1R3NA

Crystal structure of beta-alanine synthase from saccharomyces kluyveri
Total Genus 151
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
151
sequence length
438
structure length
438
Chain Sequence
GTLNLPAAAPLSIASGRLNQTILETGSQFGGVARWGQESHEFGMRRLAGTALDGAMRDWFTNECESLGCKVKVDKIGNMFAVYPGKNGGKPTATGSHLDTQPEAGKYDGILGVLAGLEVLRTFKDNNYVPNYDVCVVVWFNEEGARFARSCTGSSVWSHDLSLEEAYGLMSVGEDKPESVYDSLKNIGYIGDTPASYKENEIDAHFELHIEQGPILEDENKAIGIVTGVQAYNWQKVTVHGVGAHAGTTPWRLRKDALLMSSKMIVAASEIAQRHNGLFTCGIIDAKPYSVNIIPGEVSFTLDFRHPSDDVLATMLKEAAAEFDRLIKINDGGALSYESETLQVSPAVNFHEVCIECVSRSAFAQFKKDQVRQIWSGAGHDSCQTAPHVPTSMIFIPSKDGLSHNYYEYSSPEEIENGFKVLLQAIINYDNYRVIRGH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords beta-alanine synthase
publication title Yeast beta-Alanine Synthase Shares a Structural Scaffold and Origin with Dizinc-dependent Exopeptidases
pubmed doi rcsb
source organism Lachancea kluyveri
molecule tags Hydrolase
total genus 151
structure length 438
sequence length 438
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 3.5.1.6: Beta-ureidopropionase.
pdb deposition date 2003-10-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01546 Peptidase_M20 Peptidase family M20/M25/M40
A PF07687 M20_dimer Peptidase dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.360 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1r3nA02
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 1r3nA01
3BHXA 3T8WA 5LRGA 4KSIA 3D7FA 2AFWA 2GREA 4P4DA 2XEJA 4OC5A 4R7MA 4NGNA 3NFZA 4MHNA 3CPAA 4RUHA 5J1QA 3FH4A 3V7ZA 3KGQA 5JGFA 3IC1A 4EMEA 4ZY2A 1DE4C 2EWBA 3FECA 2WYRA 4MCRA 4MRIA 2CIJA 2I3CA 3IIBA 2ZEGA 3D66A 3KHXA 2AFMA 4UIAA 1BLLE 5HXDA 5F09A 4OP4A 4BD9A 1Y0RA 1QQ9A 2PJ4A 3NH4A 4OC0A 4JZ0A 4NGTA 2RFHA 1LAPA 2O4HA 1OBRA 4W9YA 1FNOA 2G9DA 5I4MA 4F8ZA 4DUKA 5JM6A 2PJ1A 4Z65A 1BAVA 2QJ8A 5HVFA 1LOKA 2AFUA 5K8MA 3D7GA 3FMCA 2DEAA 1AYEA 2F7VA 3PB9X 4FAIA 2JBKA 1AMPA 3RZAA 1GYTA 4LQGA 4UEFA 1DTDA 4K3NA 4OIDA 1CPXA 5K8OA 2JBJA 2AFXA 4MCSA 2IQ6A 3WABA 1YW4A 1VGYA 3KHZA 8CPAA 2PE3A 1IGBA 3BI0A 4TNUA 2PIYA 5LYDA 4PQAA 2NYQA 1M4LA 3B3CA 5K8PA 3B7IA 3NA6A 2J9AA 5D8NA 3I1UA 2GLFA 4P45A 4H2KA 2XEFA 4PPZA 1FT7A 2PJ9A 3B3TA 3ISXA 2PJ8A 1TKFA 4PXDA 4ONWA 1XRYA 2WZNA 2BO9A 3NH8A 3PB6X 4IAVA 2NSMA 4NFRA 3WC7A 4G1PA 3B35A 3FX6A 3IEHA 4TWEA 1ZG8A 4OC3A 3KL9A 2C1CA 2JEWA 2HB6A 3FEDA 1YW6A 2PRQA 3FJUA 5LYFA 2CF4A 3PFOA 4GM5A 2PVVA 4Q7AA 4P4FA 4AXVA 4JYWA 1VIXA 3DLJA 4A39A 3IWWA 6CPAA 2V77A 2V8HA 4OKOA 4P4IA 3VATA 5LRKA 1EE3P 3B3SA 3L2NA 3TX8A 4R76A 2PJ2A 5IB9A 2PJCA 4NJRA 5CBMA 1ARLA 3K2KA 1ELMP 3IFEA 3D67A 4ZX8A 3K9TA 3B3VA 2PJ0A 2V8DA 2VL1A 1CX8A 3KR4A 4NGRA 3D68A 4P6YA 3SJGA 4UEEA 5LYIA 3LWUA 3BXMA 3WC5A 2ZEFA 2ANPA 2PJBA 2O53A 4OIWA 4WWVA 3MN8A 1XJOA 1BPMA 1ELLP 1YLOA 1VHEA 3N5FA 2C6GA 4ZI6A 4X8IA 3WC6A 1RTQA 3PB7X 4ZY1A 4MCQA 3KZWA 1JQGA 1TKHA 2EK9A 3S9MA 3IJ3A 1BPNA 2BOAA 5THWA 4PXCA 2HC9A 4CPAA 2ABZA 2V8GA 4A38A 3H8GA 1F57A 1H8LA 2PIZA 2Q51A 2ZENA 4ZX9A 1F2PA 5HVGA 4NGMA 3SI0A 4NGQA 3SJXA 3S9NA 3QNVA 1HEEA 3GLJA 5CPAA 4OC2A 2PVWA 1CP7A 2ZOGA 1Z8LA 3PBEA 3FVLA 2ZOFA 3BI1A 4A94A 1LANA 3SI1A 1XBUA 4UF4A 1Y7EA 5DS0A 1ZG9A 3PRTA 3VH9A 4X2TA 3IO1A 3CDXA 3KI9A 2IMOA 3PB8X 4OC1A 5LRJA 3SJFA 4MHYA 2XEIA 4MHPA 4P44A 2ZEDA 4PXBA 1IY7A 5K8NA 1PYTB 4NGSA 4ZY0A 2AFSA 1ZLIA 3HLPA 3DGVA 4MMOA 1UWYA 1QMUA 3WT4A 3CPXA 3SJEA 2ZELA 4MCPA 1F2OA 1NSAA 3CT9A 1KWMA 2Q43A 1CG2A 5HVHA 3H8FA 3D4UA 3MRUA 4ZYQA 4WJBA 4DYOA 4F9VA 4YWYA 3SI2A 3KASA 3VARA 4R6TA 1CPSA 1ARMA 3B3WA 2GU2A 4P4JA 1CBXA 4MXUA 3FF3A 3JRUA 4P10A 4EFDA 2QVPA 3H8EA 4OC4A 4EWTA 2XEGA 2PCUA 1CP6A 2ZEOA 4OMEA 1TKJA 1VHOA 3HUVA 2PJ3A 2PJ5A 2IJZA 1PCAA 1TXRA 4A37A 5JH9A 1XFOA 3ISZA 3RBUA 2PJAA 3GUXA 1HDUA 1R43A 4O23A 2BCOA 4P4EA 3KQZA 2PJ7A 4IK2A 3D7DA 3TC8A 2QYVA 3V38A 2AFZA 1LAMA 4PXEA 3KQXA 4UIBA 2FVGA 4UEZA 2POKA 2RB7A 2PJ6A 3KR5A 1HDQA 2F8HA 2ZEPA 2GLJA 3PFEA 1LFWA 2AFOA 2Q4ZA 4NGPA 1R3NA 4NJQA 1YMEA 3GB0A 2OOTA 3RAMA 1Y0YA 2ZEEA 4FUUA 5D29A 4FWUA 3B2YA 2V8VA 1TF9A 3PEIA 4FBEA 4IHMA 3NH5A 7CPAA 1TF8A 1ZLHA 5ELYA 4DJLA 4F9UA 1XMBA 1LCPA 3FEEA 1ZG7A 4MHZA 1Z5RA 1Q7LA 4X3RA 4B6ZA 3PBBA 1Z2LA 3PB4X 4YU9A 2EK8A 4P4BA 2C6PA 2ZEMA 3LMSA 2CTCA 2OR4A 1YSJA 2ZEHA 2CTBA 5LYLA 4R8FA 2C6CA 3S9LA 3D7HA
chains in the Genus database with same CATH superfamily
4O3QA 4ZJQA 4D3GA 3KG1A 3TVYA 3KHRA 3IGVA 2H5IB 3AAWB 2GREA 1FKAF 2KJWA 4CLPA 4IOCQ 3CO0P 1EB0A 3SMZA 3IGNA 2RH3A 3NGSA 1MJ9A 4AG9A 5BYQA 3CW2C 5GADU 1U02A 1K1QA 1GNKA 1ZZFA 1U1NA 3RRGA 3OFEA 4ED2A 4LF6F 3BGUA 4ZITA 4QIGA 5D4PA 1WG4A 4MAKA 4BD9A 2PJ4A 3OWCA 4DQPA 3MPUB 3CDUA 1OBRA 3FBFA 4LF8F 2B6AA 1SBRA 3UN5A 4XDCA 5J1EA 1NJXA 5KFMA 3FDSA 2HVEA 1XR6A 1XN9A 4FPRA 1HWIA 3H5YA 2QJ8A 4UFWA 1LOKA 3SZ2A 1U0HA 4CYOA 1T9VA 4JI5F 2Q4VA 3POTA 3JYTA 2PA3A 1DTDA 2J0XA 3IG1B 2WRMA 1MROB 2BJ1A 4WU3A 1MNEA 3AD8C 3W8GA 1IB1E 2K1RA 1FD2A 3DLKB 1IR0A 2OAUA 1HBOA 2VG5A 2MHNA 3T9NA 5HLFB 5F8HA 3ZZPA 1PGZA 2DTJA 3IAM9 2GAHC 1W26A 1HNIB 2OPSA 1EX8A 1X5SA 1FFGB 5CABA 1MK4A 2M5YA 2G4BA 2E66A 2FB0A 5HATA 3KL9A 4L74A 3W60A 4GVLA 3Q8VA 2W01A 4KS9A 4CRZB 4PYDA 2NSBA 1UA1A 5G22A 1M1HA 4A8SA 3HVTB 4DV5J 4TU9A 5GADI 4UFXA 2KHDA 1Y9OA 1Y3JA 3JQMA 2F5IA 4Y28C 2NZ4A 1LV5A 2F9JA 3N28A 2CQHA 1BQMB 2COLA 3MPYA 5CCLA 4B17A 2IJRA 2MKIA 4C3MA 3LAKA 1IBKJ 2ZW7A 1P9YA 4IG0B 4LT6A 4P7TA 4FBUA 3U1MA 3QGPA 5MAOA 4DX6A 5KFEA 2B5JB 3PGPA 3Q8SB 4X66F 1RWNB 3IJ3A 3E0KA 3EDRB 3RR8A 2C22A 2M0GB 4C8MA 4AVCA 2VB6A 2E1PA 2AGQA 4ZVOB 3R5DA 4H4KC 2PIZA 3D54A 4DL3A 3M9MB 1F2PA 5HSPA 2HNZA 2B51A 3V2UC 3T1AA 4NGQA 1OYDA 2FS5A 1T02A 4F67A 1FNMA 2YKOA 3D3BJ 2W4DA 4DZDA 5CPAA 1QSTA 3SCKE 2YVSA 2QYGA 5IV0A 3JS9A 2BE7D 3OQ2A 4DQRA 3HSGA 4IH5A 4C8KA 2HHUA 3UDVA 2R7XA 1IR2A 4UF4A 3C15A 4QR0A 1PJ5A 4OX7A 3NRBA 1H3DA 1F1BB 1UPPA 1X7VA 2HFOA 5BYSA 3RB6A 2ZDOA 5J2MA 2PR8A 2ZVIA 3RW7A 1X5TA 1IN0A 4G1QB 2JLGA 4CM2A 2XGPA 1QSSA 3NKYA 3PX4A 3CT9A 4E8UA 1OQ3A 4ECTA 2EC0A 2UU9J 3PW5A 4EZ9A 5L9NA 3CGIA 1HYSA 1M5KC 4I69A 5HK4A 3ZZIA 4X4PA 1UVKA 5AXKA 1ZAVA 2ZH2A 4WZMA 4ANDA 1CBXA 4LF1A 4MXUA 1HQUA 2FVRA 5KT4A 5KFYA 3FNNA 3DRPB 2XYHB 2BKNA 1YVFA 4B3RF 2C2OB 2GVZA 3CC4S 2YKMB 2IVFB 3UWTA 3AY0A 3D9BA 3MAAA 1RYSA 4QC6A 2ZH8A 5ETKA 3KLEA 3OTOF 2FZGB 3CDWA 3OR1B 2L9NA 4P9SA 1LWEA 2XMMA 3CJKA 4XPDC 3HFVA 1RUSA 2LXUA 3GV7B 2MXYA 5HBMB 4R5PB 3F73A 2HHSA 2WSFC 1X60A 3O8WA 2J7KA 4RWWA 2HQCA 5B0GA 5AJ3F 1S10A 1F3VA 3QSYB 1PYOB 1WKLA 4BLGA 3BS9A 1AZSB 4R25A 1PILA 2REEA 2CAJA 1JNRB 1JX4A 3NBPB 2CQGA 4KOYA 2CKWA 3FEEA 2W8LA 2YNGB 1AT1B 2BRKA 4ILLA 4IO9Q 3OJUA 2ZH5A 3JSRA 2DVIA 4F0KA 4W4MA 4IRKA 4O3RA 2OR4A 2HQGA 1FKOB 3GR0A 4KFBA 2FIUA 3QJPA 3M2RB 3M8QB 3I3GA 3Q8PB 3R9FA 4JJXA 4KPCA 4YOEA 4FF2A 4M3SA 1Y11A 3BGOP 1EIYB 3CNQP 4ZCMA 2PDOA 1S1VA 4WIIA 3M6WA 2DNZA 4MCRA 3OR2A 1SV5B 4NEZA 2WTFA 2R3VA 1Z4UA 1ZBTA 1K0TA 1RISA 2G2YA 3S6FA 3M1VB 4PAAA 2Z0GA 2GQQA 3NH4A 5D0EA 4H6ZA 3KK2A 1RWXB 2BQRA 4Q43A 3V81A 3GILA 3LO3A 3W6XA 2DNHA 3GFYA 1JXEA 2Q04A 3NS6A 5IS2A 2YQ3A 4DR5F 3UR3C 4RLEA 3AQOA 3BYRA 3O3LA 1SJFA 2KFNA 2V9WA 1CPXA 3TA1A 2VI7A 2M52A 1RHKB 1SKUB 1IYLA 1R0BG 2ABYA 1OZPA 1JJHA 1YW4A 3N79A 4KO0B 1U1KA 5A8WA 3MMBA 4JI3J 2DKOB 3MPVA 1NRKA 1WHVA 4DUYJ 3QMQA 1FTRA 2BVZA 5IOLA 4LBIA 1UP1A 4H4KA 4I4BA 2BJ7A 2W9BA 3ONQA 4DR4J 4MK9A 4B9MA 3DGPA 4C3LA 4YDDB 2BEIA 5IZHA 4TN2A 2VG7B 2I8EA 3PR5B 3LD2A 4E2FB 4AL7A 2WUUA 1YBAA 4DL2A 1VK3A 3IEHA 4MFPA 3AJ1A 4HHUA 1FRLA 2JEWA 3PEJA 3FJUA 1RTZA 4PUOA 1HNZF 3I0SB 2RIJA 1DLOB 4PQUA 4LRCA 3LP1B 5IT0A 3SSQA 1U26A 3GSIA 3IWWA 2V77A 2PE8A 2EK6A 1IBMJ 3PHEA 2FVQA 3CWJA 2PJ2A 2DPIA 3Q2TC 1VHSA 2Y1RI 1GX6A 2CIMA 2CJQA 3W9JA 4NXMJ 2CVIA 1HWKA 1NZAA 1NJYA 4ZPVR 5KG2A 2HEKA 4ECUA 1JLQB 1NK4A 1RAEB 1XJOA 2DYAA 1UFLA 1D8ZA 4WKYA 1TK8A 2CZ9A 1U1MA 2BRLA 4UFVA 1CS4B 1U4BA 3FBCA 2EK9A 4ECVA 2GJFA 3EGNA 5C25A 4QUSA 2ABZA 4DV1J 3ETMA 3MM6B 2MDAA 2E44A 1T9YA 2ALYB 2KVQE 3JAMU 1UWAA 5I3QA 1DQ8A 3HT3A 1RWVB 2ZH6A 2QFIA 4KIAA 3IU2A 3HSZA 1QSYA 1HR0J 4A94A 4B9LA 1XBUA 1Y7EA 2CPZA 1TVRA 4MHDA 1AW0A 2BANA 1NMEB 1P1TA 3SJFA 1FERA 4OHWA 1H2UX 1RQ0A 2CNOB 2QFJA 4CP5A 1Y7PA 4IG3B 3HHEA 3MI7X 4MMOA 4ZJLA 2AQ4A 5KFGA 4Q8FA 4WK3A 3W9HA 5HMZA 5C42B 2EEYA 5D4NA 4ZP7A 4J9UE 2HURA 1HMVA 2G13A 5HH1A 1S4EA 4B3SF 4F4YA 1YJRA 4TLRA 1CSJA 2WW4A 2OMLA 2WONA 5KTDA 2LCWA 1NDLA 4XK8C 4NCZA 2BV3A 4A95A 4PG5A 5B08A 3TUIC 1KLMB 4K0KF 2ZJRQ 5DLFA 1J4JA 1FRMA 3PJ9A 1DQ9A 1FRJA 2M88A 3M32B 4JV5J 2WAQD 3TEGA 1RU1A 3DNCA 2HBRB 5H84A 2HAFA 4PWWA 4F6AA 2OPRA 2FVGA 2FIWA 4J3GA 2VBWA 3TOAA 2E7XA 1R3NA 3R9EA 2B9XA 2Q66A 1SQEA 2PEHA 3T41A 4HNXB 1FJGJ 1S48A 3MR3A 2VHGA 4K2JA 4ZVRB 2WBRA 2KT5A 5DRKA 2G0BA 1LCPA 3K2YA 4P7VA 2DXFA 3KJNB 3D3SA 5L9XA 5HROB 3L09A 4J9VA 3R1HA 4ANCA 2HG4A 4LSNA 4MK7A 2VPYB 4ZGYB 4CO0A 1SIZA 1IWAA 2FLOA 4DUTA 4M1KA 2MZSA 1W25A 4LSLA 1Z4EA 3JAMY 3TO7A 1FXDA 2C3OA 5A0YA 1SC6A 4CO2A 1CJTA 3J7A1 4KJIA 3H2LA 5EN1A 3DKDA 4FPIA 4J9PA 4L8AA 2R7VA 1GH8A 1AXQA 2KXHA 3EC4A 1S1WB 1F3FA 4NCGB 2X1AA 1V0CA 2D7SA 2BYCA 3MMCA 4EMEA 2CPFA 2VZYA 1B64A 3FECA 2B4OA 2J0SD 2F40A 1PKUA 1Y9KA 5CXTA 1C1BB 1FI4A 2FC8A 1BLLE 1ZS6A 1LRZA 2ZD1A 1XTZA 3E8OA 2U1AA 2VC1A 3K0JA 1NNDA 2NUUG 2YQ1A 5LSLA 1LAPA 2OO4A 1RCXB 2Z2YB 4NXNJ 2E1MC 5GAEU 1RO5A 3GJSB 3DOKA 4RN7A 3PB9X 3QAYA 3W61A 1AROP 2C2ZB 8AT1B 3QQCD 4A8FA 1T05B 2DHAA 5LXYA 5K5MA 2IC3B 3KWMA 2RJZA 1ZTTA 4HR2A 3TVKA 1WNEA 5KG0A 2AEFA 4X4TA 3HO1A 3RAQA 2XO6A 4C0HA 4TNUA 2CPJA 5KFAA 3AQPA 1S6QA 3ZXWA 1VQ5S 4CLFA 2F9DA 4OZ3A 1PAUB 3AXMA 1FT7A 1ZYQA 4WP8A 4B3OB 2NXEA 3KK3A 4I7FA 3G86A 4EO6A 4K4ZA 3W64A 1X4CA 3DDNA 8RUCA 1KOOA 2B5GB 2Q7SA 2IM2A 3MZIA 3M9OB 2PFFB 1YTYA 4F8RA 2H48B 1T9UA 1IM4A 1YW6A 5KOXA 4ZVGA 3RW6A 2JEGA 3TJAA 4XPLA 4P2XA 2YNHB 1TZ0A 2DCLA 4IF5A 4DS5A 2FZCB 2ATRA 4UOHA 3EICA 1LK5A 3QFHA 4DEZA 2EI5A 3RNZA 1RT6B 1IBLF 3PO5A 4UOCA 3PW4A 1SL1A 2P8IA 3CCLS 2MKYA 4Q2LA 2LEPA 2VOPA 2CJKA 1N8RT 2NS1B 4ZPAA 4ECQA 4KHPJ 1X4BA 1NU4A 4PKDB 1UKUA 2PJBA 3OXGA 5CNPA 4JV1A 2R2SA 4WF9Q 2EKYA 2ZOMA 1N54B 3N5FA 1M5HA 5GAEI 5HQLA 4X8IA 2N4DA 4B02A 2BQ3A 2BJ9A 1B70B 2FTRA 4OJGA 1KQGB 3PCOB 1VR6A 4ER8A 1OS5A 1KVKA 1SL2A 4PXCA 2HC9A 2LECA 1JXVA 5H9FJ 2I1RA 3MFIA 2HZAA 2UVUA 1H8LA 3BSNA 3O1LA 1HQEB 3IBCB 3SI0A 3G6XA 2R2TA 5AXMA 1G2EA 2HKEA 2BZ2A 3J7ZT 2FY1A 4OI2A 1Z8TA 2IBOA 3DC2A 4X2TA 3JXOA 2PT0A 4WKRA 2FIAA 2OHDA 2QLJB 1ICEB 1Y00A 2LQBA 5G0RA 4Q44A 2P6SA 3M6VA 1Y9WA 4RBUA 1FX4A 4X4RA 3VV2B 2GIRA 3HLPA 2XMTA 1F2OA 4A48A 1NB7A 2J8SA 1ULRA 4NLXA 4X64J 2HWIA 2UZAA 2H51B 3O5TB 3R1KA 4ZCKA 4FYWB 2DCUB 4ICLB 1WI8A 2R7QA 5J2QB 5EWEA 1MU2B 1KUXA 2BOPA 3PYEA 3BSAA 4P10A 2HS4A 3JRUA 4EFDA 1LFPA 2DGQA 4J5OA 2XEGA 2V0NA 2PCUA 4NYZA 4ZP8A 2UVVA 1YJVA 4MJ8A 4KH1B 2JC0A 4A37A 1WOOA 1R43A 2BCOA 1KTVA 3LALA 5J1NA 3NCPA 2GIQA 4ZVPB 1Q8BA 3DMJB 2QL5B 5CZXA 3CDEA 2GHWA 1UTAA 3L7UA 3V38A 2XO7A 5EX3A 4CLSA 2WK4A 3AB2B 3FBEA 3W62A 1VJQA 2W8KA 1DY3A 5C82A 1PIEA 3THVA 3QJLA 2YNCA 2POKA 3VQSA 4R8UA 5ETVA 2EG1A 3P5BP 3KUEA 1RTJB 5KFHA 2UUBJ 2ZH4A 2GE3A 5J2PA 1UMJA 2OOTA 3KLFB 3U7JA 5D29A 1TKZB 3DOMA 3B2YA 2DNOA 4CYQA 4ATNA 2E9TA 4J9MA 2AJ4A 3VAMA 2DGVA 5A2QU 2CQ0A 1NPRA 1HBMA 2BABA 1HQ2A 5HQMA 4M94A 2ZWOA 1S7HA 3ZNUA 3DDDA 4YU9A 4EVYA 2IVMA 1CM0A 4CT8A 3EZ5A 3FQLA 4P4BA 2B4DA 1NZ8A 3KUGA 2WSCC 2ZUGA 4MY3A 2KFYA 2MZ1A 5KFBA 3SQGA 4UQTA 1U2FA 3U1NA 5HJXA 4NLTA 4KYZA 3PRBA 2FD2A 1UVJA 2EK1A 1WTFA 1S1TB 1NPKA 5BXIA 2XMJA 2ZNZA 2WW8A 1T3NA 1VQNS 4OV6A 3D66A 1QSNA 4RL1A 3TO8A 3KJVA 1TL4A 2DNLA 4KT0C 1ZAWA 5AGEA 4ZOSA 1KHVA 1VQ8S 3I6PA 4F8ZA 3FEZA 3CUNA 1EKRA 2HVDA 4NA3A 1IU8A 1NK8A 2B4UA 1JKHA 1JJCB 4FAIA 1N6QA 3RZAA 3OXFA 4C2MA 3KLHB 3DU6A 5SUHA 2Z30B 2G1DA 4XTTA 3LP2B 3FYNA 2IFXA 3IRXA 2KYZA 3ZTPA 2DISA 4NPOA 3O2IA 3QAHA 1Z4RA 2OPPB 1NBEB 3U27A 2HLTA 3CJRA 4DLEA 4XPEA 3I5BA 4FZVA 3UCGA 3D0IE 2ZH1A 2GANA 2WZ1A 4GMKA 4XPKA 2GO9A 3B7IA 4YEAA 2HQYA 4MK8A 4O4GA 3T19A 2E1AA 2Y0SD 4ERDA 3FIXA 2CQDA 2QMLA 4IH7A 4JD6A 1TKFA 1N5SA 4O44A 2LYVA 2Q1LA 1V3SA 4IAVA 1S0NA 2VQFF 2NR0A 4O3NA 4L6V3 4Z37A 5F8LA 3EJMA 3GFXA 3TOBA 2C2NA 3FEDA 4WTOB 5LYFA 1K8AT 1UETA 4JLYA 3A4TA 2KVIA 3NNHA 4A39A 4CAFA 4QR1A 3FKBA 4P4IA 1RU2A 2XZTB 4TVAB 5A2QY 1NO8A 3MURP 1Y5LB 1UFWA 3Q24A 2UUAF 1C1CA 1IKXA 5KFRA 3MM9A 1S76D 2QZ8A 3S01A 4WBFA 2V4JB 1PYSB 3D68A 1HPZA 4MFBA 3PM9A 4C48A 2ANPA 5DDPC 2QJ3A 1VYAA 3DN9A 3CDBA 4QU7A 3C14A 4ZI6A 3RAXA 2B9EA 1NH7A 3GG0A 3R5AA 5H9FK 3B4DA 4QOTA 2YY3A 3PB7X 4OAEA 1YITS 5EMIA 2J7UA 2RKIB 1RAHB 3ZTQA 2CQIA 1D3WA 1FWPA 4Q36A 4ED3A 2PEBA 2UUCF 1HWUA 3H40A 1F57A 3B82A 4M5DA 3TW0A 1I5OB 1JK9B 3VGSA 3G6YA 3HJFA 5HVGA 2RDIA 2AJ0A 1RK8A 1HEEA 4HH1A 2W9CA 4YB6A 3KK1A 2BJ8A 1WI6A 3UQSA 2NQPA 1U8SA 1U48A 1RXOB 2VEZA 5D3GA 2V34A 4DU7A 3G8TA 5B0EA 1NDPA 5CYJA 1KUVA 1U6MA 4B13A 5LRJA 2RHSB 3VTIA 1T95A 2PMWA 4X4OA 3QJJA 1OQ6A 4RW4A 3HVWA 1PYTB 1BY9A 1OPIA 2EFNA 2WCXA 2XWXA 4H4OB 5J2NB 2YNEA 1IXKA 3CJSA 3TANA 5ETQA 5HQ8A 3FRZA 4A32A 3BPDA 3DLGB 1RT5A 2QMXA 2D4OA 4F9VA 1W2IA 4QWBA 5FVJA 2J6TA 2FUG9 1Q81T 2AZ3A 2KFZA 3VARA 1CPSA 3OL7A 3B3WA 3T6BA 3NWRA 1SXLA 5C24A 3NXZA 3TX0A 4FKYA 3UY5A 3N6LA 1VHOA 4ZP6A 3P2HA 3PP9A 2ZHBA 3HF5A 5H1SV 2DJWA 5LOQA 3ZO7A 4A8XA 3GIKA 2D3ZA 5D15A 4DR2F 4C2YA 1T94A 1QAXA 2Y0MA 1FRIA 1XIQA 2GGPB 1S9FA 4C2ZA 2HK3A 2E5LF 3AOBA 2QYVA 1VLYA 2FHJD 4UWJA 1C0TB 2OLWA 1N32J 4B3RJ 3GFHA 3KR5A 4A46A 4ZCIA 3TE4A 4CQ1A 4IUFA 4NJQA 4ED4A 1VCTA 2XLJA 2NREA 3GFZA 1S7FA 1KSPA 4LRDA 3ILIA 4DR6J 1QSOA 4JB8B 3JTPA 4KVME 1RTDA 5LMNF 2CJAA 2F1FA 3GP9A 1S72S 4NI2B 5H9EK 2AYMA 4LQ6A 1TKDA 2C1EB 1XMQF 3W2WA 4FKXA 3KFWX 3BBFA 1UWBA 4DV5F 2D74B 4LREA 2K8GA 1Q8KA 2FPHX 2Z57B 2DPTA 1K44A 4H6UA 1U6BA 3T5HA 3HFZB 3H4BA 2ZW5A 3I82A 1IWGA 4R9MA 3EVMA 4USUA 3FRMA 1AA1B 1YI2S 3HLUA 1CJKA 2AU0A 1NPPA 2HBZB 4EZ6A 5F0UA 3V4IB 3T1YF 4DDFA 5IWAJ 4PZVA 1O5JA 1KTQA 1PSDA 2LXFA 2Q4YA 1NK6A 4IDKB 1CULA 1TAQA 2AX1A 4C3KA 2HGNA 1N5YB 2ZEGA 1MWYA 1NEEA 1RT3B 5ETTA 3EXCX 3T5JA 3IBWA 3NS7B 4OC0A 1D09B 3BJ8A 2F8MA 5FD1A 4DPTA 2G9DA 2ZZTA 2JL9A 3CCVS 4KVOE 5KFSA 3FB3A 4UTGA 4CNYA 1HBUA 3ZC4A 2OSRA 1IOIA 3MM7A 5K8MA 4KHRA 2MY7A 2F7VA 2M7SA 1FWLA 4HDHA 2VC0A 3Q8QB 3BLNA 3RUBL 2DR9A 4N56A 3CCMS 1GMWA 2J9CA 2JBJA 2KRRA 3TARA 1QSLA 1S9EA 2HNYA 1L0CA 2HS0A 4ILRA 1VGYA 4NEYA 5E0OA 1IGBA 2KB2A 2NYQA 2XB2D 4LUBA 1ELOA 1JLGB 1LWFA 2P2CB 3I4PA 4X4VA 4DR5J 1BXNA 1DTTB 3WC0A 1NKEA 2UXBF 2I5JB 5A27A 2B8QA 3R5CA 1CJVA 5HO4A 1OY9A 1Q7LB 1NJIT 2ADBA 2VFRA 3ISNC 4KLVA 4G1PA 4B9VA 4KC5A 2KG1A 2C1CA 4EU0A 4FS1A 4FNHA 1MMNA 4YHHJ 2GFQA 3CJ3A 5LSRA 5E33A 5GCNA 1S6UA 4I67A 1VIOA 2OEKA 2IIHA 2RRNA 3UPFA 3NGTA 4NLUA 4B08A 1LW0A 2BM1A 1WEXA 2HHVA 1ACMB 1YZ6A 4PSWA 1TKXA 2VFVA 5HANA 4LBPA 2ZEFA 2ODFA 2DR6A 2WPXA 4WWVA 3BBBA 3BN4A 3L3CA 4CIOA 1WKJA 2HK2A 2BM0A 3US5A 2B6AB 3DFEA 2HLUA 4Y49C 5J1EB 1U0SA 2R7TA 4DF8A 3DLBA 1U0HB 2Z4PA 4AFFA 3POTB 4K7QA 3JYTB 2F5GA 1WHWA 2RQMA 4ZX9A 3SCJE 4HHJA 1CBKA 3SJXA 2V2QA 3QNVA 2NSCA 2DXEA 2KDOA 3IS9B 2PVWA 2ZOGA 4OJHA 4KV8A 4XNHC 1HBOB 2RT3A 3DSBA 1QD1A 3ZTOA 2VG5B 2X7BA 2W2PP 1SJQA 2OKQA 4LQ3A 3BB5A 2FSRA 2OPSB 3UD5A 4OYZA 4DPWA 2JJ4D 2YNIA 4BBHA 5K8NA 4DV3J 5KAKA 2V68A 1UWYA 2AKWB 5IM0A 3K57A 4MCPA 2FGCA 4CM0A 4TY9A 2QLBB 2VPZB 3H8FA 3TR5A 3CJTA 4YWYA 4ECXA 4PRFA 3W2VA 4OLPA 2ASYA 2G0JA 1XE4A 2WVDA 2PJ5A 2IJZA 4DSIA 5B0AA 1VHIA 4FXVA 1YJ9S 3RBUA 2IHR1 2FVCA 4F3QA 2H5EA 1XR5A 4RJVA 2HV2A 5IXUA 3EO4A 2A6MA 4IK2A 4NYPA 2E1RA 4F26A 2XTJP 4B3SJ 4DS4A 4JI3F 3GYGA 4AVBA 5I3UA 4C98A 4IFYA 4GKJJ 4RWXA 1CVJA 4DR4F 3BEGB 1IQTA 2AEJA 2RRAA 2B56A 4LF9J 2B4BA 5KFXA 4HLBA 2X3GA 2V8VA 2RS2A 2HNZB 2YKNA 1BE4A 4QW9A 4XAKA 1UVMA 1GMUA 3P45B 5AE1A 1NXIA 1U7LA 1TF8A 7CPAA 4HHHA 3ZFVA 2P9CA 5KT6A 1N5TA 1R8HA 3SI8A 4QIFA 5D4LA 4XO0A 3HDSA 4E8OA 3C15B 5L1JA 3DRRA 3ZZYA 3S6GA 1X31C 4F04B 1M5VC 2Y1IA 4UY85 1IBMF 4JI8F 3UD3P 3BR9A 3PRVA 4DCOB 1B3TA 5J2MB 4QPTA 1BQXA 3UE2A 5BR8J 1YJNS 4WE1B 2VBYA 2VKZG 3AD9C 3KG0A 4R7MA 2R7HA 3CE8A 4MHNA 4EEYA 4DZ6A 4KKOA 3W91A 1HYSB 4PPDA 1DE4C 2N3LA 2EWBA 1NMTA 4HNWB 2CY2A 3UNGC 1M44A 1Y10A 3BKUA 1HQUB 4QIEA 4NLQA 1Y0RA 2F4VF 4DV1F 2HS3A 2GVZB 3C6UA 2GAGC 3GV8B 2JDDA 5CYMA 3VAGA 4AL5A 1PJ7A 2UVWA 3FCVA 2PJ1A 3EPIA 3MAAB 5CYQA 3P49B 3A3PB 3VAKA 4L73A 3D7GA 3GCXP 1AYEA 3KLEB 1SVDA 1RHRB 2F63A 3KOAA 3TA2A 1NLKL 5L1IA 3KG4A 2Q79A 2LKZA 1LWEB 5GMDA 3CJKB 2DXQA 4CLLA 3X1LB 4C9DA 2NUHA 1NSLA 4OLOA 2PE3A 4IOBA 3AA8A 3M4XA 1S5KA 3QIPA 1QUVA 1RAGB 4K4YA 1C2PA 3GJRB 1BUXA 4KOVA 1S9GA 3AOAA 3UR0A 1U47A 4OX9J 3C3LA 3JTKA 3OFHA 4B11A 2B4PA 1S5ZA 4J9QA 3MUVP 3B35A 3W5XA 2PQ8A 2QLXA 1TUGB 2JVRA 1MWQA 2B0GA 3TO9A 1RWMB 4ES2A 4MJKA 2OFGX 4KFBB 1D9AA 4U67Q 1K73T 1D8YA 2IA0A 4P4FA 5F0WA 3UVJA 2QA2A 1BQMA 4RW8A 3H59A 2JDJA 1YK3A 4NX9A 2CA9A 1EE3P 1HW8A 5G4DA 5DM7Q 2WVEA 2A3JA 2IL4A 4JV5F 5L38A 2AGPA 1S1VB 3V6JA 1DZ5A 2VODA 3VAIA 2UV8A 3MEGA 3GJQB 1WWHA 4ZJOA 2OFHX 3RYLA 2HQDA 2R7OA 4A8YA 4J37A 1S7KA 2DPSA 2RU9A 2WVBA 1YLOA 3BSCA 1HI8A 2C6GA 3HFKA 3KK2B 4M5HA 4B12A 1RTQA 3V81B 5D78A 1X4FA 2JLMA 1J2VA 1EARA 1QUPA 3K5LA 1XIXA 4B5OA 1KQKA 2BSWA 2RQCA 2A4NA 6AT1B 5KFDA 3GWCA 3TJ9A 4OYXA 2HHWA 1DAXA 4CTAA 4HVZA 2ZKTA 2JDCA 1XF8A 1IUJA 4RW9A 4DI6A 3PBEA 4YGOA 3FVLA 5A8WB 3MMBB 4B9UA 4Y2IA 1ZG9A 3ET6A 3MGJA 4LF7J 4U9YA 4IYQA 3IWEA 3BJ7A 2W9BB 4WYWA 3CXQA 2EBGA 2ZM6F 4TYBA 2IRUA 3DGPB 1JLAA 2Z2ZA 1O8BA 3CEDA 1PAEX 2P6EA 4Y0FA 3R97A 2GW8A 4HPSA 3GKRA 3TNVA 2C3UA 3PIOQ 2BA9A 2C3PA 1WACA 5ETMA 5M2RA 1CG2A 2WB1D 3PG9A 3MRUA 2FHMA 4PUOB 4DYOA 3GV5B 1YDLA 1EZZB 4PQUB 4M85A 2ZFHA 3S6KA 3AJDA 1TQLA 2IJFA 2FHOB 3LP0A 3PV8A 5B7WA 4OC4A 3RU0A 2V8PA 2C3YA 4Q38A 3MMJA 1T3OA 4NOHA 3MD3A 1FA0A 4KGMA 1YR0A 2XS7A 3LAMA 2CQPA 4AL6A 4P4EA 4A2ZA 3K58A 2BUNA 2F65A 1AUSL 4HT5A 2OH2A 1M0SA 4A8WA 3MM8A 2ZPAA 1RHUB 3OTBA 2CQ4A 4LVOP 3KQXA 3IMQJ 5KFTA 1WG1A 4CH0S 1ITPA 3PACA 2DH9A 3DM2A 3R5GA 5KFWA 2A2CA 3G8QA 5I42A 5C25B 5F48A 4KB7A 3CMAS 1T9WA 4XIUA 2Z3OA 3OPKA 4MFZA 3BKTA 2ZEEA 4FUUA 1S1UA 1XK8A 3HKZD 1M90T 1S0OA 4WPAA 4OHZA 5F8JA 3R95A 1VISA 2QIFA 4XPDB 1XBWA 4GVBA 4GO7X 3OXLA 3BDEA 4JP8A 2CDRB 4B3MF 4KY3A 5MLCV 1TVRB 2OELA 4U96A 2XY7A 3N0VA 2BANB 5HMWA 2CZVC 4LF4J 4YFUA 3BQ2A 3I87A 3LMSA 5E3QA 4MFKA 2W2OP 2PIIA 3BHXA 2Z0ZA 4M5MA 1N36J 4EGLA 3PEHA 4HKQA 4ZMMA 4ZLPA 4M95A 3QB8A 3RG6A 4BWJA 3KMSA 4DWIA 2IPOB 2XZWA 1YJ7A 3MM5A 4OI1A 2DNPA 1GQEA 1HHQA 5AG4A 1HMVB 3IC1A 4C11A 5ADZA 2MQOA 2WONB 1FJ7A 4ED1A 5EWGA 3EZUA 4DUZJ 1J5EJ 3E01B 4MIAA 2QX0A 1JLFA 2D3OR 4JXQA 2BEFA 5A8RA 1WJ9A 5L1LA 1RYRA 3CXCR 3RO0A 3QSIA 4BMHA 4M5LA 3GE9A 1HARA 4C8NA 4DFPA 1S0VA 3S6HA 3NP5A 3FMBA 4CNZA 2YNFA 1NDKA 1NK5A 3L9ZA 2VDHA 2QECA 1OIAA 1RZMA 2OPRB 4YS2A 1G4CA 4MCSA 1EETA 4KGVB 2J5AA 2CPXA 1UJ5A 1RHMB 3IU1A 2PMHA 4UA3A 2L3MA 1VBXA 4CLYA 5GAGU 4UQGA 4PWUA 1H2VZ 4YY3F 1NUEA 1H7WA 4LX9A 4Y3CA 3B8GA 2AZ1A 4OX6A 1HI0P 4X64F 1LXNA 1SUQA 5JPHA 1QE1A 4N7TA 2J8AA 1RCOB 3N5BA 5K14A 3DHWC 1QSRA 4A31A 2J8RA 3HSDA 4OYIA 3B8HA 4X65F 3CDAA 3OVBA 1JLEA 4LSNB 4C2XA 3R7NB 3MMAA 4X4QA 5T7LA 2C2KB 2HB6A 4USMA 1I3OB 2PRQA 4LSLB 3AD7C 1VLOA 3BGRA 5A0YB 3A13A 1CJTB 3MR5A 3N4WA 3ADAC 4OADA 3DR6A 4NLWA 1FXRA 2XZDB 3VATA 4I68A 4D3HA 4A4JA 3Q89A 3MMCB 3HVRA 5LYIA 4FBTA 3C6TA 4NA2A 3OL8A 4NLPA 3H25A 1YG0A 1JMTA 1IKVA 2ZD1B 3HULA 5EGYA 3P5TL 2MHEA 3IWNC 5BWAB 4CLTA 2XSFA 3CJ0A 4ZY1A 3CPWR 4PEOA 3I5AA 2EFVA 1WC6A 4WFXA 3BR8A 4XDDA 1F9HA 4G6VB 1IKYA 4B5PA 2UUAJ 4O0IA 3DOKB 1R0CB 2HRUA 3H20A 3ILLA 5A76A 4MYTA 2IA6A 2UP1A 5AE3A 1AB8A 3BKFA 1RT2A 4J9NA 3P4UB 4C97A 1GMVA 1ZH5A 5GAGI 2X51A 4JI1F 4LFBJ 4RUCA 3S8SA 4J9LA 3JUWA 2MZRA 4EBEA 2PI5A 4PG8A 1XNRJ 3T6JA 2XMWA 4ZIWA 1FHTA 4TXSA 4U7UK 1S6QB 1NM2A 2MQLA 3NAHA 1VHFA 2VUGA 1RT1A 2ZBPA 2XMUA 2UUCJ 2IRXA 2MYFA 1S77D 3KK3B 4I7FB 4AUKA 3NLCA 2AFSA 2WSEC 3CCJS 3DI6A 4B9SA 2W2QP 4PG6A 2Q43A 3W65A 4B10A 1NHKL 3AT1B 5A28A 4ZYQA 3HPOA 2I2YA 5DQIA 4R6TA 3G2XA 2GHPA 5KFIA 3OHAA 3EE3A 4OQJA 1UFKA 1TKJA 3HUVA 3D3CJ 1PCAA 3HMJG 1VFJA 3ISZA 3TQEA 3GUXA 4USJC 1DARA 1F2GA 1TUWA 3DNSA 1VMBA 2RSQA 3VVUA 3CXSA 3G82A 4YR3A 1QAYA 2OSQA 1GTEA 4JWPA 2DXDA 2MQMA 2HIYA 4NWBA 3LOUA 2BW7A 4UEZA 1B7YB 4P2SA 4EBCA 2PJ6A 1FVQA 3FJ2A 4ZHRA 1R31A 1Z9UA 1SKSA 2JC1A 4OHVA 2OGUA 3DRSA 3KLGA 3I55S 4I1TA 4ZPDA 4DV0J 4DR2J 2HMIA 3ITHA 2VV5A 1NJWA 1N0VC 2E5LJ 1P1LA 3PEIA 4I49A 3LA0A 3T3FA 1TV6A 2C2EA 4AXJA 3KYLA 5KT7A 4ZIVA 4DFKA 1PU9A 2CNLB 1TR0A 4B9TA 4P2FA 1Z2LA 2R4FA 1WF0A 1WK4A 2QA1A 3CJ8A 2ZEMA 2DNNA 2ZEHA 4K4UA 5LYLA 5G0RB 2BL1A 2K2PA 4F4KA 2MPUA 3I9V9 3ILOA 5LMNJ 3QRPA 1A6LA 3NGKA 3M6XA 1XMQJ 3TT2A 2PDAA 4TNOA 3KGQA 2ZBIA 5DZ6A 3C2PA 4LRFA 2GIFA 4RNHA 5LJ3Y 3K5OA 4Y2MA 4Q0BA 2VA2A 5JVHQ 3CC7S 1NKBA 5HXDA 1M5SA 2B7CB 2WOMA 3D2MA 4P75A 4GS4A 5T14A 2GMHA 2Y1LB 2QLWA 5AXLA 3CSKA 1S7LA 2DNQA 4DX5A 2O4HA 1KRPA 2KM8B 3C19A 4Y6IA 3T1YJ 1KD1T 3CXPA 2G0CA 2F8EX 3CCWA 4P71A 2JBKA 1F5CA 2BJDA 2KXFA 3V4MA 2HFNA 3KNGA 4OIDA 5KFQA 3LGNA 3Q2SC 4O3SA 1H72C 2VQEJ 4C8YA 2VBQA 4NMXA 3GIMA 1J5OA 4R8UB 1Q4RA 3ZZZA 4AD6A 2LA4A 2XMKA 4FD5A 1HIYA 3BI0A 2FHKA 2HWTA 1UW9A 4Z7YA 5J2PB 1Q78A 2QA4G 3B3CA 1UW4A 1RAOA 1S12A 3DOMB 1VC6A 4RO0A 2CJBA 1AUGA 5E3AA 4LRBA 3I1UA 2GLFA 2W4PA 4UOFA 2H9ZA 1P8GA 3OVSA 3MUTP 3CJQA 2G2ZA 3HHLD 4E0DA 5CAAA 1HBMB 3CCZA 3NH8A 2R1IA 2ATLA 1WHXA 1VRQC 1F9EB 2HVIA 2B4DB 1Q79A 2HFVA 2R98A 4NE9C 3W8PA 1NCLA 3SQGB 3VAJA 4OYWA 3ZZUA 4PG4A 1WC3A 4BS2A 4R87A 3DLJA 2ZE2B 1XEZA 2HFUA 2UXBJ 3I4HX 4I6WA 5EX0A 4K4XA 1S4FA 3V6DA 4K59A 3B3SA 1WD6A 3MECA 3TX8A 3I5CA 5D77A 3F5BA 3HHDA 3IFEA 4JI2J 3FGVA 1EAYC 5K9FA 2VL1A 4NGRA 1N32F 3PYFA 4RX6A 1N4LA 2G3AA 1I1GA 3UO0A 4U8VA 5G21A 3V6KA 1FJEB 4HL9A 1R6VA 3KJVB 4KH0B 2GX8A 4DV2F 4KTQA 1CJWA 4DNCA 4N76A 2PA8D 1S59A 4I2QA 2NMTA 2NPIA 5F9NA 3KZWA 1LW2A 4WFYA 4DR6F 1F5BA 4ZVFA 2QN6B 1BPNA 1PBUA 1JKHB 1FE0A 4RU9A 3LODA 2OU2A 1N6QB 3BM7A 4C7QA 4CLUA 3M8PA 3M8YA 2QRRA 1N5VA 3IRXB 2ROEA 1B0VA 5I0CA 1P27B 4JV0A 4ZN3A 3WQPA 4OZ5A 4WXOA 1F5AA 3W5YA 1KVJA 1RTIA 2IBKA 3PRTA 1BQNA 2CQCA 2XCPA 3F8KA 4O4GB 2OTLS 3VF0B 1R0AA 3EY5A 5C2GA 2GZOA 2IDEA 5IWAF 3DLEA 1VKCA 4UCPA 5HJYA 4FF4A 1T03A 3GIRA 2QMUB 4O44B 3G71S 3NY0A 3NOCA 4CLKA 4PK2A 3WT4A 3ZTRA 2NLWA 4WYLA 6FDRA 5J2QA 1FY7A 5D0HA 2N82B 2CNNB 2AT1B 3W63A 3TAQA 5KG3A 1IOFA 2E5HA 1EQ0A 1JLCA 4RW7A 3PJWA 1QM9A 5E3CA 2IY5B 4ZDNA 3NNCA 4K30A 2GU2A 2DNMA 4KRWA 4YB1P 1KQFB 4NEXA 4IFVA 4Y65A 4EBDA 1SKRA 1Q0NA 2A2DA 3ELHA 4I0WA 1XOVA 2LP4A 2PJ3A 1N33J 1C1CB 3TAMA 1TXRA 1IKXB 3J81U 3TCVA 5JH9A 3MM9B 4ETZA 2PGCA 3PVXA 2B7BB 2XBPA 1HPZB 3ZNJ1 1PC5A 4M6GA 2H4YB 4MFBB 1KBRA 2QL7B 1TL7A 4J7CA 4ZLLA 2BE2A 2FYXA 3C14B 4F7VA 3TC8A 2KKHA 5ETRA 3DRYA 3BH6B 1TKZA 3I96A 4QJVA 4ZVHA 2X7IA 2LQ9A 4LMZA 3PFEA 4MKBA 2E5JA 1VC5A 2EFOA 1NKCA 5EBVA 2CPIA 1Q8IA 4M5DB 2ZKUA 3R2DJ 4IKAA 1TF9A 3L7PA 1OJ4A 1K1SA 3MXHP 3GMGA 1UAWA 3A8KA 2R2RA 2OUGA 5EC4A 3EVOA 3NG8A 2DH7A 3KK1B 4YHHF 2YPZA 2FXFA 1JLBA 2B8PA 5F41A 1ZG7A 1VQ9S 2I6WA 5D3GB 3PZPA 1YJUA 1F60B 3PYDA 2GVDA 4HI2A 1MMLA 2DR8A 5CQGA 4RW4B 2WHOA 2UV8G 2OEMA 2X1BA 3F56A 3UDLA 3KKWA 5AG7A 1UJ4A 2XEJA 4YMEA 2MQPA 1C4CA 3GCWP 2G2OA 5J1QA 4ZPWR 1RT5B 3V7ZA 4M6HA 1KOHA 2DGOA 3R1LA 4RNMA 4JI6F 4DSLA 2XULA 5I3PA 4JI8J 1IJEB 2KT3A 2GMLA 4MTPA 5C24B 3HX9A 5KG6A 4JZ0A 3HHLB 4IRCA 1FF2A 3NL0A 4HTIA 4K4TA 2CFXA 1P6TA 5KFCA 3C16A 1LK7A 3IR5B 2P6TA 1NE9A 1GYTA 4ELTA 1AUDA 1NK0A 1HA1A 4K3NA 5KT5A 1VQOS 3FZBA 5DQGA 1AFIA 5B0FA 2F4VJ 1CQMA 5A8KA 3J81Y 2AP6A 1PJ6A 1LWXA 2QA4S 4PQAA 4DV3F 1RT7A 2K3IA 3UDEA 2DK2A 5K8PA 1ZM4A 2J9AA 1EP4A 1S3ZA 3EUNA 4OZLA 2R8HA 1RTDB 4QVTA 1KEKA 1TUVA 1URNA 1Q5YA 5FDLA 2GJIA 2KTQA 2XWYA 1K47A 2L08A 2WZNA 3W2WB 1YRXA 3AH6A 4NFRA 2ZDPA 1UWBB 3P2FA 3FX6A 2FE7A 4OC3A 3RR7A 1YBUA 4ED7A 5KFKA 4V19X 2JWNA 3PXGa 3LTOA 1D9FA 4AQYJ 1RGVA 1UL3A 3D6HB 1M1DA 3E3XA 1HWLA 1MN7A 1H7XA 3WX8A 3H5SA 1VIXA 2RC4A 2I9SA 6CPAA 1CJKB 2VBZA 4RPFA 1RTHA 2CYYA 2CQ1A 3L2NA 4OZNA 4TQRA 4YDXA 2RRBA 2XHCA 2QIRA 1CULB 1EKSA 4A8QA 4GKJF 1SPBP 4CO5A 1G3OA 2ZVSA 1K4JA 4RUAA 2LFVA 2DRDA 4J91A 1VQKS 2QEXS 3RJMB 3IGRA 1TL1A 3BQ1A 2YBVA 4LF9F 2PC6A 1EJ7L 4YR0A 1VQ7S 1VQSA 2A6OA 1HBUB 3S9MA 1XMOF 1SCJB 4NLYA 1WF1A 3MM7B 3R5BA 2PFDA 3V6HA 4CPAA 4CS0B 4Q8EA 2N7CA 5U47A 3SSRA 2AIRB 4N47A 4B9NA 2YKAA 2PSWA 4YUDA 1IKWA 1RWKB 2FCKA 2Q51A 2ZENA 2N7YA 1VK8A 4TY8A 1WDDA 3NNAA 2H5MA 1S1XA 1S9EB 2HNYB 3TP2A 2JNJA 3BJYA 5HMXA 1Z8LA 2BMBA 3DXBA 3SI1A 2XSJA 4E98A 2ZZNA 2V67A 5BR8F 4CZCA 3VWEA 2PRBA 1LWFB 7FDRA 4A47A 4GC6A 1X5OA 4K5RA 3GQCA 5LT5A 2FDNA 2ZW6A 2ZEDA 2CXAA 3FSYA 4F50A 3CCUS 1CJVB 3FBUA 4NGSA 1VQ4S 2GA7A 2YTCA 4DSFA 3KXDA 2LQ8A 2J8MA 4LIRA 2W9AA 3I56S 5C7PA 1MSWD 1VOMA 1DHMA 3PNIA 4H4MA 2XS5A 1WC5A 4DL6A 4IUSA 2ZM6J 3L7OA 2HVHA 1RSCA 3PW7A 3H8EA 2APOA 3CO9A 5IV4A 4ALZA 2OPQA 2FLNA 3Q0AA 1LW0B 1C0UA 2F4FA 3SDEA 3TZYA 1XR7A 2BE9B 2HHHJ 3ENAA 2ROGA 1R57A 1FXLA 1TKXB 2EO8A 2CWXA 1HDUA 2Z3LA 1BHNA 4DCJB 2JHEA 4ZVUB 3RRKA 2AX0A 3GJTB 3FXTA 3ZTSA 1MG7A 5AT1B 4FVCA 3J80U 4OI6A 2BJEA 2RB7A 4GXHA 4RW6A 3MR2A 2F8HA 4MFQA 2QE5A 2C2RA 4OX9F 2JEIA 2GLJA 4QZVB 2O5DA 4Y00A 4PG7A 3PHTA 4E2AA 3GR1A 1SH0A 3JQKA 1XMBA 5LMUJ 3QGIA 4KV8B 3ZJ0A 5IV3A 1UEUA 2DF5A 2QMWA 3QLHA 4UWIA 4DXLA 1CJUA 2BJ3A 2OI2A 2EK8A 1U1PA 1WF2A 3KHGA 1WTBA 4R8FA 2YNIB 3BYPA 3IP0A 2XHWA 4EK2A 2MSTA 4FD7A 1M1KT 4N77A 2ASDA 4DLGA 4J9OA 5IM0B 2AFWA 4DPOA 1E6YA 3TO6A 4DG1A 3GIUA 4B3MJ 2HRTA 4C8OA 5F8GA 3CPAA 4OI4A 2V2VA 2CNTA 2UUTA 3FH4A 1WDTA 1WEZA 1K0VA 4ZY2A 3W2VB 1RWWB 3M2UA 1WOSA 2IAJA 1NB2A 4KSFA 3HKWA 4UIAA 1M1GA 4I6YA 2N3OA 3FMWA 3A9LA 3AOCA 4NGTA 4B14A 2ASJA 1BGXT 1XNQJ 2XYGB 1SQFA 4HI1A 4EFAC 5HN0A 2H1YA 4QWEA 3TAPA 5ETPA 2VJVA 4H54A 4HACA 1OSCA 2VQYA 2L9WA 3HHKA 2GC8A 5FJ4A 4UEFA 3N9UC 2VXKA 4LF7F 2QSWA 9ATCB 4NLDA 3EGVA 4K5SA 5I3UB 1ZM9A 4IFYB 2FJEB 3ULHA 4DV7J 4ED0A 2IQ6A 2HHPA 2JFKA 4ECYA 4I64A 3KHZA 1JLGA 1NH8A 4TU8A 1OPZA 2V6AA 3M9NB 4GC7A 2RU3A 2MJNA 2OIHA 1RT4A 5CH7B 5HI7A 2AJFE 4PK3A 3LH2S 4MKVA 3OFFA 3QT6A 1YGYA 5LSOA 2YKNB 1WUUA 4P45A 4FF1A 3J80Y 1TL3A 4OYAA 2XCAA 1RKIA 3LWMA 4MFLA 3CJ5A 3DRRB 2C2MB 1YREA 3A8EA 1OO0B 2NSMA 4MY0A 4JYAJ 2J9DE 1IJFB 3HXMA 4U6PA 4ES3A 3VQTA 4OIXA 1RADB 3HZEA 3RB4A 3R96A 1C4AA 4YY3J 3VALA 1U24A 2G3TA 1SJ3P 3JTNA 2CPYA 3IAS9 5T41A 2V8HA 3R5JB 5E3RA 2MLXA 5JJBA 4AVAA 5JUMA 4OJ1A 4KKOB 1ARLA 5AG6A 3ZZ0A 4ZX8A 3K9TA 4X65J 4ECZA 1QVGR 4DV4F 2JRSA 2A10A 2IM3A 3WC5A 2NPFA 4CO1A 3DRXA 2MZJA 3NE7A 1H0HB 2QO3A 1J27A 4LF5J 3C6UB 4IH6A 1LOUA 4K4SA 1RHQB 4CCHA 5CYMB 2VDIA 5AXNA 3TUPA 1X9MA 5CYQB 4DQSA 3PR4A 1UA0A 4C7HA 4YP3A 4URSA 1HI1A 3IS9A 3VVTA 4UZCA 4WCEQ 3OUYA 2XLKA 3LPYA 3EZOA 2KG0A 4NGMA 1UEKA 4PCQA 1HNVA 1L3VA 5B0BA 4LF4F 4Y49B 3KJFB 2IDLA 3K7RA 4FD6A 1XC9A 4RI1A 3DDKA 1N36F 3VH9A 2FHJA 3D1QA 3QIPB 3GIIA 3DLLQ 5KOWA 2IMOA 2OEJA 2VG6A 4OC1A 4A33A 1DURA 1L5UA 2RQ4A 1HWJA 1S9GB 2HHQA 1H6KX 2VKRA 3GPAA 4N8NA 4QYZK 4N8OA 4BBYA 3VZIA 1KVIA 4JI1J 1RHJB 3CPXA 4UBRA 3AB4B 7FD1A 5H9EJ 4XNHB 3K8VA 3W66A 3CD0A 4DUZF 1J5EF 3EDQB 5HVHA 1KC8T 2KU7A 4CDIA 1VDHA 3OVAA 1UVNA 2AJ1A 4MI4A 3UVJB 1H38A 5JXSA 3K8WA 1Y0HA 2A1BA 4RW8B 1SQGA 4AG7A 2BW2A 1V9OA 3ICLA 5KFOA 3MCSA 4CGOA 3JSMA 3H90A 4ZA1A 2C2DA 3BF4A 3SIPB 1HW9A 3QO9A 1QJHA 2HQFA 3MEGB 2OZGA 4O23A 3H98A 3KQZA 3MF5A 5LM7E 4KE5A 3CD7A 2Q3PA 3I0RA 2JH3A 1LAMA 1E6VA 1TKTA 1ZTWA 5DZ7A 1L3TA 2E5IA 2HFSA 1V5IB 3IR6B 1ZA1B 2YQ0A 2DR5A 3HD1A 4EMDA 3E2EA 3Q8RB 2RE1A 1ON0A 2DRAA 3Q23A 2F3JA 5C2CA 4ONUA 4UW2A 3RAMA 3GIJA 2CQ3A 1KP6A 4CTAB 5DS7A 4O0NA 1WELA 5CD4A 2XGQA 5DGAA 1T7PA 3BQ0A 2P6FA 2E7WA 4RW9B 2KL8A 1R8CA 2JX2A 4DJLA 3AXKA 2H4WB 3MCOA 1UPMB 3ET6B 3MCNA 4QPXA 4WE1A 1ZOTA 2CTCA 2CTBA 4CAEA 2C6CA 3FEXB 4OZ0A 1JLAB 4I2PA 4Q2MA 3DOLA 3IWGA 1W7WA 1YVOA 4LQ9A 3D7FA 2NXNA 3RYOA 3IN5A 2XQCA 1IM6A 1RAFB 3GONA 4FN5A 3W5ZA 4F2RA 4H89A 2C3MA 3G8SA 3CMES 4F4XA 3TJ8A 4TLQA 3THTA 2RUSA 1X4EA 1FDBA 2AFMA 3LP0B 2Q44A 3FFIA 3G87A 4DX7A 5GMEA 3OW2R 1DJ0A 2CPEA 1MMDA 1KLNA 3MTJA 4ZLJA 4NYOA 5HP1A 3QT7A 1D9DA 3DHXA 1ZM2A 3M2VA 4ECRA 4DUKA 1M5OC 1NSPA 2R8JA 1BAVA 2HGMA 1O6XA 4LFBF 3MPWA 1KZFA 2DEAA 3L95X 3MM8B 1AMPA 2Q6BA 1FFWB 1XNRF 2O28A 1SQHA 2XY5A 3BO4A 3R9GA 5B09A 3DM2B 5A6PA 2ZJPQ 1FDAA 5I42B 3IM9A 1X5PA 2FJAB 2AYEA 3DXSX 3R27A 1S1UB 3NAIA 2O3DA 4P6QA 3EMTA 3SFUA 1HHSA 3PKMA 1QY7A 4F0YA 5CD4H 5J8CA 5C5JA 4RNNA 2UXDJ 4W90B 2MZQA 1XJWB 4C68A 3ISXA 4GVBB 5KT3A 2HBQB 2A0FB 2OH1A 2MQNA 1HFEL 4PWDA 3VWDA 2HYIB 1REVA 3D6FB 3D2WA 2HNDA 4CRYB 2DHSA 4DSJA 1JB0C 4K4VA 4USHA 3H4QA 4NSQA 2J0WA 3M30A 2YKQA 3FC9A 2CF4A 5F47A 4AXVA 1NHVA 5SZTA 4DL5A 2YKPA 4LRAA 3T9ZA 2FT0A 2Z11A 2XLIA 1ZPWX 2V5HG 5LRKA 1DTQA 4FYDA 3MM5B 3H0PA 3EWGA 4DN9A 4LR7A 4C11B 1BWEA 1WSVA 3TZWA 2XMAA 4AT1B 2YPYA 3QAEA 4ECSA 1IQZA 2BUEA 3CF5Q 4RNOA 1VRTA 5IX3A 2W2MP 1V3RA 2O66A 1JLFB 5KFFA 1T9TA 1LKZA 5DG9A 1TTHB 4DV0F 5A8RB 2VICA 1JQGA 1S60A 2DHXA 2QLFB 2R42A 1HL6A 2ZITA 2FGOA 4ZVTB 3IA0A 2GS8A 2C42A 5EDWA 5DDOC 4AE5A 2DNKA 2YNFB 3R6GB 3OSPA 3MOJB 3K59A 1JIHA 3KHLA 1QAIA 4DV2J 4C4WA 5G1ZA 2DO4A 1EETB 3FNCA 3WHIA 4KOSA 2YWGA 3U1LA 4ED6A 4ID5A 2HGLA 3DYAA 1RI7A 3UFCX 3IO1A 1LWCA 2VPWB 3KI9A 2J7WA 4CH7A 4L76A 2IM1A 4NXYA 2Y9HA 3TA0A 2VONA 4PXBA 1SUQB 3JSYA 3TRGA 1IY7A 5DETA 1QE1B 2QG9B 1KHWA 1M4GA 1UFHA 2NYIA 5K14B 2C28A 4CLWA 4WIQA 1I94F 2EFQA 1NSAA 3KLIA 1JLEB 3MMAB 1GEHA 4RR5A 5T7LB 2KZMA 1V5VA 1YZ7A 2CRLA 2EBEA 2FZKB 3HM9A 1S57A 3MEDA 3BGRB 2AGOA 4EYIB 1T9XA 2ADCA 3LQVA 3MWBA 4DSEA 4U9ZA 4DV6F 2ZEOA 3SCIE 1H98A 2NXUA 5E2QA 4UUWA 1FKPA 2NXJA 4EYHB 5M2PA 3FEYB 1U1OA 4QWDA 2VQEF 4BWMA 3C6TB 3RBXA 2K3KA 3MPDA 1S99A 1IKVB 3OHBA 2KO1A 2FQQB 2DY9A 4J9SA 5CZVA 2LVWA 4G1IA 4P74A 1QVFR 2AW0A 3QYYA 2EPIA 4ZP9A 1IKYB 4B5PB 2KN4A 3A3OB 2ZEPA 5A6WA 4YQWA 1LFWA 2CNMA 4NGPA 2GHVC 3GY9A 4N41A 4Y2CA 4YR2A 2BDPA 2R8IA 1RT2B 3BGLA 5JQ4A 4DOZA 4LR8A 3I32A 2AYBA 2H65B 4X62J 4X4UA 3FUYA 3EM1A 3T1HF 2FVPA 4DF4A 1L3SA 2D1CA 4U9RA 1I12A 3I9ZA 3IR7B 1BWVA 2Z2LA 3M8WA 4DX8H 4JI4F 2FJVA 4MBUA 4FP9A 3DLHA 1RT1B 2VU5A 2FJBB 3HP6A 2CJ9A 5ETOA 3CD6S 3P96A 4JI2F 4OZ1A 2LU2A 2HW3A 4FXDA 5F8NA 4KSIA 1NK7A 2BKOA 3DI6B 4MKYA 4KORA 2EKNA 1FDNA 3GG1A 4F02A 3Q8UA 3KHHA 3NFZA 2B3TB 1VS3A 2DO0A 2ZBQA 2DPJA 3K5NA 3E01A 1S6PA 1FEHA 2JEVA 1FK9A 3D1OA 1U2RA 3RBZA 3R3TA 2CIJA 3QRRA 3O6QA 5IC4B 1HHTP 5F09A 1ZZNA 1RP5A 5D4OA 4O3PA 3JQJA 2XS2A 2B3UA 4BHQA 3SCLE 3CJ4A 4L75A 1OY8A 3PTWA 1FNXH 2AFUA 1VRUA 3G82B 4JI6J 4NASA 3T90A 3ILJA 3THPA 2CJXB 3J7AN 3W6SA 4B3TF 4EO8A 5F9LA 1Q2YA 3P6YC 1N5QA 1Z8WA 3QNWB 4CI0B 5KG7A 2H3EB 3D1HA 3VGTA 2L48A 2AFXA 2L41A 1SJ4P 1HBNA 3LPEA 4ZHRB 2RS8A 2QTWA 3AJ2A 2AJ2A 2P9GA 4DN0A 4Y34A 3DRSB 3QAUA 1M4LA 4DMZA 2K1RB 3KLGB 1URRA 4L89A 1VBYA 2HMIB 1G7CB 3ITHB 4MIWA 4CYUA 1KFSA 4CRJA 1WSRA 1TV6B 2AYGA 2H5JB 3D28A 4PPZA 4ZVEA 1SL0A 3FSXA 2AJ6A 2Z3NA 4ONWA 1XRYA 1HD0A 2B3VA 2ZH7A 4NF1A 2UXCJ 1FJCA 4LJMA 2VA3A 4N5SA 3GSDA 2PN6A 1N33F 1GXLA 2E29A 4RKUC 4LFAF 2B58A 3PFOA 2KM8C 1Z8XA 2YWFA 3H5UA 3MAQA 2E1CA 3D2PA 4JI7F 1N34F 3OSNA 3PX0A 4LFCF 2MGZA 1DFDA 4V19J 3MEEA 4A8KA 2MKSA 2CPDA 4CYPA 1RJJA 1CX8A 5EWFA 3BXMA 3MHYA 4Q0BB 2YNCC 1X4HA 2PSZA 2LDIA 1UCNA 2WOMB 5GMKa 2M2BA 3ETOA 4ENOA 1REGX 1P4NA 4PV6A 1VHEA 2DEJA 1FRKA 3WC6A 3NMAA 3KNAA 3CIZA 3MUMP 1YQHA 3LF0A 3SV4A 3PY8A 3GYNA 3C26A 5JMNA 3H8GA 1VC0A 3AA9A 3ZZTA 4IQMA 3GTYX 5KFVA 2P0WA 2XYPB 2ZWPA 2Y8YA 2BX6A 3NGRA 1WC4A 3C46A 1J5OB 4OC2A 4GKKF 2DGTA 4DPXA 1CP7A 2QT7A 2HWHA 2RF2A 1U25A 3EPGA 1V3ZA 4MH8A 5KFZA 1LANA 2YWWA 2YWEA 3IRWP 4L3KA 1XMOJ 1S97A 2CADA 3X3UA 2OMOA 2XM3A 1WOPA 3WC2A 5E41A 4P44A 4KPYA 1FRHA 3TZZA 1IBCB 2ASLA 4NZ6A 1QMUA 4USWA 3QIDA 3MD1A 3D4JA 4U7CA 2JEFA 3EXNA 2FJDB 1YIJS 1SIWB 1Z1ZA 3SEOA 3D4UA 3Q83A 2PR1A 2EG2A 2VFUA 4BC7A 3VR1A 1RAAB 3VAHA 4BDPA 2GCFA 3J7Z5 3QZ7A 2GQCA 2HHTA 3N6MA 3FCWA 3V6DB 2MJUA 2FJWA 3H5XA 2BACA 1K9MT 3MECB 4OYBA 4ZBGA 5KG1A 4U7UD 4CAXA 4AXIA 3CCTA 3HVAA 1XFOA 2YNDA 4NLRA 1RWOB 3I9SA 1W2BR 4MKAA 4OJ3A 1DQAA 2EC2A 4DR7F 1NSQA 1HNXJ 5F49A 3QFWA 4UCNA 1U8WA 3QZ8A 2HIQA 4I2QB 3EGWB 2AFZA 3IG1A 4UY8T 1MROA 3CIMA 3FVYA 1LW2B 2J76E 1OYEA 1YK9A 3DLKA 3BO3A 4ZS6A 1HDQA 4PYAA 2Z58B 4NLVA 2Q4ZA 1MN9A 2KCWA 3M8PB 3T9YA 2CZ4A 5HLFA 2WPWA 1Z2ZA 3OL9A 1HNIA 5E5NA 1RBAA 1FWKA 3NH5A 2VF3A 3LWLA 4R3KA 4X84A 4AQYF 4DL7A 1BMQB 1APSA 2ATCB 1RTIB 3M8ZA 1U45A 1FFSB 1BQNB 1KDNA 3D7SB 3MDFA 4DCPB 1R0AB 2C6PA 3DLEB 5B0CA 3KMQA 4WK1A 3S9LA 5DWMA 1T03B 4DU8A 1EQMA 2ZNYA 3HVTA 3HT0A 4KOXA 3UNYA 4K8RA 8ATCB 4JBCA 2J6SA 1Y5NB 4C8ZA 4PSXA 4DHVA 1OMSA 3T5KA 2E9RX 1JLCB 2DH8A 4RW7B 3MAHA 2WYRA 3FRYA 3HHNB 4HDGA 1FVSA 4MRIA 4FVMA 2OB0A 4IFVB 4BCAA 2AE6A 3G9CA 4KUAA 1N48A 4IG0A 2V94A 3SBMA 2IYIA 1FX2A 3OR2B 4DR1F 5F8IA 4L3NA 3TAMB 4W9YA 4F0MA 4R57A 4AB7A 4UUXA 5E3PA 3QBCA 5HMYA 1U1LA 2B5JA 4DR3F 3WX4A 1HNWF 3TOQA 3R6LB 1TL7B 2XI3A 2Q6CA 3SXLA 2BE2B 2Y8WA 4JOUA 3EYZA 2ZZMA 1X12A 4K50A 1M4DA 3KDNA 3I31A 1CEZA 1R6YA 2ZUAA 1VQPS 3OLAA 2KZZA 4RU2A 5CA5A 3UN2A 3JTOA 3BSOA 1XMTA 2PIYA 2NXCA 3OD2A 1RBLA 3TWZA 5K20B 4M5IA 1GK8A 1FE4A 3AFGA 4QYRA 4FYVB 3H4DA 2V9KA 2MMYA 1Y5IB 2XEFA 3DU5A 3CTRA 4NRUA 2E9ZA 2PJ8A 1JLBB 4G1QA 1KUYA 1G6BA 3M8SA 3BBCA 2W7PA 2R2UA 2JLEA 2B43A 2GVDB 4A8OA 3BREA 2ZE2A 5GVQA 4UT4A 4MYUA 4JI0J 5GAHU 2JZ5A 3HHLC 1JNZB 3LGMA 4Q7AA 2HHHF 4F3MA 1X10A 2GJ2A 1U6FA 2ILZA 5F3TA 4JV2A 4R76A 3ENVA 3DRPA 2VZ9A 3OL6A 1FESA 3K2KA 2HVZA 5RUBA 2YKMA 3MR6A 5M2UA 3LACA 2ZHOA 2PJ0A 2ERRA 2CG8A 3LWUA 1H2TZ 4M5NA 1SH3A 3UN3A 1HD1A 5DJBA 2R7UA 1ELLP 3RB0A 2HZCA 3A12A 1Q7YT 3C8YA 2DNRA 3OR1A 1RAIB 5L39A 4Z7CA 5BJRA 4MCQA 3OBIA 3GZ7A 3C16B 4KQZA 2BKPA 3GYXB 5HBMA 4LF6J 1QAJA 4R5PA 4ETXA 3HZGA 4C0OC 4F0HA 3RTVA 1IVZA 4DV4J 5FLXU 4Q45A 5LMUF 3C66A 2G9OA 2MQ8A 2MKHA 3BV8A 1B4SA 4LF8J 1VI7A 1MLAA 1AZSA 2YH0A 3S9NA 4ZPCA 5A8KB 1HLWA 3ENWA 4LUAA 3QGGA 2YX1A 1TMJA 4JI5J 3NBPA 1JXLA 3NOGA 2ZOFA 3BI1A 4CO4A 3PRDA 5JVGQ 1X0PA 4C0BA 3IBFB 2YNGA 1RT7B 3NGUA 1A0OB 5ETSA 1EP4B 3PB8X 2YH1A 3OLBA 1FKOA 1NAQA 5FDLB 4JUZA 3PKYA 3M2RA 3M8QA 5IC6B 5GAHI 3CB4A 1Q8LA 3H2VE 2OD6A 1KR4A 1KWMA 1X4DA 3PW2A 2RILA 3SI2A 1XNQF 3M05A 3HSJA 1R8BA 1SV5A 3NS5A 3R9LA 3J7YU 1R7IA 2Q7BA 1CLFA 1SJRA 2QVPA 4NLSA 1RTHB 2K7JA 2V4QA 3PIPQ 3M1VA 1YLEA 4OMEA 1TELA 2XC9A 2LQ5A 1A2ZA 4WU2A 1D0EA 4KGXB 3OFGA 2PJAA 3G8WA 3MOZA 2Z3MA 1B99A 4QIWD 1DRZA 4DV7F 2PJ7A 3D7DA 1TP7A 2VIHA 1PUAA 3UD4P 2ZXVA 4QR2A 5LXRA 1RA6A 2IMWP 3OTEA 1TIQA 4P2MA 2I38A 2VBXA 1FDDA 1GXTA 1TL1B 2CQBA 4PXEA 4GO5X 4UOGA 3QPIA 4DL4A 2ZC3A 2K7KA 2ZHAA 4UIBA 4KOWA 4FF3A 1X0FA 2GO8A 3ZZOA 4DFMA 2ROPA 2LEAA 1B0TA 4KO0A 2CNSA 4WWSA 3FK4A 1ZAXA 2QL9B 1DBDA 1YMEA 2P6GA 3GB0A 2JEJA 2MLYA 2B9YA 3SFGA 1IKWB 1SC1B 2AMCB 4JYAF 1X4GA 4TY8B 1X9SA 2C27A 4CGNA 4X66J 9RUBA 1S1XB 3D0GE 4KBIA 3JVNA 5ISVA 3PYGA 1KNZA 1CQNA 2VG7A 2XSJB 4OZ2A 5FLXY 4OHYA 4ELUA 4QIVA 2VPXB 4ZCLA 2YX4A 3VCDA 4ZKAA 3D8PA 3I0SA 3D6TB 1DLOA 5D0RA 3LP1A 4ILMA 2CDQA 3AODA 4X5KA 3NWGA 1SI9A 4DJBA 2R7WA 2ALZA 4IQXA 4NRTA 4P4DA 6FD1A 3NEKA 4X2BA 4HNYB 4O4RA 3J7YI 4C8LA 4LF5F 4RNFA 2DRBA 4H4MB 5H86A 2D41A 5DO2A 3HHLA 5IB0A 2I3CA 4BINA 1JLQA 1YX2A 3IWLA 2RDDA 1S0MA 4F4ZA 2CUYA 3PW0A 4OP4A 1QQ9A 4ED8A 2OPQB 2W2NP 4KGKA 1S6OA 1C0UB 1CS4A 2OP5A 3SDEB 3MGDA 4ED5A 4NMLA 1R8AA 1N71A 3R2CJ 1R89A 1Q1KA 2R7SA 1YVKA 1ZA2B 3BN7A 4U5YA 4QBJA 2WBMA 3QT8A 1WORA 1VQLS 1SB6A 1TL5A 2EUIA 4LQGA 3MM6A 2YXLA 4WFZA 1UVIA 3RRHA 4ZVSB 3KLVA 1KKHA 2AD9A 4KLWA 4MFJA 2LU1A 2G0IA 3LUYA 3CMQA 3JB9k 3TTHA 4P73A 4RW6B 2ZBCA 2LDYA 1OSDA 3OTOJ 2FLPA 4CGMA 5DDQC 5D8HB 5IQ6A 1FRXA 2R7RA 3NA6A 1PO6A 2ZW4A 4WFNQ 5C88A 5D8NA 3EGZA 5KG5A 2PD1A 1Q2CA 3TI0A 3B3TA 2CG4A 1R27B 4PXDA 5AJ3J 4IG3A 3EFAA 4DSKA 4QW8A 5DLGA 3TQ1A 2Z10A 2J0QD 1VBZA 3D0HE 4USKA 2BBEA 1ZETA 3WC7A 3K5MA 2AV5A 4IR9A 4KGZB 3QLHB 5C42A 5IT9U 1CJUB 3O44A 1IBKF 3KDOA 1FT8A 4HT7A 2HRYA 2KYXA 2ILYA 2PVVA 3BGFA 1A7GE 4CLZA 5L8RC 1S49A 3TZXA 1XQIA 4KAIA 1RA7A 3N7ZA 3OTDA 4J9KA 1E6YB 4QU6A 1VBKA 4DG1B 4I6AA 5IB9A 2Q0YA 1VQ6S 3CCSS 3B4MA 4NJRA 2KJVA 1KLMA 1RE1B 1JWQA 2HSEB 1RWPB 2AEMA 2HPUA 3M2UB 1GTHA 2KRBA 2V8DA 3KR4A 2IAJB 3K89A 4UEEA 2EVZA 2ARHA 4WP3A 5DDRC 4ANEA 4CT9A 3RGIA 4C7IA 3MN8A 3M32A 4RZRA 4DPUA 4M8LA 2RVJA 1B7FA 1I51B 3K17A 3TYTA 2V63A 1PC4A 1RABB 3FSIA 2GNKA 1Q95G 2W7OA 1BC6A 2LA6A 2XNQA 4OL8A 3LGHA 1N88A 3HI9A 3V8IA 2V8GA 4KOTA 4HACB 2MQQA 4A38A 1NDCA 5LL6d 3J81j 5KTCA 1Q86T 2WSAA 4F2SA 1KQSR 1FTCA 4YB5A 4RBVA 2V69A 2HHXA 1RKJA 2MZTA 2XG8A 1RAJA 2UU9F 1RT4B 5DS0A 1SC3B 1WKKA 2CNKB 5HROA 2PO4A 3WBZA 5DG8A 2RDJA 4OLLA 4FDFA 4MHYA 1ZPVA 4OX8A 1AFJA 1LEOA 3CCES 1TL3B 4WFAQ 3PO4A 2KH9A 1T8EA 3H7HB 1Q16B 4J9RA 2XY6A 1T0TV 3MFHA 4ZY0A 3DGVA 2VJUA 1VJWA 5L46A 3RB3A 4G3IA 4NCBA 1S79A 2DEIA 1S1WA 2MSSA 3JSBA 4NCGA 3HJVA 3TUZC 3BH7B 2MKCA 3NCQA 4CO3A 2EXUA 2JOQA 4MIBA 1WC0A 5E96A 1GHEA 1YQEA 5KFNA 2VFTA 3KUHA 4F36A 1ROFA 1C1BA 3Q8YA 5KFUA 1KFDA 4ES1A 1CP6A 1IIDA 2CXEA 1I94J 1HNZJ 5IT9Y 1Y4ZB 4U8YA 3K9UA 2PC1A 1S7NA 4WFBQ 2MB0B 2EBJA 2O01C 1SH2A 2ACMA 2DD8S 3B54A 4NL5A 2M4MA 3PDNA 2FJXA 2OZHA 1CC7A 1MW7A 4S0MA 1SJ1A 3G4SS 2WVFA 1Q82T 4IOAQ 3QWPA 4URQU 1T05A 2IC3A 4DV6J 1YX0A 3WIUA 2UXDF 2V2ZA 4DPYA 4TU7A 2W7AA 3TVZA 1KS2A 3MCMA 3U02A 2AFOA 1MWZA 2I79A 1Y0YA 3OUYB 2KXNB 1GFWB 1HNVB 2Z3KA 4B3OA 4F9UA 1N0UA 2DGWA 3W7BA 4MHZA 1U09A 2DHGA 4X3RA 2AF6A 1D1UA 2EW9A 1NSKL 3B6BA 3PBBA 2B5GA 2VG6B 3IWXA 4CH1A 5KTAA 1YBTA 2WB4A 3R7BB 3D7HA 1WWZA 4WXWA 1T11A 2UUWA 4FXWA 4NLOA 5D6GA 4KSAA 2OZUA 3R7SB 5LRGA 2MTLA 2YNHA 7AT1B 3QGHA 2NCKL 3T1HJ 4CAVA 3NMRA 4GRSA 1RT6A 2PMZD 4RUHA 2D4PA 2VD3A 1VQMS 3BDPA 1MJAA 5JGFA 2VASA 4CGPA 4JI4J 4Z2XA 4Q5VA 1A9NB 2VOOA 5HL7Q 2H54B 3SSSA 3WIVA 3IIBA 5F46A 3KHXA 2ZH3A 2D9PA 3G96A 3JSMB 1GT8A 4LF2A 4FD4A 2RFHA 3QO9B 2MKJA 2ZH9A 4HKFA 2V2KA 4OFZA 3S6EA 5JM6A 4L72B 1FO1A 2DGXA 5LJ5Y 5HVFA 3EVWA 4DUYF 3FMCA 2QC3A 1YJWS 3SXOA 3FZ2A 5KFLA 4RUBA 4K0KJ 2IVYA 1BD6A 3I0RB 1E6VB 1TKTB 4QWCA 4G65A 1HQEA 5K8OA 4HTJA 4P52A 3CVKA 3TFYA 2REFA 3A1YG 2DY1A 8CPAA 2ZJQQ 4M63A 5LYDA 4LSZB 4ORFA 3K5PA 4CYNA 2XI2A 4B3TJ 4H2KA 2RMLA 3M7VA 2KT2A 4AYBD 2EVNA 3OV7A 4V1Ak 1GXUA 4FNIA 2BO9A 2HAIA 5G20A 3PB6X 1WG5A 4NXMF 1SC4B 4TWEA 1ZG8A 3VZHA 2XMVA 2E5GA 1UJ6A 4DQIA 2V50A 2ZC4A 2K5TA 4GM5A 3PZJA 2Z3PA 3NE8A 4I2PB 4ICLA 4W98A 1JJ4A 3VGVA 3DOLB 3LW5C 1MU2A 3UI3A 2CWKA 4JYWA 3ENQA 1I1DA 2DITA 3A8IA 4OKOA 3GYAA 2IRYA 3QT5A 2E7VA 2IYGA 2PJCA 1N52B 1YHQS 3G6ES 3D67A 3HD2A 4NZ7A 3CCRS 1GMWD 4ECWA 2XNRA 3M8RA 4R0JA 2R8KA 4P6YA 3SJGA 5AE2A 2PI4A 2D3UA 4F4WA 4U95A 3MTKA 5D0GA 4LFAJ 2HQ3A 2O53A 4OIWA 3DMJA 3QATA 4KSEB 3FFIB 1YKWA 3EX7B 5ETNA 5BYRA 4JI7J 1X9WA 1SKWA 1XWLA 5HP1B 1QDUB 1N34J 1TU0B 1HR0F 3M2VB 4LFCJ 1R8PA 4X62F 2NYHA 3TUJC 4YFJA 1RTJA 5KT2A 2O67A 5KTQA 2DNYA 4I56A 4MT1A 3KLFA 3N01A 4LVNP 3CCQS 2RNEA 3OTCA 2LQJA 3GLJA 4OI0A 2BR0A 2I0XA 4YRHA 5DGBA 5AG5A 4TYAA 4IO1A 1LXJA 3MR7A 4HEA9 1KONA 2LMIA 2W9CB 2W1BA 1TFYA 1JWWA 2R9LA 4ELVA 2XEIA 4MHPA 3A8JA 4EUVA 4FYYB 2AHOB 1NHUA 5DM6Q 1IYKA 2LXIA 5IFMA 4GKKJ 2ZELA 4PWDB 1REVB 3PX6A 2HNDB 5DWNA 1PG5B 3GU0A 1V6HA 4X4NA 3WDOA 1RB0A 2YGWA 2MEWA 4RS2A 3M30B 1S1TA 4USIA 1NJZA 2QV6A 3KASA 3KJQB 1ARMA 2HFZA 4EWTA 4M5GA 1RLDA 4XPCA 1DTQB 3VWSA 1F0XA 2JSXA 5L1KA 5B0DA 1O51A 3VAFA 4O3OA 2ZEJA 4ZK7M 2Y0BB 4F0XA 2KI2A 2M8DB 4KOUA 3FCHA 1Y3KA 3SXNA 3CZXA 4OYOA 4JXRA 1VRTB 3S1TA 4CAWA 1IBLJ 2Z8QA 1FJGF 4YB7A 3EXYA 3KLHA 5IT4A 3A3NB 3LP2A 1H73A 4DFJA 2Y3YA 2X1FA 2O1PA 2OPPA 3WZ0A 5CCMA 3UW1A 1H74A 5HAOA 2GQ2A 3SYZA 4UZBA 1QTNB 2OTJS 2QGFB 4HH0A 5HMNA 1Q2DA 4DR7J 2UXCF 1X4AA 4C6AA 3N6NA 1UZDA 4FBEA 1XEBA 4IHMA 2QSFA 4J90A 4QBUA 4QCLA 2D3O1 5ELYA 4M5JA 4WP9A 1NK9A 2M8HA 1RWUA 1Z5RA 4ID5B 2Y1JA 4EI2A 1VQYA 1L3UA 2X3DA 3W1YC 4CGLA 2L9DA 3DYAB 3DR8A 3PB4X 3P8BB 1LWCB 1M4IA 2FC9A 1LQ9A 2YX7A 2R8VA 2DIVA 2I00A 3RBEA 2W24A 1UZHA 2R8GA 1YSJA 2EFGA 1GAOA 3UDCA 3T8WA 3OT9A 3NGDA 4M5KA 3Q22A 2GMJA 3V5RA 1CPZA 2U2FA 3NCRA 4R3LA 2AWZA 3KLIB 5KFPA 2DR7A 4OC5A 4NGNA 4USVA 2J6UA 4NXNF 5F3ZA 4LIWA 4ZPBA 2BQUA 2HQIA 4R0EA 3MEDB 2XEXA 2GV1A 2V4JA 3SV3A 1FD8A 2GIVA 2M70A 2DB1A 3KTQA 3SHPA 3IXQA 1WHYA 3F0AA 3QRQA 3T5LA 1UEVA 4KUBA 1FCAA 2ZBRA 1FNOA 4F25A 1Q5VA 2W25A 1FKPB 4YN3B 5I4MA 2RKIA 3SQOP 1U6ZA 3CJ2A 1B0PA 1TK0A 3FBBA 1S7IA 4P72A 4Z65A 3BO2A 3AHPA 3B78A 3DCAA 4Y2AA 2FY8A 1QTMA 1QLNA 4A8MP 1RACB 2B9WA 1KN6A 3BZQA 4FS2A 2BXJA 2X1GA 4OZJA 4DR1J 4E0AA 4K4WA 5EUHA 1Y7RA 3WABA 2VH7A 2MY8A 2FLLA 4DL0C 1Q53A 1G1XA 2EWHA 4OV1A 3UCZP 1BLUA 4DR3J 1HNWJ 2RAQA 4CWBA 1B6BA 2FL4A 1RLCL 3ISND 2J9DA 4NLGA 4ZPTR 1RBOB 5J1PA 4NZ0A 1JJ2R 2PJ9A 4KR0B 5DG7A 2KHCA 3BPSP 3H42A 1PYTA 2MLZA 4H4OA 5J2NA 2OD4A 3E51A 1LNQA 5KFJA 5CHCB 4KHPF 4IR1A 3DLGA 5DQHA 2JVOA 4FYXB 1PBAA 5KG4A 1UVLA 1BOBA 3H2UB 4QWAA 4UCMA 4K2XA 3F0NA 1YWXA 2HBYB 4QYZJ 2CQ2A 1HNXF 4OI3A 3UCUP 5F8MA 1U1RA 5CBMA 1P0HA 3VGUA 1ELMP 3B3VA 1S6PB 4OMFG 2MKKA 1FK9B 4RBTA 1N56A 3OJSA 2DT9A 2WVCA 5EHHA 2HUZA 1ZO0A 2GGPA 1BPMA 2D9OA 1I6JA 4BC9A 4KHMA 2DHHA 2LLZA 1XERA 4NA1A 1B87A 1I21A 1C0TA 2P5VA 1O0PA 1TKHA 3WR7A 4ITSA 4HYKA 4ID8A 2JFDA 2BOAA 3FQKA 4LR9A 5THWA 2AJQA 1RDRA 1VRUB 2IM0A 4W92B 4KZTA 4TKTA 2B4VA 3LANA 3W3SA 1U1QA 1QSMA 4Y2KA 3G3SA 2CPHA 3TEHB 3L4BC 1F2HA 4OYMA 3DDIA 1CC8A 1HBNB 5E7OB 3MEKA 3HK2A 5IQQA 5J8FA 2CJYB 4M6IA 1L3KA 4NI2A 2J8NA 1P9QC 1RXTA 1TK5A 1GX5A 4OHXA 3H8YA 3CDXA 4CYUB 1BO4A 3F44A 5ITHA 4WTYA 2ACYA 3S7RA 4USTA 1IICA 4WZQA 3R8YA 3RBDA 1OY6A 2G1HA 2LEBA 1ZLIA 3D6MB 3SJEA 3G6VA 4NCAA 3V4IA 4ZN1A 2DBBA 1U49A 3F41A 1WEYA 3KKFA 4WJBA 1F9FA 3ZZRA 2DNGA 3QWUA 4IDKA 2UVRA 2IJNA 2Z2MA 1IR1A 2JLFA 3HCXA 4P4JA 1N5YA 2VQFJ 3D5MA 3FF3A 2QYCA 5FIIA 1RT3A 2YWKA 1MJBA 2CVEA 2VFSA 2J9EA 3Q86A 1OWXA 2MGZB 3VHQA 4KVXA 3CD5A 2D69A 3MEEB 1HKAA 2RD5C 2UUBF 4OYPA 2DGUA 2M9KA 4X4SA 4A30A 2SXLA 4URGA 2V4RA 2GFFA 2N4CA 2FVSA 2OJ3A 2RHQB 5ETLA 2RQKA 2K06A 2VZZA 2M3DA 2A18A 2Z56B 4ZVQB 3P3DA 1YJTA 4DBQA 4II9A 3PJXA 2EFPA 2YWHA 4ZLNA 4F3OA 1X8DA 4F4AA 1YLXA 2DGSA 1TMMA 1ZM3A 4PR6A 4FWUA 1TFWA 1DTTA 3IM8A 1YRTA 2I5JA 1EHWA 1FEEA 4JI0F 2NZCA 1ZLHA 1WC1A 2HZVA 2RF2B 1YRUA 4LBHA 4IRDA