4H2KA

Crystal structure of the catalytic domain of succinyl-diaminopimelate desuccinylase from haemophilus influenzae
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
266
structure length
258
Chain Sequence
NAMKEKVVSLAQDLIRRPSISPNDEGCQQIIAERLEKLGFQIEWMPFNDTLNLWAKHGTSEPVIAFAGHTDVVPTGDENQWSSPPFSAEIIDGMLYGRGAADMKGSLAAMIVAAEEYVKANPNHKGTIALLITSDEEATAKDGTIHVVETLMARDEKITYCMVGEPSSAKNLGDVVKNGRRGGGKLLDSITSAIEETIGITPKAETGTSDGRFIALMGAEVVEFGPLNSTIHKVNECVSVEDLGKCGEIYHKMLVNLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The dimerization domain in DapE enzymes is required for catalysis.
pubmed doi rcsb
source organism Haemophilus influenzae
molecule tags Hydrolase
molecule keywords Succinyl-diaminopimelate desuccinylase
total genus 92
structure length 258
sequence length 266
chains with identical sequence B
ec nomenclature ec 3.5.1.18: Succinyl-diaminopimelate desuccinylase.
pdb deposition date 2012-09-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01546 Peptidase_M20 Peptidase family M20/M25/M40
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 4h2kA00
3PFOA 2QVPA 2ZEOA 3CPXA 3D7GA 5THWA 5LRGA 4NJQA 3GB0A 1YLOA 3IC1A 4MHNA 4OMEA 1YW4A 4EMEA 4P4EA 4X2TA 1H8LA 4OP4A 3T8WA 1VHOA 3JRUA 1DTDA 1LAPA 4OC3A 1ARMA 4UIBA 4X8IA 3FX6A 4ZI6A 2HC9A 3B35A 4ZYQA 2OR4A 4FAIA 4P4BA 4ZX9A 3FVLA 1DE4C 4PXCA 2QJ8A 1LANA 2C6GA 2PE3A 4P10A 4YWYA 2JBJA 4A37A 2ZENA 3SI1A 2HB6A 4ZY1A 4NGMA 4R76A 4O23A 2XEJA 3KI9A 5K8OA 2PJCA 4FUUA 4RUHA 2DEAA 2V8DA 2ZEEA 1ELLP 2PIYA 3NA6A 1LCPA 5LYIA 3ISZA 3B3VA 1TKHA 3KQZA 2PJ7A 5DS0A 3KHXA 2IJZA 4R8FA 2CTBA 2O53A 4H2KA 2V77A 4OC5A 2IQ6A 3V38A 3WC6A 6CPAA 4PQAA 2GLFA 2EK9A 5LYFA 4P4JA 3B3WA 3S9LA 3NH4A 2FVGA 3D67A 3WT4A 1CBXA 4FWUA 2Q43A 3SJEA 3PB6X 4P6YA 1VHEA 2O4HA 2C1CA 3H8GA 3VATA 4PXBA 1LOKA 2CTCA 3IFEA 4G1PA 1F2OA 2GU2A 4MXUA 2ZEFA 1TXRA 4A38A 1JQGA 1OBRA 2PJ1A 4P44A 3FECA 5HVGA 4OKOA 5CBMA 4IAVA 4K3NA 1Y0YA 4MCQA 2PJ8A 1AMPA 1LAMA 3KZWA 1XRYA 2PVWA 4P4IA 3D7DA 1Q7LA 2ZOFA 3KR4A 2NYQA 3B3TA 4MHYA 2BCOA 4MCSA 2F8HA 1TKFA 4AXVA 4OC1A 3D7FA 3IO1A 3SI0A 1YMEA 3D4UA 4ZY0A 2JBKA 5JH9A 3SJFA 1M4LA 3CPAA 3H8EA 3KR5A 2PJ2A 3BI1A 2ZEHA 3QNVA 3D68A 2AFSA 2WZNA 1QMUA 4B6ZA 3RBUA 4GM5A 2ANPA 3D7HA 1XBUA 3NH8A 4JZ0A 1CPSA 1XMBA 1ELMP 1CP6A 4MMOA 3SJGA 2PIZA 4P4FA 4PPZA 3TX8A 2PJ0A 3PBEA 1HEEA 8CPAA 5JM6A 1VGYA 3DGVA 2ZEPA 3B7IA 4PXEA 1R43A 1FT7A 2AFWA 3IWWA 3RZAA 1HDUA 1LFWA 5F09A 3SI2A 3BI0A 5K8MA 1TF9A 5IB9A 3HUVA 7CPAA 1QQ9A 5K8NA 4DUKA 1ARLA 3KHZA 2PJ5A 3S9NA 2ZOGA 1ZLIA 1CX8A 1TF8A 1RTQA 4F9UA 4OC2A 2PVVA 5HVHA 4F9VA 4P45A 4OIDA 3B3CA 1CPXA 1ZG9A 4YU9A 5I4MA 3N5FA 2XEGA 4NFRA 4DYOA 2J9AA 5HVFA 5K8PA 3NH5A 4P4DA 1Z8LA 2CF4A 3HLPA 1CG2A 2ZEDA 3K2KA 4DJLA 2JEWA 4A94A 2AFOA 3CDXA 1GYTA 2EK8A 2XEIA 1Z2LA 2V8VA 2ZEMA 5LYDA 2EWBA 5J1QA 4IHMA 5ELYA 4NGTA 3DLJA 4F8ZA 5JGFA 4TWEA 3IEHA 5D8NA 1YW6A 2ZEGA 1CP7A 3PBBA 1UWYA 4PXDA 4MHZA 4NGSA 3I1UA 1VIXA 1Y7EA 3PFEA 3LMSA 4WWVA 3RAMA 2PJBA 4IK2A 2PJ6A 4A39A 2PJ9A 2AFUA 3CT9A 1HDQA 2Q51A 1EE3P 3GLJA 2ABZA 3KL9A 2ZELA 3L2NA 3IJ3A 2IMOA 4EFDA 2PJ3A 4WJBA 2G9DA 3PB8X 4NGQA 4MRIA 1BPMA 3BXMA 2POKA 3B2YA 1KWMA 3IIBA 1Y0RA 4UF4A 2NSMA 2PJ4A 4ZX8A 1BAVA 3FEEA 1YSJA 1ZLHA 2I3CA 1F57A 3FF3A 2AFXA 1IY7A 1BPNA 4ZY2A 4UEEA 4LQGA 2WYRA 2OOTA 1Z5RA 1R3NA 3VH9A 2GREA 3TC8A 5CPAA 3ISXA 4UEFA 3LWUA 3D66A 4Z65A 4NGRA 4X3RA 3WC5A 3GUXA 1AYEA 1PCAA 2RB7A 2RFHA 5LYLA 4KSIA 2V8GA 2C6PA 4CPAA 3FEDA 5D29A 4EWTA 4FBEA 1FNOA 1XJOA 4NGPA 4UEZA 3KGQA 2PCUA 1BLLE 2C6CA 1TKJA 1ZG8A 4R7MA 3WC7A 3K9TA 2F7VA 3KQXA 1ZG7A 2XEFA 4JYWA 2GLJA 4MHPA 4MCPA 2CIJA 5HXDA 4ONWA 1IGBA 4OC4A 3PB9X 4NJRA 3FJUA 5LRKA 2BO9A 2V8HA 3FH4A 2BOAA 4UIAA 1F2PA 2QYVA 2PJAA 1NSAA 3MN8A 4R6TA 5LRJA 2VL1A 3V7ZA 4W9YA 3PB4X 4BD9A 3BHXA 3PRTA 3VARA 3PEIA 2AFMA 2AFZA 4OC0A 3NFZA 4MCRA 3PB7X 1PYTB 3MRUA 4TNUA 4OIWA 3WABA 3S9MA 4NGNA 3H8FA 3KASA 2Q4ZA 1XFOA 3FMCA 3SJXA 3B3SA 2PRQA 4Q7AA
chains in the Genus database with same CATH superfamily
3PFOA 2QVPA 2RC4A 2ZEOA 1PU9A 3CPXA 3D7GA 4PV6A 5LRGA 5THWA 4CAWA 4MHDA 2YNDA 2FS5A 3D3SA 4HPSA 4NJQA 1U6MA 2DPSA 3GB0A 1YLOA 3IC1A 4KOUA 4BBHA 4CGLA 5ISVA 4MHNA 2DPTA 4RS2A 5IX3A 4UFXA 4OMEA 1YW4A 4E8OA 4EMEA 4P4EA 2GE3A 1XEBA 3P2HA 1IU8A 4X2TA 4B13A 1H8LA 4OP4A 3RNZA 3T8WA 1A2ZA 4A95A 1VHOA 4HNWB 3JRUA 3P2FA 1DTDA 1LAPA 1TIQA 2ZW7A 1ARMA 4M3SA 4OC3A 5H86A 2ZPAA 5F47A 2EO8A 4UIBA 4X8IA 2R98A 3W91A 2JLMA 4AVAA 4QUSA 3VWEA 2YNCA 4C68A 3FX6A 4MFQA 1QSOA 3DSBA 4AB7A 3VWDA 4ZI6A 2HC9A 2REEA 3B35A 1WWZA 4GXHA 4ZYQA 2OR4A 4FAIA 1ON0A 4AG9A 4UCMA 2A4NA 4P4BA 4UCPA 4ZX9A 3SXNA 2YGWA 2Z3PA 3FVLA 3D2MA 2VQYA 1DE4C 2EUIA 4II9A 2YNCC 4C2YA 4PXCA 4QC6A 3PGPA 2QJ8A 3NE8A 1LANA 2C6GA 2PE3A 4P10A 4YWYA 2JBJA 4A37A 4CGOA 2I00A 2ZENA 4LQ6A 2HB6A 3SI1A 4NGMA 4R76A 4ZY1A 4O23A 1IYKA 2XEJA 3KI9A 5K8OA 1VHSA 4JD6A 2WPWA 3F8KA 1S3ZA 2PJCA 4FUUA 3T90A 2B5GB 4RUHA 2DEAA 1QSNA 1IOIA 3MGDA 1MJBA 2VZYA 4CAXA 2V8DA 2ZEEA 2ARHA 1ELLP 1NSLA 2PIYA 3NA6A 1LCPA 2P6GA 5LYIA 3ISZA 3B3VA 1TKHA 3KQZA 4CAVA 2PJ7A 5KTCA 2OB0A 1S7NA 4EVYA 3FNCA 1QSRA 3KHXA 1S7FA 2IJZA 4R8FA 5DS0A 2CTBA 2O53A 5A27A 3ZZIA 4H2KA 2V77A 1IIDA 1S5KA 2OU2A 1YGHA 4OC5A 2IQ6A 4IUSA 2PRBA 3V38A 2FSRA 3WC6A 4CGPA 2KCWA 3DNSA 5DWNA 6CPAA 4KOTA 3GYAA 4PQAA 2GLFA 1M1DA 2EK9A 5LYFA 4P4JA 3B3WA 3S9LA 3NH4A 4H6UA 2FVGA 4YFJA 3D67A 3FBUA 3IWEA 2QIRA 3EO4A 3WT4A 1CBXA 4FWUA 3I3GA 5CNPA 2Q43A 1M4GA 1XF8A 3PB6X 4P6YA 4YGOA 3SJEA 1VHEA 1S60A 2C1CA 2O4HA 3FYNA 3H8GA 4L8AA 3TTHA 2HQYA 2AE6A 3VATA 1Q2CA 4XNHB 2BSWA 2FE7A 4B12A 4F0YA 4PXBA 1LOKA 2WUUA 4R87A 2HUZA 1K4JA 4KSFA 4MJ8A 2CTCA 3FXTA 1CJWA 3IFEA 5F46A 4G1PA 1F2OA 1KUXA 2GU2A 4K30A 2ZEFA 3BLNA 1TXRA 2GANA 2IL4A 4KOXA 1MJ9A 4MXUA 1JQGA 1OBRA 2PJ1A 4A38A 3QAYA 4P44A 3EXNA 2Y0MA 3FECA 2ZXVA 4JLYA 4XPKA 1I12A 5HVGA 4OKOA 4I49A 4PK3A 2Z3LA 5G22A 4CYPA 5CBMA 3LODA 4IAVA 4OAEA 3LD2A 4K3NA 1Y0YA 2B4DB 2K5TA 4KOYA 4MCQA 2PJ8A 1AMPA 4C2XA 4R3KA 3R95A 4FD5A 5J8CA 3TCVA 2NMTA 1LAMA 3KZWA 1XRYA 3TT2A 4YRHA 4KOWA 4LX9A 2PVWA 4P4IA 3D7DA 4ZGYB 1Q7LA 2ZOFA 5BWAB 3KR4A 1Y9WA 2BUEA 2NYQA 3B3TA 4A30A 2Z3NA 3FRMA 4MHYA 1V0CA 2BCOA 4MCSA 2G0BA 2F8HA 1TKFA 2PQ8A 4NXYA 4AXVA 2PSWA 4OC1A 5FVJA 3D7FA 3IO1A 3SI0A 1YMEA 3D4UA 4UFVA 4C7IA 4E2AA 4ZY0A 2ZW5A 3GKRA 1Q2DA 4MBUA 2JBKA 3EFAA 2VI7A 4AVBA 5JH9A 1KUVA 3SJFA 3CZXA 4PK2A 4B14A 1M4LA 3CPAA 1YVKA 3PZJA 4F6AA 3BJ8A 4GS4A 3H8EA 3KR5A 4RI1A 2AJ6A 1GHEA 2B3VA 2H5MA 2PJ2A 1M4IA 4ONUA 5HMNA 3BI1A 5IB0A 3G8WA 1YLEA 2GFQA 2ZEHA 4KVME 2BL1A 2JDCA 3QNVA 3IGRA 2VZZA 3D68A 2AFSA 2WZNA 3KKWA 1QMUA 4B6ZA 2EBJA 1B6BA 2VEZA 3JUWA 4GM5A 2ANPA 3D7HA 4R3LA 4UCNA 3RBUA 4C2ZA 1XBUA 3NH8A 1IB1E 4JZ0A 1CPSA 1XMBA 1P4NA 1ELMP 1CP6A 4FD6A 4MMOA 3IWGA 4JWPA 1UFHA 4HNXB 3SJGA 2PIZA 4P4FA 4PPZA 3TX8A 2PJ0A 1X12A 3PBEA 1Z8TA 2CY2A 3G3SA 1HEEA 8CPAA 3C26A 4C7HA 5JM6A 1VGYA 3DGVA 2FXFA 4A33A 2ZEPA 4MFPA 4CYOA 1B87A 5HH1A 4ZBGA 3B7IA 4PXEA 4F0XA 2Z0ZA 4OLLA 2PC1A 1R43A 1FT7A 2AFWA 3IWWA 3RZAA 3TFYA 2O28A 4NF1A 1HDUA 1LFWA 1P0HA 3OWCA 3SI2A 3IU1A 5F09A 3BI0A 3H5ZA 5K8MA 2P0WA 2OZGA 1YREA 2Z3OA 3IU2A 1TF9A 4A2ZA 4A31A 4B11A 3HUVA 3RO0A 5IB9A 7CPAA 4KLVA 2JEVA 3JVNA 4NCZA 2B4DA 2B58A 1QQ9A 4M85A 2CNSA 4MY0A 4UA3A 1ARLA 2P6FA 4DUKA 5K8NA 3TOBA 3S6FA 2D4PA 2PJ5A 3D8PA 3KHZA 4XPDC 3S9NA 2ZOGA 4NSQA 1ZLIA 1CX8A 1TF8A 4AVCA 4JXQA 1AUGA 1RTQA 5G21A 4F9UA 4FD7A 1I1DA 4E0AA 1ZO0A 4OC2A 2PVVA 5HVHA 1M44A 2B5GA 2YNEA 4F9VA 4P45A 3GY9A 4OIDA 3B3CA 1BO4A 3TOAA 4CS0B 1CPXA 1ZG9A 4YU9A 2Q7BA 5I4MA 1PUAA 2R8VA 3N5FA 4J3GA 3W6XA 2XEGA 4NFRA 4DYOA 2J9AA 3TO9A 5HVFA 1FY7A 5K8PA 3NH5A 4P4DA 3DR6A 1Z8LA 4XPDB 5A28A 1OZPA 2Q7SA 3S6HA 2J8NA 2CF4A 3HLPA 4HKFA 5G20A 1CG2A 2ZEDA 3K2KA 3RYOA 4DJLA 2JEWA 1MK4A 4A94A 2AFOA 4R9MA 3CDXA 1Z8WA 3SXOA 1GYTA 2EK8A 2WPXA 4B5PA 2XEIA 1Z2LA 2CNMA 2V8VA 2ZEMA 5LYDA 2EWBA 4XNHC 1XE4A 3K9UA 4OADA 4CRYB 1N71A 1Y7RA 1Z4RA 5J1QA 2I79A 4IHMA 3T9YA 2F5IA 5ELYA 1YR0A 4PSXA 1SQHA 4NGTA 2PR1A 2X7BA 1X10A 3DLJA 5H84A 2Q44A 4CGNA 4A32A 4F8ZA 5JGFA 4TWEA 1RXTA 3IEHA 4U9ZA 2OZUA 3CXQA 2P6EA 5D8NA 1YW6A 1NMTA 2ZEGA 1CP7A 3PBBA 4KVOE 5EMIA 4CYQA 1UWYA 2Q4VA 2REFA 4PXDA 1VKCA 4MHZA 4NGSA 3I1UA 3R9FA 3DR8A 1VIXA 2DXQA 2ATRA 1Y7EA 1CM0A 1KZFA 3GIUA 1BOBA 3LMSA 3PFEA 4WWVA 3R96A 3RAMA 5KTDA 2PJBA 4IK2A 2PJ6A 4A39A 4ORFA 2R7HA 4Q36A 2PJ9A 2AFUA 4U9YA 3CT9A 1HDQA 4DNCA 2Q51A 4KOVA 1EE3P 5JQ4A 3WR7A 3GLJA 2ABZA 3NE7A 1Z9UA 3KL9A 4CYNA 2FIWA 4MFZA 1YK3A 2ZELA 1YVOA 4MY3A 2G3AA 2B4BA 3L2NA 1QSMA 3IJ3A 2IMOA 5AG5A 4QVTA 2PJ3A 4EFDA 5AG4A 1IICA 2G9DA 4WJBA 3PB8X 4HNYB 1JWQA 1IOFA 4NGQA 4MRIA 1BPMA 3BXMA 4XPLA 2POKA 2Q0YA 4KLWA 2Z10A 2OZHA 5I0CA 4B5PB 3FIXA 2FCKA 5E96A 2HV2A 3B2YA 1KWMA 1Q2YA 4PSWA 1M4DA 1R57A 4KVXA 3A9LA 4KOSA 3IIBA 1Y0RA 1QSTA 2FL4A 4KORA 2NSMA 2PJ4A 4UF4A 4RN7A 3F0AA 3QB8A 4KSAA 4UWJA 4ZX8A 1BAVA 4UFWA 2QMLA 3FB3A 3FEEA 1YSJA 1ZLHA 4LUAA 2I3CA 4QB9A 3QAHA 1F57A 2B3UA 2R1IA 3FF3A 2AFXA 1IY7A 1BPNA 3CXSA 4ZY2A 3B8GA 4UEEA 2QECA 4LQGA 2WYRA 2J8RA 2GIVA 4JXRA 5F49A 2DF5A 2OOTA 3R9EA 5GCNA 3D2PA 3LACA 5C82A 4UBRA 4KUBA 1Z5RA 1R3NA 1Z8XA 2EVNA 3JTKA 4H89A 3VH9A 2GREA 3TC8A 4B10A 5KTAA 5CPAA 3ISXA 1J4JA 1WK4A 4UEFA 3LWUA 3D66A 3ZJ0A 4Z65A 4NGRA 4CAEA 5F48A 4KUAA 4X5KA 4X3RA 3WC5A 2WSAA 3GUXA 1IYLA 2ZW6A 5IV0A 1AYEA 1MJAA 1PCAA 2FIAA 2RB7A 5DWMA 2RFHA 5LYLA 4KS9A 4KSIA 2V8GA 1XMTA 2PDOA 5G1ZA 4CAFA 1RO5A 2C6PA 2G3TA 4CPAA 3FEDA 5D29A 4EWTA 3V8IA 4FBEA 1FNOA 4MFLA 3DDDA 3EY5A 3S6GA 5C88A 3I9SA 4Q38A 4M6HA 3SHPA 4JJXA 1XJOA 4NGPA 4UEZA 3KGQA 2PCUA 1BLLE 2C6CA 4U5YA 3R9GA 1TKJA 1ZG8A 4R7MA 3WC7A 2BEIA 1KUYA 3K9TA 3TE4A 3CXPA 2F7VA 4MFKA 3KQXA 1S7LA 1ZG7A 2Q4YA 2XEFA 2FT0A 2C27A 3UY5A 1LRZA 2Z3KA 4CGMA 4JYWA 3E0KA 2GLJA 4MHPA 2Z11A 4MCPA 2CIJA 5HXDA 1S7KA 2ZW4A 4ONWA 1IGBA 3S6KA 4OC4A 4CRZB 1Y9KA 3N7ZA 3PB9X 3BJ7A 5JPHA 1XOVA 2PR8A 4NJRA 3FJUA 3F5BA 5LRKA 4H6ZA 2Z3MA 2BO9A 5J8FA 2V8HA 1YQEA 5AG7A 3FH4A 1Z4EA 2BOAA 4UIAA 3TO6A 1F2PA 1YX0A 2CXAA 2QYVA 4UWIA 4Y49C 2PJAA 4MI4A 1NSAA 2ODFA 3MN8A 4R57A 4NEXA 4BMHA 4R6TA 5AGEA 5LRJA 5AG6A 2VL1A 5EC4A 4B5OA 3V7ZA 4M6GA 4W9YA 3EC4A 3PB4X 4M6IA 3BHXA 3PRTA 4BD9A 3VARA 2J8MA 3PEIA 2AFMA 3PP9A 3R1KA 4QBJA 2CNTA 2AFZA 2VXKA 4OC0A 2JDDA 3NFZA 4FD4A 4Y49B 4MCRA 2D4OA 1PYTB 3H4QA 3MRUA 2OH1A 3PB7X 4TNUA 3W6SA 4OIWA 1L0CA 3WABA 4IF5A 3S9MA 3TO7A 4NGNA 1XIXA 3H8FA 4AG7A 3KASA 1I21A 2Q4ZA 1XFOA 3FMCA 2Q04A 4L89A 1NE9A 3SJXA 4BINA 3B3SA 4KZTA 2PRQA 4MFJA 5EBVA 2VBQA 4Q7AA
chains in the Genus database with same CATH topology
3PFOA 2QVPA 2ZEOA 3CPXA 3D7GA 5THWA 5LRGA 4NJQA 3GB0A 1YLOA 3IC1A 4MHNA 4OMEA 1YW4A 4EMEA 4P4EA 4X2TA 1H8LA 4OP4A 3T8WA 1VHOA 3JRUA 1DTDA 1LAPA 4OC3A 1ARMA 4UIBA 4X8IA 3FX6A 4ZI6A 2HC9A 3B35A 4ZYQA 2OR4A 4FAIA 4P4BA 4ZX9A 3FVLA 1DE4C 4PXCA 2QJ8A 1LANA 2C6GA 2PE3A 4P10A 4YWYA 2JBJA 4A37A 2ZENA 3SI1A 2HB6A 4ZY1A 4NGMA 4R76A 4O23A 2XEJA 3KI9A 5K8OA 2PJCA 4FUUA 4RUHA 2DEAA 2V8DA 2ZEEA 1ELLP 2PIYA 3NA6A 1LCPA 5LYIA 3ISZA 3B3VA 1TKHA 3KQZA 2PJ7A 5DS0A 3KHXA 2IJZA 4R8FA 2CTBA 2O53A 4H2KA 2V77A 4OC5A 2IQ6A 3V38A 3WC6A 6CPAA 4PQAA 2GLFA 2EK9A 5LYFA 4P4JA 3B3WA 3S9LA 3NH4A 2FVGA 3D67A 3WT4A 1CBXA 4FWUA 2Q43A 3SJEA 3PB6X 4P6YA 1VHEA 2O4HA 2C1CA 3H8GA 3VATA 4PXBA 1LOKA 2CTCA 3IFEA 4G1PA 1F2OA 2GU2A 4MXUA 2ZEFA 1TXRA 4A38A 1JQGA 1OBRA 2PJ1A 4P44A 3FECA 5HVGA 4OKOA 5CBMA 4IAVA 4K3NA 1Y0YA 4MCQA 2PJ8A 1AMPA 1LAMA 3KZWA 1XRYA 2PVWA 4P4IA 3D7DA 1Q7LA 2ZOFA 3KR4A 2NYQA 3B3TA 4MHYA 2BCOA 4MCSA 2F8HA 1TKFA 4AXVA 4OC1A 3D7FA 3IO1A 3SI0A 1YMEA 3D4UA 4ZY0A 2JBKA 5JH9A 3SJFA 1M4LA 3CPAA 3H8EA 3KR5A 2PJ2A 3BI1A 2ZEHA 3QNVA 3D68A 2AFSA 2WZNA 1QMUA 4B6ZA 3RBUA 4GM5A 2ANPA 3D7HA 1XBUA 3NH8A 4JZ0A 1CPSA 1XMBA 1ELMP 1CP6A 4MMOA 3SJGA 2PIZA 4P4FA 4PPZA 3TX8A 2PJ0A 3PBEA 1HEEA 8CPAA 5JM6A 1VGYA 3DGVA 2ZEPA 3B7IA 4PXEA 1R43A 1FT7A 2AFWA 3IWWA 3RZAA 1HDUA 1LFWA 5F09A 3SI2A 3BI0A 5K8MA 1TF9A 5IB9A 3HUVA 7CPAA 1QQ9A 5K8NA 4DUKA 1ARLA 3KHZA 2PJ5A 3S9NA 2ZOGA 1ZLIA 1CX8A 1TF8A 1RTQA 4F9UA 4OC2A 2PVVA 5HVHA 4F9VA 4P45A 4OIDA 3B3CA 1CPXA 1ZG9A 4YU9A 5I4MA 3N5FA 2XEGA 4NFRA 4DYOA 2J9AA 5HVFA 5K8PA 3NH5A 4P4DA 1Z8LA 2CF4A 3HLPA 1CG2A 2ZEDA 3K2KA 4DJLA 2JEWA 4A94A 2AFOA 3CDXA 1GYTA 2EK8A 2XEIA 1Z2LA 2V8VA 2ZEMA 5LYDA 2EWBA 5J1QA 4IHMA 5ELYA 4NGTA 3DLJA 4F8ZA 5JGFA 4TWEA 3IEHA 5D8NA 1YW6A 2ZEGA 1CP7A 3PBBA 1UWYA 4PXDA 4MHZA 4NGSA 3I1UA 1VIXA 1Y7EA 3PFEA 3LMSA 4WWVA 3RAMA 2PJBA 4IK2A 2PJ6A 4A39A 2PJ9A 2AFUA 3CT9A 1HDQA 2Q51A 1EE3P 3GLJA 2ABZA 3KL9A 2ZELA 3L2NA 3IJ3A 2IMOA 4EFDA 2PJ3A 4WJBA 2G9DA 3PB8X 4NGQA 4MRIA 1BPMA 3BXMA 2POKA 3B2YA 1KWMA 3IIBA 1Y0RA 4UF4A 2NSMA 2PJ4A 4ZX8A 1BAVA 3FEEA 1YSJA 1ZLHA 2I3CA 1F57A 3FF3A 2AFXA 1IY7A 1BPNA 4ZY2A 4UEEA 4LQGA 2WYRA 2OOTA 1Z5RA 1R3NA 3VH9A 2GREA 3TC8A 5CPAA 3ISXA 4UEFA 3LWUA 3D66A 4Z65A 4NGRA 4X3RA 3WC5A 3GUXA 1AYEA 1PCAA 2RB7A 2RFHA 5LYLA 4KSIA 2V8GA 2C6PA 4CPAA 3FEDA 5D29A 4EWTA 4FBEA 1FNOA 1XJOA 4NGPA 4UEZA 3KGQA 2PCUA 1BLLE 2C6CA 1TKJA 1ZG8A 4R7MA 3WC7A 3K9TA 2F7VA 3KQXA 1ZG7A 2XEFA 4JYWA 2GLJA 4MHPA 4MCPA 2CIJA 5HXDA 4ONWA 1IGBA 4OC4A 3PB9X 4NJRA 3FJUA 5LRKA 2BO9A 2V8HA 3FH4A 2BOAA 4UIAA 1F2PA 2QYVA 2PJAA 1NSAA 3MN8A 4R6TA 5LRJA 2VL1A 3V7ZA 4W9YA 3PB4X 4BD9A 3BHXA 3PRTA 3VARA 3PEIA 2AFMA 2AFZA 4OC0A 3NFZA 4MCRA 3PB7X 1PYTB 3MRUA 4TNUA 4OIWA 3WABA 3S9MA 4NGNA 3H8FA 3KASA 2Q4ZA 1XFOA 3FMCA 3SJXA 3B3SA 2PRQA 4Q7AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PFO A;  2QVP A;  2ZEO A;  3CPX A;  3D7G A;  5THW A;  5LRG A;  4NJQ A;  3GB0 A;  1YLO A;  3IC1 A;  4MHN A;  4OME A;  1YW4 A;  4EME A;  4P4E A;  4X2T A;  1H8L A;  4OP4 A;  3T8W A;  1VHO A;  3JRU A;  1DTD A;  1LAP A;  4OC3 A;  1ARM A;  4UIB A;  4X8I A;  3FX6 A;  4ZI6 A;  2HC9 A;  3B35 A;  4ZYQ A;  2OR4 A;  4FAI A;  4P4B A;  4ZX9 A;  3FVL A;  1DE4 C;  4PXC A;  2QJ8 A;  1LAN A;  2C6G A;  2PE3 A;  4P10 A;  4YWY A;  2JBJ A;  4A37 A;  2ZEN A;  3SI1 A;  2HB6 A;  4ZY1 A;  4NGM A;  4R76 A;  4O23 A;  2XEJ A;  3KI9 A;  5K8O A;  2PJC A;  4FUU A;  4RUH A;  2DEA A;  2V8D A;  2ZEE A;  1ELL P;  2PIY A;  3NA6 A;  1LCP A;  5LYI A;  3ISZ A;  3B3V A;  1TKH A;  3KQZ A;  2PJ7 A;  5DS0 A;  3KHX A;  2IJZ A;  4R8F A;  2CTB A;  2O53 A;  4H2K A;  2V77 A;  4OC5 A;  2IQ6 A;  3V38 A;  3WC6 A;  6CPA A;  4PQA A;  2GLF A;  2EK9 A;  5LYF A;  4P4J A;  3B3W A;  3S9L A;  3NH4 A;  2FVG A;  3D67 A;  3WT4 A;  1CBX A;  4FWU A;  2Q43 A;  3SJE A;  3PB6 X;  4P6Y A;  1VHE A;  2O4H A;  2C1C A;  3H8G A;  3VAT A;  4PXB A;  1LOK A;  2CTC A;  3IFE A;  4G1P A;  1F2O A;  2GU2 A;  4MXU A;  2ZEF A;  1TXR A;  4A38 A;  1JQG A;  1OBR A;  2PJ1 A;  4P44 A;  3FEC A;  5HVG A;  4OKO A;  5CBM A;  4IAV A;  4K3N A;  1Y0Y A;  4MCQ A;  2PJ8 A;  1AMP A;  1LAM A;  3KZW A;  1XRY A;  2PVW A;  4P4I A;  3D7D A;  1Q7L A;  2ZOF A;  3KR4 A;  2NYQ A;  3B3T A;  4MHY A;  2BCO A;  4MCS A;  2F8H A;  1TKF A;  4AXV A;  4OC1 A;  3D7F A;  3IO1 A;  3SI0 A;  1YME A;  3D4U A;  4ZY0 A;  2JBK A;  5JH9 A;  3SJF A;  1M4L A;  3CPA A;  3H8E A;  3KR5 A;  2PJ2 A;  3BI1 A;  2ZEH A;  3QNV A;  3D68 A;  2AFS A;  2WZN A;  1QMU A;  4B6Z A;  3RBU A;  4GM5 A;  2ANP A;  3D7H A;  1XBU A;  3NH8 A;  4JZ0 A;  1CPS A;  1XMB A;  1ELM P;  1CP6 A;  4MMO A;  3SJG A;  2PIZ A;  4P4F A;  4PPZ A;  3TX8 A;  2PJ0 A;  3PBE A;  1HEE A;  8CPA A;  5JM6 A;  1VGY A;  3DGV A;  2ZEP A;  3B7I A;  4PXE A;  1R43 A;  1FT7 A;  2AFW A;  3IWW A;  3RZA A;  1HDU A;  1LFW A;  5F09 A;  3SI2 A;  3BI0 A;  5K8M A;  1TF9 A;  5IB9 A;  3HUV A;  7CPA A;  1QQ9 A;  5K8N A;  4DUK A;  1ARL A;  3KHZ A;  2PJ5 A;  3S9N A;  2ZOG A;  1ZLI A;  1CX8 A;  1TF8 A;  1RTQ A;  4F9U A;  4OC2 A;  2PVV A;  5HVH A;  4F9V A;  4P45 A;  4OID A;  3B3C A;  1CPX A;  1ZG9 A;  4YU9 A;  5I4M A;  3N5F A;  2XEG A;  4NFR A;  4DYO A;  2J9A A;  5HVF A;  5K8P A;  3NH5 A;  4P4D A;  1Z8L A;  2CF4 A;  3HLP A;  1CG2 A;  2ZED A;  3K2K A;  4DJL A;  2JEW A;  4A94 A;  2AFO A;  3CDX A;  1GYT A;  2EK8 A;  2XEI A;  1Z2L A;  2V8V A;  2ZEM A;  5LYD A;  2EWB A;  5J1Q A;  4IHM A;  5ELY A;  4NGT A;  3DLJ A;  4F8Z A;  5JGF A;  4TWE A;  3IEH A;  5D8N A;  1YW6 A;  2ZEG A;  1CP7 A;  3PBB A;  1UWY A;  4PXD A;  4MHZ A;  4NGS A;  3I1U A;  1VIX A;  1Y7E A;  3PFE A;  3LMS A;  4WWV A;  3RAM A;  2PJB A;  4IK2 A;  2PJ6 A;  4A39 A;  2PJ9 A;  2AFU A;  3CT9 A;  1HDQ A;  2Q51 A;  1EE3 P;  3GLJ A;  2ABZ A;  3KL9 A;  2ZEL A;  3L2N A;  3IJ3 A;  2IMO A;  4EFD A;  2PJ3 A;  4WJB A;  2G9D A;  3PB8 X;  4NGQ A;  4MRI A;  1BPM A;  3BXM A;  2POK A;  3B2Y A;  1KWM A;  3IIB A;  1Y0R A;  4UF4 A;  2NSM A;  2PJ4 A;  4ZX8 A;  1BAV A;  3FEE A;  1YSJ A;  1ZLH A;  2I3C A;  1F57 A;  3FF3 A;  2AFX A;  1IY7 A;  1BPN A;  4ZY2 A;  4UEE A;  4LQG A;  2WYR A;  2OOT A;  1Z5R A;  1R3N A;  3VH9 A;  2GRE A;  3TC8 A;  5CPA A;  3ISX A;  4UEF A;  3LWU A;  3D66 A;  4Z65 A;  4NGR A;  4X3R A;  3WC5 A;  3GUX A;  1AYE A;  1PCA A;  2RB7 A;  2RFH A;  5LYL A;  4KSI A;  2V8G A;  2C6P A;  4CPA A;  3FED A;  5D29 A;  4EWT A;  4FBE A;  1FNO A;  1XJO A;  4NGP A;  4UEZ A;  3KGQ A;  2PCU A;  1BLL E;  2C6C A;  1TKJ A;  1ZG8 A;  4R7M A;  3WC7 A;  3K9T A;  2F7V A;  3KQX A;  1ZG7 A;  2XEF A;  4JYW A;  2GLJ A;  4MHP A;  4MCP A;  2CIJ A;  5HXD A;  4ONW A;  1IGB A;  4OC4 A;  3PB9 X;  4NJR A;  3FJU A;  5LRK A;  2BO9 A;  2V8H A;  3FH4 A;  2BOA A;  4UIA A;  1F2P A;  2QYV A;  2PJA A;  1NSA A;  3MN8 A;  4R6T A;  5LRJ A;  2VL1 A;  3V7Z A;  4W9Y A;  3PB4 X;  4BD9 A;  3BHX A;  3PRT A;  3VAR A;  3PEI A;  2AFM A;  2AFZ A;  4OC0 A;  3NFZ A;  4MCR A;  3PB7 X;  1PYT B;  3MRU A;  4TNU A;  4OIW A;  3WAB A;  3S9M A;  4NGN A;  3H8F A;  3KAS A;  2Q4Z A;  1XFO A;  3FMC A;  3SJX A;  3B3S A;  2PRQ A;  4Q7A A; 
#chains in the Genus database with same CATH topology
 3PFO A;  2QVP A;  2RC4 A;  2ZEO A;  1PU9 A;  3CPX A;  3D7G A;  4PV6 A;  5LRG A;  5THW A;  4CAW A;  4MHD A;  2YND A;  2FS5 A;  3D3S A;  4HPS A;  4NJQ A;  1U6M A;  2DPS A;  3GB0 A;  1YLO A;  3IC1 A;  4KOU A;  4BBH A;  4CGL A;  5ISV A;  4MHN A;  2DPT A;  4RS2 A;  5IX3 A;  4UFX A;  4OME A;  1YW4 A;  4E8O A;  4EME A;  4P4E A;  2GE3 A;  1XEB A;  3P2H A;  1IU8 A;  4X2T A;  4B13 A;  1H8L A;  4OP4 A;  3RNZ A;  3T8W A;  1A2Z A;  4A95 A;  1VHO A;  4HNW B;  3JRU A;  3P2F A;  1DTD A;  1LAP A;  1TIQ A;  2ZW7 A;  1ARM A;  4M3S A;  4OC3 A;  5H86 A;  2ZPA A;  5F47 A;  2EO8 A;  4UIB A;  4X8I A;  2R98 A;  3W91 A;  2JLM A;  4AVA A;  4QUS A;  3VWE A;  2YNC A;  4C68 A;  3FX6 A;  4MFQ A;  1QSO A;  3DSB A;  4AB7 A;  3VWD A;  4ZI6 A;  2HC9 A;  2REE A;  3B35 A;  1WWZ A;  4GXH A;  4ZYQ A;  2OR4 A;  4FAI A;  1ON0 A;  4AG9 A;  4UCM A;  2A4N A;  4P4B A;  4UCP A;  4ZX9 A;  3SXN A;  2YGW A;  2Z3P A;  3FVL A;  3D2M A;  2VQY A;  1DE4 C;  2EUI A;  4II9 A;  2YNC C;  4C2Y A;  4PXC A;  4QC6 A;  3PGP A;  2QJ8 A;  3NE8 A;  1LAN A;  2C6G A;  2PE3 A;  4P10 A;  4YWY A;  2JBJ A;  4A37 A;  4CGO A;  2I00 A;  2ZEN A;  4LQ6 A;  2HB6 A;  3SI1 A;  4NGM A;  4R76 A;  4ZY1 A;  4O23 A;  1IYK A;  2XEJ A;  3KI9 A;  5K8O A;  1VHS A;  4JD6 A;  2WPW A;  3F8K A;  1S3Z A;  2PJC A;  4FUU A;  3T90 A;  2B5G B;  4RUH A;  2DEA A;  1QSN A;  1IOI A;  3MGD A;  1MJB A;  2VZY A;  4CAX A;  2V8D A;  2ZEE A;  2ARH A;  1ELL P;  1NSL A;  2PIY A;  3NA6 A;  1LCP A;  2P6G A;  5LYI A;  3ISZ A;  3B3V A;  1TKH A;  3KQZ A;  4CAV A;  2PJ7 A;  5KTC A;  2OB0 A;  1S7N A;  4EVY A;  3FNC A;  1QSR A;  3KHX A;  1S7F A;  2IJZ A;  4R8F A;  5DS0 A;  2CTB A;  2O53 A;  5A27 A;  3ZZI A;  4H2K A;  2V77 A;  1IID A;  1S5K A;  2OU2 A;  1YGH A;  4OC5 A;  2IQ6 A;  4IUS A;  2PRB A;  3V38 A;  2FSR A;  3WC6 A;  4CGP A;  2KCW A;  3DNS A;  5DWN A;  6CPA A;  4KOT A;  3GYA A;  4PQA A;  2GLF A;  1M1D A;  2EK9 A;  5LYF A;  4P4J A;  3B3W A;  3S9L A;  3NH4 A;  4H6U A;  2FVG A;  4YFJ A;  3D67 A;  3FBU A;  3IWE A;  2QIR A;  3EO4 A;  3WT4 A;  1CBX A;  4FWU A;  3I3G A;  5CNP A;  2Q43 A;  1M4G A;  1XF8 A;  3PB6 X;  4P6Y A;  4YGO A;  3SJE A;  1VHE A;  1S60 A;  2C1C A;  2O4H A;  3FYN A;  3H8G A;  4L8A A;  3TTH A;  2HQY A;  2AE6 A;  3VAT A;  1Q2C A;  4XNH B;  2BSW A;  2FE7 A;  4B12 A;  4F0Y A;  4PXB A;  1LOK A;  2WUU A;  4R87 A;  2HUZ A;  1K4J A;  4KSF A;  4MJ8 A;  2CTC A;  3FXT A;  1CJW A;  3IFE A;  5F46 A;  4G1P A;  1F2O A;  1KUX A;  2GU2 A;  4K30 A;  2ZEF A;  3BLN A;  1TXR A;  2GAN A;  2IL4 A;  4KOX A;  1MJ9 A;  4MXU A;  1JQG A;  1OBR A;  2PJ1 A;  4A38 A;  3QAY A;  4P44 A;  3EXN A;  2Y0M A;  3FEC A;  2ZXV A;  4JLY A;  4XPK A;  1I12 A;  5HVG A;  4OKO A;  4I49 A;  4PK3 A;  2Z3L A;  5G22 A;  4CYP A;  5CBM A;  3LOD A;  4IAV A;  4OAE A;  3LD2 A;  4K3N A;  1Y0Y A;  2B4D B;  2K5T A;  4KOY A;  4MCQ A;  2PJ8 A;  1AMP A;  4C2X A;  4R3K A;  3R95 A;  4FD5 A;  5J8C A;  3TCV A;  2NMT A;  1LAM A;  3KZW A;  1XRY A;  3TT2 A;  4YRH A;  4KOW A;  4LX9 A;  2PVW A;  4P4I A;  3D7D A;  4ZGY B;  1Q7L A;  2ZOF A;  5BWA B;  3KR4 A;  1Y9W A;  2BUE A;  2NYQ A;  3B3T A;  4A30 A;  2Z3N A;  3FRM A;  4MHY A;  1V0C A;  2BCO A;  4MCS A;  2G0B A;  2F8H A;  1TKF A;  2PQ8 A;  4NXY A;  4AXV A;  2PSW A;  4OC1 A;  5FVJ A;  3D7F A;  3IO1 A;  3SI0 A;  1YME A;  3D4U A;  4UFV A;  4C7I A;  4E2A A;  4ZY0 A;  2ZW5 A;  3GKR A;  1Q2D A;  4MBU A;  2JBK A;  3EFA A;  2VI7 A;  4AVB A;  5JH9 A;  1KUV A;  3SJF A;  3CZX A;  4PK2 A;  4B14 A;  1M4L A;  3CPA A;  1YVK A;  3PZJ A;  4F6A A;  3BJ8 A;  4GS4 A;  3H8E A;  3KR5 A;  4RI1 A;  2AJ6 A;  1GHE A;  2B3V A;  2H5M A;  2PJ2 A;  1M4I A;  4ONU A;  5HMN A;  3BI1 A;  5IB0 A;  3G8W A;  1YLE A;  2GFQ A;  2ZEH A;  4KVM E;  2BL1 A;  2JDC A;  3QNV A;  3IGR A;  2VZZ A;  3D68 A;  2AFS A;  2WZN A;  3KKW A;  1QMU A;  4B6Z A;  2EBJ A;  1B6B A;  2VEZ A;  3JUW A;  4GM5 A;  2ANP A;  3D7H A;  4R3L A;  4UCN A;  3RBU A;  4C2Z A;  1XBU A;  3NH8 A;  1IB1 E;  4JZ0 A;  1CPS A;  1XMB A;  1P4N A;  1ELM P;  1CP6 A;  4FD6 A;  4MMO A;  3IWG A;  4JWP A;  1UFH A;  4HNX B;  3SJG A;  2PIZ A;  4P4F A;  4PPZ A;  3TX8 A;  2PJ0 A;  1X12 A;  3PBE A;  1Z8T A;  2CY2 A;  3G3S A;  1HEE A;  8CPA A;  3C26 A;  4C7H A;  5JM6 A;  1VGY A;  3DGV A;  2FXF A;  4A33 A;  2ZEP A;  4MFP A;  4CYO A;  1B87 A;  5HH1 A;  4ZBG A;  3B7I A;  4PXE A;  4F0X A;  2Z0Z A;  4OLL A;  2PC1 A;  1R43 A;  1FT7 A;  2AFW A;  3IWW A;  3RZA A;  3TFY A;  2O28 A;  4NF1 A;  1HDU A;  1LFW A;  1P0H A;  3OWC A;  3SI2 A;  3IU1 A;  5F09 A;  3BI0 A;  3H5Z A;  5K8M A;  2P0W A;  2OZG A;  1YRE A;  2Z3O A;  3IU2 A;  1TF9 A;  4A2Z A;  4A31 A;  4B11 A;  3HUV A;  3RO0 A;  5IB9 A;  7CPA A;  4KLV A;  2JEV A;  3JVN A;  4NCZ A;  2B4D A;  2B58 A;  1QQ9 A;  4M85 A;  2CNS A;  4MY0 A;  4UA3 A;  1ARL A;  2P6F A;  4DUK A;  5K8N A;  3TOB A;  3S6F A;  2D4P A;  2PJ5 A;  3D8P A;  3KHZ A;  4XPD C;  3S9N A;  2ZOG A;  4NSQ A;  1ZLI A;  1CX8 A;  1TF8 A;  4AVC A;  4JXQ A;  1AUG A;  1RTQ A;  5G21 A;  4F9U A;  4FD7 A;  1I1D A;  4E0A A;  1ZO0 A;  4OC2 A;  2PVV A;  5HVH A;  1M44 A;  2B5G A;  2YNE A;  4F9V A;  4P45 A;  3GY9 A;  4OID A;  3B3C A;  1BO4 A;  3TOA A;  4CS0 B;  1CPX A;  1ZG9 A;  4YU9 A;  2Q7B A;  5I4M A;  1PUA A;  2R8V A;  3N5F A;  4J3G A;  3W6X A;  2XEG A;  4NFR A;  4DYO A;  2J9A A;  3TO9 A;  5HVF A;  1FY7 A;  5K8P A;  3NH5 A;  4P4D A;  3DR6 A;  1Z8L A;  4XPD B;  5A28 A;  1OZP A;  2Q7S A;  3S6H A;  2J8N A;  2CF4 A;  3HLP A;  4HKF A;  5G20 A;  1CG2 A;  2ZED A;  3K2K A;  3RYO A;  4DJL A;  2JEW A;  1MK4 A;  4A94 A;  2AFO A;  4R9M A;  3CDX A;  1Z8W A;  3SXO A;  1GYT A;  2EK8 A;  2WPX A;  4B5P A;  2XEI A;  1Z2L A;  2CNM A;  2V8V A;  2ZEM A;  5LYD A;  2EWB A;  4XNH C;  1XE4 A;  3K9U A;  4OAD A;  4CRY B;  1N71 A;  1Y7R A;  1Z4R A;  5J1Q A;  2I79 A;  4IHM A;  3T9Y A;  2F5I A;  5ELY A;  1YR0 A;  4PSX A;  1SQH A;  4NGT A;  2PR1 A;  2X7B A;  1X10 A;  3DLJ A;  5H84 A;  2Q44 A;  4CGN A;  4A32 A;  4F8Z A;  5JGF A;  4TWE A;  1RXT A;  3IEH A;  4U9Z A;  2OZU A;  3CXQ A;  2P6E A;  5D8N A;  1YW6 A;  1NMT A;  2ZEG A;  1CP7 A;  3PBB A;  4KVO E;  5EMI A;  4CYQ A;  1UWY A;  2Q4V A;  2REF A;  4PXD A;  1VKC A;  4MHZ A;  4NGS A;  3I1U A;  3R9F A;  3DR8 A;  1VIX A;  2DXQ A;  2ATR A;  1Y7E A;  1CM0 A;  1KZF A;  3GIU A;  1BOB A;  3LMS A;  3PFE A;  4WWV A;  3R96 A;  3RAM A;  5KTD A;  2PJB A;  4IK2 A;  2PJ6 A;  4A39 A;  4ORF A;  2R7H A;  4Q36 A;  2PJ9 A;  2AFU A;  4U9Y A;  3CT9 A;  1HDQ A;  4DNC A;  2Q51 A;  4KOV A;  1EE3 P;  5JQ4 A;  3WR7 A;  3GLJ A;  2ABZ A;  3NE7 A;  1Z9U A;  3KL9 A;  4CYN A;  2FIW A;  4MFZ A;  1YK3 A;  2ZEL A;  1YVO A;  4MY3 A;  2G3A A;  2B4B A;  3L2N A;  1QSM A;  3IJ3 A;  2IMO A;  5AG5 A;  4QVT A;  2PJ3 A;  4EFD A;  5AG4 A;  1IIC A;  2G9D A;  4WJB A;  3PB8 X;  4HNY B;  1JWQ A;  1IOF A;  4NGQ A;  4MRI A;  1BPM A;  3BXM A;  4XPL A;  2POK A;  2Q0Y A;  4KLW A;  2Z10 A;  2OZH A;  5I0C A;  4B5P B;  3FIX A;  2FCK A;  5E96 A;  2HV2 A;  3B2Y A;  1KWM A;  1Q2Y A;  4PSW A;  1M4D A;  1R57 A;  4KVX A;  3A9L A;  4KOS A;  3IIB A;  1Y0R A;  1QST A;  2FL4 A;  4KOR A;  2NSM A;  2PJ4 A;  4UF4 A;  4RN7 A;  3F0A A;  3QB8 A;  4KSA A;  4UWJ A;  4ZX8 A;  1BAV A;  4UFW A;  2QML A;  3FB3 A;  3FEE A;  1YSJ A;  1ZLH A;  4LUA A;  2I3C A;  4QB9 A;  3QAH A;  1F57 A;  2B3U A;  2R1I A;  3FF3 A;  2AFX A;  1IY7 A;  1BPN A;  3CXS A;  4ZY2 A;  3B8G A;  4UEE A;  2QEC A;  4LQG A;  2WYR A;  2J8R A;  2GIV A;  4JXR A;  5F49 A;  2DF5 A;  2OOT A;  3R9E A;  5GCN A;  3D2P A;  3LAC A;  5C82 A;  4UBR A;  4KUB A;  1Z5R A;  1R3N A;  1Z8X A;  2EVN A;  3JTK A;  4H89 A;  3VH9 A;  2GRE A;  3TC8 A;  4B10 A;  5KTA A;  5CPA A;  3ISX A;  1J4J A;  1WK4 A;  4UEF A;  3LWU A;  3D66 A;  3ZJ0 A;  4Z65 A;  4NGR A;  4CAE A;  5F48 A;  4KUA A;  4X5K A;  4X3R A;  3WC5 A;  2WSA A;  3GUX A;  1IYL A;  2ZW6 A;  5IV0 A;  1AYE A;  1MJA A;  1PCA A;  2FIA A;  2RB7 A;  5DWM A;  2RFH A;  5LYL A;  4KS9 A;  4KSI A;  2V8G A;  1XMT A;  2PDO A;  5G1Z A;  4CAF A;  1RO5 A;  2C6P A;  2G3T A;  4CPA A;  3FED A;  5D29 A;  4EWT A;  3V8I A;  4FBE A;  1FNO A;  4MFL A;  3DDD A;  3EY5 A;  3S6G A;  5C88 A;  3I9S A;  4Q38 A;  4M6H A;  3SHP A;  4JJX A;  1XJO A;  4NGP A;  4UEZ A;  3KGQ A;  2PCU A;  1BLL E;  2C6C A;  4U5Y A;  3R9G A;  1TKJ A;  1ZG8 A;  4R7M A;  3WC7 A;  2BEI A;  1KUY A;  3K9T A;  3TE4 A;  3CXP A;  2F7V A;  4MFK A;  3KQX A;  1S7L A;  1ZG7 A;  2Q4Y A;  2XEF A;  2FT0 A;  2C27 A;  3UY5 A;  1LRZ A;  2Z3K A;  4CGM A;  4JYW A;  3E0K A;  2GLJ A;  4MHP A;  2Z11 A;  4MCP A;  2CIJ A;  5HXD A;  1S7K A;  2ZW4 A;  4ONW A;  1IGB A;  3S6K A;  4OC4 A;  4CRZ B;  1Y9K A;  3N7Z A;  3PB9 X;  3BJ7 A;  5JPH A;  1XOV A;  2PR8 A;  4NJR A;  3FJU A;  3F5B A;  5LRK A;  4H6Z A;  2Z3M A;  2BO9 A;  5J8F A;  2V8H A;  1YQE A;  5AG7 A;  3FH4 A;  1Z4E A;  2BOA A;  4UIA A;  3TO6 A;  1F2P A;  1YX0 A;  2CXA A;  2QYV A;  4UWI A;  4Y49 C;  2PJA A;  4MI4 A;  1NSA A;  2ODF A;  3MN8 A;  4R57 A;  4NEX A;  4BMH A;  4R6T A;  5AGE A;  5LRJ A;  5AG6 A;  2VL1 A;  5EC4 A;  4B5O A;  3V7Z A;  4M6G A;  4W9Y A;  3EC4 A;  3PB4 X;  4M6I A;  3BHX A;  3PRT A;  4BD9 A;  3VAR A;  2J8M A;  3PEI A;  2AFM A;  3PP9 A;  3R1K A;  4QBJ A;  2CNT A;  2AFZ A;  2VXK A;  4OC0 A;  2JDD A;  3NFZ A;  4FD4 A;  4Y49 B;  4MCR A;  2D4O A;  1PYT B;  3H4Q A;  3MRU A;  2OH1 A;  3PB7 X;  4TNU A;  3W6S A;  4OIW A;  1L0C A;  3WAB A;  4IF5 A;  3S9M A;  3TO7 A;  4NGN A;  1XIX A;  3H8F A;  4AG7 A;  3KAS A;  1I21 A;  2Q4Z A;  1XFO A;  3FMC A;  2Q04 A;  4L89 A;  1NE9 A;  3SJX A;  4BIN A;  3B3S A;  4KZT A;  2PRQ A;  4MFJ A;  5EBV A;  2VBQ A;  4Q7A A; 
#chains in the Genus database with same CATH homology
 3PFO A;  2QVP A;  2ZEO A;  3CPX A;  3D7G A;  5THW A;  5LRG A;  4NJQ A;  3GB0 A;  1YLO A;  3IC1 A;  4MHN A;  4OME A;  1YW4 A;  4EME A;  4P4E A;  4X2T A;  1H8L A;  4OP4 A;  3T8W A;  1VHO A;  3JRU A;  1DTD A;  1LAP A;  4OC3 A;  1ARM A;  4UIB A;  4X8I A;  3FX6 A;  4ZI6 A;  2HC9 A;  3B35 A;  4ZYQ A;  2OR4 A;  4FAI A;  4P4B A;  4ZX9 A;  3FVL A;  1DE4 C;  4PXC A;  2QJ8 A;  1LAN A;  2C6G A;  2PE3 A;  4P10 A;  4YWY A;  2JBJ A;  4A37 A;  2ZEN A;  3SI1 A;  2HB6 A;  4ZY1 A;  4NGM A;  4R76 A;  4O23 A;  2XEJ A;  3KI9 A;  5K8O A;  2PJC A;  4FUU A;  4RUH A;  2DEA A;  2V8D A;  2ZEE A;  1ELL P;  2PIY A;  3NA6 A;  1LCP A;  5LYI A;  3ISZ A;  3B3V A;  1TKH A;  3KQZ A;  2PJ7 A;  5DS0 A;  3KHX A;  2IJZ A;  4R8F A;  2CTB A;  2O53 A;  4H2K A;  2V77 A;  4OC5 A;  2IQ6 A;  3V38 A;  3WC6 A;  6CPA A;  4PQA A;  2GLF A;  2EK9 A;  5LYF A;  4P4J A;  3B3W A;  3S9L A;  3NH4 A;  2FVG A;  3D67 A;  3WT4 A;  1CBX A;  4FWU A;  2Q43 A;  3SJE A;  3PB6 X;  4P6Y A;  1VHE A;  2O4H A;  2C1C A;  3H8G A;  3VAT A;  4PXB A;  1LOK A;  2CTC A;  3IFE A;  4G1P A;  1F2O A;  2GU2 A;  4MXU A;  2ZEF A;  1TXR A;  4A38 A;  1JQG A;  1OBR A;  2PJ1 A;  4P44 A;  3FEC A;  5HVG A;  4OKO A;  5CBM A;  4IAV A;  4K3N A;  1Y0Y A;  4MCQ A;  2PJ8 A;  1AMP A;  1LAM A;  3KZW A;  1XRY A;  2PVW A;  4P4I A;  3D7D A;  1Q7L A;  2ZOF A;  3KR4 A;  2NYQ A;  3B3T A;  4MHY A;  2BCO A;  4MCS A;  2F8H A;  1TKF A;  4AXV A;  4OC1 A;  3D7F A;  3IO1 A;  3SI0 A;  1YME A;  3D4U A;  4ZY0 A;  2JBK A;  5JH9 A;  3SJF A;  1M4L A;  3CPA A;  3H8E A;  3KR5 A;  2PJ2 A;  3BI1 A;  2ZEH A;  3QNV A;  3D68 A;  2AFS A;  2WZN A;  1QMU A;  4B6Z A;  3RBU A;  4GM5 A;  2ANP A;  3D7H A;  1XBU A;  3NH8 A;  4JZ0 A;  1CPS A;  1XMB A;  1ELM P;  1CP6 A;  4MMO A;  3SJG A;  2PIZ A;  4P4F A;  4PPZ A;  3TX8 A;  2PJ0 A;  3PBE A;  1HEE A;  8CPA A;  5JM6 A;  1VGY A;  3DGV A;  2ZEP A;  3B7I A;  4PXE A;  1R43 A;  1FT7 A;  2AFW A;  3IWW A;  3RZA A;  1HDU A;  1LFW A;  5F09 A;  3SI2 A;  3BI0 A;  5K8M A;  1TF9 A;  5IB9 A;  3HUV A;  7CPA A;  1QQ9 A;  5K8N A;  4DUK A;  1ARL A;  3KHZ A;  2PJ5 A;  3S9N A;  2ZOG A;  1ZLI A;  1CX8 A;  1TF8 A;  1RTQ A;  4F9U A;  4OC2 A;  2PVV A;  5HVH A;  4F9V A;  4P45 A;  4OID A;  3B3C A;  1CPX A;  1ZG9 A;  4YU9 A;  5I4M A;  3N5F A;  2XEG A;  4NFR A;  4DYO A;  2J9A A;  5HVF A;  5K8P A;  3NH5 A;  4P4D A;  1Z8L A;  2CF4 A;  3HLP A;  1CG2 A;  2ZED A;  3K2K A;  4DJL A;  2JEW A;  4A94 A;  2AFO A;  3CDX A;  1GYT A;  2EK8 A;  2XEI A;  1Z2L A;  2V8V A;  2ZEM A;  5LYD A;  2EWB A;  5J1Q A;  4IHM A;  5ELY A;  4NGT A;  3DLJ A;  4F8Z A;  5JGF A;  4TWE A;  3IEH A;  5D8N A;  1YW6 A;  2ZEG A;  1CP7 A;  3PBB A;  1UWY A;  4PXD A;  4MHZ A;  4NGS A;  3I1U A;  1VIX A;  1Y7E A;  3PFE A;  3LMS A;  4WWV A;  3RAM A;  2PJB A;  4IK2 A;  2PJ6 A;  4A39 A;  2PJ9 A;  2AFU A;  3CT9 A;  1HDQ A;  2Q51 A;  1EE3 P;  3GLJ A;  2ABZ A;  3KL9 A;  2ZEL A;  3L2N A;  3IJ3 A;  2IMO A;  4EFD A;  2PJ3 A;  4WJB A;  2G9D A;  3PB8 X;  4NGQ A;  4MRI A;  1BPM A;  3BXM A;  2POK A;  3B2Y A;  1KWM A;  3IIB A;  1Y0R A;  4UF4 A;  2NSM A;  2PJ4 A;  4ZX8 A;  1BAV A;  3FEE A;  1YSJ A;  1ZLH A;  2I3C A;  1F57 A;  3FF3 A;  2AFX A;  1IY7 A;  1BPN A;  4ZY2 A;  4UEE A;  4LQG A;  2WYR A;  2OOT A;  1Z5R A;  1R3N A;  3VH9 A;  2GRE A;  3TC8 A;  5CPA A;  3ISX A;  4UEF A;  3LWU A;  3D66 A;  4Z65 A;  4NGR A;  4X3R A;  3WC5 A;  3GUX A;  1AYE A;  1PCA A;  2RB7 A;  2RFH A;  5LYL A;  4KSI A;  2V8G A;  2C6P A;  4CPA A;  3FED A;  5D29 A;  4EWT A;  4FBE A;  1FNO A;  1XJO A;  4NGP A;  4UEZ A;  3KGQ A;  2PCU A;  1BLL E;  2C6C A;  1TKJ A;  1ZG8 A;  4R7M A;  3WC7 A;  3K9T A;  2F7V A;  3KQX A;  1ZG7 A;  2XEF A;  4JYW A;  2GLJ A;  4MHP A;  4MCP A;  2CIJ A;  5HXD A;  4ONW A;  1IGB A;  4OC4 A;  3PB9 X;  4NJR A;  3FJU A;  5LRK A;  2BO9 A;  2V8H A;  3FH4 A;  2BOA A;  4UIA A;  1F2P A;  2QYV A;  2PJA A;  1NSA A;  3MN8 A;  4R6T A;  5LRJ A;  2VL1 A;  3V7Z A;  4W9Y A;  3PB4 X;  4BD9 A;  3BHX A;  3PRT A;  3VAR A;  3PEI A;  2AFM A;  2AFZ A;  4OC0 A;  3NFZ A;  4MCR A;  3PB7 X;  1PYT B;  3MRU A;  4TNU A;  4OIW A;  3WAB A;  3S9M A;  4NGN A;  3H8F A;  3KAS A;  2Q4Z A;  1XFO A;  3FMC A;  3SJX A;  3B3S A;  2PRQ A;  4Q7A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...