1R3NA

Crystal structure of beta-alanine synthase from saccharomyces kluyveri
Total Genus 151
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
151
sequence length
438
structure length
438
Chain Sequence
GTLNLPAAAPLSIASGRLNQTILETGSQFGGVARWGQESHEFGMRRLAGTALDGAMRDWFTNECESLGCKVKVDKIGNMFAVYPGKNGGKPTATGSHLDTQPEAGKYDGILGVLAGLEVLRTFKDNNYVPNYDVCVVVWFNEEGARFARSCTGSSVWSHDLSLEEAYGLMSVGEDKPESVYDSLKNIGYIGDTPASYKENEIDAHFELHIEQGPILEDENKAIGIVTGVQAYNWQKVTVHGVGAHAGTTPWRLRKDALLMSSKMIVAASEIAQRHNGLFTCGIIDAKPYSVNIIPGEVSFTLDFRHPSDDVLATMLKEAAAEFDRLIKINDGGALSYESETLQVSPAVNFHEVCIECVSRSAFAQFKKDQVRQIWSGAGHDSCQTAPHVPTSMIFIPSKDGLSHNYYEYSSPEEIENGFKVLLQAIINYDNYRVIRGH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords beta-alanine synthase
publication title Yeast beta-Alanine Synthase Shares a Structural Scaffold and Origin with Dizinc-dependent Exopeptidases
pubmed doi rcsb
source organism Lachancea kluyveri
total genus 151
structure length 438
sequence length 438
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 3.5.1.6: Beta-ureidopropionase.
pdb deposition date 2003-10-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01546 Peptidase_M20 Peptidase family M20/M25/M40
A PF07687 M20_dimer Peptidase dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.360 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1r3nA02
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 1r3nA01
3B7IA 4MHZA 3H8FA 4NJRA 1XMBA 5IB9A 3D4UA 4A37A 1CP7A 1EE3P 3KASA 4TWEA 1PCAA 3BI1A 4UF4A 4YU9A 2PRQA 4H2KA 5K8NA 3NH8A 1CP6A 1YMEA 2IMOA 3IO1A 3WABA 2ZEPA 2PCUA 2PE3A 4OC0A 2IJZA 2C6PA 4MHNA 3DGVA 3GB0A 3IJ3A 3KHXA 2ZEHA 1BAVA 1GYTA 1FT7A 2PJAA 2PJ8A 1CX8A 3PFOA 3FJUA 3H8GA 2ZOGA 3RZAA 3CPAA 2AFSA 2ZELA 3FX6A 1TKJA 2PJ5A 3ISXA 2PIZA 4YWYA 4UEFA 1UWYA 2XEJA 3BI0A 5I4MA 5D8NA 4TNUA 2C6CA 4EMEA 3QNVA 1KWMA 4IHMA 1ZG9A 3B3SA 1VIXA 4BD9A 3BHXA 3D67A 3SI2A 3CDXA 3WC5A 3DLJA 2G9DA 4P44A 4P4JA 3B3VA 5THWA 3SJGA 4K3NA 3B2YA 1Q7LA 3PB9X 4UEZA 2EK8A 2PJ4A 4A38A 3B35A 2Q43A 2RB7A 4OC2A 3SI0A 3FECA 1XJOA 2HC9A 2V8HA 1VHEA 2C1CA 4Z65A 1Y7EA 5CBMA 3T8WA 1F57A 4W9YA 2ZEMA 4O23A 4R76A 2PIYA 2OOTA 4PXCA 4ZY1A 1CG2A 2Q51A 4R7MA 1M4LA 4ZX9A 4A39A 4AXVA 3L2NA 3KQXA 4JYWA 3PB7X 5LRJA 4FUUA 2PJ0A 4IK2A 5D29A 2PJ6A 2V8VA 3H8EA 3RBUA 1R43A 5JGFA 2PJBA 1XBUA 1ZG8A 2V8DA 3KHZA 3MRUA 4MHYA 4EFDA 3D66A 3KZWA 3CPXA 2ZENA 3D7GA 2ZEOA 3SJXA 4MRIA 3KI9A 4FWUA 3NA6A 2ANPA 3D7FA 2GU2A 3K9TA 2WZNA 3KR4A 4JZ0A 4PXEA 1CPSA 1F2OA 1ZG7A 3RAMA 4MHPA 4P4IA 1ARLA 3WC7A 1HEEA 1BPMA 4P4BA 3LMSA 2XEGA 3LWUA 1CPXA 4ZYQA 3JRUA 5LYDA 5JH9A 2RFHA 4OKOA 2PJ7A 3IFEA 1BPNA 2ZEFA 5HXDA 1AMPA 4OMEA 5F09A 4WWVA 4ZY0A 1RTQA 3CT9A 4IAVA 2GLFA 2PJ9A 1IGBA 2EK9A 2F8HA 1ELMP 2AFZA 3SJFA 1XRYA 4MCPA 4PQAA 4UIBA 4OP4A 3FVLA 4UEEA 4DYOA 5LRKA 2PVWA 2DEAA 3KQZA 1DE4C 3SJEA 2JEWA 5K8MA 1LAPA 2V8GA 2JBJA 1F2PA 1ZLHA 4FBEA 4GM5A 3NH4A 4OC1A 3D7DA 1HDUA 1BLLE 4F8ZA 3WT4A 4OC4A 1FNOA 3SI1A 3NH5A 1YLOA 2HB6A 4NGTA 2AFOA 1ELLP 2I3CA 1QMUA 1TXRA 1LOKA 4NGNA 1VHOA 3I1UA 4X2TA 3VARA 3B3WA 4MCRA 2QVPA 3B3CA 1HDQA 2FVGA 2POKA 2PJCA 2QYVA 5K8OA 3KGQA 1LFWA 2V77A 2PJ3A 3D7HA 1XFOA 2J9AA 2ABZA 1TF8A 3PB8X 3IEHA 4FAIA 5LRGA 4NGQA 2BCOA 3PB6X 4Q7AA 1OBRA 4KSIA 3TX8A 2GREA 2XEFA 1NSAA 3B3TA 2EWBA 4NGPA 7CPAA 4OIWA 1ARMA 2C6GA 3GUXA 4CPAA 4EWTA 1PYTB 4MMOA 4MCQA 2AFMA 4P6YA 3FH4A 3PFEA 2CF4A 3GLJA 3TC8A 2BOAA 4P4DA 3PEIA 4LQGA 4X3RA 2WYRA 3FF3A 3PRTA 3V38A 3V7ZA 1AYEA 4NFRA 2Q4ZA 5DS0A 4ZX8A 1YW6A 2ZOFA 3WC6A 8CPAA 2F7VA 5LYFA 2PVVA 1IY7A 4OC3A 5HVHA 1Z8LA 2NYQA 2VL1A 3IIBA 5ELYA 4ONWA 3S9LA 4ZI6A 5LYIA 4DJLA 1TF9A 2GLJA 4PPZA 1CBXA 4WJBA 4MXUA 2AFUA 2BO9A 1YW4A 4UIAA 4PXBA 3HUVA 3S9NA 6CPAA 1DTDA 1TKFA 3HLPA 3PBEA 2JBKA 3ISZA 4F9UA 3PBBA 4B6ZA 1Z2LA 1YSJA 3NFZA 1H8LA 3VATA 4DUKA 3FEEA 2IQ6A 4NJQA 4R6TA 2CTBA 1ZLIA 3IC1A 3MN8A 2CIJA 4G1PA 1Y0YA 4X8IA 3BXMA 5HVGA 4ZY2A 3VH9A 2ZEGA 2ZEDA 5J1QA 4R8FA 4P4EA 2PJ2A 1LAMA 1LCPA 2ZEEA 3D68A 5LYLA 5K8PA 4A94A 1R3NA 4NGMA 2O53A 2O4HA 2XEIA 3K2KA 4OIDA 4RUHA 4PXDA 3S9MA 1LANA 3KL9A 4P10A 4MCSA 5JM6A 2PJ1A 3KR5A 2NSMA 3N5FA 1TKHA 5HVFA 5CPAA 4NGSA 1JQGA 4P45A 3FEDA 3FMCA 4NGRA 2CTCA 4OC5A 1QQ9A 1Y0RA 4F9VA 2AFWA 3IWWA 1Z5RA 4P4FA 1VGYA 3PB4X 2OR4A 2QJ8A 2AFXA
chains in the Genus database with same CATH superfamily
1SJ4P 4JI1J 1WHWA 2CJYB 2YNFB 4H4MB 2Q4YA 2FC8A 2WPWA 4TWEA 1R6YA 4ZVQB 4OI4A 4J9UE 4O3OA 2Q7BA 3PGPA 1RISA 2YY3A 4DWIA 1HD1A 4I49A 4X4OA 2BR0A 3IJ3A 1TUVA 2ZEHA 4ZPWR 3HD2A 2AP6A 1R89A 1N5QA 4HH0A 2HHWA 1R8PA 2QEXS 3QIDA 1QAIA 3DLEB 4NMLA 1UA1A 4M5HA 3MF5A 2DKOB 4JI3J 4UEFA 3GIMA 4EMEA 3HHNB 4BLGA 2A1BA 4PG4A 1UPPA 2H5EA 3PRDA 4RZRA 1S0NA 5K14B 3M6XA 2BACA 1YVKA 4ICLB 1WI6A 2UP1A 2ZH8A 3FMBA 2ASJA 3QBCA 1QSTA 2DISA 4LSLA 2W2OP 4WTYA 3EX7B 3OJUA 1QVFR 1T05A 5B0EA 1FKPB 2X3GA 1Q7LA 2CQIA 4MKVA 2EK8A 3W60A 2RSQA 2WW8A 3G86A 2HLTA 6AT1B 3IWEA 2QX0A 2OJ3A 5DLGA 5B09A 2MYFA 3AODA 3TP2A 5AJ3F 2QA1A 3OUYA 1DQ9A 1EQ0A 1S7KA 2HHPA 4CNYA 5JQ4A 2YNIA 3AA9A 4CM0A 4ZX9A 5HATA 4DQIA 2HGLA 3DM2B 5D3GA 3IGVA 4C7IA 2PJ0A 1YIJS 1GXUA 2H5MA 3I3GA 1KUVA 1Y0HA 2JEIA 1U2CA 1Z9UA 3GQCA 2PJBA 3DMJB 1ZG8A 3UCUP 3CPXA 3ZZUA 4ZP7A 3MCMA 4MRIA 5D4NA 4N56A 3QSIA 3KI9A 2M5YA 2BKNA 4P9SA 4JD6A 5KFZA 5F8NA 3UNYA 4OX8A 1XE4A 2VZ9A 3FXTA 4DSLA 5A8WA 1LOUA 4OMFG 1ELOA 3CXQA 3IR7B 3W2WB 3EVMA 4N7TA 3LMSA 3D2PA 1CPXA 3W7BA 5KFDA 3MFHA 4OKOA 4PK3A 3I9V9 4RBTA 2M88A 4OLOA 5KT3A 4WWVA 4ZVSB 3CT9A 1RTHB 3SFUA 4HKFA 1S48A 3F41A 4ZVHA 2B5JB 2DO0A 2C2RA 2MQNA 4W90B 3KHGA 2DYAA 3MMCB 3C6UA 2KFNA 4MY3A 4CLLA 4NEZA 2CJAA 4AG7A 4DSKA 5AE2A 2PVWA 1RT7B 1YBUA 2UVVA 1BY9A 1LAPA 2VONA 3QRPA 4D3HA 2JLFA 1F5BA 5KFNA 3S8SA 1TAQA 1U45A 3IR5B 4RWXA 1NHKL 4NLPA 2J0WA 4IR1A 1BWEA 1ELLP 4QYRA 1JWWA 3HP6A 2DPTA 2HBYB 1UVLA 4C3MA 2VBQA 3R9LA 2AJ0A 1X4GA 2HRUA 2MLXA 3PVXA 1N8RT 1M90T 2V77A 4DV0F 2P6GA 3D7HA 2J0SD 3TZXA 4P2XA 5E96A 3GFXA 3D0IE 3DHWC 3KK2B 1WC3A 1HWUA 4WK1A 2FVCA 3RAQA 1OYEA 3UD5A 3SCKE 4Q7AA 1XMOF 3FMWA 5KFMA 2MDAA 3JQJA 3FVYA 2EC0A 3R7BB 3W9IA 3HVTB 2E5JA 5DM7Q 1IQZA 4ZCKA 1XC9A 2JHEA 1TFYA 1A7GE 2GQQA 5CYMB 5KT6A 1YI2S 2WOMB 2QIFA 4A4JA 3M6VA 2MKJA 5KG1A 1VQMS 4E0DA 3AJ1A 1M1DA 3PEIA 3CJ8A 3RAXA 3PRTA 1MMNA 2Q4ZA 3KK1A 4UOGA 3GU0A 3R95A 3LP0A 3PZJA 2GE3A 4I64A 2RRAA 2VPZB 4A8YA 1C0UA 2A6MA 2R7OA 3OHBA 3VWDA 1S0VA 4LFBF 4KVME 1S79A 4U8YA 4I67A 4UOFA 3ULHA 2FHJA 1RTDB 1S1WA 2UUWA 2FS5A 1RA6A 4F9UA 3FRYA 3GE9A 2ZJQQ 4C6AA 1LWCA 2FJEB 4Q8FA 2YNCA 1PKUA 1BC6A 5KG3A 3W64A 5J2NB 3CCLS 2Y3YA 1AT1B 4G1PA 3SQGA 5F9LA 1WD6A 1U8SA 4DSFA 1MMDA 4LR9A 5J8FA 1TQLA 5EX3A 3B6BA 1IJEB 4MKBA 2UUCJ 3FFIB 1SIWB 4B5PA 2KG1A 3SV3A 3TA0A 4C9DA 1FJGF 4ZDNA 3CXPA 2KCWA 2NSMA 1RAGB 4TVAB 1ZZNA 1T9WA 2FZKB 1WC5A 2FHKA 3FMCA 2AE6A 3PRVA 4MKYA 1B64A 3ZNJ1 4ZVFA 1TKZA 4NI2A 5GVQA 3E01B 4GXHA 2MKKA 4MKAA 4WKRA 3T5HA 1R0AA 1QM9A 2PR1A 4F4XA 1XIQA 1VCTA 4Y65A 3UW1A 2VBYA 2LKZA 3MM6A 1VQ9S 4CO4A 1CP7A 1VRTA 4UF4A 4HACB 3V2UC 3LACA 2L9WA 3NGSA 2MZRA 3D5MA 2BVZA 4CQ1A 4KQZA 1CJKB 2J8SA 2YWGA 4RBUA 2W2MP 4YFUA 4ZKAA 4YS2A 3MUTP 2GZOA 1FT7A 3VAGA 1CQMA 3BZQA 3BO2A 1ITPA 4EI2A 3R96A 2YTCA 3C15B 4K50A 4CO1A 3O1LA 4ZVGA 1Y11A 4RNOA 3A3PB 1OWXA 3MM8B 2JVOA 1LKZA 1LFPA 2JRSA 2FIAA 3BI0A 2QLJB 1N54B 5IV3A 1B7FA 4E0AA 4LF5J 2BV3A 1U1PA 3SI2A 3RU0A 3R2DJ 4FNHA 3WC5A 5AXMA 1UFKA 4JV0A 4PKDB 1S1VB 3VR1A 2CJQA 4A47A 2GAHC 4CCHA 3IWXA 4I6WA 1M5HA 4USWA 4UCMA 1XJOA 2IVYA 2QL9B 5CBMA 2HVHA 4CYUA 5D4LA 2K06A 1UVJA 3UCZP 1ZS6A 4HTIA 4JV1A 2QFIA 2CKWA 5KOWA 4R7MA 2B9XA 3CEDA 1R8BA 3J7AN 3DRRB 3M32A 3CCVS 3GV8B 2YKNA 4KKOA 3GKRA 3H90A 3A8EA 4F4WA 2ZC3A 3ZZPA 2IC3A 1UEKA 4AYBD 4K2JA 4PWDB 5JGFA 1UW4A 3M9MB 2Z2YB 3BQ1A 1XN9A 3OPKA 4F4KA 4A8OA 1M5SA 4DX5A 4FWUA 1RU2A 2GU2A 3RG6A 2WZNA 4ZGYB 4II9A 1CPSA 3BSAA 1IBMF 2UUTA 3VGTA 4CLTA 4JB8B 3RAMA 1JLEB 4P75A 4K30A 1VC0A 5HLFA 3CVKA 2MQMA 1JNRB 5ITHA 4U7UD 2VHGA 5GAGI 2E7WA 2ACMA 2CQ1A 1HHQA 1VQNS 4JV2A 4LRBA 3FGVA 2HHHF 2CPYA 1ZBTA 2BM0A 3GIIA 3ICLA 4U7CA 1KVKA 1X4CA 3QGIA 5GMEA 2YNFA 4H4MA 2NXJA 3I9SA 1GH8A 1PIEA 2B3VA 5AJ3J 1XNRF 3PIPQ 2XB2D 4NLWA 2Y9HA 4EO8A 1KNZA 2KFZA 2M7SA 2E7VA 2MQPA 2VQEF 3BKFA 3CD7A 3R5AA 2RDIA 3A8IA 2FC9A 4RW8B 5HQMA 2ZFHA 2XZDB 5C88A 2UXBF 4Z2XA 3L4BC 1Y7PA 1M1KT 3HDSA 2N82B 4KOUA 2F4FA 3BF4A 4P7TA 1VHOA 4P7VA 3EGZA 4GKKF 3B3WA 1D9AA 2AQ4A 2P6TA 1U24A 3DOMB 5K14A 2POKA 4ICLA 3HKWA 3FBUA 3NKYA 2W7OA 1VLOA 3HF5A 2PJ3A 3J80Y 4ECRA 2F3JA 2DBBA 2IM0A 2BW2A 2XY5A 1FKPA 4F4AA 3KNGA 4I6YA 3MEEB 5GMDA 3TJ8A 2R7RA 3RO0A 3KLGB 1X4EA 1H2TZ 2R8GA 1ARMA 2C6GA 2D9OA 1XOVA 2VQFF 4FZVA 2HHXA 2HQFA 5KFFA 5D4OA 2BOAA 3GYGA 4OV1A 1J4JA 3HX9A 1TZ0A 2XMTA 3DM2A 2E1AA 1Q7YT 3CZXA 2ALZA 3HPOA 3TRGA 2QIRA 1UTAA 2Q79A 2IMWP 1U09A 3DMJA 2O67A 5KG4A 4ZBGA 4TNOA 2GS8A 2HFVA 3W63A 3D3BJ 4WIIA 3AJDA 4Y2CA 1EETB 4Q36A 1WACA 4NA3A 4CO2A 5BYRA 4PEOA 4DL5A 5ETPA 5E3CA 1T9UA 3MAHA 2OTJS 4DV0J 3W2WA 1JLAB 2H5JB 5CCMA 4X4SA 3M8RA 3LAMA 1PAUB 1XMOJ 2P9GA 2VV5A 2FT0A 1KOHA 1RTHA 3H25A 3GWCA 2B5JA 5BJRA 1NNDA 1XR5A 4MCSA 1AUSL 3HSJA 2LEAA 3MMCA 2KHDA 1S76D 2CQGA 1O5JA 4OC5A 1RT7A 4DCPB 2AEMA 2RU9A 4RKUC 5E3QA 1SQEA 1WJ9A 4B12A 5KTDA 3RR8A 3C2PA 3HJFA 4P52A 1HNVB 3B7IA 1TKTB 4C2ZA 4LFBJ 4CGMA 2MY8A 4NSQA 4A37A 4F04B 1Q2YA 2C2OB 1BUXA 5BYQA 3R27A 3EZUA 1KTVA 3NNCA 2PE3A 4OIXA 1S7NA 1HQUB 2M3DA 3MCOA 3KHXA 3IBWA 1RWUA 4X62F 3KK2A 4HVZA 1ACMB 2IAJB 1NDKA 2ZVSA 2DNHA 2FY1A 1T8EA 4YWYA 3RW7A 3CJ3A 3HVTA 3TUZC 4U9ZA 2DNLA 2CJKA 1E6VB 1JK9B 5CYMA 5DETA 4ED7A 1T94A 2WOMA 4QJVA 2YNCC 3KKFA 1S9EB 4NL5A 1V5VA 1YHQS 4F50A 1FJGJ 3CDXA 2BE2B 3IAM9 4X84A 3AD8C 3FJ2A 2G9DA 2OFGX 3VVTA 4AL7A 3S6FA 1BLUA 4WZMA 1SL2A 3IBFB 2HKEA 4EGLA 2APOA 1KN6A 4MFZA 4LF9F 1RHUB 1FJ7A 4U8VA 2V8HA 2NCKL 3MCSA 1GMWA 4ANCA 3EYZA 2DH8A 2LU2A 4W9YA 4A8SA 1RTDA 1KDNA 2DK2A 2JFKA 1IVZA 2KRBA 3CCRS 3MPDA 1NK6A 4CRZB 1UVIA 4KGKA 5D29A 5J2NA 4TU7A 2V8VA 1Q8IA 2B4DB 2NSBA 4R5PB 4WP9A 4LF2A 1QAYA 2HFNA 4DX6A 4J9LA 5HQ8A 1TUGB 3ADAC 4KY3A 5KFQA 3A4TA 4LUAA 3FFIA 4C2XA 4OI3A 3OFFA 3TARA 1VK3A 3EXNA 1B7YB 4KOWA 2OD4A 2ZUAA 3RBXA 4KT0C 3IU2A 3B78A 2MKCA 1ARLA 1KEKA 2K7KA 1FE0A 2WCXA 2ZH7A 4USTA 4DPXA 3E01A 4A8MP 1JLGB 1K1QA 1JX4A 2FVPA 4OYWA 4DSJA 4KE5A 4IAVA 1DHMA 3NS7B 4HACA 4B9TA 1PG5B 3I96A 2R8IA 1FA0A 1SPBP 3BS9A 4IKAA 1CJKA 3GILA 2HQ3A 3BN4A 3NS6A 2XLIA 1QUPA 2WPXA 1OY6A 3C15A 1YZ6A 2EG2A 4FBEA 2RE1A 1RWWB 5K5MA 2GIQA 3GY9A 3L09A 3FZ2A 1P8GA 1SV5B 3QWPA 5JXSA 1BLLE 3LF0A 5KFVA 2C3MA 3SI1A 1YLOA 4NGTA 4K4ZA 5GAHU 4O3SA 3Q8VA 4U6PA 1FFWB 3VZHA 4CTAB 3BYRA 1T9VA 4ED1A 2XM3A 3AJ2A 3OTOJ 2YNHB 1IBMJ 3EZ5A 4AL6A 1FDAA 4R57A 1EZZB 5KFKA 4X4TA 2V4RA 3OXFA 4WIQA 3SCLE 1S1VA 2QMUB 2J9CA 2CZ9A 3QAHA 5KFWA 3PB6X 4ZLNA 2HYIB 4NZ7A 4K0KJ 4FD6A 4GKJF 3AHPA 4M5LA 5KG2A 3B3TA 2HHHJ 3FKBA 2V63A 1WNEA 4TU9A 4J9RA 1ZETA 2WVDA 1QAXA 4JYAF 3GCXP 2JX2A 4IH6A 3BBFA 2GX8A 1QSMA 4LF1A 2LQ8A 4PZVA 3TC8A 3QYYA 1S9GB 3L7PA 3DRRA 2LFVA 5HANA 5CABA 2VF3A 1PYOB 2LP4A 1SBRA 4ZPDA 4ZX8A 5CHCB 2BZ2A 1YW6A 2VBXA 2WVEA 3WC6A 4AFFA 8CPAA 3FC9A 2VQEJ 4PWDA 2NYQA 2VL1A 3G8SA 4YB7A 5IC4B 2EW9A 4I0WA 4M95A 2VOPA 4MJ8A 5F8MA 5A6WA 1G2EA 2UXBJ 3GYAA 3CC7S 5M2RA 1QE1B 1YW4A 4UIAA 4PXBA 1DTDA 3SFGA 2PRBA 4GKKJ 4E2AA 4XIUA 3OTBA 3J81Y 1JLEA 1UA0A 2HNZB 2PD1A 2CTBA 1ZLIA 4BDPA 4L3NA 3CCQS 2Z30B 2DO4A 4Y2AA 4LFCF 1LK7A 4P4EA 4JLYA 1LAMA 3D68A 2CNOB 2HGNA 4UUWA 3K2KA 2J76E 2XI2A 1SJ3P 4I56A 1SIZA 4WFZA 4EBCA 2PJ1A 1FDNA 2VQFJ 3JQMA 2EPIA 1T95A 4NGSA 4P45A 4TQRA 1X4HA 3IRXB 2L08A 4QZVB 1P0HA 3NP5A 4RW8A 1P1LA 4RNMA 2RQCA 3X3UA 2QJ8A 1K9MT 2OPRB 1FNXH 1GT8A 1KONA 3H8FA 3JQKA 4K59A 3KASA 1PCAA 2DR5A 4H2KA 3DOMA 3T41A 1CP6A 1N52B 4G65A 4CLSA 4X65F 1RLCL 2VH7A 4YHHF 2EO8A 1I5OB 5GAEI 2V34A 1N71A 1ZAWA 4HH1A 3N6NA 2FYXA 1S5KA 2AFSA 4WXOA 3KFWX 3BLNA 2VFTA 2BKOA 3MEEA 2GIVA 1H2UX 5FLXY 2I79A 1UFWA 4RPFA 5RUBA 3IXQA 2CJBA 3KLGA 2OUGA 4ES1A 3H20A 3R9FA 1KWMA 3MR7A 3JTKA 2IFXA 3SIPB 1HW9A 4MI4A 2L9DA 1NMEB 1PJ6A 1A9NB 4NZ0A 5AE3A 3D1OA 5L8RC 2D4OA 3CJ2A 3WZ0A 2FLOA 2MKYA 5KTAA 1T7PA 5AT1B 3JTPA 1MK4A 3G8TA 5B0GA 4EVYA 5LOQA 2VBWA 3TVYA 4EFAC 3Q8SB 1RCOB 1YGYA 4NLRA 4C2MA 4M1KA 1EETA 4CH1A 4XPDB 3GPAA 2PMZD 4PYAA 1S1UB 1RWOB 2QYCA 1N36F 1FRJA 3R1LA 3QT5A 3W5ZA 2MMYA 2PJ6A 1JLAA 3A9LA 5F0WA 2J8AA 3TEHB 1CVJA 2ZENA 2DIVA 5LJ3Y 3LWLA 2ATLA 1GMVA 2C1EB 2ARHA 1U6FA 3K2YA 3K9TA 4UY8T 4WFNQ 1N88A 3OTEA 4DFMA 4ECTA 2H65B 2BUEA 4ED5A 5DGAA 2PDAA 3NMAA 4QWCA 4WYLA 2NZ4A 3V5RA 2XEGA 2DRBA 3UO0A 3GIKA 1Y5LB 5HXDA 3PCOB 2ZEFA 3PM9A 1JMTA 4PPDA 3K89A 1HNVA 3B8HA 2PN6A 1TKTA 4LVOP 2PJ9A 4ZITA 2M52A 2F8HA 3GIUA 2REFA 3IG1A 3I55S 1SVDA 1Q95G 2DY9A 4C68A 4YGOA 3KMSA 1HQUA 4OYIA 1UVMA 2FZCB 3AH6A 1V0CA 3MWBA 3RR7A 5IXUA 2LXUA 1QUVA 2IAJA 2KTQA 1MSWD 3QQCD 3JSBA 1NPRA 2ADCA 4F26A 2FVRA 2OMLA 5F8HA 1E6VA 2O1PA 3T1YJ 4G3IA 1TXRA 3I1UA 2ASYA 2CG8A 2J7UA 3D28A 4MCRA 3B3CA 3B4DA 1S9EA 3SSSA 1SJQA 4CP5A 1T9YA 3HZGA 2BE2A 4ED8A 2GHPA 5L46A 1R6VA 2HS3A 4ELTA 1S60A 4FAIA 5J2QB 1TELA 5CA5A 3MPUB 1SH0A 1PAEX 3MGDA 2P6SA 2K3KA 3QIPB 2BQRA 2H4WB 3MR3A 3HFZB 4KPYA 1IOFA 2N4DA 2BE7D 3W9JA 2ZJPQ 2ZC4A 2OAUA 3GUXA 4MMOA 2G0CA 3CXCR 1HHTP 3DXBA 3AD9C 1ZM3A 3Q83A 1TIQA 3PW4A 1KUXA 2V2KA 4P4DA 3UD4P 1O0PA 2GA7A 2QLBB 1NDPA 4Z37A 3V38A 1RACB 2AJFE 5LYFA 2ZZNA 3AOCA 2GC8A 4OI2A 1Z8LA 2B4DA 2DGUA 3VWSA 4R5PA 1RAHB 1GAOA 1P1TA 2F8MA 4NMXA 3LGMA 2OZGA 4W92B 4UW2A 2K3IA 4WJBA 4DF4A 3MGJA 1HNXF 2I2YA 2HHTA 3M8QA 4P2FA 3AFGA 5F3TA 2A3JA 1M1GA 1O51A 4USUA 5C24B 3FRMA 1H8LA 4BCAA 2LQ5A 3ZO7A 5SZTA 2OH2A 1L3TA 4ZVEA 4IO9Q 3G82B 3MMJA 3VTIA 4X8IA 2V2QA 1JLGA 3ILIA 3I0SB 4UFVA 3KJVB 3BKTA 4E8OA 4GKJJ 4BWJA 4QQBA 2W25A 1H2VZ 4UT4A 2XMKA 4JYAJ 4PXDA 2ZHBA 3UFCX 5EDWA 3AOBA 3S9MA 2VUGA 3FSIA 4FS1A 2HQIA 1KTQA 1OQ3A 3KLIB 3V4MA 5AG6A 1VS3A 4NYPA 4FF2A 5DQHA 2OU2A 1NBEB 3VAJA 4UQGA 3OT9A 1U49A 2I38A 3IR6B 3EDRB 3HXMA 1XK8A 2DGXA 2MSTA 2PFFB 4DU7A 2OR4A 1AB8A 1SV5A 4F0KA 2J7WA 1DQ8A 2VFRA 2J9DA 2K1RB 1IBCB 2PI4A 2HSEB 3W61A 1YTYA 2DHAA 4MIWA 4B14A 4CTAA 3FQKA 4AVAA 1X0PA 2PCUA 1WG4A 2YNHA 2C6PA 4C2YA 4NLXA 2AJ1A 2HS4A 1BQMB 4Q8EA 2HAFA 1NH7A 2EI5A 2Q66A 3ELHA 3KNAA 4LFCJ 2ILZA 3KHHA 2R3VA 2IL4A 2H3EB 5ETSA 2BMBA 2C22A 4AG9A 4KFBB 5I4MA 5F8IA 4X4VA 2Z3LA 1UP1A 2GMLA 1KQGB 1S9GA 3LODA 3IRWP 1PGZA 3NGUA 4Y2MA 4P44A 1VQ5S 4IQMA 4K3NA 2DPJA 2PMWA 1TR0A 1CSJA 3AB2B 2DITA 2E5HA 2E5GA 4QR1A 2B9WA 4NF1A 3DOKB 3D1QA 2KXHA 5CZXA 3DR6A 1VBKA 5GMKa 1OJ4A 3CC4S 4UOCA 3NE7A 1U1OA 4I2PB 4JYWA 2BYCA 4RR5A 1FDDA 4YHHJ 1HBUB 1V5IB 4CYQA 2HNZA 3D6HB 4NXNF 5C2CA 4DXLA 5IFMA 4NEXA 3KLFB 1ZOTA 2B51A 4KGZB 5HMNA 4V1Ak 4NWBA 3Q22A 1U8WA 2YWKA 4LBHA 1ZM4A 2V9KA 3CNQP 4TKTA 3FNNA 3UCGA 3PO4A 2ZDPA 4J9NA 1OQ6A 3DLGB 4DS4A 4UFWA 5KG6A 3EY5A 4FF1A 3PYFA 3CJ5A 4OAEA 1J5OB 4OFZA 1G6BA 3EDQB 4P4IA 2E29A 2XCAA 3IRXA 3P96A 4XTTA 2DNPA 1R0CB 3CWJA 2RFHA 4LX9A 3CCTA 1ZZFA 3BM7A 4WBFA 2BEIA 2Z10A 2BXJA 2OPRA 5F46A 4XNHB 4DUZF 5E3PA 1ZO0A 3V6JA 2KO1A 1NDLA 1D0EA 3OVAA 5H9EJ 4DYOA 2EG1A 1N36J 3LP1B 2EC2A 3JAMY 2AKWB 2PT0A 2V8PA 3EXCX 3QZ8A 3TZWA 3BH7B 1Z4UA 3FBFA 4FPIA 4E2FB 2C2KB 1IB1E 5L1IA 2JL9A 2JZ5A 4OC4A 3V6DB 2I3CA 1GTHA 4B08A 2YQ0A 1J2VA 2M2BA 3MURP 3BB5A 2YH1A 3G6VA 1RB0A 2XBPA 4QVTA 3PKMA 4B3OB 3MD3A 4J3GA 1OY9A 3RRKA 4NRTA 1Q86T 1Y9WA 1WF0A 3TJ9A 5FD1A 2F65A 2BCOA 2UUAF 3SQOP 4OLLA 2ZBPA 4DPUA 1FERA 5GCNA 2ZW6A 2CFXA 1X9MA 1AZSB 3SMZA 3VALA 2NYIA 2A4NA 4KUAA 4UWJA 2KHCA 1PYTB 5C5JA 3OLAA 4OYAA 5F47A 1S1UA 2PR8A 3MR2A 3TFYA 1IUJA 1IR2A 2BJ9A 4NFRA 4YP3A 3B8GA 1UJ4A 3FUYA 5AG4A 1UZHA 4DCJB 3CPWR 2X3DA 2ZOFA 4ANEA 4OYOA 4DN9A 3CUNA 4G1IA 4LR7A 4DCOB 1KQKA 4EZ9A 4LIRA 1B99A 4ES2A 3X1LB 1WUUA 5DQIA 2QO3A 4A8QA 1H74A 5D4PA 2I6WA 3HUVA 2Q0YA 2JFDA 2KU7A 2JLMA 1YSJA 4USHA 1DAXA 2QL7B 1X5SA 3VCDA 4P2MA 3NG8A 2U2FA 3H5UA 4FPRA 8AT1B 3ENAA 1TK0A 5IS2A 2DB1A 2LU1A 3TUPA 3KOAA 1EQMA 1JJ4A 5A0YB 4DV2F 4C11B 4QCLA 5DLFA 2JDJA 7FDRA 3RW6A 5LYLA 3MR5A 3KK3B 1C1BB 1XJWB 2HNDB 2RHSB 2DHGA 1S3ZA 1LRZA 4PR6A 3AQPA 2IPOB 2CVEA 1HR0F 4P10A 4O3PA 3CIZA 4X4PA 5JM6A 2CADA 2AJQA 1IYLA 4A32A 4F3QA 2CTCA 1CLFA 2HWTA 3GONA 3J7A1 3DXSX 4H54A 5CZVA 2NXNA 1TKDA 4IYQA 3GJRB 1SL0A 1VQSA 5L1JA 4MHZA 1R57A 3I5AA 4RU2A 2QMXA 1HNXJ 2WVCA 1RAAB 1QD1A 1U0SA 3BQ0A 2R7WA 2YPZA 3OR1B 2IJZA 4X2BA 5KT7A 1KS2A 3KUHA 1RHKB 5J2QA 1YJ7A 3TO7A 1AUDA 4FYDA 5AG5A 3QIPA 2BOPA 1NKCA 3BBCA 4I2QB 1F0XA 1U26A 3MOJB 3PHEA 5H9EK 1DZ5A 1ZG9A 4CNZA 2CDRB 2V4JA 2CPEA 1H7WA 1SKSA 1YJTA 3F44A 2B4VA 4JI6F 2AEFA 4KOVA 3DLJA 1SQGA 2AWZA 3W2VB 3POTB 5KFCA 3D2MA 2XI3A 3B35A 5BR8F 1JLCB 4DFJA 3SI0A 3LPEA 4K4SA 4TXSA 3TO9A 4QYZJ 2H4YB 5J8CA 5J1EB 5B7WA 3GTYX 2BEFA 3W8PA 2PMHA 3M4XA 2XSFA 1RKIA 1M4LA 6FD1A 1M5KC 4OJ3A 5C24A 2C2DA 3DLLQ 1F2GA 3LW5C 4DOZA 1MJAA 4C3KA 4MT1A 5KFAA 3EZOA 5L1KA 1WOPA 3AY0A 4F0MA 4IK2A 4GC6A 1RT1B 5IOLA 3G82A 1IKYB 3V4IB 3SSQA 4DV3F 1IIDA 4DPYA 1RT6B 1P6TA 1HWJA 3CJQA 3KJVA 2V4QA 3U1MA 3QJJA 4LVNP 1WC0A 2Z4PA 2FZGB 5JVGQ 5C7PA 3Q24A 2ZD1B 3VQSA 4N5SA 4NA1A 4XDCA 2YH0A 4ERDA 2KRRA 1SH3A 4LRDA 2W7PA 3KLIA 4K8RA 4QR0A 1W2IA 2CJXB 1LWFB 4FXWA 5A2QY 2DTJA 5C25B 3JRUA 5LYDA 3VAHA 4USMA 1RGVA 3KLVA 3A13A 4CLZA 3IFEA 3THPA 1MG7A 2G4BA 5KFRA 3GV5B 2ATRA 1X10A 2K1RA 1W7WA 2VOOA 2EK9A 1NSLA 4PQAA 4ZCIA 2FTRA 2DNNA 1FWLA 4A46A 2XMWA 2MQLA 1AA1B 3L95X 1WWZA 3P45B 3ZZRA 1RT2B 2AJ6A 2DT9A 3Q8QB 1MN7A 1BQMA 4OX7A 2V5HG 4NASA 3U27A 4R3KA 4CO3A 2JBJA 4X5KA 4NXNJ 1VMBA 5LXYA 3G6XA 4F3MA 2I9SA 4A8KA 4XPEA 1TL3B 2D74B 1U0HB 2NLWA 4DV1F 3KG1A 1N6QB 1FXDA 2QA4S 1NUEA 3I32A 3CJKB 4F7VA 1NDCA 3PNIA 1YLEA 4NLYA 1HWIA 1XFOA 4IG3B 2HIYA 5IT4A 2Z0GA 2KI2A 1XR6A 3OSNA 2BL1A 5HQLA 4AQYJ 4KSIA 5HO4A 2XS2A 2EFNA 4IQXA 1NSAA 3H5SA 3DOKA 1WSRA 2HVIA 5KG5A 7CPAA 3W3SA 2OZHA 2MHNA 4F4ZA 2ZPAA 5G0RB 3TQEA 3S6HA 4DUZJ 1P4NA 3FH4A 2VA3A 4YEAA 2AYMA 1P27B 1SJ1A 5DWMA 4I2PA 4LRFA 3C3LA 2AD9A 1HI8A 3DOLB 1HBUA 4HNYB 5G21A 2PVVA 4ZP9A 1LW2B 2XCPA 2P5VA 4KSEB 2EVZA 3KLFA 4C97A 1TV6B 3CJSA 2QRRA 1X0FA 2W2QP 3DLGA 4LBIA 3EO4A 4USVA 2BKPA 4QU7A 3HLPA 3HKZD 1J5OA 1Z4EA 5B0DA 3IN5A 1K73T 4ETZA 4ZHRB 3R3TA 2RDJA 4NJQA 1SI9A 3U1NA 4QW8A 1SC1B 4NLVA 1U1RA 3AA8A 3KYLA 2UUAJ 2ERRA 3NY0A 3UI3A 3VF0B 3DDKA 3DRSB 2R8KA 3C19A 2HGMA 3FIXA 1DTTB 5A8RB 4L89A 3TEGA 2YKOA 7FD1A 2MTLA 2O3DA 2RRNA 3MMBB 4L74A 2XYGB 1TKHA 5HVFA 3OFEA 4NCAA 1D3WA 4WKYA 2YGWA 2XZTB 4DV6F 4CLWA 1U6MA 3SCIE 5E3RA 3QGHA 4F9VA 8ATCB 2CQ3A 1Z5RA 3PB4X 4P4JA 3ZC4A 1HARA 1APSA 4O3NA 4XPDC 3ILOA 3V6DA 3NL0A 4UFXA 3GIJA 2LECA 4KH1B 3DDDA 5H86A 3SDEB 2V67A 2IMOA 4MFKA 5HBMB 4HDHA 4YB5A 3ZTRA 4B3OA 1VQ7S 3GB0A 2AGPA 4C7HA 3P6YC 5F49A 3RZAA 4WU2A 3CPAA 1GK8A 4HPSA 3W62A 1Q4RA 2H51B 2MPUA 5IQQA 3T6BA 4YRHA 4DV2J 2LA4A 2CQ0A 2J8RA 1AZSA 1YJ9S 3ET6B 1R8HA 3QNVA 1PYTA 3B3SA 1FJCA 1X8DA 3EVOA 2A6OA 2DRAA 2GQ2A 3T3FA 1HR0J 2W7AA 4OLPA 2EBJA 4QU6A 2JC0A 4XPLA 1JXVA 2P2CB 1CJVB 2IYIA 4C0HA 3JSRA 2OZUA 2XZWA 3OFHA 1B0VA 2IM2A 4XDDA 2XULA 1IXKA 1VLYA 4CZCA 3M05A 3QT8A 3MEKA 5LSRA 1RP5A 4NLUA 2BJ3A 4U96A 2ZEMA 3UDCA 3PG9A 1FT8A 2WONB 4N8OA 3D1HA 2MB0B 2AZ3A 2C2NA 2W2NP 4ZPCA 5LMUF 1VIOA 4C8MA 4L76A 3GR0A 4LBPA 1IKVB 4UCNA 4ILRA 1UKUA 4N8NA 2ZH6A 4DL4A 1F2HA 5DDPC 1RAFB 4IRKA 1KD1T 3M8WA 3PYGA 4ED3A 1R43A 2XHWA 5ETMA 2P8IA 3F0NA 5A0YA 1H7XA 4GVBB 3D66A 2YNDA 4C11A 4C8LA 2VPWB 1FDBA 4ZN1A 1UFLA 1VRQC 3KK3A 1C1BA 2HNDA 3O3LA 2G3TA 3GYNA 3R7NB 1SL1A 2AW0A 1M5PC 1X4FA 5KT2A 3PEHA 4ZPBA 4HT5A 3KG4A 1S6QB 4PXEA 5B0BA 4B3RF 4KHPF 2XNQA 3MZIA 2I1RA 2J7KA 3IGRA 1WTFA 2YKMB 2ZBRA 4JI6J 3C26A 2F40A 4RI1A 1R7IA 1VQPS 4P4BA 1RHRB 5DZ6A 1FK9B 4LF6F 4C48A 1ZA2B 4QUSA 3J80U 2C2MB 5BR8J 3W9HA 3BPDA 2NSCA 4ZY0A 2G1HA 2W9CA 3T9NA 1ELMP 3EGNA 4UIBA 4K4TA 2EKNA 3W5YA 2AHOB 3KLHB 3RBDA 1HLWA 3I6PA 4DN0A 5BWAB 4UOHA 2B4OA 3OR1A 1Q16B 4V19J 3HO1A 3D54A 2R1IA 1EIYB 3IS9B 2AJ2A 3NE8A 2YX7A 5DO2A 2K7JA 4DV3J 1AFIA 3SEOA 1N0UA 1D9DA 2B56A 4B10A 2Z11A 3NGDA 4MHDA 4U95A 1S10A 3G4SS 1HDQA 4FS2A 1RWMB 1VKCA 1W2BR 1UWAA 4PRFA 2E44A 1WHVA 3W2VA 3POTA 3PB8X 2KN4A 1RXOB 2O66A 4F8RA 1UL3A 2P6EA 3PZPA 2V50A 1JLCA 4LR8A 4KGMA 1CEZA 1SH2A 4MYUA 1S7FA 4EO6A 2EK1A 4O3QA 1N48A 5J1EA 2GIFA 4JI7J 2EVNA 4WXWA 2ZNYA 3MM7B 4CYOA 3OVSA 4X4NA 1UPMB 4N47A 1R8CA 3BSCA 3TAQA 3NGKA 2WYRA 4OZLA 2PDOA 2AYGA 2KJVA 1HD0A 4IOAQ 4ZVRB 2K5TA 1RT1A 3A8JA 1WK4A 4LRCA 2F9DA 4KLVA 3FCWA 4MFJA 4OC3A 1IKYA 3V4IA 3H5ZA 1OS5A 4ZS6A 1RT6A 5C2GA 5LYIA 3DGPB 5AXKA 3D2WA 4JI5F 4LREA 5DGBA 2ROPA 2ZD1A 4IRDA 2CQCA 4DV1J 2JDDA 3PX0A 4KBIA 1Z2LA 4TLQA 1IWGA 2GVDB 3RYOA 3FBEA 1FRXA 3LO3A 4PWUA 4WK3A 4Q0BA 1LWFA 1NB7A 1XIXA 1YBAA 3HVWA 2ATCB 5ETVA 5D77A 2PSZA 5C25A 2MXYA 3H40A 2IDEA 1UJ6A 3OL8A 5ETRA 2ZEEA 3HVRA 1YRTA 4KAIA 3W6XA 4PSXA 2CQBA 4HT7A 2WBRA 1PU9A 2XEIA 5CH7B 4RUHA 1PBUA 3C66A 1NK9A 4DS5A 2OH1A 4OYMA 3KJFB 4JWPA 4IFYB 1SC6A 3SCJE 1KKHA 1FFSB 3DDIA 1Q79A 3QT7A 4B9VA 5HJYA 2VZZA 4LFAF 1RT2A 4NGRA 1IWAA 4HHUA 2ZZTA 3NNHA 4A31A 1BMQB 1QQ9A 2XYHB 3TO6A 2E5LF 4URSA 3T9YA 2COLA 4JI8F 2VQYA 2FGCA 2AFXA 1S6UA 1TL3A 1U0HA 3OW2R 2ZBCA 1QSRA 1RZMA 1N6QA 3M2RB 4QIEA 3I0RB 3CW2C 2ZEPA 4WE1B 3HULA 1DY3A 1R0BG 3CJKA 4E98A 5HAOA 1HIYA 2B8PA 3HLUA 4B5OA 2YNEA 1QVGR 1SCJB 4IG3A 2AU0A 1ZTTA 1CJUB 2ZOGA 2MQ8A 2PA3A 3CO9A 3I4PA 3QT6A 2WBMA 2W8KA 1RAJA 1PSDA 1PO6A 3DI6B 1NO8A 4KLWA 5DJBA 2UXCF 2CZ4A 2W4PA 4CLKA 2R7QA 3AT1B 3UQSA 3PX6A 3DOLA 3QPIA 2W9BB 5HMYA 5KFXA 2EXUA 4GMKA 2L41A 4QWAA 4XNHC 3MM5B 3ZTOA 1TV6A 2R8VA 1S0MA 1Y00A 3NCPA 1I94F 1YJNS 4DV7J 2MKSA 2ZNZA 5G20A 1QJHA 4W98A 2GQCA 3HK2A 2OGUA 2EBGA 5ETLA 4ZHRA 2YWWA 5ETOA 4U9YA 5B0AA 4FF3A 4F25A 4Y2KA 2B6AB 4YQWA 4ORFA 5HI7A 3KHZA 4EFDA 1FWKA 3C6TB 4QBJA 2O28A 2ZUGA 3DRSA 2IJFA 4OADA 3QFHA 3T6JA 4IH7A 9RUBA 3D7FA 1DTTA 5A8RA 1QSNA 2FJVA 3MTKA 1T3NA 3N6LA 1FCAA 3MECB 3OJSA 2DR7A 1ZG7A 3EPGA 5DG7A 2LDIA 3MMBA 1BE4A 4TYBA 4KOXA 4ILLA 1TL1B 2UUBF 1VHFA 3QWUA 3PP9A 3FYNA 4O3RA 3T90A 3PTWA 3KWMA 4J9VA 3A12A 5KFJA 4USKA 3AXMA 4M6GA 1NEEA 4AXIA 4N76A 2GHVC 1GTEA 1I12A 1H0HB 2CIMA 3QAEA 5D15A 1OPZA 3SJFA 4QIWD 3SDEA 3MHYA 3OL7A 2N3LA 4UEEA 4B11A 5LMUJ 5HBMA 2KVQE 2XS5A 2IA6A 2Y1RI 3JXOA 2OD6A 3CCES 3R2CJ 3NAIA 2A18A 3DDNA 3CCMS 4OZJA 1S77D 1YJWS 1RUSA 4F8ZA 1WKKA 1EP4B 2OEJA 1RTIB 3ET6A 1XMTA 2A2DA 2MY7A 3PYDA 3BJ7A 1FKAF 2GFFA 2HHSA 5FDLB 3CXSA 1RWKB 4B3RJ 1K47A 3EPIA 4KHPJ 3A1YG 3VVUA 1Q2CA 1CJVA 3GFYA 5F8GA 1DJ0A 4ZN3A 1XQIA 2EKYA 4URGA 5LRGA 3JTOA 2F5IA 3L9ZA 2F63A 1RWNB 2ZVIA 1Y9OA 4OL8A 2R7VA 5MLCV 3J81U 3R1HA 1VRUB 4LF6J 4CWBA 2EWBA 2D69A 4LF4F 4Y00A 5E41A 3GV7B 4I6AA 1F5CA 4FYXB 1CULA 3CC2S 2WONA 3R5CA 4J37A 4LF7F 3RB3A 3T1AA 1MNEA 4CAXA 1IKVA 1U25A 3V7ZA 1RA7A 3PJ9A 2VB6A 1IM6A 1H72C 3S6GA 1ROFA 2CPHA 3GMGA 1XMQF 4H6UA 4ONWA 4GVBA 2V2ZA 1FRKA 3K9UA 3HHLB 1KC8T 4PPZA 1SJRA 4DSIA 1MJBA 1UMJA 2GV1A 3GG1A 2RS2A 2N7CA 1S7LA 2CXAA 4DR3F 3KLEB 1C2PA 1Q0NA 2CQ2A 1FD8A 1S59A 1S6QA 1HNZF 4M5NA 1IKXB 1QSLA 3K5NA 2AYBA 1YRUA 1U2RA 4J5OA 2YKMA 1YJUA 3NBPB 1KUYA 4BC9A 1GMUA 1FK9A 2XWYA 2A0FB 3HFVA 1WELA 2QZ8A 4JI4F 2CXEA 2Z0ZA 4A94A 3M8ZA 4WYWA 3ETMA 3IA0A 3TANA 3EXYA 1SQHA 2O53A 2UVUA 2GANA 3KLHA 1ZPWX 5FLXU 2XY6A 1NK8A 4DV5F 3ONQA 1YZ7A 5KFIA 3QJLA 3Q2TC 4M85A 5H1SV 5D8HB 2YQ3A 4I69A 2RMLA 2IBOA 4CLYA 1FTRA 1J5EF 4ZMMA 3IS9A 2I5JB 1Y0RA 5I3QA 2QJ3A 3IWWA 4P4FA 1S1TB 3HSGA 1ICEB 5ADZA 3L3CA 3CB4A 2R7HA 3MAAB 3HHLD 1Y7RA 3BR9A 1VFJA 5LJ5Y 3EC4A 3THVA 4JI5J 4YU9A 4OZ5A 3GZ7A 3IO1A 1YG0A 3GG0A 5CD4H 4DPOA 4QWBA 3OR2B 4IDKB 3AAWB 2VXKA 5EX0A 1KRPA 1BAVA 3P49B 2YKPA 4NLGA 2ZELA 1EB0A 2PIZA 4LQ3A 1MN9A 2VFUA 1OIAA 1JB0C 4QR2A 3HT3A 3PACA 2DJWA 1M4IA 3UR0A 2HFZA 1X5OA 5DQGA 2K8GA 3B3VA 4J9QA 3IWLA 2RNEA 2QTWA 2IA0A 3D3CJ 1RTZA 1HA1A 2Q43A 3D8PA 3PHTA 2F5GA 4IG0B 2CY2A 2E5LJ 3EICA 4B9LA 2DHSA 2PEBA 2F4VF 4MIBA 3DGPA 4ECSA 1X7VA 4JI8J 1Y7EA 1U4BA 4HKQA 3DLEA 2HVZA 5D78A 1KLNA 2OOTA 4PXCA 1MMLA 1VBXA 1IBLF 4CT8A 4Q44A 3IM8A 1H73A 4L8AA 5IX3A 4C7QA 2GVDA 1UJ5A 4QWDA 4O4GB 1FVSA 2GIRA 4A39A 3PYEA 3PB7X 4V19X 1QTMA 1HPZB 3I87A 3MPVA 3TVZA 3LPYA 4ETXA 3WX8A 4CM2A 2JLEA 2BJDA 4L3KA 2ZW7A 1Y4ZB 2FJDB 2M0GB 3BR8A 1BD6A 1ZM9A 3EMTA 1Q5VA 3KZWA 2ROGA 4LIWA 5DG9A 3D7GA 3SBMA 2G9OA 3FZBA 4MFBB 1J27A 2IJRA 2Y0MA 2XO6A 1W26A 1URRA 4ZCLA 3H4DA 2V68A 4KRWA 4IFYA 5E5NA 2UXCJ 4O4RA 3NGRA 2YWFA 2YWEA 3IBCB 5LT5A 4MIAA 5ISVA 2KM8B 3LWUA 2JH3A 4ZYQA 3QNWB 3TCVA 3WDOA 2KVIA 5I42B 5IV0A 1TKXB 2KJWA 3BEGB 5DDOC 1AMPA 4OMEA 5F09A 2G0JA 3OV7A 5EWGA 4ED6A 6FDRA 3M2RA 3I0RA 4YR0A 1I94J 3P2HA 3MDFA 2BRKA 2QG9B 3ISND 3T1HF 4WE1A 2DGTA 4MJKA 1G1XA 2MEWA 3LANA 3KQZA 3CDWA 2FY8A 2WAQD 1CJUA 3N4WA 2V8GA 3CIMA 1F2PA 4G1QB 3RTVA 2WSCC 4X64F 2QMWA 4OC1A 5LM7E 3IWGA 2GW8A 3TJAA 2JNJA 3FDSA 2MQQA 3DI6A 4X4QA 4C0OC 2CA9A 1S9FA 2GAGC 3E8OA 4Q45A 2E1RA 4ZVUB 4ATNA 3UN5A 5CYJA 4OZ2A 2HQCA 3O44A 2CAJA 5EWFA 2XGPA 2W9BA 1TF8A 2ABZA 4RW4B 2UUBJ 3UN2A 2N4CA 3W65A 1ZH5A 3UDVA 3PV8A 3MM5A 5MAOA 4HHJA 4O0NA 4Z7CA 2FE7A 3PRBA 4KHMA 4DU8A 2AFMA 1HBMB 1F3FA 4RW7B 2EFVA 9ATCB 1NSQA 2DXEA 5DS7A 1FXRA 1AYEA 2PC6A 4IFVB 1LW0B 4AE5A 1MROB 2P9CA 4R0EA 4J9MA 4HDGA 1A0OB 2B6AA 3G6YA 2Z58B 1RYSA 2M8DB 4ZPTR 5EMIA 4URQU 3C6TA 4L72B 4CGPA 2MSSA 5G4DA 2RUGA 4P2SA 2MZ1A 4J9OA 2YKAA 2OO4A 2QLXA 3TA1A 5CNPA 6CPAA 4DX7A 1V3ZA 1S0OA 4J91A 4U7UK 2H1YA 3MECA 4DJBA 4OYZA 3PBBA 3PXGa 2EWHA 1GX6A 2ZOMA 3P8BB 2KXNB 5HK4A 5AXNA 4MFQA 1NMTA 1E6YB 4R6TA 4CO5A 1TL1A 1G4CA 3F8KA 3ZNUA 3IC1A 1KBRA 3LWMA 2ZDOA 1CBKA 4HNWB 3FEXB 1F9HA 1HYSB 1XWLA 4OI0A 1UEUA 1YRXA 2ZEDA 3EM1A 5J1QA 2EFGA 3KJQB 4CGLA 1X60A 1RAOA 1XEBA 1R3NA 1WDTA 3D9BA 1Z1ZA 1UVKA 3QZ7A 4ZLJA 4LF4J 3D0GE 2WHOA 4HR2A 3KMQA 2AJ4A 3H5YA 4DR6F 4EYIB 2R4FA 5GADU 4LF7J 1KLMB 2B4PA 1JQGA 2B0GA 4HI1A 5J1NA 1P9YA 3NNAA 4QOTA 3AQOA 3H2LA 1FE4A 3RYLA 1XMQJ 1FFGB 4M5JA 4ZA1A 3CULA 3NMRA 1EP4A 4NLOA 1RTIA 1VQYA 1H98A 1JJCB 4MH8A 4B9NA 4U5YA 2ZW4A 4DR3J 4IRCA 3NWRA 4K4YA 1YK3A 5FDLA 4RNHA 1HNZJ 1IKWB 1EHWA 4M5IA 3MPWA 3D0HE 1D8ZA 4P73A 3LOUA 1JKHB 3FJUA 3H8GA 3DU5A 3PR5B 2H5IB 3W5XA 3Q23A 3CCUS 3PO5A 4KOTA 4NRUA 3H2UB 1L3UA 1VRUA 2D7SA 3BJYA 1UZDA 1RJJA 1X9WA 4JI4J 4DQPA 2CPFA 4JI2F 1HMVB 4QBUA 3QSYB 5JJBA 3CJRA 4FN5A 1VIXA 4BD9A 3SI8A 3RBEA 2E9TA 2CDQA 2Y1LB 3PW7A 3U1LA 3K5LA 1NRKA 4DV5J 4UTGA 3DHXA 4X4UA 3ZZIA 4IOCQ 4AXJA 4KPCA 1WF1A 4J7CA 5J2PB 1U1NA 1NJIT 1N5YB 4OC2A 1J5EJ 1VQKS 3ENQA 5EN1A 1SC4B 3HHLA 5DDRC 5GAHI 4F4YA 1JLQB 4PABA 3D3SA 1FNMA 3T8WA 1R8AA 2FPHX 3MM8A 3ZZZA 3NWGA 2VG7B 2ZBIA 5ETKA 4O23A 4R76A 1T9TA 3KLEA 3TO8A 5DG8A 4C3LA 2J6SA 4ZPVR 4FYVB 2KDOA 3NGTA 1IKXA 4M6IA 2QC3A 3B54A 5LMNF 4F02A 3NXZA 4QB9A 5LRJA 2ZH2A 3NBPA 5HN0A 3DC2A 4DX8H 4LSNB 2WVFA 3JAMU 4Y2IA 1HHSA 2AZ1A 3RRGA 1M5VC 1KQFB 3IU1A 2AMCB 5FVJA 3H42A 1KHVA 1VBZA 4YN3B 3R6GB 1FHTA 2RS8A 2ALYB 1XNRJ 1CC8A 3WC7A 1F60B 4NXYA 2I5JA 2LMIA 1S1TA 2PJ7A 4KS9A 3MAAA 4ZCMA 5E3AA 4YMEA 2DD8S 2F4VJ 1RTQA 2I8EA 3U7JA 2JLGA 1WHYA 2D4PA 3M1VB 3QAUA 3G9CA 4XPKA 4OX6A 5IZHA 2DY1A 2RQKA 3LA0A 1Y9KA 4OP4A 4OZ1A 2RH3A 1IBLJ 1I21A 3DRPB 4R8UB 3OR2A 2PFDA 4IDKA 2LVWA 4RLEA 2X1FA 4ALZA 2JEWA 2YVSA 1B6BA 3E0KA 1IBKF 2B8QA 3FBCA 1IU8A 4KSFA 2ILYA 5JMNA 3NH4A 2Y1IA 1YQHA 1JXLA 2FVSA 3BREA 1VC5A 3R97A 4NGNA 1YGHA 5E0OA 3T5JA 4X2TA 5D0RA 3BGRB 1Y5IB 2WZ1A 1WF2A 4KJIA 2HRTA 2JOQA 3DSBA 1ULRA 4Y3CA 2WSAA 2Z8QA 3I56S 3M2UB 5ETNA 3K5MA 3C8YA 5E2QA 2G3AA 1FI4A 2RF2B 3TX8A 4J9KA 3HD1A 4IG0A 3MFIA 2XEFA 4USJC 4UQTA 3VV2B 1KVJA 4B3SF 4A8WA 3IMQJ 3B82A 4M6HA 4PQUB 4LQGA 4JV5F 4O4GA 1NSKL 3T1HJ 4P71A 2NREA 1HPZA 4NLSA 1X4AA 5DS0A 3OLBA 4YDXA 4ZP6A 3US5A 4FBUA 4I4BA 2MHEA 3S9LA 1L0CA 3D4JA 2DGSA 2FIWA 1CPZA 2IYGA 1SXLA 1CBXA 4X64J 4F36A 1GEHA 2WB4A 4MXUA 4UA3A 2IY5B 4FD7A 1TL5A 4MFBA 3TZYA 5J1PA 3DLKB 1EKRA 2FLLA 1AFJA 4ZOSA 2GHWA 1TKFA 3PBEA 2JWNA 1HQEB 3BKUA 1K0VA 2B7CB 3QMQA 2GNKA 2VICA 1HWLA 3VATA 1KFSA 1N56A 1WKJA 2VFVA 4DLEA 5KAKA 3MN8A 1R31A 5C42B 4DR1F 5KT5A 5HVGA 3CCSS 2P6FA 3MEDB 3M7VA 3SYZA 2ZEGA 5I42A 1JXEA 2V9WA 3QJPA 2B9YA 1TKXA 5KFOA 4C8NA 3HHKA 3DU6A 2XMJA 2YWHA 3A3NB 4NGMA 2ZH4A 1BGXT 1X5TA 1KP6A 2DR8A 2HZVA 1ZPVA 3GCWP 1XERA 4PG7A 2GMJA 4ED0A 2NS1B 3QO9B 2CPXA 2HIQA 3CDBA 4G1QA 3F5BA 2HHQA 3N28A 5EGYA 4X62J 1VGYA 1GQEA 1L3SA 4A2ZA 2UU9F 1VJQA 4C98A 1RBAA 1AXQA 2XYPB 4DZ6A 1OSCA 1QSYA 2YNGB 3NH8A 1BO4A 1N5VA 5KFPA 3KJNB 1UWBB 4K5SA 3VZIA 4P74A 2RHQB 2IRUA 4MHNA 3M9NB 3F73A 1WC1A 4KSAA 2OPPB 1CJTB 2PJAA 2YX1A 4RW4A 1ZA1B 4PSWA 2DEIA 2PJ5A 2EFPA 1YVFA 3ISXA 3M2VB 3D6TB 3V6HA 4FNIA 1VHSA 1UWYA 2C3UA 3V6KA 5D8NA 2DF5A 4WFYA 2QL5B 4LF9J 4IHMA 3M8PB 3BHXA 2AGOA 1HBMA 4KOSA 4XPCA 5AGEA 3K59A 4RW7A 3WX4A 4LMZA 4DR6J 4EK2A 4B9UA 4IFVA 1LW0A 2CPDA 4R87A 1MROA 4M3SA 2MZSA 4C4WA 2VFSA 1U6BA 3OVBA 5IWAF 3G3SA 2X7IA 3TX0A 2PQ8A 1GNKA 2HC9A 1TTHB 3VAKA 1HFEL 5A76A 1TMMA 2VODA 5A2QU 1S7IA 3AOAA 1A6LA 1NU4A 5KFLA 1LXJA 1NHVA 2QGFB 3VGVA 1RBLA 3H59A 2RQ4A 1VQOS 4YB6A 3NLCA 2ZE2B 1YWXA 4LUBA 5I3PA 1P9QC 3N01A 1E6YA 4WP3A 1WEXA 2R8JA 1RO5A 4Y49B 3H8EA 1Q53A 2HBQB 3IGNA 1HYSA 1NHUA 3THTA 4DPWA 1GMWD 1NB2A 2ZEOA 3N79A 1WDDA 3FBBA 4A95A 4FVMA 4UZBA 1MW7A 1T03B 3G6ES 4MFPA 1MWYA 2HZCA 4JI2J 2MZQA 1CQNA 4DR7F 1V3RA 4PV6A 3BO3A 3KR4A 4LQ9A 2M70A 4HEA9 4MBUA 2Z3MA 3TUJC 2DNKA 1KLMA 3J81j 4Y34A 1I1GA 2CNTA 4YR2A 2VC1A 2W8LA 3SXOA 4DUYF 3FK4A 1IJFB 4MAKA 3GIRA 3EUNA 4ED2A 4WWSA 3BQ2A 1UAWA 3IM9A 3ILJA 2FD2A 2HNYB 4KGXB 4S0MA 1Z2ZA 1MWQA 1S1XB 4OQJA 3H4BA 3RRHA 3JVNA 5A27A 3TT2A 5F41A 4K4UA 4NXMF 5HROB 2UVRA 2NZCA 4BBYA 4HL9A 4ER8A 1HBNB 3J7ZT 2VA2A 4YFJA 2Y1JA 3K7RA 2VKRA 3KTQA 1IKWA 2NXUA 2CQDA 5LMNJ 3J7YI 1JKHA 2ADBA 1VQ6S 5G1ZA 2KYXA 4KV8B 3GFZA 3HHLC 2NQPA 4A8XA 2HMIB 3KDOA 4OYXA 3J7YU 3ILLA 1IR0A 3MXHP 1TK8A 2D3ZA 3O8WA 1HMVA 3OSPA 5F3ZA 1FXLA 4LRAA 3VARA 4FP9A 3MEGB 4DR2F 4JP8A 3N6MA 1MU2B 5K8OA 1LFWA 2Z3OA 1UVNA 2X1AA 4B3TF 2FJBB 3RUBL 3K58A 5I0CA 1SB6A 2ASDA 5J2PA 1OBRA 1N5YA 4JJXA 1K8AT 3ZXWA 2RRBA 3UDLA 3TI0A 1JLQA 5IQ6A 3QAYA 4NGPA 3E3XA 2VG7A 1DFDA 3OTOF 1BQXA 1G7CB 2NR0A 3GLJA 1QY7A 3H2VE 5BYSA 1OSDA 4PG8A 4TY9A 2HK3A 2DNMA 1N32F 4K0KF 3WIVA 4KVOE 1JLFB 2XMUA 4LF8F 1IY7A 2OI2A 5HVHA 1FX2A 4OHZA 3PKYA 2LEPA 3GYXB 3KKWA 5GAGU 1IBKJ 4DJLA 4LSNA 1YJRA 1X12A 2GO9A 2AFUA 2O5DA 4K4XA 4RU9A 1GHEA 2BO9A 2IM3A 2GGPB 5B08A 3F0AA 1NXIA 2KB2A 1X9SA 2VEZA 4A30A 1QDUB 3Q8RB 2XTJP 2UV8A 4ZJLA 2DIUA 3Q8YA 3K17A 5KG0A 3VH9A 4RUBA 2XSJB 5M2UA 5HMXA 1U1LA 4DG1B 1YREA 4KO0B 2W1BA 1RAIB 4JOUA 4UZCA 1RTJB 3M1VA 1WG1A 3CDEA 4OIDA 1QE1A 4RX6A 4CH0S 4B3SJ 1NCLA 3ZZYA 1U6ZA 5T14A 4DR4F 3DRPA 4R8UA 4EEYA 4JV5J 3HFKA 2DR6A 4X65J 4C8ZA 4MYTA 3HSZA 5CAAA 3OTDA 2Z2LA 3N5BA 3P4UB 3P5BP 2UVWA 5LSOA 2QMLA 1LQ9A 2HAIA 3ISNC 4ZVPB 4OYBA 2ABYA 3PR4A 3BGRA 5LSLA 5KG7A 5IC6B 1YMEA 1LK5A 3JSYA 3M8YA 2R7XA 1VISA 2B3TB 2H48B 3M2UA 2EK6A 2MJUA 3A3OB 3VWEA 1YKWA 2FDNA 5IT9U 2DNYA 3NEKA 1IM4A 2WK4A 1D09B 2W24A 2J0XA 3Q86A 2RF2A 1T11A 5EWEA 3ENWA 3FX6A 3R5GA 3CMQA 1AUGA 1F9FA 3NOCA 4DR1J 5FIIA 2W2PP 1C0TB 3JS9A 1VYAA 1YVOA 2XEJA 4KIAA 3CDAA 3UVJB 4ILMA 4MFLA 4N77A 3CJ0A 1YDLA 3QFWA 5DM6Q 2BJEA 4AUKA 4PQUA 3ZFVA 3SXLA 2O01C 2KM8C 3SJGA 2C27A 3GJTB 4UEZA 2EFQA 4A38A 1HBOB 2RB7A 2HLUA 3FRZA 3SZ2A 3FECA 4L73A 3UDEA 2UXDF 2R2RA 4OX9F 2KYZA 2Q44A 1F57A 2UU9J 3DLKA 2HFSA 2FSRA 1K1SA 4F0YA 4QW9A 2AEJA 2LLZA 1U1MA 2BJ8A 4QPTA 1HQEA 2CRLA 3KQXA 1TUWA 2VDIA 2MLYA 1D9FA 5HSPA 5D0GA 4I1TA 1EX8A 5C42A 4ID5B 3FSYA 4R0JA 1F9EB 2ZH1A 4NCBA 3MEDA 4UWIA 1PC4A 2VD3A 2LXFA 2OLWA 2V6AA 1PJ7A 1O8BA 3IG1B 3QGPA 3NA6A 2QV6A 2Y8YA 2BA9A 1N4LA 2RUSA 2FJAB 2HRYA 1VQ4S 1Q8LA 3DFEA 3LGHA 3Q89A 1G3OA 1T0TV 2DGOA 3MR6A 3TA2A 5EBVA 4ED4A 3QO9A 1F3VA 3NS5A 1XF8A 1BPMA 5F48A 1K44A 3PY8A 2KXFA 2R7TA 4YOEA 5JH9A 2LCWA 1FEEA 5I3UB 2VDHA 1S5ZA 4C0BA 3EVWA 3RNZA 3LAKA 4KYZA 5IWAJ 2CNSA 4RNNA 3AB4B 3RBZA 5L38A 4NPOA 1SKRA 1TP7A 1FTCA 4BBHA 2YNGA 2MLZA 1WORA 2ZITA 5JPHA 1UWBA 4KB7A 1UCNA 1BOBA 4ZJOA 1V6HA 3E51A 2FCKA 3I4HX 4DEZA 5KTQA 2OPPA 1BXNA 1CJTA 1NZ8A 2IVFB 2G2OA 3CGIA 3SJEA 2MGZB 3OTCA 3ZTPA 2YBVA 3FCVA 2KKHA 3WIUA 4NCGB 1N33F 3D7DA 1HDUA 3M2VA 1S97A 2VJUA 2HB6A 1QMUA 1DARA 2XWXA 4TY8B 2ZWPA 3M8PA 3R1KA 4A33A 4DR7J 1FJEB 4NOHA 2DH9A 3RB4A 2XEXA 2J9AA 3KUEA 3LP2B 4WPAA 1HKAA 3SHPA 4DUYJ 3B4MA 1B0PA 1JLBB 3T1YF 1T3OA 2D3UA 2KT5A 3LH2S 3P3DA 3M8QB 1U1QA 2J9EA 3OXLA 4NXMJ 1URNA 1RADB 4DHVA 1D1UA 3PDNA 3ZZTA 2CF4A 4NCZA 2BBEA 1PBAA 2WUUA 2RILA 2ZE2A 1NLKL 2YXLA 3CTRA 1ON0A 3I5BA 4HI2A 1NJZA 2E1PA 1O6XA 3G87A 4OZ3A 2Y8WA 2ZKUA 5F8JA 4WF9Q 4M5MA 2C3OA 4ENOA 2V2VA 1T03A 1S49A 3S9NA 1FRLA 2FJWA 3ISZA 2GJ2A 3MCNA 3VQTA 3U02A 4DR2J 3FEEA 1S4FA 4BC7A 4CYNA 2VKZG 2XY7A 3R5JB 3G2XA 4FXVA 1B0TA 4B3TJ 4GVLA 4X4RA 3BXMA 2HNYA 3KG0A 3JSMB 5JUMA 4R8FA 1S1XA 2G2YA 2Z57B 5HROA 4ECZA 2ZH9A 3CE8A 1HBNA 4WFBQ 2J6UA 2FLPA 2QYGA 1VHIA 3RB0A 2HWIA 1GXTA 2REEA 2BX6A 3KDNA 1N32J 4KV8A 3DRXA 4DUTA 4LF8J 2HMIA 1FRHA 2KZZA 4AT1B 3MD1A 1WG5A 2CNMA 3I0SA 4B9SA 3UR3C 4RUAA 3I31A 1TFWA 2HWHA 5IB0A 5HL7Q 2A2CA 2NUUG 3RB6A 1KSPA 4CYPA 2OIHA 5IB9A 2NPIA 2PA8D 5IV4A 2PRQA 3C46A 3ZTSA 3MEGA 2BSWA 2H9ZA 3WABA 1MU2A 1WEZA 5KFBA 1B3TA 3Q2SC 2RVJA 2DEJA 1GYTA 2WTFA 5U47A 3PFOA 1NZAA 3OQ2A 2YX4A 2ZM6F 4DL6A 2F9JA 4I68A 4DF8A 2H54B 2L48A 1HNWF 3KHLA 2CZVC 1B70B 1I1DA 1I6JA 2P9EA 2AIRB 4OJHA 1F1BB 1RHQB 5F9NA 1VDHA 1NKEA 3DYAB 3WQPA 1BQNB 3LQVA 5K9FA 2M4MA 3FSXA 3BSOA 4RS2A 2J5AA 2PO4A 4BMHA 4CGOA 4HHHA 1HWKA 4DR4J 3WHIA 1JLFA 1M5OC 4RW6B 3VAMA 2ROEA 3OWCA 2HK2A 4PCQA 3TE4A 2DVIA 1Z4RA 4UUXA 4CAVA 4CAWA 1U02A 2RDDA 1VHEA 4H4KA 2CPJA 2OPQB 1TL7B 4USIA 5AXLA 3BJ8A 2GGPA 2CJ9A 4FXDA 3S01A 2J6TA 1CG2A 4KFBA 1Y3JA 2XC9A 1U2FA 3S6EA 2X1GA 2VJVA 4Q2LA 3PIOQ 4AXVA 1N34F 3L2NA 3RGIA 1U1KA 4NX9A 1NK0A 2Q7SA 2CYYA 3RBUA 2W01A 2J8NA 4TU8A 3MM9B 4ONUA 5H9FJ 3MRUA 4MHYA 2G1DA 5CD4A 2GCFA 1GX5A 1KOOA 2XSJA 2C42A 3TAMB 1QSOA 1SUQB 4DG1A 3R9GA 4KO0A 3W6SA 1RTJA 2G0BA 3DNSA 1RHJB 2LXIA 4XAKA 3VGSA 1LV5A 2KZMA 1Q8BA 1ZM2A 2WSFC 4U9RA 2R7SA 3NOGA 5JVHQ 3MAQA 1FY7A 5CYQB 3FEZA 5GAEU 1JJHA 2FUG9 3IP0A 3TOBA 3H7HB 1Q82T 4H89A 4CLUA 4KORA 1KR4A 2DCUB 3ITHB 2HVEA 4L6V3 2UXDJ 4WZQA 2AFZA 4OX9J 4R3LA 1KFDA 3EGWB 1HI1A 3CDUA 3GSDA 2GFQA 3DRYA 3QLHB 4NYOA 5LRKA 2CQ4A 1Y3KA 4DLGA 5KT4A 2CQHA 2R2TA 1YR0A 1NK7A 5K8MA 4A48A 1Q2DA 2JDCA 3BGLA 1Q8KA 1ZLHA 1FX4A 1FO1A 4RW9B 4NLTA 2ZJRQ 2FL4A 2Q6CA 4Y6IA 1C0TA 4QWEA 2QA4G 2DPSA 4ECUA 2HFUA 2MKIA 2AFOA 2V94A 3UVJA 1WTBA 2KH9A 4OJ1A 4WP8A 2AX1A 2CQPA 4OHWA 2B7BB 2B58A 2MQOA 3P2FA 2PJCA 1HQ2A 2B9EA 1DRZA 3KGQA 1IICA 2XNRA 2OKQA 1RWPB 1RT3B 2OEKA 4PAAA 3V81B 4TQSA 4YDDB 2AX0A 2XO7A 3LP1A 1QSSA 2R98A 3TR5A 4NGQA 1RABB 1HBOA 1HW8A 5HMWA 1N5SA 2L9NA 2BM1A 2GMHA 2VG5B 4DL2A 2QT7A 3TUIC 4OIWA 2XG8A 1YJVA 2QA2A 4MK9A 2CVIA 5HJXA 4PYDA 4FYYB 2QSWA 1OY8A 1NM2A 4X3RA 3FF3A 3BV8A 2MZJA 2DNGA 2DPIA 2NUHA 1JJ2R 2WSEC 3TQ1A 2QE5A 2LEBA 1LWEB 5BXIA 5HP1B 2Z2MA 4ID5A 4DNCA 3IIBA 3BYPA 2DGVA 4ELVA 3W1YC 1XTZA 2VBZA 1UEVA 3H0PA 4WTOB 1N33J 1RLDA 2CNLB 2EBEA 2NXCA 3NCRA 2FVQA 1IQTA 3CD0A 1WKLA 1NE9A 4DUKA 3D6MB 1HNIB 1Z8TA 2DNRA 5I3UA 4C8KA 4IOBA 3K0JA 2VPYB 1RWXB 1EAYC 2D41A 4ZVTB 4JXRA 1TU0B 4B9MA 5D6GA 5CCLA 1PUAA 5IT9Y 4EUVA 1S7HA 3ENVA 4AD6A 3KHRA 1QTNB 5L9NA 3EGVA 2ZH5A 2ZXVA 5H9FK 4CS0B 2Q6BA 2MGZA 2QFJA 4G6VB 3D6FB 1VR6A 2RJZA 1Z8WA 2RU3A 2P0WA 5CQGA 3G71S 4ECYA 2Q4VA 4NCGA 5KFTA 5LXRA 2BDPA 2K2PA 2V4JB 2W9AA 3C16B 4BWMA 4M5DB 1EJ7L 1XMBA 1RU1A 2R42A 3R7SB 2N7YA 3K57A 1EE3P 4TY8A 3BH6B 2PIIA 2FHOB 1Y5NB 2JEJA 1KVIA 3M8SA 4OC0A 3LUYA 1CS4B 2D3OR 2QLWA 4Y49C 3DGVA 1T9XA 2XLKA 2V0NA 5T7LB 2HG4A 2AGQA 3LALA 3LP2A 2ZWOA 2BE9B 4P6QA 1WC6A 3IWNC 1JLBA 3CJTA 2RD5C 1M4DA 3V8IA 1REVB 1DQAA 3SSRA 1WOOA 4WFXA 3VAIA 3R5BA 2FIUA 2VIHA 3EFAA 1TK5A 4F0HA 2IHR1 1FVQA 4ZIWA 5KFEA 1RT4B 2HBZB 3D67A 1Q81T 4FKXA 5KFYA 2XMAA 5FJ4A 3LD2A 1RKJA 3B2YA 2A10A 2HBRB 4DR5F 2I0XA 3PB9X 1YBTA 4J90A 1L3VA 1D8YA 1K0TA 4AB7A 2XMVA 1S99A 4I2QA 2J0QD 2PIYA 1KQSR 2UV8G 1KHWA 2DXDA 2PGCA 2DH7A 2HQDA 3R6LB 1RQ0A 3EJMA 2LYVA 3CD6S 2KG0A 2B5GB 4MK7A 4DSEA 1X31C 4KH0B 2ZM6J 4Q43A 3JSMA 1YX0A 4YY3F 2C3YA 1HNWJ 2DXFA 2HEKA 2ANPA 2J8MA 1RYRA 2R2UA 4ITSA 4YUDA 2HZAA 1EKSA 2XGQA 4JZ0A 3JTNA 4TYAA 1RT5B 4B02A 5EHHA 5KFGA 1U47A 1NK5A 5IT0A 3MI7X 4BS2A 1IR1A 4NA2A 1IOIA 3M30B 2Z3NA 3UWTA 3CMES 4CRYB 4ZK7M 2LQ9A 4CRJA 1UW9A 4OI1A 1BPNA 4DPTA 2OHDA 3OHAA 1L3KA 1YK9A 4GC7A 4U67Q 2GLFA 2ODFA 1IGBA 1WI8A 1XRYA 2RQMA 4MCPA 2B4BA 2C2ZB 4Q5VA 3FVLA 1WC4A 1HI0P 3MMAB 3AD7C 2BJ1A 2OSQA 3R8YA 3S7RA 4CGNA 4NLDA 1N34J 4YB1P 3UD3P 3BN7A 4JI0F 4LJMA 4H4KC 3G96A 3CCZA 4GM5A 3HM9A 1ZAXA 3CCJS 2R8HA 1YLXA 3Q0AA 3FEYB 4O44B 3S1TA 4PUOB 1JIHA 2QSFA 2LDYA 5E7OB 3QB8A 1ZTWA 2ZEJA 3FQLA 2FVGA 3DYAA 3JYTB 2QYVA 4FD4A 1BQNA 1PYSB 2AYEA 1M4GA 4NYZA 2HV2A 1RBOB 2HFOA 1X4BA 4ECWA 4IO1A 4RW6A 3FB3A 1S72S 4AVCA 1C1CB 1VI7A 2HS0A 3DR8A 5DZ7A 2RIJA 3N9UC 3DCAA 2OPQA 1TL7A 1LNQA 4EWTA 1FRIA 3LGNA 2B43A 4KR0B 1H3DA 3G8QA 3PFEA 2G0IA 4UBRA 1TMJA 2NYHA 4JXQA 4AQYF 5DWNA 4RN7A 3BBBA 2ACYA 4FYWB 3DN9A 3W8GA 4DV4F 3MM9A 2BABA 2CUYA 5ELYA 3CCWA 3MUVP 1W25A 2XQCA 3D7SB 1TAUA 1NH8A 1TF9A 2GLJA 2R2SA 3WR7A 3TAMA 2JSXA 1SUQA 4KVXA 2YKQA 2R9LA 3A8KA 1GXLA 4BHQA 4R9MA 7AT1B 2B4UA 4D3GA 5G0RA 3T5KA 4MTPA 2LA6A 4F2SA 3MOZA 1FESA 2IQ6A 2OEMA 4EYHB 3W91A 3K5OA 5CYQA 2VI7A 2CIJA 4CLPA 1VC6A 2DNZA 4PWWA 4ANDA 2D3O1 4FF4A 2HURA 1WOSA 4DV6J 1LW2A 5K8PA 3ITHA 1OYDA 1DTQB 3EWGA 3ZZOA 3HVAA 4OZ0A 3O2IA 1JWQA 4ES3A 2O4HA 3FCHA 1BHNA 5ETQA 1LANA 4I7FB 2CPZA 3QLHA 2ZW5A 2AT1B 4OJGA 1SC3B 3M6WA 4EZ6A 5CPAA 4F0XA 5IM0B 5A28A 4RNFA 3BSNA 3S6KA 3HSDA 4IUSA 2PE8A 3DNCA 5J2MB 1XNQF 2PSWA 4RW9A 4DFPA 4L75A 4LSZB 1TVRB 4Q38A 3D4UA 4OHVA 5K8NA 2OTLS 1VJWA 4GO7X 3H8YA 1FRMA 2NMTA 4EBEA 3BGUA 2E9ZA 3I9ZA 3OL6A 1RT3A 2IRXA 3V81A 1RWVB 3VAFA 1CX8A 2I00A 1C4CA 5L39A 1PJ5A 3HT0A 3UE2A 2PC1A 4BINA 1TKJA 3G8WA 2VG5A 5KFSA 2DR9A 3E2EA 4B17A 3L7UA 4DL0C 4TNUA 2C6CA 4CAEA 4IR9A 1S6PB 4F3OA 4UY85 5G22A 5F8LA 2FJXA 3UN3A 3M9OB 2DXQA 3I5CA 1T02A 3HI9A 3R5DA 1GFWB 1DLOB 2FHMA 2HUZA 2HW3A 2IM1A 2W4CA 1LWEA 5A8KB 4Y28C 5HP1A 4RUCA 2R7UA 4ZLLA 3L7OA 1Y10A 4H4OB 3SXNA 1V3SA 4CDIA 2VC0A 4B3MF 4Z65A 2EUIA 4JBCA 4K4WA 1YQEA 2MZTA 4ZY1A 2G13A 5EUHA 5KTCA 2VG6B 2KL8A 3O6QA 4NLQA 3TOAA 1B4SA 2C3PA 2JC1A 4QC6A 3QRQA 1HNIA 1I3OB 3GFHA 4RL1A 3T19A 4FUUA 2BW7A 4OV6A 4MK8A 2XMMA 4K7QA 4CT9A 2WW4A 5T41A 4AVBA 4EU0A 2V8DA 4ECVA 2RC4A 1S12A 2W9CB 1QLNA 3SJXA 2OPSB 2CNKB 2JJ4D 2C28A 3GJSB 4NZ6A 4DL7A 1XBWA 3GJQB 1VBYA 4M63A 1QAJA 1ZYQA 1AW0A 2FGOA 3K8WA 3QATA 4J9PA 1KZFA 4MHPA 1MWZA 2RKIB 3C14B 3UY5A 3CJ4A 1HEEA 4DQRA 3PW0A 4DR5J 3DLBA 5HH1A 5F0UA 1SKWA 4JUZA 4LT6A 2N3OA 2GVZB 4X66F 3Q8UA 3C16A 2QLFB 5KFHA 2B3UA 4M5DA 1Z8XA 2Y0SD 5K20B 2HHUA 4DL3A 3PJXA 2GJIA 2JEFA 2UZAA 1SJFA 1CS4A 2BANB 2DEAA 2OELA 3HCXA 5E33A 1DE4C 5T7LA 5M2PA 5B0CA 2BUNA 1WWHA 3H98A 3T5LA 3GP9A 2V69A 3CD5A 1FKOB 2MKHA 1REVA 2L3MA 2XS7A 2BJ7A 4C8YA 2NXEA 3WT4A 1FNOA 2BRLA 4O0IA 3NH5A 3J7Z5 1Q78A 4KTQA 4GRSA 3PX4A 4YY3J 1EARA 1NJYA 1LOKA 4H6ZA 2RT3A 2HHVA 4ECQA 8RUCA 1UFHA 5SUHA 1RT4A 2KT2A 2Z56B 1A2ZA 2FLNA 4OI6A 1NPKA 4WU3A 3IEHA 5A6PA 2IRYA 3TAPA 2IBKA 2GREA 2VU5A 2IJNA 1F6TA 3CO0P 1CJWA 5AE1A 1OO0B 3T9ZA 1NPPA 3IAS9 1XEZA 4A8FA 4CPAA 3H4QA 4RO0A 4ZPAA 1NJXA 1N5TA 2XLJA 5DRKA 1WEYA 1DBDA 2DNOA 1RE1B 3GR1A 4Q0BB 1IYKA 4N41A 4LSLB 1REGX 4Z7YA 4ELUA 3GSIA 2YQ1A 1T05B 1MJ9A 4ID8A 3QRRA 1Q7LB 2B5GA 2HQYA 1JNZB 4ZIVA 4JI0J 2CWKA 4JI7F 2QECA 2PI5A 4ZI6A 4JI1F 3BO4A 2VZYA 4F67A 4QIFA 5B0FA 2HVDA 3LTOA 2FB0A 1SQFA 2CNNB 3OUYB 4PK2A 2YNIB 2IVMA 2GO8A 3DKDA 3MM7A 1VOMA 2D1CA 2U1AA 3HZEA 4XK8C 4B6ZA 3MPYA 1U48A 2X51A 1C4AA 1RT5A 2BQ3A 5D3GB 5CXTA 4ZP8A 4RBVA 3M30A 2RAQA 1Y0YA 3Q8PB 3CMAS 2E7XA 4LFAJ 4JI3F 2E9RX 4M5KA 1RSCA 3NAHA 1M44A 3CSKA 4KOYA 2LQBA 1DURA 2ZHAA 1OPIA 3KL9A 3KUGA 1H38A 3MMAA 3OFGA 2WRMA 3MTJA 4M94A 2Z2ZA 1NKBA 1BWVA 4C8OA 5A8WB 3I82A 3TVKA 4RWWA 2J9DE 2E5IA 4DI6A 4EBDA 2WB1D 1VQ8S 4IF5A 4OHYA 4DQSA 1V9OA 4DV4J 1FEHA 4PG5A 2SXLA 3M6UA 1B87A 4KZTA 1LWXA 2Z3PA 4O44A 3ZTQA 4PUOA 4NJRA 2PEHA 4RJVA 3BI1A 2AF6A 2Q04A 2ZHOA 1XR7A 4FDFA 1OZPA 4P72A 3JYTA 4HTJA 2CG4A 3HMJG 3C6UB 1VQLS 3PEJA 1S6OA 5D0EA 2Z3KA 2OMOA 2PJ8A 2CPIA 1M0SA 2X1BA 1C1CA 5HMZA 3JUWA 4OZNA 2FXFA 3W66A 3O5TB 2M8HA 4M5GA 3TW0A 1FWPA 2ZKTA 2OSRA 4LQ6A 1RHMB 3TZZA 3MUMP 2HQGA 5KOXA 1S4EA 3TTHA 4GS4A 5THWA 4QYZK 2VASA 3R9EA 1U7LA 3NRBA 3CF5Q 2E1CA 2PJ4A 2ZBQA 3HHDA 3TNVA 4HNXB 4WFAQ 3RJMB 4F2RA 1XNQJ 2C1CA 1RK8A 3K5PA 2DNQA 4HYKA 4NEYA 2DRDA 2Q51A 2LQJA 1LEOA 3TWZA 2ASLA 2MJNA 2F1FA 4DDFA 1RXTA 3DLHA 4UCPA 3VGUA 3KK1B 2EFOA 4FKYA 2KT3A 4ZLPA 3LP0B 4CIOA 3N7ZA 4TN2A 1XBUA 1C0UB 1ZAVA 3ZJ0A 3K8VA 4DV7F 1DTQA 2C2EA 2OB0A 2ZZMA 1S1WB 1LXNA 3PW5A 4I7FA 1F2OA 1FF2A 1LWCB 2HPUA 3HHEA 4DQQA 2QN6B 3H5XA 2IDLA 5IM0A 1VK8A 2JEVA 2W4DA 1S57A 3SQGB 5J2MA 1N0VC 1NSPA 5DDQC 2ZH3A 3JB9k 4ZVOB 1TVRA 4DZDA 1OMSA 3FNCA 1WSVA 1WHXA 2OP5A 1H6KX 4TLRA 4B3MJ 4Q2MA 3TOQA 4B5PB 5H84A 4FVCA 1AROP 3P5TL 1RI7A 2NPFA 4E8UA 3KXDA 4CO0A 5EC4A 2Q1LA 2D9PA 1TKZB 4NI2B 4MY0A 1TL4A 2GJFA 2DHXA 2G2ZA 2EEYA 1R0AB 2M9KA 3OBIA 4KUBA 2X7BA 1SKUB 1CULB 2FQQB 3MM6B 3BGFA 5AG7A 1YX2A 1S6PA 1VRTB 2QVPA 4YR3A 2FHJD 4IH5A 1PC5A 4DFKA 2DCLA 1PILA 5GADI 1NJWA 3UNGC 3BDEA 4EMDA 4CAFA 1FD2A 3WBZA 1DLOA 4KHRA 2E66A 2CWXA 3WC0A 4IUFA 2OFHX 4F6AA 4ZJQA 5A8KA 3BPSP 2Y0BB 4WCEQ 4H4OA 5L9XA 2JVRA 4QIVA 1L5UA 4KGVB 2UUCF 1CC7A 2JEGA 5LL6d 4R25A 4OYPA 2DGWA 4X66J 4M8LA 4K2XA 4MCQA 3HJVA 4CLFA 1HL6A 4P6YA 5KFUA 4HLBA 2VG6A 5L1LA 4XO0A 1K4JA 1X5PA 2YPYA 3BDPA 3PJWA 4CH7A 4GO5X 3ETOA 4W4MA 3TYTA 5ETTA 1RCXB 4CI0B 2F7VA 3OD2A 3AXKA 1NAQA 3NCQA 4NE9C 3OL9A 1Q1KA 3WC2A 4KC5A 4DMZA 2OPSA 1IN0A 3VHQA 4CYUB 2BQUA 4K5RA 3QGGA 2DHHA 1CM0A 1I51B 1MLAA 1RAEB 2JBKA 2F8EX 3EE3A 1NK4A 1X4DA 3NFZA 5D0HA 3M32B 4B13A 2YKNB 4KKOB 3ZZ0A 2RKIA 3C14A 2IC3B 4FBTA 2E1MC 1Q5YA 4AL5A 4J9SA 4ZY2A 2PJ2A 3SV4A 1R27B 1LCPA 2XHCA 2WVBA 2GVZA 3UPFA 1F5AA 4ECXA 1M1HA 3PW2A 4LF5F 4PG6A 2KFYA 2Q3PA 3BGOP 3N0VA 4DBQA 5C82A 3KR5A <