4M6IA

Structure of the reduced, zn-bound form of mycobacterium tuberculosis peptidoglycan amidase rv3717
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
214
structure length
185
Chain Sequence
IAGMVVFIDPGHTSTNSGYPEHTFTWETGLRLRAALNALGVRTALSRGNDGPCVDERANMANALRPNAIVSLHADGGPASGRGFHVNYSAPPLNAIQAGPSVQFARIMRDQLQASGIPKANYIGQDGLYGRSDLAGLNLAQYPSILVELGNMKNPADSALMESAEGRQKYANALVRGVAGFLATQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptidoglycan Amidase Rv3717
publication title Structural and Biochemical Analyses of Mycobacterium tuberculosis N-Acetylmuramyl-L-alanine Amidase Rv3717 Point to a Role in Peptidoglycan Fragment Recycling.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Hydrolase
total genus 77
structure length 185
sequence length 214
chains with identical sequence B
ec nomenclature ec 3.5.-.-:
pdb deposition date 2013-08-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01520 Amidase_3 N-acetylmuramoyl-L-alanine amidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.40 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn-dependent exopeptidases 4m6iA00
4BINA 1JWQA 3NE8A 5EMIA 4M6IA 4M6GA 4LQ6A 2ODFA 4M6HA 2Q7SA 3CZXA 3QAYA 4RN7A 1XOVA
chains in the Genus database with same CATH superfamily
2ZEEA 3FYNA 3IJ3A 3BJ8A 3DDDA 3KZWA 4OC1A 4U9ZA 1MJBA 4JXQA 2ZEGA 3I3GA 5LRJA 2EVNA 4IF5A 1BLLE 3IO1A 3NH5A 1AYEA 4UIAA 3FJUA 1BPMA 3B3SA 1IOFA 2VL1A 5F09A 1YLEA 4HNWB 3UY5A 1N71A 5D8NA 2GREA 4MCRA 3DSBA 5KTCA 4QBJA 1RO5A 3V7ZA 4NGTA 4YGOA 1ZO0A 3D66A 3F8KA 2XEJA 2C6CA 3LMSA 4JLYA 2PJBA 4CGLA 1YVKA 1Z8XA 4C7IA 1WK4A 3S9MA 2R98A 2PJAA 5I4MA 1Z9UA 2X7BA 4KLWA 3B8GA 4R3KA 3LACA 3FMCA 4UWIA 4A37A 4KLVA 2AFSA 1NSLA 3PFOA 1IYKA 3T90A 2R8VA 4NGQA 4MI4A 2OH1A 1IB1E 3IC1A 3KQXA 3NH4A 4HPSA 5C82A 1TKFA 1CBXA 2Z11A 5K8OA 3R9FA 7CPAA 5H84A 2G3AA 4NGNA 2BOAA 5J8FA 3SXOA 2IJZA 1VIXA 5AG6A 4OC2A 3CPAA 2B5GB 4ZYQA 2IMOA 2D4PA 1Z2LA 3SI2A 4PQAA 4QC6A 4BBHA 5JGFA 1XOVA 1NSAA 4OP4A 1WWZA 4AVCA 1S7KA 3SI0A 4RUHA 1Z8WA 4GS4A 4P4JA 1K4JA 3V38A 2VI7A 3D7GA 5JPHA 4F0XA 2Z3KA 3IGRA 4KOYA 4OC5A 2ZOGA 3BHXA 2POKA 3P2FA 3VH9A 3T9YA 2B5GA 4K30A 4ZY0A 3KR5A 4JZ0A 4MHYA 4B5PB 5ISVA 3FRMA 2FT0A 4KOVA 2BUEA 4NCZA 5G21A 4C7HA 2O28A 4EVYA 4GXHA 3BJ7A 2ODFA 3IWWA 5CPAA 2Q44A 2WSAA 3S9LA 4O23A 2J8MA 3IU2A 4MRIA 4JWPA 1S7NA 3PBBA 2KCWA 1Q7LA 4I49A 3RYOA 4CRYB 4Z65A 1QQ9A 1X10A 3H4QA 1I21A 4B5PA 5GCNA 3CXPA 2CTCA 3RBUA 4H89A 1CP7A 4MFPA 3EY5A 4Q36A 1XFOA 3GIUA 2RFHA 1Y7RA 4R8FA 4WWVA 2AFXA 3DGVA 4Q38A 1TXRA 2JBJA 4CAWA 1YX0A 4P4BA 5LYIA 5AG5A 1MJAA 2FVGA 4P44A 2WPXA 3EFAA 4H6ZA 2CNTA 3C26A 3HUVA 3SJFA 2AE6A 1BPNA 3FX6A 3R9EA 4JYWA 2CTBA 4FBEA 4MFZA 1M44A 4IUSA 4PK2A 3ZJ0A 3PZJA 4MXUA 4KOUA 2Q4YA 4OIWA 2V77A 1B87A 4HKFA 4LX9A 1AMPA 3D4UA 2VEZA 2Z3NA 4KOTA 2PJ2A 1P0HA 3VARA 4C68A 4P45A 3IWEA 1A2ZA 4LQ6A 4UWJA 2QVPA 3RZAA 1ELMP 5LRKA 5HH1A 2Z0ZA 3B7IA 3WABA 2Q7SA 4UEFA 2Z3MA 3I9SA 1GYTA 4CGNA 3PB4X 2XEFA 4UBRA 1Y0YA 2G0BA 4W9YA 4C2ZA 1IICA 1VGYA 2DXQA 2HC9A 4C2YA 1I12A 3PFEA 2CY2A 3SJEA 4P6YA 3EXNA 4UF4A 3FEDA 2D4OA 2OU2A 5K8MA 4H6UA 2PRBA 3HLPA 4R9MA 5CNPA 1KUVA 1ARMA 3FVLA 3H8GA 1Q2DA 1V0CA 4WJBA 1Y9KA 2O53A 1Z4RA 1H8LA 3D67A 4X5KA 1OZPA 1XF8A 5G22A 1YGHA 4CRZB 4BD9A 1QSMA 4CAXA 2F5IA 2P6FA 3KGQA 2VXKA 3S6KA 2ZENA 2PVVA 4M3SA 2NYQA 3N7ZA 2C6PA 3D8PA 4OIDA 1Y0RA 4K3NA 4OLLA 4YWYA 4FUUA 1LAPA 4X8IA 2WUUA 3KQZA 4NJQA 5D29A 1NMTA 3E0KA 4R57A 1F2OA 3KKWA 2FIAA 1ZG7A 5JQ4A 4CYNA 4B13A 5A28A 2PVWA 3FIXA 3K9UA 5AG4A 5HVGA 5C88A 3B35A 2BCOA 4OC4A 4ORFA 2PJ6A 3F5BA 3BXMA 3GUXA 1YSJA 1LANA 2AFMA 3W91A 2Q51A 1P4NA 3DR8A 4MCPA 4A39A 2ZXVA 3F0AA 1B6BA 4DYOA 5LYFA 4KOWA 5EBVA 4H2KA 3SI1A 1LAMA 4NGSA 1IYLA 2NSMA 2PJ7A 5I0CA 2AJ6A 3FEEA 2EO8A 4NXYA 4M6HA 4ZX9A 2PQ8A 2F7VA 1M4IA 4HNYB 4MCSA 3PB8X 1HDUA 3CT9A 5F47A 4DJLA 4UA3A 3FXTA 4JXRA 4QB9A 4B12A 2P6EA 3JTKA 1XEBA 3IIBA 3LD2A 4MFKA 3RNZA 2OZGA 3QNVA 1TIQA 4UCPA 1LFWA 1S7FA 4NFRA 1VHEA 1LCPA 4CAEA 3T8WA 1M4DA 1Z8LA 2PJCA 3RAMA 3TOBA 4J3GA 4DNCA 3S9NA 3CDXA 3MGDA 2B4BA 2PE3A 4HNXB 2K5TA 2VZZA 1UWYA 4A30A 4L8AA 4B14A 2REEA 4KSAA 4F6AA 1BOBA 4UIBA 5KTAA 3OWCA 3MN8A 4FD5A 4G1PA 3H8FA 4TWEA 4YU9A 2NMTA 2Z10A 2ZEHA 4UFWA 2HV2A 2PSWA 3MRUA 5THWA 2ZEOA 4NGMA 2XEIA 2G9DA 3KR4A 2FXFA 3KI9A 4P4EA 1YW6A 4B5OA 4II9A 1R43A 3B2YA 4PPZA 3KHZA 2B3VA 1CP6A 4FD7A 4Q7AA 1CM0A 1M4GA 3TCVA 3FF3A 3V8IA 4RN7A 2AFWA 4CPAA 1OBRA 4B6ZA 3S6GA 3FH4A 1CJWA 1S7LA 1PU9A 2PJ0A 3VWEA 1IGBA 4RI1A 4CGMA 3K2KA 2O4HA 4MBUA 4IHMA 5J8CA 4R76A 4KSFA 1ON0A 1U6MA 4KOSA 2GE3A 4PXEA 2BL1A 1YQEA 2Z3PA 3EO4A 4NGPA 4PXBA 4NSQA 2V8DA 2VQYA 3TT2A 1YLOA 4AG9A 4KVME 3R9GA 5F48A 3WC5A 2ZELA 4P4IA 4RS2A 2Q0YA 3FECA 3SJXA 4KVOE 4P10A 3D7FA 5EC4A 4CYOA 3D68A 4UEZA 4CAFA 3D7DA 2PJ1A 4M6IA 4F9VA 3JUWA 1J4JA 2Q4VA 4UFVA 5DWNA 4BMHA 1IIDA 2B58A 2ZEFA 2ZW4A 1FY7A 5ELYA 5G20A 2EWBA 3B3WA 4BINA 5G1ZA 1CG2A 3SHPA 4A38A 4ONWA 1XMBA 4AVBA 4CYQA 5HXDA 2G3TA 3TC8A 3EC4A 2Z3LA 2DPSA 4LQGA 3NE8A 3B3TA 3D2MA 3TFYA 2JBKA 4FD6A 2PIZA 3GB0A 5LYDA 5H86A 2FL4A 3A9LA 1IY7A 1F2PA 4F8ZA 2PIYA 3TO7A 2FS5A 3NH8A 2CNMA 4KUBA 1L0CA 2OZHA 2V8HA 4P4DA 2ANPA 3FB3A 2AFZA 2FCKA 2HQYA 4NEXA 1JWQA 3SJGA 3FBUA 4MFLA 3JRUA 3ISXA 4XNHB 4U5YA 3FNCA 4UFXA 5K8PA 5IX3A 2F8HA 4CS0B 4E8OA 3BLNA 3H5ZA 2C1CA 4M85A 5IB9A 4PV6A 4F0YA 1M1DA 1FT7A 2WYRA 2REFA 2GLJA 4XPLA 4ZY1A 4FD4A 1PYTB 3PB9X 3SXNA 3CXSA 1CPXA 3GKRA 2QJ8A 4A31A 2QECA 1QSNA 2RC4A 5IV0A 2PR1A 4MHZA 4KSIA 1VHOA 3RO0A 1TKHA 3QAHA 1R57A 4PXCA 4KS9A 4GM5A 2ZEMA 2JEVA 4OMEA 4KUAA 2GANA 4QUSA 2XEGA 4ZI6A 1KUXA 1DE4C 4P4FA 3IU1A 4XNHC 5A27A 3KHXA 1I1DA 6CPAA 2PJ4A 1XRYA 2DPTA 2FSRA 3TX8A 4ZGYB 4CGOA 1GHEA 4E2AA 2PR8A 3D2PA 3JVNA 2IQ6A 4C2XA 2CXAA 3PB6X 3VATA 1YW4A 4L89A 4MJ8A 4A2ZA 2B3UA 4Y49B 1ELLP 5DWMA 4UEEA 2YNDA 2Q7BA 2FE7A 3QB8A 1F57A 2OOTA 3N5FA 2ZW6A 5AG7A 3WC6A 4MHNA 2PRQA 5HVFA 4NF1A 4XPDB 1QMUA 2P0WA 3W6SA 2ZW5A 2JDCA 4R6TA 2AFOA 2I00A 3LWUA 1BO4A 5JH9A 2ZEPA 5E96A 3R95A 1S3ZA 2GU2A 3ISZA 3PP9A 3ZZIA 2PJ5A 2VBQA 1RXTA 3DNSA 2C27A 3DLJA 2EK9A 4MFJA 1YR0A 4OC3A 2ATRA 4IK2A 3WT4A 4AVAA 4FAIA 5DS0A 4R3LA 4OKOA 2HB6A 1YVOA 1DTDA 2CIJA 3D3SA 3IEHA 4OC0A 4A33A 4Y49C 1R3NA 2EK8A 2GFQA 2J9AA 1ZG8A 4KZTA 4X2TA 2A4NA 2QMLA 1UFHA 2HUZA 4MY0A 3IFEA 2PCUA 5K8NA 5AGEA 4KORA 4FWUA 2Q04A 2PC1A 4XPDC 2Q43A 1PCAA 2YGWA 3WC7A 2CNSA 2ZPAA 2OR4A 3R96A 1XJOA 1TF9A 3NE7A 3I1UA 1MK4A 3R1KA 1HEEA 1ZG9A 2OZUA 3LODA 1BAVA 3CPXA 2GIVA 3NA6A 4A94A 2CF4A 1TF8A 2V8GA 5HVHA 3BI1A 2J8RA 1TKJA 2JLMA 4MHPA 4U9YA 2BEIA 1KUYA 2EUIA 4NGRA 3CZXA 5F49A 4A32A 4F9UA 1KZFA 3TO9A 1JQGA 1RTQA 3TE4A 4PSWA 2R7HA 3B3VA 3NFZA 4NJRA 4M6GA 1YK3A 2V8VA 4A95A 1QSOA 2EBJA 1QSTA 5F46A 5IB0A 2ARHA 1YMEA 3BI0A 1LRZA 4B10A 2QIRA 2H5MA 3DR6A 4MY3A 4UCNA 4YRHA 3VWDA 1LOKA 2PJ3A 2Q4ZA 3PRTA 2C6GA 3GYAA 1Y7EA 2JDDA 4TNUA 1Q2CA 3PGPA 1ZLIA 4PXDA 4X3RA 1Z8TA 3PEIA 3D7HA 1CX8A 4QVTA 4B11A 3TO6A 4EFDA 3G8WA 4OADA 1S5KA 4CYPA 2FIWA 4AXVA 1PUAA 3H8EA 5CBMA 4IAVA 1EE3P 4YFJA 5KTDA 2PJ8A 3KASA 4PK3A 4ZY2A 1IOIA 4ONUA 4R87A 3WR7A 1S60A 3PB7X 5BWAB 5LYLA 1CPSA 2YNEA 1HDQA 4MHDA 4AG7A 2P6GA 1NE9A 4LUAA 2ZW7A 2Y0MA 1Z4EA 2B4DB 2DF5A 4R7MA 1XMTA 8CPAA 3QAYA 4MMOA 1XBUA 2BO9A 1Y9WA 4KVXA 3CXQA 2QYVA 2RB7A 4UCMA 2VZYA 3PBEA 2YNCA 4CGPA 1AUGA 2DEAA 4OAEA 3K9TA 5FVJA 3IWGA 2J8NA 3TOAA 4MFQA 3KL9A 1IU8A 5JM6A 4XPKA 1QSRA 2PDOA 1VKCA 1X12A 3W6XA 4EWTA 1FNOA 1XIXA 1ZLHA 3S6HA 3L2NA 4CAVA 2GLFA 4PSXA 2I3CA 2YNCC 1XE4A 2B4DA 2IL4A 5J1QA 1ARLA 2ZOFA 3G3SA 4E0AA 1YREA 2JEWA 4ZX8A 4MCQA 1M4LA 2ZEDA 4ZBGA 2OB0A 4AB7A 1KWMA 4JD6A 2BSWA 2WPWA 4DUKA 4EMEA 3S6FA 4KOXA 1MJ9A 2Z3OA 3GLJA 3GY9A 2ABZA 1Q2YA 2WZNA 2PJ9A 4JJXA 1Z5RA 5LRGA 5EMIA 3B3CA 3TTHA 5HMNA 2AFUA 1VHSA 3P2HA 2R1IA 2I79A 1SQHA
chains in the Genus database with same CATH topology
4BINA 1JWQA 3NE8A 5EMIA 4M6IA 4M6GA 2HC9A 4LQ6A 2ODFA 4M6HA 2HB6A 2Q7SA 3CZXA 4EFDA 3QAYA 4RN7A 1XOVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BIN A;  1JWQ A;  3NE8 A;  5EMI A;  4M6I A;  4M6G A;  4LQ6 A;  2ODF A;  4M6H A;  2Q7S A;  3CZX A;  3QAY A;  4RN7 A;  1XOV A; 
#chains in the Genus database with same CATH topology
 2ZEE A;  3FYN A;  3IJ3 A;  3BJ8 A;  3DDD A;  3KZW A;  4OC1 A;  4U9Z A;  1MJB A;  4JXQ A;  2ZEG A;  3I3G A;  5LRJ A;  2EVN A;  4IF5 A;  1BLL E;  3IO1 A;  3NH5 A;  1AYE A;  4UIA A;  3FJU A;  1BPM A;  3B3S A;  1IOF A;  2VL1 A;  5F09 A;  1YLE A;  4HNW B;  3UY5 A;  1N71 A;  5D8N A;  2GRE A;  4MCR A;  3DSB A;  5KTC A;  4QBJ A;  1RO5 A;  3V7Z A;  4NGT A;  4YGO A;  1ZO0 A;  3D66 A;  3F8K A;  2XEJ A;  2C6C A;  3LMS A;  4JLY A;  2PJB A;  4CGL A;  1YVK A;  1Z8X A;  4C7I A;  1WK4 A;  3S9M A;  2R98 A;  2PJA A;  5I4M A;  1Z9U A;  2X7B A;  4KLW A;  3B8G A;  4R3K A;  3LAC A;  3FMC A;  4UWI A;  4A37 A;  4KLV A;  2AFS A;  1NSL A;  3PFO A;  1IYK A;  3T90 A;  2R8V A;  4NGQ A;  4MI4 A;  2OH1 A;  1IB1 E;  3IC1 A;  3KQX A;  3NH4 A;  4HPS A;  5C82 A;  1TKF A;  1CBX A;  2Z11 A;  5K8O A;  3R9F A;  7CPA A;  5H84 A;  2G3A A;  4NGN A;  2BOA A;  5J8F A;  3SXO A;  2IJZ A;  1VIX A;  5AG6 A;  4OC2 A;  3CPA A;  2B5G B;  4ZYQ A;  2IMO A;  2D4P A;  1Z2L A;  3SI2 A;  4PQA A;  4QC6 A;  4BBH A;  5JGF A;  1XOV A;  1NSA A;  4OP4 A;  1WWZ A;  4AVC A;  1S7K A;  3SI0 A;  4RUH A;  1Z8W A;  4GS4 A;  4P4J A;  1K4J A;  3V38 A;  2VI7 A;  3D7G A;  5JPH A;  4F0X A;  2Z3K A;  3IGR A;  4KOY A;  4OC5 A;  2ZOG A;  3BHX A;  2POK A;  3P2F A;  3VH9 A;  3T9Y A;  2B5G A;  4K30 A;  4ZY0 A;  3KR5 A;  4JZ0 A;  4MHY A;  4B5P B;  5ISV A;  3FRM A;  2FT0 A;  4KOV A;  2BUE A;  4NCZ A;  5G21 A;  4C7H A;  2O28 A;  4EVY A;  4GXH A;  3BJ7 A;  2ODF A;  3IWW A;  5CPA A;  2Q44 A;  2WSA A;  3S9L A;  4O23 A;  2J8M A;  3IU2 A;  4MRI A;  4JWP A;  1S7N A;  3PBB A;  2KCW A;  1Q7L A;  4I49 A;  3RYO A;  4CRY B;  4Z65 A;  1QQ9 A;  1X10 A;  3H4Q A;  1I21 A;  4B5P A;  5GCN A;  3CXP A;  2CTC A;  3RBU A;  4H89 A;  1CP7 A;  4MFP A;  3EY5 A;  4Q36 A;  1XFO A;  3GIU A;  2RFH A;  1Y7R A;  4R8F A;  4WWV A;  2AFX A;  3DGV A;  4Q38 A;  1TXR A;  2JBJ A;  4CAW A;  1YX0 A;  4P4B A;  5LYI A;  5AG5 A;  1MJA A;  2FVG A;  4P44 A;  2WPX A;  3EFA A;  4H6Z A;  2CNT A;  3C26 A;  3HUV A;  3SJF A;  2AE6 A;  1BPN A;  3FX6 A;  3R9E A;  4JYW A;  2CTB A;  4FBE A;  4MFZ A;  1M44 A;  4IUS A;  4PK2 A;  3ZJ0 A;  3PZJ A;  4MXU A;  4KOU A;  2Q4Y A;  4OIW A;  2V77 A;  1B87 A;  4HKF A;  4LX9 A;  1AMP A;  3D4U A;  2VEZ A;  2Z3N A;  4KOT A;  2PJ2 A;  1P0H A;  3VAR A;  4C68 A;  4P45 A;  3IWE A;  1A2Z A;  4LQ6 A;  4UWJ A;  2QVP A;  3RZA A;  1ELM P;  5LRK A;  5HH1 A;  2Z0Z A;  3B7I A;  3WAB A;  2Q7S A;  4UEF A;  2Z3M A;  3I9S A;  1GYT A;  4CGN A;  3PB4 X;  2XEF A;  4UBR A;  1Y0Y A;  2G0B A;  4W9Y A;  4C2Z A;  1IIC A;  1VGY A;  2DXQ A;  2HC9 A;  4C2Y A;  1I12 A;  3PFE A;  2CY2 A;  3SJE A;  4P6Y A;  3EXN A;  4UF4 A;  3FED A;  2D4O A;  2OU2 A;  5K8M A;  4H6U A;  2PRB A;  3HLP A;  4R9M A;  5CNP A;  1KUV A;  1ARM A;  3FVL A;  3H8G A;  1Q2D A;  1V0C A;  4WJB A;  1Y9K A;  2O53 A;  1Z4R A;  1H8L A;  3D67 A;  4X5K A;  1OZP A;  1XF8 A;  5G22 A;  1YGH A;  4CRZ B;  4BD9 A;  1QSM A;  4CAX A;  2F5I A;  2P6F A;  3KGQ A;  2VXK A;  3S6K A;  2ZEN A;  2PVV A;  4M3S A;  2NYQ A;  3N7Z A;  2C6P A;  3D8P A;  4OID A;  1Y0R A;  4K3N A;  4OLL A;  4YWY A;  4FUU A;  1LAP A;  4X8I A;  2WUU A;  3KQZ A;  4NJQ A;  5D29 A;  1NMT A;  3E0K A;  4R57 A;  1F2O A;  3KKW A;  2FIA A;  1ZG7 A;  5JQ4 A;  4CYN A;  4B13 A;  5A28 A;  2PVW A;  3FIX A;  3K9U A;  5AG4 A;  5HVG A;  5C88 A;  3B35 A;  2BCO A;  4OC4 A;  4ORF A;  2PJ6 A;  3F5B A;  3BXM A;  3GUX A;  1YSJ A;  1LAN A;  2AFM A;  3W91 A;  2Q51 A;  1P4N A;  3DR8 A;  4MCP A;  4A39 A;  2ZXV A;  3F0A A;  1B6B A;  4DYO A;  5LYF A;  4KOW A;  5EBV A;  4H2K A;  3SI1 A;  1LAM A;  4NGS A;  1IYL A;  2NSM A;  2PJ7 A;  5I0C A;  2AJ6 A;  3FEE A;  2EO8 A;  4NXY A;  4M6H A;  4ZX9 A;  2PQ8 A;  2F7V A;  1M4I A;  4HNY B;  4MCS A;  3PB8 X;  1HDU A;  3CT9 A;  5F47 A;  4DJL A;  4UA3 A;  3FXT A;  4JXR A;  4QB9 A;  4B12 A;  2P6E A;  3JTK A;  1XEB A;  3IIB A;  3LD2 A;  4MFK A;  3RNZ A;  2OZG A;  3QNV A;  1TIQ A;  4UCP A;  1LFW A;  1S7F A;  4NFR A;  1VHE A;  1LCP A;  4CAE A;  3T8W A;  1M4D A;  1Z8L A;  2PJC A;  3RAM A;  3TOB A;  4J3G A;  4DNC A;  3S9N A;  3CDX A;  3MGD A;  2B4B A;  2PE3 A;  4HNX B;  2K5T A;  2VZZ A;  1UWY A;  4A30 A;  4L8A A;  4B14 A;  2REE A;  4KSA A;  4F6A A;  1BOB A;  4UIB A;  5KTA A;  3OWC A;  3MN8 A;  4FD5 A;  4G1P A;  3H8F A;  4TWE A;  4YU9 A;  2NMT A;  2Z10 A;  2ZEH A;  4UFW A;  2HV2 A;  2PSW A;  3MRU A;  5THW A;  2ZEO A;  4NGM A;  2XEI A;  2G9D A;  3KR4 A;  2FXF A;  3KI9 A;  4P4E A;  1YW6 A;  4B5O A;  4II9 A;  1R43 A;  3B2Y A;  4PPZ A;  3KHZ A;  2B3V A;  1CP6 A;  4FD7 A;  4Q7A A;  1CM0 A;  1M4G A;  3TCV A;  3FF3 A;  3V8I A;  4RN7 A;  2AFW A;  4CPA A;  1OBR A;  4B6Z A;  3S6G A;  3FH4 A;  1CJW A;  1S7L A;  1PU9 A;  2PJ0 A;  3VWE A;  1IGB A;  4RI1 A;  4CGM A;  3K2K A;  2O4H A;  4MBU A;  4IHM A;  5J8C A;  4R76 A;  4KSF A;  1ON0 A;  1U6M A;  4KOS A;  2GE3 A;  4PXE A;  2BL1 A;  1YQE A;  2Z3P A;  3EO4 A;  4NGP A;  4PXB A;  4NSQ A;  2V8D A;  2VQY A;  3TT2 A;  1YLO A;  4AG9 A;  4KVM E;  3R9G A;  5F48 A;  3WC5 A;  2ZEL A;  4P4I A;  4RS2 A;  2Q0Y A;  3FEC A;  3SJX A;  4KVO E;  4P10 A;  3D7F A;  5EC4 A;  4CYO A;  3D68 A;  4UEZ A;  4CAF A;  3D7D A;  2PJ1 A;  4M6I A;  4F9V A;  3JUW A;  1J4J A;  2Q4V A;  4UFV A;  5DWN A;  4BMH A;  1IID A;  2B58 A;  2ZEF A;  2ZW4 A;  1FY7 A;  5ELY A;  5G20 A;  2EWB A;  3B3W A;  4BIN A;  5G1Z A;  1CG2 A;  3SHP A;  4A38 A;  4ONW A;  1XMB A;  4AVB A;  4CYQ A;  5HXD A;  2G3T A;  3TC8 A;  3EC4 A;  2Z3L A;  2DPS A;  4LQG A;  3NE8 A;  3B3T A;  3D2M A;  3TFY A;  2JBK A;  4FD6 A;  2PIZ A;  3GB0 A;  5LYD A;  5H86 A;  2FL4 A;  3A9L A;  1IY7 A;  1F2P A;  4F8Z A;  2PIY A;  3TO7 A;  2FS5 A;  3NH8 A;  2CNM A;  4KUB A;  1L0C A;  2OZH A;  2V8H A;  4P4D A;  2ANP A;  3FB3 A;  2AFZ A;  2FCK A;  2HQY A;  4NEX A;  1JWQ A;  3SJG A;  3FBU A;  4MFL A;  3JRU A;  3ISX A;  4XNH B;  4U5Y A;  3FNC A;  4UFX A;  5K8P A;  5IX3 A;  2F8H A;  4CS0 B;  4E8O A;  3BLN A;  3H5Z A;  2C1C A;  4M85 A;  5IB9 A;  4PV6 A;  4F0Y A;  1M1D A;  1FT7 A;  2WYR A;  2REF A;  2GLJ A;  4XPL A;  4ZY1 A;  4FD4 A;  1PYT B;  3PB9 X;  3SXN A;  3CXS A;  1CPX A;  3GKR A;  2QJ8 A;  4A31 A;  2QEC A;  1QSN A;  2RC4 A;  5IV0 A;  2PR1 A;  4MHZ A;  4KSI A;  1VHO A;  3RO0 A;  1TKH A;  3QAH A;  1R57 A;  4PXC A;  4KS9 A;  4GM5 A;  2ZEM A;  2JEV A;  4OME A;  4KUA A;  2GAN A;  4QUS A;  2XEG A;  4ZI6 A;  1KUX A;  1DE4 C;  4P4F A;  3IU1 A;  4XNH C;  5A27 A;  3KHX A;  1I1D A;  6CPA A;  2PJ4 A;  1XRY A;  2DPT A;  2FSR A;  3TX8 A;  4ZGY B;  4CGO A;  1GHE A;  4E2A A;  2PR8 A;  3D2P A;  3JVN A;  2IQ6 A;  4C2X A;  2CXA A;  3PB6 X;  3VAT A;  1YW4 A;  4L89 A;  4MJ8 A;  4A2Z A;  2B3U A;  4Y49 B;  1ELL P;  5DWM A;  4UEE A;  2YND A;  2Q7B A;  2FE7 A;  3QB8 A;  1F57 A;  2OOT A;  3N5F A;  2ZW6 A;  5AG7 A;  3WC6 A;  4MHN A;  2PRQ A;  5HVF A;  4NF1 A;  4XPD B;  1QMU A;  2P0W A;  3W6S A;  2ZW5 A;  2JDC A;  4R6T A;  2AFO A;  2I00 A;  3LWU A;  1BO4 A;  5JH9 A;  2ZEP A;  5E96 A;  3R95 A;  1S3Z A;  2GU2 A;  3ISZ A;  3PP9 A;  3ZZI A;  2PJ5 A;  2VBQ A;  1RXT A;  3DNS A;  2C27 A;  3DLJ A;  2EK9 A;  4MFJ A;  1YR0 A;  4OC3 A;  2ATR A;  4IK2 A;  3WT4 A;  4AVA A;  4FAI A;  5DS0 A;  4R3L A;  4OKO A;  2HB6 A;  1YVO A;  1DTD A;  2CIJ A;  3D3S A;  3IEH A;  4OC0 A;  4A33 A;  4Y49 C;  1R3N A;  2EK8 A;  2GFQ A;  2J9A A;  1ZG8 A;  4KZT A;  4X2T A;  2A4N A;  2QML A;  1UFH A;  2HUZ A;  4MY0 A;  3IFE A;  2PCU A;  5K8N A;  5AGE A;  4KOR A;  4FWU A;  2Q04 A;  2PC1 A;  4XPD C;  2Q43 A;  1PCA A;  2YGW A;  3WC7 A;  2CNS A;  2ZPA A;  2OR4 A;  3R96 A;  1XJO A;  1TF9 A;  3NE7 A;  3I1U A;  1MK4 A;  3R1K A;  1HEE A;  1ZG9 A;  2OZU A;  3LOD A;  1BAV A;  3CPX A;  2GIV A;  3NA6 A;  4A94 A;  2CF4 A;  1TF8 A;  2V8G A;  5HVH A;  3BI1 A;  2J8R A;  1TKJ A;  2JLM A;  4MHP A;  4U9Y A;  2BEI A;  1KUY A;  2EUI A;  4NGR A;  3CZX A;  5F49 A;  4A32 A;  4F9U A;  1KZF A;  3TO9 A;  1JQG A;  1RTQ A;  3TE4 A;  4PSW A;  2R7H A;  3B3V A;  3NFZ A;  4NJR A;  4M6G A;  1YK3 A;  2V8V A;  4A95 A;  1QSO A;  2EBJ A;  1QST A;  5F46 A;  5IB0 A;  2ARH A;  1YME A;  3BI0 A;  1LRZ A;  4B10 A;  2QIR A;  2H5M A;  3DR6 A;  4MY3 A;  4UCN A;  4YRH A;  3VWD A;  1LOK A;  2PJ3 A;  2Q4Z A;  3PRT A;  2C6G A;  3GYA A;  1Y7E A;  2JDD A;  4TNU A;  1Q2C A;  3PGP A;  1ZLI A;  4PXD A;  4X3R A;  1Z8T A;  3PEI A;  3D7H A;  1CX8 A;  4QVT A;  4B11 A;  3TO6 A;  4EFD A;  3G8W A;  4OAD A;  1S5K A;  4CYP A;  2FIW A;  4AXV A;  1PUA A;  3H8E A;  5CBM A;  4IAV A;  1EE3 P;  4YFJ A;  5KTD A;  2PJ8 A;  3KAS A;  4PK3 A;  4ZY2 A;  1IOI A;  4ONU A;  4R87 A;  3WR7 A;  1S60 A;  3PB7 X;  5BWA B;  5LYL A;  1CPS A;  2YNE A;  1HDQ A;  4MHD A;  4AG7 A;  2P6G A;  1NE9 A;  4LUA A;  2ZW7 A;  2Y0M A;  1Z4E A;  2B4D B;  2DF5 A;  4R7M A;  1XMT A;  8CPA A;  3QAY A;  4MMO A;  1XBU A;  2BO9 A;  1Y9W A;  4KVX A;  3CXQ A;  2QYV A;  2RB7 A;  4UCM A;  2VZY A;  3PBE A;  2YNC A;  4CGP A;  1AUG A;  2DEA A;  4OAE A;  3K9T A;  5FVJ A;  3IWG A;  2J8N A;  3TOA A;  4MFQ A;  3KL9 A;  1IU8 A;  5JM6 A;  4XPK A;  1QSR A;  2PDO A;  1VKC A;  1X12 A;  3W6X A;  4EWT A;  1FNO A;  1XIX A;  1ZLH A;  3S6H A;  3L2N A;  4CAV A;  2GLF A;  4PSX A;  2I3C A;  2YNC C;  1XE4 A;  2B4D A;  2IL4 A;  5J1Q A;  1ARL A;  2ZOF A;  3G3S A;  4E0A A;  1YRE A;  2JEW A;  4ZX8 A;  4MCQ A;  1M4L A;  2ZED A;  4ZBG A;  2OB0 A;  4AB7 A;  1KWM A;  4JD6 A;  2BSW A;  2WPW A;  4DUK A;  4EME A;  3S6F A;  4KOX A;  1MJ9 A;  2Z3O A;  3GLJ A;  3GY9 A;  2ABZ A;  1Q2Y A;  2WZN A;  2PJ9 A;  4JJX A;  1Z5R A;  5LRG A;  5EMI A;  3B3C A;  3TTH A;  5HMN A;  2AFU A;  1VHS A;  3P2H A;  2R1I A;  2I79 A;  1SQH A; 
#chains in the Genus database with same CATH homology
 4BIN A;  1JWQ A;  3NE8 A;  5EMI A;  4M6I A;  4M6G A;  2HC9 A;  4LQ6 A;  2ODF A;  4M6H A;  2HB6 A;  2Q7S A;  3CZX A;  4EFD A;  3QAY A;  4RN7 A;  1XOV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...