1R3NA

Crystal structure of beta-alanine synthase from saccharomyces kluyveri
Total Genus 151
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
151
sequence length
438
structure length
438
Chain Sequence
GTLNLPAAAPLSIASGRLNQTILETGSQFGGVARWGQESHEFGMRRLAGTALDGAMRDWFTNECESLGCKVKVDKIGNMFAVYPGKNGGKPTATGSHLDTQPEAGKYDGILGVLAGLEVLRTFKDNNYVPNYDVCVVVWFNEEGARFARSCTGSSVWSHDLSLEEAYGLMSVGEDKPESVYDSLKNIGYIGDTPASYKENEIDAHFELHIEQGPILEDENKAIGIVTGVQAYNWQKVTVHGVGAHAGTTPWRLRKDALLMSSKMIVAASEIAQRHNGLFTCGIIDAKPYSVNIIPGEVSFTLDFRHPSDDVLATMLKEAAAEFDRLIKINDGGALSYESETLQVSPAVNFHEVCIECVSRSAFAQFKKDQVRQIWSGAGHDSCQTAPHVPTSMIFIPSKDGLSHNYYEYSSPEEIENGFKVLLQAIINYDNYRVIRGH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords beta-alanine synthase
publication title Yeast beta-Alanine Synthase Shares a Structural Scaffold and Origin with Dizinc-dependent Exopeptidases
pubmed doi rcsb
source organism Lachancea kluyveri
molecule tags Hydrolase
total genus 151
structure length 438
sequence length 438
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 3.5.1.6: Beta-ureidopropionase.
pdb deposition date 2003-10-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01546 Peptidase_M20 Peptidase family M20/M25/M40
A PF07687 M20_dimer Peptidase dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.360 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1r3nA02
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 1r3nA01
2HB6A 2O53A 1TF8A 3D4UA 2Q4ZA 3FJUA 3KGQA 1PCAA 2PJ3A 4G1PA 3VATA 1H8LA 4ZI6A 3NH4A 3BI1A 3FMCA 3K2KA 4NGMA 1LAPA 1YMEA 5THWA 2IJZA 4YWYA 2HC9A 1F2OA 1CBXA 3KASA 3NH5A 2EK8A 4OMEA 4OP4A 2ZEDA 3SI2A 3WC7A 3B7IA 4X8IA 1F57A 3S9LA 2CF4A 3SJGA 4R6TA 4MCQA 5K8PA 4NGQA 1Y7EA 3SJEA 3ISXA 1LFWA 2PJ8A 4P4JA 5JGFA 4RUHA 3WABA 5HVHA 1VIXA 1Q7LA 3IJ3A 4P10A 4YU9A 4EWTA 2AFZA 3BXMA 2V8DA 1R43A 4IAVA 1DE4C 2RB7A 1FT7A 5ELYA 1TKJA 2PJ6A 2PJ1A 3H8FA 4UF4A 3LWUA 2C6CA 3CPAA 1M4LA 2PJ9A 4MHNA 4R76A 3FEEA 4F9VA 5LYDA 2XEJA 3KQZA 3JRUA 3RAMA 2QVPA 4OC0A 5JM6A 5IB9A 4ONWA 1ZG8A 6CPAA 3RBUA 1YSJA 3PBEA 4MXUA 4LQGA 4EMEA 3QNVA 3WC6A 4MHYA 1BPMA 2C6PA 5LRGA 3KI9A 2F8HA 1UWYA 3MN8A 1Y0YA 1ZLIA 4ZX8A 4TNUA 1VHOA 4W9YA 2AFWA 2GLFA 2PJ7A 3FH4A 3PB9X 2C6GA 4R7MA 1FNOA 4NGRA 1AYEA 2BCOA 4A38A 2GREA 5K8NA 2PJCA 5LRKA 1QQ9A 2PJ5A 2Q43A 3IO1A 1IY7A 3KHZA 1CPSA 4OIDA 2WYRA 2OOTA 4P4IA 2ZELA 3I1UA 4P4DA 2XEFA 1QMUA 3PFEA 4JYWA 4PXEA 4PQAA 5LYIA 4FUUA 3FX6A 1LOKA 3K9TA 4MRIA 3CDXA 3N5FA 4MHPA 2ZEEA 3IEHA 5F09A 3RZAA 2C1CA 3LMSA 3PFOA 4NGNA 3D68A 4UEZA 3B3CA 2ABZA 3SJFA 1CP6A 1PYTB 4FWUA 3PRTA 1XRYA 3KL9A 4B6ZA 2PVWA 5JH9A 4A39A 1CX8A 5HVGA 1LCPA 4PXDA 4OKOA 1Z8LA 4EFDA 2PJAA 1NSAA 2RFHA 1TKHA 5I4MA 1F2PA 4MMOA 4WJBA 5HVFA 4ZYQA 4OC5A 4OC1A 2V8GA 1BAVA 3IC1A 1OBRA 3D7GA 1XJOA 4ZY2A 2CTBA 3PB7X 4P6YA 3IIBA 4JZ0A 3FVLA 3BHXA 4CPAA 1DTDA 2V8VA 1LANA 3IFEA 2PRQA 5CPAA 2ZEOA 4MCPA 3VH9A 3PB4X 2Q51A 1XMBA 4IHMA 3SI1A 2PVVA 1VHEA 1XBUA 4DUKA 7CPAA 5J1QA 2DEAA 5K8MA 4IK2A 3TX8A 8CPAA 2AFUA 4Z65A 2IMOA 2EK9A 1HDUA 3KHXA 4X2TA 2AFSA 4AXVA 3H8EA 4K3NA 3B3WA 4NGPA 2ANPA 4UIBA 1VGYA 3B3TA 4KSIA 4PXCA 2PIZA 3NFZA 3B2YA 2ZEPA 4NFRA 1ZLHA 4WWVA 4P45A 2XEGA 3PBBA 2J9AA 1TKFA 3DLJA 4P4BA 4NGTA 5K8OA 1Z5RA 4DYOA 4UIAA 1CP7A 2NYQA 2PJ4A 3WT4A 2XEIA 4A94A 1ARMA 1XFOA 4F8ZA 3V38A 2VL1A 1TF9A 2AFXA 1CPXA 3PB6X 3GLJA 4P4FA 3IWWA 2EWBA 1IGBA 2ZENA 1HEEA 3D7DA 3D67A 2OR4A 3PB8X 3SJXA 4OC2A 3KR4A 4ZY1A 2PJ2A 4UEFA 4A37A 1RTQA 4TWEA 3B3SA 2ZOGA 1ARLA 3T8WA 4NJQA 4PXBA 2ZEGA 3D7HA 4F9UA 2NSMA 3S9NA 3SI0A 4Q7AA 3D7FA 2O4HA 2G9DA 4UEEA 1YW6A 2JEWA 3NH8A 5LRJA 3BI0A 3H8GA 2POKA 1BLLE 2ZEFA 4MHZA 4NGSA 4MCSA 2PCUA 2PIYA 3S9MA 2BO9A 3KR5A 4R8FA 4FBEA 3CT9A 3HLPA 2PE3A 3GB0A 2V77A 1Y0RA 1ELLP 3GUXA 3FF3A 3V7ZA 3FECA 5LYLA 2IQ6A 1ELMP 2PJ0A 2FVGA 5HXDA 1JQGA 3VARA 2QJ8A 5DS0A 2JBJA 1Z2LA 1CG2A 1ZG7A 1EE3P 2WZNA 5LYFA 2JBKA 1GYTA 4OC4A 1BPNA 1HDQA 2ZOFA 4X3RA 4OIWA 2QYVA 2V8HA 1YLOA 3KZWA 2ZEHA 3HUVA 4FAIA 1TXRA 4P4EA 3L2NA 4ZX9A 3FEDA 2CIJA 2BOAA 4MCRA 2F7VA 2PJBA 2GLJA 5CBMA 4O23A 3ISZA 3B3VA 3MRUA 4NJRA 1ZG9A 1LAMA 2GU2A 4ZY0A 3KQXA 1KWMA 5D29A 3NA6A 4H2KA 2ZEMA 2AFOA 4P44A 4PPZA 5D8NA 4DJLA 2CTCA 4GM5A 3CPXA 4BD9A 1YW4A 3D66A 3TC8A 3WC5A 2AFMA 1AMPA 2I3CA 1R3NA 3DGVA 3PEIA 4OC3A 3B35A
chains in the Genus database with same CATH superfamily
3ETOA 3G87A 1L3TA 3K89A 3KG1A 2F63A 1MG7A 1LWFB 1RT7A 1UEUA 1C1CA 1VK8A 1ZAXA 2IRXA 5JUMA 4CO5A 3UN5A 3J7YU 1K44A 1NHVA 1N5YB 3LUYA 4FF1A 3SQOP 1RTIA 3VGVA 5L1IA 3K8VA 3NEKA 5HROA 4X4OA 2ZUGA 4OMEA 3GYNA 2CPXA 3JSMA 2XMWA 4NEYA 3OL9A 2NSCA 2E5LJ 4DV2J 2HHWA 5DWNA 5L39A 3CCTA 3NNAA 1IKYA 2OZUA 3W64A 3TOQA 4UFXA 5JXSA 1Z9UA 2UXDJ 3NGUA 2KN4A 4M6GA 1PG5B 1Q8LA 4LX9A 2FS5A 5KTDA 4NLGA 1WNEA 2JHEA 2PEBA 3L09A 4B02A 3MPDA 1U2CA 3VQTA 2QVPA 3AQOA 4NF1A 5CABA 2V2QA 2IRYA 1S1VA 2H4WB 2ODFA 4X2BA 1TVRB 1NK5A 2C6PA 2CDQA 2XWYA 4C8NA 4CO3A 2RILA 3SQGA 2HFVA 3I9V9 4OX9F 4TKTA 3H20A 3B82A 3C46A 2MSSA 1UETA 2HURA 1HPZA 2CAJA 1VIOA 5E7OB 2OSRA 1HBNB 1OQ6A 2PJCA 4AL5A 2PA3A 5B0AA 5LL6d 3TANA 5G0RA 5IV3A 3ITHA 4ED1A 4JYWA 2P9CA 1H38A 1XNRF 3Q2SC 1LOKA 3K9TA 2KZZA 3V4IB 4MRIA 4IG0B 4MHPA 2YNEA 2ZEEA 4Q8EA 5CZVA 3RBZA 5J2NB 1M1KT 1RQ0A 1X4FA 2YWFA 4KHRA 1RHJB 3N01A 4DR1F 1U47A 4CYQA 4L89A 3QPIA 1Z8LA 1SKRA 5F41A 4Z7CA 4I69A 1EB0A 4ED4A 2NSBA 5B0CA 1TKHA 1F2PA 2Z10A 3AT1B 3D6TB 3KLGB 5KT4A 1Y00A 4ECQA 5E5NA 3NCQA 4RBTA 4OHXA 3NY0A 5K14A 3OFGA 1J27A 2GX8A 1AW0A 2AKWB 2PRQA 3QMQA 1JLGB 4A95A 3R5DA 4ZKAA 1XMBA 1U1MA 3QJPA 2K3IA 3ILLA 2FQQB 3IWLA 3VAGA 4KOWA 2WPXA 4Z65A 1BWVA 2VXKA 2BYCA 4XPDC 2F65A 3LO3A 4LFBF 3TEGA 2X3GA 3F8KA 2GFFA 3RO0A 1JLFB 3M4XA 2UXBJ 4FBTA 3I31A 4ZP7A 2EKNA 2HGMA 2ADCA 4CYOA 3LAKA 3UI3A 4URQU 1H98A 5GAEU 2CNKB 4ZHRB 3MR3A 2XS7A 2G2OA 1FNXH 4KGKA 2VBZA 5CYMA 5ETTA 4F4XA 4H6UA 3AAWB 1TFWA 4EFAC 4ZJLA 3MM7B 4YR3A 5D0RA 4F8RA 1KFDA 3O2IA 2JLMA 4OQJA 1JJHA 1X0FA 2B8PA 1GAOA 3VAMA 2XCPA 4NCAA 2XB2D 1SC1B 1CPXA 2B9XA 3UVJA 1BO4A 1Q0NA 2ZD1B 3PXGa 2Y3YA 4IRKA 3M2UB 1W25A 3NP5A 2A18A 1DTTB 1B4SA 2JLGA 3X3UA 2NLWA 1RADB 1XNQF 4UEFA 2D1CA 1IOIA 2OH2A 4ATNA 2M5YA 3MPWA 3CTRA 1MWQA 1D9AA 1BE4A 1RYRA 1U49A 4OYPA 5EHHA 4J9SA 1K1QA 1RAIB 4PWDA 2VKZG 3UDVA 1AZSA 3EXYA 3EGNA 3K8WA 5C25B 1HQUB 4NCBA 1Y5NB 4NLYA 4QWDA 3PW0A 3H8GA 2FHJA 4AT1B 3CMQA 3FGVA 1X9WA 4KO0B 2PCUA 1UZDA 3FMWA 2ATLA 2MYFA 1U1QA 4ZA1A 5KFYA 4KUBA 2D41A 3P6YC 4DN9A 3R9LA 4LF5F 3PKMA 3HO1A 3WX4A 4N5SA 5DS0A 2JBJA 4KGVB 3LODA 1RWKB 3BSOA 2QL7B 2XYGB 2G2YA 3P45B 1DRZA 4DUZJ 2FZCB 4CI0B 2WZNA 1UKUA 1J4JA 1C1BA 5M2PA 5E3AA 1BPNA 5C2CA 5F46A 5IZHA 3M30A 4X3RA 2QYVA 4IR9A 2WHOA 3JSBA 2H51B 2EK1A 3EFAA 2FZKB 3BR8A 4WFAQ 3HHLC 2KB2A 3NL0A 4MKVA 4NZ6A 3TUZC 3AXMA 4RW4A 4JI5J 1SH0A 2HVHA 3IXQA 1ZM3A 2Y8YA 3EPIA 4DV0F 1MMDA 1ELOA 4N56A 5DS7A 4GM5A 3KJVA 1CVJA 3BBBA 1B0VA 4WFXA 2Y0MA 3PVXA 3B35A 2AEFA 5I42B 4YRHA 1J5OB 2RVJA 2LCWA 2F40A 4YFJA 2BJ8A 2DISA 4J9OA 2PJ3A 3Q8YA 3NOCA 4WU3A 1CC8A 3BBCA 1JLAB 4KH0B 4ANCA 2ZHBA 2EPIA 2DNRA 3GJRB 2EFGA 2YNFA 1S59A 2IHR1 3D2PA 1RHRB 4H54A 3SSQA 5HSPA 1RI7A 2ZEDA 3K58A 2DNPA 1EP4A 2P5VA 1F57A 4WFYA 5B0EA 2GAHC 2Q79A 4DL4A 3DLKA 3UO0A 2J9DA 4F50A 2PJ8A 1O8BA 1NK8A 4DZ6A 1TTHB 3D54A 2EFOA 4WCEQ 3AA9A 3POTB 4X64J 3QATA 2MZJA 3KLFA 1UEVA 3HMJG 4X4VA 3GY9A 4MFBA 2CXAA 2Y1JA 3VF0B 4J9KA 4ZPBA 3BJYA 4Y00A 5LYDA 2KM8C 2GHPA 1N33J 3LPEA 1R0BG 1WI6A 3QGHA 4MXUA 1AXQA 2VBYA 1TK5A 1QSSA 4JV1A 4LUAA 1V3ZA 4ZLNA 1NNDA 4DSJA 5CAAA 1NDKA 3KDNA 2DCUB 5KFQA 3PRVA 1UVLA 5DLGA 3EXNA 4NXYA 4UCPA 4OADA 2HVZA 2ZH3A 2O1PA 3TW0A 1QAYA 1IY7A 1YGYA 4KR0B 5DWMA 2B9WA 1FRXA 4DR4F 2OOTA 4K0KJ 4JI7J 3QJJA 1N32F 2W7AA 2B9EA 4PQAA 3ICLA 2FPHX 3M1VB 1H7WA 2CJ9A 1VDHA 5IV4A 3K2YA 3TA0A 2N7YA 4NGNA 1OPZA 1IICA 1FT8A 4FYDA 2WB4A 5K5MA 1IQTA 8AT1B 2WCXA 3ENQA 2YH1A 4UCMA 3A8JA 3PM9A 3MD1A 2G3TA 2OPQB 4O44B 2DR5A 2BL1A 1JNRB 1FESA 3DSBA 3RR7A 2RFHA 2VPZB 3L4BC 5A2QY 1HR0F 2R98A 3J81Y 5KG4A 3M8ZA 1LWEA 4DCJB 4DUTA 4IQMA 5AE3A 4DV4F 1JJCB 1NKBA 2VPXB 3DLBA 3S6KA 2CTBA 1UWAA 3R2DJ 3BEGB 2ZEOA 3VH9A 3W61A 3R27A 3V6DA 4FVMA 1KQKA 1Y5LB 4EGLA 1YGHA 3BPSP 4F3QA 2DNZA 2KT2A 3QGIA 2KT3A 4WXOA 1S1XB 4G1IA 1B7FA 2GNKA 1YVOA 2XEXA 2W01A 1C2PA 3IGVA 4CYUB 3B3TA 4DV7J 2YBVA 1UJ6A 1UP1A 4OV6A 1PGZA 2K2PA 3HVTA 1MU2A 4DQQA 4NCGB 1RDRA 5F8GA 4MKYA 4JYAJ 1N88A 2F8EX 4OYZA 1EZZB 3AD9C 1OY9A 2P6SA 4RUCA 1KKHA 1DTQA 2FCKA 4K4XA 2ROGA 4BINA 3FEYB 2BJEA 1NUEA 4C8ZA 4USWA 1X5SA 3NNHA 2MZSA 1GTHA 3JAMU 3QLHA 3R5GA 2CQGA 4RUBA 2UV8G 3BZQA 5A8RA 5ETOA 1KTQA 1WTFA 2QLFB 4ZPWR 3DN9A 2QIFA 1SJ4P 2D69A 4U7UK 1WK4A 1X9MA 4PG8A 4FF3A 1NJYA 2UVUA 1X4BA 4MY3A 1U8SA 2C2RA 1SQGA 2JC1A 4Q7AA 2ZC4A 4M6IA 2JEWA 2ZWPA 3PZPA 2B58A 3HHLA 4YDXA 4NGSA 4MCSA 1SPBP 3GMGA 3P2HA 4DQPA 2AP6A 2ALZA 2EC0A 3KR5A 2PD1A 3T6BA 2ZBQA 4J9RA 1YHQS 4JV5J 2IAJB 2BE2B 4JD6A 2V4RA 5KFEA 3N6NA 2CPDA 1X4AA 3F73A 3HSZA 3NWGA 3FEXB 1TAUA 3W6XA 1JLEA 4JB8B 2PMHA 2JBKA 4QIWD 1S97A 3HJFA 3DOKA 1YLOA 1NZ8A 3DM2A 2M7SA 3J80U 1YK3A 3MMBB 3L2NA 4M5IA 3FXTA 3R7SB 3GE9A 1T7PA 3QIPA 1VHFA 2H5IB 4DV3J 1SKWA 4O23A 2DNYA 4DSEA 3MURP 2IVMA 4CGLA 1S6PB 3NA6A 3SBMA 4NLTA 5D8NA 2OPPB 4OYAA 1N52B 3X1LB 2BM1A 1WHWA 3NMAA 1HARA 1ZAWA 1UW9A 1IKVB 2FYXA 1R3NA 3R97A 1YX0A 4OHYA 4TU9A 2E1AA 4GS4A 3LWMA 4N8NA 4DL6A 2OI2A 1H6KX 1HL6A 3LANA 3BI1A 2ZFHA 1GQEA 4IFYB 3MM5B 3CZXA 1C0UA 2MQNA 1XQIA 1Y10A 3N9UC 2AMCB 4LVOP 1KDNA 4UBRA 2CQIA 3I32A 5F8LA 2V67A 3SI2A 4LFAJ 4P9SA 3ZNUA 1FO1A 2F8MA 3K59A 3SHPA 2YNIA 3H4QA 1T3NA 1Y7EA 1FWPA 1VQLS 3SJEA 3ISXA 3NCPA 3G8TA 2JSXA 4QIFA 4RUHA 3IJ3A 2K1RA 3MHYA 3T5JA 4C97A 5HP1B 1HMVB 4FKYA 4IH7A 2I6WA 3FRYA 3K7RA 3MZIA 2UUAJ 1TL7B 3I55S 1JKHA 5ELYA 1NJIT 1U0HA 2VF3A 1I12A 1TL3B 5J2MA 3KLIB 1RWUA 3LALA 1H3DA 1M0SA 4DN0A 2HQGA 4JXQA 2KJWA 1FRIA 3J81j 3PBEA 3R7BB 5KFZA 2IRUA 2YY3A 2FY1A 2E9RX 4CO2A 4KFBA 4J37A 3KJFB 4NLSA 5LRGA 2GQCA 3EM1A 2QL5B 3ADAC 1UFHA 3H59A 3FH4A 2AHOB 3ZXWA 2VQEJ 3VWSA 5IB0A 4LF4F 1Q53A 3NMRA 1XIQA 3MR7A 4UOHA 3MAAA 4MTPA 1T03B 1GMVA 2H5JB 3PYGA 3CXCR 3RJMB 2CJYB 4OLLA 2MXYA 3OTCA 2LA6A 1T05A 3OLAA 2UUBJ 4R57A 1VK3A 3RZAA 2C1CA 1I1DA 1I1GA 1DAXA 3CD5A 2R2TA 2GHWA 1N5SA 3PRTA 5HL7Q 1RA7A 4ZDNA 2BV3A 2PFFB 2RD5C 3B78A 4RNOA 1LRZA 4OYMA 4N77A 1TL1B 2MHEA 4I1TA 2G0IA 2DF5A 3E01B 1H73A 3FZBA 2VZYA 2M70A 3IC1A 1U2RA 2GVDA 1NBEB 3VZHA 3BHXA 2N82B 4DX6A 4B17A 1LANA 5J1EB 1U48A 4IRCA 2NXUA 1FWLA 1N54B 4Y2KA 2N4DA 2I0XA 3C6TB 2D3ZA 3VGUA 2Y0SD 2DR9A 4N41A 1FFWB 2C22A 2QT7A 4FKXA 4OZ5A 1LKZA 1S99A 2QYCA 4IQXA 2X7BA 4Z37A 4LF9F 2VG7B 1VLYA 3GYAA 2PT0A 5A8WA 4ITSA 3KLHA 2VQYA 1S12A 2LLZA 3LTOA 1IBMF 5KFKA 3LD2A 2YWHA 3V6KA 4XDDA 3W3SA 2P6TA 1VRUA 1Q5YA 4PZVA 4P45A 2Z4PA 1Y9OA 3CSKA 1IBKF 3BQ2A 4EZ9A 3NS6A 1CJTA 1WC0A 3W7BA 5K8OA 3VALA 4DU8A 4UT4A 2NYQA 5E33A 2UVRA 4ANDA 2BANA 3AA8A 4WXWA 2JVRA 4ZVFA 2OMLA 3PHEA 4Y2MA 3UNGC 3OR1A 2WPWA 2NMTA 1FF2A 2VG6A 3OBIA 2FL4A 2YNHB 2LKZA 3WX8A 4TWEA 3P96A 5M2UA 3NGDA 2W9AA 5KFAA 3EICA 1ZM4A 3PDNA 2YNDA 3I0SB 1L3UA 1RK8A 1Y9KA 4B3TJ 3H42A 2BQUA 1HBUA 4FDFA 3TA1A 1REVA 4A31A 1IKWA 3H5UA 2RT3A 4ZIVA 4J90A 2BJ9A 3RU0A 4CLFA 5E0OA 3FF3A 2R8VA 1FXRA 5D8HB 4KGXB 2VA3A 5KFMA 1V3RA 1PAUB 5LMNJ 2ACYA 1L3KA 4NXNJ 2QA1A 1KD1T 4DNCA 2YNGA 3G82B 4OAEA 5HO4A 4IH5A 4OHVA 4GKKF 2ZOFA 1T8EA 4UA3A 2CQCA 2FSRA 2ZVSA 2KDOA 2VFTA 2WZ1A 5B0BA 4ZX9A 2WUUA 1TP7A 1Q78A 3D7SB 4MCRA 4J9QA 2W1BA 1WG5A 2BKOA 2HNZA 1ZG9A 3ISND 4K59A 4DG1A 5HMNA 2AX1A 4XTTA 1B99A 1MROA 1RTZA 2W9BB 1S4EA 5HBMA 2C3UA 5L1KA 1KHWA 3JVNA 3GCXP 4GRSA 3CIMA 2J9CA 5F8MA 2Q4ZA 2XO7A 2MZQA 2JH3A 4ED3A 2C2NA 4QW8A 5G20A 4ONUA 1HFEL 2XMAA 2XSJB 2RNEA 5THWA 1S1WB 2XHCA 3SIPB 3GU0A 1F2OA 4FP9A 4GKJF 3MPUB 3OR2A 1NH7A 4U9YA 2OP5A 3OQ2A 5C7PA 4KHPJ 1DURA 2Q44A 1NPPA 2RHQB 4Y6IA 3NCRA 5IC6B 5AXNA 4JV0A 2DKOB 3OVSA 1HI8A 1YDLA 1PJ6A 1HBNA 2AFZA 4H4OA 2YKNA 1FT7A 3W6SA 3EYZA 1S10A 3AXKA 3ZZPA 1O51A 3H4BA 2IFXA 3SXOA 8RUCA 2P8IA 4H89A 3LAMA 5DG8A 1RT5A 3HLUA 1KQSR 3KQZA 4IG0A 2VASA 3JRUA 2PC1A 3DCAA 4Q0BB 1RB0A 2OEJA 5J2NA 1SH3A 1SH2A 2HW3A 3KK2B 1BQNB 2G1DA 4J9NA 1UFKA 2CNNB 1T02A 1SL1A 4KVXA 3CE8A 1RTJB 4URSA 3JQKA 3SV3A 5CCMA 4YUDA 4M95A 1X4CA 2NS1B 3MEDB 2NYIA 2GVZB 2VKRA 5LRKA 2OAUA 2MPUA 1WSVA 1B3TA 5ETPA 5LYIA 2ZM6J 2ZE2A 2VH7A 1JLGA 2V2KA 2XMUA 1WACA 1XC9A 2R7SA 3N0VA 3PFOA 2BSWA 3SJFA 4FWUA 4HH0A 1S3ZA 3G71S 3M9NB 1SQHA 2O66A 4WP8A 3DDNA 3IU1A 3NXZA 1JLFA 2DHAA 4MFKA 4OKOA 5J1NA 2GQ2A 5DRKA 3IRXA 1N56A 1U1LA 3RYLA 2OEKA 1IBLF 4KGZB 1OBRA 4P73A 2DGQA 4HDGA 2HNYA 2HFSA 3KUEA 3AJ2A 1I51B 2PSZA 2P6EA 3EC4A 4CO4A 1NRKA 1RA6A 1TKZB 4FYXB 1N36F 2MHNA 4QPTA 1FKOB 3MEGA 3MUTP 2HQFA 2XY6A 4FF4A 1VHEA 1CC7A 1Q2DA 5KFPA 2FT0A 4EU0A 3TX8A 5F8JA 1M4GA 3UPFA 3DLGA 2ROPA 2WSCC 2ZD1A 1MWYA 1V9OA 1ICEB 4AQYF 4RW8A 2EW9A 5HATA 4K3NA 3CJ2A 1IKXA 3T1HF 2GIVA 2B3UA 4YB7A 3N5BA 1VJQA 3NFZA 3TUIC 3S01A 5C25A 1HQUA 4J7CA 3WIVA 2D9OA 3T1YJ 4JJXA 2XEGA 4WFZA 4KO0A 2H9ZA 4A8WA 4NGTA 1KP6A 2HQCA 1Z5RA 2ZC3A 4DYOA 2WVCA 3KXDA 1YRXA 2Z2LA 4M5KA 4CRYB 1IM6A 3ZC4A 5F47A 3QT7A 4FS2A 1F6TA 3D6FB 1S6OA 2AYEA 3QIDA 4DX5A 2X1AA 2M9KA 3D7DA 2XO6A 4MY0A 1XBWA 1VRTB 4DFMA 3DKDA 4YR0A 1F5CA 3C14A 2AYGA 2B7CB 2VFRA 3LP2B 5LJ3Y 2E7WA 4Q5VA 1U45A 2VBQA 3D7FA 4RI1A 5HMXA 2H5MA 2DB1A 3QQCD 4J3GA 1FRMA 2XWXA 3P5TL 4WF9Q 4FPRA 2W4DA 4F2SA 3FUYA 2BO9A 1RE1B 1HYSA 1S9GB 2OMOA 5EWEA 1EHWA 1ZH5A 3DLEB 3GILA 4J9LA 3JTPA 2R42A 4KTQA 3GONA 1D9FA 5LYLA 4TNOA 4M5GA 2H48B 1M5OC 4CO0A 4JXRA 1LW0A 2K06A 1U1OA 4JI6J 4NLOA 2GAGC 1FHTA 1CSJA 5I42A 4H6ZA 1C1CB 3S7RA 1J5OA 1RWNB 3TTHA 1EE3P 3CCWA 1FDBA 3HJVA 5LYFA 1UFWA 2JOQA 1XMOF 1N5VA 3NAHA 4ECUA 1S7FA 4LF6J 1A0OB 2AD9A 5AXLA 2SXLA 3JSMB 3FEDA 2CPEA 4EBCA 1K9MT 4F02A 5CBMA 4USMA 5KT2A 4DUYF 1PU9A 5CYQA 3W5YA 4QCLA 2CQ1A 1Q8IA 2I79A 1IKYB 4P44A 4ECXA 2HNDA 4DJLA 2ASJA 2CTCA 2LU2A 3CPXA 1YRUA 2AYBA 4OI6A 3WC5A 4LBHA 1WTBA 1GX5A 3L95X 5D77A 4JI3F 2HB6A 4KRWA 2QRRA 3POTA 2Q1LA 4DV1J 2CJAA 3VATA 4KE5A 3TZZA 3OW2R 4LSZB 3FMCA 1OIAA 4NGMA 3MM9A 2IPOB 2FGCA 4F0XA 1N4LA 4YWYA 2EG1A 4QWAA 1S1VB 1LOUA 4XPEA 3TZWA 3EZOA 5KFXA 2HFZA 3SQGB 1FCAA 3OJSA 4U7CA 4CLKA 3EO4A 2BEIA 1S49A 4KOTA 1XWLA 1HPZB 5KTCA 5IX3A 2F5GA 1OY8A 4OLPA 4CGNA 4LR8A 3H98A 2ZW6A 5G0RB 2HQYA 2DY9A 2ZVIA 1NHUA 3ITHB 2V63A 1RABB 1XMQJ 1RT1A 3BJ8A 2XSFA 2DXEA 4UQTA 4KYZA 1WF1A 4YHHJ 2PJ9A 2B6AB 4MIAA 1HNWF 2HIQA 2DXFA 2DEJA 2ROEA 4X66F 4KUAA 4HYKA 2YQ0A 5JM6A 1HNIA 2DTJA 4FD6A 4ONWA 2X1BA 1VC6A 2PSWA 2VPYB 4KAIA 3D8PA 2J7UA 2X1GA 1IR2A 1SL2A 4O44A 3BN7A 4H4MB 2J0WA 1PO6A 3VGSA 2HEKA 1NSPA 1YREA 2FHOB 5D4PA 4A38A 4XPLA 2FHMA 3PTWA 2CJXB 3HD2A 2RJZA 5K14B 2HMIA 2EK6A 3J7ZT 1OWXA 2HS4A 2MQ8A 1XN9A 2VDHA 2HHUA 4EK2A 3D9BA 4YY3F 2AU0A 2QZ8A 4ED5A 3F56A 2KFNA 3IEHA 3W60A 3ENWA 3D68A 2B4DB 3B3CA 1VQOS 1BQXA 4LRCA 5CA5A 1OY6A 1LXJA 3D0IE 5FVJA 3IG1B 3C3LA 4A46A 4NRTA 4A39A 4JLYA 2Q7BA 3GIIA 2JNJA 3CO9A 1XEBA 3C8YA 4EO6A 3P4UB 4OX7A 2MQOA 4DR7J 2DPSA 4C9DA 1NJXA 3BO3A 1X4HA 4WJBA 5CYMB 4NCGA 6AT1B 1TIQA 4FXWA 2ADBA 3M8YA 3OTOJ 4Z2XA 1FVQA 1RP5A 4NE9C 4G1QA 4BC7A 2AV5A 5AE2A 3PB4X 1FKAF 5BJRA 2LDYA 3IWXA 2W2NP 1WF2A 2YKMB 4FYYB 3Q86A 2DEAA 4Q2MA 1UFLA 4DMZA 1UZHA 4G65A 2XNRA 4CAFA 1G3OA 2MY8A 4Q2LA 4DCOB 2IMWP 3KTQA 1PBAA 1WWHA 1BQMA 4USKA 2OHDA 4QJVA 1EETA 2JX2A 1B0PA 1AZSB 4ZITA 1KUYA 1QSMA 4KSIA 1HWUA 2E7VA 2AWZA 3V5RA 1SBRA 2E5LF 3B2YA 1NCLA 1UW4A 2IC3A 5LMUF 2YX1A 5EMIA 1SV5B 1ZZNA 2GFQA 4CNZA 3GIKA 2RH3A 4WIQA 3CJSA 4LBIA 4PK2A 5A76A 2R8GA 1FJCA 4ID5A 4IOAQ 2V2VA 4ZBGA 3NGSA 4RW7A 4OZNA 2DNHA 3KHRA 4A94A 2JRSA 2IAJA 2BE2A 2AFXA 1ZZFA 2BJ1A 3IWGA 4B08A 3M8RA 2DVIA 1UWBB 3ZTQA 2OD4A 5IM0A 1HEEA 2F1FA 4HHJA 1FKPB 4C2ZA 4Y34A 3M6WA 5L46A 3TR5A 1M4IA 2J8SA 1SUQA 4Z7YA 3M30B 5AJ3F 4F9UA 5D15A 2XY7A 2G9DA 3IBWA 2QG9B 3NH8A 3OT9A 3MMBA 3GG0A 2VJUA 4RW4B 2XY5A 1YITS 2K3KA 3QRRA 3S6GA 5FLXY 2CPYA 4WZQA 4NA1A 3KJVB 3WDOA 2HVEA 4OYOA 2Q4VA 1XR6A 1M4DA 5IFMA 2DJWA 1SB6A 2MGZA 4ECYA 3AB2B 3S1TA 5KG5A 2AEJA 2BZ2A 5DZ6A 1T94A 2I00A 4PQUA 4UZBA 2PI5A 1U09A 4GC7A 3TAMB 4IFYA 1SCJB 4KBIA 2YNFB 1ZETA 1G1XA 4BBHA 1VKCA 2FIUA 1EP4B 1JWQA 2E5JA 5IQQA 4NLVA 2KXHA 2EFVA 4OLOA 2UZAA 4F7VA 4JI0J 1BWEA 2MKKA 3FRMA 2DHGA 1WI8A 3T19A 3W63A 4UFWA 1Y9WA 1FDAA 4CNYA 4ED0A 3L9ZA 2ZKUA 5F8HA 2COLA 4HEA9 1HMVA 3KLFB 2O53A 1VQNS 4Q38A 4MFBB 5KT7A 2FHJD 4ZPVR 5I3PA 1SKSA 3I96A 2DY1A 4ZI6A 5DDQC 4DSFA 3KLIA 4I0WA 4K5SA 3CNQP 3C16A 1WC4A 1ON0A 4IDKA 2XLJA 3DRPA 3KASA 3NH5A 1VQ9S 4OX9J 5I3QA 1KLNA 2N3LA 1I94F 2ZH1A 4MIWA 2IM2A 1FI4A 5KFTA 4BBYA 1LFWA 2OSQA 1X31C 4FD4A 2E5IA 1F2HA 1U7LA 3BH7B 2B5GA 1NLKL 4AG9A 1XNRJ 4WKRA 4DJBA 3NWRA 4K4VA 2EFQA 1GX6A 1T03A 3TOAA 2NZCA 5HJYA 3Q8PB 4MHNA 3GCWP 3FEEA 1NSQA 2GIRA 2XGQA 2HHXA 4DR1J 2MJNA 2CJQA 4USVA 2L08A 3BB5A 1S7HA 3WC6A 5EC4A 4USIA 1PC5A 2LA4A 5AXMA 4P75A 3PW2A 1CJKB 1G2EA 2AFWA 4BDPA 1RHQB 4GXHA 4R7MA 2KH9A 3HVAA 3JYTA 4WK1A 2UVWA 1TL1A 1B7YB 2EVZA 1R8HA 3TX0A 2PJ5A 2Q43A 3OXFA 3E01A 5HJXA 2XEFA 5KFVA 4EI2A 1GMWD 2GQQA 3SEOA 5L9XA 3V6DB 4ECRA 3FX6A 4WP3A 2BUNA 4K30A 2WW8A 3LP0A 4Y2IA 5M2RA 3LMSA 4DUZF 1UL3A 2AW0A 4XPKA 2WVBA 3CDAA 2CRLA 3SFUA 2C2OB 3KLEB 2PI4A 5T41A 1CX8A 2YWWA 4NSQA 2I38A 2AJFE 5BR8F 4URGA 1DQ9A 3HVTB 2BVZA 1MU2B 4B3SJ 2XBPA 3T6JA 5AG6A 2HFNA 4MFQA 4OC5A 1N8RT 3PX4A 2QMLA 4NYZA 3CCRS 4IO1A 1OMSA 1S5KA 3OHAA 4KGMA 3MM8B 1FJGF 3TUPA 5D0HA 3BN4A 2CQPA 3OHBA 2MSTA 4ZVTB 1AT1B 1XBUA 1VLOA 4PABA 5A8RB 4ZVQB 4E0DA 5A27A 1RO5A 2PQ8A 4I7FB 1HDUA 4RLEA 2NUHA 4MI4A 3BSAA 4DR6J 4F4KA 4DQRA 4C7HA 4ZPAA 5GAGU 3TO7A 4OYBA 2KU7A 3NBPA 2B5JA 3HHLB 1U6ZA 3GSIA 4FXVA 1S9EA 3AOCA 5EGYA 3ILIA 4JI2F 4ZCMA 2OGUA 4X4NA 4P4BA 4R3LA 1WHYA 1YJVA 3R3TA 2XZTB 4O0NA 3HSJA 4C11A 4OYWA 3J7YI 3H40A 1UJ4A 2GW8A 3H5ZA 5DZ7A 3I9SA 3GLJA 1D1UA 2J0XA 1R6YA 1JLEB 4CQ1A 2JLFA 4LIWA 1IM4A 1N33F 5IT0A 4ZY1A 4HL9A 3LQVA 1SJ3P 3LGHA 3DOKB 1H2TZ 4YFUA 2MEWA 2CNMA 2YTCA 1Q2YA 3D7HA 2IBKA 1T9TA 1T9VA 3DM2B 3HHNB 3TI0A 4J9UE 4W98A 3FK4A 1N34F 2ZH2A 3QIPB 5LRJA 3ETMA 3M6UA 2HLUA 4OJGA 1AUDA 4DV0J 5C42A 3HVWA 1QSNA 4PEOA 1H74A 2EFNA 4HHUA 4OHWA 4FBEA 2HHHF 1J2VA 2A2CA 5I3UA 1KR4A 2UUCF 1RSCA 3CUNA 4JI7F 3H5SA 2IQ6A 3LP1B 2MB0B 2PJ0A 2XC9A 2W9BA 2NZ4A 1XE4A 2FVGA 2BQ3A 5HXDA 2QJ8A 2FHKA 3LPYA 1ZG7A 1FERA 1PSDA 2A10A 1C0UB 4C8YA 4J9VA 2XSJA 2CVEA 1SQFA 3IM9A 1EARA 1K4JA 3OL6A 4DX8H 1U0SA 2FE7A 2Z3PA 3O5TB 2UU9J 3R1HA 1YQEA 1U4BA 1N0UA 2CIJA 3FRZA 4Y0FA 4QQBA 4ZJOA 4HT7A 4RX6A 4ED7A 2YKQA 3WBZA 2J9DE 1UVMA 1YZ7A 3U7JA 2GJFA 4OJHA 2ZEMA 1EJ7L 3MGDA 1A6LA 2K1RB 1QVGR 1YI2S 1YW4A 4M63A 1UVIA 3CDBA 1F5BA 3H2UB 1V0CA 1JKHB 1ZTTA 3TARA 1N6QA 6FD1A 3V2UC 1U0HB 3OTBA 1VQKS 2DPJA 3HHLD 4CLPA 1P9QC 1TZ0A 2JEIA 5J2MB 2RU3A 2G9OA 1XR5A 1MMNA 1HNXJ 3UY5A 2HQIA 3THTA 3CCQS 2RS2A 1URNA 5ETSA 1KOHA 2V9WA 4K5RA 4Q0BA 2MLYA 1ZM9A 3BSCA 3V8IA 4ORFA 3QBCA 2CF4A 3C2PA 4RW9A 2CDRB 2YWKA 3DOMA 2QN6B 4DR4J 3TVKA 5KFDA 5HVHA 1VIXA 1N32J 1RTHB 3MAAB 3MEDA 1RT6B 4U8VA 1QE1A 2GVZA 1RACB 1DE4C 3DDDA 3B4MA 1V3SA 4CM0A 3KKWA 3UR3C 1TKJA 3NAIA 3UQSA 2VG5A 2DR6A 3G3SA 1S1UB 3NGKA 4UOFA 5GVQA 1T05B 5KFIA 4HNXB 5F8IA 3BO2A 1ZO0A 2HQ3A 2JEVA 4F6AA 1RTDB 2E1CA 1F3FA 1QLNA 3E8OA 1UVJA 2F9JA 4K2XA 4OHZA 3RBUA 2CQ2A 2PO4A 5A28A 4AXJA 2KI2A 1A2ZA 1UWYA 1HR0J 1Y0YA 4OJ3A 4R0EA 3MAQA 1NM2A 2PJ7A 5JQ4A 3RBDA 1M5SA 2GANA 3SSSA 2C6GA 1UA1A 3NKYA 2HRTA 2B4BA 1K1SA 2DHXA 4ECWA 3RAXA 1O6XA 4CGOA 3K5LA 1WEYA 4L3KA 3QT5A 2CADA 4C0OC 1TMMA 4UTGA 4B3RF 3AB4B 4ILMA 3OVBA 1NPKA 2VC1A 4KS9A 2D7SA 2KZMA 1TKZA 4L6V3 5T7LA 1FKOA 3R95A 4WYLA 4N76A 5F09A 2G0JA 3O6QA 2B4OA 1CPZA 1W26A 5KOWA 4DBQA 4DI6A 5JH9A 4J91A 5KOXA 2FZGB 4QWEA 1JB0C 1C0TA 3R7NB 2CQDA 2HWIA 4CWBA 5A8WB 3KLHB 1VBXA 3R5AA 3OSNA 1Z1ZA 3TRGA 1LK7A 2NQPA 4DV3F 2DNGA 3TWZA 3TFYA 3R96A 2P9EA 2XYHB 1VHIA 3NLCA 2FVQA 3D7GA 2BEFA 1PJ5A 4UOGA 4HNWB 3ELHA 4O0IA 1Q1KA 2Q51A 2DRDA 1QD1A 2IL4A 4CYPA 4EMDA 2VG6B 5HAOA 2YKPA 1HNZF 5DGBA 4V1Ak 1PYTA 2EK9A 5IS2A 3US5A 4DFPA 2AFSA 3RRHA 4X5KA 3B3WA 3EZUA 4WE1B 3FIXA 5B7WA 4PXCA 2W2MP 1B87A 2FIAA 5E2QA 1REVB 1IKWB 2DT9A 3A3NB 3TAPA 4IUSA 4OFZA 3HP6A 1S9GA 2Q6BA 3HT3A 2FLLA 2C28A 3ZFVA 1IQZA 3SXLA 2Z3MA 2XEIA 3O3LA 3KG4A 6FDRA 4W90B 3DLEA 1VQ7S 3BJ7A 2G2ZA 1R27B 2LU1A 2MQLA 3VWEA 2Y1LB 4PCQA 3G8QA 3H25A 2ZXVA 2RRBA 3O1LA 4OX8A 3G6YA 3C15B 3D67A 2CFXA 2BJDA 2YNGB 1Y3KA 1RBLA 1ARLA 3M2RA 4FNHA 2A2DA 3JS9A 4PXBA 4M6HA 2BW2A 2LP4A 1WC1A 2O4HA 4UEEA 1BUXA 4ZVRB 5RUBA 2AGPA 1YVFA 4P2MA 2HNZB 3FYNA 1R0CB 4DG1B 1JLQA 5HMWA 2VQEF 3W8GA 5IQ6A 1WKLA 2RMLA 2X7IA 4WK3A 2DYAA 4HDHA 1T9UA 1MROB 2Q04A 4B3MJ 2ZHOA 5AG4A 3PJ9A 4RPFA 5HBMB 2C2MB 3P8BB 4LRDA 3NRBA 4QW9A 2XI3A 2KRBA 1QSLA 2RDIA 3H7HB 2HFOA 4MYTA 1S0OA 5JPHA 3E51A 4HI1A 4JI4F 2WSFC 5EDWA 2R7TA 1RXTA 1FE4A 3T90A 3OR2B 4NLRA 3HUVA 1L3VA 2IA6A 1VBZA 4KY3A 1FRKA 4ELTA 1UEKA 1RWOB 2G0CA 3I4PA 1ROFA 1C4AA 2C3PA 4Y3CA 3A13A 3QAYA 4H4OB 2YKNB 2L9NA 2AFMA 3PEIA 3RGIA 3NE8A 1GFWB 4NX9A 3GFYA 3SDEA 4A8YA 2NPFA 2E1PA 3GYXB 4ENOA 3TUJC 4OI3A 2JDDA 4QIEA 1SKUB 1RT5B 3SCJE 2AJ2A 3SFGA 2B6AA 5H9FJ 4IO9Q 4CYNA 3VAKA 3DLLQ 1YMEA 3D6MB 1IJEB 1F3VA 3CW2C 1YVKA 2NXCA 3FVYA 5G4DA 4CO1A 4CLUA 3CCES 2GZOA 3K5PA 4ZLJA 3VV2B 3DDKA 3GIUA 1I6JA 4Y28C 4LF4J 3I87A 1SJRA 5KFSA 1SL0A 4HNYB 4K4YA 3WHIA 3TO8A 5KG3A 4H4MA 2KHDA 4A8QA 2LQ5A 3CB4A 5EN1A 5FLXU 4P10A 1KN6A 3H5XA 3L7PA 2VI7A 5KFJA 1Y7RA 1WOPA 5GCNA 5A0YB 2ZE2B 2JEGA 2RQ4A 4Q8FA 2C6CA 1Z8WA 2O67A 3C6UB 4ANEA 1PYOB 2HLTA 3GV7B 2A1BA 2XCAA 1K0TA 4Y2AA 1SVDA 3ZJ0A 4QWCA 2B4DA 3T5KA 4QZVB 2LEAA 4LQGA 4EMEA 3QNVA 1X10A 3HT0A 1M1HA 3CXSA 2ZH4A 3IM8A 1MSWD 4DF4A 1WJ9A 3IG1A 5ETVA 2ZKTA 5HI7A 2A4NA 1ZM2A 2Z2ZA 4LF8J 5DQHA 3IRXB 4B14A 4ZPTR 1AYEA 4Q43A 2NUUG 1KEKA 5JVGQ 2OPRA 2BCOA 2ASLA 2HBQB 3PNIA 2IIHA 4IRDA 5KT6A 3UD3P 5DG7A 1AB8A 3KHZA 2HNYB 2BQRA 4OIDA 2EBEA 4P4IA 4YS2A 1LNQA 4PXEA 4NEZA 2QIRA 2KVIA 3FBEA 3MEGB 4L8AA 3AY0A 3TVZA 1XK8A 5D6GA 2YKMA 2RQMA 1HD1A 3DLGB 2PMWA 4UEZA 5D4LA 2PE8A 1QSYA 4LF9J 4NCZA 5ETKA 4RW8B 2MKJA 3IAS9 3SXNA 1IKXB 3FC9A 4GMKA 1ZOTA 1IBMJ 2VOOA 3AOAA 2GV1A 2PJAA 3PX6A 3WIUA 4ER8A 2J9EA 5I4MA 1K0VA 4MMOA 1V5IB 5F3ZA 1IBKJ 4OIXA 1R8BA 2ZBCA 5KTAA 3FNNA 4KQZA 4JZ0A 1SV5A 1WC5A 2R9LA 3FMBA 2J6SA 2QECA 4UW2A 1RKIA 5A8KB 4AL7A 2E1RA 2AYMA 2BX6A 1MJAA 4ECZA 2UP1A 2R4FA 1UWBA 2J5AA 3C14B 3KHXA 4KOYA 1FKPA 5KG6A 5C88A 1KSPA 1NSLA 3HFKA 1R8CA 1HI1A 2O3DA 1F9FA 5G1ZA 1TMJA 3VTIA 2CPJA 3W8PA 1S7NA 3W66A 3GPAA 4OZLA 2DR7A 2J8AA 4BLGA 1HYSB 1S60A 4KLWA 4B12A 2IY5B 4UIAA 3PEJA 1CP7A 2K8GA 3J7Z5 1ZS6A 3BGRB 4MFLA 1LW0B 1RAEB 1X4EA 2M3DA 2V0NA 4F36A 5LXYA 4DZDA 5C24A 1RLDA 2MLXA 1T9YA 4KPCA 3E2EA 2FLOA 1MLAA 1IR1A 4V19J 5DQIA 3MR5A 2WOMB 2AQ4A 3B3SA 1OPIA 2KL8A 4NJQA 2C42A 3TAMA 2IYIA 1JX4A 3GIRA 4UY8T 4R5PA 2PA8D 2J6UA 1ITPA 4E8OA 2X51A 1GMWA 1ZPVA 1VQ5S 1SC3B 3LWLA 5CYQB 2Z3OA 4WWSA 3CCMS 2ZEFA 4MHZA 4QBUA 2YH0A 2M8DB 2G0BA 2HNDB 4PRFA 4NRUA 3QWPA 3GB0A 4ZVUB 1Y0RA 5G21A 2HK2A 2AZ3A 3ET6A 1GK8A 2G3AA 3FECA 1KBRA 3DRSA 3QAEA 4TXSA 4C98A 2CIMA 1IWGA 4EYHB 3PJWA 4I6YA 2RF2A 1SJFA 4F04B 2ZZTA 3L7UA 3LGNA 4O4RA 3MM9B 1Q79A 1RBAA 1MK4A 3PYFA 2Q4YA 2RDJA 2AJ0A 1KTVA 1B70B 4HACA 2BOAA 4K4UA 2HRUA 4LVNP 4DSKA 2F7VA 2PJBA 1U26A 3KYLA 3B4DA 1FRLA 5AXKA 3TOBA 4MIBA 3PG9A 2NXNA 2OLWA 2QO3A 3D66A 3TC8A 1TAQA 1AMPA 1RT1B 3CF5Q 2KYXA 3EMTA 1R8AA 2CNOB 5KFBA 1WEXA 3IN5A 2OUGA 2DNOA 2H5EA 5ETRA 1IIDA 2R2SA 4NYPA 3OXLA 1WHXA 1HNIB 3PACA 2HC9A 2ZZMA 1NDPA 4TYBA 1CJVB 3ZZZA 1P1LA 3VCDA 2B0GA 1FDNA 1CJWA 2XZWA 3G9CA 2BDPA 3SJGA 1HNVA 3JSYA 4MCQA 2RSQA 2AJ6A 3M9MB 1CJKA 2HVIA 1YJTA 5JGFA 5EX3A 1D3WA 1Q7LA 3ZTOA 3TZXA 1G6BA 4G3IA 2HMIB 4YU9A 4F4ZA 3EXCX 2RB7A 2I5JA 1Q82T 4UF4A 1NK7A 2Z2YB 3RRKA 3DRYA 4PV6A 2KFYA 2QJ3A 1PJ7A 3FZ2A 2BRLA 1NJWA 4KVOE 3M8PB 1P1TA 4B5OA 1W7WA 3DU6A 4X4TA 3ZO7A 2FIWA 2P6GA 4KPYA 4NLUA 2EFPA 5LSOA 4GO5X 2CJKA 5SZTA 1R8PA 1HHTP 2EXUA 1NPRA 4CAEA 3KLEA 3MTKA 1X12A 2QV6A 2OJ3A 3BGOP 4B5PA 1IBLJ 4NGRA 4AYBD 1M5KC 1D9DA 2D9PA 5L8RC 4G1QB 1S77D 3KOAA 1N36J 4P4DA 1QMUA 3CXPA 3MM8A 4AUKA 4KH1B 3CCUS 4LSNA 4S0MA 1TFYA 3ILJA 2Z3LA 2ZBPA 2ZPAA 3IA0A 1YBTA 4C3LA 3Q22A 2GO8A 4JBCA 4DV5F 4AQYJ 5H9FK 2R8JA 1S7IA 3T1HJ 1BQMB 2FJAB 4I7FA 3DRRA 3TZYA 2REFA 4NZ0A 1P27B 2NYHA 3EWGA 1EETB 2BA9A 2FVPA 3DU5A 1PBUA 3M2VB 1HD0A 1EKSA 3AD7C 3HZGA 1T9XA 1CLFA 2OB0A 2IC3B 5HVFA 5CCLA 4ZYQA 1GT8A 4ECVA 5LOQA 4NXMF 5IT4A 4NL5A 5AE1A 4XPCA 3PEHA 1W2BR 3PB7X 1LV5A 4HTIA 1JWWA 1JJ2R 4ID5B 4RW7B 5B0DA 1MMLA 1QSRA 2H4YB 3GFXA 1SJQA 1VI7A 4NI2A 3DRXA 4IHMA 3GKRA 2FGOA 4G6VB 3T5LA 1OZPA 1XERA 5K8MA 1F1BB 2E29A 3TE4A 4NEXA 1EKRA 2WSEC 5IM0B 8CPAA 2HAFA 1GXLA 3R6LB 2VICA 4HT5A 1TKXA 2WVEA 2Z56B 4A47A 1SUQB 1UMJA 1E6VB 2CQ3A 1HHQA 1YG0A 5GADU 3OFEA 2EKYA 1FTCA 1HQEA 1VGYA 3NGRA 4XDCA 4IFVB 2M52A 2ASDA 2AT1B 2KKHA 1YJ7A 2DPIA 4OZJA 2CQBA 1ZBTA 3SMZA 3R1LA 1RHMB 2ZEPA 3PIOQ 3CPWR 3MXHP 2NR0A 2BOPA 4DR5F 1Q81T 1R57A 2ZH9A 1ZLHA 3CDUA 5KFLA 2PIIA 1DLOB 4PG7A 3DMJA 3EJMA 1JLCA 4PUOB 3VR1A 2ZJRQ 2XMMA 4IYQA 4ZK7M 2PJ4A 1RISA 4CGMA 3JAMY 3UDEA 1ARMA 1LEOA 2EWHA 2W4CA 4WFNQ 2MGZB 1YBUA 4F8ZA 1S6QA 3LP1A 3I6PA 2KRRA 1F0XA 4PQUB 1XMOJ 4DPYA 1NKCA 3A4TA 3KR4A 2PJ2A 4WZMA 3MEKA 3KKFA 4K4ZA 2ZOGA 4ILLA 4RW6A 3S9NA 2IVYA 4CIOA 4DUYJ 2EI5A 5H9EJ 4DXLA 4I2QA 2QL9B 1RCXB 3RUBL 2F4VF 2KHCA 3WZ0A 2J0SD 4H4KC 2KXFA 3FBFA 4I4BA 3W65A 2I9SA 1G7CB 4C2XA 1ZA1B 1ELLP 3GUXA 4KORA 3CC4S 4EBEA 1VMBA 2AGQA 3BR9A 1M1DA 4MK7A 3QZ7A 3IR7B 3MOZA 4ZPDA 1HDQA 3C16B 2F9DA 1ZAVA 4DV6F 4IDKB 3DRPB 2V8HA 1KNZA 1TUGB 3OWCA 4LFCJ 3KZWA 2M2BA 3CC2S 2EO8A 2CKWA 2MZ1A 1JJ4A 1YJUA 1DY3A 2JFKA 2YX7A 2VHGA 4DR7F 4PG4A 4X4RA 1DQ8A 1K47A 1HBMB 4ZY0A 3CCZA 2CQ0A 3OTOF 3GYGA 2B5GB 3LA0A 1PKUA 2IJRA 2X1FA 2LQ9A 4MT1A 2OPSB 1RTHA 4R25A 3KFWX 1RT6A 1U8WA 2BMBA 2Q7SA 4JI1F 2JVOA 1TF8A 2Z2MA 4ED6A 2W24A 2VZ9A 3FJUA 3MFIA 1PCAA 2B51A 2KG1A 3E3XA 2DNNA 3PR5B 4O3SA 1S1UA 4CLLA 2PN6A 1XTZA 2Z0GA 2R7UA 1RTDA 3GWCA 4KC5A 4CH7A 1Z2ZA 2EK8A 3OD2A 1PIEA 2DGXA 2KT5A 4M5HA 2RHSB 3K5OA 3D1OA 3MD3A 4LQ9A 2ZBIA 1OYEA 2FD2A 2XLIA 3JYTB 3SZ2A 1Q86T 3FSXA 3MOJB 3J7AN 2YKOA 3KHGA 2JDCA 4PPDA 4OYXA 1X4GA 5KG7A 1R43A 4YY3J 2VQFF 3IS9A 3GV8B 1FXLA 3MMAB 1NK9A 2QMWA 3H8FA 4QVTA 4EYIB 3Q89A 3FDSA 4J9PA 1KVIA 3LP0B 1NEEA 4NLXA 2P2CB 3CD7A 4F9VA 3AFGA 4AG7A 1PC4A 2L41A 1IB1E 2IA0A 3FJ2A 3FKBA 1TQLA 2YX4A 2FDNA 2LXFA 2MQMA 5IB9A 3Q2TC 3W91A 2HWTA 3CJKB 2I8EA 1X5PA 2M0GB 4MHYA 4GVBA 5FJ4A 1VHOA 3MM6B 1OYDA 3QJLA 1CEZA 4ZCLA 2ZW4A 3SSRA 3ZNJ1 4ZPCA 3S6HA 4KOXA 1IR0A 4BWJA 3HSDA 4MH8A 4WFBQ 3TT2A 1MJBA 1F9HA 3CC7S 4CZCA 2UUWA 1GXTA 2V5HG 3CJ4A 3MI7X 4CAVA 2ZH8A 2MKIA 4FNIA 1UAWA 1WOSA 4DPXA 1IYLA 1WC6A 1GH8A 2V4JA 1TK8A 1BGXT 3QRQA 1T0TV 4B9TA 3T5HA 2VD3A 3W2WB 5BYQA 3MEEA 3R9EA 3H2VE 4GC6A 2GHVC 2DGTA 1WOOA 1QJHA 4TLRA 5LMUJ 5BXIA 4WE1A 3NBPB 2B5JB 1BC6A 1S9EB 3HF5A 4JI0F 1Q7YT 1VQYA 3RAQA 2QX0A 2QLJB 2LEBA 4L73A 2V9KA 3EGWB 4PR6A 2Q66A 3ZZ0A 1WKJA 4KIAA 4XIUA 3IFEA 1B64A 1R31A 2DEIA 4C11B 4U95A 3ZZRA 2DGWA 3JSRA 3AOBA 3SI1A 3M8WA 1IU8A 2L3MA 2HHSA 1FE0A 1DBDA 1UVNA 4QUSA 2VA2A 5IT9Y 2AFUA 5AJ3J 3C15A 3HSGA 4AXVA 3H8EA 4A8KA 4ZLLA 2DO0A 4XK8C 2Y1IA 3M32A 3LACA 3BKUA 2YQ1A 3LH2S 4PSWA 4R0JA 4C8OA 4AXIA 5D3GA 5C42B 2YWGA 4DPTA 1AFIA 4PSXA 3PBBA 1TKFA 3KHLA 5I3UB 1IN0A 4H4KA 3D5MA 5D78A 2MQPA 1EQMA 5D4NA 2U1AA 3CJ3A 4LR9A 4ES2A 2DH7A 1XOVA 4PYAA 3BBFA 3DOLA 2DR8A 5F48A 1RAGB 2N4CA 2DH8A 2R2RA 4HHHA 4LF1A 1VQ4S 3ZZYA 3HKZD 4TLQA 3QFWA 3JQMA 1LXNA 3SI0A 4X62F 5KTQA 1X7VA 3P2FA 2O01C 1MNEA 3SCKE 2Y0BB 2V8PA 2Z11A 3F5BA 4ES1A 3EDQB 4ED2A 4KSAA 1L5UA 4UOCA 5DJBA 4GO7X 3RW7A 2UXCF 4X4UA 2WRMA 3DI6A 3QO9A 3LGMA 9RUBA 4EO8A 4USJC 1CQNA 1QSTA 3WC2A 3I5BA 2ACMA 1HBOA 2BABA 1H7XA 3V7ZA 1N6QB 2YPZA 2ILZA 2F5IA 1RT2A 4E98A 3IGNA 1HI0P 4QOTA 3MPVA 4BMHA 4DX7A 1XMTA 1KQFB 4R9MA 3KJNB 3GSDA 4YP3A 1M5VC 3VZIA 2EBJA 3KK1A 4A4JA 2HS0A 4DL2A 3R6GB 2W2QP 5IV0A 2C3MA 4U6PA 4F3MA 2D4OA 4A32A 4IOBA 3GIMA 3DHXA 1I94J 2HHTA 3VAJA 1AUSL 4C4WA 4UCNA 4B3SF 4RW9B 1TKTA 4QIVA 2YPYA 3PRBA 3DOMB 4E2AA 1WEZA 3PW4A 5F49A 2QMXA 3CCSS 2V50A 4LQ3A 1NK0A 1KFSA 1ZTWA 4I56A 1QUPA 4B9UA 1QE1B 5JMNA 4CTAB 4X65J 3QAHA 1CULA 2VG5B 4FPIA 2F3JA 5BYRA 5A0YA 4P74A 4E8UA 3C6UA 4FYWB 4MFZA 4CAWA 3T1AA 1S1TA 1CBXA 3C19A 4DR6F 1PYSB 3Q8VA 3PYEA 4RNMA 2Z57B 4P52A 3C66A 3B7IA 4X8IA 4OZ3A 3G6VA 5HN0A 2IM0A 5H9EK 3RRGA 4HI2A 2RRAA 2GS8A 1WDTA 3G6XA 1NDCA 4P4JA 1VQPS 5KFRA 1D8YA 3EZ5A 2AZ1A 4L72B 3BGLA 2V8DA 4IAVA 2YGWA 4M94A 3V6HA 3H90A 4DCPB 1FD2A 4ICLB 3QGGA 2ZH5A 5D0EA 5T7LB 3KUGA 4LF7F 1YZ6A 3U27A 4C68A 3O8WA 3DYAA 3QGPA 4C7QA 3J7A1 2XMVA 4JWPA 5BR8J 2HGLA 2ZNZA 1HA1A 2C2ZB 1C0TB 2GE3A 5AG7A 1TL5A 4P2SA 1X4DA 4HKFA 3PB9X 2BUEA 4FD7A 2UUTA 2C1EB 4DS5A 2XMKA 3SI8A 2IJFA 3MPYA 1FJGJ 1T3OA 4YR2A 5GAHU 4P2FA 4KOVA 3IO1A 3DLHA 1TV6B 3RG6A 2LDIA 5F9LA 2CA9A 4AD6A 3Q0AA 2I2YA 2JEFA 3FBUA 3BYPA 4ETZA 3W9HA 2MKSA 1GEHA 1N71A 3MR6A 3TCVA 1KHVA 2RIJA 5A8KA 4P7TA 5J1PA 1PYTB 1Z4EA 3A1YG 1XRYA 4RBVA 4P72A 4ZJQA 1CS4B 4ECSA 3R5BA 4DPOA 2UU9F 5AT1B 2CYYA 4FYVB 1GXUA 2ZW5A 3H2LA 3M8QB 4UQGA 2L9DA 2BJ7A 4EFDA 2FJWA 4F2RA 4KKOB 5A2QU 3J81U 4JI2J 1MWZA 4OC1A 4OJ1A 1SC6A 2V8GA 3Q8QB 1OS5A 3IBFB 4NLDA 4KSFA 3EE3A 1XJOA 2CWKA 4P6YA 1IWAA 3FVLA 1SJ1A 1S6UA 2DIVA 1S79A 5JJBA 3QAUA 4II9A 5IWAF 3BSNA 3D28A 1DZ5A 3W2VA 2A3JA 4IG3B 3BGRA 3DXSX 3VAIA 4F3OA 5KFGA 1RHUB 4AL6A 4U8YA 2CWXA 1HNXF 5E41A 4J5OA 2IMOA 3A3OB 4LRFA 3SYZA 3M2RB 1NH8A 4MKBA 1N34J 3OTDA 2W7PA 2WOMA 2EVNA 4MKAA 4V19X 2MLZA 4UIBA 2DK2A 1NHKL 3I9ZA 2HIYA 3FBCA 3Q83A 4UUWA 2QGFB 1L0CA 2Y8WA 4F4AA 4F0MA 1JLQB 2HHHJ 4JI8J 5CZXA 2FLPA 1FVSA 1KLMA 2W8KA 2UUCJ 2D4PA 1J5EF 4CP5A 3CCLS 1M1GA 2HQDA 2IYGA 3EGVA 4ERDA 4UWJA 4LSLB 4F67A 2VL1A 3MMCA 5HQ8A 5HLFB 2VEZA 3FCVA 4L3NA 2WONA 1VQ8S 4DR3J 2CPZA 4ILRA 3T8WA 3KLVA 5A6PA 3MECB 2NSMA 1X0PA 3NS5A 1Y0HA 4I2PB 4C0BA 2ZUAA 2GO9A 4LF2A 4KB7A 1K8AT 5F0WA 2MMYA 4I67A 1OO0B 4C48A 5I0CA 5HQMA 3PR4A 2WVDA 2ZHAA 4C2YA 5IC4B 4LBPA 3MCSA 4QB9A 3BGFA 1M44A 2FTRA 2FVRA 1LW2A 3GJSB 2DH9A 4WKYA 1WHVA 1LWXA 3S6FA 1GHEA 3EVMA 4K7QA 3SDEB 1F9EB 1Z8TA 3HI9A 3IBCB 2WK4A 1RKJA 3BH6B 2DGUA 4F0HA 4B9NA 3HDSA 1FNMA 5KT5A 4C8MA 2N3OA 1TELA 3KMQA 2VUGA 3BDPA 1UVKA 3G4SS 2OKQA 4LREA 2QFJA 3OL7A 1E6YA 3LOUA 3CMES 4ZIWA 2HRYA 1KUVA 1O0PA 1CJVA 1VQSA 1JLBA 2KCWA 5CXTA 5ISVA 2HWHA 1LAMA 1KWMA 4XNHC 2QLBB 4H2KA 3BS9A 3OL8A 2BKPA 1JIHA 2R7QA 1WC3A 4NLWA 1BOBA 3CJRA 2FC8A 3I5CA 3PCOB 3D4UA 2GC8A 3EVOA 4NZ7A 4JOUA 4UUXA 2B4PA 5HANA 2OD6A 1KONA 3WQPA 2IJZA 3M8PA 2R2UA 1RAJA 1QDUB 4UWIA 4DR2J 2CPIA 4R8UA 4DWIA 3QYYA 3U1MA 3FEZA 3QSIA 4R6TA 2JZ5A 2HAIA 4UY85 2VZZA 4B13A 2OPRB 1VRQC 1FRJA 3CJQA 1EQ0A 3HFVA 3KG0A 1H2VZ 2V68A 2HUZA 4TQSA 3OV7A 3BXMA 4B3RJ 1EAYC 3MMJA 1UPMB 4LJMA 4AVAA 4ZVHA 3OUYA 5GMKa 2PJ1A 5J2QA 1G4CA 1M4LA 4L74A 3TJ9A 3UCGA 2B43A 3R8YA 1FXDA 3K0JA 1RGVA 4CCHA 2ZITA 5GAGI 3PRDA 4OZ1A 2Z30B 1YSJA 1IUJA 1FDDA 4LT6A 1X8DA 1ZLIA 5KG0A 4W9YA 3OPKA 4CLTA 2QFIA 4M5DB 3M2VA 3BLNA 1BHNA 2JDJA 4DV2F 4GVLA 1GTEA 1Q8KA 1QQ9A 2V69A 3CCVS 1D0EA 4B3MF 3I1UA 3ZZOA 4EZ6A 2RU9A 2UXDF 1KQGB 3HULA 1YRTA 3KMSA 4I6WA 4ECTA 1QTMA 2W2PP 3W5XA 1HNZJ 3GP9A 4MHDA 4QR0A 3R1KA 4ZVPB 3D3BJ 1REGX 1N5TA 1LQ9A 4TY8A 4EUVA 1BXNA 1E6VA 2GGPA 3VHQA 2Z3KA 1U25A 1R0AA 2OIHA 2XMJA 3AJ1A 4PXDA 3PW7A 1FWKA 2PRBA 4IFVA 4RKUC 5ITHA 2E9TA 3GR0A 5FDLA 5EWFA 1NJZA 4DS4A 5H84A 2DIUA 3IIBA 1DTDA 2V8VA 4B9LA 4FS1A 3E0KA 1NK6A 5CPAA 2XG8A 1DLOA 4F0YA 1YJRA 5DM6Q 2W2OP 1CM0A 1RT3A 4PUOA 3M6VA 4F4YA 1U6MA 3CXQA 1QUVA 4DUKA 5C24B 1F2GA 3VVTA 3T9ZA 2DGSA 3M7VA 4USUA 4QPXA 2RQKA 3C26A 4KT0C 2YQ3A 2ZJPQ 1S0MA 1FEEA 3FQLA 1TR0A 2QYGA 3B54A 1IBCB 2ANPA 4WTOB 4TY9A 2ZH6A 1Q8BA 3KK3B 2NPIA 4R5PB 2PR1A 2XNQA 2IBOA 1RWPB 2RAQA 2PFDA 1DFDA 1CJUB 2HG4A 4L75A 2WB1D 3MUVP 4LQ6A 4RL1A 5ETLA 4DLGA 3RB0A 3L3CA 1RU1A 3ET6B 1JXLA 3CJ0A 3DRSB 3WT4A 5DDOC 4R87A 1QY7A 4CRJA 1N5QA 4JUZA 5KFFA 5BWAB 1HWJA 4NMXA 4B3OB 2VBXA 3PB6X 1WSRA 2QA4G 3IWWA 2EWBA 2RF2B 4JI4J 2OR4A 4DF8A 4OC2A 2GJIA 4A37A 1RTQA 3CVKA 2PC6A 2HZVA 3UD5A 4DOZA 2CPHA 4HACB 2UXBF 1YW6A 2R7RA 3CJ5A 1DHMA 4BWMA 3JUWA 4NA2A 2POKA 4LF8F 1QAJA 3S9MA 2FVSA 3BF4A 1HBMA 3V6JA 2HS3A 4M5NA 3MTJA 4IH6A 4CLSA 2ATRA 1CBKA 2VU5A 4FVCA 2DGVA 3A8IA 2OPSA 1JQGA 1FJ7A 1VYAA 3VGTA 2KO1A 4Q44A 3DNSA 4UFVA 1CG2A 5IT9U 1F60B 5F9NA 1QSOA 2IJNA 2GIFA 1V5VA 5L38A 2Z58B 4YMEA 2MTLA 2ZEHA 1WELA 1TXRA 2E66A 2NREA 4TYAA 3G2XA 3OLBA 1HNVB 2UV8A 4NJRA 3THPA 2GU2A 4IF5A 4DQSA 2B3VA 4RWWA 4P7VA 4RR5A 4YB6A 3G8SA 4B9VA 1Q7LB 3N4WA 4KV8A 4WTYA 2M88A 3F41A 2RDDA 4A30A 4DL3A 4HVZA 5B09A 4U96A 1U24A 2LQ8A 4ZVGA 5KFOA 2I5JB 1NMEB 2C2KB 1HWKA 3MMAA 3KGQA 3TQEA 4OX6A 4ZVOB 3KHHA 3NH4A 4O4GA 4WP9A 4UZCA 3FNCA 4P6QA 3JQJA 1R7IA 2RS8A 2Q0YA 3KDOA 4LFBJ 4M1KA 3U1NA 5DM7Q 1M5HA 4YEAA 4O3OA 5H86A 1RT4A 3AODA 3CJKA 5C5JA 1R89A 3PX0A 3WC7A 4MYUA 4A2ZA 2AGOA 5LXRA 4WPAA 1P6TA 5K8PA 1MN9A 4B5PB 4RBUA 3MM6A 5HQLA 4DEZA 5E96A 1R6VA 4K4TA 1FK9A 3KNAA 1H72C 3WABA 4JI5F 1B6BA 4QIGA 4ZP9A 4C8KA 2W25A 5F3TA 4LSNB 5D4OA 3GJQB 2VONA 4KJIA 4ELUA 2OFGX 1HW9A 1X5TA 3T9YA 1LWFA 1I5OB 3D4JA 2VJVA 2JL9A 1YR0A 1XNQJ 1N5YA 4DL0C 3QZ8A 5CQGA 3UCZP 2B4UA 1RAOA 3DRRB 2CQHA 3RW6A 3KI9A 3BV8A 3W2WA 5IXUA 2QSFA 3MN8A 2YKAA 3H5YA 2CNSA 4X4PA 1MJ9A 3HVRA 4O3QA 2CG4A 1FNOA 1LWCB 1PAEX 3Q8UA 5K8NA 1RWWB 2LYVA 2BXJA 4TVAB 2WYRA 2HV2A 5BYSA 3PFEA 1VC0A 4OI0A 3RBEA 4LF5J 4FUUA 3GFZA 1M90T 3NNCA 2HHVA 4X4QA 4NI2B 2CXEA 4X64F 3T9NA 1Y11A 4PWUA 2HSEB 2DO4A 4HTJA 1TKXB 3ILOA 1CP6A 2QLWA 3A3PB 2GIQA 1YWXA 3KL9A 2YXLA 1TVRA 4B6ZA 5K9FA 2PVWA 3QFHA 1HQEB 5HVGA 2GA7A 5J8FA 4F4WA 3TEHB 4J9MA 3W9IA 2BKNA 1VHSA 1BAVA 4LUBA 4U9RA 4MJKA 3M05A 1NE9A 3DMJB 3CDWA 4CPAA 1JLCB 2ZWOA 3H8YA 4MCPA 5ETNA 2LFVA 1ACMB 4K0KF 1VC5A 3W5ZA 3MFHA 3HZEA 3V4IA 1S6QB 3IP0A 5B0FA 4DDFA 4DPUA 5J1QA 1S76D 3SCIE 3KUHA 2ALYB 2F4FA 2ERRA 2OELA 2R7HA 3UE2A 3JTNA 2HGNA 2M8HA 4F25A 4IUFA 4RW6B 4C7IA 1VBYA 4DFJA 4NGPA 1X5OA 3D2WA 4QYZJ 3UWTA 4KLVA 4TN2A 2PIZA 4I2QB 4E0AA 2ILYA 2VDIA 2VPWB 4NWBA 4YDDB 3KLGA 5EX0A 3HD1A 5E3PA 3JTKA 4N47A 3BQ1A 3ONQA 2J0QD 3W1YC 5EUHA 3D2MA 4WU2A 2H3EB 2D3UA 2EEYA 4OI2A 2VC0A 4DSIA 2EG2A 2Z8QA 4MFPA 3TO9A 1XFOA 3RR8A 2B4VA 3RNZA 3V38A 2HYIB 2FLNA 2HZAA 4LRAA 2HBZB 3O44A 2ZENA 3MDFA 3S6EA 1NU4A 3TA2A 8ATCB 3G6ES 4ZCIA 3I0RB 2R8HA 2ZJQQ 4I6AA 4Y49B 1SI9A 4RNNA 4QR1A 2R7VA 4AFFA 5E3CA 4ZHRA 4OL8A 5J2PB 4PYDA 3FFIB 3BI0A 1RLCL 1P9YA 2OO4A 4DV7F 3UCUP 3CWJA 1XIXA 4XO0A 3GZ7A 1NZAA 1RAAB 1IJFB 1FX2A 2OFHX 1APSA 2J76E 2MZRA 2W9CB 4ZVEA 3MM7A 4JYAF 3DGPB 3AHPA 5E3QA 3ZTSA 4ZCKA 4CTAA 1O5JA 2K5TA 1UCNA 1OSDA 3QWUA 1Y5IB 3VARA 2XI2A 2XZDB 3IR6B 4CAXA 3P3DA 2EBGA 1BLUA 4JP8A 1S7KA 3M2UA 1MN7A 3A12A 1DTTA 3TJ8A 2C27A 3HXMA 3I5AA 2P9GA 4RS2A 2DRAA 3A9LA 1YLXA 1NXIA 1BMQB 2VFSA 5GAEI 3EVWA 1CQMA 4FAIA 4M85A 4P4EA 1T11A 5KAKA 1WWZA 1SIWB 1SC4B 3R9FA 3CIZA 4NLQA 3ISZA 3B3VA 4DV4J 2QTWA 2RKIB 1WF0A 2XS2A 4ZP6A 3K5NA 4WBFA 1RCOB 2H65B 4EBDA 4PPZA 2ZOMA 2XLKA 1YJNS 1OSCA 2VFVA 3IS9B 4QC6A 1U1RA 4C3MA 1I21A 4ZN3A 1YJWS 2E9ZA 4JV5F 2ZH7A 4U5YA 3G96A 3EPGA 1H0HB 4MFJA 4ICLA 2ZDOA 2QEXS 3KJQB 1XEZA 1QTNB 4RNFA 1VQ6S 1JMTA 4ZMMA 1P0HA 3FB3A 1AROP 2FUG9 2CPFA 4GVBB 3BYRA 4CH1A 3GV5B 4OP4A 3D3SA 3QNWB 1AA1B 4X4SA 3PKYA 5KFCA 1EIYB 4QYRA 5AG5A 4KOUA 1HW8A 2FXFA 4CDIA 4K50A 3BDEA 2E7XA 3HFZB 5FIIA 2Z3NA 4PAAA 3V81B 1TV6A 5G22A 5KFUA 1NB2A 3AD8C 1YX2A 3MCNA 3MCMA 1RT7B 2AJ4A 5AGEA 2KJVA 5JVHQ 4DV5J 1WDDA 5DQGA 2IM3A 3NG8A 4U7UD 1JLAA 2XEJA 3B8GA 2AEMA 1RTIB 2JFDA 2KXNB 2V4JB 2QA4S 1FTRA 1FY7A 5E3RA 5HROB 4ZLPA 3GTYX 1ZG8A 2MKHA 2MKCA 1NKEA 3MEEB 2ASYA 1CS4A 1NB7A 5CNPA 4NXMJ 4YQWA 1EX8A 2B8QA 4LFAF 3OVAA 3M8QA 3CGIA 4YB5A 1NMTA 4ZGYB 1YJ9S 4KKOA 3EGZA 3HHKA 1CPSA 4ES3A 4WIIA 3QB8A 2H1YA 5C2GA 2J8MA 4CM2A 3QT6A 5DGAA 3I82A 2UUAF 3D1HA 2XQCA 4E2FB 1RZMA 3QSYB 2DNKA 4IG3A 4DFKA 2C3YA 3HX9A 2GCFA 3TQ1A 5DETA 2MDAA 4CLZA 2O28A 2PDOA 1WORA 4LFCF 3Q23A 1HWLA 4KSEB 4FD5A 3V4MA 3M32B 4DR5J 2RQCA 2QE5A 4RUAA 3M6XA 5D3GB 3R2CJ 4M5MA 4HLBA 3DFEA 2VBWA 4USTA 4ZY2A 4A8OA 5B0GA 1JK9B 2PMZD 4X84A 1VQMS 2XM3A 1H2UX 4A8SA 3KNGA 2XYPB 3DOLB 3M1VA 2V94A 7CPAA 3LF0A 4LSLA 5MAOA 2W7OA 1YKWA 2DNLA 2UUBF 5HLFA 2RRNA 3F0AA 2XTJP 1KOOA 4Q36A 1N0VC 4A8FA 1NO8A 2OPQA 2UVVA 2MKYA 1RAHB 4ZOSA 3MECA 4CT8A 2DHHA 4RZRA 2F4VJ 4I2PA 5KG1A 3IU2A 2YWEA 5SUHA 4ZN1A 1RWMB 1LK5A 1Y4ZB 2L9WA 3VAHA 3DI6B 2HZCA 3QO9B 3N79A 2J9AA 4EVYA 3DLJA 1HBOB 4F26A 1F5AA 2NCKL 3I56S 4B9SA 1RT2B 2DGOA 1WG1A 2R1IA 2LQBA 3FCWA 1RYSA 1KVKA 4LRBA 4DV6J 4FXDA 3KK1B 1S1XA 4DU7A 4QWBA 2AE6A 2ZEGA 1U6FA 2O5DA 2JWNA 3K57A 1AFJA 3ZTRA 3DNCA 4CYUA 3B6BA 1YK9A 5F0UA 2XULA 3SCLE 2R7WA 2FJDB 1DQAA 1TKTB 1Q16B 3NGTA 1BLLE 4RN7A 2PIYA 3IR5B 1A7GE 3NOGA 4JI1J 3EX7B 3F44A 1ZPWX 2W4PA 3K17A 2MQQA 4K4SA 1CULB 2JJ4D 1ELMP 3UVJB 3CJ8A 3G86A 3RBXA 3B8HA 4QU7A 4C6AA 3ISNC 1S57A 1Z2LA 1C4CA 3MAHA 2WBRA 3LW5C 4FBUA 1GYTA 4KOSA 2VFUA 5KFNA 1PILA 1FX4A 2A6MA 4PWDB 1S1TB 1FEHA 2A6OA 2PEHA 1XF8A 3CULA 4JV2A 1TL4A 5DDPC 2DCLA 1VJWA 4QYZK 4DLEA 1A9NB 2LEPA 3DR6A 3U02A 3I3GA 3ULHA 3MRUA 3FQKA 4B3TF 3KQXA 4OYIA 5D29A 2ZBRA 2B9YA 2AFOA 3UFCX 4PG6A 2VQFJ 1NK4A 4F0KA 4B10A 2LMIA 2DXQA 2ATCB 1Z8XA 1RXOB 3ENVA 4G1PA 2Y9HA 2ZW7A 1KVJA 1C1BB 3SV4A 3EY5A 5LMNF 3K2KA 4PK3A 4LR7A 1LAPA 1NSKL 1RWVB 3DYAB 2BBEA 2RC4A 2REEA 1I3OB 4NXNF 2FJEB 3PV8A 3FBBA 3UN3A 3RB4A 1S48A 2GMLA 3AH6A 4BCAA 4WYWA 1Z4RA 3BKTA 2Z0ZA 3FSIA 3R5CA 4NGQA 2HHPA 2NXEA 1JXVA 5GMDA 2HVDA 2IVFB 2J7KA 2OZGA 1S6PA 2QC3A 1GMUA 2ARHA 4M5DA 5KG2A 1V6HA 2OPPA 4P71A 3HHEA 3UR0A 5CH7B 4EWTA 5J8CA 1UJ5A 1RAFB 1VFJA 1IKVA 1KUXA 4RO0A 2PJ6A 3GG1A 5KT3A 3LWUA 3VVUA 2E5HA 3BREA 3CPAA 4N8OA 1QAXA 2C2DA 1U1NA 3RYOA 4D3GA 5GADI 5HK4A 3MM5A 1SIZA 2EUIA 3WR7A 3PYDA 2MZTA 9ATCB 1P8GA 2V4QA 4YOEA 4HKQA 1W2IA 5U47A 2P0WA 3DLKB 3IMQJ 2OH1A 4CRZB 4QBJA 1KS2A 4KHPF 4Y65A 2FB0A 1S0NA 2OTLS 3VWDA 1GNKA 5HP1A 3Q24A 1LFPA 1URRA 5LSRA 1TL7A 4W4MA 4PKDB 3UDCA 3EDRB 2FY8A 3IAM9 3W2VB 1X60A 3CDXA 1OQ3A 3CO0P 3GJTB 3TAQA 3P49B 3N6LA 1TL3A 1DJ0A 2HPUA 3NS7B 2DNMA 2CJBA 1YLEA 4CLWA 2WSAA 4GKKJ 3CD0A 3MCOA 1KRPA 1RWXB 1U2FA 1Q5VA 2RUGA 4A8MP 1NSAA 3GR1A 3OFFA 3KK3A 5IOLA 2YVSA 1VBKA 4LIRA 2ZNYA 4ELVA 2G4BA 1KLMB 2QLXA 2BRKA 1CJUA 2VB6A 3D6HB 3UW1A 4I64A 4K4WA 4X65F 2V6AA 2V2ZA 5GMEA 2RUSA 1VS3A 2FJBB 2Q3PA 2ZM6F 3MMCB 4OZ0A 2LXIA 2ZEJA 4M5LA 1VOMA 2R8IA 2J6TA 5K20B 4B3OA 2B56A 2LECA 2WONB 4M5JA 1YIJS 2BR0A 5L1JA 1PUAA 2IDLA 1WKKA 4XPDB 3CJTA 4OV1A 4X2TA 4OZ2A 5MLCV 1U02A 3AJDA 4P2XA 4X62J 4GKJJ 1BY9A 2WW4A 3HK2A 1S0VA 4C2MA 2ZZNA 4PG5A 3DXBA 1LWEB 4ED8A 4AB7A 5LSLA 3U1LA 2UXCJ 1YQHA 2FVCA 2AX0A 4HPSA 2AF6A 4NFRA 4ID8A 4O3RA 1S72S 3ZZIA 4CH0S 3HHDA 3S8SA 4B11A 1RJJA 2CNLB 4ZS6A 3BPDA 5ETMA 5J1EA 5CD4A 4DL5A 1LW2B 2R7OA 2N7CA 2VV5A 2BE9B 1NDLA 2D74B 2QMUB 4NMLA 2DPTA 4FF2A 3C6TA 3UD4P 2D3OR 1FFSB 1TF9A 2QA2A 4CT9A 2CZVC 4P4FA 1IGBA 3M9OB 4TQRA 5EBVA 4K2JA 1U1PA 3RB3A 2Q6CA 4TU8A 2XS5A 1UA0A 2CVIA 1P4NA 4RWXA 2VG7A 3TO6A 4NASA 4Y49C 1E6YB 1JLBB 2JC0A 2OU2A 5LT5A 3R5JB 4U9ZA 2IM1A 3GQCA 1DTQB 1K73T 4FZVA 5A6WA 4Y2CA 2PE3A 4NLPA 3BM7A 4AE5A 3UN2A 3T1YF 5F8NA 3QLHB 1HWIA 5KFWA 3TJAA 3PIPQ 3OTEA 3RB6A 4IKAA 2DNQA 1ZA2B 3HM9A 2VODA 4IOCQ 4XAKA 2YNHA 1UPPA 3ZTPA 2CUYA 4OC4A 2GMHA 1KC8T 1RUSA 4MK8A 1FA0A 3F0NA 1BD6A 3G8WA 1VISA 7AT1B 3BGUA 4R8UB 3NE7A 3I0SA 1S9FA 1N48A 3TNVA 5D0GA 1T9WA 1HHSA 5HMYA 3D0HE 5H1SV 3R9GA 4NYOA 2MY7A 3AQPA 2B7BB 3OJUA 4A8XA 1TUVA 2XHWA 4C3KA 3WC0A 2CNTA 1D09B 4BD9A 2LXUA 4OMFG 5L9NA 4DL7A 1DARA 3IGRA 3DGVA 2I3CA 4OC3A 2J8NA 3OUYB 2P6FA 4PWWA 2K7JA 5J2QB 4LF7J 3N7ZA 4MBUA 2I1RA 2R8KA 3MUMP 7FDRA 3P5BP 4QR2A 3ENAA 1ULRA 1AUGA 1H8LA 3VAFA 2ABYA 2A0FB 4JI6F 2AJ1A 4D3HA 3G82A 5DDRC 1M5PC 1L3SA 4ZVSB 1Y3JA 1KZFA 4KZTA 3FSYA 5DO2A 4ALZA 3THVA 1TU0B 3CCJS 4U67Q 4CS0B 2AJQA 2XGPA 3BKFA 3S9LA 4LF6F 3MF5A 5T14A 2YNCC 1WG4A 1WD6A 1SQEA 3PW5A 4USHA 5DLFA 2MJUA 4JI8F 2HK3A 2E5GA 2H54B 3TYTA 1LWCA 2AIRB 1IOFA 1HQ2A 4MK9A 4B9MA 4LMZA 3BO4A 5B08A 1Q95G 2JEJA 1HLWA 2R3VA 4YGOA 2B3TB 2C3OA 3PGPA 4IR1A 4R76A 1IXKA 1TK0A 2DBBA 4TU7A 4DV1F 2KM8B 3RAMA 4OC0A 1FJEB 1IVZA 4DR3F 1S1WA 6CPAA 4TY8B 2VIHA 4C0HA 4RJVA 5LM7E 3I4HX 4ETXA 2GGPB 3MGJA 1BPMA 2FJVA 5FD1A 2YNIB 2F8HA 3L7OA 1R0AB 1U6BA 4ZX8A 4TNUA 2GLFA 3A8KA 4MAKA 3T3FA 4EEYA 4BS2A 2BACA 5FDLB 2DXDA 4CGPA 3Q8SB 3MWBA 4BHQA 2GREA 2OZHA 4RU9A 4CLYA 2VOPA 5CHCB 1HKAA 2L48A 4HH1A 1B0TA 2G13A 2ZELA 5IWAJ 5ETQA 2HFUA 2KFZA 1RT3B 3N28A 3DC2A 1XMQF 2OEMA 3W62A 3H4DA 3HKWA 3N5FA 3VQSA 3UNYA 3K5MA 4L76A 3JB9k 5CD4H 4YHHF 3W9JA 1YBAA 2ABZA 2IDEA 2R7XA 2DHSA 1FRHA 4DQIA 3IRWP 4KFBB 2DRBA 4Q45A 2E1MC 3K9UA 7FD1A 1U1KA 2Y1RI 2HHQA 3KK2A 1BQNA 1LCPA 2CY2A 3D3CJ 2LQJA 2NXJA 1RTJA 2U2FA 3GFHA 1Q4RA 1VR6A 1J5EJ 4NA3A 3CDEA 1XR7A 2KYZA 3Q8RB 1IYKA 1X9SA 4O3NA 5HMZA 2K7KA 3DDIA 4M8LA 3ZZUA 4JI3J 3PJXA 2W8LA 4DSLA 3PP9A 5C82A 3D1QA 2ZDPA 4YN3B 2PVVA 4RU2A 4KHMA 3PY8A 3DHWC 2BJ3A 2CZ9A 1RHKB 4IK2A 3PO4A 3M8SA 1JNZB 2OTJS 3MR2A 2WTFA 1RBOB 2FC9A 2XMTA 3UDLA 1S7LA 1QM9A 4DR2F 3I0RA 3J80Y 1FFGB 1D8ZA 3IWNC 3HCXA 1ZYQA 1UTAA 2CG8A 1QVFR 2GVDB 4HR2A 3CD6S 5J2PA 4NOHA 4WWVA 3FFIA 3N6MA 3BQ0A 5ADZA 4XNHB 4OI1A 3PZJA 2RE1A 2W9CA 1Y7PA 3IWEA 5L1LA 3DGPA 1HIYA 4DHVA 2D3O1 3OXGA 3D0GE 2HKEA 5LJ5Y 2X3DA 1OJ4A 2WVFA 1FD8A 2BW7A 1HNWJ 2PGCA 4X66J 4W92B 3KWMA 4MJ8A 4O3PA 3PB8X 3SJXA 2WAQD 4YB1P 2CQ4A 1VCTA 2M4MA 2PR8A 4DPWA 2CZ4A 2KTQA 1MW7A 2FJXA 4FN5A 3TVYA 4NPOA 1TKDA 3H0PA 3CEDA 2V34A 4N7TA 3PO5A 3PHTA 2HBRB 1VRUB 3OSPA 3A8EA 4BC9A 3T41A 3CMAS 1CJTB 2BM0A 1QAIA 5EWGA 3ZZTA 2KVQE 2RKIA 1S5ZA 4R8FA 2HBYB 4I49A 3CT9A 4KV8B 3HLPA 2J7WA 5HH1A 2V77A 3QT8A 1Q2CA 4AVCA 2APOA 2BANB 5CYJA 4AVBA 2LVWA 2EC2A 1T95A 3OR1B 1NAQA 2E44A 4QU6A 2KG0A 4K8RA 2BE7D 1S4FA 3HPOA 1XJWB 2J8RA 4O4GB 4KVME 2G1HA 2WBMA 4A48A 3JXOA 2DITA 1VRTA 3OFHA 3JTOA 3FCHA 3QRPA 4OIWA 5DG9A 3LP2A 5KFHA 1RT4B 2GJ2A 1HBUB 5GAHI 4RNHA 3TP2A 2JLEA 4ZP8A 2GLJA 2C2EA 1Z4UA 1FK9B 2YNCA