4M6IA

Structure of the reduced, zn-bound form of mycobacterium tuberculosis peptidoglycan amidase rv3717
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
214
structure length
185
Chain Sequence
IAGMVVFIDPGHTSTNSGYPEHTFTWETGLRLRAALNALGVRTALSRGNDGPCVDERANMANALRPNAIVSLHADGGPASGRGFHVNYSAPPLNAIQAGPSVQFARIMRDQLQASGIPKANYIGQDGLYGRSDLAGLNLAQYPSILVELGNMKNPADSALMESAEGRQKYANALVRGVAGFLATQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and Biochemical Analyses of Mycobacterium tuberculosis N-Acetylmuramyl-L-alanine Amidase Rv3717 Point to a Role in Peptidoglycan Fragment Recycling.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Hydrolase
molecule keywords Peptidoglycan Amidase Rv3717
total genus 77
structure length 185
sequence length 214
chains with identical sequence B
ec nomenclature ec 3.5.-.-:
pdb deposition date 2013-08-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01520 Amidase_3 N-acetylmuramoyl-L-alanine amidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.40 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn-dependent exopeptidases 4m6iA00
3QAYA 5EMIA 1JWQA 3NE8A 4M6HA 3CZXA 1XOVA 4LQ6A 4RN7A 4BINA 2Q7SA 2ODFA 4M6IA 4M6GA
chains in the Genus database with same CATH superfamily
4H6ZA 3FRMA 2ZOGA 3D67A 4OC1A 2FCKA 4QVTA 3T90A 4MCRA 4F9VA 3W6XA 3FMCA 4MHZA 1PYTB 1JWQA 1QSMA 4Y49C 3TE4A 2JBKA 1LAPA 2VEZA 4TNUA 2PRQA 4FD5A 5A27A 2B5GB 3D7GA 3R1KA 1IOIA 1PCAA 5CPAA 3R96A 3TCVA 4KOXA 3B35A 5EMIA 4R87A 1YQEA 5JH9A 2CTCA 3GYAA 2GIVA 2D4PA 3TOBA 4QUSA 1YSJA 4J3GA 4XPLA 3FX6A 2OZHA 3K2KA 3R9FA 3CT9A 2FSRA 1SQHA 5G1ZA 2PVVA 2PRBA 2HV2A 2B4BA 4IK2A 3SI2A 1TKJA 3S9NA 4P4JA 3S9MA 2ZEGA 1Z8TA 4AG9A 4KLVA 4ZX8A 5BWAB 1S60A 3FEEA 3BJ7A 2PR1A 1ZG8A 4WJBA 3D4UA 3TO9A 4MY3A 4QB9A 5DWMA 2HC9A 4XPDC 4YU9A 3PP9A 1QMUA 2ZENA 2YNCC 2FS5A 2ANPA 1TIQA 2EVNA 4MFPA 3DLJA 2VL1A 4M85A 4PK3A 2IL4A 3KL9A 5K8OA 4IUSA 1YLEA 1S3ZA 4A39A 3LD2A 2OH1A 3WR7A 3JUWA 3SI0A 3TTHA 1S7LA 3NH8A 2ABZA 1CX8A 2B4DA 1ZLIA 4LUAA 4NFRA 4A38A 1YW6A 4H2KA 4RS2A 4EVYA 4NGQA 2RB7A 1YX0A 3H4QA 3LODA 5KTDA 1TKHA 4KVME 4ZGYB 1DTDA 2EBJA 4KOVA 2WUUA 3NA6A 2R1IA 2V8VA 1I1DA 1XEBA 1Z8WA 2J9AA 4MI4A 2V8DA 4UEFA 2OOTA 2B58A 4OC3A 2A4NA 2Q4ZA 1KWMA 3FXTA 3QAHA 1BO4A 4OC5A 4EWTA 2ZXVA 5LRGA 4X3RA 1MJ9A 1VGYA 3DNSA 4CS0B 1LOKA 2Q4VA 4HNXB 1Q2CA 4H6UA 4OC0A 4NCZA 4C2ZA 1XBUA 3JRUA 3V38A 3IU1A 3KGQA 2JLMA 1RO5A 1JQGA 1TXRA 4WWVA 5F46A 2BL1A 2EK9A 3NE7A 3BLNA 4X8IA 2P6FA 1Y7EA 4MY0A 1YVKA 3FH4A 5JPHA 4U5YA 1R3NA 3D7HA 3H5ZA 1MK4A 1H8LA 3EC4A 3B3TA 4UFWA 4II9A 4AXVA 2Q44A 4UWIA 2GREA 2C6CA 2YGWA 4LQ6A 1YGHA 1AYEA 1ARLA 4DUKA 4KOYA 5IV0A 4A32A 4IHMA 2FIAA 5G22A 3RZAA 2JBJA 1XFOA 1R43A 4L89A 4M6GA 4NGRA 3IIBA 4OC2A 3B3VA 1M4LA 4RUHA 2CXAA 4MCPA 2PJ7A 3FF3A 4UFVA 3SJXA 4KOUA 1P4NA 3H8FA 5A28A 2GU2A 3IFEA 4KOTA 5HVFA 5KTCA 3RBUA 5C82A 2BCOA 2GFQA 2AFXA 2P6GA 4NGPA 4AVAA 4B12A 3EO4A 2AJ6A 2IJZA 2REEA 4MFZA 4A31A 2ZEMA 3IGRA 2NYQA 2F7VA 2FT0A 3KZWA 5LYLA 4BINA 4AG7A 3SJEA 8CPAA 1NE9A 4ZY2A 4PK2A 3LACA 4PXBA 1GHEA 1VHEA 2DF5A 5HVGA 3FJUA 4JJXA 5E96A 4BMHA 3RNZA 5I4MA 1FNOA 2ZEHA 4C68A 5JQ4A 1CBXA 2R8VA 3IEHA 4M6HA 4MXUA 2XEIA 2Z3KA 2V8HA 1B87A 4KSIA 2PJ0A 3D8PA 1B6BA 3FIXA 4A33A 1F57A 4FBEA 2Z10A 1Z8LA 4CGOA 5H84A 5IX3A 1ZG9A 2FE7A 3CXSA 3ZJ0A 5THWA 3B3WA 4FD4A 3SXNA 4MHNA 3TO7A 2Z11A 3DDDA 4QC6A 5DWNA 4U9ZA 4UIAA 3VWEA 2BUEA 5F47A 1BAVA 2ZEPA 3SXOA 1OZPA 1Q2YA 5H86A 4XNHC 1S5KA 3MN8A 3IU2A 3KHXA 3WT4A 4FAIA 3SJFA 4A30A 4CPAA 5I0CA 1UWYA 2WPWA 4KUAA 3RYOA 1KUYA 4C7HA 4UEZA 3EY5A 3K9TA 2BO9A 4KORA 4UFXA 1AMPA 4A95A 3F8KA 2YNDA 1PU9A 1WK4A 4MBUA 1TKFA 4NGSA 1HDQA 2I79A 3N7ZA 4KOSA 4Y49B 3RO0A 4CRZB 4F6AA 2Z3LA 3B2YA 3I1UA 1IIDA 3WC5A 4YFJA 2OZUA 4UWJA 3TX8A 4P4FA 5AG6A 1NSAA 4JD6A 3VARA 3B7IA 3CXPA 1YK3A 4MHPA 4XPKA 2X7BA 1WWZA 1VHSA 2IMOA 4X2TA 3ZZIA 5HH1A 4UBRA 1Z9UA 2VBQA 4JLYA 4UEEA 3SHPA 4HNWB 1YREA 4R9MA 4B10A 2EK8A 3SJGA 2GLFA 2ZW6A 1M4GA 4TWEA 3KQXA 1CPXA 1LCPA 1YR0A 5EC4A 4A94A 2D4OA 2NMTA 4R8FA 1LAMA 4F0YA 4L8AA 4C7IA 4MRIA 1QSRA 3KHZA 2I3CA 4UCMA 2EO8A 4ZY0A 3IJ3A 4NEXA 2J8NA 4PXCA 1ARMA 4PPZA 5EBVA 2PR8A 3R9GA 3W6SA 3PRTA 2ZW4A 1KUXA 4MFQA 3UY5A 4F0XA 2FL4A 3S6GA 4CAXA 1IGBA 4FUUA 4RI1A 2AFMA 3CZXA 5ELYA 2Q43A 2QYVA 4B11A 4MMOA 4UF4A 2EUIA 1LRZA 3B3SA 1XJOA 3GKRA 2Q51A 3GY9A 1S7KA 4OKOA 5G21A 3TOAA 3V7ZA 3WC7A 1KUVA 4CYNA 2P0WA 2VZYA 2Z3NA 3NH5A 2HUZA 2AFZA 2I00A 3BI0A 3VWDA 4CGPA 4CYOA 1F2OA 1UFHA 2B4DB 1I21A 3PEIA 4YWYA 6CPAA 4OLLA 1BPNA 1Z5RA 2WYRA 3EFAA 4I49A 4NJRA 1RTQA 4ORFA 4A2ZA 3SI1A 4XNHB 4JYWA 3JVNA 3PB9X 4P4EA 1Y9WA 3R9EA 4R3LA 3GUXA 4O23A 4CAVA 5LYFA 2BOAA 1QSNA 2CTBA 2V77A 3D3SA 3B8GA 3F5BA 2IQ6A 2ZW7A 2FXFA 4P45A 3CPXA 1S7NA 4JZ0A 2Q4YA 2FIWA 3PB7X 3GB0A 4B6ZA 3FBUA 1XE4A 1Y9KA 3BI1A 3NE8A 1NMTA 2G0BA 3P2FA 2C27A 5J8CA 3D7DA 4KVOE 4P6YA 3PB8X 4CGLA 3NH4A 3OWCA 4M6IA 4OADA 3KASA 1EE3P 2AFOA 5G20A 1M44A 1XMBA 5JM6A 2C6PA 2RC4A 3MGDA 1P0HA 2ZEDA 3A9LA 1XIXA 3S6KA 2Q0YA 1VHOA 2OB0A 1Z4EA 2PE3A 2WSAA 4NXYA 2ZEEA 5K8PA 4DNCA 2F5IA 3IC1A 3LWUA 2BEIA 4OC4A 5JGFA 2ZOFA 1X12A 4OIWA 2C6GA 1U6MA 3P2HA 4JXRA 4UCPA 5LYIA 2O53A 2Y0MA 1Q2DA 2OZGA 4P4BA 4ZYQA 4CYPA 2O4HA 2ODFA 4K3NA 1BOBA 1BLLE 3LMSA 1ELLP 1S7FA 2PJ8A 1R57A 4IAVA 4NJQA 4R76A 1IY7A 4XPDB 5AGEA 5GCNA 2B3UA 4KOWA 5FVJA 3B3CA 3PB6X 3KR5A 2PCUA 3NFZA 2PJBA 2OU2A 1Q7LA 4NSQA 4PXDA 4MCQA 1A2ZA 3BXMA 1YMEA 4QBJA 2O28A 4PSWA 3T8WA 4A37A 1YW4A 1XRYA 4BBHA 3E0KA 4OP4A 4P4DA 3FVLA 3G3SA 4LX9A 1CP6A 5F09A 2POKA 5K8NA 2PJ9A 4H89A 4KSAA 2PJ6A 2AFSA 2PVWA 4PSXA 3S9LA 1CJWA 2AFUA 4ZY1A 2F8HA 1M4IA 4AVBA 1M1DA 5IB0A 4KS9A 4PXEA 5AG5A 1Y7RA 2CY2A 4RN7A 1FT7A 3IWWA 1CPSA 4KSFA 4GM5A 2PJ4A 2JDCA 2ZEOA 3CPAA 4X5KA 1MJBA 3D7FA 4B13A 5ISVA 4K30A 4MFLA 2R7HA 2DEAA 3H8EA 4EMEA 5AG4A 5F48A 4NGTA 2AE6A 1AUGA 5LRKA 3I3GA 4YRHA 2RFHA 2VXKA 2VI7A 1FY7A 4EFDA 1Y0RA 2Q04A 4YGOA 4MHYA 2CNSA 2PJ1A 1Z8XA 5J1QA 2GANA 2PJCA 3GLJA 4KLWA 4ONUA 1Z4RA 4ONWA 1M4DA 2JEWA 2PSWA 2PJAA 3FNCA 3W91A 1GYTA 5D8NA 3T9YA 1IYLA 5HXDA 1CP7A 2G3AA 2PC1A 3KKWA 1KZFA 1LFWA 4F9UA 4AB7A 5CNPA 4Z65A 2QVPA 1V0CA 2QIRA 2VQYA 4R7MA 4U9YA 5HVHA 2J8RA 3H8GA 1Y0YA 2ZELA 4GXHA 3TC8A 4F8ZA 2K5TA 3KR4A 1HDUA 1DE4C 2G3TA 4HKFA 4OMEA 4B14A 3D2PA 4NF1A 3I9SA 1TF9A 1LANA 2Z0ZA 1BPMA 2VZZA 3HLPA 2PJ5A 4DYOA 3TT2A 2PJ3A 3QB8A 4LQGA 1Z2LA 1ZLHA 3IO1A 3IWEA 2BSWA 2YNEA 3HUVA 2Z3PA 3D66A 1RXTA 1CM0A 2QECA 5KTAA 1IU8A 3TO6A 1MJAA 2G9DA 3N5FA 1XOVA 4JWPA 4MHDA 4ZBGA 3PBBA 4GS4A 1NSLA 2PIYA 1ZO0A 2ATRA 2XEFA 3WABA 3CXQA 4MJ8A 1IOFA 2ARHA 4KUBA 3ISXA 3PFOA 4MFJA 2OR4A 4FD6A 4PV6A 3ISZA 3PB4X 3R95A 4DJLA 3G8WA 1YVOA 2B5GA 2C1CA 2QJ8A 2REFA 4Q38A 4ZX9A 2P6EA 4AVCA 1CG2A 3PFEA 2XEGA 1PUAA 3PBEA 2B3VA 2ZPAA 5LRJA 2CIJA 4UIBA 3L2NA 3QAYA 3CDXA 4B5PA 5LYDA 1XMTA 2CNTA 4HPSA 2Z3MA 1F2PA 2GE3A 2PDOA 4R57A 4CGMA 4CRYB 4FD7A 1VIXA 3FEDA 4G1PA 3WC6A 2KCWA 1ZG7A 4UA3A 5IB9A 1OBRA 4PQAA 1J4JA 2YNCA 5J8FA 4BD9A 4KZTA 1IB1E 4P44A 4B5PB 5DS0A 1IICA 4E2AA 2WPXA 4R3KA 3D68A 1N71A 4ZI6A 3V8IA 5D29A 3MRUA 3F0AA 3TFYA 1L0CA 2GLJA 4E0AA 3QNVA 1QQ9A 1QSTA 4Q7AA 4CAWA 5C88A 7CPAA 4NGNA 4OAEA 1YLOA 4C2YA 3DR8A 3BJ8A 2EWBA 3PZJA 1VKCA 2HQYA 3VATA 4B5OA 4C2XA 2PJ2A 2AFWA 5AG7A 2NSMA 3D2MA 3JTKA 3DR6A 1TF8A 2DPSA 3RAMA 2WZNA 2CF4A 2QMLA 1QSOA 4Q36A 3C26A 1X10A 3DSBA 2Q7BA 3DGVA 3EXNA 4NGMA 1XF8A 5CBMA 3VH9A 5HMNA 2JDDA 4MFKA 5K8MA 1ELMP 3FECA 3KQZA 4UCNA 2J8MA 5F49A 4CGNA 2ZW5A 1I12A 2XEJA 4OIDA 4HNYB 1IYKA 4R6TA 4P4IA 2R98A 3PGPA 2DXQA 4JXQA 3S6FA 3KI9A 4M3SA 4E8OA 3GIUA 4FWUA 2DPTA 2V8GA 2ZEFA 4IF5A 2H5MA 4CAFA 1HEEA 4CYQA 2PQ8A 2Z3OA 2HB6A 4MCSA 3FB3A 3IWGA 3K9UA 1ON0A 1K4JA 4W9YA 2CNMA 2PIZA 2JEVA 2FVGA 4P10A 4KVXA 2Q7SA 3S6HA 4CAEA 3BHXA 3FYNA
chains in the Genus database with same CATH topology
3QAYA 5EMIA 4EFDA 1JWQA 3NE8A 4M6HA 1XOVA 3CZXA 4LQ6A 4RN7A 4BINA 2HB6A 2Q7SA 2ODFA 2HC9A 4M6IA 4M6GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QAY A;  5EMI A;  1JWQ A;  3NE8 A;  4M6H A;  3CZX A;  1XOV A;  4LQ6 A;  4RN7 A;  4BIN A;  2Q7S A;  2ODF A;  4M6I A;  4M6G A; 
#chains in the Genus database with same CATH topology
 4H6Z A;  3FRM A;  2ZOG A;  3D67 A;  4OC1 A;  2FCK A;  4QVT A;  3T90 A;  4MCR A;  4F9V A;  3W6X A;  3FMC A;  4MHZ A;  1PYT B;  1JWQ A;  1QSM A;  4Y49 C;  3TE4 A;  2JBK A;  1LAP A;  2VEZ A;  4TNU A;  2PRQ A;  4FD5 A;  5A27 A;  2B5G B;  3D7G A;  3R1K A;  1IOI A;  1PCA A;  5CPA A;  3R96 A;  3TCV A;  4KOX A;  3B35 A;  5EMI A;  4R87 A;  1YQE A;  5JH9 A;  2CTC A;  3GYA A;  2GIV A;  2D4P A;  3TOB A;  4QUS A;  1YSJ A;  4J3G A;  4XPL A;  3FX6 A;  2OZH A;  3K2K A;  3R9F A;  3CT9 A;  2FSR A;  1SQH A;  5G1Z A;  2PVV A;  2PRB A;  2HV2 A;  2B4B A;  4IK2 A;  3SI2 A;  1TKJ A;  3S9N A;  4P4J A;  3S9M A;  2ZEG A;  1Z8T A;  4AG9 A;  4KLV A;  4ZX8 A;  5BWA B;  1S60 A;  3FEE A;  3BJ7 A;  2PR1 A;  1ZG8 A;  4WJB A;  3D4U A;  3TO9 A;  4MY3 A;  4QB9 A;  5DWM A;  2HC9 A;  4XPD C;  4YU9 A;  3PP9 A;  1QMU A;  2ZEN A;  2YNC C;  2FS5 A;  2ANP A;  1TIQ A;  2EVN A;  4MFP A;  3DLJ A;  2VL1 A;  4M85 A;  4PK3 A;  2IL4 A;  3KL9 A;  5K8O A;  4IUS A;  1YLE A;  1S3Z A;  4A39 A;  3LD2 A;  2OH1 A;  3WR7 A;  3JUW A;  3SI0 A;  3TTH A;  1S7L A;  3NH8 A;  2ABZ A;  1CX8 A;  2B4D A;  1ZLI A;  4LUA A;  4NFR A;  4A38 A;  1YW6 A;  4H2K A;  4RS2 A;  4EVY A;  4NGQ A;  2RB7 A;  1YX0 A;  3H4Q A;  3LOD A;  5KTD A;  1TKH A;  4KVM E;  4ZGY B;  1DTD A;  2EBJ A;  4KOV A;  2WUU A;  3NA6 A;  2R1I A;  2V8V A;  1I1D A;  1XEB A;  1Z8W A;  2J9A A;  4MI4 A;  2V8D A;  4UEF A;  2OOT A;  2B58 A;  4OC3 A;  2A4N A;  2Q4Z A;  1KWM A;  3FXT A;  3QAH A;  1BO4 A;  4OC5 A;  4EWT A;  2ZXV A;  5LRG A;  4X3R A;  1MJ9 A;  1VGY A;  3DNS A;  4CS0 B;  1LOK A;  2Q4V A;  4HNX B;  1Q2C A;  4H6U A;  4OC0 A;  4NCZ A;  4C2Z A;  1XBU A;  3JRU A;  3V38 A;  3IU1 A;  3KGQ A;  2JLM A;  1RO5 A;  1JQG A;  1TXR A;  4WWV A;  5F46 A;  2BL1 A;  2EK9 A;  3NE7 A;  3BLN A;  4X8I A;  2P6F A;  1Y7E A;  4MY0 A;  1YVK A;  3FH4 A;  5JPH A;  4U5Y A;  1R3N A;  3D7H A;  3H5Z A;  1MK4 A;  1H8L A;  3EC4 A;  3B3T A;  4UFW A;  4II9 A;  4AXV A;  2Q44 A;  4UWI A;  2GRE A;  2C6C A;  2YGW A;  4LQ6 A;  1YGH A;  1AYE A;  1ARL A;  4DUK A;  4KOY A;  5IV0 A;  4A32 A;  4IHM A;  2FIA A;  5G22 A;  3RZA A;  2JBJ A;  1XFO A;  1R43 A;  4L89 A;  4M6G A;  4NGR A;  3IIB A;  4OC2 A;  3B3V A;  1M4L A;  4RUH A;  2CXA A;  4MCP A;  2PJ7 A;  3FF3 A;  4UFV A;  3SJX A;  4KOU A;  1P4N A;  3H8F A;  5A28 A;  2GU2 A;  3IFE A;  4KOT A;  5HVF A;  5KTC A;  3RBU A;  5C82 A;  2BCO A;  2GFQ A;  2AFX A;  2P6G A;  4NGP A;  4AVA A;  4B12 A;  3EO4 A;  2AJ6 A;  2IJZ A;  2REE A;  4MFZ A;  4A31 A;  2ZEM A;  3IGR A;  2NYQ A;  2F7V A;  2FT0 A;  3KZW A;  5LYL A;  4BIN A;  4AG7 A;  3SJE A;  8CPA A;  1NE9 A;  4ZY2 A;  4PK2 A;  3LAC A;  4PXB A;  1GHE A;  1VHE A;  2DF5 A;  5HVG A;  3FJU A;  4JJX A;  5E96 A;  4BMH A;  3RNZ A;  5I4M A;  1FNO A;  2ZEH A;  4C68 A;  5JQ4 A;  1CBX A;  2R8V A;  3IEH A;  4M6H A;  4MXU A;  2XEI A;  2Z3K A;  2V8H A;  1B87 A;  4KSI A;  2PJ0 A;  3D8P A;  1B6B A;  3FIX A;  4A33 A;  1F57 A;  4FBE A;  2Z10 A;  1Z8L A;  4CGO A;  5H84 A;  5IX3 A;  1ZG9 A;  2FE7 A;  3CXS A;  3ZJ0 A;  5THW A;  3B3W A;  4FD4 A;  3SXN A;  4MHN A;  3TO7 A;  2Z11 A;  3DDD A;  4QC6 A;  5DWN A;  4U9Z A;  4UIA A;  3VWE A;  2BUE A;  5F47 A;  1BAV A;  2ZEP A;  3SXO A;  1OZP A;  1Q2Y A;  5H86 A;  4XNH C;  1S5K A;  3MN8 A;  3IU2 A;  3KHX A;  3WT4 A;  4FAI A;  3SJF A;  4A30 A;  4CPA A;  5I0C A;  1UWY A;  2WPW A;  4KUA A;  3RYO A;  1KUY A;  4C7H A;  4UEZ A;  3EY5 A;  3K9T A;  2BO9 A;  4KOR A;  4UFX A;  1AMP A;  4A95 A;  3F8K A;  2YND A;  1PU9 A;  1WK4 A;  4MBU A;  1TKF A;  4NGS A;  1HDQ A;  2I79 A;  3N7Z A;  4KOS A;  4Y49 B;  3RO0 A;  4CRZ B;  4F6A A;  2Z3L A;  3B2Y A;  3I1U A;  1IID A;  3WC5 A;  4YFJ A;  2OZU A;  4UWJ A;  3TX8 A;  4P4F A;  5AG6 A;  1NSA A;  4JD6 A;  3VAR A;  3B7I A;  3CXP A;  1YK3 A;  4MHP A;  4XPK A;  2X7B A;  1WWZ A;  1VHS A;  2IMO A;  4X2T A;  3ZZI A;  5HH1 A;  4UBR A;  1Z9U A;  2VBQ A;  4JLY A;  4UEE A;  3SHP A;  4HNW B;  1YRE A;  4R9M A;  4B10 A;  2EK8 A;  3SJG A;  2GLF A;  2ZW6 A;  1M4G A;  4TWE A;  3KQX A;  1CPX A;  1LCP A;  1YR0 A;  5EC4 A;  4A94 A;  2D4O A;  2NMT A;  4R8F A;  1LAM A;  4F0Y A;  4L8A A;  4C7I A;  4MRI A;  1QSR A;  3KHZ A;  2I3C A;  4UCM A;  2EO8 A;  4ZY0 A;  3IJ3 A;  4NEX A;  2J8N A;  4PXC A;  1ARM A;  4PPZ A;  5EBV A;  2PR8 A;  3R9G A;  3W6S A;  3PRT A;  2ZW4 A;  1KUX A;  4MFQ A;  3UY5 A;  4F0X A;  2FL4 A;  3S6G A;  4CAX A;  1IGB A;  4FUU A;  4RI1 A;  2AFM A;  3CZX A;  5ELY A;  2Q43 A;  2QYV A;  4B11 A;  4MMO A;  4UF4 A;  2EUI A;  1LRZ A;  3B3S A;  1XJO A;  3GKR A;  2Q51 A;  3GY9 A;  1S7K A;  4OKO A;  5G21 A;  3TOA A;  3V7Z A;  3WC7 A;  1KUV A;  4CYN A;  2P0W A;  2VZY A;  2Z3N A;  3NH5 A;  2HUZ A;  2AFZ A;  2I00 A;  3BI0 A;  3VWD A;  4CGP A;  4CYO A;  1F2O A;  1UFH A;  2B4D B;  1I21 A;  3PEI A;  4YWY A;  6CPA A;  4OLL A;  1BPN A;  1Z5R A;  2WYR A;  3EFA A;  4I49 A;  4NJR A;  1RTQ A;  4ORF A;  4A2Z A;  3SI1 A;  4XNH B;  4JYW A;  3JVN A;  3PB9 X;  4P4E A;  1Y9W A;  3R9E A;  4R3L A;  3GUX A;  4O23 A;  4CAV A;  5LYF A;  2BOA A;  1QSN A;  2CTB A;  2V77 A;  3D3S A;  3B8G A;  3F5B A;  2IQ6 A;  2ZW7 A;  2FXF A;  4P45 A;  3CPX A;  1S7N A;  4JZ0 A;  2Q4Y A;  2FIW A;  3PB7 X;  3GB0 A;  4B6Z A;  3FBU A;  1XE4 A;  1Y9K A;  3BI1 A;  3NE8 A;  1NMT A;  2G0B A;  3P2F A;  2C27 A;  5J8C A;  3D7D A;  4KVO E;  4P6Y A;  3PB8 X;  4CGL A;  3NH4 A;  3OWC A;  4M6I A;  4OAD A;  3KAS A;  1EE3 P;  2AFO A;  5G20 A;  1M44 A;  1XMB A;  5JM6 A;  2C6P A;  2RC4 A;  3MGD A;  1P0H A;  2ZED A;  3A9L A;  1XIX A;  3S6K A;  2Q0Y A;  1VHO A;  2OB0 A;  1Z4E A;  2PE3 A;  2WSA A;  4NXY A;  2ZEE A;  5K8P A;  4DNC A;  2F5I A;  3IC1 A;  3LWU A;  2BEI A;  4OC4 A;  5JGF A;  2ZOF A;  1X12 A;  4OIW A;  2C6G A;  1U6M A;  3P2H A;  4JXR A;  4UCP A;  5LYI A;  2O53 A;  2Y0M A;  1Q2D A;  2OZG A;  4P4B A;  4ZYQ A;  4CYP A;  2O4H A;  2ODF A;  4K3N A;  1BOB A;  1BLL E;  3LMS A;  1ELL P;  1S7F A;  2PJ8 A;  1R57 A;  4IAV A;  4NJQ A;  4R76 A;  1IY7 A;  4XPD B;  5AGE A;  5GCN A;  2B3U A;  4KOW A;  5FVJ A;  3B3C A;  3PB6 X;  3KR5 A;  2PCU A;  3NFZ A;  2PJB A;  2OU2 A;  1Q7L A;  4NSQ A;  4PXD A;  4MCQ A;  1A2Z A;  3BXM A;  1YME A;  4QBJ A;  2O28 A;  4PSW A;  3T8W A;  4A37 A;  1YW4 A;  1XRY A;  4BBH A;  3E0K A;  4OP4 A;  4P4D A;  3FVL A;  3G3S A;  4LX9 A;  1CP6 A;  5F09 A;  2POK A;  5K8N A;  2PJ9 A;  4H89 A;  4KSA A;  2PJ6 A;  2AFS A;  2PVW A;  4PSX A;  3S9L A;  1CJW A;  2AFU A;  4ZY1 A;  2F8H A;  1M4I A;  4AVB A;  1M1D A;  5IB0 A;  4KS9 A;  4PXE A;  5AG5 A;  1Y7R A;  2CY2 A;  4RN7 A;  1FT7 A;  3IWW A;  1CPS A;  4KSF A;  4GM5 A;  2PJ4 A;  2JDC A;  2ZEO A;  3CPA A;  4X5K A;  1MJB A;  3D7F A;  4B13 A;  5ISV A;  4K30 A;  4MFL A;  2R7H A;  2DEA A;  3H8E A;  4EME A;  5AG4 A;  5F48 A;  4NGT A;  2AE6 A;  1AUG A;  5LRK A;  3I3G A;  4YRH A;  2RFH A;  2VXK A;  2VI7 A;  1FY7 A;  4EFD A;  1Y0R A;  2Q04 A;  4YGO A;  4MHY A;  2CNS A;  2PJ1 A;  1Z8X A;  5J1Q A;  2GAN A;  2PJC A;  3GLJ A;  4KLW A;  4ONU A;  1Z4R A;  4ONW A;  1M4D A;  2JEW A;  2PSW A;  2PJA A;  3FNC A;  3W91 A;  1GYT A;  5D8N A;  3T9Y A;  1IYL A;  5HXD A;  1CP7 A;  2G3A A;  2PC1 A;  3KKW A;  1KZF A;  1LFW A;  4F9U A;  4AB7 A;  5CNP A;  4Z65 A;  2QVP A;  1V0C A;  2QIR A;  2VQY A;  4R7M A;  4U9Y A;  5HVH A;  2J8R A;  3H8G A;  1Y0Y A;  2ZEL A;  4GXH A;  3TC8 A;  4F8Z A;  2K5T A;  3KR4 A;  1HDU A;  1DE4 C;  2G3T A;  4HKF A;  4OME A;  4B14 A;  3D2P A;  4NF1 A;  3I9S A;  1TF9 A;  1LAN A;  2Z0Z A;  1BPM A;  2VZZ A;  3HLP A;  2PJ5 A;  4DYO A;  3TT2 A;  2PJ3 A;  3QB8 A;  4LQG A;  1Z2L A;  1ZLH A;  3IO1 A;  3IWE A;  2BSW A;  2YNE A;  3HUV A;  2Z3P A;  3D66 A;  1RXT A;  1CM0 A;  2QEC A;  5KTA A;  1IU8 A;  3TO6 A;  1MJA A;  2G9D A;  3N5F A;  1XOV A;  4JWP A;  4MHD A;  4ZBG A;  3PBB A;  4GS4 A;  1NSL A;  2PIY A;  1ZO0 A;  2ATR A;  2XEF A;  3WAB A;  3CXQ A;  4MJ8 A;  1IOF A;  2ARH A;  4KUB A;  3ISX A;  3PFO A;  4MFJ A;  2OR4 A;  4FD6 A;  4PV6 A;  3ISZ A;  3PB4 X;  3R95 A;  4DJL A;  3G8W A;  1YVO A;  2B5G A;  2C1C A;  2QJ8 A;  2REF A;  4Q38 A;  4ZX9 A;  2P6E A;  4AVC A;  1CG2 A;  3PFE A;  2XEG A;  1PUA A;  3PBE A;  2B3V A;  2ZPA A;  5LRJ A;  2CIJ A;  4UIB A;  3L2N A;  3QAY A;  3CDX A;  4B5P A;  5LYD A;  1XMT A;  2CNT A;  4HPS A;  2Z3M A;  1F2P A;  2GE3 A;  2PDO A;  4R57 A;  4CGM A;  4CRY B;  4FD7 A;  1VIX A;  3FED A;  4G1P A;  3WC6 A;  2KCW A;  1ZG7 A;  4UA3 A;  5IB9 A;  1OBR A;  4PQA A;  1J4J A;  2YNC A;  5J8F A;  4BD9 A;  4KZT A;  1IB1 E;  4P44 A;  4B5P B;  5DS0 A;  1IIC A;  4E2A A;  2WPX A;  4R3K A;  3D68 A;  1N71 A;  4ZI6 A;  3V8I A;  5D29 A;  3MRU A;  3F0A A;  3TFY A;  1L0C A;  2GLJ A;  4E0A A;  3QNV A;  1QQ9 A;  1QST A;  4Q7A A;  4CAW A;  5C88 A;  7CPA A;  4NGN A;  4OAE A;  1YLO A;  4C2Y A;  3DR8 A;  3BJ8 A;  2EWB A;  3PZJ A;  1VKC A;  2HQY A;  3VAT A;  4B5O A;  4C2X A;  2PJ2 A;  2AFW A;  5AG7 A;  2NSM A;  3D2M A;  3JTK A;  3DR6 A;  1TF8 A;  2DPS A;  3RAM A;  2WZN A;  2CF4 A;  2QML A;  1QSO A;  4Q36 A;  3C26 A;  1X10 A;  3DSB A;  2Q7B A;  3DGV A;  3EXN A;  4NGM A;  1XF8 A;  5CBM A;  3VH9 A;  5HMN A;  2JDD A;  4MFK A;  5K8M A;  1ELM P;  3FEC A;  3KQZ A;  4UCN A;  2J8M A;  5F49 A;  4CGN A;  2ZW5 A;  1I12 A;  2XEJ A;  4OID A;  4HNY B;  1IYK A;  4R6T A;  4P4I A;  2R98 A;  3PGP A;  2DXQ A;  4JXQ A;  3S6F A;  3KI9 A;  4M3S A;  4E8O A;  3GIU A;  4FWU A;  2DPT A;  2V8G A;  2ZEF A;  4IF5 A;  2H5M A;  4CAF A;  1HEE A;  4CYQ A;  2PQ8 A;  2Z3O A;  2HB6 A;  4MCS A;  3FB3 A;  3IWG A;  3K9U A;  1ON0 A;  1K4J A;  4W9Y A;  2CNM A;  2PIZ A;  2JEV A;  2FVG A;  4P10 A;  4KVX A;  2Q7S A;  3S6H A;  4CAE A;  3BHX A;  3FYN A; 
#chains in the Genus database with same CATH homology
 3QAY A;  5EMI A;  4EFD A;  1JWQ A;  3NE8 A;  4M6H A;  1XOV A;  3CZX A;  4LQ6 A;  4RN7 A;  4BIN A;  2HB6 A;  2Q7S A;  2ODF A;  2HC9 A;  4M6I A;  4M6G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...