4H2KA

Crystal structure of the catalytic domain of succinyl-diaminopimelate desuccinylase from haemophilus influenzae
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
266
structure length
258
Chain Sequence
b'NAMKEKVVSLAQDLIRRPSISPNDEGCQQIIAERLEKLGFQIEWMPFNDTLNLWAKHGTSEPVIAFAGHTDVVPTGDENQWSSPPFSAEIIDGMLYGRGAADMKGSLAAMIVAAEEYVKANPNHKGTIALLITSDEEATAKDGTIHVVETLMARDEKITYCMVGEPSSAKNLGDVVKNGRRGGGKLLDSITSAIEETIGITPKAETGTSDGRFIALMGAEVVEFGPLNSTIHKVNECVSVEDLGKCGEIYHKMLVNLL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Succinyl-diaminopimelate desuccinylase
molecule tags Hydrolase
source organism Haemophilus influenzae
publication title The dimerization domain in DapE enzymes is required for catalysis.
pubmed doi rcsb
total genus 92
structure length 258
sequence length 266
chains with identical sequence B
ec nomenclature ec 3.5.1.18: Succinyl-diaminopimelate desuccinylase.
pdb deposition date 2012-09-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01546 Peptidase_M20 Peptidase family M20/M25/M40
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 4h2kA00
1R3NA 4X8IA 5K8MA 4P4DA 4F8ZA 1AMPA 1QQ9A 2EWBA 3GLJA 2Q4ZA 4UIBA 2AFSA 3WC7A 2ZEPA 2V8VA 2NYQA 1R43A 3PEIA 2BO9A 4R76A 5K8OA 3GUXA 2HB6A 5F09A 3PRTA 3LMSA 1VGYA 5HVFA 1Z2LA 1Z5RA 3SJEA 2ZOFA 2I3CA 4OP4A 3LWUA 2QVPA 2ZEDA 4Z65A 3B7IA 4PQAA 1YW6A 1HDQA 5K8PA 4G1PA 4MHPA 3H8EA 3FEDA 2PCUA 4X3RA 1GYTA 2PJ0A 1Y7EA 2J9AA 4JYWA 4PXCA 3FEEA 4NGMA 1HEEA 1ZG8A 3IEHA 3S9MA 4F9VA 1VIXA 3KHXA 2PJ7A 4DUKA 3PB7X 3HUVA 4FWUA 3WC6A 4K3NA 1PYTB 4NGQA 2IMOA 3SJFA 2V77A 1YSJA 3HLPA 4MCQA 3VARA 3BI1A 5K8NA 1LOKA 2CTBA 3KGQA 3CPAA 2ZEGA 4ONWA 1IGBA 3PBBA 2Q51A 3D4UA 2AFUA 3SJGA 2PE3A 2AFZA 2EK9A 4A39A 2PIZA 4P10A 2IQ6A 1LAMA 3FVLA 2GU2A 1NSAA 1Y0RA 2C6PA 1ZG9A 4MCSA 3FMCA 3NA6A 4YU9A 1LAPA 4MHYA 5JM6A 3WT4A 4NGSA 5LRKA 4MRIA 1VHEA 8CPAA 2C6GA 2PJ4A 4TWEA 2ZEFA 3NFZA 4AXVA 4IK2A 3MRUA 3ISXA 3IO1A 7CPAA 1YW4A 4NGTA 4P4EA 3TX8A 1CPXA 2PJ1A 3D67A 3D7DA 3PFEA 3VH9A 3FJUA 3JRUA 5IB9A 4A94A 3KR5A 1TXRA 1FT7A 1ELLP 2BOAA 4KSIA 2AFMA 2CF4A 4UEZA 4UEFA 3PB4X 4IAVA 3KQZA 2ZELA 2PJ2A 5I4MA 3H8GA 2XEGA 2ZEHA 1TKHA 4MMOA 1XJOA 3K2KA 1F57A 5ELYA 4NGNA 2EK8A 2JEWA 2CTCA 1DE4C 3NH8A 4DJLA 2XEIA 2RB7A 3B2YA 3B3WA 4O23A 3NH4A 3IIBA 3I1UA 2PJBA 3SI2A 3RBUA 3S9LA 2PIYA 2XEJA 3D7HA 1ELMP 4OKOA 4A37A 2ZEMA 5CPAA 3GB0A 2ZOGA 3H8FA 4OC4A 2JBJA 5THWA 3PFOA 5LYIA 4WWVA 1TKFA 3FF3A 2F8HA 1DTDA 1LANA 4ZY1A 2Q43A 1LFWA 2HC9A 4GM5A 2RFHA 4OC2A 3V38A 4PPZA 4H2KA 2PJCA 4ZX9A 4RUHA 4EWTA 1XMBA 1BPNA 2V8GA 1IY7A 4X2TA 1ARLA 3TC8A 3PB9X 1Q7LA 3WC5A 4MCPA 5LYLA 4FAIA 4JZ0A 5LYDA 3RZAA 4Q7AA 4NJRA 5D8NA 4P4BA 3DGVA 2VL1A 3KR4A 2GLFA 3CDXA 3MN8A 2PJ6A 2PJ3A 1H8LA 3QNVA 2QYVA 3KASA 1PCAA 3B3SA 4FUUA 1BAVA 2WYRA 2BCOA 4P45A 4IHMA 3B3TA 1YLOA 6CPAA 3L2NA 4UF4A 4ZI6A 4ZY0A 2PJ9A 2OR4A 2WZNA 3D7GA 2NSMA 3ISZA 3FX6A 3RAMA 2PJ5A 2C6CA 4OC5A 2FVGA 5DS0A 3SJXA 2ZEOA 2V8HA 4A38A 2IJZA 2AFOA 5HXDA 4P4FA 1CBXA 2V8DA 5J1QA 4R6TA 4MHNA 1M4LA 3BHXA 5D29A 1F2OA 1JQGA 2ZENA 2PJ8A 5LRGA 3KQXA 2PRQA 4NFRA 3FECA 2GLJA 4LQGA 4ZYQA 1Y0YA 1RTQA 3PB6X 1CP7A 1QMUA 4W9YA 4OC3A 1EE3P 5LYFA 3KI9A 3K9TA 4CPAA 2G9DA 1Z8LA 1CP6A 2DEAA 1ZLHA 3PBEA 3BXMA 1CG2A 4OIWA 4OC0A 2ZEEA 3D66A 1LCPA 4DYOA 2O53A 3S9NA 3B35A 5JH9A 1ZG7A 4FBEA 1XBUA 2GREA 1BLLE 4UIAA 4EMEA 5HVHA 4YWYA 1CPSA 4WJBA 3IFEA 2POKA 2PJAA 4MXUA 3VATA 5HVGA 4R7MA 3SI1A 1XRYA 5CBMA 4B6ZA 2PVWA 3WABA 4PXEA 4UEEA 4NJQA 1CX8A 1TKJA 4ZY2A 4TNUA 4OIDA 2OOTA 1HDUA 5JGFA 2XEFA 5LRJA 4MHZA 3IWWA 4P4IA 1KWMA 3CT9A 3NH5A 1YMEA 3DLJA 2ANPA 4R8FA 4BD9A 3IC1A 3FH4A 2F7VA 2AFXA 2C1CA 3SI0A 3B3VA 4NGPA 1UWYA 2ABZA 3D7FA 3KZWA 3KL9A 3KHZA 4EFDA 3IJ3A 4F9UA 4OC1A 2AFWA 3B3CA 4ZX8A 1ZLIA 3CPXA 1VHOA 4PXBA 3V7ZA 1ARMA 1BPMA 1XFOA 4NGRA 2CIJA 3PB8X 4OMEA 1AYEA 4P4JA 1FNOA 4P44A 3D68A 4P6YA 1TF8A 2JBKA 2PVVA 3T8WA 1TF9A 2QJ8A 2O4HA 4MCRA 3N5FA 3BI0A 1OBRA 4PXDA 1F2PA
chains in the Genus database with same CATH superfamily
4X5KA 2P6GA 1R3NA 4X8IA 3ZJ0A 1P4NA 1Z4EA 5K8MA 1Q2YA 4P4DA 4F8ZA 1YX0A 1AMPA 1QQ9A 5CNPA 4XPLA 4OAEA 2EWBA 2R8VA 3GLJA 1S7FA 2PDOA 2Q4ZA 4UIBA 2AFSA 1AUGA 4ZBGA 2HUZA 3LODA 4QC6A 3WC7A 4MFPA 4XNHC 4RS2A 3F5BA 2WUUA 2Z3NA 2ZEPA 2QECA 3JTKA 4PV6A 4UFVA 5EC4A 2V8VA 2NYQA 1R43A 1Q2DA 2C27A 4UCMA 2B3UA 3PEIA 2H5MA 2BO9A 4KLWA 4R76A 5K8OA 2REEA 3GUXA 3F8KA 2HB6A 1IOFA 5F09A 5IB0A 5DWNA 2DF5A 2AE6A 4KZTA 2KCWA 1PU9A 3PRTA 3T9YA 4E2AA 1X12A 2YGWA 3LMSA 4NXYA 1VGYA 3IWGA 4B5PA 2OZUA 4H6UA 2Q7BA 2BL1A 2Z3PA 1RO5A 5HVFA 1YK3A 1Z2LA 4R87A 5ISVA 1Z5RA 4B14A 3SJEA 4FD6A 2ZOFA 4HKFA 2ZXVA 5AG5A 2I3CA 4OP4A 3LWUA 4NEXA 2QVPA 3EO4A 4CGNA 4F0YA 2ZEDA 4Z65A 4RN7A 3B7IA 3W6XA 4PQAA 1YW6A 1HDQA 3EXNA 3N7ZA 4OADA 3RYOA 3IWEA 5K8PA 5G22A 2ZPAA 4M85A 5C82A 1XF8A 2R7HA 2WSAA 1U6MA 4G1PA 4MHPA 4B13A 3C26A 3H8EA 5G1ZA 5FVJA 4QB9A 3FEDA 2PCUA 3CZXA 4X3RA 1GYTA 2PJ0A 2HQYA 1Y7EA 2J9AA 4BINA 4JYWA 4CRZB 3JUWA 4PXCA 4YRHA 2Z11A 2CNTA 3FEEA 1HEEA 1NE9A 1ZG8A 3IEHA 1S60A 4NGMA 4PK2A 2G3TA 1VIXA 4ORFA 3S9MA 3KHXA 3F0AA 4LX9A 4CAEA 3JVNA 2PJ7A 4DUKA 3PB7X 3HUVA 4KOXA 1V0CA 4E8OA 4FWUA 3WC6A 1Q2CA 4K3NA 1PYTB 4MY3A 4NGQA 3PGPA 4Y49C 2IMOA 3SJFA 4CYNA 1WWZA 4MFLA 4PSWA 4JXQA 3R9EA 4KOUA 3IGRA 2V77A 2ARHA 4U9ZA 2EBJA 3TT2A 1WK4A 4XPKA 5G21A 4ZGYB 1YSJA 5EBVA 1M4IA 3HLPA 4MCQA 3VARA 2QIRA 2PR8A 1VHSA 3BI1A 1MJ9A 3D8PA 5K8NA 4F6AA 2ZW7A 2FE7A 2O28A 1LOKA 2CTBA 2JDDA 4BMHA 3FYNA 1J4JA 2Q04A 3CPAA 2NMTA 3KGQA 5F49A 2Q44A 2ZEGA 3TO6A 2Z10A 3V8IA 4ONWA 2R1IA 2ZW4A 2PC1A 2OB0A 1M1DA 3G8WA 1IGBA 2P6EA 3FBUA 3GIUA 3PBBA 3S6KA 2Q51A 2AFUA 3D4UA 3SJGA 2RC4A 2AJ6A 1UFHA 2P6FA 2B4BA 2PE3A 3BJ7A 4GS4A 5AG7A 2K5TA 4NCZA 2AFZA 2EK9A 2FL4A 1P0HA 4A39A 2PIZA 4P10A 4KS9A 4AB7A 4NSQA 2IQ6A 1LAMA 3FVLA 4KUAA 2GU2A 1NSAA 3P2HA 2Q7SA 4Q36A 1NMTA 1Y0RA 2C6PA 2DPTA 4MHDA 5I0CA 1ZG9A 3R96A 4MCSA 4A95A 5J8CA 1PUAA 1XIXA 3FMCA 4CAVA 2VXKA 3FB3A 4XPDC 1VKCA 3NA6A 1I21A 1Y9WA 4YU9A 4AG7A 4YGOA 3KKWA 1LAPA 3BJ8A 4MHYA 4CS0B 2Q4VA 4CYOA 4E0AA 5JM6A 2GANA 4C2XA 3WT4A 4NGSA 1K4JA 5LRKA 4MRIA 3SHPA 2EVNA 1VHEA 2BUEA 4U9YA 8CPAA 4UBRA 3D3SA 2C6GA 2DXQA 2PJ4A 2ZEFA 4TWEA 2B5GB 4MBUA 3NFZA 4AXVA 4IK2A 2D4PA 2J8NA 3MRUA 4H6ZA 3VWDA 3TE4A 2A4NA 3IO1A 3ISXA 4R57A 1YW4A 4KOSA 4A31A 4CGOA 7CPAA 4NGTA 4P4EA 3TX8A 3MGDA 1CPXA 2PJ1A 3D67A 3D7DA 3CXQA 3PFEA 3VH9A 3FJUA 1YVKA 4CGLA 3JRUA 2B58A 3PP9A 4MY0A 1YR0A 2PRBA 5IB9A 4BBHA 4A94A 1S5KA 5A27A 1QSRA 3KR5A 1M4DA 1TXRA 1FT7A 1ELLP 1RXTA 1YGHA 2BOAA 2VZYA 2AFMA 2CF4A 4KSIA 4UEZA 4UCPA 4UEFA 2YNEA 3EFAA 5H86A 4DNCA 3PB4X 1QSOA 2ATRA 4KSAA 3CXPA 2F5IA 4IAVA 3KQZA 3A9LA 2ZELA 3TOBA 2PJ2A 4J3GA 4C2YA 2GFQA 4U5YA 5I4MA 2OZGA 3H8GA 4C2ZA 3S6GA 3RNZA 5BWAB 2XEGA 2ZEHA 3GY9A 1TKHA 4MMOA 1XJOA 4CYQA 4IUSA 4LUAA 1Z9UA 5F47A 4Y49B 2Q0YA 3K2KA 1F57A 5G20A 5ELYA 3GYAA 4NGNA 3R9FA 5JPHA 2EK8A 3D2PA 5KTDA 2JEWA 2CTCA 1BO4A 1DE4C 3LACA 3NH8A 4DJLA 1KUVA 1TIQA 2QMLA 4RI1A 2XEIA 3QB8A 4A2ZA 1YLEA 3E0KA 2FCKA 2RB7A 4KSFA 3B2YA 3TO9A 3B3WA 2Q4YA 4JXRA 4O23A 3NH4A 4FD4A 4XPDB 3IIBA 3I1UA 2PJBA 3SI2A 3RBUA 2PR1A 5AG4A 4KOYA 2PIYA 2XEJA 3D7HA 3S9LA 1QSTA 2VEZA 4CAXA 1ELMP 4OKOA 4A37A 2ZEMA 5CPAA 4QBJA 3GB0A 2B3VA 2ZOGA 2X7BA 5AGEA 1FY7A 3H8FA 4OC4A 2JBJA 5THWA 3SXNA 3PFOA 5LYIA 4WWVA 1XEBA 4GXHA 1TKFA 4MFJA 3DNSA 3FF3A 4Q38A 4AVAA 2F8HA 4HPSA 1DTDA 1LANA 4ZY1A 2Q43A 1LFWA 2HC9A 2VZZA 4GM5A 2RFHA 4C7HA 4OC2A 3V38A 4PPZA 1I12A 4H2KA 5HMNA 2FS5A 2PJCA 4CRYB 4ZX9A 4RUHA 4EWTA 2JLMA 1XMBA 1BPNA 1Z8WA 3I3GA 4JJXA 2ZW6A 1NSLA 2V8GA 1IY7A 4KVXA 4X2TA 3GKRA 3PZJA 4PK3A 3TO7A 1ARLA 4PSXA 3TC8A 2J8RA 5F46A 3PB9X 4M6IA 3P2FA 2VQYA 1Q7LA 3WC5A 4MCPA 5LYLA 4FAIA 4JZ0A 1ZO0A 5LYDA 2FSRA 3RZAA 3CXSA 4QUSA 4Q7AA 5F48A 4NJRA 5D8NA 2JEVA 2Z3LA 4P4BA 2R98A 3DGVA 1QSMA 2VL1A 4K30A 3KR4A 2GLFA 3CDXA 3DR8A 3IU2A 3R95A 4AVCA 1SQHA 3MN8A 2PJ6A 5J8FA 2PJ3A 2Z3OA 2G0BA 3T90A 1JWQA 1H8LA 5C88A 1I1DA 5GCNA 3QNVA 4AVBA 2QYVA 4F9VA 3KASA 4IF5A 1PCAA 3B3SA 4II9A 3R1KA 4FUUA 5AG6A 1B6BA 5JQ4A 1BAVA 2WPXA 2Y0MA 2WYRA 2BCOA 1CM0A 3EY5A 4P45A 3VWEA 4IHMA 4MFQA 2I79A 3B3TA 1YLOA 4UCNA 4QVTA 6CPAA 3L2NA 4UF4A 4ZI6A 4ZY0A 2PJ9A 4M3SA 3FXTA 2OR4A 2WZNA 3D7GA 2NSMA 2EO8A 1IICA 4YFJA 3ISZA 4R9MA 3FX6A 4AG9A 4B5PB 3RAMA 2VI7A 2PJ5A 1R57A 2I00A 2DPSA 4H89A 4CAFA 2C6CA 2D4OA 1Z8TA 4OC5A 2FVGA 4M6GA 5DS0A 3R9GA 2ZEOA 3SJXA 3NE7A 2V8HA 4A38A 1XE4A 2IJZA 3H4QA 2Z3KA 3EC4A 2AFOA 5HXDA 4MFZA 2YNCA 1IYKA 4P4FA 1CBXA 1IB1E 2V8DA 4KOVA 1Y7RA 5J1QA 4KOTA 4UWJA 5DWMA 5EMIA 1S7NA 3S6FA 2CXAA 4R6TA 4MHNA 1M4LA 3BHXA 5D29A 1CJWA 3S6HA 1F2OA 2CY2A 4ONUA 1JQGA 3B8GA 4HNWB 2ZENA 1IYLA 4KVOE 2PJ8A 5LRGA 3KQXA 2PRQA 3DR6A 4NFRA 3BLNA 4JLYA 1GHEA 2GLJA 3FECA 4LQGA 2BSWA 1Y0YA 4ZYQA 1RTQA 3PB6X 1CP7A 1QMUA 1XOVA 3IU1A 1KUYA 4W9YA 1EE3P 4OC3A 4R3LA 1L0CA 5LYFA 1X10A 2FT0A 3KI9A 2JDCA 3K9TA 4B5OA 1M44A 4KORA 4CPAA 2G9DA 1Z8LA 3UY5A 3ZZIA 1CP6A 4CGPA 4NF1A 1IOIA 4CAWA 2DEAA 1ZLHA 2B4DA 2Z3MA 1BOBA 3PBEA 3W6SA 4L8AA 1Z8XA 3BXMA 1CG2A 4MFKA 4B12A 4OIWA 4OC0A 2ZEEA 1XMTA 3D66A 5A28A 1KUXA 5IX3A 1LCPA 4KUBA 3QAYA 4DYOA 4KLVA 2O53A 2OZHA 2ODFA 4HNXB 5H84A 4FD5A 3S9NA 1QSNA 3B35A 3G3SA 4UA3A 4C68A 5JH9A 1ZG7A 3SXOA 1XBUA 4FBEA 2GIVA 2GREA 1MK4A 2CNMA 4UFWA 1BLLE 1IIDA 4UIAA 1S7KA 4EMEA 1A2ZA 5HVHA 3RO0A 3TCVA 2ZW5A 4YWYA 2YNDA 4L89A 4B11A 4R3KA 3DSBA 4MI4A 4M6HA 1CPSA 2VBQA 4EVYA 4HNYB 4WJBA 1YVOA 3IFEA 2POKA 2PJAA 4MXUA 3VATA 1IU8A 5HVGA 4JD6A 4R7MA 5HH1A 3I9SA 3SI1A 1XRYA 5CBMA 4CGMA 4B6ZA 2PVWA 3WABA 4PXEA 4UEEA 2PSWA 4NJQA 1CX8A 4CYPA 1TKJA 1KZFA 4KVME 4XNHB 4JWPA 3OWCA 4ZY2A 4C7IA 2PQ8A 4TNUA 4OIDA 2OOTA 1HDUA 1M4GA 5JGFA 1YQEA 2XEFA 5LRJA 4MHZA 3IWWA 4P4IA 2CNSA 1KWMA 3CT9A 3NH5A 1YMEA 3DLJA 2ANPA 4R8FA 3NE8A 1B87A 4B10A 4F0XA 5KTCA 4LQ6A 2GE3A 2G3AA 4FD7A 2YNCC 3IC1A 3FH4A 4BD9A 4A33A 1OZPA 2F7VA 2AFXA 2C1CA 3SI0A 3D2MA 2HV2A 3H5ZA 3B3VA 4NGPA 1UWYA 2ABZA 2FIAA 2FXFA 1Y9KA 3FRMA 2OH1A 3D7FA 3KZWA 3KL9A 1MJAA 3KHZA 3TTHA 5E96A 2IL4A 4EFDA 2WPWA 3IJ3A 5IV0A 2B5GA 1YREA 2P0WA 4F9UA 3TOAA 4OC1A 3QAHA 2AFWA 3B3CA 4ZX8A 1ZLIA 4OLLA 1S3ZA 2FIWA 3CPXA 1VHOA 3DDDA 2OU2A 4UWIA 3W91A 4PXBA 2BEIA 3V7ZA 4I49A 4KOWA 1ARMA 1BPMA 1XFOA 5KTAA 1ON0A 3K9UA 4NGRA 4A32A 2CIJA 3PB8X 4OMEA 1LRZA 3TFYA 1N71A 1S7LA 1MJBA 1AYEA 4UFXA 2J8MA 1FNOA 4P4JA 2REFA 3D68A 4P44A 4P6YA 1TF8A 2JBKA 3WR7A 2Z0ZA 2PVVA 2EUIA 3T8WA 1Z4RA 1TF9A 2QJ8A 2O4HA 4MCRA 3N5FA 2B4DB 3BI0A 1OBRA 4PXDA 1F2PA 4MJ8A 3FNCA 3FIXA 4A30A 3LD2A
chains in the Genus database with same CATH topology
1R3NA 4X8IA 5K8MA 4P4DA 4F8ZA 1AMPA 1QQ9A 2EWBA 3GLJA 2Q4ZA 4UIBA 2AFSA 3WC7A 2ZEPA 2V8VA 2NYQA 1R43A 3PEIA 2BO9A 4R76A 5K8OA 3GUXA 2HB6A 5F09A 3PRTA 3LMSA 1VGYA 5HVFA 1Z2LA 1Z5RA 3SJEA 2ZOFA 2I3CA 4OP4A 3LWUA 2QVPA 2ZEDA 4Z65A 3B7IA 4PQAA 1YW6A 1HDQA 5K8PA 4G1PA 4MHPA 3H8EA 3FEDA 2PCUA 4X3RA 1GYTA 2PJ0A 1Y7EA 2J9AA 4JYWA 4PXCA 3FEEA 4NGMA 1HEEA 1ZG8A 3IEHA 3S9MA 4F9VA 1VIXA 3KHXA 2PJ7A 4DUKA 3PB7X 3HUVA 4FWUA 3WC6A 4K3NA 1PYTB 4NGQA 2IMOA 3SJFA 2V77A 1YSJA 3HLPA 4MCQA 3VARA 3BI1A 5K8NA 1LOKA 2CTBA 3KGQA 3CPAA 2ZEGA 4ONWA 1IGBA 3PBBA 2Q51A 3D4UA 2AFUA 3SJGA 2PE3A 2AFZA 2EK9A 4A39A 2PIZA 4P10A 2IQ6A 1LAMA 3FVLA 2GU2A 1NSAA 1Y0RA 2C6PA 1ZG9A 4MCSA 3FMCA 3NA6A 4YU9A 1LAPA 4MHYA 5JM6A 3WT4A 4NGSA 5LRKA 4MRIA 1VHEA 8CPAA 2C6GA 2PJ4A 4TWEA 2ZEFA 3NFZA 4AXVA 4IK2A 3MRUA 3ISXA 3IO1A 7CPAA 1YW4A 4NGTA 4P4EA 3TX8A 1CPXA 2PJ1A 3D67A 3D7DA 3PFEA 3VH9A 3FJUA 3JRUA 5IB9A 4A94A 3KR5A 1TXRA 1FT7A 1ELLP 2BOAA 4KSIA 2AFMA 2CF4A 4UEZA 4UEFA 3PB4X 4IAVA 3KQZA 2ZELA 2PJ2A 5I4MA 3H8GA 2XEGA 2ZEHA 1TKHA 4MMOA 1XJOA 3K2KA 1F57A 5ELYA 4NGNA 2EK8A 2JEWA 2CTCA 1DE4C 3NH8A 4DJLA 2XEIA 2RB7A 3B2YA 3B3WA 4O23A 3NH4A 3IIBA 3I1UA 2PJBA 3SI2A 3RBUA 3S9LA 2PIYA 2XEJA 3D7HA 1ELMP 4OKOA 4A37A 2ZEMA 5CPAA 3GB0A 2ZOGA 3H8FA 4OC4A 2JBJA 5THWA 3PFOA 5LYIA 4WWVA 1TKFA 3FF3A 2F8HA 1DTDA 1LANA 4ZY1A 2Q43A 1LFWA 2HC9A 4GM5A 2RFHA 4OC2A 3V38A 4PPZA 4H2KA 2PJCA 4ZX9A 4RUHA 4EWTA 1XMBA 1BPNA 2V8GA 1IY7A 4X2TA 1ARLA 3TC8A 3PB9X 1Q7LA 3WC5A 4MCPA 5LYLA 4FAIA 4JZ0A 5LYDA 3RZAA 4Q7AA 4NJRA 5D8NA 4P4BA 3DGVA 2VL1A 3KR4A 2GLFA 3CDXA 3MN8A 2PJ6A 2PJ3A 1H8LA 3QNVA 2QYVA 3KASA 1PCAA 3B3SA 4FUUA 1BAVA 2WYRA 2BCOA 4P45A 4IHMA 3B3TA 1YLOA 6CPAA 3L2NA 4UF4A 4ZI6A 4ZY0A 2PJ9A 2OR4A 2WZNA 3D7GA 2NSMA 3ISZA 3FX6A 3RAMA 2PJ5A 2C6CA 4OC5A 2FVGA 5DS0A 3SJXA 2ZEOA 2V8HA 4A38A 2IJZA 2AFOA 5HXDA 4P4FA 1CBXA 2V8DA 5J1QA 4R6TA 4MHNA 1M4LA 3BHXA 5D29A 1F2OA 1JQGA 2ZENA 2PJ8A 5LRGA 3KQXA 2PRQA 4NFRA 3FECA 2GLJA 4LQGA 4ZYQA 1Y0YA 1RTQA 3PB6X 1CP7A 1QMUA 4W9YA 4OC3A 1EE3P 5LYFA 3KI9A 3K9TA 4CPAA 2G9DA 1Z8LA 1CP6A 2DEAA 1ZLHA 3PBEA 3BXMA 1CG2A 4OIWA 4OC0A 2ZEEA 3D66A 1LCPA 4DYOA 2O53A 3S9NA 3B35A 5JH9A 1ZG7A 4FBEA 1XBUA 2GREA 1BLLE 4UIAA 4EMEA 5HVHA 4YWYA 1CPSA 4WJBA 3IFEA 2POKA 2PJAA 4MXUA 3VATA 5HVGA 4R7MA 3SI1A 1XRYA 5CBMA 4B6ZA 2PVWA 3WABA 4PXEA 4UEEA 4NJQA 1CX8A 1TKJA 4ZY2A 4TNUA 4OIDA 2OOTA 1HDUA 5JGFA 2XEFA 5LRJA 4MHZA 3IWWA 4P4IA 1KWMA 3CT9A 3NH5A 1YMEA 3DLJA 2ANPA 4R8FA 4BD9A 3IC1A 3FH4A 2F7VA 2AFXA 2C1CA 3SI0A 3B3VA 4NGPA 1UWYA 2ABZA 3D7FA 3KZWA 3KL9A 3KHZA 4EFDA 3IJ3A 4F9UA 4OC1A 2AFWA 3B3CA 4ZX8A 1ZLIA 3CPXA 1VHOA 4PXBA 3V7ZA 1ARMA 1BPMA 1XFOA 4NGRA 2CIJA 3PB8X 4OMEA 1AYEA 4P4JA 1FNOA 4P44A 3D68A 4P6YA 1TF8A 2JBKA 2PVVA 3T8WA 1TF9A 2QJ8A 2O4HA 4MCRA 3N5FA 3BI0A 1OBRA 4PXDA 1F2PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1R3N A;  4X8I A;  5K8M A;  4P4D A;  4F8Z A;  1AMP A;  1QQ9 A;  2EWB A;  3GLJ A;  2Q4Z A;  4UIB A;  2AFS A;  3WC7 A;  2ZEP A;  2V8V A;  2NYQ A;  1R43 A;  3PEI A;  2BO9 A;  4R76 A;  5K8O A;  3GUX A;  2HB6 A;  5F09 A;  3PRT A;  3LMS A;  1VGY A;  5HVF A;  1Z2L A;  1Z5R A;  3SJE A;  2ZOF A;  2I3C A;  4OP4 A;  3LWU A;  2QVP A;  2ZED A;  4Z65 A;  3B7I A;  4PQA A;  1YW6 A;  1HDQ A;  5K8P A;  4G1P A;  4MHP A;  3H8E A;  3FED A;  2PCU A;  4X3R A;  1GYT A;  2PJ0 A;  1Y7E A;  2J9A A;  4JYW A;  4PXC A;  3FEE A;  4NGM A;  1HEE A;  1ZG8 A;  3IEH A;  3S9M A;  4F9V A;  1VIX A;  3KHX A;  2PJ7 A;  4DUK A;  3PB7 X;  3HUV A;  4FWU A;  3WC6 A;  4K3N A;  1PYT B;  4NGQ A;  2IMO A;  3SJF A;  2V77 A;  1YSJ A;  3HLP A;  4MCQ A;  3VAR A;  3BI1 A;  5K8N A;  1LOK A;  2CTB A;  3KGQ A;  3CPA A;  2ZEG A;  4ONW A;  1IGB A;  3PBB A;  2Q51 A;  3D4U A;  2AFU A;  3SJG A;  2PE3 A;  2AFZ A;  2EK9 A;  4A39 A;  2PIZ A;  4P10 A;  2IQ6 A;  1LAM A;  3FVL A;  2GU2 A;  1NSA A;  1Y0R A;  2C6P A;  1ZG9 A;  4MCS A;  3FMC A;  3NA6 A;  4YU9 A;  1LAP A;  4MHY A;  5JM6 A;  3WT4 A;  4NGS A;  5LRK A;  4MRI A;  1VHE A;  8CPA A;  2C6G A;  2PJ4 A;  4TWE A;  2ZEF A;  3NFZ A;  4AXV A;  4IK2 A;  3MRU A;  3ISX A;  3IO1 A;  7CPA A;  1YW4 A;  4NGT A;  4P4E A;  3TX8 A;  1CPX A;  2PJ1 A;  3D67 A;  3D7D A;  3PFE A;  3VH9 A;  3FJU A;  3JRU A;  5IB9 A;  4A94 A;  3KR5 A;  1TXR A;  1FT7 A;  1ELL P;  2BOA A;  4KSI A;  2AFM A;  2CF4 A;  4UEZ A;  4UEF A;  3PB4 X;  4IAV A;  3KQZ A;  2ZEL A;  2PJ2 A;  5I4M A;  3H8G A;  2XEG A;  2ZEH A;  1TKH A;  4MMO A;  1XJO A;  3K2K A;  1F57 A;  5ELY A;  4NGN A;  2EK8 A;  2JEW A;  2CTC A;  1DE4 C;  3NH8 A;  4DJL A;  2XEI A;  2RB7 A;  3B2Y A;  3B3W A;  4O23 A;  3NH4 A;  3IIB A;  3I1U A;  2PJB A;  3SI2 A;  3RBU A;  3S9L A;  2PIY A;  2XEJ A;  3D7H A;  1ELM P;  4OKO A;  4A37 A;  2ZEM A;  5CPA A;  3GB0 A;  2ZOG A;  3H8F A;  4OC4 A;  2JBJ A;  5THW A;  3PFO A;  5LYI A;  4WWV A;  1TKF A;  3FF3 A;  2F8H A;  1DTD A;  1LAN A;  4ZY1 A;  2Q43 A;  1LFW A;  2HC9 A;  4GM5 A;  2RFH A;  4OC2 A;  3V38 A;  4PPZ A;  4H2K A;  2PJC A;  4ZX9 A;  4RUH A;  4EWT A;  1XMB A;  1BPN A;  2V8G A;  1IY7 A;  4X2T A;  1ARL A;  3TC8 A;  3PB9 X;  1Q7L A;  3WC5 A;  4MCP A;  5LYL A;  4FAI A;  4JZ0 A;  5LYD A;  3RZA A;  4Q7A A;  4NJR A;  5D8N A;  4P4B A;  3DGV A;  2VL1 A;  3KR4 A;  2GLF A;  3CDX A;  3MN8 A;  2PJ6 A;  2PJ3 A;  1H8L A;  3QNV A;  2QYV A;  3KAS A;  1PCA A;  3B3S A;  4FUU A;  1BAV A;  2WYR A;  2BCO A;  4P45 A;  4IHM A;  3B3T A;  1YLO A;  6CPA A;  3L2N A;  4UF4 A;  4ZI6 A;  4ZY0 A;  2PJ9 A;  2OR4 A;  2WZN A;  3D7G A;  2NSM A;  3ISZ A;  3FX6 A;  3RAM A;  2PJ5 A;  2C6C A;  4OC5 A;  2FVG A;  5DS0 A;  3SJX A;  2ZEO A;  2V8H A;  4A38 A;  2IJZ A;  2AFO A;  5HXD A;  4P4F A;  1CBX A;  2V8D A;  5J1Q A;  4R6T A;  4MHN A;  1M4L A;  3BHX A;  5D29 A;  1F2O A;  1JQG A;  2ZEN A;  2PJ8 A;  5LRG A;  3KQX A;  2PRQ A;  4NFR A;  3FEC A;  2GLJ A;  4LQG A;  4ZYQ A;  1Y0Y A;  1RTQ A;  3PB6 X;  1CP7 A;  1QMU A;  4W9Y A;  4OC3 A;  1EE3 P;  5LYF A;  3KI9 A;  3K9T A;  4CPA A;  2G9D A;  1Z8L A;  1CP6 A;  2DEA A;  1ZLH A;  3PBE A;  3BXM A;  1CG2 A;  4OIW A;  4OC0 A;  2ZEE A;  3D66 A;  1LCP A;  4DYO A;  2O53 A;  3S9N A;  3B35 A;  5JH9 A;  1ZG7 A;  4FBE A;  1XBU A;  2GRE A;  1BLL E;  4UIA A;  4EME A;  5HVH A;  4YWY A;  1CPS A;  4WJB A;  3IFE A;  2POK A;  2PJA A;  4MXU A;  3VAT A;  5HVG A;  4R7M A;  3SI1 A;  1XRY A;  5CBM A;  4B6Z A;  2PVW A;  3WAB A;  4PXE A;  4UEE A;  4NJQ A;  1CX8 A;  1TKJ A;  4ZY2 A;  4TNU A;  4OID A;  2OOT A;  1HDU A;  5JGF A;  2XEF A;  5LRJ A;  4MHZ A;  3IWW A;  4P4I A;  1KWM A;  3CT9 A;  3NH5 A;  1YME A;  3DLJ A;  2ANP A;  4R8F A;  4BD9 A;  3IC1 A;  3FH4 A;  2F7V A;  2AFX A;  2C1C A;  3SI0 A;  3B3V A;  4NGP A;  1UWY A;  2ABZ A;  3D7F A;  3KZW A;  3KL9 A;  3KHZ A;  4EFD A;  3IJ3 A;  4F9U A;  4OC1 A;  2AFW A;  3B3C A;  4ZX8 A;  1ZLI A;  3CPX A;  1VHO A;  4PXB A;  3V7Z A;  1ARM A;  1BPM A;  1XFO A;  4NGR A;  2CIJ A;  3PB8 X;  4OME A;  1AYE A;  4P4J A;  1FNO A;  4P44 A;  3D68 A;  4P6Y A;  1TF8 A;  2JBK A;  2PVV A;  3T8W A;  1TF9 A;  2QJ8 A;  2O4H A;  4MCR A;  3N5F A;  3BI0 A;  1OBR A;  4PXD A;  1F2P A; 
#chains in the Genus database with same CATH topology
 4X5K A;  2P6G A;  1R3N A;  4X8I A;  3ZJ0 A;  1P4N A;  1Z4E A;  5K8M A;  1Q2Y A;  4P4D A;  4F8Z A;  1YX0 A;  1AMP A;  1QQ9 A;  5CNP A;  4XPL A;  4OAE A;  2EWB A;  2R8V A;  3GLJ A;  1S7F A;  2PDO A;  2Q4Z A;  4UIB A;  2AFS A;  1AUG A;  4ZBG A;  2HUZ A;  3LOD A;  4QC6 A;  3WC7 A;  4MFP A;  4XNH C;  4RS2 A;  3F5B A;  2WUU A;  2Z3N A;  2ZEP A;  2QEC A;  3JTK A;  4PV6 A;  4UFV A;  5EC4 A;  2V8V A;  2NYQ A;  1R43 A;  1Q2D A;  2C27 A;  4UCM A;  2B3U A;  3PEI A;  2H5M A;  2BO9 A;  4KLW A;  4R76 A;  5K8O A;  2REE A;  3GUX A;  3F8K A;  2HB6 A;  1IOF A;  5F09 A;  5IB0 A;  5DWN A;  2DF5 A;  2AE6 A;  4KZT A;  2KCW A;  1PU9 A;  3PRT A;  3T9Y A;  4E2A A;  1X12 A;  2YGW A;  3LMS A;  4NXY A;  1VGY A;  3IWG A;  4B5P A;  2OZU A;  4H6U A;  2Q7B A;  2BL1 A;  2Z3P A;  1RO5 A;  5HVF A;  1YK3 A;  1Z2L A;  4R87 A;  5ISV A;  1Z5R A;  4B14 A;  3SJE A;  4FD6 A;  2ZOF A;  4HKF A;  2ZXV A;  5AG5 A;  2I3C A;  4OP4 A;  3LWU A;  4NEX A;  2QVP A;  3EO4 A;  4CGN A;  4F0Y A;  2ZED A;  4Z65 A;  4RN7 A;  3B7I A;  3W6X A;  4PQA A;  1YW6 A;  1HDQ A;  3EXN A;  3N7Z A;  4OAD A;  3RYO A;  3IWE A;  5K8P A;  5G22 A;  2ZPA A;  4M85 A;  5C82 A;  1XF8 A;  2R7H A;  2WSA A;  1U6M A;  4G1P A;  4MHP A;  4B13 A;  3C26 A;  3H8E A;  5G1Z A;  5FVJ A;  4QB9 A;  3FED A;  2PCU A;  3CZX A;  4X3R A;  1GYT A;  2PJ0 A;  2HQY A;  1Y7E A;  2J9A A;  4BIN A;  4JYW A;  4CRZ B;  3JUW A;  4PXC A;  4YRH A;  2Z11 A;  2CNT A;  3FEE A;  1HEE A;  1NE9 A;  1ZG8 A;  3IEH A;  1S60 A;  4NGM A;  4PK2 A;  2G3T A;  1VIX A;  4ORF A;  3S9M A;  3KHX A;  3F0A A;  4LX9 A;  4CAE A;  3JVN A;  2PJ7 A;  4DUK A;  3PB7 X;  3HUV A;  4KOX A;  1V0C A;  4E8O A;  4FWU A;  3WC6 A;  1Q2C A;  4K3N A;  1PYT B;  4MY3 A;  4NGQ A;  3PGP A;  4Y49 C;  2IMO A;  3SJF A;  4CYN A;  1WWZ A;  4MFL A;  4PSW A;  4JXQ A;  3R9E A;  4KOU A;  3IGR A;  2V77 A;  2ARH A;  4U9Z A;  2EBJ A;  3TT2 A;  1WK4 A;  4XPK A;  5G21 A;  4ZGY B;  1YSJ A;  5EBV A;  1M4I A;  3HLP A;  4MCQ A;  3VAR A;  2QIR A;  2PR8 A;  1VHS A;  3BI1 A;  1MJ9 A;  3D8P A;  5K8N A;  4F6A A;  2ZW7 A;  2FE7 A;  2O28 A;  1LOK A;  2CTB A;  2JDD A;  4BMH A;  3FYN A;  1J4J A;  2Q04 A;  3CPA A;  2NMT A;  3KGQ A;  5F49 A;  2Q44 A;  2ZEG A;  3TO6 A;  2Z10 A;  3V8I A;  4ONW A;  2R1I A;  2ZW4 A;  2PC1 A;  2OB0 A;  1M1D A;  3G8W A;  1IGB A;  2P6E A;  3FBU A;  3GIU A;  3PBB A;  3S6K A;  2Q51 A;  2AFU A;  3D4U A;  3SJG A;  2RC4 A;  2AJ6 A;  1UFH A;  2P6F A;  2B4B A;  2PE3 A;  3BJ7 A;  4GS4 A;  5AG7 A;  2K5T A;  4NCZ A;  2AFZ A;  2EK9 A;  2FL4 A;  1P0H A;  4A39 A;  2PIZ A;  4P10 A;  4KS9 A;  4AB7 A;  4NSQ A;  2IQ6 A;  1LAM A;  3FVL A;  4KUA A;  2GU2 A;  1NSA A;  3P2H A;  2Q7S A;  4Q36 A;  1NMT A;  1Y0R A;  2C6P A;  2DPT A;  4MHD A;  5I0C A;  1ZG9 A;  3R96 A;  4MCS A;  4A95 A;  5J8C A;  1PUA A;  1XIX A;  3FMC A;  4CAV A;  2VXK A;  3FB3 A;  4XPD C;  1VKC A;  3NA6 A;  1I21 A;  1Y9W A;  4YU9 A;  4AG7 A;  4YGO A;  3KKW A;  1LAP A;  3BJ8 A;  4MHY A;  4CS0 B;  2Q4V A;  4CYO A;  4E0A A;  5JM6 A;  2GAN A;  4C2X A;  3WT4 A;  4NGS A;  1K4J A;  5LRK A;  4MRI A;  3SHP A;  2EVN A;  1VHE A;  2BUE A;  4U9Y A;  8CPA A;  4UBR A;  3D3S A;  2C6G A;  2DXQ A;  2PJ4 A;  2ZEF A;  4TWE A;  2B5G B;  4MBU A;  3NFZ A;  4AXV A;  4IK2 A;  2D4P A;  2J8N A;  3MRU A;  4H6Z A;  3VWD A;  3TE4 A;  2A4N A;  3IO1 A;  3ISX A;  4R57 A;  1YW4 A;  4KOS A;  4A31 A;  4CGO A;  7CPA A;  4NGT A;  4P4E A;  3TX8 A;  3MGD A;  1CPX A;  2PJ1 A;  3D67 A;  3D7D A;  3CXQ A;  3PFE A;  3VH9 A;  3FJU A;  1YVK A;  4CGL A;  3JRU A;  2B58 A;  3PP9 A;  4MY0 A;  1YR0 A;  2PRB A;  5IB9 A;  4BBH A;  4A94 A;  1S5K A;  5A27 A;  1QSR A;  3KR5 A;  1M4D A;  1TXR A;  1FT7 A;  1ELL P;  1RXT A;  1YGH A;  2BOA A;  2VZY A;  2AFM A;  2CF4 A;  4KSI A;  4UEZ A;  4UCP A;  4UEF A;  2YNE A;  3EFA A;  5H86 A;  4DNC A;  3PB4 X;  1QSO A;  2ATR A;  4KSA A;  3CXP A;  2F5I A;  4IAV A;  3KQZ A;  3A9L A;  2ZEL A;  3TOB A;  2PJ2 A;  4J3G A;  4C2Y A;  2GFQ A;  4U5Y A;  5I4M A;  2OZG A;  3H8G A;  4C2Z A;  3S6G A;  3RNZ A;  5BWA B;  2XEG A;  2ZEH A;  3GY9 A;  1TKH A;  4MMO A;  1XJO A;  4CYQ A;  4IUS A;  4LUA A;  1Z9U A;  5F47 A;  4Y49 B;  2Q0Y A;  3K2K A;  1F57 A;  5G20 A;  5ELY A;  3GYA A;  4NGN A;  3R9F A;  5JPH A;  2EK8 A;  3D2P A;  5KTD A;  2JEW A;  2CTC A;  1BO4 A;  1DE4 C;  3LAC A;  3NH8 A;  4DJL A;  1KUV A;  1TIQ A;  2QML A;  4RI1 A;  2XEI A;  3QB8 A;  4A2Z A;  1YLE A;  3E0K A;  2FCK A;  2RB7 A;  4KSF A;  3B2Y A;  3TO9 A;  3B3W A;  2Q4Y A;  4JXR A;  4O23 A;  3NH4 A;  4FD4 A;  4XPD B;  3IIB A;  3I1U A;  2PJB A;  3SI2 A;  3RBU A;  2PR1 A;  5AG4 A;  4KOY A;  2PIY A;  2XEJ A;  3D7H A;  3S9L A;  1QST A;  2VEZ A;  4CAX A;  1ELM P;  4OKO A;  4A37 A;  2ZEM A;  5CPA A;  4QBJ A;  3GB0 A;  2B3V A;  2ZOG A;  2X7B A;  5AGE A;  1FY7 A;  3H8F A;  4OC4 A;  2JBJ A;  5THW A;  3SXN A;  3PFO A;  5LYI A;  4WWV A;  1XEB A;  4GXH A;  1TKF A;  4MFJ A;  3DNS A;  3FF3 A;  4Q38 A;  4AVA A;  2F8H A;  4HPS A;  1DTD A;  1LAN A;  4ZY1 A;  2Q43 A;  1LFW A;  2HC9 A;  2VZZ A;  4GM5 A;  2RFH A;  4C7H A;  4OC2 A;  3V38 A;  4PPZ A;  1I12 A;  4H2K A;  5HMN A;  2FS5 A;  2PJC A;  4CRY B;  4ZX9 A;  4RUH A;  4EWT A;  2JLM A;  1XMB A;  1BPN A;  1Z8W A;  3I3G A;  4JJX A;  2ZW6 A;  1NSL A;  2V8G A;  1IY7 A;  4KVX A;  4X2T A;  3GKR A;  3PZJ A;  4PK3 A;  3TO7 A;  1ARL A;  4PSX A;  3TC8 A;  2J8R A;  5F46 A;  3PB9 X;  4M6I A;  3P2F A;  2VQY A;  1Q7L A;  3WC5 A;  4MCP A;  5LYL A;  4FAI A;  4JZ0 A;  1ZO0 A;  5LYD A;  2FSR A;  3RZA A;  3CXS A;  4QUS A;  4Q7A A;  5F48 A;  4NJR A;  5D8N A;  2JEV A;  2Z3L A;  4P4B A;  2R98 A;  3DGV A;  1QSM A;  2VL1 A;  4K30 A;  3KR4 A;  2GLF A;  3CDX A;  3DR8 A;  3IU2 A;  3R95 A;  4AVC A;  1SQH A;  3MN8 A;  2PJ6 A;  5J8F A;  2PJ3 A;  2Z3O A;  2G0B A;  3T90 A;  1JWQ A;  1H8L A;  5C88 A;  1I1D A;  5GCN A;  3QNV A;  4AVB A;  2QYV A;  4F9V A;  3KAS A;  4IF5 A;  1PCA A;  3B3S A;  4II9 A;  3R1K A;  4FUU A;  5AG6 A;  1B6B A;  5JQ4 A;  1BAV A;  2WPX A;  2Y0M A;  2WYR A;  2BCO A;  1CM0 A;  3EY5 A;  4P45 A;  3VWE A;  4IHM A;  4MFQ A;  2I79 A;  3B3T A;  1YLO A;  4UCN A;  4QVT A;  6CPA A;  3L2N A;  4UF4 A;  4ZI6 A;  4ZY0 A;  2PJ9 A;  4M3S A;  3FXT A;  2OR4 A;  2WZN A;  3D7G A;  2NSM A;  2EO8 A;  1IIC A;  4YFJ A;  3ISZ A;  4R9M A;  3FX6 A;  4AG9 A;  4B5P B;  3RAM A;  2VI7 A;  2PJ5 A;  1R57 A;  2I00 A;  2DPS A;  4H89 A;  4CAF A;  2C6C A;  2D4O A;  1Z8T A;  4OC5 A;  2FVG A;  4M6G A;  5DS0 A;  3R9G A;  2ZEO A;  3SJX A;  3NE7 A;  2V8H A;  4A38 A;  1XE4 A;  2IJZ A;  3H4Q A;  2Z3K A;  3EC4 A;  2AFO A;  5HXD A;  4MFZ A;  2YNC A;  1IYK A;  4P4F A;  1CBX A;  1IB1 E;  2V8D A;  4KOV A;  1Y7R A;  5J1Q A;  4KOT A;  4UWJ A;  5DWM A;  5EMI A;  1S7N A;  3S6F A;  2CXA A;  4R6T A;  4MHN A;  1M4L A;  3BHX A;  5D29 A;  1CJW A;  3S6H A;  1F2O A;  2CY2 A;  4ONU A;  1JQG A;  3B8G A;  4HNW B;  2ZEN A;  1IYL A;  4KVO E;  2PJ8 A;  5LRG A;  3KQX A;  2PRQ A;  3DR6 A;  4NFR A;  3BLN A;  4JLY A;  1GHE A;  2GLJ A;  3FEC A;  4LQG A;  2BSW A;  1Y0Y A;  4ZYQ A;  1RTQ A;  3PB6 X;  1CP7 A;  1QMU A;  1XOV A;  3IU1 A;  1KUY A;  4W9Y A;  1EE3 P;  4OC3 A;  4R3L A;  1L0C A;  5LYF A;  1X10 A;  2FT0 A;  3KI9 A;  2JDC A;  3K9T A;  4B5O A;  1M44 A;  4KOR A;  4CPA A;  2G9D A;  1Z8L A;  3UY5 A;  3ZZI A;  1CP6 A;  4CGP A;  4NF1 A;  1IOI A;  4CAW A;  2DEA A;  1ZLH A;  2B4D A;  2Z3M A;  1BOB A;  3PBE A;  3W6S A;  4L8A A;  1Z8X A;  3BXM A;  1CG2 A;  4MFK A;  4B12 A;  4OIW A;  4OC0 A;  2ZEE A;  1XMT A;  3D66 A;  5A28 A;  1KUX A;  5IX3 A;  1LCP A;  4KUB A;  3QAY A;  4DYO A;  4KLV A;  2O53 A;  2OZH A;  2ODF A;  4HNX B;  5H84 A;  4FD5 A;  3S9N A;  1QSN A;  3B35 A;  3G3S A;  4UA3 A;  4C68 A;  5JH9 A;  1ZG7 A;  3SXO A;  1XBU A;  4FBE A;  2GIV A;  2GRE A;  1MK4 A;  2CNM A;  4UFW A;  1BLL E;  1IID A;  4UIA A;  1S7K A;  4EME A;  1A2Z A;  5HVH A;  3RO0 A;  3TCV A;  2ZW5 A;  4YWY A;  2YND A;  4L89 A;  4B11 A;  4R3K A;  3DSB A;  4MI4 A;  4M6H A;  1CPS A;  2VBQ A;  4EVY A;  4HNY B;  4WJB A;  1YVO A;  3IFE A;  2POK A;  2PJA A;  4MXU A;  3VAT A;  1IU8 A;  5HVG A;  4JD6 A;  4R7M A;  5HH1 A;  3I9S A;  3SI1 A;  1XRY A;  5CBM A;  4CGM A;  4B6Z A;  2PVW A;  3WAB A;  4PXE A;  4UEE A;  2PSW A;  4NJQ A;  1CX8 A;  4CYP A;  1TKJ A;  1KZF A;  4KVM E;  4XNH B;  4JWP A;  3OWC A;  4ZY2 A;  4C7I A;  2PQ8 A;  4TNU A;  4OID A;  2OOT A;  1HDU A;  1M4G A;  5JGF A;  1YQE A;  2XEF A;  5LRJ A;  4MHZ A;  3IWW A;  4P4I A;  2CNS A;  1KWM A;  3CT9 A;  3NH5 A;  1YME A;  3DLJ A;  2ANP A;  4R8F A;  3NE8 A;  1B87 A;  4B10 A;  4F0X A;  5KTC A;  4LQ6 A;  2GE3 A;  2G3A A;  4FD7 A;  2YNC C;  3IC1 A;  3FH4 A;  4BD9 A;  4A33 A;  1OZP A;  2F7V A;  2AFX A;  2C1C A;  3SI0 A;  3D2M A;  2HV2 A;  3H5Z A;  3B3V A;  4NGP A;  1UWY A;  2ABZ A;  2FIA A;  2FXF A;  1Y9K A;  3FRM A;  2OH1 A;  3D7F A;  3KZW A;  3KL9 A;  1MJA A;  3KHZ A;  3TTH A;  5E96 A;  2IL4 A;  4EFD A;  2WPW A;  3IJ3 A;  5IV0 A;  2B5G A;  1YRE A;  2P0W A;  4F9U A;  3TOA A;  4OC1 A;  3QAH A;  2AFW A;  3B3C A;  4ZX8 A;  1ZLI A;  4OLL A;  1S3Z A;  2FIW A;  3CPX A;  1VHO A;  3DDD A;  2OU2 A;  4UWI A;  3W91 A;  4PXB A;  2BEI A;  3V7Z A;  4I49 A;  4KOW A;  1ARM A;  1BPM A;  1XFO A;  5KTA A;  1ON0 A;  3K9U A;  4NGR A;  4A32 A;  2CIJ A;  3PB8 X;  4OME A;  1LRZ A;  3TFY A;  1N71 A;  1S7L A;  1MJB A;  1AYE A;  4UFX A;  2J8M A;  1FNO A;  4P4J A;  2REF A;  3D68 A;  4P44 A;  4P6Y A;  1TF8 A;  2JBK A;  3WR7 A;  2Z0Z A;  2PVV A;  2EUI A;  3T8W A;  1Z4R A;  1TF9 A;  2QJ8 A;  2O4H A;  4MCR A;  3N5F A;  2B4D B;  3BI0 A;  1OBR A;  4PXD A;  1F2P A;  4MJ8 A;  3FNC A;  3FIX A;  4A30 A;  3LD2 A; 
#chains in the Genus database with same CATH homology
 1R3N A;  4X8I A;  5K8M A;  4P4D A;  4F8Z A;  1AMP A;  1QQ9 A;  2EWB A;  3GLJ A;  2Q4Z A;  4UIB A;  2AFS A;  3WC7 A;  2ZEP A;  2V8V A;  2NYQ A;  1R43 A;  3PEI A;  2BO9 A;  4R76 A;  5K8O A;  3GUX A;  2HB6 A;  5F09 A;  3PRT A;  3LMS A;  1VGY A;  5HVF A;  1Z2L A;  1Z5R A;  3SJE A;  2ZOF A;  2I3C A;  4OP4 A;  3LWU A;  2QVP A;  2ZED A;  4Z65 A;  3B7I A;  4PQA A;  1YW6 A;  1HDQ A;  5K8P A;  4G1P A;  4MHP A;  3H8E A;  3FED A;  2PCU A;  4X3R A;  1GYT A;  2PJ0 A;  1Y7E A;  2J9A A;  4JYW A;  4PXC A;  3FEE A;  4NGM A;  1HEE A;  1ZG8 A;  3IEH A;  3S9M A;  4F9V A;  1VIX A;  3KHX A;  2PJ7 A;  4DUK A;  3PB7 X;  3HUV A;  4FWU A;  3WC6 A;  4K3N A;  1PYT B;  4NGQ A;  2IMO A;  3SJF A;  2V77 A;  1YSJ A;  3HLP A;  4MCQ A;  3VAR A;  3BI1 A;  5K8N A;  1LOK A;  2CTB A;  3KGQ A;  3CPA A;  2ZEG A;  4ONW A;  1IGB A;  3PBB A;  2Q51 A;  3D4U A;  2AFU A;  3SJG A;  2PE3 A;  2AFZ A;  2EK9 A;  4A39 A;  2PIZ A;  4P10 A;  2IQ6 A;  1LAM A;  3FVL A;  2GU2 A;  1NSA A;  1Y0R A;  2C6P A;  1ZG9 A;  4MCS A;  3FMC A;  3NA6 A;  4YU9 A;  1LAP A;  4MHY A;  5JM6 A;  3WT4 A;  4NGS A;  5LRK A;  4MRI A;  1VHE A;  8CPA A;  2C6G A;  2PJ4 A;  4TWE A;  2ZEF A;  3NFZ A;  4AXV A;  4IK2 A;  3MRU A;  3ISX A;  3IO1 A;  7CPA A;  1YW4 A;  4NGT A;  4P4E A;  3TX8 A;  1CPX A;  2PJ1 A;  3D67 A;  3D7D A;  3PFE A;  3VH9 A;  3FJU A;  3JRU A;  5IB9 A;  4A94 A;  3KR5 A;  1TXR A;  1FT7 A;  1ELL P;  2BOA A;  4KSI A;  2AFM A;  2CF4 A;  4UEZ A;  4UEF A;  3PB4 X;  4IAV A;  3KQZ A;  2ZEL A;  2PJ2 A;  5I4M A;  3H8G A;  2XEG A;  2ZEH A;  1TKH A;  4MMO A;  1XJO A;  3K2K A;  1F57 A;  5ELY A;  4NGN A;  2EK8 A;  2JEW A;  2CTC A;  1DE4 C;  3NH8 A;  4DJL A;  2XEI A;  2RB7 A;  3B2Y A;  3B3W A;  4O23 A;  3NH4 A;  3IIB A;  3I1U A;  2PJB A;  3SI2 A;  3RBU A;  3S9L A;  2PIY A;  2XEJ A;  3D7H A;  1ELM P;  4OKO A;  4A37 A;  2ZEM A;  5CPA A;  3GB0 A;  2ZOG A;  3H8F A;  4OC4 A;  2JBJ A;  5THW A;  3PFO A;  5LYI A;  4WWV A;  1TKF A;  3FF3 A;  2F8H A;  1DTD A;  1LAN A;  4ZY1 A;  2Q43 A;  1LFW A;  2HC9 A;  4GM5 A;  2RFH A;  4OC2 A;  3V38 A;  4PPZ A;  4H2K A;  2PJC A;  4ZX9 A;  4RUH A;  4EWT A;  1XMB A;  1BPN A;  2V8G A;  1IY7 A;  4X2T A;  1ARL A;  3TC8 A;  3PB9 X;  1Q7L A;  3WC5 A;  4MCP A;  5LYL A;  4FAI A;  4JZ0 A;  5LYD A;  3RZA A;  4Q7A A;  4NJR A;  5D8N A;  4P4B A;  3DGV A;  2VL1 A;  3KR4 A;  2GLF A;  3CDX A;  3MN8 A;  2PJ6 A;  2PJ3 A;  1H8L A;  3QNV A;  2QYV A;  3KAS A;  1PCA A;  3B3S A;  4FUU A;  1BAV A;  2WYR A;  2BCO A;  4P45 A;  4IHM A;  3B3T A;  1YLO A;  6CPA A;  3L2N A;  4UF4 A;  4ZI6 A;  4ZY0 A;  2PJ9 A;  2OR4 A;  2WZN A;  3D7G A;  2NSM A;  3ISZ A;  3FX6 A;  3RAM A;  2PJ5 A;  2C6C A;  4OC5 A;  2FVG A;  5DS0 A;  3SJX A;  2ZEO A;  2V8H A;  4A38 A;  2IJZ A;  2AFO A;  5HXD A;  4P4F A;  1CBX A;  2V8D A;  5J1Q A;  4R6T A;  4MHN A;  1M4L A;  3BHX A;  5D29 A;  1F2O A;  1JQG A;  2ZEN A;  2PJ8 A;  5LRG A;  3KQX A;  2PRQ A;  4NFR A;  3FEC A;  2GLJ A;  4LQG A;  4ZYQ A;  1Y0Y A;  1RTQ A;  3PB6 X;  1CP7 A;  1QMU A;  4W9Y A;  4OC3 A;  1EE3 P;  5LYF A;  3KI9 A;  3K9T A;  4CPA A;  2G9D A;  1Z8L A;  1CP6 A;  2DEA A;  1ZLH A;  3PBE A;  3BXM A;  1CG2 A;  4OIW A;  4OC0 A;  2ZEE A;  3D66 A;  1LCP A;  4DYO A;  2O53 A;  3S9N A;  3B35 A;  5JH9 A;  1ZG7 A;  4FBE A;  1XBU A;  2GRE A;  1BLL E;  4UIA A;  4EME A;  5HVH A;  4YWY A;  1CPS A;  4WJB A;  3IFE A;  2POK A;  2PJA A;  4MXU A;  3VAT A;  5HVG A;  4R7M A;  3SI1 A;  1XRY A;  5CBM A;  4B6Z A;  2PVW A;  3WAB A;  4PXE A;  4UEE A;  4NJQ A;  1CX8 A;  1TKJ A;  4ZY2 A;  4TNU A;  4OID A;  2OOT A;  1HDU A;  5JGF A;  2XEF A;  5LRJ A;  4MHZ A;  3IWW A;  4P4I A;  1KWM A;  3CT9 A;  3NH5 A;  1YME A;  3DLJ A;  2ANP A;  4R8F A;  4BD9 A;  3IC1 A;  3FH4 A;  2F7V A;  2AFX A;  2C1C A;  3SI0 A;  3B3V A;  4NGP A;  1UWY A;  2ABZ A;  3D7F A;  3KZW A;  3KL9 A;  3KHZ A;  4EFD A;  3IJ3 A;  4F9U A;  4OC1 A;  2AFW A;  3B3C A;  4ZX8 A;  1ZLI A;  3CPX A;  1VHO A;  4PXB A;  3V7Z A;  1ARM A;  1BPM A;  1XFO A;  4NGR A;  2CIJ A;  3PB8 X;  4OME A;  1AYE A;  4P4J A;  1FNO A;  4P44 A;  3D68 A;  4P6Y A;  1TF8 A;  2JBK A;  2PVV A;  3T8W A;  1TF9 A;  2QJ8 A;  2O4H A;  4MCR A;  3N5F A;  3BI0 A;  1OBR A;  4PXD A;  1F2P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...