5HMNA 2CNSA 3OWCA 2JLMA 3KR5A 4MI4A 4AG9A 2QJ8A 1M1DA 3S6GA 3IGRA 2OZUA 4TNUA 1XRYA 4JWPA 4KORA 3IC1A 3DR6A 4H6ZA 4F6AA 4UFXA 4KSAA 4G1PA 2PJ1A 2PJ8A 2B5GA 3PB8X 4F0XA 3PP9A 1CM0A 3IU2A 1YREA 4A94A 3QB8A 1IICA 2BUEA 1YLEA 3W6XA 3CDXA 4FD4A 4R7MA 1Y9KA 2G3AA 3NH8A 3BLNA 4BBHA 2PQ8A 2J8RA 2F5IA 3B3SA 1B6BA 3DNSA 1Z8LA 3FEEA 4XNHB 4FD5A 2CIJA 4OMEA 3GY9A 4CYOA 2I79A 4KOSA 2PJ0A 7CPAA 3FIXA 2PDOA 2PJ4A 1Z8WA 2WPWA 2ZPAA 1IOFA 3C26A 2IQ6A 2ZXVA 2C27A 2P6EA 2Q04A 3S9MA 3IO1A 5D29A 1XEBA 2REFA 3KI9A 4A31A 1YSJA 1ZLIA 2FIWA 2R7HA 3T90A 2EVNA 4PXDA 2B58A 2Z3PA 2Q4ZA 3IEHA 4A32A 2OOTA 3LWUA 4KVME 1JQGA 4OAEA 2IJZA 5J8FA 5AGEA 1TF9A 1S5KA 4BMHA 3D7HA 2JDDA 2B3UA 3IIBA 3I1UA 4EFDA 3SI0A 5AG4A 4PXBA 2FCKA 3H5ZA 2V77A 4P6YA 4OC4A 3IWEA 4LQGA 4CRYB 3FH4A 4A37A 2XEJA 4A95A 3CZXA 4KOUA 2HQYA 2Z3MA 4MHZA 4MCRA 2AFWA 1RXTA 3PFOA 4CAWA 4C2XA 4CYQA 1FNOA 4X2TA 5F09A 1Y7EA 2D4PA 1Z2LA 3KL9A 1MJBA 3FEDA 4CAXA 3FNCA 3KZWA 4C7HA 4NEXA 1RTQA 4IAVA 4OIDA 4CS0B 4QB9A 3RZAA 5HXDA 1ZG9A 1CX8A 3B2YA 4NSQA 4B5PA 1MK4A 2AFXA 2GREA 3L2NA 1IYLA 4KUAA 4Z65A 4ZYQA 4NGRA 3S6HA 4MHYA 2PRBA 4OC5A 2BO9A 4AXVA 4QC6A 5FVJA 1YMEA 1LAMA 2ANPA 2REEA 4XPDC 2YNEA 5I0CA 2WZNA 3EO4A 3S9NA 5THWA 5IB0A 4NJQA 4CAFA 4UEEA 4IUSA 3LODA 5KTAA 4RN7A 3PB9X 4KS9A 8CPAA 4R87A 1I12A 4OP4A 4F0YA 4EMEA 1TIQA 2J8MA 2B4DA 1OBRA 1BPNA 3SJFA 4CGNA 3GLJA 4B14A 3TOBA 2D4OA 3JUWA 4MFZA 3EY5A 4A33A 1PU9A 3UY5A 1OZPA 4DYOA 4HKFA 4XPDB 3TT2A 2DPSA 5IB9A 1LCPA 2FE7A 5GCNA 5CBMA 1LANA 5EC4A 1B87A 1Y0RA 1ELLP 1IY7A 4OC3A 1R43A 4PSWA 4UCPA 3D68A 1MJAA 2CF4A 3G8WA 4KOYA 4KOTA 4C2ZA 3R1KA 1AMPA 1YW4A 2AFMA 3NFZA 2JEWA 4R3KA 4UBRA 5G21A 3KHZA 3TCVA 3ZJ0A 1S7FA 2Q7BA 1QSRA 2OR4A 1PCAA 3D3SA 2FL4A 1HDQA 4RS2A 4L8AA 3SXOA 3SI2A 2PJ6A 1M4GA 3WC5A 4C68A 4OIWA 5J1QA 3D7FA 4NXYA 1UWYA 3TFYA 5K8NA 4ZY0A 4E2AA 1M4IA 2Q7SA 3FBUA 3EXNA 2PJCA 2PSWA 2GE3A 3FXTA 2ODFA 4RUHA 1YK3A 3V7ZA 1R57A 1Z4RA 2ATRA 3FF3A 4E8OA 1KUXA 3BXMA 4P44A 4OLLA 1XMBA 4NJRA 2Z10A 4DJLA 1I1DA 1RO5A 1XFOA 2YNCC 2QECA 4JZ0A 4P10A 3CXSA 3CXQA 4Y49C 1Z8XA 2JEVA 1NSLA 3MRUA 3WC7A 5H84A 3GB0A 2P6GA 2QMLA 4X8IA 1S60A 4DNCA 2QVPA 4ZI6A 4YFJA 3FJUA 3SXNA 2O28A 5ELYA 2Z3KA 2HC9A 4C7IA 5LYFA 1XOVA 1SQHA 2EWBA 4PK2A 4MFPA 1TF8A 4CGPA 1S7KA 4DUKA 5C88A 1WWZA 5CNPA 4JXRA 4MJ8A 4R8FA 1LOKA 4AVAA 3GIUA 1KUYA 4PXCA 4R3LA 2FIAA 3HLPA 4PXEA 5F48A 3R9GA 3K2KA 4M85A 4F8ZA 2AFSA 4WJBA 1CG2A 1Z4EA 1Z8TA 3KASA 4IF5A 2B5GB 1EE3P 2XEIA 4NCZA 4U5YA 4H89A 3SJXA 3IU1A 1NMTA 4R9MA 4KOXA 3SJGA 3N5FA 3DSBA 2IL4A 3BHXA 4EVYA 1ZG8A 5JGFA 3GUXA 3F8KA 3QAYA 4AB7A 2Z0ZA 4HPSA 4JD6A 3PZJA 2DXQA 1Y7RA 5K8PA 2P6FA 1TXRA 2PR1A 5G22A 3TC8A 1FY7A 2V8DA 2ZEFA 3K9TA 4OKOA 4PV6A 4U9YA 4UEZA 1CP7A 3KGQA 2PRQA 1Z5RA 4Q38A 1QSTA 4AG7A 4B6ZA 5BWAB 4PSXA 4Q36A 3KR4A 4YGOA 2DPTA 4RI1A 2K5TA 4B11A 1TKHA 3R95A 2XEFA 4YU9A 2CNMA 4ONWA 4OC0A 5LRGA 3WR7A 5F49A 1J4JA 5JPHA 4X5KA 4KLWA 4GS4A 1H8LA 2VBQA 1M4LA 3NA6A 2ZEPA 2ZW5A 2NSMA 4Q7AA 1IU8A 1HDUA 2CY2A 4MY3A 4YRHA 2C1CA 2G3TA 2A4NA 1ARMA 2V8HA 3WT4A 5KTCA 1YVOA 4NGNA 3P2FA 4P4EA 2AJ6A 2EUIA 2AE6A 2Q51A 4ZX9A 5IV0A 1IB1E 3F0AA 3H8FA 4BINA 4L89A 2AFOA 3SI1A 4P4BA 1YQEA 4II9A 3FECA 1GHEA 2G9DA 3B7IA 2NYQA 1VIXA 2C6PA 5LYLA 2ZW4A 4NGTA 3FMCA 5I4MA 4CAVA 3B3VA 1ZO0A 4KUBA 1Q2DA 2AFZA 1X10A 3P2HA 3K9UA 3S6KA 1XIXA 4R57A 1U6MA 2JBJA 3R9FA 2Q44A 4LUAA 2C6CA 5LRJA 2B4BA 1FT7A 4UFWA 2ZENA 2QYVA 2ZOFA 4B5OA 4M6GA 2H5MA 4B10A 1Z9UA 5HVHA 2HUZA 2VQYA 4A2ZA 1F2PA 4P45A 2ABZA 3HUVA 4UCMA 2Q4YA 2GIVA 3KHXA 3NH5A 4KLVA 3V38A 4CYPA 4F9UA 2Z11A 1BOBA 3GYAA 3KQZA 4CGOA 2Q0YA 3NE7A 4MMOA 4MCSA 1AYEA 4MRIA 3TE4A 1ARLA 4A38A 4IK2A 4FAIA 5F46A 2QIRA 2FSRA 3W6SA 2Z3LA 4M6IA 4MFQA 4ORFA 3TX8A 4F9VA 5G1ZA 2F7VA 4FD6A 4NFRA 2RB7A 3VARA 3SHPA 4KOVA 1XF8A 1YLOA 5J8CA 1KWMA 4MFKA 3T9YA 2GFQA 3PB7X 4P4DA 5K8OA 4MHNA 4KSFA 4X3RA 3R96A 2PE3A 5JH9A 2P0WA 1UFHA 5IX3A 1JWQA 1Q2YA 3NE8A 3RNZA 2BSWA 2GU2A 2ZEDA 2I00A 1QSOA 1YR0A 4NGQA 1DE4C 3PBBA 2GANA 4W9YA 4GM5A 1ZG7A 3VH9A 4ZBGA 2OH1A 2XEGA 3TO6A 1GYTA 2CNTA 2FS5A 2X7BA 3FVLA 3IWWA 4OADA 4CGMA 4HNYB 3BI0A 1I21A 2B3VA 4MFJA 2PC1A 4R76A 2ZEHA 4JYWA 3S9LA 2V8VA 3G3SA 1VHOA 2R8VA 1Y9WA 3H8GA 4UWJA 4CRZB 4H2KA 4P4FA 4H6UA 5EMIA 2PIYA 2EBJA 2FXFA 3B3TA 3I9SA 2G0BA 1F57A 3PGPA 4PPZA 4UWIA 5EBVA 4B13A 2PJ7A 3PB4X 2PJ9A 4K3NA 3FX6A 4MFLA 3KQXA 2Z3OA 2OB0A 5E96A 1CP6A 1DTDA 1CJWA 2VZZA 3ZZIA 2Q4VA 3QAHA 1VKCA 1M44A 4FUUA 1A2ZA 3KKWA 2WUUA 1QSNA 1P4NA 4OC2A 4P4JA 4XPKA 3CPXA 1R3NA 4AVCA 2WPXA 1LFWA 2Y0MA 4Y49B 1ELMP 3E0KA 4NF1A 3RAMA 3D7GA 3VWDA 4JXQA 2BOAA 3D66A 2BL1A 4UFVA 2VEZA 3TTHA 2I3CA 3MN8A 3JRUA 4ZX8A 4MBUA 1X12A 3NH4A 3FB3A 2CTBA 1VGYA 3QNVA 4FBEA 5K8MA 1AUGA 5AG7A 2ZOGA 2RC4A 3PB6X 4EWTA 3D8PA 2YGWA 3DR8A 2Z3NA 2YNCA 6CPAA 4UEFA 3D4UA 4LQ6A 2PIZA 5D8NA 2VXKA 3FRMA 3IWGA 3H4QA 4UIBA 3R9EA 3TO7A 2PVWA 4WWVA 4O23A 2RFHA 1L0CA 3FYNA 2R98A 2BCOA
chains in the Genus database with same CATH topology
1CPXA 2ZEOA 1CPSA 1ZLHA 2VL1A 1VHEA 2PCUA 1BAVA 3DLJA 2PJ5A 1Q7LA 5LYIA 3WC6A 4UF4A 1XBUA 2ZEEA 1CBXA 2J9AA 2FVGA 2EK9A 2O4HA 1BPMA 2ZEMA 4IHMA 1YW6A 3PEIA 3D67A 4ZY2A 3SJEA 4UIAA 3B35A 3IFEA 2WYRA 3D7DA 2V8GA 4BD9A 4MHPA 2F8HA 2POKA 2Q43A 4TWEA 3CT9A 3BI1A 4FWUA 4P4IA 2IMOA 3T8WA 3ISZA 2HB6A 3PRTA 1QMUA 1XJOA 2C6GA 1PYTB 4MCQA 1TKJA 5JM6A 2PJAA 4NGSA 5DS0A 3CPAA 4OC1A 5HVFA 2JBKA 2EK8A 2ZEGA 4NGPA 2ZELA 2GLFA 5LYDA 1Y0YA 1NSAA 1TKFA 4MCPA 3IJ3A 5CPAA 3RBUA 3VATA 3WABA 2O53A 3PBEA 1QQ9A 2PJBA 4PQAA 5LRKA 2CTCA 2PJ3A 4YWYA 3H8EA 4R6TA 4ZY1A 4CPAA 1HEEA 4NGMA 4KSIA 3LMSA 5HVGA 3ISXA 1IGBA 1LAPA 3PFEA 1BLLE 4MXUA 2PJ2A 3DGVA 3B3CA 2DEAA 2PVVA 4A39A 3B3WA 1F2OA 2AFUA 2GLJA 3KR5A 2QJ8A 4TNUA 1XRYA 3IC1A 4G1PA 2PJ1A 2PJ8A 3PB8X 4A94A 3CDXA 4R7MA 3NH8A 3B3SA 3FEEA 1Z8LA 2CIJA 4OMEA 2PJ0A 7CPAA 2PJ4A 2IQ6A 3S9MA 3IO1A 5D29A 3KI9A 1YSJA 1ZLIA 4PXDA 2Q4ZA 3IEHA 2OOTA 3LWUA 1JQGA 2IJZA 1TF9A 3D7HA 3IIBA 3I1UA 4EFDA 3SI0A 4PXBA 2V77A 4P6YA 4OC4A 4LQGA 3FH4A 4A37A 2XEJA 4MHZA 4MCRA 2AFWA 3PFOA 1FNOA 4X2TA 5F09A 1Y7EA 3KL9A 1Z2LA 3FEDA 3KZWA 1RTQA 4IAVA 4OIDA 3RZAA 5HXDA 1ZG9A 1CX8A 3B2YA 2AFXA 3L2NA 2GREA 4Z65A 4ZYQA 4NGRA 4MHYA 4OC5A 2BO9A 4AXVA 1YMEA 1LAMA 2ANPA 2WZNA 3S9NA 5THWA 4NJQA 4UEEA 3PB9X 8CPAA 4OP4A 4EMEA 1OBRA 1BPNA 3SJFA 3GLJA 4DYOA 5IB9A 1LCPA 5CBMA 1LANA 1Y0RA 1ELLP 1IY7A 4OC3A 1R43A 3D68A 2CF4A 1AMPA 1YW4A 2AFMA 3NFZA 2JEWA 3KHZA 2OR4A 1PCAA 1HDQA 3SI2A 2PJ6A 3WC5A 4OIWA 5J1QA 3D7FA 1UWYA 5K8NA 4ZY0A 2PJCA 4RUHA 3V7ZA 3FF3A 3BXMA 4P44A 1XMBA 4NJRA 4DJLA 1XFOA 4P10A 4JZ0A 3MRUA 3WC7A 3GB0A 4X8IA 2QVPA 4ZI6A 3FJUA 5ELYA 2HC9A 5LYFA 2EWBA 4DUKA 1TF8A 4R8FA 1LOKA 4PXCA 3HLPA 4PXEA 3K2KA 4F8ZA 2AFSA 4WJBA 1CG2A 3KASA 1EE3P 2XEIA 3SJXA 3SJGA 3N5FA 3BHXA 1ZG8A 5JGFA 3GUXA 5K8PA 1TXRA 3TC8A 2V8DA 2ZEFA 3K9TA 4OKOA 4UEZA 1CP7A 3KGQA 2PRQA 1Z5RA 4B6ZA 3KR4A 1TKHA 2XEFA 4YU9A 4ONWA 5LRGA 4OC0A 1H8LA 1M4LA 3NA6A 2ZEPA 2NSMA 4Q7AA 1HDUA 2C1CA 1ARMA 2V8HA 3WT4A 4NGNA 4P4EA 2Q51A 4ZX9A 3H8FA 2AFOA 3SI1A 4P4BA 3FECA 2G9DA 3B7IA 2NYQA 1VIXA 2C6PA 5LYLA 4NGTA 3FMCA 5I4MA 3B3VA 2AFZA 2JBJA 2C6CA 5LRJA 1FT7A 2ZENA 2QYVA 2ZOFA 5HVHA 1F2PA 4P45A 2ABZA 3HUVA 3NH5A 3KHXA 3V38A 4F9UA 3KQZA 4MMOA 4MCSA 1AYEA 4MRIA 1ARLA 4A38A 4IK2A 4FAIA 4F9VA 3TX8A 2F7VA 4NFRA 2RB7A 3VARA 1YLOA 1KWMA 3PB7X 4P4DA 5K8OA 4MHNA 4X3RA 2PE3A 5JH9A 2GU2A 2ZEDA 4NGQA 4W9YA 3VH9A 1DE4C 3PBBA 4GM5A 1ZG7A 2XEGA 1GYTA 3FVLA 3IWWA 3BI0A 4R76A 3S9LA 2ZEHA 4JYWA 2V8VA 1VHOA 3H8GA 4H2KA 4P4FA 2PIYA 3B3TA 1F57A 4PPZA 2PJ7A 3PB4X 2PJ9A 4K3NA 3FX6A 3KQXA 1DTDA 1CP6A 4FUUA 4OC2A 4P4JA 3CPXA 1R3NA 1LFWA 1ELMP 3RAMA 3D7GA 2BOAA 3D66A 2I3CA 3MN8A 3JRUA 4ZX8A 3NH4A 2CTBA 1VGYA 3QNVA 4FBEA 5K8MA 2ZOGA 3PB6X 4EWTA 6CPAA 4UEFA 3D4UA 2PIZA 5D8NA 4UIBA 2PVWA 4WWVA 4O23A 2RFHA 2BCOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CPX A;  2ZEO A;  1CPS A;  1ZLH A;  2VL1 A;  1VHE A;  2PCU A;  1BAV A;  3DLJ A;  2PJ5 A;  1Q7L A;  5LYI A;  3WC6 A;  4UF4 A;  1XBU A;  2ZEE A;  1CBX A;  2J9A A;  2FVG A;  2EK9 A;  2O4H A;  1BPM A;  2ZEM A;  4IHM A;  1YW6 A;  3PEI A;  3D67 A;  4ZY2 A;  3SJE A;  4UIA A;  3B35 A;  3IFE A;  2WYR A;  3D7D A;  2V8G A;  4BD9 A;  4MHP A;  2F8H A;  2POK A;  2Q43 A;  4TWE A;  3CT9 A;  3BI1 A;  4FWU A;  4P4I A;  2IMO A;  3T8W A;  3ISZ A;  2HB6 A;  3PRT A;  1QMU A;  1XJO A;  2C6G A;  1PYT B;  4MCQ A;  1TKJ A;  5JM6 A;  2PJA A;  4NGS A;  5DS0 A;  3CPA A;  4OC1 A;  5HVF A;  2JBK A;  2EK8 A;  2ZEG A;  4NGP A;  2ZEL A;  2GLF A;  5LYD A;  1Y0Y A;  1NSA A;  1TKF A;  4MCP A;  3IJ3 A;  5CPA A;  3RBU A;  3VAT A;  3WAB A;  2O53 A;  3PBE A;  1QQ9 A;  2PJB A;  4PQA A;  5LRK A;  2CTC A;  2PJ3 A;  4YWY A;  3H8E A;  4R6T A;  4ZY1 A;  4CPA A;  1HEE A;  4NGM A;  4KSI A;  3LMS A;  5HVG A;  3ISX A;  1IGB A;  1LAP A;  3PFE A;  1BLL E;  4MXU A;  2PJ2 A;  3DGV A;  3B3C A;  2DEA A;  2PVV A;  4A39 A;  3B3W A;  1F2O A;  2AFU A;  2GLJ A;  3KR5 A;  2QJ8 A;  4TNU A;  1XRY A;  3IC1 A;  4G1P A;  2PJ1 A;  2PJ8 A;  3PB8 X;  4A94 A;  3CDX A;  4R7M A;  3NH8 A;  3B3S A;  3FEE A;  1Z8L A;  2CIJ A;  4OME A;  2PJ0 A;  7CPA A;  2PJ4 A;  2IQ6 A;  3S9M A;  3IO1 A;  5D29 A;  3KI9 A;  1YSJ A;  1ZLI A;  4PXD A;  2Q4Z A;  3IEH A;  2OOT A;  3LWU A;  1JQG A;  2IJZ A;  1TF9 A;  3D7H A;  3IIB A;  3I1U A;  4EFD A;  3SI0 A;  4PXB A;  2V77 A;  4P6Y A;  4OC4 A;  4LQG A;  3FH4 A;  4A37 A;  2XEJ A;  4MHZ A;  4MCR A;  2AFW A;  3PFO A;  1FNO A;  4X2T A;  5F09 A;  1Y7E A;  3KL9 A;  1Z2L A;  3FED A;  3KZW A;  1RTQ A;  4IAV A;  4OID A;  3RZA A;  5HXD A;  1ZG9 A;  1CX8 A;  3B2Y A;  2AFX A;  3L2N A;  2GRE A;  4Z65 A;  4ZYQ A;  4NGR A;  4MHY A;  4OC5 A;  2BO9 A;  4AXV A;  1YME A;  1LAM A;  2ANP A;  2WZN A;  3S9N A;  5THW A;  4NJQ A;  4UEE A;  3PB9 X;  8CPA A;  4OP4 A;  4EME A;  1OBR A;  1BPN A;  3SJF A;  3GLJ A;  4DYO A;  5IB9 A;  1LCP A;  5CBM A;  1LAN A;  1Y0R A;  1ELL P;  1IY7 A;  4OC3 A;  1R43 A;  3D68 A;  2CF4 A;  1AMP A;  1YW4 A;  2AFM A;  3NFZ A;  2JEW A;  3KHZ A;  2OR4 A;  1PCA A;  1HDQ A;  3SI2 A;  2PJ6 A;  3WC5 A;  4OIW A;  5J1Q A;  3D7F A;  1UWY A;  5K8N A;  4ZY0 A;  2PJC A;  4RUH A;  3V7Z A;  3FF3 A;  3BXM A;  4P44 A;  1XMB A;  4NJR A;  4DJL A;  1XFO A;  4P10 A;  4JZ0 A;  3MRU A;  3WC7 A;  3GB0 A;  4X8I A;  2QVP A;  4ZI6 A;  3FJU A;  5ELY A;  2HC9 A;  5LYF A;  2EWB A;  4DUK A;  1TF8 A;  4R8F A;  1LOK A;  4PXC A;  3HLP A;  4PXE A;  3K2K A;  4F8Z A;  2AFS A;  4WJB A;  1CG2 A;  3KAS A;  1EE3 P;  2XEI A;  3SJX A;  3SJG A;  3N5F A;  3BHX A;  1ZG8 A;  5JGF A;  3GUX A;  5K8P A;  1TXR A;  3TC8 A;  2V8D A;  2ZEF A;  3K9T A;  4OKO A;  4UEZ A;  1CP7 A;  3KGQ A;  2PRQ A;  1Z5R A;  4B6Z A;  3KR4 A;  1TKH A;  2XEF A;  4YU9 A;  4ONW A;  5LRG A;  4OC0 A;  1H8L A;  1M4L A;  3NA6 A;  2ZEP A;  2NSM A;  4Q7A A;  1HDU A;  2C1C A;  1ARM A;  2V8H A;  3WT4 A;  4NGN A;  4P4E A;  2Q51 A;  4ZX9 A;  3H8F A;  2AFO A;  3SI1 A;  4P4B A;  3FEC A;  2G9D A;  3B7I A;  2NYQ A;  1VIX A;  2C6P A;  5LYL A;  4NGT A;  3FMC A;  5I4M A;  3B3V A;  2AFZ A;  2JBJ A;  2C6C A;  5LRJ A;  1FT7 A;  2ZEN A;  2QYV A;  2ZOF A;  5HVH A;  1F2P A;  4P45 A;  2ABZ A;  3HUV A;  3NH5 A;  3KHX A;  3V38 A;  4F9U A;  3KQZ A;  4MMO A;  4MCS A;  1AYE A;  4MRI A;  1ARL A;  4A38 A;  4IK2 A;  4FAI A;  4F9V A;  3TX8 A;  2F7V A;  4NFR A;  2RB7 A;  3VAR A;  1YLO A;  1KWM A;  3PB7 X;  4P4D A;  5K8O A;  4MHN A;  4X3R A;  2PE3 A;  5JH9 A;  2GU2 A;  2ZED A;  4NGQ A;  4W9Y A;  3VH9 A;  1DE4 C;  3PBB A;  4GM5 A;  1ZG7 A;  2XEG A;  1GYT A;  3FVL A;  3IWW A;  3BI0 A;  4R76 A;  3S9L A;  2ZEH A;  4JYW A;  2V8V A;  1VHO A;  3H8G A;  4H2K A;  4P4F A;  2PIY A;  3B3T A;  1F57 A;  4PPZ A;  2PJ7 A;  3PB4 X;  2PJ9 A;  4K3N A;  3FX6 A;  3KQX A;  1DTD A;  1CP6 A;  4FUU A;  4OC2 A;  4P4J A;  3CPX A;  1R3N A;  1LFW A;  1ELM P;  3RAM A;  3D7G A;  2BOA A;  3D66 A;  2I3C A;  3MN8 A;  3JRU A;  4ZX8 A;  3NH4 A;  2CTB A;  1VGY A;  3QNV A;  4FBE A;  5K8M A;  2ZOG A;  3PB6 X;  4EWT A;  6CPA A;  4UEF A;  3D4U A;  2PIZ A;  5D8N A;  4UIB A;  2PVW A;  4WWV A;  4O23 A;  2RFH A;  2BCO A; 
#chains in the Genus database with same CATH topology
 2JDC A;  1CPX A;  2J8N A;  2HV2 A;  2ZEO A;  3JVN A;  1CPS A;  2DF5 A;  1WK4 A;  1BO4 A;  5KTD A;  1ZLH A;  2VL1 A;  1IOI A;  1VHE A;  4ONU A;  5F47 A;  1YVK A;  4KZT A;  2EO8 A;  2PCU A;  1BAV A;  4KVO E;  3DLJ A;  5HH1 A;  2PJ5 A;  4PK3 A;  1Q7L A;  4JJX A;  4QUS A;  1V0C A;  1IID A;  4B12 A;  1PUA A;  1Q2C A;  2OU2 A;  5G20 A;  5LYI A;  3WC6 A;  4E0A A;  3B8G A;  1IYK A;  4UF4 A;  1XBU A;  2ZEE A;  1QSM A;  2WSA A;  1CBX A;  2ZW6 A;  2J9A A;  4M3S A;  1P0H A;  4B5P B;  3BJ8 A;  2FVG A;  5JQ4 A;  1M4D A;  1NE9 A;  2CXA A;  2EK9 A;  3RO0 A;  1KUV A;  2O4H A;  2FT0 A;  1BPM A;  2ZEM A;  4IHM A;  1YW6 A;  3A9L A;  3EFA A;  3PEI A;  3LAC A;  4HNX B;  4MHD A;  3D67 A;  4ZY2 A;  3SJE A;  4UIA A;  3D2P A;  2KCW A;  3B35 A;  3MGD A;  3IFE A;  2WYR A;  3BJ7 A;  5H86 A;  1S7L A;  3D7D A;  1LRZ A;  1XMT A;  5AG5 A;  4XPL A;  2V8G A;  4UCN A;  4BD9 A;  4MHP A;  1XE4 A;  2F8H A;  5A27 A;  2POK A;  2Q43 A;  4TWE A;  2B4D B;  5A28 A;  3CT9 A;  3V8I A;  3BI1 A;  4FWU A;  4P4I A;  3S6F A;  4QBJ A;  2IMO A;  3T8W A;  3ISZ A;  2HB6 A;  3PRT A;  1QMU A;  2ZW7 A;  3GKR A;  1XJO A;  1YGH A;  2PR8 A;  2C6G A;  4U9Z A;  1PYT B;  1VHS A;  4MCQ A;  1KZF A;  1TKJ A;  3VWE A;  5JM6 A;  3N7Z A;  4I49 A;  2PJA A;  2R1I A;  4NGS A;  5DS0 A;  3CPA A;  4OC1 A;  3F5B A;  5HVF A;  4C2Y A;  4LX9 A;  2JBK A;  3CXP A;  5ISV A;  1K4J A;  2EK8 A;  2ZEG A;  3LD2 A;  4NGP A;  2ZEL A;  2GLF A;  4GXH A;  5AG6 A;  5LYD A;  1Y0Y A;  1NSA A;  1TKF A;  4MCP A;  2OZH A;  3IJ3 A;  4M6H A;  5CPA A;  3RBU A;  3VAT A;  3WAB A;  2O53 A;  3JTK A;  1QQ9 A;  3PBE A;  4JLY A;  2YND A;  2PJB A;  4PQA A;  5LRK A;  2CTC A;  2PJ3 A;  4YWY A;  1ON0 A;  3H8E A;  2BEI A;  1S7N A;  3TO9 A;  4R6T A;  1S3Z A;  2VI7 A;  5DWN A;  4ZY1 A;  4K30 A;  4J3G A;  4CPA A;  3EC4 A;  1HEE A;  4NGM A;  4KSI A;  4KVX A;  3W91 A;  5DWM A;  4KOW A;  3LMS A;  3DDD A;  3RYO A;  1MJ9 A;  5HVG A;  4MY0 A;  4QVT A;  3ISX A;  2OZG A;  3TOA A;  1IGB A;  5C82 A;  1LAP A;  3PFE A;  1BLL E;  1N71 A;  4MXU A;  4ZGY B;  2ARH A;  2NMT A;  4CAE A;  2PJ2 A;  4CYN A;  3B3C A;  3DGV A;  2DEA A;  2PVV A;  2VZY A;  4A39 A;  1YX0 A;  4CGL A;  4A30 A;  4HNW B;  3B3W A;  4FD7 A;  4AVB A;  1F2O A;  2AFU A;  3D2M A;  4UA3 A;  4XNH C;  2GLJ A;  3I3G A;  5HMN A;  2CNS A;  3OWC A;  2JLM A;  3KR5 A;  4MI4 A;  4AG9 A;  2QJ8 A;  1M1D A;  3S6G A;  3IGR A;  2OZU A;  4TNU A;  1XRY A;  4JWP A;  4KOR A;  3IC1 A;  3DR6 A;  4H6Z A;  4F6A A;  4UFX A;  4KSA A;  4G1P A;  2PJ1 A;  2PJ8 A;  2B5G A;  3PB8 X;  4F0X A;  3PP9 A;  1CM0 A;  3IU2 A;  1YRE A;  4A94 A;  3QB8 A;  1IIC A;  2BUE A;  1YLE A;  3W6X A;  3CDX A;  4FD4 A;  4R7M A;  1Y9K A;  2G3A A;  3NH8 A;  3BLN A;  4BBH A;  2PQ8 A;  2J8R A;  2F5I A;  3B3S A;  1B6B A;  3DNS A;  1Z8L A;  3FEE A;  4XNH B;  4FD5 A;  2CIJ A;  4OME A;  3GY9 A;  4CYO A;  2I79 A;  4KOS A;  2PJ0 A;  7CPA A;  3FIX A;  2PDO A;  2PJ4 A;  1Z8W A;  2WPW A;  2ZPA A;  1IOF A;  3C26 A;  2IQ6 A;  2ZXV A;  2C27 A;  2P6E A;  2Q04 A;  3S9M A;  3IO1 A;  5D29 A;  1XEB A;  2REF A;  3KI9 A;  4A31 A;  1YSJ A;  1ZLI A;  2FIW A;  2R7H A;  3T90 A;  2EVN A;  4PXD A;  2B58 A;  2Z3P A;  2Q4Z A;  3IEH A;  4A32 A;  2OOT A;  3LWU A;  4KVM E;  1JQG A;  4OAE A;  2IJZ A;  5J8F A;  5AGE A;  1TF9 A;  1S5K A;  4BMH A;  3D7H A;  2JDD A;  2B3U A;  3IIB A;  3I1U A;  4EFD A;  3SI0 A;  5AG4 A;  4PXB A;  2FCK A;  3H5Z A;  2V77 A;  4P6Y A;  4OC4 A;  3IWE A;  4LQG A;  4CRY B;  3FH4 A;  4A37 A;  2XEJ A;  4A95 A;  3CZX A;  4KOU A;  2HQY A;  2Z3M A;  4MHZ A;  4MCR A;  2AFW A;  1RXT A;  3PFO A;  4CAW A;  4C2X A;  4CYQ A;  1FNO A;  4X2T A;  5F09 A;  1Y7E A;  2D4P A;  1Z2L A;  3KL9 A;  1MJB A;  3FED A;  4CAX A;  3FNC A;  3KZW A;  4C7H A;  4NEX A;  1RTQ A;  4IAV A;  4OID A;  4CS0 B;  4QB9 A;  3RZA A;  5HXD A;  1ZG9 A;  1CX8 A;  3B2Y A;  4NSQ A;  4B5P A;  1MK4 A;  2AFX A;  2GRE A;  3L2N A;  1IYL A;  4KUA A;  4Z65 A;  4ZYQ A;  4NGR A;  3S6H A;  4MHY A;  2PRB A;  4OC5 A;  2BO9 A;  4AXV A;  4QC6 A;  5FVJ A;  1YME A;  1LAM A;  2ANP A;  2REE A;  4XPD C;  2YNE A;  5I0C A;  2WZN A;  3EO4 A;  3S9N A;  5THW A;  5IB0 A;  4NJQ A;  4CAF A;  4UEE A;  4IUS A;  3LOD A;  5KTA A;  4RN7 A;  3PB9 X;  4KS9 A;  8CPA A;  4R87 A;  1I12 A;  4OP4 A;  4F0Y A;  4EME A;  1TIQ A;  2J8M A;  2B4D A;  1OBR A;  1BPN A;  3SJF A;  4CGN A;  3GLJ A;  4B14 A;  3TOB A;  2D4O A;  3JUW A;  4MFZ A;  3EY5 A;  4A33 A;  1PU9 A;  3UY5 A;  1OZP A;  4DYO A;  4HKF A;  4XPD B;  3TT2 A;  2DPS A;  5IB9 A;  1LCP A;  2FE7 A;  5GCN A;  5CBM A;  1LAN A;  5EC4 A;  1B87 A;  1Y0R A;  1ELL P;  1IY7 A;  4OC3 A;  1R43 A;  4PSW A;  4UCP A;  3D68 A;  1MJA A;  2CF4 A;  3G8W A;  4KOY A;  4KOT A;  4C2Z A;  3R1K A;  1AMP A;  1YW4 A;  2AFM A;  3NFZ A;  2JEW A;  4R3K A;  4UBR A;  5G21 A;  3KHZ A;  3TCV A;  3ZJ0 A;  1S7F A;  2Q7B A;  1QSR A;  2OR4 A;  1PCA A;  3D3S A;  2FL4 A;  1HDQ A;  4RS2 A;  4L8A A;  3SXO A;  3SI2 A;  2PJ6 A;  1M4G A;  3WC5 A;  4C68 A;  4OIW A;  5J1Q A;  3D7F A;  4NXY A;  1UWY A;  3TFY A;  5K8N A;  4ZY0 A;  4E2A A;  1M4I A;  2Q7S A;  3FBU A;  3EXN A;  2PJC A;  2PSW A;  2GE3 A;  3FXT A;  2ODF A;  4RUH A;  1YK3 A;  3V7Z A;  1R57 A;  1Z4R A;  2ATR A;  3FF3 A;  4E8O A;  1KUX A;  3BXM A;  4P44 A;  4OLL A;  1XMB A;  4NJR A;  2Z10 A;  4DJL A;  1I1D A;  1RO5 A;  1XFO A;  2YNC C;  2QEC A;  4JZ0 A;  4P10 A;  3CXS A;  3CXQ A;  4Y49 C;  1Z8X A;  2JEV A;  1NSL A;  3MRU A;  3WC7 A;  5H84 A;  3GB0 A;  2P6G A;  2QML A;  4X8I A;  1S60 A;  4DNC A;  2QVP A;  4ZI6 A;  4YFJ A;  3FJU A;  3SXN A;  2O28 A;  5ELY A;  2Z3K A;  2HC9 A;  4C7I A;  5LYF A;  1XOV A;  1SQH A;  2EWB A;  4PK2 A;  4MFP A;  1TF8 A;  4CGP A;  1S7K A;  4DUK A;  5C88 A;  1WWZ A;  5CNP A;  4JXR A;  4MJ8 A;  4R8F A;  1LOK A;  4AVA A;  3GIU A;  1KUY A;  4PXC A;  4R3L A;  2FIA A;  3HLP A;  4PXE A;  5F48 A;  3R9G A;  3K2K A;  4M85 A;  4F8Z A;  2AFS A;  4WJB A;  1CG2 A;  1Z4E A;  1Z8T A;  3KAS A;  4IF5 A;  2B5G B;  1EE3 P;  2XEI A;  4NCZ A;  4U5Y A;  4H89 A;  3SJX A;  3IU1 A;  1NMT A;  4R9M A;  4KOX A;  3SJG A;  3N5F A;  3DSB A;  2IL4 A;  3BHX A;  4EVY A;  1ZG8 A;  5JGF A;  3GUX A;  3F8K A;  3QAY A;  4AB7 A;  2Z0Z A;  4HPS A;  4JD6 A;  3PZJ A;  2DXQ A;  1Y7R A;  5K8P A;  2P6F A;  1TXR A;  2PR1 A;  5G22 A;  3TC8 A;  1FY7 A;  2V8D A;  2ZEF A;  3K9T A;  4OKO A;  4PV6 A;  4U9Y A;  4UEZ A;  1CP7 A;  3KGQ A;  2PRQ A;  1Z5R A;  4Q38 A;  1QST A;  4AG7 A;  4B6Z A;  5BWA B;  4PSX A;  4Q36 A;  3KR4 A;  4YGO A;  2DPT A;  4RI1 A;  2K5T A;  4B11 A;  1TKH A;  3R95 A;  2XEF A;  4YU9 A;  2CNM A;  4ONW A;  4OC0 A;  5LRG A;  3WR7 A;  5F49 A;  1J4J A;  5JPH A;  4X5K A;  4KLW A;  4GS4 A;  1H8L A;  2VBQ A;  1M4L A;  3NA6 A;  2ZEP A;  2ZW5 A;  2NSM A;  4Q7A A;  1IU8 A;  1HDU A;  2CY2 A;  4MY3 A;  4YRH A;  2C1C A;  2G3T A;  2A4N A;  1ARM A;  2V8H A;  3WT4 A;  5KTC A;  1YVO A;  4NGN A;  3P2F A;  4P4E A;  2AJ6 A;  2EUI A;  2AE6 A;  2Q51 A;  4ZX9 A;  5IV0 A;  1IB1 E;  3F0A A;  3H8F A;  4BIN A;  4L89 A;  2AFO A;  3SI1 A;  4P4B A;  1YQE A;  4II9 A;  3FEC A;  1GHE A;  2G9D A;  3B7I A;  2NYQ A;  1VIX A;  2C6P A;  5LYL A;  2ZW4 A;  4NGT A;  3FMC A;  5I4M A;  4CAV A;  3B3V A;  1ZO0 A;  4KUB A;  1Q2D A;  2AFZ A;  1X10 A;  3P2H A;  3K9U A;  3S6K A;  1XIX A;  4R57 A;  1U6M A;  2JBJ A;  3R9F A;  2Q44 A;  4LUA A;  2C6C A;  5LRJ A;  2B4B A;  1FT7 A;  4UFW A;  2ZEN A;  2QYV A;  2ZOF A;  4B5O A;  4M6G A;  2H5M A;  4B10 A;  1Z9U A;  5HVH A;  2HUZ A;  2VQY A;  4A2Z A;  1F2P A;  4P45 A;  2ABZ A;  3HUV A;  4UCM A;  2Q4Y A;  2GIV A;  3KHX A;  3NH5 A;  4KLV A;  3V38 A;  4CYP A;  4F9U A;  2Z11 A;  1BOB A;  3GYA A;  3KQZ A;  4CGO A;  2Q0Y A;  3NE7 A;  4MMO A;  4MCS A;  1AYE A;  4MRI A;  3TE4 A;  1ARL A;  4A38 A;  4IK2 A;  4FAI A;  5F46 A;  2QIR A;  2FSR A;  3W6S A;  2Z3L A;  4M6I A;  4MFQ A;  4ORF A;  3TX8 A;  4F9V A;  5G1Z A;  2F7V A;  4FD6 A;  4NFR A;  2RB7 A;  3VAR A;  3SHP A;  4KOV A;  1XF8 A;  1YLO A;  5J8C A;  1KWM A;  4MFK A;  3T9Y A;  2GFQ A;  3PB7 X;  4P4D A;  5K8O A;  4MHN A;  4KSF A;  4X3R A;  3R96 A;  2PE3 A;  5JH9 A;  2P0W A;  1UFH A;  5IX3 A;  1JWQ A;  1Q2Y A;  3NE8 A;  3RNZ A;  2BSW A;  2GU2 A;  2ZED A;  2I00 A;  1QSO A;  1YR0 A;  4NGQ A;  1DE4 C;  3PBB A;  2GAN A;  4W9Y A;  4GM5 A;  1ZG7 A;  3VH9 A;  4ZBG A;  2OH1 A;  2XEG A;  3TO6 A;  1GYT A;  2CNT A;  2FS5 A;  2X7B A;  3FVL A;  3IWW A;  4OAD A;  4CGM A;  4HNY B;  3BI0 A;  1I21 A;  2B3V A;  4MFJ A;  2PC1 A;  4R76 A;  2ZEH A;  4JYW A;  3S9L A;  2V8V A;  3G3S A;  1VHO A;  2R8V A;  1Y9W A;  3H8G A;  4UWJ A;  4CRZ B;  4H2K A;  4P4F A;  4H6U A;  5EMI A;  2PIY A;  2EBJ A;  2FXF A;  3B3T A;  3I9S A;  2G0B A;  1F57 A;  3PGP A;  4PPZ A;  4UWI A;  5EBV A;  4B13 A;  2PJ7 A;  3PB4 X;  2PJ9 A;  4K3N A;  3FX6 A;  4MFL A;  3KQX A;  2Z3O A;  2OB0 A;  5E96 A;  1CP6 A;  1DTD A;  1CJW A;  2VZZ A;  3ZZI A;  2Q4V A;  3QAH A;  1VKC A;  1M44 A;  4FUU A;  1A2Z A;  3KKW A;  2WUU A;  1QSN A;  1P4N A;  4OC2 A;  4P4J A;  4XPK A;  3CPX A;  1R3N A;  4AVC A;  2WPX A;  1LFW A;  2Y0M A;  4Y49 B;  1ELM P;  3E0K A;  4NF1 A;  3RAM A;  3D7G A;  3VWD A;  4JXQ A;  2BOA A;  3D66 A;  2BL1 A;  4UFV A;  2VEZ A;  3TTH A;  2I3C A;  3MN8 A;  3JRU A;  4ZX8 A;  4MBU A;  1X12 A;  3NH4 A;  3FB3 A;  2CTB A;  1VGY A;  3QNV A;  4FBE A;  5K8M A;  1AUG A;  5AG7 A;  2ZOG A;  2RC4 A;  3PB6 X;  4EWT A;  3D8P A;  2YGW A;  3DR8 A;  2Z3N A;  2YNC A;  6CPA A;  4UEF A;  3D4U A;  4LQ6 A;  2PIZ A;  5D8N A;  2VXK A;  3FRM A;  3IWG A;  3H4Q A;  4UIB A;  3R9E A;  3TO7 A;  2PVW A;  4WWV A;  4O23 A;  2RFH A;  1L0C A;  3FYN A;  2R98 A;  2BCO A; 
#chains in the Genus database with same CATH homology
 1CPX A;  2ZEO A;  1CPS A;  1ZLH A;  2VL1 A;  1VHE A;  2PCU A;  1BAV A;  3DLJ A;  2PJ5 A;  1Q7L A;  5LYI A;  3WC6 A;  4UF4 A;  1XBU A;  2ZEE A;  1CBX A;  2J9A A;  2FVG A;  2EK9 A;  2O4H A;  1BPM A;  2ZEM A;  4IHM A;  1YW6 A;  3PEI A;  3D67 A;  4ZY2 A;  3SJE A;  4UIA A;  3B35 A;  3IFE A;  2WYR A;  3D7D A;  2V8G A;  4BD9 A;  4MHP A;  2F8H A;  2POK A;  2Q43 A;  4TWE A;  3CT9 A;  3BI1 A;  4FWU A;  4P4I A;  2IMO A;  3T8W A;  3ISZ A;  2HB6 A;  3PRT A;  1QMU A;  1XJO A;  2C6G A;  1PYT B;  4MCQ A;  1TKJ A;  5JM6 A;  2PJA A;  4NGS A;  5DS0 A;  3CPA A;  4OC1 A;  5HVF A;  2JBK A;  2EK8 A;  2ZEG A;  4NGP A;  2ZEL A;  2GLF A;  5LYD A;  1Y0Y A;  1NSA A;  1TKF A;  4MCP A;  3IJ3 A;  5CPA A;  3RBU A;  3VAT A;  3WAB A;  2O53 A;  3PBE A;  1QQ9 A;  2PJB A;  4PQA A;  5LRK A;  2CTC A;  2PJ3 A;  4YWY A;  3H8E A;  4R6T A;  4ZY1 A;  4CPA A;  1HEE A;  4NGM A;  4KSI A;  3LMS A;  5HVG A;  3ISX A;  1IGB A;  1LAP A;  3PFE A;  1BLL E;  4MXU A;  2PJ2 A;  3DGV A;  3B3C A;  2DEA A;  2PVV A;  4A39 A;  3B3W A;  1F2O A;  2AFU A;  2GLJ A;  3KR5 A;  2QJ8 A;  4TNU A;  1XRY A;  3IC1 A;  4G1P A;  2PJ1 A;  2PJ8 A;  3PB8 X;  4A94 A;  3CDX A;  4R7M A;  3NH8 A;  3B3S A;  3FEE A;  1Z8L A;  2CIJ A;  4OME A;  2PJ0 A;  7CPA A;  2PJ4 A;  2IQ6 A;  3S9M A;  3IO1 A;  5D29 A;  3KI9 A;  1YSJ A;  1ZLI A;  4PXD A;  2Q4Z A;  3IEH A;  2OOT A;  3LWU A;  1JQG A;  2IJZ A;  1TF9 A;  3D7H A;  3IIB A;  3I1U A;  4EFD A;  3SI0 A;  4PXB A;  2V77 A;  4P6Y A;  4OC4 A;  4LQG A;  3FH4 A;  4A37 A;  2XEJ A;  4MHZ A;  4MCR A;  2AFW A;  3PFO A;  1FNO A;  4X2T A;  5F09 A;  1Y7E A;  3KL9 A;  1Z2L A;  3FED A;  3KZW A;  1RTQ A;  4IAV A;  4OID A;  3RZA A;  5HXD A;  1ZG9 A;  1CX8 A;  3B2Y A;  2AFX A;  3L2N A;  2GRE A;  4Z65 A;  4ZYQ A;  4NGR A;  4MHY A;  4OC5 A;  2BO9 A;  4AXV A;  1YME A;  1LAM A;  2ANP A;  2WZN A;  3S9N A;  5THW A;  4NJQ A;  4UEE A;  3PB9 X;  8CPA A;  4OP4 A;  4EME A;  1OBR A;  1BPN A;  3SJF A;  3GLJ A;  4DYO A;  5IB9 A;  1LCP A;  5CBM A;  1LAN A;  1Y0R A;  1ELL P;  1IY7 A;  4OC3 A;  1R43 A;  3D68 A;  2CF4 A;  1AMP A;  1YW4 A;  2AFM A;  3NFZ A;  2JEW A;  3KHZ A;  2OR4 A;  1PCA A;  1HDQ A;  3SI2 A;  2PJ6 A;  3WC5 A;  4OIW A;  5J1Q A;  3D7F A;  1UWY A;  5K8N A;  4ZY0 A;  2PJC A;  4RUH A;  3V7Z A;  3FF3 A;  3BXM A;  4P44 A;  1XMB A;  4NJR A;  4DJL A;  1XFO A;  4P10 A;  4JZ0 A;  3MRU A;  3WC7 A;  3GB0 A;  4X8I A;  2QVP A;  4ZI6 A;  3FJU A;  5ELY A;  2HC9 A;  5LYF A;  2EWB A;  4DUK A;  1TF8 A;  4R8F A;  1LOK A;  4PXC A;  3HLP A;  4PXE A;  3K2K A;  4F8Z A;  2AFS A;  4WJB A;  1CG2 A;  3KAS A;  1EE3 P;  2XEI A;  3SJX A;  3SJG A;  3N5F A;  3BHX A;  1ZG8 A;  5JGF A;  3GUX A;  5K8P A;  1TXR A;  3TC8 A;  2V8D A;  2ZEF A;  3K9T A;  4OKO A;  4UEZ A;  1CP7 A;  3KGQ A;  2PRQ A;  1Z5R A;  4B6Z A;  3KR4 A;  1TKH A;  2XEF A;  4YU9 A;  4ONW A;  5LRG A;  4OC0 A;  1H8L A;  1M4L A;  3NA6 A;  2ZEP A;  2NSM A;  4Q7A A;  1HDU A;  2C1C A;  1ARM A;  2V8H A;  3WT4 A;  4NGN A;  4P4E A;  2Q51 A;  4ZX9 A;  3H8F A;  2AFO A;  3SI1 A;  4P4B A;  3FEC A;  2G9D A;  3B7I A;  2NYQ A;  1VIX A;  2C6P A;  5LYL A;  4NGT A;  3FMC A;  5I4M A;  3B3V A;  2AFZ A;  2JBJ A;  2C6C A;  5LRJ A;  1FT7 A;  2ZEN A;  2QYV A;  2ZOF A;  5HVH A;  1F2P A;  4P45 A;  2ABZ A;  3HUV A;  3NH5 A;  3KHX A;  3V38 A;  4F9U A;  3KQZ A;  4MMO A;  4MCS A;  1AYE A;  4MRI A;  1ARL A;  4A38 A;  4IK2 A;  4FAI A;  4F9V A;  3TX8 A;  2F7V A;  4NFR A;  2RB7 A;  3VAR A;  1YLO A;  1KWM A;  3PB7 X;  4P4D A;  5K8O A;  4MHN A;  4X3R A;  2PE3 A;  5JH9 A;  2GU2 A;  2ZED A;  4NGQ A;  4W9Y A;  3VH9 A;  1DE4 C;  3PBB A;  4GM5 A;  1ZG7 A;  2XEG A;  1GYT A;  3FVL A;  3IWW A;  3BI0 A;  4R76 A;  3S9L A;  2ZEH A;  4JYW A;  2V8V A;  1VHO A;  3H8G A;  4H2K A;  4P4F A;  2PIY A;  3B3T A;  1F57 A;  4PPZ A;  2PJ7 A;  3PB4 X;  2PJ9 A;  4K3N A;  3FX6 A;  3KQX A;  1DTD A;  1CP6 A;  4FUU A;  4OC2 A;  4P4J A;  3CPX A;  1R3N A;  1LFW A;  1ELM P;  3RAM A;  3D7G A;  2BOA A;  3D66 A;  2I3C A;  3MN8 A;  3JRU A;  4ZX8 A;  3NH4 A;  2CTB A;  1VGY A;  3QNV A;  4FBE A;  5K8M A;  2ZOG A;  3PB6 X;  4EWT A;  6CPA A;  4UEF A;  3D4U A;  2PIZ A;  5D8N A;  4UIB A;  2PVW A;  4WWV A;  4O23 A;  2RFH A;  2BCO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...