1R3NA

Crystal structure of beta-alanine synthase from saccharomyces kluyveri
Total Genus 151
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
151
sequence length
438
structure length
438
Chain Sequence
GTLNLPAAAPLSIASGRLNQTILETGSQFGGVARWGQESHEFGMRRLAGTALDGAMRDWFTNECESLGCKVKVDKIGNMFAVYPGKNGGKPTATGSHLDTQPEAGKYDGILGVLAGLEVLRTFKDNNYVPNYDVCVVVWFNEEGARFARSCTGSSVWSHDLSLEEAYGLMSVGEDKPESVYDSLKNIGYIGDTPASYKENEIDAHFELHIEQGPILEDENKAIGIVTGVQAYNWQKVTVHGVGAHAGTTPWRLRKDALLMSSKMIVAASEIAQRHNGLFTCGIIDAKPYSVNIIPGEVSFTLDFRHPSDDVLATMLKEAAAEFDRLIKINDGGALSYESETLQVSPAVNFHEVCIECVSRSAFAQFKKDQVRQIWSGAGHDSCQTAPHVPTSMIFIPSKDGLSHNYYEYSSPEEIENGFKVLLQAIINYDNYRVIRGH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Yeast beta-Alanine Synthase Shares a Structural Scaffold and Origin with Dizinc-dependent Exopeptidases
pubmed doi rcsb
source organism Lachancea kluyveri
molecule tags Hydrolase
molecule keywords beta-alanine synthase
total genus 151
structure length 438
sequence length 438
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 3.5.1.6: Beta-ureidopropionase.
pdb deposition date 2003-10-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01546 Peptidase_M20 Peptidase family M20/M25/M40
A PF07687 M20_dimer Peptidase dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.360 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1r3nA02
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 1r3nA01
4R6TA 4MCPA 3WC5A 2CTBA 4NGPA 2AFXA 2EK8A 3CT9A 1UWYA 5HXDA 5LYFA 3D66A 4MMOA 1Y0RA 1XFOA 2JEWA 5HVGA 3MN8A 3KHXA 2ABZA 2ZEHA 4G1PA 3KQZA 3PBBA 5HVHA 4YU9A 2XEGA 2O4HA 2PJCA 3L2NA 3FMCA 1XMBA 4O23A 1ZLHA 1CPSA 4EFDA 1Z2LA 2V8DA 1ZG8A 2GLJA 1ZG9A 5JGFA 4FBEA 1XBUA 2AFMA 5I4MA 1HDUA 1TF9A 2CIJA 2PCUA 5JM6A 5LYIA 2C6GA 4ZYQA 1EE3P 1FNOA 4MCQA 4EMEA 4PXEA 4IHMA 3K9TA 3DLJA 3RBUA 2V8VA 3K2KA 2ZOGA 3BXMA 4ZY1A 3SJGA 2PRQA 4JZ0A 1TKJA 3I1UA 1ELMP 4IAVA 2PJ7A 3H8FA 4FUUA 5DS0A 5F09A 1DE4C 3SJEA 1ZG7A 3D4UA 4BD9A 2F7VA 1TXRA 1BPNA 1M4LA 4A94A 1AYEA 1KWMA 4B6ZA 8CPAA 3GUXA 1Z5RA 5LRGA 3BHXA 3SJXA 4CPAA 4PQAA 4RUHA 5IB9A 1LANA 4OIDA 3B35A 4H2KA 3CPAA 5J1QA 1ELLP 3CDXA 4OP4A 1XRYA 4PXCA 3BI1A 2DEAA 2PVWA 3PFEA 4TWEA 4W9YA 4P4JA 4OIWA 4NJQA 3V38A 4P4DA 3CPXA 4R76A 3T8WA 4NGTA 5LYDA 4NGSA 1YMEA 3IFEA 1LAMA 3SI1A 4MXUA 2WZNA 2JBKA 1BLLE 2CTCA 1BPMA 4MRIA 4UEFA 5K8NA 3KI9A 2XEJA 4UIBA 3RZAA 5K8PA 2AFZA 4A39A 3B2YA 2IMOA 4NJRA 3PB4X 3MRUA 3FH4A 3GLJA 2PJ1A 2C6CA 4P10A 4WWVA 3VH9A 2XEFA 1CP7A 3N5FA 2ZEEA 3D68A 2OOTA 5D29A 2QYVA 2ZEFA 4IK2A 3IJ3A 2V8HA 2ZEGA 4OC2A 1TF8A 4EWTA 4MCRA 3V7ZA 4GM5A 2PJBA 4NGRA 2POKA 1TKFA 3PEIA 5CBMA 4Q7AA 3KL9A 2PIZA 3FEEA 2RB7A 3D67A 1VHEA 4ZI6A 4P4IA 2PJ0A 1AMPA 1Y0YA 2CF4A 6CPAA 1QMUA 4X8IA 3D7HA 2ZOFA 2EK9A 4ZX8A 3IEHA 3WC7A 1Y7EA 3FECA 4OC5A 1FT7A 4NGMA 1YW6A 4MHNA 2WYRA 2C1CA 1PCAA 3B3CA 5D8NA 2XEIA 5LRKA 3S9NA 4MHZA 3WC6A 2HB6A 1HDQA 3PBEA 3WT4A 2PJ4A 4NFRA 4UEZA 1LOKA 3B3VA 3VARA 5ELYA 2ANPA 1CPXA 2HC9A 3IIBA 1F57A 3WABA 2AFWA 1ARLA 5LYLA 2OR4A 2Q43A 4P4EA 4ZY0A 3H8GA 3NH8A 3KHZA 3SJFA 4F8ZA 3IC1A 3SI0A 4KSIA 4ZX9A 3B3SA 4TNUA 2PIYA 2J9AA 3HLPA 3NA6A 3KZWA 4MCSA 2BCOA 3PB8X 5JH9A 1YSJA 5K8MA 1CP6A 4UEEA 1F2OA 3KR5A 2ZELA 4A38A 1XJOA 1VIXA 4P6YA 3S9LA 3FX6A 1VHOA 5THWA 2VL1A 3IO1A 4P45A 1YLOA 2PJ8A 4X2TA 3NFZA 4A37A 2IJZA 4OC4A 4JYWA 1ZLIA 5CPAA 3FVLA 4NGQA 3RAMA 4AXVA 4DUKA 3SI2A 2V77A 4ZY2A 2PJ5A 2BOAA 5HVFA 2GU2A 3PRTA 2AFSA 3FJUA 2AFOA 1CBXA 3H8EA 2Q51A 2JBJA 1R3NA 4OKOA 4UIAA 4YWYA 3LWUA 2C6PA 3KQXA 3ISXA 2RFHA 3KASA 2PJ6A 1H8LA 3B3TA 2I3CA 2F8HA 1F2PA 1BAVA 1GYTA 4OC3A 2PJAA 2QJ8A 4F9VA 1R43A 2G9DA 3PB6X 1VGYA 1TKHA 4OC0A 2GLFA 2QVPA 4NGNA 4MHPA 2PJ9A 3BI0A 4FAIA 2O53A 3JRUA 5K8OA 7CPAA 3VATA 4ONWA 4OC1A 3S9MA 4X3RA 4WJBA 3PB7X 2PJ3A 4DYOA 1Q7LA 4PXBA 3NH4A 2IQ6A 4MHYA 1DTDA 3FF3A 2PE3A 1YW4A 2FVGA 3D7DA 4K3NA 3KGQA 4F9UA 2NSMA 2PVVA 1QQ9A 3GB0A 1JQGA 3FEDA 3D7FA 2ZEMA 4R8FA 4P44A 4PXDA 3LMSA 1LFWA 3PFOA 3B3WA 2GREA 1CX8A 5LRJA 1NSAA 1Z8LA 2BO9A 2V8GA 3IWWA 3DGVA 3PB9X 1LCPA 4PPZA 4FWUA 3TC8A 1RTQA 2ZEDA 1IY7A 4LQGA 4P4FA 4P4BA 2PJ2A 2ZENA 1HEEA 1IGBA 3HUVA 2EWBA 3KR4A 3D7GA 1PYTB 3TX8A 4Z65A 1LAPA 4OMEA 2Q4ZA 3QNVA 1CG2A 2AFUA 2ZEOA 4UF4A 1OBRA 2ZEPA 4DJLA 2NYQA 3NH5A 3ISZA 1ARMA 4R7MA 3B7IA
chains in the Genus database with same CATH superfamily
2OEKA 3WC5A 2HFVA 4B3TJ 5M2RA 2P8IA 1WHVA 1RT2B 2RRBA 1N36F 1MMDA 4FS1A 4AL5A 3PR4A 4KYZA 4KGKA 3KHXA 3UCUP 1U6MA 2ABZA 4FKYA 2YNGB 2HS4A 4L89A 2YPYA 4ZVHA 4FZVA 2PJCA 4QIEA 5L1LA 1XWLA 1RWUA 2V8DA 5KT2A 4X66J 5BJRA 3OJSA 3RB3A 4NE9C 2HVHA 1GMWA 3EXCX 3SDEB 3OTEA 2ZKUA 4NASA 4ELTA 2C6GA 2FHOB 4Q2MA 4JWPA 1TK0A 3NAHA 4UA3A 4ZY1A 3MEKA 3TJAA 5HMWA 4DR7F 3CD5A 7AT1B 4WFZA 4I56A 2QLWA 2F7VA 1WSRA 2FJBB 4LVNP 4RZRA 3TI0A 1KWMA 1G1XA 1VLYA 8CPAA 4FXVA 2FHJA 4NSQA 4OIDA 3CWJA 2VI7A 1RYRA 1GTHA 3TZYA 1JLCB 2CZ4A 3MFHA 3GG1A 4I1TA 2Q7SA 2V4JB 4DQPA 1UZHA 3TP2A 1KQFB 2OMLA 2OELA 2AZ3A 2JBKA 3M6XA 3MEDB 4DV0F 3BKUA 4RUBA 4B13A 3K2YA 3NE8A 3DDKA 3NGTA 2XY7A 4PG4A 4MFPA 3OUYB 2IVYA 3MRUA 3FH4A 2XQCA 4RNMA 2KM8B 1IJEB 4NCBA 2ASLA 3GIJA 2G3AA 2XEFA 3ITHB 1V3RA 1Q81T 3UVJB 2Z0ZA 3R5BA 4Y2IA 2HUZA 5IC4B 4KGVB 3LP2B 3R1KA 1H3DA 2Q6BA 3K5OA 2GMHA 1WK4A 1JJCB 2AW0A 3I32A 3D3SA 2PIZA 4UT4A 1L5UA 3O3LA 3MTKA 2HMIA 3WIUA 1P1TA 2BXJA 4M94A 3SSRA 2QX0A 1S1UB 1ZETA 2WVDA 3QIPA 2M3DA 2V9WA 2YNHA 3MMJA 4OYBA 2ZH9A 5F8JA 1HR0F 4YGOA 1Y3JA 2DNZA 1REVB 1P27B 5GMDA 4NGMA 1ZH5A 5C82A 1RDRA 1PCAA 3B3CA 1RT6A 3BBFA 2MJUA 2XEIA 1SB6A 2WVBA 1U49A 3VWDA 3BYRA 1T05A 1RT1A 2NSCA 4M5DB 3T3FA 4ICLB 3VAFA 2DNOA 2WSAA 3TX0A 3KNAA 4G1IA 3IIBA 3EVWA 1F57A 4NLQA 4DSLA 1JLGA 3QGIA 2DRAA 3BSNA 4DV3J 3TZZA 3KK1B 4F8ZA 3MPYA 5LOQA 1UVMA 5GAEI 1CQMA 2K1RB 1TL4A 1TTHB 2PIYA 2VQFJ 2BCOA 3PB8X 2W2OP 2PMWA 3KTQA 2QZ8A 2VONA 3OXFA 1UWBA 3CCTA 4QB9A 2JVOA 2OO4A 4D3GA 5THWA 3VHQA 3I9SA 4F2RA 4IFYB 1YJ9S 4A37A 1ZLIA 2MGZA 4PG7A 5BWAB 2P6TA 4QW9A 1U1MA 2GVDB 4ZKAA 4ED5A 5IT4A 4YS2A 4KKOB 4PSWA 4WIIA 1RA6A 1M5OC 3TVZA 1CBXA 1YGHA 4IF5A 4OI2A 5A2QU 4DLGA 4KS9A 4J9OA 3PRVA 1RGVA 3GJTB 1VC0A 4YY3J 2HHUA 2Y3YA 1ZZNA 2ASJA 4C3MA 2UU9F 2VBZA 4K5RA 2EFQA 2VICA 5KFBA 4PWWA 5U47A 2UZAA 1QTMA 2FL4A 1HPZB 3LTOA 2XGPA 3SCJE 3VALA 1D8ZA 2XB2D 4URSA 1H38A 1LWCB 2Q1LA 3TYTA 4PXBA 5J2MB 2AJ0A 4GC6A 2VJUA 1SL1A 1LOUA 5EWEA 2Q4VA 1EB0A 2E1RA 3DC2A 2YBVA 4DG1A 2J9DA 4CO0A 4PV6A 3KJVA 1SPBP 2C3MA 4F4WA 2B7CB 2QA4G 3CJQA 3I9V9 2YTCA 2NREA 3VVUA 1FE4A 4PXDA 3NCRA 3DR6A 1S12A 3DLBA 4RR5A 3M8QA 1JWQA 3IWWA 2ZH8A 3TT2A 3VCDA 3TC8A 2DIUA 3NEKA 1ZAVA 4LQGA 2ZENA 4ZP8A 3R6GB 2HHSA 3KHHA 3NL0A 1MNEA 2GVZA 5FJ4A 2ILYA 2OD6A 2D9PA 3BLNA 2UVWA 4NA1A 3JSMB 3CIMA 2EFGA 4FN5A 4YFUA 1NHUA 2FUG9 2HHPA 4CAEA 3B7IA 3IS9B 1IKXA 3A1YG 3U7JA 4MK9A 2CNLB 2Y8YA 3SCKE 1CJKB 4CLPA 1XOVA 1VQSA 1HQEA 4DV1F 1WC6A 3BO3A 1XR7A 3ILIA 1R27B 4B02A 4PWDB 4NZ0A 2FHMA 1KQKA 4DPYA 4AVAA 2AMCB 2HQIA 2QYCA 2CIJA 5E7OB 3TAMA 3H2VE 4JI8J 1JWWA 1EE3P 3BJ7A 1JLAA 2UUAJ 3ZTSA 4HHUA 1DJ0A 4NLGA 3SJGA 2H65B 2H1YA 2HNDB 1DTTA 3AOBA 4QZVB 2DT9A 5FDLB 2FVQA 2WONA 3NS5A 4FUUA 2ROGA 2B56A 4B6ZA 1N56A 3L95X 2XI3A 3N6MA 2D69A 1JNZB 3B35A 2DR5A 5KFUA 2HNYA 1C1BB 5T7LA 3PR5B 2JLGA 2RQKA 4QIWD 4O0NA 4OIWA 1B4SA 1RWKB 4NF1A 2CQ4A 3SFGA 1RAEB 4HNWB 1TK5A 3R2CJ 4J37A 4M3SA 4NGTA 1PKUA 1SQGA 2VKZG 5J2QA 3U1LA 3SI1A 5C88A 3RAQA 4LF8J 4NXNF 4FVCA 5J8FA 2RUSA 3MEGB 2QFJA 5KFIA 4H6UA 3G82B 2JX2A 2OSQA 3C6UB 3B8HA 1LWFB 4DSEA 3NGSA 4ALZA 4AB7A 4YB5A 4PYAA 2HBQB 1FA0A 5B7WA 2J6TA 2AIRB 5E5NA 3IR6B 2MSTA 4M85A 3W5ZA 2AX0A 2VFUA 2IRXA 2IAJA 1L3UA 3TO9A 3F41A 1OYEA 5D3GA 5F9LA 6CPAA 4IOCQ 4H54A 3RNZA 2HIYA 4DR1F 4DPTA 3FQLA 1LWEA 2APOA 1Q86T 2COLA 2XZWA 2JWNA 1WC0A 2FVPA 4KHPJ 5KFZA 1HMVB 2CQBA 5F41A 4ZCIA 3K0JA 4E0DA 4WP9A 1HNXF 2HHXA 4F4XA 3QSYB 4P2FA 2PJ4A 5IQQA 2J9EA 3MAAB 1G2EA 2QJ3A 4ZLJA 3H98A 1CPXA 3GFZA 4BLGA 1DRZA 1WKLA 2R3VA 1UAWA 5F47A 1VJQA 4PKDB 2XY5A 5A8KB 2N4CA 5LYLA 2FB0A 2ATCB 1FF2A 4OLLA 3AOAA 2KM8C 1SUQB 2EXUA 5HLFB 4U7CA 1UEVA 2H48B 2QLBB 4DFPA 2R8VA 1BQNA 4KSIA 2ADCA 4TNUA 2DNRA 4RI1A 3JAMU 1GNKA 3PX0A 4U9RA 2PIIA 4IG3A 2J0XA 1SJ3P 4WK3A 5KG5A 2J0QD 2ZELA 2X3DA 1M90T 4QUSA 1IR0A 3C46A 1RXOB 2IDLA 2HK2A 1WHWA 2VPXB 3N79A 4R25A 2UXCF 3SQGB 2AJFE 1RTIB 4YRHA 5DWNA 2D3ZA 3SI2A 5HVFA 1N54B 3SXLA 5CCLA 3E01B 2AFSA 4XDCA 4OHYA 4Y49C 4PK3A 4KRWA 1YWXA 4N8NA 2DR9A 3MM8B 3BGOP 2BQ3A 1VRQC 2A6OA 1RAOA 4WFBQ 1RUSA 1S0VA 3M8QB 1YJUA 1Y5IB 3A8JA 2WOMA 4YHHF 1XMTA 3FEXB 4YB6A 2QO3A 2HWIA 2KB2A 3KKFA 4DXLA 4MKYA 4DL2A 4MFJA 5A8RB 3LF0A 1BWVA 1VGYA 4FD5A 3EYZA 4DV6J 2OPQA 4ZLNA 2ZH2A 1KLNA 7CPAA 4J9MA 4ONWA 4IKAA 1RWXB 1MROA 3T6BA 5KFDA 3IRXB 1KS2A 2DEIA 4ZK7M 2PE3A 2CNOB 3R5AA 2W2PP 4ED1A 2NSMA 1PYOB 1Y3KA 3UPFA 1RAAB 3QSIA 4A8YA 4K4UA 3D28A 3T90A 4DUTA 4X5KA 5LXRA 1KHVA 5IT0A 4DV5J 4CH0S 5DETA 2R2SA 2KCWA 5K9FA 1OO0B 1NK8A 4HPSA 1X4BA 3OUYA 3T9YA 3KK2A 4RW4A 4KKOA 2UUBJ 4B3SJ 4LFCF 1IUJA 3BKTA 1PYTB 5E3RA 1R89A 1A2ZA 2Q3PA 4WKYA 3RTVA 1CG2A 1J5OA 1FEHA 5E96A 3KLEA 2MZSA 1FERA 1TL1B 2BJ9A 4LUBA 2GIRA 4YB1P 1D3WA 4K4SA 3G3SA 3D54A 3MDFA 4NLXA 3GCWP 1R8AA 7FDRA 2AJ1A 1QE1B 3DGPB 2IVMA 4LF7J 5HVGA 3P4UB 2X1GA 2ZITA 4G1QB 3MN8A 2KJVA 3CCUS 3TRGA 1V5VA 2HVZA 1VQ4S 2NUHA 2Z10A 5K14B 2X1BA 4OJ3A 1KTVA 1Z2LA 2I38A 3A13A 2GVZB 2HGMA 5I4MA 5LYIA 1U47A 3HSJA 4LF6F 4EMEA 1T05B 4PXEA 2XY6A 1U24A 3FFIA 8RUCA 3BXMA 3JTPA 4MYUA 1WI6A 4C2XA 4TQSA 3Q8YA 1YK9A 2M8DB 1HYSB 1KEKA 4KFBA 4MBUA 4X4RA 2HWHA 4QWBA 4L75A 2M4MA 2VG6B 5KFVA 1RWVB 4N47A 1UVKA 3RRGA 1X4DA 4IG0A 1RWMB 1BWEA 4CH7A 2V4QA 1Z5RA 2QRRA 4IH6A 3CF5Q 2B5GA 1UWAA 1SC3B 1SC1B 2OEJA 4I0WA 3BI1A 2NXEA 4MT1A 3IG1A 1AUSL 1NSLA 4CO2A 1Y9KA 2L9DA 3D3BJ 3M6WA 4MFZA 1KVKA 2C27A 4CLWA 1HNZF 2H9ZA 1S0MA 1XMQJ 2ZWPA 4IRDA 4NGSA 1RACB 3VAKA 1UP1A 1K9MT 2WZNA 4XPKA 2ZBCA 5JVGQ 3J81j 2BW7A 4DX6A 2B5JA 3PX4A 4MRIA 2HRTA 4LIWA 1U1RA 1XF8A 4Q0BA 2E5LF 5GMEA 2PJ1A 2WW4A 2V63A 2CPYA 2BVZA 4BDPA 2HBYB 2A3JA 2XLKA 4Z2XA 2HQYA 3BH6B 3M8RA 2AEFA 2WTFA 1RTHA 4JB8B 2FGOA 1GK8A 2MYFA 4NXNJ 2CWKA 4OZ0A 1Z9UA 1ZTTA 1WG4A 1XK8A 5I42B 1XNQJ 1VRTA 4TU7A 2UVUA 4QQBA 5LMNF 3Q86A 4LVOP 1GXLA 2CAJA 4CDIA 4U7UD 3TJ8A 4X62F 4CLYA 5IFMA 1IKYA 1HNVB 4CYOA 2GHWA 4HT5A 3DOKA 4XPLA 3V6DA 1FT7A 4EEYA 2RHQB 4ZS6A 4DDFA 2E44A 1SKSA 5B08A 3ZNJ1 4L3KA 1HQUA 1N33F 1HDQA 1TMJA 2XMKA 1JLEA 1FTCA 4QJVA 1OQ6A 2VKRA 1N34F 4DPXA 3M2UA 3UW1A 2JLMA 3F5BA 4RKUC 5AE3A 3M9OB 2Q66A 2BW2A 1D9FA 3D7SB 4JOUA 5B0EA 1LWFA 1YJNS 2KRRA 2BACA 3HLPA 3IMQJ 3CULA 3GG0A 3DRSB 2YX4A 2MKKA 1N5VA 1S5KA 3GYXB 4NMXA 2OKQA 1O8BA 2ZPAA 3W2VA 3CJ3A 2NLWA 2WPWA 2K2PA 2P6EA 2FPHX 3MM7B 4DX8H 4DBQA 3RAMA 4B9SA 2CNMA 3NCQA 4RW4B 1TFYA 3MR3A 3BV8A 4DPWA 1L3SA 3BF4A 3KG0A 3K59A 2ZOMA 3ZFVA 4LRFA 2F4VF 1VRUB 5F8HA 2DGWA 2Q4YA 2NCKL 2DHSA 1R3NA 1AFJA 1S7KA 2DCUB 3TTHA 3KASA 1WJ9A 4KHRA 1T11A 3CJRA 2I3CA 3OVAA 3UVJA 1M44A 3ENWA 4JLYA 2VFSA 3OVBA 1LNQA 1RWWB 2G9DA 1PSDA 1R6YA 3IBCB 3CCRS 1N5YB 4J9KA 3HP6A 1T9WA 2MHEA 3W8GA 2GGPB 1V5IB 5K8OA 2UP1A 2CJAA 1N4LA 3TO7A 5HMZA 1T95A 1RT7A 1JLEB 4ECWA 2A4NA 4H4MB 4MHYA 4S0MA 1R8BA 2FVGA 4DN0A 1FRHA 1D1UA 2BEFA 2PVVA 3CO0P 4DQIA 4CAVA 4NA3A 4LF5F 1RK8A 4WTOB 4K30A 1Q4RA 5DM6Q 3KLIB 2AEMA 4P44A 2EWHA 5E0OA 4DR7J 4L6V3 2XMTA 2PA3A 3DGVA 4P6QA 2EC0A 2L48A 3CJKA 5EMIA 1Q0NA 3VR1A 2ZEDA 2DXFA 4MY3A 1H6KX 2RS2A 3MCSA 3FBUA 3GZ7A 2RS8A 3TX8A 4K5SA 1XIQA 3PNIA 4ECRA 4E0AA 3EMTA 3D1OA 3K58A 5AG5A 4ES1A 3H5YA 1QSLA 2F4VJ 4GKJF 2CJQA 3G6XA 4ZP9A 2NZ4A 4GXHA 4RPFA 3CT9A 4ED3A 5KT7A 1SIWB 3T5JA 2D3O1 3MWBA 4IR9A 1KSPA 2MKIA 4YB7A 3MEDA 1HKAA 2MPUA 1RP5A 1J2VA 3DRRB 1WELA 2B0GA 2HHQA 3DRRA 1RCXB 4GVLA 3P6YC 1PILA 4F3MA 4KO0B 4JI7F 4DUZF 3I87A 2V4RA 1RWOB 5J1PA 3OVSA 3I5BA 5KTAA 2AJ4A 1HDUA 2BJ3A 2FYXA 2Q6CA 2HVIA 2C3OA 5G22A 2ZC3A 3V8IA 3K2KA 1QAXA 4C2YA 3QLHA 3I0SB 2VG7B 4KO0A 1TKJA 3HI9A 5DGAA 2VQYA 3JYTA 4DV2J 4R0EA 1TKZA 1KUXA 1IKVB 2XI2A 3M8PA 1XR6A 1U48A 2H3EB 3G2XA 3O6QA 1UTAA 4R57A 1X5PA 2KYXA 2PT0A 3OLBA 1X4CA 6FD1A 1CEZA 1XRYA 5EDWA 4M5JA 3DDDA 1M5VC 3EWGA 2B6AA 4NLTA 1B70B 3PFEA 1G4CA 2EKYA 2R4FA 3GR0A 1ON0A 4IH5A 4C7QA 1H2TZ 4R76A 2EO8A 2CFXA 3EVOA 1RT5A 1GHEA 1VISA 3IWNC 4DSJA 5GADI 2EFOA 4ZVQB 3KI9A 5LSLA 4QPXA 5K8PA 4F3QA 4HI2A 2X1FA 1NLKL 2YNDA 5EWFA 2F8MA 1A6LA 3IBFB 4P52A 3CB4A 3L4BC 3BEGB 3K8VA 4PZVA 5AJ3J 4GVBA 4DQQA 3N5FA 1ZTWA 2ERRA 2GANA 2OAUA 3FMBA 2ZEFA 1A0OB 4LF6J 2CUYA 2LDIA 4QOTA 2ZVSA 3TW0A 1XEBA 4TYAA 2E5IA 4NGRA 2XO6A 2IBKA 2UUWA 1O0PA 3DMJB 4C3KA 3OHAA 3GYAA 2GW8A 2EI5A 2ILZA 4CCHA 1Q8KA 3DM2A 2HURA 2QEXS 3SXNA 1Y0YA 1YX0A 1LKZA 5DQGA 2GQQA 2X3GA 2DNKA 1TK8A 1U1PA 4K4WA 1WOOA 1TP7A 2K7JA 4DUYJ 3W2VB 5IX3A 1FO1A 3MHYA 3IGRA 1BOBA 3OFFA 6AT1B 4NRTA 4DR3J 3D1QA 2HRUA 4QR1A 2JL9A 4UFXA 1U4BA 1HNWJ 1BD6A 2FIWA 3TAMB 5LRKA 5E2QA 4KOUA 4M5LA 1S9GB 2CPXA 4WYWA 1WWHA 5AXMA 5ELYA 1ICEB 3BKFA 2JDDA 1YBTA 2N82B 1BY9A 4OI3A 1UZDA 4YQWA 3FUYA 4KOYA 4KC5A 2AFWA 4P2MA 1R57A 3GQCA 4U95A 5J2QB 3GWCA 4I69A 5DG8A 2CJKA 2BE7D 1IYLA 2ZWOA 3V6JA 3NGRA 3IC1A 3WDOA 2M7SA 3TAQA 4DU7A 2HNYB 4QR0A 3ZC4A 3JB9k 3DYAA 1IBCB 3A8EA 2B3UA 2H54B 4NZ6A 5KG6A 2W9CA 4P45A 2AYEA 4LBHA 3I96A 3M6VA 1JLBA 3RRHA 3R2DJ 4X2TA 2PEBA 3SQGA 2W4CA 4AXVA 3EZ5A 2VBXA 1JJHA 2N3OA 2DPJA 3LW5C 4Y2AA 3UDLA 3LAKA 2R7WA 1VQMS 2NXJA 5IM0A 3DRPB 4RBVA 2C42A 1T0TV 2CPDA 3DDNA 4ZPWR 2J7KA 2KI2A 1IBLF 1TKXA 3HVWA 2IM1A 3THTA 4JI5F 1HBUA 3LH2S 3CXCR 1R43A 1XTZA 1SQFA 4MJKA 3N28A 3PB6X 2QA4S 1PC5A 3TOQA 2GLFA 4UFWA 5KFLA 2O53A 3IM9A 1S1WA 2CXEA 5IWAJ 4X4UA 3QB8A 5IZHA 2VA2A 2JHEA 2W8LA 3HCXA 1ZBTA 2AGQA 1PU9A 4DR2F 3IR5B 2DYAA 1S7HA 2RDIA 1U02A 2JC1A 2H5MA 1L0CA 1FWPA 5CH7B 2HZCA 3MR6A 4ZVEA 1UJ6A 5D15A 1WTBA 3D7FA 1HR0J 4QYZJ 1XNRF 3OWCA 1UMJA 3B3WA 2R8JA 1SBRA 5B09A 4UUXA 1S9EA 5IS2A 4NLSA 4B3OA 2WVEA 5L38A 5D3GB 2YKMA 5KTQA 3PIOQ 2V2QA 2FC9A 4FBUA 1HBOA 4LSNA 1MWQA 4EYIB 2ZW7A 3HUVA 1U09A 3LAMA 2PSZA 2EK6A 1W26A 2AV5A 5F46A 4HH1A 1T9TA 4B14A 2Q4ZA 3R7BB 3JYTB 3W6XA 2ZH6A 2DVIA 4DQRA 4YR0A 2DH8A 4I2PB 4MCPA 2WW8A 2MQMA 1RT4A 4OZJA 2CJYB 3RU0A 4MJ8A 3VZHA 3SDEA 3KJNB 1RE1B 3R7SB 2CXAA 2Q7BA 2LECA 1F2HA 3TEGA 3PBBA 5HVHA 1JLBB 1DQ8A 3IAS9 4LX9A 3KKWA 4KFBB 4UWIA 4NI2B 1WOPA 1N5TA 2CQDA 1N6QA 4FYXB 3HFVA 4E2AA 4F0XA 1YVOA 3OR2B 3MEGA 1EETB 5CYMA 1DTQA 2JLFA 4AE5A 4LBIA 2ZOGA 2VBWA 3M2RB 1FJGJ 4WFNQ 4CYUB 4A8KA 1N48A 1QVFR 1WUUA 2QL5B 3JVNA 4OAEA 2AU0A 3UD5A 3CC2S 2O3DA 2VB6A 4B9NA 2XEXA 1IYKA 1ZG7A 3D4UA 2XLJA 1TXRA 1FJCA 3FRZA 4V19J 5A8WA 4OYIA 5KTCA 3H59A 4DR3F 1ELLP 1M0SA 1H98A 4U8YA 1I1DA 2OHDA 1B0PA 3DRSA 4TWEA 3CZXA 4W9YA 3E3XA 1WC1A 4P4DA 3DLKB 2V2ZA 5J2NA 1EARA 2UU9J 3KDOA 3AB4B 4ZVGA 1GX6A 4UEFA 1UW4A 4Y65A 1JLAB 4EFAC 4OLPA 2XEJA 3MMBB 3QAHA 3J80Y 3BSAA 1RXTA 4DV3F 4A95A 1CULA 1NJWA 1M1GA 2C6CA 4DV7F 1FKOA 2YNIA 2GFQA 1KR4A 4LSLA 5IQ6A 2ZEEA 4B3RJ 4IK2A 4ECTA 4KR0B 3TOBA 1PGZA 5D4OA 4OC2A 3QGPA 3N01A 1C1CA 3V7ZA 2Q0YA 3BR8A 1N52B 1P0HA 5C5JA 4Q7AA 3HHLB 4C97A 4K7QA 4I2PA 3DGPA 1BMQB 4DSIA 2FVRA 2CQPA 5JVHQ 4FF2A 4A33A 3RR7A 2PJ0A 4J3GA 3ZJ0A 3DLLQ 1YG0A 3PZPA 4FXDA 3UD3P 2CF4A 5MLCV 4HACA 3B6BA 1GT8A 2O66A 2BL1A 4Q45A 2DGUA 1RAGB 2E1MC 3C2PA 3NXZA 4NOHA 2ZNYA 1HARA 3LODA 2KVIA 1GMUA 2YNEA 2ZBQA 1FKAF 2MQQA 2J0WA 4O44B 2V8PA 5H9EJ 4FBTA 4M63A 3GJQB 4I2QA 5D78A 4B9VA 3CW2C 4RN7A 4OV6A 4ID8A 1BXNA 4LFCJ 4DR4J 3AODA 1S79A 1NDKA 5IT9U 3IWEA 4DR5F 5KFCA 2OTLS 4KORA 2WSEC 4K8RA 2F8EX 1SV5A 3HLUA 1K44A 4F0MA 4PG6A 3KHRA 1GX5A 1B99A 1JLCA 1VQ5S 3ZTRA 4IO1A 3CDUA 4B3MJ 5RUBA 4QWAA 2U2FA 4G65A 1LQ9A 1H72C 1ZYQA 2DNNA 2Z3KA 1H0HB 5KG7A 3D1HA 2FCKA 2NXUA 1FY7A 2PJ8A 2HLUA 4ZLPA 3LGNA 4HT7A 4NGQA 1EAYC 2YXLA 3HHDA 1LXJA 3VGTA 4Y2KA 1VDHA 1Y7PA 3DU6A 1CQNA 3PTWA 1FX2A 1ZM9A 4KAIA 4LFBJ 3FJUA 4C8OA 3GJSB 4ZCKA 3MD3A 4I6YA 4U9ZA 2Z8QA 4JD6A 1HI0P 2M52A 1SVDA 4CLLA 3ISXA 3I6PA 3LO3A 4XPDC 2JDJA 4CI0B 4X4QA 2IY5B 4QBJA 2HW3A 4USJC 2AYBA 1S7FA 2XS7A 1TMMA 4NA2A 3M8PB 1YJVA 1F3FA 4YR3A 4M6GA 2B4VA 3TZXA 2PSWA 4NLDA 1Y4ZB 1YGYA 5KG4A 1S7LA 3QZ8A 2HKEA 4ID5A 3S9MA 2V5HG 3G8TA 1DZ5A 3ENVA 1Q7LA 4PPDA 4CLKA 2WVFA 3NS7B 3SXOA 1NPPA 2D3OR 4J90A 2XM3A 3LWLA 3FEDA 2EG2A 1JLQA 4E2FB 2NSBA 2HFOA 1Y11A 2XYPB 1QE1A 2JVRA 1TU0B 2P6SA 1RHQB 2YWGA 3CMES 3C6TB 4M5DA 3I3GA 2YNGA 5J1NA 2ROPA 1LCPA 1TVRB 3T41A 4D3HA 1N0UA 3JSBA 4AXIA 4L8AA 2VPWB 1S49A 3FBEA 3D7GA 4KV8B 2J7UA 1S1WB 1QUPA 3RB4A 2IHR1 3R1HA 3NG8A 3J7ZT 2IIHA 2ZE2A 3MI7X 4DMZA 3CXQA 1C0UA 3FRMA 1UW9A 3ISND 2A1BA 2HNZA 3DMJA 1Q5VA 2IAJB 1HWKA 4MMOA 4A2ZA 1VQNS 4KGZB 2MQ8A 4R0JA 2LXFA 2ZEHA 2B5GB 2FC8A 3CCES 2GQCA 4LMZA 2GC8A 1RLDA 4O23A 5EX3A 1CPSA 3I55S 5D0EA 3VZIA 2KL8A 2CQ2A 4A46A 7FD1A 1ZG9A 1XBUA 1NDCA 2Z3PA 2RSQA 2UVRA 1K47A 2RJZA 2C2NA 1RT3B 5DDOC 2PFFB 2V8VA 4AD6A 3S6GA 2JFKA 3T1YJ 1U0HA 2HFNA 1S1VB 2P9GA 3I1UA 3HHKA 3JQJA 4XNHB 1ZAXA 4J9NA 1WSVA 5HO4A 5HQMA 1M4LA 3H4QA 1E6VB 3S01A 4RUHA 3GSIA 3RO0A 4X64J 3HK2A 1YJ7A 2VDIA 3KLHB 2FS5A 1G7CB 3GTYX 5D4LA 3BM7A 2ACMA 2E1PA 2Y1RI 4B9MA 2GJIA 1WDDA 2XTJP 2CPHA 1NPRA 3PZJA 1Q7YT 4P4JA 3T9NA 2AKWB 4F36A 1IKVA 3BJYA 4ZPVR 1F3VA 3V6DB 1RT5B 3QRRA 3MPUB 4X84A 3R9FA 1YMEA 3EGNA 4MXUA 4F26A 2K3KA 2OZUA 2ROEA 2YH1A 3K57A 2R7UA 3KFWX 3L7OA 4LFAF 3JTOA 3D0HE 1D0EA 3MAQA 4R3KA 1X4GA 4H4OA 2DH7A 3PG9A 3AFGA 2AEJA 4LREA 5F8LA 3T19A 2FJVA 4MTPA 3BH7B 4YUDA 3VGVA 2OPQB 1HNXJ 4USUA 1DQAA 5HATA 4UZCA 3TVKA 1FD2A 5D77A 4WCEQ 2H5JB 3SZ2A 1X5OA 1BE4A 1MSWD 4N56A 4QWEA 2G9OA 2ZBPA 4AG7A 3HX9A 2POKA 1UFHA 4JP8A 5DWMA 4UY8T 1K8AT 3W9HA 1S76D 1BO4A 3FRYA 5L9XA 4ZI6A 3IRXA 3BSCA 5A28A 1AMPA 3KLVA 2MLYA 3FXTA 2ZHAA 4FKXA 2RKIA 4N76A 3N0VA 2WHOA 4DS4A 3VQTA 1H7WA 2X7BA 3HF5A 3I4PA 3SCLE 2PDOA 4RW8B 1I1GA 3HO1A 1TKTA 1AA1B 3I9ZA 5HANA 4Q2LA 3J7YU 3IG1B 5F8IA 1VMBA 1Q1KA 4QCLA 3ZTPA 2E9RX 3MPWA 3OR1B 4EZ9A 3TQEA 3B3VA 2R7OA 1YQHA 3NBPB 4WP3A 1TL7B 2E1AA 5DG9A 2GVDA 3K8WA 4F0KA 3DFEA 2GS8A 3CD7A 3NH8A 5M2PA 2GO8A 1HWLA 3U02A 4LFAJ 3V6KA 1LW2B 2BEIA 5EX0A 2EKNA 3HVTA 2GGPA 1HWJA 4OYMA 2YKPA 5L1IA 4PQUB 1MMLA 1R8HA 3BO2A 2ZZMA 3R9EA 1V6HA 4FYVB 5IWAF 4DUKA 2C1EB 2QLJB 4F3OA 3NY0A 3PJXA 2RMLA 4ZMMA 2VU5A 4N77A 2VC0A 1HD0A 4FF1A 5C24B 1SV5B 5AE1A 3PYDA 5J8CA 1KC8T 2BX6A 3W91A 1Q5YA 1FRXA 1X60A 2Z2MA 1YRUA 4F9VA 1NDLA 1YVFA 3BREA 4OC0A 4ECXA 3TFYA 1BGXT 2QVPA 3OD2A 1LW0A 2J6UA 4HL9A 4O3PA 2IYIA 2MZ1A 4MFLA 4X3RA 5L8RC 3DLEA 3CMQA 5KT4A 4ZOSA 4OZNA 5AT1B 2QMLA 1NU4A 3SV4A 1M1DA 2RHSB 2VD3A 4K3NA 2V68A 2J9DE 3UD4P 5ETLA 4AYBD 4KOXA 2EK1A 2GA7A 3TUIC 4AVCA 4GO5X 1CJKA 4OHWA 2ZW5A 1A7GE 4GKKJ 2VQEJ 2WB4A 4CGOA 1X4FA 3R97A 2XULA 3BGFA 4IDKA 1JIHA 1R0CB 1SI9A 2Z3OA 2FXFA 3ZZIA 4MKBA 1NK4A 5HH1A 2MLZA 3SCIE 2HHHF 3JS9A 4Z65A 3DNSA 3HM9A 4KPYA 2DY1A 4ZJQA 3U27A 4ECQA 5LJ3Y 1Q2YA 2N7YA 3VF0B 4LUAA 2AYGA 2NQPA 4R6TA 3PGPA 4IUFA 4ITSA 4RNFA 2KG1A 4E98A 2HMIB 5LYFA 3BYPA 1IIDA 4CYQA 1S6QB 4NLPA 1FEEA 2D4PA 3WIVA 4K50A 1ZM4A 2UUCF 3GILA 1PG5B 3L2NA 2YNHB 1ZPVA 1SH3A 2VOPA 4UW2A 3PV8A 5A0YA 2MKJA 4IFVA 3OL6A 2WSCC 4JI3J 2GQ2A 2XS5A 5JM6A 1KONA 3DI6A 4RW6A 1MW7A 2BJDA 3ILLA 5KFWA 3Q89A 2FZKB 2GX8A 2LMIA 2DO0A 3JXOA 2E7XA 3PACA 3HHEA 1HNIA 4BD9A 2GAHC 3WX8A 4IFYA 1BPNA 1GTEA 1S77D 3QQCD 3BHXA 3CJTA 1EETA 4HH0A 3W6SA 1BLUA 5A2QY 4DUYF 4B9LA 1MROB 5G0RB 2VH7A 1NMTA 3CPAA 4U96A 3MD1A 4OP4A 3OV7A 1OYDA 3U1NA 2BQUA 2PVWA 3UDCA 1I12A 1X9MA 4LR9A 4QYRA 3SSSA 1EIYB 4RW7B 2WCXA 5JJBA 4TY9A 4ETZA 2DGQA 4FPIA 1CJWA 3OSNA 1RHUB 3KMSA 3QJLA 4OYAA 5D0GA 1HHSA 4X4TA 2NMTA 1BHNA 5LMNJ 4O3RA 3D4JA 4B11A 1LRZA 4FYWB 4QU6A 2NS1B 3PDNA 3C14A 3C14B 5IB0A 3BGUA 2KTQA 4QIVA 1JK9B 3DOMA 1M1KT 2E7VA 4K4XA 2BRKA 2F4FA 4ZP6A 2JEJA 4DCPB 1FRLA 3UWTA 3QRPA 2DXEA 5E3CA 1S1VA 4BCAA 4GC7A 2EFVA 4F4KA 2W9BB 3RYOA 4C8MA 2PJBA 4OX9F 1V3ZA 3FJ2A 5JXSA 3CJ5A 1NNDA 1E6YA 4Y28C 4RUCA 1S1UA 1U1OA 3BN4A 4JI1F 3G96A 4JV5F 3OL7A 2YWHA 3FK4A 1OPZA 1RT2A 4X66F 4DV4J 4CYPA 1SKWA 3GU0A 4H4KA 4MHDA 2O1PA 1N8RT 2VA3A 2FTRA 4RNNA 3ETOA 5IXUA 4NLYA 4X8IA 2EK9A 1REVA 4TVAB 2G13A 3R7NB 4ZX8A 1Y7EA 5K14A 2V50A 1K0VA 1QTNB 4GS4A 3QFHA 4KIAA 4ZVFA 4CGNA 4M6HA 3LP1A 4M5KA 4B3TF 1J27A 4X65F 3I4HX 4MI4A 3S9NA 1KOHA 3W7BA 4JUZA 4KVOE 3CNQP 4Z7CA 3DLGA 1FFSB 5KFKA 5GVQA 5KFMA 1C0UB 4CYNA 4DFMA 3H42A 2CDRB 4C7IA 5A27A 2OTJS 4NRUA 3K9UA 3DU5A 1IWAA 4ZVUB 3RAXA 4OYXA 1PO6A 2HFUA 3BQ1A 3AJDA 4U9YA 2CPJA 3H40A 2B8PA 2QSFA 3R5GA 2P5VA 4WYLA 2ABYA 4WTYA 5LSOA 4IUSA 4UEEA 4IYQA 2KT2A 1R0AA 4GKKF 1LK5A 1F2OA 4R8UA 3NRBA 1XJOA 4EO6A 3FSYA 1I51B 3M8ZA 2E29A 4WE1A 1BUXA 3NFZA 4WU3A 5DQIA 2YH0A 2GIQA 2IA6A 1U0HB 2W01A 1U1QA 4HYKA 4OJHA 4P71A 5IV3A 1FI4A 3AY0A 3G8QA 4URQU 3US5A 2B4DB 2OFGX 3PRTA 1S59A 1ZAWA 4IDKB 2HFSA 3P8BB 3MMCB 2FGCA 2PRBA 1OY6A 3M05A 3ENQA 2V2KA 1WDTA 5D6GA 1S48A 2VDHA 4YR2A 1X10A 1ACMB 2DKOB 2BYCA 3AAWB 3NMAA 1IR1A 2WVCA 2IMWP 3O1LA 2F8HA 3Q8SB 3LP2A 1NSPA 3OXLA 5L46A 2B9EA 4YY3F 1T3NA 4ZVTB 1FDAA 3Q24A 3H5SA 4FD7A 4OV1A 2GNKA 4BWJA 3VATA 1RKJA 4ILRA 3VAJA 1WORA 3ZTOA 1U45A 3NH4A 3H7HB 1MWYA 3EGVA 2PC1A 4KSEB 3PY8A 3FF3A 3KLEB 1KLMB 2YQ1A 2C2DA 5KT3A 4O3SA 3GB0A 1F5CA 3EY5A 4IRCA 2DB1A 3R9LA 3G8SA 3CO9A 3NCPA 4DL6A 1JLQB 2AF6A 1W2IA 3LWMA 2GREA 1MN7A 4UUWA 2J76E 3N6LA 2QMWA 2V8GA 1QLNA 3PB9X 4P75A 6FDRA 3DLGB 1N6QB 5LSRA 1IM6A 3BJ8A 4P4FA 3G6ES 3TQ1A 1JNRB 1SKUB 3QT6A 5SUHA 3D0GE 4LRCA 2EWBA 3VGUA 2ASYA 5ETPA 2XSFA 2L41A 1C4CA 1S0OA 1RTJB 4OMEA 4M5MA 4C48A 4Y2MA 1M5HA 2ZJPQ 1FXDA 3W9IA 3HJFA 3WC2A 3OL8A 2OGUA 2LDYA 4X4VA 4R7MA 3WR7A 8AT1B 4WF9Q 4ECZA 1X4EA 4A8SA 1B64A 1UWYA 3G86A 3FBCA 4Y00A 4MH8A 1ULRA 3TWZA 2BABA 4OHZA 1H2UX 3F0AA 3BBCA 1W7WA 4BBYA 5GCNA 1TR0A 5ETKA 3K5PA 2CQIA 4OZ2A 5AE2A 4IRKA 1ZLHA 2H4WB 1TKZB 4BC9A 2RT3A 4ELUA 2AFMA 4OI0A 4I6AA 2PN6A 2PCUA 1S4EA 1FNOA 4ATNA 1FTRA 3H5UA 3V81B 3KOAA 4LIRA 3VGSA 2PRQA 3KHGA 1S1XB 4X4NA 1ZA1B 1VQ7S 2DHGA 3KJVB 3OPKA 2BDPA 2NYHA 2OZGA 3V4MA 5DS0A 2MMYA 3ZZZA 5C2GA 1M1HA 3H8YA 4G1QA 5DO2A 2Z58B 1EHWA 5ETSA 2UXCJ 1HI8A 1UPPA 1FKOB 5HQLA 4J91A 1F0XA 4R5PA 5J2MA 5EHHA 3V4IB 1LWCA 3FVYA 4IG3B 1FVQA 3B8GA 1JMTA 3EUNA 1HPZA 4YFJA 1IN0A 1FJEB 5SZTA 2HAFA 2DJWA 1FHTA 3MZIA 1NK7A 3A8KA 4P7VA 2FJDB 4IO9Q 1IOFA 3EZOA 4A48A 3CCQS 5LMUF 1BLLE 1GMWD 3CXPA 3LPYA 2RVJA 4LR8A 4J9UE 2CQ0A 4ANCA 1WKJA 2GZOA 4CM0A 3TR5A 3RZAA 4UIBA 3W65A 2FHKA 3OHBA 4A39A 4Q43A 2OMOA 4ECVA 5IOLA 2IC3A 2RILA 1TQLA 4TKTA 1T94A 1M5KC 3ZXWA 1NKBA 2EVNA 4LF4J 3VH9A 1RBOB 3K17A 3L3CA 1U1LA 4KH0B 1Q8LA 4N5SA 1FD8A 3MEEA 1TKXB 4URGA 4ZP7A 5EUHA 2CPEA 4X65J 1U2CA 1AFIA 4KE5A 2B3TB 4CZCA 2YKNA 3PKYA 3RR8A 3IS9A 2KFZA 3D67A 3LQVA 3J7Z5 2HYIB 4HI1A 4P4IA 2YX7A 2VQEF 4KH1B 4OYWA 2V94A 3IP0A 3BGRA 2F3JA 2UUCJ 2I1RA 4HLBA 4P73A 3BB5A 2I5JB 3QGHA 2QTWA 2YKQA 3ZZUA 3FECA 2KVQE 3ELHA 2FZGB 1BQXA 3QYYA 3P45B 4AT1B 1U0SA 2BRLA 2VZZA 2MQPA 3FCWA 4CNYA 4NPOA 2EG1A 4MHZA 5BYQA 1N32F 3WT4A 1UVJA 2FE7A 2CNTA 1KHWA 3FNNA 3MM9A 5L1KA 2VFVA 3AJ2A 5CYJA 1Q2CA 1NE9A 3A3NB 4ZY0A 2MQLA 1EZZB 2XS2A 2HG4A 1IQZA 1RA7A 1S6OA 1VQ6S 1TL3A 2AE6A 4FNIA 3VAGA 1C1BA 2O28A 2C22A 5JH9A 5EC4A 1UFWA 2FJWA 5K8MA 2IC3B 4Q8EA 1VRTB 3Q2TC 3W63A 4KVXA 3A9LA 2KU7A 1RAJA 1P4NA 1QSSA 4OC4A 4F25A 3FVLA 3OL9A 1TV6A 2AYMA 2BOAA 2EFNA 3HVAA 1SJ1A 1NXIA 5T41A 4KBIA 2GU2A 4B3MF 1RABB 3M6UA 2ALYB 1J4JA 3KUGA 2VIHA 4UIAA 3T5HA 4DU8A 2Z2YB 2KDOA 2RFHA 3HDSA 2ACYA 4UOCA 3PO5A 1BAVA 2CYYA 4L73A 4B3SF 4OC3A 1T9VA 1VQKS 3K89A 3LACA 3BZQA 3T1HF 3KLGB 1QSTA 1YRXA 1KFSA 4WZMA 3TCVA 3IN5A 2F5IA 5KFNA 5HJXA 1SL2A 5LXYA 3N7ZA 5LL6d 4HKQA 4ZITA 4UWJA 3TUPA 1AROP 4MK7A 1VK8A 1CC7A 1NPKA 1T03B 4WP8A 1VS3A 4TYBA 1MU2A 1CX8A 1OPIA 4WBFA 3OSPA 1XR5A 5H86A 4F8RA 2HQFA 4OX9J 1X8DA 5ETNA 3EX7B 2KFYA 1TZ0A 2FJXA 2F63A 1P8GA 1F2GA 5JMNA 3HVRA 1RTHB 1X9SA 1AUDA 2B58A 2MLXA 3UI3A 5ETVA 2ASDA 5K20B 3M32A 3FB3A 1F1BB 3CCWA 5BR8F 2W4PA 3C26A 2OI2A 2ZD1A 3C3LA 3MAAA 3GFHA 3WZ0A 4DF8A 4HVZA 2ZZTA 4CO3A 3DHWC 2G2ZA 1RT6B 1NB2A 3R5JB 2I0XA 4JV2A 4CLUA 4NL5A 1K0TA 1XNQF 4ANEA 2CQCA 3D5MA 4A32A 4PRFA 3F44A 1CS4A 3TANA 3KNGA 5IM0B 4UTGA 4I2QB 4IQMA 1TL5A 4O44A 1TUWA 3LP0B 3IGNA 1X5SA 1ELOA 1T8EA 3CXSA 1RB0A 2LA6A 1C0TA 4RNHA 5HBMB 3KWMA 2F40A 2W24A 5KFRA 3B4DA 3E51A 1FJGF 1IU8A 2OPRB 3T1YF 4I6WA 2R7HA 2P6FA 5AG6A 2W4DA 5LMUJ 5IB9A 4PYDA 3D6FB 1F5AA 3IWLA 5J1QA 3CDXA 2JRSA 4PWUA 5GMKa 2LYVA 2XZTB 4F67A 4DQSA 2CVIA 1PJ5A 3GFYA 3GYGA 1KDNA 4CLFA 3SSQA 1NSKL 4C8NA 2JSXA 3C16A 3OFEA 3MCNA 3QLHB 1APSA 3CPWR 3JUWA 1DTTB 3NWRA 2DBBA 2Y9HA 1U1NA 1WEXA 1DBDA 2OFHX 4ORFA 2IMOA 1VRUA 2XNRA 3PKMA 3NP5A 2DHAA 5DDPC 2BKPA 4ZCMA 2J8AA 2OOTA 4WU2A 2JEGA 2XCPA 3CC7S 1R0BG 1IBKF 4V1Ak 5FLXU 2I2YA 3D3CJ 4EWTA 4ENOA 3MM9B 1W25A 2IVFB 2Q79A 1GAOA 2MB0B 3W3SA 2L08A 4NXYA 3POTB 2ZVIA 1ZOTA 8ATCB 2DITA 3DNCA 3PW7A 3UO0A 3GYNA 3M7VA 4U8VA 1F60B 2SXLA 1Q53A 1KD1T 3WHIA 1HD1A 3BDEA 5ETTA 3BSOA 2BJ7A 5D8NA 2VUGA 1K1SA 1JKHB 3CVKA 4M5NA 3OR2A 3PBEA 3VVTA 2VPZB 1KNZA 3TA0A 1PAEX 5AJ3F 2H5EA 1Z8XA 5DLFA 2ZH1A 1SL0A 3MEEB 4C0OC 2PMHA 1ZA2B 3HHNB 5LT5A 3MTJA 2JEIA 3D2WA 2RF2A 3AHPA 2DNGA 2MHNA 1HNZJ 2WAQD 4XNHC 2J9AA 3NA6A 3KXDA 4R8UB 4LQ6A 4ZN3A 3W8PA 2PC6A 3M4XA 1H74A 3PYEA 5HP1B 2CPIA 1X31C 3FYNA 2YKNB 3AQOA 3HFZB 4QWDA 4HKFA 2ZHOA 3NOCA 1VHOA 2UV8A 3DLKA 4J9LA 2OLWA 4I64A 5GAHU 1OWXA 1KQSR 1S72S 4IH7A 2HHHJ 3R5DA 3I5AA 4LR7A 1CJTA 2JBJA 4CT8A 4UOGA 1CJUA 3ZTQA 1BQNB 3RG6A 3B3TA 2DPIA 1QSMA 4DR5J 4ECUA 3PP9A 2R7VA 1GYTA 2PJAA 3KJFB 5D0RA 1WHYA 5CNPA 1VLOA 2HHVA 2GV1A 4OHXA 3KJQB 5DJBA 3TARA 1I6JA 3JRUA 4OC1A 5HL7Q 2UXDF 4UFVA 3PB7X 3OW2R 1HBNB 5FIIA 2DR7A 4NI2A 1RKIA 1JLFA 4RWWA 2LXIA 2VF3A 3KLIA 4DX5A 3QAYA 1TIQA 3AQPA 5LRJA 1S6PA 1DTQB 1U6FA 3NLCA 4FVMA 4TLQA 2NUUG 4XDDA 1I3OB 1VK3A 4AL6A 3ILJA 4Q8FA 3P49B 2LEPA 3OJUA 3EFAA 2VG5B 1W2BR 4ZVRB 5KFSA 4NCGB 4TY8A 3PRDA 3UCGA 2KH9A 4WPAA 3PXGa 3UNYA 5GADU 1UA0A 2R2RA 4EGLA 4M5IA 4CP5A 1QSOA 2RAQA 2NYQA 2LQ9A 2R8IA 4DFJA 3Q23A 3E8OA 4ZIVA 4CLSA 2JH3A 2PMZD 1JXLA 4NGPA 2DHHA 2RF2B 1VIOA 4NXMF 5JQ4A 4NLOA 1X7VA 2JEWA 4CM2A 3DSBA 2Y0SD 1NMEB 2KXFA 4MFBA 4CAXA 1TAQA 2OU2A 3L7PA 3MPVA 4QW8A 2VQFF 2HRYA 4RL1A 1H2VZ 1XMOJ 3QPIA 1P1LA 3CCSS 3SI8A 2GLJA 5JGFA 3KK2B 2K5TA 1CJTB 4ZYQA 2VPYB 1GXUA 2G1HA 4WWSA 4KOWA 2QL9B 4C6AA 3RBUA 2B5JB 3H0PA 4UQGA 3PYFA 4PEOA 4BHQA 3W60A 2CY2A 1Y0HA 4H89A 1XN9A 4C4WA 5F8GA 2LU1A 2N4DA 3BPSP 4DOZA 2BOPA 1N5QA 1HFEL 3IGVA 4NWBA 3M8SA 1V0CA 1S5ZA 2EPIA 4J5OA 3A3OB 3KLHA 2XMVA 4IR1A 1WC4A 3CCJS 2BKNA 4MK8A 1FVSA 3D6MB 4IOAQ 4DR6J 1NDPA 3V38A 3O8WA 2V69A 1O51A 1S57A 4USIA 3IFEA 1FRIA 2YQ0A 5E3PA 3Q8UA 1RSCA 5C42B 2FZCB 2CTCA 5J1EA 1IBKJ 3M2RA 1VQPS 4BINA 1HNVA 4O3QA 2E5HA 2AFZA 4OZ5A 4K0KJ 1L3KA 5KG0A 2VJVA 2CJ9A 4RW9B 3GE9A 3THPA 1YLXA 5DZ6A 4WWVA 4I7FA 4YDDB 4OI1A 1TFWA 2VV5A 5HMYA 3PW4A 2RC4A 5BXIA 3A3PB 1TF8A 3NKYA 4A47A 3MMAB 1FRKA 3UR0A 2R7XA 3PYGA 2J9CA 4CAWA 4UZBA 3PEIA 5CBMA 5HQ8A 4ED4A 4M6IA 3KL9A 4RWXA 1NKEA 1ROFA 4A8MP 4JI2F 3PVXA 2XZDB 2VZ9A 4HNXB 4DZDA 4Z7YA 3RBEA 5KOWA 2ZC4A 4LT6A 5DQHA 2QGFB 3D7HA 4IQXA 4USWA 3G6YA 3NNCA 4DCOB 1M4DA 3TO6A 1Z4EA 1YK3A 2C2OB 1NH8A 1WOSA 1FFGB 1YW6A 4KOTA 1UVLA 5IV0A 5DZ7A 2G4BA 4DHVA 3N4WA 1LK7A 3ONQA 3W62A 2FVSA 3NWGA 4X4OA 2BM1A 3TAPA 2NR0A 4Q5VA 2HB6A 4UEZA 1QVGR 2ZEJA 1WC5A 2AGPA 2CNSA 2V34A 3KHLA 2FLNA 2E5LJ 2ANPA 3MXHP 2HHWA 1KKHA 4HHHA 1TL1A 1HNWF 2R8KA 2HC9A 1DLOA 3PW2A 4KLVA 1ARLA 4LRDA 3RBDA 4CH1A 4BC7A 3T5KA 5IV4A 3H8GA 2NYIA 3H4BA 2KZMA 1PYTA 4ANDA 3K5NA 3SJFA 5B0GA 3QIPB 4AG9A 3CDWA 3KZWA 5E41A 4FF4A 4J9RA 4AL7A 5JUMA 1CP6A 3GONA 4QC6A 1U26A 3KG1A 1FNXH 1MJAA 1RHMB 1HW8A 1KN6A 2WB1D 4FYYB 2EFPA 3GV8B 2O01C 4P2SA 1QAJA 1AB8A 2W9CB 4F4ZA 2OH1A 2V77A 4HACB 4XPDB 2LQBA 3FDSA 3Q8RB 3PW5A 2H5IB 5BR8J 2AFOA 2OSRA 2DPTA 3BQ2A 2XWXA 1NHKL 5J2PA 2K1RA 2A2DA 2AP6A 1GEHA 2YNCA 2UUAF 4B5OA 2OPPA 4RW7A 1QSYA 4XPCA 3HJVA 4PG5A 4MHPA 3H4DA 4O3OA 4C7HA 4FAIA 2LVWA 4GRSA 1CC8A 2X1AA 3MM8A 2DXQA 2WBMA 4W98A 4A8FA 4O4GA 4WJBA 3DLEB 2PFDA 5CA5A 2XMUA 3U1MA 1CLFA 2VODA 2W2QP 4YEAA 1UFKA 4XO0A 3EC4A 4PCQA 5J2NB 1GH8A 1U2FA 4DR2J 1SJFA 4QU7A 4ZBGA 2CDQA 3QAUA 1Z4UA 2VEZA 2WBRA 3QJPA 4OADA 4FD4A 4JXQA 2VXKA 2CPZA 2FDNA 3P5BP 4FWUA 1S9GA 5D4NA 4OI6A 2RQ4A 2XCAA 3VWEA 2HZVA 3MGJA 4RNOA 5HMNA 1IGBA 4YDXA 3B82A 2UUBF 4DL5A 3A4TA 4QR2A 5HLFA 4M5HA 3T6JA 4N7TA 5FDLA 2YGWA 2ZEOA 3IWXA 1OBRA 1JXEA 2DNMA 2IJFA 3WBZA 5KFTA 1VC5A 1NJZA 2YPZA 4C8KA 2JJ4D 1VR6A 5LM7E 3AD8C 1KVIA 1S7NA 2ZW4A 2KT5A 4OX7A 1VHSA 3CJ4A 3W61A 5H9FK 5J1EB 2ATLA 4USVA 3W5YA 4G1PA 5KFHA 3QT5A 2RH3A 2N7CA 3N6NA 1C0TB 2RD5C 3CEDA 1FKPB 2DEJA 5HJYA 2B4OA 3GIMA 3M30B 1WD6A 2VFRA 2REEA 1HLWA 4BMHA 1CS4B 2HWTA 2RIJA 4UCNA 1IKWA 4N8OA 4C9DA 4MYTA 1B6BA 4C3LA 2ALZA 4Q44A 3I82A 2GMLA 4NYOA 2PA8D 4NLWA 1ELMP 1YQEA 4XAKA 4F04B 4RX6A 3AA8A 2VBQA 1OY9A 3VV2B 2DGOA 3GUXA 2RKIB 3FKBA 3OQ2A 3SJXA 4RUAA 1LANA 2L9WA 1R6VA 2C2ZB 2BJEA 2CKWA 4CGLA 5G0RA 4Q38A 2B4BA 4KGMA 1TAUA 3I0RA 1VQOS 2V0NA 2G0BA 2ZFHA 2OPSB 2RE1A 3QO9A 1OIAA 4ED0A 3FIXA 5C7PA 2YY3A 5EN1A 3CCZA 3AOCA 2ZH3A 4KSAA 1LAMA 1HWUA 1CSJA 1RTDA 2V9KA 2VG7A 4RJVA 3C15B 2WUUA 1QUVA 4Q0BB 5F8MA 3EICA 4K59A 2HEKA 4WFAQ 1MU2B 3NMRA 3PHEA 1TL3B 5F3ZA 2J8RA 5AGEA 2CPFA 3NAIA 5D29A 3TOAA 4NCAA 3M32B 1LEOA 4L76A 1RCOB 1AT1B 5HN0A 4GM5A 4CWBA 3OBIA 4ES2A 3FEEA 1SJRA 2ZJRQ 5KFQA 3R6LB 4JI7J 1CBKA 2HZAA 4B5PB 1HW9A 3IA0A 1LW2A 1XBWA 4OJ1A 2DH9A 2B9XA 4ZCLA 4O0IA 1Y5NB 2PGCA 1PYSB 1HQ2A 5GAGU 1FWLA 2YQ3A 2Z2LA 2Z3MA 2C1CA 2GIFA 3RJMB 3CDBA 3CJ0A 2HLTA 5HAOA 2OEMA 3G6VA 3WABA 3IRWP 4WIQA 1KFDA 1YITS 2Q43A 5T14A 1UJ5A 3QJJA 2VOOA 2MZRA 3KHZA 4PAAA 2CRLA 3OTDA 1YX2A 5HK4A 4DUZJ 5CZVA 2F65A 4YOEA 3AD7C 1SC4B 3JTNA 2R7RA 3KLFB 1XERA 2HNZB 2PO4A 1VYAA 2R7QA 3OFGA 4OIXA 4P6YA 3S9LA 1NHVA 2E5GA 2LQJA 3QRQA 4R87A 2ZKTA 3IO1A 2LCWA 1ZPWX 3ETMA 4CTAA 2IJZA 4CTAB 5ADZA 2QSWA 3G4SS 1B87A 3HSZA 3CE8A 2GJFA 3OTCA 1TKDA 5DDQC 2KXHA 1OY8A 3FQKA 1IJFB 1FE0A 5ETRA 4X4SA 1Q95G 2Q51A 3T1HJ 1Q2DA 5KG1A 3IAM9 1KRPA 3G8WA 1H8LA 2BJ1A 2FIUA 4NLRA 3C16B 2MY7A 1Q8BA 1CVJA 3X3UA 2CG4A 5KFGA 1DURA 4ZPTR 1WF1A 5C25A 2PJ9A 5I3PA 1I21A 2PJ3A 2MZTA 4JV1A 2IQ6A 3E2EA 2LA4A 3RBZA 1SH2A 2IPOB 2CA9A 1FKPA 4ZHRB 4KUBA 2BMBA 1Q8IA 3S6FA 1RBLA 5CAAA 2XMAA 2JFDA 1LFWA 4ETXA 3PFOA 5D8HB 4NZ7A 5CD4H 4JI6J 1Z8LA 5F48A 3FNCA 3NS6A 2AHOB 2AX1A 2C3UA 4PPZA 1NO8A 2XLIA 5GAHI 4Z37A 3E01A 2OPRA 2IA0A 3UN3A 4KQZA 2HVDA 5HBMA 1GXTA 3MUMP 2K8GA 3KK1A 4JBCA 2HVEA 1S1TA 4XK8C 2IM3A 2Z0GA 4DN9A 3QNWB 4CQ1A 1IBMJ 3LP0A 4UF4A 5CYQB 3D2PA 4KPCA 1I5OB 2MXYA 2MY8A 5AXKA 2EW9A 4F2SA 2XSJB 2CZ9A 4HTIA 2F1FA 4OMFG 4I49A 1FWKA 3QATA 4C68A 1CM0A 4J9SA 3ENAA 2MKYA 2HQCA 4ES3A 2GHVC 1RTDB 1EP4B 2XEGA 2O4HA 1RWPB 2ZJQQ 4KY3A 3EM1A 4C98A 2MGZB 4CS0B 1S9FA 2R2UA 4MAKA 4A31A 2HQDA 2OPSA 3QO9B 3PIPQ 2GJ2A 4PR6A 1UPMB 3DN9A 2F9DA 2PD1A 2K06A 4JI5J 4DS5A 1VBZA 2C2KB 4YHHJ 3AXMA 2C2RA 2QECA 4ER8A 3L9ZA 1NAQA 2KN4A 3RGIA 1HHQA 4EMDA 5F3TA 4OJGA 3GIKA 3DXBA 1DFDA 1WEZA 3FEYB 2BJ8A 4LF1A 1DE4C 3SJEA 3ITHA 3ZZRA 2Y8WA 3PM9A 1U7LA 3J81U 1IWGA 4UOHA 4N41A 1U6ZA 2XBPA 2PI5A 3TE4A 4OX6A 2PR1A 2GE3A 2IRUA 3SEOA 3T8WA 1EKSA 4I7FB 4PABA 1IKWB 4WFYA 4JJXA 2I8EA 1HYSA 2FIAA 1WNEA 3P2HA 3QGGA 3QT8A 4ICLA 1F9FA 4CRYB 1WF2A 3FFIB 4FPRA 1NB7A 3G82A 2DNYA 4DV2F 5K5MA 4P10A 3BO4A 4RU9A 2DNLA 4DWIA 3PW0A 4DJBA 1QD1A 3OTBA 2RRNA 2CIMA 2AJ2A 3IJ3A 3C19A 2HS0A 2V8HA 3S1TA 1U2RA 2B8QA 4HDHA 4MCRA 3EDRB 1Q16B 4FF3A 3GIRA 1AUGA 2KHDA 4JI4F 2MSSA 1K1QA 1VHEA 1YR0A 1Y7RA 2W7AA 3HMJG 2R8HA 4NEYA 1QMUA 1FCAA 2ZOFA 1KVJA 3QIDA 2W8KA 1EP4A 3W5XA 2CZVC 3UN5A 2R8GA 1LWEB 4NYZA 4J9PA 1Y10A 5KOXA 4MHNA 5I0CA 4MFQA 2LXUA 1NSQA 1YBUA 4NFRA 3GY9A 3LALA 4ILLA 2IJNA 3J81Y 4C0HA 2NZCA 2GO9A 2XMMA 2ZUAA 2MTLA 5L9NA 1FRMA 4CO4A 3AT1B 5CHCB 3HKWA 3MM5A 4E8UA 2FJEB 4CT9A 5GAGI 3B4MA 4DR1J 1QJHA 3LA0A 2OB0A 1Z4RA 5HSPA 1S60A 1T9UA 4MCSA 3M9MB 4A4JA 1RT4B 3MUVP 3BBBA 3KR5A 4NXMJ 4KJIA 4A38A 3HFKA 2G0CA 1D9DA 4MFKA 2KJWA 2DO4A 1YLOA 1AW0A 2IJRA 4NEXA 4WXWA 4PG8A 5KFEA 3DCAA 1YLEA 4WK1A 2VASA 3TNVA 2D74B 1XC9A 1EKRA 5T7LB 4DL7A 3RW7A 2RQMA 4PUOB 1TELA 4OKOA 4YWYA 5F0UA 4J7CA 2C6PA 2J8MA 1NUEA 4A8QA 2PQ8A 4DCJB 3LUYA 1DQ9A 1OSCA 2QA1A 2BE2B 4K4YA 3M1VA 3P96A 2R7SA 3GKRA 1PAUB 4JI8F 1C4AA 2YWWA 1FDDA 4JI3F 3ADAC 1TKHA 1YZ7A 4FP9A 3KK3B 4QIGA 2DHXA 3AH6A 1KQGB 4DV1J 3UE2A 3TO8A 2M0GB 3LOUA 3RBXA 1B0VA 3EE3A 4DV5F 2JEVA 1MJ9A 3FC9A 4X64F 1X9WA 1VHFA 2A6MA 4LF7F 3BGLA 3RRKA 2BV3A 2KG0A 3VAHA 2VC1A 4FD6A 1PC4A 1CJUB 4W92B 3LMSA 3LPEA 2HQGA 1S99A 4P9SA 4MIBA 2Y0BB 2RUGA 1IBLJ 3HVTB 4P4BA 3MMCA 3SQOP 3J7A1 2Y0MA 5G1ZA 3V6HA 2JDCA 2I6WA 1MLAA 1IKYB 3V81A 4FDFA 4TU9A 3IU2A 1U8WA 3GP9A 1XE4A 3DYAB 3KUHA 4Y0FA 3NBPA 4CO5A 1WEYA 4AFFA 2EK8A 4CLZA 4UCPA 3EDQB 5KFOA 1XFOA 4ZPCA 3HHLA 1S6PB 4NLUA 3GSDA 1RO5A 2DTJA 4Y6IA 1RTIA 1WTFA 3KQZA 2I9SA 1OZPA 9ATCB 4C2MA 1PUAA 3EVMA 2YKAA 1XMBA 3GV7B 1RHKB 3QMQA 4TLRA 1KTQA 2LKZA 4UOFA 1URRA 3SMZA 3VQSA 4FBEA 3UDEA 1S10A 3CCVS 1JKHA 4MY0A 1V9OA 4B9UA 3AXKA 3M30A 4GO7X 3DLJA 5A8WB 5C42A 5M2UA 1QY7A 1FXRA 2RDDA 1NZAA 3G71S 2CQ3A 2VZYA 4OZ3A 2BE9B 2LFVA 5B0BA 4Y2CA 4X4PA 3FSXA 1ZS6A 4UY85 2W25A 4F50A 1WKKA 4CPAA 4PQAA 1LV5A 4KUAA 1BQMB 4AXJA 3GIIA 2M8HA 5HP1A 2CNNB 1Z8WA 2PI4A 3Q22A 4UQTA 1UA1A 1LFPA 4PXCA 4P72A 2IBOA 3MM6B 4ZIWA 1HMVA 3R9GA 4OLOA 3HZEA 2M70A 3EJMA 2C2EA 4Y34A 3CPXA 4EBEA 5G4DA 3RUBL 4G6VB 5B0FA 1U1KA 1Z2ZA 4OFZA 2IFXA 2HGLA 5K8NA 3EXNA 5KG3A 1X4HA 1PIEA 2ZW6A 2JC0A 4ZPAA 1P6TA 3PB4X 3GLJA 1T7PA 1CJVB 4NCZA 3J80U 3MCMA 4NMLA 2K3IA 2KO1A 2OIHA 3CJ8A 4OZ1A 3D68A 1REGX 1RU2A 1YRTA 1HWIA 5H84A 2YWFA 3K5LA 4RBUA 4AQYJ 3F56A 3FBFA 5DS7A 3H2LA 4F0YA 1M4GA 3CDEA 5HMXA 2D41A 3FMWA 2FLPA 1HBOB 1MK4A 4DV0J 3SV3A 5H9FJ 1RYSA 1E6VA 4B10A 4DV4F 2VHGA 4RU2A 1LWXA 3HHLD 5BYRA 1F5BA 1RI7A 5B0AA 2BA9A 3DOKB 1SQHA 2JLEA 4DG1B 1JLGB 2W7PA 2FLOA 1VQ8S 5J2PB 2YX1A 3ZZPA 4HEA9 3IM8A 1T9YA 5F0WA 1RAIB 4II9A 2IL4A 4RW6B 4EUVA 1EX8A 4C11A 4C2ZA 5A0YB 2A2CA 2O67A 3BPDA 1A9NB 2M9KA 2OR4A 3I5CA 1Y9WA 2CJXB 2BUNA 4M1KA 4OYOA 4F4AA 3M8WA 1XEZA 1XMQF 1VBXA 1FX4A 3B3SA 3JSYA 5KTDA 4Q36A 3MCOA 3AD9C 4XPEA 1Z8TA 1D9AA 5KFXA 3X1LB 2CJBA 4ZJLA 3Q2SC 1RQ0A 3Q83A 2Y1LB 5AG7A 1RAHB 3EGWB 1T03A 4JI0J 2XG8A 4NYPA 1FT8A 3KG4A 2NXNA 4JYWA 5CPAA 4DEZA 1RAFB 1KUYA 4JXRA 4ZY2A 2PJ5A 3EXYA 2M88A 3LANA 2ZBIA 1YVKA 4H6ZA 3OFHA 2HBZB 4R5PB 4YN3B 4LF9J 5KFYA 4ID5B 1X0PA 3CTRA 4P2XA 2J5AA 3NNHA 3O2IA 3V5RA 4DZ6A 4E8OA 3ISNC 3HD2A 3OXGA 4UBRA 4B08A 1NZ8A 2EC2A 4JI6F 1QAIA 3ZZOA 5EGYA 2YWEA 1Q7LB 2VBYA 2X7IA 4JYAF 4H4MA 2PEHA 3NGKA 4B12A 1HBNA 4CIOA 2MEWA 1VBYA 1M5PC 1G3OA 1YW4A 2U1AA 1SKRA 1NJIT 4LBPA 3GCXP 1QQ9A 2YWKA 2DPSA 3F0NA 4ZHRA 4LSZB 4F02A 2ZEMA 1T02A 3HXMA 2D1CA 1B7YB 2ADBA 1X4AA 2RRAA 1JB0C 1M4IA 1XJWB 3GPAA 4OQJA 2A10A 4L72B 1MN9A 2MKCA 4NX9A 3K5MA 1IICA 4C0BA 3OTOJ 1NBEB 2P9EA 1RT1B 4LRAA 1Y9OA 3AJ1A 1HHTP 1HEEA 2B9WA 2XNQA 1WHXA 2ZHBA 2I00A 3KYLA 2J7WA 1Q78A 2OUGA 1LAPA 3MM7A 5E33A 3PEHA 3AB2B 5H1SV 2AFUA 4W90B 5KAKA 1I94J 3MM6A 4O4RA 1OQ3A 2G3TA 3ISZA 2ZH5A 5LJ5Y 2O5DA 2KFNA 1WWZA 2KHCA 1YTYA 2GCFA 4MIWA 4EK2A 3DM2B 2AFXA 3D66A 2CADA 2XHCA 2BUEA 2AGOA 1J5EJ 2BKOA 3FCVA 9RUBA 1JXVA 3H5ZA 4YU9A 4FS2A 2RDJA 5DM7Q 1UEUA 3LGMA 3TA2A 1RTZA 2NXCA 1HBMA 2KT3A 1UWBB 4BS2A 2FT0A 5L1JA 4A8WA 5CABA 1FESA 2J0SD 4MCQA 1MWZA 1UFLA 4M5GA 5I3UA 2FJAB 3BN7A 2ZXVA 4MIAA 4K4ZA 1RZMA 3NGDA 2HS3A 1EQMA 2QMUB 1C1CB 1N33J 4QWCA 2GHPA 2LU2A 3RB6A 3MOJB 3FBBA 5FVJA 4ZA1A 3S6KA 2B6AB 4R3LA 2B51A 4TXSA 4H2KA 4UCMA 3N9UC 2ZDPA 4CNZA 3JQMA 1L3TA 5AG4A 3HT0A 5KFFA 2J6SA 2D3UA 4JI2J 1JLFB 3LGHA 3TEHB 2EEYA 3MUTP 2REFA 5D4PA 1UKUA 3R1LA 1X12A 3CCLS 1SH0A 3H5XA 3QWPA 3H20A 3B54A 3MECA 2KYZA 4KHMA 3GIUA 1VJWA 1LW0B 1RADB 2YVSA 1B7FA 4P7TA 3UDVA 4KGXB 1FFWB 3MPDA 1AXQA 1IR2A 1WG1A 4ZVOB 4USMA 1MMNA 3SBMA 3JTKA 4HR2A 1H73A 2DISA 3PX6A 1JJ2R 5G20A 2OPPB 1B3TA 1YZ6A 2KXNB 2DR8A 1KP6A 3SFUA 2QIFA 5DGBA 2QG9B 2YNFB 3IBWA 3P3DA 4OZLA 2XSJA 1IKXB 2RB7A 3QWUA 5KFAA 4DR6F 3VWSA 3R5CA 5E3AA 3KK3A 3BQ0A 3TJ9A 2HQ3A 4TQRA 5HI7A 5CCMA 4C8YA 4HTJA 2QLXA 3MMAA 1OJ4A 3CDAA 3NOGA 2C2MB 1YJWS 1KBRA 1D8YA 3R96A 4ZPDA 2V4JA 2MKHA 2DGVA 4LSLB 1VQLS 4AVBA 4LQ9A 1VCTA 2FY1A 3GMGA 3ULHA 3W2WA 1RU1A 4XIUA 3GR1A 3PJWA 2IYGA 3TA1A 3M2VA 3VARA 3MMBA 2W9BA 5DG7A 4CRZB 1FJ7A 4EBCA 1FDNA 1P9YA 3FGVA 2NPIA 2UVVA 3KMQA 3DOMB 3SI0A 3I0SA 5H9EK 2Z56B 5I3UB 2QYGA 4ZN1A 4LF9F 4R9MA 3EPGA 2HHTA 4QBUA 4ZLLA 1GFWB 3C6UA 3FZBA 2M5YA 4QIFA 5I42A 3UCZP 5CXTA 4WFXA 4FXWA 2RQCA 1QAYA 2R42A 4LRBA 1T9XA 2CQGA 1GMVA 4USTA 3CCMS 4CYUA 2R1IA 3EZUA 2JZ5A 3NE7A 2QFIA 5D0HA 1IM4A 3R27A 2AJQA 1YBAA 4BWMA 3T1AA 2DIVA 3H8EA 4H4OB 2DRBA 3OLAA 2J8SA 2UUTA 2DD8S 2XMWA 2QL7B 3C6TA 2A0FB 1F2PA 1X0FA 4DL4A 2MJNA 1RWNB 1OS5A 2D9OA 5CQGA 2EBJA 1VFJA 4NGNA 3UN2A 2LEAA 3DXSX 1PJ7A 3CJ2A 4RW9A 2L9NA 3Q0AA 3W1YC 2JNJA 5KG2A 3BS9A 1S6UA 3B78A 3W64A 4DLEA 2C3PA 1D09B 3TUJC 3D7DA 1VOMA 2DGTA 2ZBRA 2RU3A 1IOIA 4KOSA 1MJBA 4JYAJ 4DF4A 1IBMF 2B4UA 1RHJB 1JX4A 4KZTA 2F5GA 5DDRC 2YNIB 4DL3A 5G21A 3GFXA 1I94F 2BO9A 2PDAA 3QAEA 4USKA 5KT6A 1CULB 2B4DA 3P2FA 3CD6S 3WC0A 1IY7A 3NGUA 2DNHA 4CLTA 3KR4A 2UV8G 5HROB 5ETQA 5I3QA 4IOBA 2FLLA 3THVA 1NRKA 4DPUA 2ZM6F 4ED8A 2V67A 1V3SA 3OTOF 1LXNA 3QNVA 2QN6B 4ILMA 1JJ4A 2ZEPA 3I56S 1KLMA 3NH5A 3SYZA 3PHTA 1N32J 1YJRA 3HSDA 2HFZA 3D8PA 3CJSA 4K4VA 1NH7A 2W1BA 2IM2A 3CSKA 3KDNA 5HXDA 5IT9Y 5JPHA 1Y0RA 3DKDA 3SHPA 2E1CA 2UXDJ 3IXQA 2DXDA 3JSRA 5KFPA 4F6AA 2HPUA 1R7IA 1HBUB 4K4TA 3FMCA 1N5SA 2MQNA 4KT0C 4U5YA 3PEJA 1ZG8A 1B0TA 4DPOA 3NNAA 4KB7A 1TF9A 4CGPA 4C8ZA 2P9CA 2QLFB 1X5TA 3K9TA 1BQMA 3MECB 2ZE2B 4ED2A 2ZNZA 3VAIA 4EYHB 1URNA 2YNFA 3HZGA 3GV5B 5A8RA 4JZ0A 1G6BA 4TNOA 2PJ7A 4IAVA 4RS2A 2VG6A 4KV8A 5F09A 5AXNA 3UQSA 2MZJA 4NCGA 4TY8B 4DSFA 4RLEA 5C24A 4A94A 1AYEA 1VI7A 2VG5A 3W66A 4GVBB 3BGRB 4JI0F 4OHVA 3AA9A 4V19X 2Q44A 1RJJA 2G0JA 3DOLB 4NEZA 5CZXA 2CQ1A 2WSFC 2C28A 1YHQS 3L09A 2G0IA 1DAXA 2DEAA 3HSGA 2Y1JA 1YDLA 3MF5A 4JV0A 1RLCL 1SC6A 2ZH7A 4OYZA 1GQEA 1M5SA 2ZZNA 1IQTA 1VC6A 3ET6A 3PO4A 5A76A 3L7UA 1O5JA 2QIRA 1NJXA 3QFWA 4BBHA 2OP5A 4L3NA 1R0AB 3TUZC 2X51A 3OR1A 1HBMB 4L74A 1FDBA 4J9QA 2P2CB 2QE5A 2DRDA 4U67Q 3CMAS 2ODFA 4WXOA 3MFIA 1CPZA 4RO0A 4EI2A 3WX4A 1ITPA 2B3VA 1TL7A 2XGQA 4LF8F 4KTQA 1TKFA 1DLOB 2Z3LA 2WZ1A 2WPXA 2BQRA 1ZM2A 3V4IA 1NK6A 1J5EF 4JV5J 3CD0A 2P6GA 2F9JA 1SXLA 3IEHA 1SJ4P 3WC7A 2D7SA 2H51B 2V6AA 4OC5A 4PK2A 3PRBA 1PBUA 1YJTA 1DARA 3Q8VA 3CIZA 3S6EA 2HK3A 1FK9A 3DI6B 4PQUA 5AXLA 3KUEA 2BE2A 2ZDOA 3WC6A 3VTIA 3EPIA 4DV7J 2E66A 3F8KA 2AD9A 5L39A 2YKOA 4FYDA 1VQ9S 1Q79A 3D6TB 2HV2A 3JQKA 2NPFA 1U8SA 2FY8A 3FSIA 4IG0B 4KHPF 1FXLA 2BM0A 1S1TB 3R8YA 2G1DA 4F0HA 3CUNA 2QC3A 5ITHA 1HQEB 2KRBA 3V2UC 4C11B 3P5TL 4OL8A 4OI4A 5F8NA 3KLFA 4YP3A 2MKSA 4TN2A 3J7YI 3DHXA 4QVTA 2UXBJ 1N36J 1N88A 3TZWA 1VHIA 3H90A 2RNEA 1HA1A 3FX6A 3G87A 2MDAA 3KLGA 2KKHA 3ET6B 2HBRB 1HNIB 1KZFA 2GFFA 1EJ7L 1YI2S 3JSMA 3EGZA 4QPTA 2C3YA 1WG5A 5C2CA 3QT7A 2DY9A 4A30A 4ELVA 2E9ZA 5E3QA 2PR8A 2DNPA 4LSNB 4O3NA 4LQ3A 5B0CA 5ETMA 4DV6F 1Y00A 3FEZA 3IWGA 1RT3A 1U25A 3LWUA 2AJ6A 3KQXA 1NK0A 4OX8A 5ISVA 2PJ6A 1WF0A 1S9EB 2RU9A 4HDGA 1J5OB 2EBEA 3JAMY 1NKCA 2R98A 3QBCA 3HULA 3MURP 1C2PA 2ARHA 2HNDA 5A8KA 1OSDA 1XMOF 3T5LA 3MGDA 2CG8A 1S6QA 3MR2A 4KOVA 3BI0A 1RT7B 4WZQA 4A8XA 1Z1ZA 3K7RA 1S97A 2FD2A 4DYOA 1XQIA 4DFKA 4ZGYB 4LF2A 3POTA 2LEBA 1TV6B 4P74A 2DR6A 2HSEB 3KGQA 4IFVB 4USHA 2EVZA 4F9UA 1KOOA 2DGSA 1S0NA 1U6BA 2GIVA 3W9JA 2B4PA 2DNQA 4DL0C 4M95A 5IC6B 5EWGA 3QZ7A 1VBKA 3GJRB 3J7AN 2ZH4A 1VQYA 3MOZA 4DI6A 1O6XA 2WRMA 3D2MA 4KSFA 5FLXY 4JI1J 3A12A 3CJKB 2G2YA 3A8IA 1TVRA 4CGMA 1T3OA 2R2TA 1MG7A 3S8SA 4DNCA 4ZJOA 2OH2A 2Z30B 1VKCA 3C66A 4EVYA 2V2VA 4MFBB 4ECYA 3M1VB 4MKAA 1HL6A 2WOMB 4PWDA 5CYMB 2XYGB 4Y3CA 4M8LA 3I0RB 1N0VC 2FQQB 2JEFA 2XHWA 3S6HA 2FSRA 2AT1B 2CTBA 4K0KF 2BZ2A 2E9TA 2ZUGA 1OMSA 4Y49B 4X62J 3HKZD 1TUGB 4ED7A 2OZHA 3D9BA 5A6WA 3C8YA 2VFTA 3DR8A 3ZZ0A 1S1XA 4ZVPB 4EFDA 1K73T 3G9CA 4CO1A 4TU8A 5HROA 1IB1E 3O44A 2AZ1A 2LLZA 1CJVA 2IRYA 1S3ZA 3CC4S 2P0WA 2W9AA 1PBAA 3W2WB 3CGIA 1P9QC 4B3RF 4IHMA 1N71A 4B3OB 4B9TA 1UETA 3C15A 2ZD1B 3D0IE 3H8FA 3RYLA 3MM5B 1SUQA 2CQHA 4EZ6A 2XWYA 4LFBF 4LJMA 2QA2A 1PJ6A 3HD1A 5LRGA 4AUKA 4HHJA 1UVNA 1DY3A 4ONUA 1S7IA 4YMEA 2QV6A 5ETOA 1E6YB 4XTTA 5BYSA 5A6PA 4NJQA 4NLVA 1NK9A 1RTJA 5LYDA 1R8PA 4B17A 2MZQA 1H7XA 3DRXA 3EO4A 4RBTA 2Q04A 1NJYA 1HI1A 1BPMA 3S7RA 4DSKA 4AQYF 1UEKA 1YKWA 2H4YB 5CD4A 3M8YA 2BSWA 3RW6A 5F49A 3B2YA 4NJRA 2LQ5A 2Z4PA 4EU0A 2OD4A 3DDIA 1WC3A 3DRPA 1UJ4A 2AQ4A 3BR9A 1HQUB 2IDEA 2FVCA 2XO7A 4DR4F 1CP7A 3DLHA 1F6TA 2E7WA 2QYVA 2ZM6J 4LF4F 1R8CA 2ZEGA 4ECSA 3H2UB 1TUVA 3HT3A 4W4MA 2DK2A 2XC9A 2BR0A 4O4GB 1Q82T 1NCLA 2XYHB 2W2NP 3ZNUA 2W7OA 2KZZA 3MAHA 2BANA 2QT7A 1XIXA 4C8LA 4JI4J 4KLWA 2AWZA 3WQPA 3UY5A 2I5JA 4LF5J 2L3MA 2IM0A 4RW8A 4WKRA 3O5TB 4GKJJ 1F9EB 4DX7A 1UVIA 4EBDA 2Z3NA 1NEEA 2GMJA 2PE8A 1ZO0A 2WYRA 1N34J 4I4BA 3MR7A 2OJ3A 2BANB 3IR7B 5GAEU 4ZDNA 3FZ2A 5B0DA 1LOKA 3ZO7A 2DCLA 4ERDA 1YIJS 3HPOA 3TVYA 2G2OA 3R3TA 2EBGA 3VAMA 2M2BA 4I68A 2Z11A 2CWXA 1QDUB 1BC6A 1QSNA 3F73A 3D6HB 1N5YA 2WONB 4P4EA 3DRYA 1S4FA 1ZZFA 5KT5A 4FNHA 5DRKA 3ZZTA 5DLGA 4ZX9A 4B5PA 2D4OA 3M9NB 4U6PA 2BBEA 2N3LA 1SIZA 4KVME 2HGNA 3ILOA 1YSJA 1IVZA 5EBVA 1VIXA 1WI8A 4G3IA 1FK9B 4ZVSB 1SJQA 4H4KC 1HIYA 2VL1A 1FRJA 2J8NA 3R95A 1K4JA 4HNYB 1RISA 1QM9A 3IU1A 3UR3C 2HIQA 3M2UB 2UXBF 3OT9A 1ZM3A 2R9LA 1FNMA 3E0KA 3ICLA 1YREA 1EQ0A 4PUOA 2QMXA 2CVEA 4X2BA 1KUVA 5FD1A 2XMJA 2R7TA 2CNKB 4OYPA 2Y1IA 1UCNA 3LP1B 1WACA 5CYQA 4ED6A 4PSXA 3LD2A 3BDPA 4J9VA 1Y5LB 4U7UK 3UNGC 1SCJB 2QJ8A 2FHJD 3RB0A 3HHLC 1R31A 2W2MP 4CAFA 4MKVA 5F9NA 1AZSA 2LQ8A 3PJ9A 4CRJA 2GAGC 1AZSB 2A18A 1DTDA 2DF5A 3ZZYA 3N5BA 3I31A 1SQEA 1UL3A 4F7VA 2LP4A 1JQGA 2HAIA 2Z57B 4I67A 2MQOA 1TKTB 4WE1B 1RBAA 2DGXA 4R8FA 1QSRA 3Q8PB 3Q8QB 3T9ZA 1NM2A 4QYZK 3UFCX 5KFJA 3MR5A 1RHRB 1NSAA 1NK5A 2WK4A 3DOLA 3M2VB 1RTQA 4EO8A 2B9YA 2EUIA 2B7BB 2PJ2A 2YKMB 2JOQA 1F9HA 4GMKA 5C25B 2YNCC 4K2JA