4M6IA

Structure of the reduced, zn-bound form of mycobacterium tuberculosis peptidoglycan amidase rv3717
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
214
structure length
185
Chain Sequence
IAGMVVFIDPGHTSTNSGYPEHTFTWETGLRLRAALNALGVRTALSRGNDGPCVDERANMANALRPNAIVSLHADGGPASGRGFHVNYSAPPLNAIQAGPSVQFARIMRDQLQASGIPKANYIGQDGLYGRSDLAGLNLAQYPSILVELGNMKNPADSALMESAEGRQKYANALVRGVAGFLATQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and Biochemical Analyses of Mycobacterium tuberculosis N-Acetylmuramyl-L-alanine Amidase Rv3717 Point to a Role in Peptidoglycan Fragment Recycling.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Hydrolase
molecule keywords Peptidoglycan Amidase Rv3717
total genus 77
structure length 185
sequence length 214
chains with identical sequence B
ec nomenclature ec 3.5.-.-:
pdb deposition date 2013-08-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01520 Amidase_3 N-acetylmuramoyl-L-alanine amidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.40 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn-dependent exopeptidases 4m6iA00
4LQ6A 4RN7A 4M6IA 1JWQA 3QAYA 2ODFA 5EMIA 3NE8A 4M6HA 4M6GA 1XOVA 3CZXA 2Q7SA 4BINA
chains in the Genus database with same CATH superfamily
4NF1A 3FXTA 3IEHA 4UIAA 4XPLA 3HUVA 4X2TA 4F9UA 4NGMA 2HC9A 2ZENA 2PE3A 1IY7A 5LRJA 1U6MA 3SHPA 4B6ZA 4AB7A 3UY5A 1Q2CA 1IGBA 3TOBA 5AG5A 3PB9X 2PJ8A 3KHXA 3V7ZA 2WZNA 3KI9A 4MCPA 3PZJA 2REEA 3VWDA 4XNHB 1MK4A 3HLPA 4NFRA 3S6FA 3GUXA 4P4EA 2ZEEA 3RYOA 4E8OA 2O4HA 4U9ZA 3NA6A 2QIRA 3BI0A 3FRMA 3T9YA 2PVWA 3PB4X 4BBHA 1HDQA 2J8NA 4UFXA 3SJFA 2QVPA 1MJBA 1AYEA 3MRUA 4FAIA 1CP7A 5JGFA 3B2YA 4UBRA 2C6PA 2G9DA 1YSJA 3F8KA 4KLVA 4NGQA 2XEFA 5G21A 3CT9A 2J8RA 4UCNA 3V38A 3KASA 1I1DA 2YGWA 5F09A 2Q4ZA 2XEGA 1CG2A 2AFOA 2JDCA 3IIBA 2YNDA 3TCVA 2ZOGA 3L2NA 2NYQA 4ONWA 1RXTA 1IOFA 1ELLP 4OADA 4QUSA 5LYIA 5HMNA 2G3AA 2ZEGA 3EFAA 4ZY0A 1SQHA 2ZEHA 4K30A 5G22A 4CAVA 3FYNA 2IJZA 2Q43A 2CNSA 1OZPA 4U5YA 1QSTA 3PRTA 4LUAA 3FMCA 2BL1A 4F6AA 5IB9A 2WPXA 2Z3MA 4AVAA 4M3SA 2AFMA 2QMLA 4OC4A 4IF5A 3FECA 2JEVA 3DLJA 1B87A 2PJAA 1IYKA 2Q51A 4I49A 4M6IA 4W9YA 4E2AA 5K8PA 3B3CA 1ZG8A 4FD4A 2FT0A 2ZEMA 7CPAA 2VQYA 4MMOA 4Q7AA 2XEJA 3WC5A 4EWTA 2ZEDA 3C26A 2PIYA 1Q7LA 1P4NA 2ZEFA 4PPZA 2I79A 5ELYA 2GFQA 2PJ1A 2WUUA 2NMTA 1KWMA 1YVKA 4RI1A 3KQXA 3B3VA 5CBMA 2R7HA 1P0HA 3JVNA 3S6GA 1S3ZA 4PXEA 4YWYA 2Q7SA 2BCOA 3CDXA 1J4JA 4UA3A 2Z10A 4IHMA 2OZHA 2AJ6A 2QJ8A 4P44A 4KOTA 4ZI6A 4RUHA 1TXRA 4FD7A 4Q38A 4F8ZA 1BO4A 5JM6A 1PCAA 4MFZA 5LYFA 3GB0A 2K5TA 4IUSA 1Z9UA 4MHPA 3T8WA 2YNCA 4CAXA 3NH4A 4MFJA 5IX3A 1XOVA 1XFOA 2GLFA 2Z0ZA 3CPAA 1JWQA 1ZG7A 3FH4A 1IB1E 1Y7EA 3D7FA 3FVLA 2PRBA 3KKWA 4MFQA 4OC1A 5K8OA 4UEZA 1QMUA 4QC6A 4F0YA 1F2PA 1YW4A 3MGDA 4P4FA 4CPAA 1CBXA 3IGRA 2C6GA 4EFDA 4CAWA 2AFUA 4A2ZA 2B4DB 4PSXA 4MCSA 3R1KA 1KUXA 3CPXA 4GXHA 4R3KA 4Q36A 2EK9A 1GYTA 1Z5RA 2RFHA 2DPSA 2PJ7A 4K3NA 1Z8LA 4P45A 5LYDA 3SJXA 3V8IA 4FBEA 6CPAA 2V8GA 3NH5A 4GM5A 5IV0A 2PJCA 4FD5A 1IU8A 4HNWB 2FE7A 4NJQA 4M6HA 3B8GA 5F47A 4UF4A 4JWPA 1TKHA 1A2ZA 1VHOA 3H8EA 4TNUA 1VHSA 1KZFA 2ZW5A 4PV6A 4X3RA 5CPAA 3VARA 3PP9A 4AXVA 2B3UA 3NH8A 1QSNA 3CXQA 3I1UA 4OC5A 3BXMA 3B35A 5AG6A 4P10A 4KOWA 4LQGA 3WR7A 4B5PA 3LMSA 2D4PA 3SXOA 4KVME 2EK8A 5KTDA 2R1IA 3SI2A 4OKOA 2O53A 1Y0YA 2GIVA 2FIWA 2PJ6A 1WWZA 2X7BA 4JXQA 3WABA 4MBUA 3LACA 2EVNA 1CX8A 3B3WA 5C82A 3D7GA 4UCPA 3R95A 2Z3PA 2PQ8A 3SJGA 3GYAA 3VWEA 4EVYA 3WC7A 4DNCA 4UEFA 2PIZA 2B3VA 4HPSA 4ZYQA 2P6FA 3TC8A 2V8HA 3I3GA 3R9FA 1S5KA 2V8DA 1RO5A 3FX6A 4NCZA 5FVJA 2G0BA 2O28A 3P2FA 1QSMA 2EWBA 2PJBA 4MJ8A 3LODA 3B3SA 3D68A 2AFWA 4B13A 3N7ZA 4II9A 1Z4RA 2Q4YA 3F0AA 3BJ8A 2ANPA 4H6ZA 4OIWA 2Z3LA 4NGPA 4UFWA 4C7HA 5JQ4A 4P4IA 1OBRA 3VH9A 3PB8X 3EY5A 2I3CA 5DWNA 4NGSA 4XPDB 4PXDA 3H4QA 3IO1A 3KHZA 4UWJA 2Q0YA 3S9NA 1XIXA 4XPKA 3B7IA 5D29A 4AVCA 2ZW4A 2V8VA 4CS0B 3IWWA 3P2HA 5A27A 2HUZA 5LYLA 2BOAA 1S60A 2IQ6A 4MCRA 2Z3NA 4A37A 1ZLHA 1AMPA 3A9LA 3IWGA 4OP4A 3WC6A 2HQYA 4CGLA 3JUWA 4A39A 4OC3A 1LAPA 3EO4A 4NXYA 3GIUA 2ZW6A 4OIDA 1VHEA 2VI7A 2EO8A 4MI4A 4OMEA 2VZZA 5D8NA 5J8CA 1B6BA 1NE9A 4CYOA 4ZBGA 3H8GA 4KOXA 4CGMA 4QBJA 4M6GA 3SI1A 4MRIA 1FY7A 3BJ7A 2EBJA 1Y9KA 4MHDA 4P4JA 4F9VA 3ZJ0A 5HVHA 1IICA 2ODFA 5JPHA 5KTAA 4WJBA 1NMTA 1Z8TA 2GU2A 2CTCA 3PB7X 2ZW7A 2WPWA 4MFLA 5E96A 3CXSA 4KSAA 3GY9A 4BD9A 3ISZA 4NSQA 3TTHA 2ABZA 4B12A 2OR4A 2Z3KA 3E0KA 4RS2A 3RNZA 4EMEA 2G3TA 4YRHA 3NFZA 2P6EA 4MHNA 4DJLA 4PQAA 2OZUA 5G20A 2CY2A 5J8FA 4J3GA 5ISVA 2PSWA 4CRZB 2Z11A 2PJ5A 2CTBA 1YMEA 1LAMA 3KQZA 4MFPA 2DEAA 5F46A 1CPXA 4MY0A 4OC2A 1X10A 1QQ9A 1IYLA 3FEEA 1XJOA 1CPSA 2OB0A 1PU9A 3JRUA 2RC4A 4ORFA 5HVFA 2B4DA 4PSWA 2KCWA 2REFA 4IAVA 3D8PA 2F8HA 2ZEPA 4KSFA 4AVBA 2PCUA 3IFEA 3FJUA 4A31A 3ZZIA 2ZPAA 4JYWA 5F48A 1FT7A 4NGTA 2PVVA 5CNPA 4B5OA 2PJ4A 4R57A 2Q04A 1M1DA 3R9GA 2PDOA 1Z8XA 4OC0A 3R96A 1K4JA 2PRQA 3PGPA 1Z2LA 4M85A 2BEIA 2DF5A 4PXCA 5BWAB 4CYPA 4OAEA 2P6GA 3PB6X 4Y49B 3FF3A 1PYTB 1TKFA 3G8WA 4OLLA 1M4IA 2AFSA 2AFXA 1F2OA 2JEWA 4NGNA 3S6KA 3DR6A 4KLWA 4ZY2A 1TF9A 2F7VA 1Z4EA 4B14A 4Y49C 5H84A 3QAHA 1M44A 1V0CA 4MXUA 4MY3A 4X5KA 1YLEA 2HV2A 2HB6A 3TO9A 4KOUA 2DXQA 3IU2A 4XPDC 3W6SA 4C2ZA 1YR0A 2BO9A 3K9UA 2C1CA 3F5BA 2PJ0A 3N5FA 4R8FA 4C2YA 4CAFA 4U9YA 5DS0A 4H2KA 1YGHA 1M4GA 3BI1A 4CGOA 1MJ9A 1LFWA 4AG9A 2FIAA 2CF4A 1M4DA 1VKCA 2VL1A 4G1PA 3D2PA 2PJ2A 4R7MA 4L8AA 1BLLE 5F49A 4LX9A 1XRYA 1NSAA 1YLOA 2C6CA 2NSMA 1XF8A 2ATRA 3KL9A 3RO0A 1WK4A 4B11A 4QB9A 3S9LA 1ZG9A 1EE3P 3DR8A 2F5IA 1F57A 2J9AA 3G3SA 3KR4A 3QAYA 4KS9A 1UFHA 4YU9A 1XEBA 3TX8A 4R87A 4LQ6A 2B5GB 2JLMA 8CPAA 4KZTA 4CGPA 4ZX8A 3TO7A 4UWIA 5EMIA 4MCQA 3VATA 1FNOA 2P0WA 4P4BA 2R98A 3SJEA 1BPMA 4O23A 3PBBA 4HNXB 4KOSA 1XMBA 4PXBA 4UIBA 3KR5A 2B5GA 4R76A 4RN7A 2FCKA 3IC1A 4YGOA 1NSLA 4CGNA 2C27A 5G1ZA 3TOAA 2YNCC 3WT4A 4KVOE 3NE7A 1ELMP 2QYVA 3TO6A 3OWCA 3W6XA 3KZWA 2ARHA 3W91A 3D3SA 3IU1A 2OH1A 2PJ3A 3D7HA 2QECA 2GANA 4NEXA 4H6UA 4UCMA 5H86A 3MN8A 2WYRA 4P4DA 3DSBA 5AG7A 1BAVA 2JBKA 1R3NA 1YREA 1S7FA 2DPTA 4KSIA 4DYOA 3PFEA 3S9MA 2CNMA 4H89A 4A32A 3D7DA 1KUYA 1JQGA 3SXNA 1CJWA 1Y0RA 4FUUA 1GHEA 2CIJA 2ZOFA 4PK2A 4GS4A 4BINA 2RB7A 4ZGYB 4HNYB 2PC1A 3KGQA 3TE4A 2D4OA 1YW6A 2POKA 4C2XA 1ZO0A 2J8MA 1Q2YA 4JD6A 4FWUA 3EXNA 3K9TA 5HH1A 4A38A 1YK3A 5C88A 1BPNA 3NE8A 3D66A 4R6TA 1LCPA 4JXRA 2R8VA 4JJXA 1HDUA 2WSAA 3D2MA 2BUEA 4KOVA 5GCNA 1ON0A 4CYNA 5AG4A 5IB0A 2GREA 1Z8WA 1X12A 4CYQA 1DTDA 1CM0A 1KUVA 4C7IA 2OU2A 1M4LA 3LWUA 2GLJA 2EUIA 2AFZA 1ARLA 2ZELA 2VEZA 4UEEA 4TWEA 4CRYB 5KTCA 4FD6A 3IJ3A 4KUAA 4A94A 2BSWA 2JDDA 4UFVA 3SI0A 3TT2A 4MHZA 2FSRA 1IOIA 1L0CA 1RTQA 2PR1A 4MHYA 4PK3A 1I12A 2FL4A 3R9EA 2H5MA 3DDDA 4MFKA 4R9MA 3D4UA 4YFJA 4C68A 5K8NA 1LRZA 3BLNA 1N71A 2GE3A 4KOYA 3PBEA 1AUGA 4Z65A 2FS5A 2VZYA 1LANA 1XE4A 1S7NA 4E0AA 2FVGA 5EBVA 1YQEA 3FBUA 2Y0MA 3JTKA 4A33A 3H8FA 2I00A 1ZLIA 5HXDA 2XEIA 5AGEA 1YX0A 5HVGA 3GLJA 3B3TA 2ZEOA 1S7LA 1I21A 1R43A 4KUBA 5J1QA 1MJAA 4L89A 4DUKA 3CZXA 4HKFA 1LOKA 3S6HA 4ONUA 2Q4VA 2V77A 4CAEA 3GKRA 1S7KA 1UWYA 2IL4A 5THWA 1PUAA 1VGYA 4B5PB 3T90A 4QVTA 4ZX9A 1CP6A 2ZXVA 4NJRA 4IK2A 4KVXA 2AE6A 2VBQA 3RZAA 2CNTA 1YVOA 3QB8A 2Q7BA 2B58A 2B4BA 3DNSA 1XBUA 1Y7RA 3PFOA 3CXPA 4A95A 3PEIA 3QNVA 2VXKA 5JH9A 4BMHA 4A30A 4ZY1A 2YNEA 5LRKA 1IIDA 2PJ9A 2CXAA 1ARMA 4WWVA 1R57A 3FIXA 2OOTA 4X8IA 3K2KA 1VIXA 1XMTA 4KORA 1TF8A 5I0CA 2Q44A 3DGVA 3FEDA 2OZGA 2Z3OA 3EC4A 3LD2A 5EC4A 5LRGA 4XNHC 1QSRA 5K8MA 4B10A 4NGRA 1TIQA 2IMOA 4R3LA 1H8LA 3FNCA 3IWEA 4F0XA 1TKJA 2A4NA 5DWMA 5A28A 2JBJA 3TFYA 1DE4C 1QSOA 3BHXA 1HEEA 2PR8A 3I9SA 4JLYA 4P6YA 3D67A 3RAMA 3RBUA 1Q2DA 3H5ZA 5I4MA 4AG7A 1BOBA 3FB3A 2FXFA 3ISXA 4JZ0A 1Y9WA
chains in the Genus database with same CATH topology
4LQ6A 4RN7A 4EFDA 3CZXA 4M6IA 1JWQA 3QAYA 2ODFA 5EMIA 2HB6A 4M6HA 4M6GA 2HC9A 3NE8A 1XOVA 2Q7SA 4BINA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LQ6 A;  4RN7 A;  4M6I A;  1JWQ A;  3QAY A;  2ODF A;  5EMI A;  3NE8 A;  4M6H A;  4M6G A;  1XOV A;  3CZX A;  2Q7S A;  4BIN A; 
#chains in the Genus database with same CATH topology
 4NF1 A;  3FXT A;  3IEH A;  4UIA A;  4XPL A;  3HUV A;  4X2T A;  4F9U A;  4NGM A;  2HC9 A;  2ZEN A;  2PE3 A;  1IY7 A;  5LRJ A;  1U6M A;  3SHP A;  4B6Z A;  4AB7 A;  3UY5 A;  1Q2C A;  1IGB A;  3TOB A;  5AG5 A;  3PB9 X;  2PJ8 A;  3KHX A;  3V7Z A;  2WZN A;  3KI9 A;  4MCP A;  3PZJ A;  2REE A;  3VWD A;  4XNH B;  1MK4 A;  3HLP A;  4NFR A;  3S6F A;  3GUX A;  4P4E A;  2ZEE A;  3RYO A;  4E8O A;  2O4H A;  4U9Z A;  3NA6 A;  2QIR A;  3BI0 A;  3FRM A;  3T9Y A;  2PVW A;  3PB4 X;  4BBH A;  1HDQ A;  2J8N A;  4UFX A;  3SJF A;  2QVP A;  1MJB A;  1AYE A;  3MRU A;  4FAI A;  1CP7 A;  5JGF A;  3B2Y A;  4UBR A;  2C6P A;  2G9D A;  1YSJ A;  3F8K A;  4KLV A;  4NGQ A;  2XEF A;  5G21 A;  3CT9 A;  2J8R A;  4UCN A;  3V38 A;  3KAS A;  1I1D A;  2YGW A;  5F09 A;  2Q4Z A;  2XEG A;  1CG2 A;  2AFO A;  2JDC A;  3IIB A;  2YND A;  3TCV A;  2ZOG A;  3L2N A;  2NYQ A;  4ONW A;  1RXT A;  1IOF A;  1ELL P;  4OAD A;  4QUS A;  5LYI A;  5HMN A;  2G3A A;  2ZEG A;  3EFA A;  4ZY0 A;  1SQH A;  2ZEH A;  4K30 A;  5G22 A;  4CAV A;  3FYN A;  2IJZ A;  2Q43 A;  2CNS A;  1OZP A;  4U5Y A;  1QST A;  3PRT A;  4LUA A;  3FMC A;  2BL1 A;  4F6A A;  5IB9 A;  2WPX A;  2Z3M A;  4AVA A;  4M3S A;  2AFM A;  2QML A;  4OC4 A;  4IF5 A;  3FEC A;  2JEV A;  3DLJ A;  1B87 A;  2PJA A;  1IYK A;  2Q51 A;  4I49 A;  4M6I A;  4W9Y A;  4E2A A;  5K8P A;  3B3C A;  1ZG8 A;  4FD4 A;  2FT0 A;  2ZEM A;  7CPA A;  2VQY A;  4MMO A;  4Q7A A;  2XEJ A;  3WC5 A;  4EWT A;  2ZED A;  3C26 A;  2PIY A;  1Q7L A;  1P4N A;  2ZEF A;  4PPZ A;  2I79 A;  5ELY A;  2GFQ A;  2PJ1 A;  2WUU A;  2NMT A;  1KWM A;  1YVK A;  4RI1 A;  3KQX A;  3B3V A;  5CBM A;  2R7H A;  1P0H A;  3JVN A;  3S6G A;  1S3Z A;  4PXE A;  4YWY A;  2Q7S A;  2BCO A;  3CDX A;  1J4J A;  4UA3 A;  2Z10 A;  4IHM A;  2OZH A;  2AJ6 A;  2QJ8 A;  4P44 A;  4KOT A;  4ZI6 A;  4RUH A;  1TXR A;  4FD7 A;  4Q38 A;  4F8Z A;  1BO4 A;  5JM6 A;  1PCA A;  4MFZ A;  5LYF A;  3GB0 A;  2K5T A;  4IUS A;  1Z9U A;  4MHP A;  3T8W A;  2YNC A;  4CAX A;  3NH4 A;  4MFJ A;  5IX3 A;  1XOV A;  1XFO A;  2GLF A;  2Z0Z A;  3CPA A;  1JWQ A;  1ZG7 A;  3FH4 A;  1IB1 E;  1Y7E A;  3D7F A;  3FVL A;  2PRB A;  3KKW A;  4MFQ A;  4OC1 A;  5K8O A;  4UEZ A;  1QMU A;  4QC6 A;  4F0Y A;  1F2P A;  1YW4 A;  3MGD A;  4P4F A;  4CPA A;  1CBX A;  3IGR A;  2C6G A;  4EFD A;  4CAW A;  2AFU A;  4A2Z A;  2B4D B;  4PSX A;  4MCS A;  3R1K A;  1KUX A;  3CPX A;  4GXH A;  4R3K A;  4Q36 A;  2EK9 A;  1GYT A;  1Z5R A;  2RFH A;  2DPS A;  2PJ7 A;  4K3N A;  1Z8L A;  4P45 A;  5LYD A;  3SJX A;  3V8I A;  4FBE A;  6CPA A;  2V8G A;  3NH5 A;  4GM5 A;  5IV0 A;  2PJC A;  4FD5 A;  1IU8 A;  4HNW B;  2FE7 A;  4NJQ A;  4M6H A;  3B8G A;  5F47 A;  4UF4 A;  4JWP A;  1TKH A;  1A2Z A;  1VHO A;  3H8E A;  4TNU A;  1VHS A;  1KZF A;  2ZW5 A;  4PV6 A;  4X3R A;  5CPA A;  3VAR A;  3PP9 A;  4AXV A;  2B3U A;  3NH8 A;  1QSN A;  3CXQ A;  3I1U A;  4OC5 A;  3BXM A;  3B35 A;  5AG6 A;  4P10 A;  4KOW A;  4LQG A;  3WR7 A;  4B5P A;  3LMS A;  2D4P A;  3SXO A;  4KVM E;  2EK8 A;  5KTD A;  2R1I A;  3SI2 A;  4OKO A;  2O53 A;  1Y0Y A;  2GIV A;  2FIW A;  2PJ6 A;  1WWZ A;  2X7B A;  4JXQ A;  3WAB A;  4MBU A;  3LAC A;  2EVN A;  1CX8 A;  3B3W A;  5C82 A;  3D7G A;  4UCP A;  3R95 A;  2Z3P A;  2PQ8 A;  3SJG A;  3GYA A;  3VWE A;  4EVY A;  3WC7 A;  4DNC A;  4UEF A;  2PIZ A;  2B3V A;  4HPS A;  4ZYQ A;  2P6F A;  3TC8 A;  2V8H A;  3I3G A;  3R9F A;  1S5K A;  2V8D A;  1RO5 A;  3FX6 A;  4NCZ A;  5FVJ A;  2G0B A;  2O28 A;  3P2F A;  1QSM A;  2EWB A;  2PJB A;  4MJ8 A;  3LOD A;  3B3S A;  3D68 A;  2AFW A;  4B13 A;  3N7Z A;  4II9 A;  1Z4R A;  2Q4Y A;  3F0A A;  3BJ8 A;  2ANP A;  4H6Z A;  4OIW A;  2Z3L A;  4NGP A;  4UFW A;  4C7H A;  5JQ4 A;  4P4I A;  1OBR A;  3VH9 A;  3PB8 X;  3EY5 A;  2I3C A;  5DWN A;  4NGS A;  4XPD B;  4PXD A;  3H4Q A;  3IO1 A;  3KHZ A;  4UWJ A;  2Q0Y A;  3S9N A;  1XIX A;  4XPK A;  3B7I A;  5D29 A;  4AVC A;  2ZW4 A;  2V8V A;  4CS0 B;  3IWW A;  3P2H A;  5A27 A;  2HUZ A;  5LYL A;  2BOA A;  1S60 A;  2IQ6 A;  4MCR A;  2Z3N A;  4A37 A;  1ZLH A;  1AMP A;  3A9L A;  3IWG A;  4OP4 A;  3WC6 A;  2HQY A;  4CGL A;  3JUW A;  4A39 A;  4OC3 A;  1LAP A;  3EO4 A;  4NXY A;  3GIU A;  2ZW6 A;  4OID A;  1VHE A;  2VI7 A;  2EO8 A;  4MI4 A;  4OME A;  2VZZ A;  5D8N A;  5J8C A;  1B6B A;  1NE9 A;  4CYO A;  4ZBG A;  3H8G A;  4KOX A;  4CGM A;  4QBJ A;  4M6G A;  3SI1 A;  4MRI A;  1FY7 A;  3BJ7 A;  2EBJ A;  1Y9K A;  4MHD A;  4P4J A;  4F9V A;  3ZJ0 A;  5HVH A;  1IIC A;  2ODF A;  5JPH A;  5KTA A;  4WJB A;  1NMT A;  1Z8T A;  2GU2 A;  2CTC A;  3PB7 X;  2ZW7 A;  2WPW A;  4MFL A;  5E96 A;  3CXS A;  4KSA A;  3GY9 A;  4BD9 A;  3ISZ A;  4NSQ A;  3TTH A;  2ABZ A;  4B12 A;  2OR4 A;  2Z3K A;  3E0K A;  4RS2 A;  3RNZ A;  4EME A;  2G3T A;  4YRH A;  3NFZ A;  2P6E A;  4MHN A;  4DJL A;  4PQA A;  2OZU A;  5G20 A;  2CY2 A;  5J8F A;  4J3G A;  5ISV A;  2PSW A;  4CRZ B;  2Z11 A;  2PJ5 A;  2CTB A;  1YME A;  1LAM A;  3KQZ A;  4MFP A;  2DEA A;  5F46 A;  1CPX A;  4MY0 A;  4OC2 A;  1X10 A;  1QQ9 A;  1IYL A;  3FEE A;  1XJO A;  1CPS A;  2OB0 A;  1PU9 A;  3JRU A;  2RC4 A;  4ORF A;  5HVF A;  2B4D A;  4PSW A;  2KCW A;  2REF A;  4IAV A;  3D8P A;  2F8H A;  2ZEP A;  4KSF A;  4AVB A;  2PCU A;  3IFE A;  3FJU A;  4A31 A;  3ZZI A;  2ZPA A;  4JYW A;  5F48 A;  1FT7 A;  4NGT A;  2PVV A;  5CNP A;  4B5O A;  2PJ4 A;  4R57 A;  2Q04 A;  1M1D A;  3R9G A;  2PDO A;  1Z8X A;  4OC0 A;  3R96 A;  1K4J A;  2PRQ A;  3PGP A;  1Z2L A;  4M85 A;  2BEI A;  2DF5 A;  4PXC A;  5BWA B;  4CYP A;  4OAE A;  2P6G A;  3PB6 X;  4Y49 B;  3FF3 A;  1PYT B;  1TKF A;  3G8W A;  4OLL A;  1M4I A;  2AFS A;  2AFX A;  1F2O A;  2JEW A;  4NGN A;  3S6K A;  3DR6 A;  4KLW A;  4ZY2 A;  1TF9 A;  2F7V A;  1Z4E A;  4B14 A;  4Y49 C;  5H84 A;  3QAH A;  1M44 A;  1V0C A;  4MXU A;  4MY3 A;  4X5K A;  1YLE A;  2HV2 A;  2HB6 A;  3TO9 A;  4KOU A;  2DXQ A;  3IU2 A;  4XPD C;  3W6S A;  4C2Z A;  1YR0 A;  2BO9 A;  3K9U A;  2C1C A;  3F5B A;  2PJ0 A;  3N5F A;  4R8F A;  4C2Y A;  4CAF A;  4U9Y A;  5DS0 A;  4H2K A;  1YGH A;  1M4G A;  3BI1 A;  4CGO A;  1MJ9 A;  1LFW A;  4AG9 A;  2FIA A;  2CF4 A;  1M4D A;  1VKC A;  2VL1 A;  4G1P A;  3D2P A;  2PJ2 A;  4R7M A;  4L8A A;  1BLL E;  5F49 A;  4LX9 A;  1XRY A;  1NSA A;  1YLO A;  2C6C A;  2NSM A;  1XF8 A;  2ATR A;  3KL9 A;  3RO0 A;  1WK4 A;  4B11 A;  4QB9 A;  3S9L A;  1ZG9 A;  1EE3 P;  3DR8 A;  2F5I A;  1F57 A;  2J9A A;  3G3S A;  3KR4 A;  3QAY A;  4KS9 A;  1UFH A;  4YU9 A;  1XEB A;  3TX8 A;  4R87 A;  4LQ6 A;  2B5G B;  2JLM A;  8CPA A;  4KZT A;  4CGP A;  4ZX8 A;  3TO7 A;  4UWI A;  5EMI A;  4MCQ A;  3VAT A;  1FNO A;  2P0W A;  4P4B A;  2R98 A;  3SJE A;  1BPM A;  4O23 A;  3PBB A;  4HNX B;  4KOS A;  1XMB A;  4PXB A;  4UIB A;  3KR5 A;  2B5G A;  4R76 A;  4RN7 A;  2FCK A;  3IC1 A;  4YGO A;  1NSL A;  4CGN A;  2C27 A;  5G1Z A;  3TOA A;  2YNC C;  3WT4 A;  4KVO E;  3NE7 A;  1ELM P;  2QYV A;  3TO6 A;  3OWC A;  3W6X A;  3KZW A;  2ARH A;  3W91 A;  3D3S A;  3IU1 A;  2OH1 A;  2PJ3 A;  3D7H A;  2QEC A;  2GAN A;  4NEX A;  4H6U A;  4UCM A;  5H86 A;  3MN8 A;  2WYR A;  4P4D A;  3DSB A;  5AG7 A;  1BAV A;  2JBK A;  1R3N A;  1YRE A;  1S7F A;  2DPT A;  4KSI A;  4DYO A;  3PFE A;  3S9M A;  2CNM A;  4H89 A;  4A32 A;  3D7D A;  1KUY A;  1JQG A;  3SXN A;  1CJW A;  1Y0R A;  4FUU A;  1GHE A;  2CIJ A;  2ZOF A;  4PK2 A;  4GS4 A;  4BIN A;  2RB7 A;  4ZGY B;  4HNY B;  2PC1 A;  3KGQ A;  3TE4 A;  2D4O A;  1YW6 A;  2POK A;  4C2X A;  1ZO0 A;  2J8M A;  1Q2Y A;  4JD6 A;  4FWU A;  3EXN A;  3K9T A;  5HH1 A;  4A38 A;  1YK3 A;  5C88 A;  1BPN A;  3NE8 A;  3D66 A;  4R6T A;  1LCP A;  4JXR A;  2R8V A;  4JJX A;  1HDU A;  2WSA A;  3D2M A;  2BUE A;  4KOV A;  5GCN A;  1ON0 A;  4CYN A;  5AG4 A;  5IB0 A;  2GRE A;  1Z8W A;  1X12 A;  4CYQ A;  1DTD A;  1CM0 A;  1KUV A;  4C7I A;  2OU2 A;  1M4L A;  3LWU A;  2GLJ A;  2EUI A;  2AFZ A;  1ARL A;  2ZEL A;  2VEZ A;  4UEE A;  4TWE A;  4CRY B;  5KTC A;  4FD6 A;  3IJ3 A;  4KUA A;  4A94 A;  2BSW A;  2JDD A;  4UFV A;  3SI0 A;  3TT2 A;  4MHZ A;  2FSR A;  1IOI A;  1L0C A;  1RTQ A;  2PR1 A;  4MHY A;  4PK3 A;  1I12 A;  2FL4 A;  3R9E A;  2H5M A;  3DDD A;  4MFK A;  4R9M A;  3D4U A;  4YFJ A;  4C68 A;  5K8N A;  1LRZ A;  3BLN A;  1N71 A;  2GE3 A;  4KOY A;  3PBE A;  1AUG A;  4Z65 A;  2FS5 A;  2VZY A;  1LAN A;  1XE4 A;  1S7N A;  4E0A A;  2FVG A;  5EBV A;  1YQE A;  3FBU A;  2Y0M A;  3JTK A;  4A33 A;  3H8F A;  2I00 A;  1ZLI A;  5HXD A;  2XEI A;  5AGE A;  1YX0 A;  5HVG A;  3GLJ A;  3B3T A;  2ZEO A;  1S7L A;  1I21 A;  1R43 A;  4KUB A;  5J1Q A;  1MJA A;  4L89 A;  4DUK A;  3CZX A;  4HKF A;  1LOK A;  3S6H A;  4ONU A;  2Q4V A;  2V77 A;  4CAE A;  3GKR A;  1S7K A;  1UWY A;  2IL4 A;  5THW A;  1PUA A;  1VGY A;  4B5P B;  3T90 A;  4QVT A;  4ZX9 A;  1CP6 A;  2ZXV A;  4NJR A;  4IK2 A;  4KVX A;  2AE6 A;  2VBQ A;  3RZA A;  2CNT A;  1YVO A;  3QB8 A;  2Q7B A;  2B58 A;  2B4B A;  3DNS A;  1XBU A;  1Y7R A;  3PFO A;  3CXP A;  4A95 A;  3PEI A;  3QNV A;  2VXK A;  5JH9 A;  4BMH A;  4A30 A;  4ZY1 A;  2YNE A;  5LRK A;  1IID A;  2PJ9 A;  2CXA A;  1ARM A;  4WWV A;  1R57 A;  3FIX A;  2OOT A;  4X8I A;  3K2K A;  1VIX A;  1XMT A;  4KOR A;  1TF8 A;  5I0C A;  2Q44 A;  3DGV A;  3FED A;  2OZG A;  2Z3O A;  3EC4 A;  3LD2 A;  5EC4 A;  5LRG A;  4XNH C;  1QSR A;  5K8M A;  4B10 A;  4NGR A;  1TIQ A;  2IMO A;  4R3L A;  1H8L A;  3FNC A;  3IWE A;  4F0X A;  1TKJ A;  2A4N A;  5DWM A;  5A28 A;  2JBJ A;  3TFY A;  1DE4 C;  1QSO A;  3BHX A;  1HEE A;  2PR8 A;  3I9S A;  4JLY A;  4P6Y A;  3D67 A;  3RAM A;  3RBU A;  1Q2D A;  3H5Z A;  5I4M A;  4AG7 A;  1BOB A;  3FB3 A;  2FXF A;  3ISX A;  4JZ0 A;  1Y9W A; 
#chains in the Genus database with same CATH homology
 4LQ6 A;  4RN7 A;  4EFD A;  3CZX A;  4M6I A;  1JWQ A;  3QAY A;  2ODF A;  5EMI A;  2HB6 A;  4M6H A;  4M6G A;  2HC9 A;  3NE8 A;  1XOV A;  2Q7S A;  4BIN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...