4M6IA

Structure of the reduced, zn-bound form of mycobacterium tuberculosis peptidoglycan amidase rv3717
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
214
structure length
185
Chain Sequence
IAGMVVFIDPGHTSTNSGYPEHTFTWETGLRLRAALNALGVRTALSRGNDGPCVDERANMANALRPNAIVSLHADGGPASGRGFHVNYSAPPLNAIQAGPSVQFARIMRDQLQASGIPKANYIGQDGLYGRSDLAGLNLAQYPSILVELGNMKNPADSALMESAEGRQKYANALVRGVAGFLATQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Peptidoglycan Amidase Rv3717
publication title Structural and Biochemical Analyses of Mycobacterium tuberculosis N-Acetylmuramyl-L-alanine Amidase Rv3717 Point to a Role in Peptidoglycan Fragment Recycling.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
total genus 77
structure length 185
sequence length 214
chains with identical sequence B
ec nomenclature ec 3.5.-.-:
pdb deposition date 2013-08-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01520 Amidase_3 N-acetylmuramoyl-L-alanine amidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.40 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn-dependent exopeptidases 4m6iA00
3CZXA 3NE8A 4M6IA 3QAYA 5EMIA 2Q7SA 4M6HA 1XOVA 2ODFA 4LQ6A 1JWQA 4RN7A 4M6GA 4BINA
chains in the Genus database with same CATH superfamily
4PXDA 3PZJA 3TOAA 3ISXA 3KHZA 1VKCA 1M4DA 2R7HA 4RS2A 2YNCA 4IF5A 2YNDA 5LRJA 1IOIA 4WWVA 2QECA 5AGEA 2FIWA 3CZXA 3D7DA 3RNZA 1Y0YA 3ZJ0A 1YW4A 3T8WA 1XJOA 2NSMA 4KSAA 3NA6A 1I21A 2OZHA 3JUWA 4DJLA 1HDQA 4DYOA 1V0CA 1PUAA 2BOAA 3KGQA 1XF8A 2GANA 1YK3A 3JVNA 3PGPA 1QQ9A 4O23A 1GHEA 4EFDA 4KUBA 4UIAA 4XNHC 2Z3OA 4R76A 3G8WA 2G3TA 3F0AA 5J1QA 1CJWA 2HB6A 3K9TA 2YNCC 3H4QA 2AFXA 4R7MA 1RO5A 2RC4A 4UEFA 4FAIA 2PJAA 4NFRA 4FD7A 3GIUA 4GS4A 4FD5A 2J9AA 2ZPAA 4QUSA 4NXYA 4KOTA 3B35A 2P6EA 4MY0A 4KOWA 4X8IA 4AVBA 1M1DA 3L2NA 1HDUA 2V77A 2F8HA 1Y9WA 2FSRA 3I9SA 1IU8A 4IK2A 2JEVA 4OMEA 5IB9A 5H84A 4CGLA 2XEJA 2ZW7A 2PRQA 2PJ2A 3B3WA 3MRUA 4MHNA 4OADA 3D7HA 4F9VA 2PC1A 3NFZA 5BWAB 3TO6A 4A32A 1VHOA 4MY3A 4Q7AA 3WR7A 2YGWA 2D4OA 4NGSA 4K3NA 4CYNA 4CPAA 4KOUA 3C26A 2PJBA 3KQZA 2C6GA 2R1IA 1TXRA 4II9A 1VIXA 3CXPA 3V38A 4NEXA 4BINA 3D4UA 4FBEA 3EO4A 1AUGA 3PBEA 2Q0YA 3D2PA 3GKRA 2VQYA 4UBRA 1PYTB 1KZFA 3SJEA 4JJXA 1XBUA 2Q7SA 3CT9A 3FB3A 2OH1A 2WZNA 4L89A 1Y0RA 1PCAA 2PJ4A 3N5FA 3NH8A 4CAFA 5AG4A 3IGRA 3SJFA 4B12A 2B5GB 1QSTA 4C2ZA 3BHXA 3S6GA 3TX8A 4M6IA 1KUYA 1LFWA 1X12A 1S60A 4M6HA 4NCZA 2QMLA 1S7LA 2PJ9A 2VZYA 3D8PA 2B3VA 1CPXA 2OR4A 5C88A 3DGVA 2WPXA 1MJBA 1WWZA 2AJ6A 4NGMA 1CPSA 5D29A 4KOYA 4CRYB 4P6YA 3B3TA 1BOBA 4XPKA 1FNOA 2V8DA 2AE6A 3NE7A 2ZEEA 4MMOA 3B3CA 4AG9A 3NH5A 3RYOA 1ZG8A 1Q2DA 2B4DB 2BUEA 1CP6A 4MBUA 1YW6A 3F8KA 2Q04A 3DLJA 1ZG7A 2Z3KA 2PR8A 2EUIA 3WABA 4EMEA 1S7KA 4KSIA 2WSAA 3DR6A 4P4DA 3LMSA 5HVFA 1M4IA 4RI1A 3MGDA 5EBVA 4UFWA 2EO8A 1IYLA 4NJRA 4MFLA 1MJAA 4OC2A 2CF4A 2OZGA 2P6FA 4Y49B 2DEAA 3S6KA 1IGBA 4JXRA 4WJBA 2Q7BA 4MFQA 1IB1E 2P6GA 4ZX8A 2P0WA 2ZOFA 1Y7RA 4DUKA 3LD2A 1A2ZA 2PR1A 3FRMA 3DSBA 4XPDC 5K8PA 1YLOA 1TKJA 4ZGYB 2Q4YA 1Y9KA 3KASA 4MHYA 3FX6A 2ZENA 4LQGA 3D67A 1HEEA 1ELMP 2BO9A 4Z65A 5LYLA 4GM5A 4TNUA 3CXQA 4MHDA 3D2MA 2CNMA 2GREA 1YR0A 4GXHA 4PQAA 2WUUA 3R9GA 3ZZIA 4BBHA 5IX3A 1YVOA 5CNPA 1Z2LA 1QSRA 2D4PA 1UWYA 4QBJA 2B58A 2NYQA 2PJ3A 3FVLA 4NJQA 1AMPA 1EE3P 1JQGA 4B13A 4P4IA 1CM0A 2J8MA 4A39A 3MN8A 3TC8A 5D8NA 2IJZA 2VEZA 2PJ6A 1F57A 3FECA 2Q4VA 4OKOA 3R96A 4CYOA 4F8ZA 4YWYA 1XMTA 4HNYB 1VHSA 1DE4C 3W6SA 4AVAA 3GB0A 2O4HA 4LX9A 5JH9A 3IEHA 3SI0A 1L0CA 1R3NA 2Z10A 1N71A 4NF1A 5A28A 4KVME 3SHPA 1FT7A 4LQ6A 1ON0A 3KQXA 4JWPA 2PJ1A 2V8GA 4MJ8A 5G22A 2GLFA 3KR5A 1ZLHA 4MXUA 4P4FA 2CNSA 1PU9A 4ZI6A 1CP7A 1JWQA 4B14A 8CPAA 2REFA 3SJXA 5H86A 5AG6A 4B11A 3GY9A 3IC1A 2ZW6A 3FMCA 4CAXA 2J8NA 4NGQA 1IOFA 1F2PA 4OAEA 4JXQA 5G1ZA 3CDXA 4JZ0A 4P4EA 3PB4X 2QYVA 1LAPA 4UCPA 1NMTA 2AFMA 4TWEA 4A2ZA 4C7HA 4CGPA 4F6AA 3BI1A 1XRYA 4A33A 4KLVA 2JBKA 4C2YA 4JLYA 4HNWB 2F5IA 5LYFA 3DDDA 2RFHA 2PIZA 1M44A 2B5GA 2ZEMA 3EC4A 4FUUA 1R57A 4KORA 2JBJA 3S6HA 4B5OA 4KUAA 1ZLIA 2R98A 4A95A 2FT0A 2I3CA 4ONUA 4F0XA 1Z4RA 4UWIA 4YFJA 4B5PB 2PCUA 3IJ3A 1LCPA 3CXSA 4IHMA 1SQHA 4UCNA 3RZAA 2B3UA 3IFEA 1BPNA 2FS5A 3PRTA 3KL9A 2B4DA 4MCSA 4OIWA 1LRZA 1IICA 2CIJA 3VWDA 2XEIA 5AG5A 2PSWA 4FD4A 2NMTA 1ARMA 1XOVA 3FNCA 4DNCA 3D66A 3A9LA 2FVGA 2C27A 4PXCA 2DPSA 2PJ8A 4BMHA 3DR8A 1RTQA 4IAVA 4A31A 1H8LA 2V8HA 4K30A 1P4NA 4E2AA 4PSWA 2A4NA 3HLPA 5IB0A 2WYRA 3VWEA 5CPAA 5EC4A 4ZX9A 2CY2A 2IL4A 3QAHA 4R9MA 3IWWA 3KHXA 3PFEA 4UA3A 3H5ZA 2CTBA 4KOVA 4XNHB 5F09A 5HVHA 1J4JA 2K5TA 2GIVA 2PVWA 2F7VA 2HUZA 2WPWA 3IO1A 4NGNA 4ONWA 1QSNA 3SI2A 4AB7A 3I1UA 3UY5A 3R1KA 4KOXA 2QVPA 2AFSA 5F46A 2G9DA 4OLLA 4MRIA 2GFQA 3KR4A 1LOKA 4P44A 4CYPA 2ARHA 4H6ZA 2EBJA 4MCQA 3RO0A 3TE4A 3H8EA 3SJGA 4FD6A 1YVKA 3TTHA 1P0HA 1IY7A 4OC1A 1BLLE 3NE8A 4CGMA 4C2XA 4M85A 3TO9A 4CYQA 2QJ8A 1ELLP 4R57A 1M4LA 1M4GA 2R8VA 1CX8A 3OWCA 4R87A 1IYKA 3PB8X 1Z8XA 4YRHA 2ODFA 5HVGA 3FXTA 4UCMA 4JD6A 4PXBA 3T9YA 1Z8TA 2Z3NA 4LUAA 4OIDA 3R9FA 4J3GA 5J8CA 2DXQA 1CG2A 3KKWA 4CGNA 3SXOA 4MI4A 2PE3A 4F9UA 1QSMA 1YLEA 4MFKA 3D7FA 3GUXA 3LACA 3H8FA 4H6UA 2Q43A 4MHZA 2OOTA 4A37A 4MCRA 3CPAA 3K2KA 4QB9A 2EK9A 3FH4A 3VARA 1B87A 3WC5A 1U6MA 2HC9A 2PRBA 1Z8WA 3FBUA 4PV6A 1KUVA 2FXFA 4OC4A 1AYEA 1YGHA 5K8NA 4Q38A 4ZY1A 2VZZA 5AG7A 3W6XA 2ZEDA 3N7ZA 2ANPA 4A94A 3TFYA 4MFPA 2ZEHA 4U9ZA 5F49A 2ZEFA 4QC6A 5DWNA 5J8FA 3IU2A 1I12A 1Q2CA 2PJ7A 2XEGA 4R3KA 4UFXA 1YQEA 5ELYA 3IU1A 1Q2YA 2PQ8A 2PJ5A 2Q44A 1LANA 4OP4A 1ZO0A 3B3SA 3FYNA 2VI7A 4AVCA 4X3RA 1VHEA 3BI0A 2AFZA 2ZXVA 5LRGA 1QSOA 3FF3A 1KUXA 5THWA 5LRKA 3PB7X 3V8IA 2BSWA 3QNVA 4CAVA 2HV2A 4ZY2A 1WK4A 3EY5A 4P4BA 4XPLA 4FWUA 3B2YA 4IUSA 3ISZA 3D68A 2G0BA 3D7GA 4NGTA 3RAMA 3BLNA 4ZBGA 3GLJA 4EWTA 2ZEPA 2OU2A 3PFOA 3TOBA 1ARLA 3T90A 5FVJA 2BEIA 4I49A 4E0AA 5KTDA 5HH1A 2BL1A 4MCPA 2EK8A 2FCKA 4PSXA 2Z3LA 2EWBA 1GYTA 4KVOE 5ISVA 3IWEA 3EFAA 1Z5RA 3K9UA 1Z9UA 3B7IA 4KZTA 4OC5A 1YSJA 5JM6A 4A38A 3PEIA 2Z3MA 4C68A 2AFUA 4ZYQA 2POKA 2VXKA 4UF4A 2ATRA 4HKFA 1Y7EA 4NSQA 4L8AA 2XEFA 2ZW4A 3G3SA 4M6GA 4UFVA 1Z4EA 4KSFA 3WT4A 1TF9A 1IIDA 4CS0B 2I00A 4HPSA 1R43A 3BJ8A 1B6BA 1CBXA 5HMNA 3RBUA 4R3LA 1XFOA 4JYWA 1NSLA 2JDCA 2OB0A 4AXVA 4W9YA 1OBRA 5GCNA 4UIBA 5LYIA 6CPAA 2AFOA 4NGRA 2EVNA 3GYAA 2PJCA 3P2HA 4UEEA 1S5KA 1S7NA 2C1CA 3R95A 4PPZA 3HUVA 1TKFA 5JQ4A 4Y49C 5HXDA 2JEWA 1VGYA 1MK4A 3TT2A 4UWJA 3SI1A 1KWMA 4Q36A 5I4MA 4R8FA 1ZG9A 3FJUA 3CPXA 4B10A 2CXAA 2Z3PA 1YX0A 1XE4A 2CNTA 2Q4ZA 3P2FA 4YU9A 5IV0A 5KTCA 1RXTA 1XMBA 2GE3A 3F5BA 3SXNA 3S9LA 2ZOGA 2C6CA 2ZEOA 1TKHA 2V8VA 3KI9A 3LODA 2PJ0A 4PK3A 1FY7A 4F0YA 5I0CA 2ZW5A 4MFZA 5K8OA 1XIXA 2O53A 4BD9A 2KCWA 2Z0ZA 3KZWA 1NE9A 2DF5A 2IQ6A 3QAYA 4PXEA 4KS9A 5F48A 3VATA 4MHPA 5LYDA 3TO7A 1K4JA 4AG7A 2JLMA 4A30A 2G3AA 5KTAA 3B8GA 1XEBA 2O28A 3FIXA 4NGPA 1BPMA 2H5MA 2C6PA 4RUHA 2PVVA 4KLWA 5G20A 3E0KA 3IWGA 2JDDA 3D3SA 4PK2A 4QVTA 2FIAA 4CAEA 3LWUA 3QB8A 4G1PA 4R6TA 3TCVA 2IMOA 1YREA 2FE7A 2PIYA 2RB7A 3FEDA 5F47A 4C7IA 4E8OA 2REEA 3B3VA 1S3ZA 5DS0A 4CAWA 1I1DA 3S6FA 1Z8LA 2ZEGA 4U5YA 5A27A 2QIRA 2PDOA 4KVXA 3V7ZA 2GLJA 1TF8A 2J8RA 3S9NA 4M3SA 3S9MA 3NH4A 4ORFA 3WC6A 2GU2A 1YMEA 3PP9A 3W91A 5EMIA 3FEEA 4HNXB 4CGOA 2VBQA 2X7BA 5K8MA 3WC7A 1OZPA 4U9YA 4B5PA 5CBMA 3BXMA 3BJ7A 3PB9X 4H89A 4OC3A 5C82A 1X10A 4B6ZA 1TIQA 1S7FA 2Z11A 3PBBA 4X2TA 2YNEA 4ZY0A 3VH9A 3IIBA 3JTKA 5JGFA 4CRZB 2ZELA 3H8GA 2CTCA 2ABZA 4OC0A 7CPAA 4XPDB 2Y0MA 4UEZA 5E96A 2HQYA 2I79A 2VL1A 4MFJA 1MJ9A 1QMUA 5JPHA 3DNSA 4P4JA 4P45A 3R9EA 2B4BA 1NSAA 2BCOA 2AFWA 1BAVA 4EVYA 2FL4A 2OZUA 1UFHA 4P10A 3I3GA 3JRUA 3PB6X 1BO4A 1DTDA 1F2OA 4H2KA 1LAMA 4YGOA 1Q7LA 5G21A 2Q51A 4RN7A 5DWMA 4X5KA 4KOSA 2DPTA 3EXNA
chains in the Genus database with same CATH topology
2HC9A 2HB6A 3CZXA 3NE8A 4M6IA 3QAYA 5EMIA 2Q7SA 4M6HA 1XOVA 2ODFA 4LQ6A 1JWQA 4EFDA 4RN7A 4M6GA 4BINA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CZX A;  3NE8 A;  4M6I A;  3QAY A;  5EMI A;  2Q7S A;  4M6H A;  1XOV A;  2ODF A;  4LQ6 A;  1JWQ A;  4RN7 A;  4M6G A;  4BIN A; 
#chains in the Genus database with same CATH topology
 4PXD A;  3PZJ A;  3TOA A;  3ISX A;  3KHZ A;  1VKC A;  1M4D A;  2R7H A;  4RS2 A;  2YNC A;  4IF5 A;  2YND A;  5LRJ A;  1IOI A;  4WWV A;  2QEC A;  5AGE A;  2FIW A;  3CZX A;  3D7D A;  3RNZ A;  1Y0Y A;  3ZJ0 A;  1YW4 A;  3T8W A;  1XJO A;  2NSM A;  4KSA A;  3NA6 A;  1I21 A;  2OZH A;  3JUW A;  4DJL A;  1HDQ A;  4DYO A;  1V0C A;  1PUA A;  2BOA A;  3KGQ A;  1XF8 A;  2GAN A;  1YK3 A;  3JVN A;  3PGP A;  1QQ9 A;  4O23 A;  1GHE A;  4EFD A;  4KUB A;  4UIA A;  4XNH C;  2Z3O A;  4R76 A;  3G8W A;  2G3T A;  3F0A A;  5J1Q A;  1CJW A;  2HB6 A;  3K9T A;  2YNC C;  3H4Q A;  2AFX A;  4R7M A;  1RO5 A;  2RC4 A;  4UEF A;  4FAI A;  2PJA A;  4NFR A;  4FD7 A;  3GIU A;  4GS4 A;  4FD5 A;  2J9A A;  2ZPA A;  4QUS A;  4NXY A;  4KOT A;  3B35 A;  2P6E A;  4MY0 A;  4KOW A;  4X8I A;  4AVB A;  1M1D A;  3L2N A;  1HDU A;  2V77 A;  2F8H A;  1Y9W A;  2FSR A;  3I9S A;  1IU8 A;  4IK2 A;  2JEV A;  4OME A;  5IB9 A;  5H84 A;  4CGL A;  2XEJ A;  2ZW7 A;  2PRQ A;  2PJ2 A;  3B3W A;  3MRU A;  4MHN A;  4OAD A;  3D7H A;  4F9V A;  2PC1 A;  3NFZ A;  5BWA B;  3TO6 A;  4A32 A;  1VHO A;  4MY3 A;  4Q7A A;  3WR7 A;  2YGW A;  2D4O A;  4NGS A;  4K3N A;  4CYN A;  4CPA A;  4KOU A;  3C26 A;  2PJB A;  3KQZ A;  2C6G A;  2R1I A;  1TXR A;  4II9 A;  1VIX A;  3CXP A;  3V38 A;  4NEX A;  4BIN A;  3D4U A;  4FBE A;  3EO4 A;  1AUG A;  3PBE A;  2Q0Y A;  3D2P A;  3GKR A;  2VQY A;  4UBR A;  1PYT B;  1KZF A;  3SJE A;  4JJX A;  1XBU A;  2Q7S A;  3CT9 A;  3FB3 A;  2OH1 A;  2WZN A;  4L89 A;  1Y0R A;  1PCA A;  2PJ4 A;  3N5F A;  3NH8 A;  4CAF A;  5AG4 A;  3IGR A;  3SJF A;  4B12 A;  2B5G B;  1QST A;  4C2Z A;  3BHX A;  3S6G A;  3TX8 A;  4M6I A;  1KUY A;  1LFW A;  1X12 A;  1S60 A;  4M6H A;  4NCZ A;  2QML A;  1S7L A;  2PJ9 A;  2VZY A;  3D8P A;  2B3V A;  1CPX A;  2OR4 A;  5C88 A;  3DGV A;  2WPX A;  1MJB A;  1WWZ A;  2AJ6 A;  4NGM A;  1CPS A;  5D29 A;  4KOY A;  4CRY B;  4P6Y A;  3B3T A;  1BOB A;  4XPK A;  1FNO A;  2V8D A;  2AE6 A;  3NE7 A;  2ZEE A;  4MMO A;  3B3C A;  4AG9 A;  3NH5 A;  3RYO A;  1ZG8 A;  1Q2D A;  2B4D B;  2BUE A;  1CP6 A;  4MBU A;  1YW6 A;  3F8K A;  2Q04 A;  3DLJ A;  1ZG7 A;  2Z3K A;  2PR8 A;  2EUI A;  3WAB A;  4EME A;  1S7K A;  4KSI A;  2WSA A;  3DR6 A;  4P4D A;  3LMS A;  5HVF A;  1M4I A;  4RI1 A;  3MGD A;  5EBV A;  4UFW A;  2EO8 A;  1IYL A;  4NJR A;  4MFL A;  1MJA A;  4OC2 A;  2CF4 A;  2OZG A;  2P6F A;  4Y49 B;  2DEA A;  3S6K A;  1IGB A;  4JXR A;  4WJB A;  2Q7B A;  4MFQ A;  1IB1 E;  2P6G A;  4ZX8 A;  2P0W A;  2ZOF A;  1Y7R A;  4DUK A;  3LD2 A;  1A2Z A;  2PR1 A;  3FRM A;  3DSB A;  4XPD C;  5K8P A;  1YLO A;  1TKJ A;  4ZGY B;  2Q4Y A;  1Y9K A;  3KAS A;  4MHY A;  3FX6 A;  2ZEN A;  4LQG A;  3D67 A;  1HEE A;  1ELM P;  2BO9 A;  4Z65 A;  5LYL A;  4GM5 A;  4TNU A;  3CXQ A;  4MHD A;  3D2M A;  2CNM A;  2GRE A;  1YR0 A;  4GXH A;  4PQA A;  2WUU A;  3R9G A;  3ZZI A;  4BBH A;  5IX3 A;  1YVO A;  5CNP A;  1Z2L A;  1QSR A;  2D4P A;  1UWY A;  4QBJ A;  2B58 A;  2NYQ A;  2PJ3 A;  3FVL A;  4NJQ A;  1AMP A;  1EE3 P;  1JQG A;  4B13 A;  4P4I A;  1CM0 A;  2J8M A;  4A39 A;  3MN8 A;  3TC8 A;  5D8N A;  2IJZ A;  2VEZ A;  2PJ6 A;  1F57 A;  3FEC A;  2Q4V A;  4OKO A;  3R96 A;  4CYO A;  4F8Z A;  4YWY A;  1XMT A;  4HNY B;  1VHS A;  1DE4 C;  3W6S A;  4AVA A;  3GB0 A;  2O4H A;  4LX9 A;  5JH9 A;  3IEH A;  3SI0 A;  1L0C A;  1R3N A;  2Z10 A;  1N71 A;  4NF1 A;  5A28 A;  4KVM E;  3SHP A;  1FT7 A;  4LQ6 A;  1ON0 A;  3KQX A;  4JWP A;  2PJ1 A;  2V8G A;  4MJ8 A;  5G22 A;  2GLF A;  3KR5 A;  1ZLH A;  4MXU A;  4P4F A;  2CNS A;  1PU9 A;  4ZI6 A;  1CP7 A;  1JWQ A;  4B14 A;  8CPA A;  2REF A;  3SJX A;  5H86 A;  5AG6 A;  4B11 A;  3GY9 A;  3IC1 A;  2ZW6 A;  3FMC A;  4CAX A;  2J8N A;  4NGQ A;  1IOF A;  1F2P A;  4OAE A;  4JXQ A;  5G1Z A;  3CDX A;  4JZ0 A;  4P4E A;  3PB4 X;  2QYV A;  1LAP A;  4UCP A;  1NMT A;  2AFM A;  4TWE A;  4A2Z A;  4C7H A;  4CGP A;  4F6A A;  3BI1 A;  1XRY A;  4A33 A;  4KLV A;  2JBK A;  4C2Y A;  4JLY A;  4HNW B;  2F5I A;  5LYF A;  3DDD A;  2RFH A;  2PIZ A;  1M44 A;  2B5G A;  2ZEM A;  3EC4 A;  4FUU A;  1R57 A;  4KOR A;  2JBJ A;  3S6H A;  4B5O A;  4KUA A;  1ZLI A;  2R98 A;  4A95 A;  2FT0 A;  2I3C A;  4ONU A;  4F0X A;  1Z4R A;  4UWI A;  4YFJ A;  4B5P B;  2PCU A;  3IJ3 A;  1LCP A;  3CXS A;  4IHM A;  1SQH A;  4UCN A;  3RZA A;  2B3U A;  3IFE A;  1BPN A;  2FS5 A;  3PRT A;  3KL9 A;  2B4D A;  4MCS A;  4OIW A;  1LRZ A;  1IIC A;  2CIJ A;  3VWD A;  2XEI A;  5AG5 A;  2PSW A;  4FD4 A;  2NMT A;  1ARM A;  1XOV A;  3FNC A;  4DNC A;  3D66 A;  3A9L A;  2FVG A;  2C27 A;  4PXC A;  2DPS A;  2PJ8 A;  4BMH A;  3DR8 A;  1RTQ A;  4IAV A;  4A31 A;  1H8L A;  2V8H A;  4K30 A;  1P4N A;  4E2A A;  4PSW A;  2A4N A;  3HLP A;  5IB0 A;  2WYR A;  3VWE A;  5CPA A;  5EC4 A;  4ZX9 A;  2CY2 A;  2IL4 A;  3QAH A;  4R9M A;  3IWW A;  3KHX A;  3PFE A;  4UA3 A;  3H5Z A;  2CTB A;  4KOV A;  4XNH B;  5F09 A;  5HVH A;  1J4J A;  2K5T A;  2GIV A;  2PVW A;  2F7V A;  2HUZ A;  2WPW A;  3IO1 A;  4NGN A;  4ONW A;  1QSN A;  3SI2 A;  4AB7 A;  3I1U A;  3UY5 A;  3R1K A;  4KOX A;  2QVP A;  2AFS A;  5F46 A;  2G9D A;  4OLL A;  4MRI A;  2GFQ A;  3KR4 A;  1LOK A;  4P44 A;  4CYP A;  2ARH A;  4H6Z A;  2EBJ A;  4MCQ A;  3RO0 A;  3TE4 A;  3H8E A;  3SJG A;  4FD6 A;  1YVK A;  3TTH A;  1P0H A;  1IY7 A;  4OC1 A;  1BLL E;  3NE8 A;  4CGM A;  4C2X A;  4M85 A;  3TO9 A;  4CYQ A;  2QJ8 A;  1ELL P;  4R57 A;  1M4L A;  1M4G A;  2R8V A;  1CX8 A;  3OWC A;  4R87 A;  1IYK A;  3PB8 X;  1Z8X A;  4YRH A;  2ODF A;  5HVG A;  3FXT A;  4UCM A;  4JD6 A;  4PXB A;  3T9Y A;  1Z8T A;  2Z3N A;  4LUA A;  4OID A;  3R9F A;  4J3G A;  5J8C A;  2DXQ A;  1CG2 A;  3KKW A;  4CGN A;  3SXO A;  4MI4 A;  2PE3 A;  4F9U A;  1QSM A;  1YLE A;  4MFK A;  3D7F A;  3GUX A;  3LAC A;  3H8F A;  4H6U A;  2Q43 A;  4MHZ A;  2OOT A;  4A37 A;  4MCR A;  3CPA A;  3K2K A;  4QB9 A;  2EK9 A;  3FH4 A;  3VAR A;  1B87 A;  3WC5 A;  1U6M A;  2HC9 A;  2PRB A;  1Z8W A;  3FBU A;  4PV6 A;  1KUV A;  2FXF A;  4OC4 A;  1AYE A;  1YGH A;  5K8N A;  4Q38 A;  4ZY1 A;  2VZZ A;  5AG7 A;  3W6X A;  2ZED A;  3N7Z A;  2ANP A;  4A94 A;  3TFY A;  4MFP A;  2ZEH A;  4U9Z A;  5F49 A;  2ZEF A;  4QC6 A;  5DWN A;  5J8F A;  3IU2 A;  1I12 A;  1Q2C A;  2PJ7 A;  2XEG A;  4R3K A;  4UFX A;  1YQE A;  5ELY A;  3IU1 A;  1Q2Y A;  2PQ8 A;  2PJ5 A;  2Q44 A;  1LAN A;  4OP4 A;  1ZO0 A;  3B3S A;  3FYN A;  2VI7 A;  4AVC A;  4X3R A;  1VHE A;  3BI0 A;  2AFZ A;  2ZXV A;  5LRG A;  1QSO A;  3FF3 A;  1KUX A;  5THW A;  5LRK A;  3PB7 X;  3V8I A;  2BSW A;  3QNV A;  4CAV A;  2HV2 A;  4ZY2 A;  1WK4 A;  3EY5 A;  4P4B A;  4XPL A;  4FWU A;  3B2Y A;  4IUS A;  3ISZ A;  3D68 A;  2G0B A;  3D7G A;  4NGT A;  3RAM A;  3BLN A;  4ZBG A;  3GLJ A;  4EWT A;  2ZEP A;  2OU2 A;  3PFO A;  3TOB A;  1ARL A;  3T90 A;  5FVJ A;  2BEI A;  4I49 A;  4E0A A;  5KTD A;  5HH1 A;  2BL1 A;  4MCP A;  2EK8 A;  2FCK A;  4PSX A;  2Z3L A;  2EWB A;  1GYT A;  4KVO E;  5ISV A;  3IWE A;  3EFA A;  1Z5R A;  3K9U A;  1Z9U A;  3B7I A;  4KZT A;  4OC5 A;  1YSJ A;  5JM6 A;  4A38 A;  3PEI A;  2Z3M A;  4C68 A;  2AFU A;  4ZYQ A;  2POK A;  2VXK A;  4UF4 A;  2ATR A;  4HKF A;  1Y7E A;  4NSQ A;  4L8A A;  2XEF A;  2ZW4 A;  3G3S A;  4M6G A;  4UFV A;  1Z4E A;  4KSF A;  3WT4 A;  1TF9 A;  1IID A;  4CS0 B;  2I00 A;  4HPS A;  1R43 A;  3BJ8 A;  1B6B A;  1CBX A;  5HMN A;  3RBU A;  4R3L A;  1XFO A;  4JYW A;  1NSL A;  2JDC A;  2OB0 A;  4AXV A;  4W9Y A;  1OBR A;  5GCN A;  4UIB A;  5LYI A;  6CPA A;  2AFO A;  4NGR A;  2EVN A;  3GYA A;  2PJC A;  3P2H A;  4UEE A;  1S5K A;  1S7N A;  2C1C A;  3R95 A;  4PPZ A;  3HUV A;  1TKF A;  5JQ4 A;  4Y49 C;  5HXD A;  2JEW A;  1VGY A;  1MK4 A;  3TT2 A;  4UWJ A;  3SI1 A;  1KWM A;  4Q36 A;  5I4M A;  4R8F A;  1ZG9 A;  3FJU A;  3CPX A;  4B10 A;  2CXA A;  2Z3P A;  1YX0 A;  1XE4 A;  2CNT A;  2Q4Z A;  3P2F A;  4YU9 A;  5IV0 A;  5KTC A;  1RXT A;  1XMB A;  2GE3 A;  3F5B A;  3SXN A;  3S9L A;  2ZOG A;  2C6C A;  2ZEO A;  1TKH A;  2V8V A;  3KI9 A;  3LOD A;  2PJ0 A;  4PK3 A;  1FY7 A;  4F0Y A;  5I0C A;  2ZW5 A;  4MFZ A;  5K8O A;  1XIX A;  2O53 A;  4BD9 A;  2KCW A;  2Z0Z A;  3KZW A;  1NE9 A;  2DF5 A;  2IQ6 A;  3QAY A;  4PXE A;  4KS9 A;  5F48 A;  3VAT A;  4MHP A;  5LYD A;  3TO7 A;  1K4J A;  4AG7 A;  2JLM A;  4A30 A;  2G3A A;  5KTA A;  3B8G A;  1XEB A;  2O28 A;  3FIX A;  4NGP A;  1BPM A;  2H5M A;  2C6P A;  4RUH A;  2PVV A;  4KLW A;  5G20 A;  3E0K A;  3IWG A;  2JDD A;  3D3S A;  4PK2 A;  4QVT A;  2FIA A;  4CAE A;  3LWU A;  3QB8 A;  4G1P A;  4R6T A;  3TCV A;  2IMO A;  1YRE A;  2FE7 A;  2PIY A;  2RB7 A;  3FED A;  5F47 A;  4C7I A;  4E8O A;  2REE A;  3B3V A;  1S3Z A;  5DS0 A;  4CAW A;  1I1D A;  3S6F A;  1Z8L A;  2ZEG A;  4U5Y A;  5A27 A;  2QIR A;  2PDO A;  4KVX A;  3V7Z A;  2GLJ A;  1TF8 A;  2J8R A;  3S9N A;  4M3S A;  3S9M A;  3NH4 A;  4ORF A;  3WC6 A;  2GU2 A;  1YME A;  3PP9 A;  3W91 A;  5EMI A;  3FEE A;  4HNX B;  4CGO A;  2VBQ A;  2X7B A;  5K8M A;  3WC7 A;  1OZP A;  4U9Y A;  4B5P A;  5CBM A;  3BXM A;  3BJ7 A;  3PB9 X;  4H89 A;  4OC3 A;  5C82 A;  1X10 A;  4B6Z A;  1TIQ A;  1S7F A;  2Z11 A;  3PBB A;  4X2T A;  2YNE A;  4ZY0 A;  3VH9 A;  3IIB A;  3JTK A;  5JGF A;  4CRZ B;  2ZEL A;  3H8G A;  2CTC A;  2ABZ A;  4OC0 A;  7CPA A;  4XPD B;  2Y0M A;  4UEZ A;  5E96 A;  2HQY A;  2I79 A;  2VL1 A;  4MFJ A;  1MJ9 A;  1QMU A;  5JPH A;  3DNS A;  4P4J A;  4P45 A;  3R9E A;  2B4B A;  1NSA A;  2BCO A;  2AFW A;  1BAV A;  4EVY A;  2FL4 A;  2OZU A;  1UFH A;  4P10 A;  3I3G A;  3JRU A;  3PB6 X;  1BO4 A;  1DTD A;  1F2O A;  4H2K A;  1LAM A;  4YGO A;  1Q7L A;  5G21 A;  2Q51 A;  4RN7 A;  5DWM A;  4X5K A;  4KOS A;  2DPT A;  3EXN A; 
#chains in the Genus database with same CATH homology
 2HC9 A;  2HB6 A;  3CZX A;  3NE8 A;  4M6I A;  3QAY A;  5EMI A;  2Q7S A;  4M6H A;  1XOV A;  2ODF A;  4LQ6 A;  1JWQ A;  4EFD A;  4RN7 A;  4M6G A;  4BIN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...