1R3NA

Crystal structure of beta-alanine synthase from saccharomyces kluyveri
Total Genus 151
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
151
sequence length
438
structure length
438
Chain Sequence
GTLNLPAAAPLSIASGRLNQTILETGSQFGGVARWGQESHEFGMRRLAGTALDGAMRDWFTNECESLGCKVKVDKIGNMFAVYPGKNGGKPTATGSHLDTQPEAGKYDGILGVLAGLEVLRTFKDNNYVPNYDVCVVVWFNEEGARFARSCTGSSVWSHDLSLEEAYGLMSVGEDKPESVYDSLKNIGYIGDTPASYKENEIDAHFELHIEQGPILEDENKAIGIVTGVQAYNWQKVTVHGVGAHAGTTPWRLRKDALLMSSKMIVAASEIAQRHNGLFTCGIIDAKPYSVNIIPGEVSFTLDFRHPSDDVLATMLKEAAAEFDRLIKINDGGALSYESETLQVSPAVNFHEVCIECVSRSAFAQFKKDQVRQIWSGAGHDSCQTAPHVPTSMIFIPSKDGLSHNYYEYSSPEEIENGFKVLLQAIINYDNYRVIRGH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Yeast beta-Alanine Synthase Shares a Structural Scaffold and Origin with Dizinc-dependent Exopeptidases
pubmed doi rcsb
source organism Lachancea kluyveri
molecule tags Hydrolase
molecule keywords beta-alanine synthase
total genus 151
structure length 438
sequence length 438
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 3.5.1.6: Beta-ureidopropionase.
pdb deposition date 2003-10-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01546 Peptidase_M20 Peptidase family M20/M25/M40
A PF07687 M20_dimer Peptidase dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.360 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1r3nA02
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 1r3nA01
4R76A 2PJ8A 2EK9A 3D7FA 3GLJA 4P4JA 1YW4A 2AFWA 4K3NA 2IMOA 1ELLP 1ZG9A 2QJ8A 1TXRA 1YMEA 3DLJA 4WJBA 3ISXA 4P4BA 4B6ZA 2GLJA 3I1UA 5CBMA 1CPSA 1ZLIA 1AMPA 4PXBA 4OC0A 3FECA 4A37A 3L2NA 3WC6A 5J1QA 1Y0YA 3KHZA 5JGFA 8CPAA 1FNOA 1ARMA 4NGTA 1Q7LA 4MCRA 5DS0A 4MXUA 2CIJA 3KGQA 4RUHA 2ZEEA 2PJBA 4MHYA 2PJ0A 3D7GA 2PJ6A 3GUXA 2PJ7A 3D66A 2CTCA 2JBKA 1KWMA 2Q43A 1Y0RA 5LYDA 4G1PA 2PCUA 4IK2A 2PE3A 3KR5A 1VHEA 3SJXA 1R43A 5K8NA 3NFZA 4PPZA 4TNUA 4MCQA 4F8ZA 4TWEA 2GREA 5ELYA 4LQGA 4FAIA 1XJOA 3FEDA 2DEAA 3S9NA 2EK8A 4EWTA 1XMBA 2AFSA 2J9AA 5THWA 3BXMA 4ZX9A 1TF9A 1CP7A 2FVGA 4PXDA 3KQXA 3B3TA 1VHOA 1DE4C 2IJZA 2V8DA 4ZI6A 1BPNA 2HC9A 2PJ5A 3KL9A 4DUKA 3FX6A 3D4UA 4ZY1A 4DJLA 2I3CA 1LAMA 3S9LA 1ZG7A 3B3WA 4OKOA 2XEJA 4W9YA 4YU9A 3V7ZA 2ZOGA 3LMSA 2V8VA 2BOAA 3H8GA 4OC5A 3PB8X 2AFUA 2C1CA 4R7MA 2IQ6A 4OP4A 2QYVA 4ZY0A 3HLPA 3IC1A 2PJ1A 2F8HA 1LANA 3PFEA 7CPAA 1PYTB 1Z8LA 3K2KA 4P4IA 5JM6A 4OC1A 1BLLE 1M4LA 3FH4A 3NA6A 3HUVA 5K8OA 3PB6X 3NH5A 2PJAA 3PB7X 4PQAA 1YLOA 1FT7A 4WWVA 1Z5RA 2C6CA 2CTBA 4UEEA 2XEIA 4MHNA 2ZEHA 3B7IA 1IY7A 3CPXA 4R6TA 3IWWA 4P4EA 4P4DA 1CX8A 4OC2A 1BPMA 2WZNA 4JZ0A 5CPAA 4UEFA 3SJFA 4UF4A 4X3RA 3PB9X 2ZEFA 2PIYA 3SI1A 4Z65A 5LYIA 1YSJA 3MN8A 1LFWA 2AFMA 3SI2A 2PVWA 1QMUA 4P10A 4NGSA 4IHMA 3T8WA 3PBBA 5HVHA 5HVGA 2CF4A 4A39A 2XEFA 4FWUA 2ZELA 3NH4A 3TC8A 2RFHA 1UWYA 3IEHA 3FVLA 4IAVA 4OIDA 4F9VA 5LYLA 5F09A 1F57A 3WC5A 4MMOA 3PFOA 3WC7A 2AFOA 4EFDA 3B3SA 4PXCA 3KHXA 2PJ9A 4MRIA 2QVPA 3BI0A 1CBXA 1VIXA 3D68A 3H8FA 4MHPA 1YW6A 4P45A 3BI1A 3FJUA 3N5FA 2O53A 1CPXA 1XFOA 1AYEA 2ZEDA 6CPAA 3SI0A 3LWUA 1LOKA 3IIBA 3KI9A 2GLFA 4AXVA 2ANPA 2HB6A 4GM5A 3S9MA 4KSIA 5LYFA 1RTQA 2WYRA 2Q4ZA 3D7DA 4NFRA 1CP6A 1ZG8A 1XBUA 4CPAA 3K9TA 3SJGA 5D29A 1EE3P 3QNVA 4ONWA 2G9DA 3D7HA 3KZWA 4H2KA 3MRUA 3VARA 2V8HA 2JBJA 3PB4X 3RBUA 3IJ3A 2BCOA 3NH8A 5D8NA 4BD9A 2C6PA 4FUUA 2PRQA 4P4FA 5K8MA 4OC3A 4NGNA 3D67A 1ARLA 5HXDA 4OC4A 3KQZA 2AFXA 4ZYQA 3KR4A 1XRYA 3VH9A 3CDXA 1HDQA 2GU2A 4YWYA 3IFEA 2RB7A 3DGVA 3B35A 5I4MA 2PJ4A 1OBRA 1TKFA 4NGPA 3PEIA 1ZLHA 3CT9A 3WABA 4ZX8A 4DYOA 2JEWA 2Q51A 4FBEA 2ZEMA 1H8LA 3ISZA 3JRUA 3KASA 4UIBA 3RZAA 2NSMA 2F7VA 1GYTA 4MCPA 4X2TA 5HVFA 4P44A 1VGYA 3PBEA 3BHXA 4F9UA 4OIWA 2NYQA 1DTDA 4NGRA 4UEZA 1QQ9A 1TKHA 3SJEA 2POKA 2OR4A 4X8IA 1NSAA 1IGBA 3VATA 3FEEA 1LCPA 4MHZA 1JQGA 4ZY2A 1LAPA 1Z2LA 3B3CA 3TX8A 2XEGA 3FMCA 5LRKA 1R3NA 2ZEOA 3PRTA 1HEEA 1TF8A 4NGMA 4O23A 4Q7AA 3CPAA 2EWBA 2C6GA 2O4HA 4UIAA 4PXEA 2ZOFA 3B2YA 3B3VA 2PJCA 3IO1A 3H8EA 4P6YA 4OMEA 3GB0A 4EMEA 1CG2A 2ABZA 2PIZA 2BO9A 2V77A 4NJRA 3V38A 2PVVA 4A94A 2VL1A 2ZEGA 1HDUA 2V8GA 1TKJA 3WT4A 3FF3A 2ZENA 2OOTA 1BAVA 5IB9A 4JYWA 5LRGA 1Y7EA 1PCAA 1F2OA 1ELMP 2ZEPA 1F2PA 4MCSA 4NJQA 2AFZA 2PJ2A 4R8FA 4A38A 2PJ3A 5LRJA 5K8PA 5JH9A 3RAMA 4NGQA
chains in the Genus database with same CATH superfamily
4UQGA 4M6GA 2EK9A 4TU8A 1RWUA 1NDLA 4P4JA 4TXSA 3DU5A 4YN3B 2QJ8A 4DPWA 4K4ZA 3OHAA 2J0XA 1IKXA 1S0VA 1HQ2A 3PIPQ 3HHLD 4ED4A 1SC6A 1URNA 2VICA 1RLDA 3JSMA 1KVJA 2ROPA 3H2VE 3OXGA 3CO9A 1U1NA 2IIHA 4MIWA 2UVWA 5HMZA 3N9UC 4YOEA 2NS1B 1IWGA 2VG7B 1M44A 4PG8A 4ZIVA 2DEIA 4DF4A 4ZVSB 4MH8A 3UD4P 4DSKA 4PPZA 2ADCA 1CJKB 1NM2A 5C42B 2UVRA 4N56A 2XLIA 4LF6F 1N5QA 1IWAA 1JK9B 3BGRB 4U7UK 5C25A 4JI4F 5G22A 3H59A 2AGPA 2O67A 3AOCA 3MAAA 5BR8F 2YKOA 4ZKAA 1VDHA 2DTJA 1FDBA 1NJYA 4JI8J 3JTOA 4ITSA 2DEJA 2LEBA 2ZJQQ 2XNRA 5LMUF 4FYWB 2J5AA 2Z3LA 1V5VA 2PJ5A 4CO0A 2VJUA 4KHPF 2M2BA 5A8WB 1TELA 1RXOB 1FNMA 2B4OA 2XEJA 3THVA 2KZZA 1VQLS 3VCDA 4B9MA 2QMXA 4IF5A 5A76A 1B7FA 5KG0A 1TUWA 2DXFA 2H9ZA 2IBOA 2XYPB 1OO0B 1TL7B 7CPAA 2OU2A 4JI3J 2W2NP 3P5TL 3G6ES 3UY5A 2XO7A 1YIJS 2B4UA 2WSEC 4C97A 2Y9HA 2LA4A 3TOAA 4H4MA 3I5BA 4UEEA 4HACA 2XEIA 4Y6IA 2CNTA 3DSBA 1IY7A 3K7RA 1N33F 5H9FK 2FQQB 3FMBA 1RA7A 1R8AA 2XGQA 4OC2A 3TTHA 2IDEA 1UFHA 3M8WA 3PB9X 3BV8A 2PIYA 2KCWA 3TVKA 3UVJB 4Z65A 2DYAA 3OFGA 5I3UB 1XJWB 3EGNA 5D8HB 1SKSA 1DARA 2ZPAA 2AJ0A 5D0RA 2JVRA 3NBPB 3OLAA 4X64F 2W9AA 4KHRA 1BQMA 1X4CA 4XDDA 1DTTA 5DGAA 2ZH7A 1I5OB 4U6PA 2LXUA 4XPEA 1VQ9S 2V63A 4TVAB 1P9YA 2E9ZA 1ICEB 1W2IA 1PG5B 2O28A 1U02A 1T02A 3N5FA 3WBZA 2FHOB 4LMZA 2JDDA 2ZNZA 5BWAB 1ZM3A 3SXNA 1BQMB 2IRXA 5M2UA 1HNWJ 2ZZNA 3EVWA 3NGRA 1NSLA 3D7DA 4RS2A 1F5BA 1YGHA 1SB6A 1KS2A 3GP9A 2OGUA 4WFAQ 1F1BB 3AD7C 4QWEA 4F0MA 2MB0B 2G3TA 2UVUA 3A9LA 3MFIA 3WR7A 4OC3A 4RUBA 2L9NA 1Q7YT 3V2UC 5IZHA 1H74A 2UUCJ 3PKMA 2VZ9A 4TNOA 2V2VA 2MJNA 3JS9A 4KLWA 2AFXA 4JI0F 3WDOA 4HDHA 2D7SA 3W63A 2OEKA 4OI0A 3OXFA 2EFNA 3PRVA 1UJ5A 5HL7Q 2NCKL 2NXEA 2ZJPQ 5I4MA 2PR1A 5EWGA 1BXNA 2M70A 2PJ4A 2EK1A 3Q8RB 2RDDA 4M5MA 2XWXA 3LOUA 4CLYA 4ZLLA 5HROB 2RS8A 4HT5A 3ISZA 3DHWC 1G4CA 1GMVA 4QBJA 3H4DA 1S9EA 4JV0A 1WG1A 5DQIA 1TKZB 2P6SA 4V19J 4K8RA 2RE1A 5KAKA 4EBCA 2NYHA 2QL9B 5IFMA 3SJEA 1LQ9A 3NBPA 1Y3KA 5C25B 1SV5A 2ZEOA 3Q23A 1U0HA 1BE4A 2IM2A 2O4HA 1SQFA 2H5JB 4NX9A 5KG2A 3J81j 4FS1A 2BW2A 3RTVA 1M5HA 3MCSA 3ZNJ1 2GVDB 4ZK7M 5GADU 1ZO0A 4J5OA 2OD6A 1MWQA 5HROA 4AQYF 2IA0A 2CUYA 1RT6B 2FY8A 2J7WA 4B5OA 3HX9A 1E6YB 2A6OA 1PIEA 4C8OA 3TOBA 5KOXA 3JSMB 2CAJA 1RHJB 2M7SA 2VV5A 1ELMP 1RDRA 4NJQA 2PJ2A 3I6PA 4WZMA 2GC8A 4S0MA 3G86A 4U5YA 1AXQA 3MD1A 1JIHA 2L41A 3HSJA 3OUYB 4NLDA 4Q8EA 4DG1B 5KG5A 3IWEA 1SQHA 3GLJA 4OV6A 1YW4A 1WK4A 3BDPA 1WHXA 2CNNB 1TXRA 2DNPA 1Q1KA 3ISXA 4NLPA 4WE1B 3K5LA 2OLWA 3KOAA 1T94A 4WFZA 2CQ1A 2V2KA 2P0WA 1URRA 3MCMA 2WW8A 1OSCA 4WTOB 4JXQA 2B5GA 3NY0A 4UY8T 3HK2A 4EZ9A 4MXUA 2F65A 2IVYA 4ZIWA 1YBUA 3V4IA 2M88A 4KAIA 4HT7A 4FXDA 1P1TA 1Z8XA 2IDLA 1KBRA 1RBLA 3KHLA 1SUQA 2VA2A 3GJSB 3WZ0A 4P74A 4IH7A 4MTPA 3QLHB 1RTJB 3CNQP 3W3SA 5KTQA 1BC6A 2AJ4A 1GHEA 3SJXA 2E9RX 1HPZB 5JMNA 3SCLE 4O44B 5EUHA 3NGDA 3MMAA 4MIBA 4CTAA 3CCRS 3G6YA 4P2FA 4KFBA 2WONB 5HJXA 2AE6A 1RQ0A 5FD1A 3HSGA 2BE7D 5RUBA 1YBTA 1I94J 3FX6A 1RAIB 4DZDA 4RX6A 2DR9A 4B3RF 4AE5A 3JXOA 4FXWA 1OZPA 3KLHB 4NA2A 1NDCA 2XMAA 3FIXA 5ISVA 3N28A 1FKOA 1IBMF 4KB7A 1RAAB 1S1UA 4J9VA 4AYBD 2VC1A 2NXJA 4K7QA 4LFCF 2LDIA 4K30A 1SC1B 4DN0A 3F56A 4HNWB 3HUVA 3PB7X 5ETVA 1IBMJ 1M5PC 4KHPJ 2D3UA 1HBOA 2BRKA 4D3GA 1TIQA 3TQEA 2C2NA 4EGLA 4IFVB 2IM0A 2PGCA 4M5HA 4C8YA 2J8AA 2B3UA 1WC1A 3EGWB 4I56A 4LFCJ 1OPZA 1CJUA 2I5JA 2C2ZB 3HHEA 5E3RA 1QDUB 3VAKA 2XMVA 5AXKA 3GMGA 1RXTA 1SIZA 3VF0B 2LFVA 5EMIA 4JV5F 1F57A 4WIIA 1XMQJ 3CW2C 3IAM9 3CJ5A 1MG7A 3CULA 4LRAA 1TKTA 1JLFA 1HMVA 2LQJA 2KB2A 4X64J 4JI5F 3AXKA 2OPRA 1N5YB 3TAPA 2YNGA 4U8VA 2Z2LA 1Q86T 2FVPA 2MEWA 3GTYX 3VAHA 3KTQA 2DVIA 5T14A 3C16B 3SSQA 1S4FA 2VFTA 1N48A 3J7YI 3W2WB 3K9TA 2VBYA 4K4SA 4OX8A 1FDAA 3OL7A 4UWIA 4CWBA 1RAHB 4N47A 1RTDA 3R9GA 2UU9F 4A8SA 2G0BA 2E1RA 3FQLA 3ZZRA 3VARA 2W25A 2BCOA 2CZVC 1HWIA 1HBUB 4HHJA 4CLZA 4FUUA 1JLEB 2BRLA 3D67A 3KJFB 4NRTA 3WC2A 4ZYQA 5AXNA 2FPHX 1VC6A 4JV2A 1Q2YA 4LF4F 3CJ4A 2HZAA 4KVOE 4PG4A 2ZEJA 3PEHA 3QYYA 2UVVA 1S7KA 2Q51A 4QPTA 3HVWA 2ZOMA 1YQHA 4GO7X 2AZ1A 4DJBA 2RKIA 3UCZP 1AZSB 2QA2A 5HVFA 3F44A 4F04B 4DWIA 3RAQA 1TKXB 4QOTA 4IRCA 1ITPA 1ELOA 2QZ8A 4ID5A 4DCJB 3M8RA 2GV1A 5AXMA 2G2OA 1F2HA 2R4FA 2OR4A 4OHVA 2Z3PA 2EBEA 4A8OA 1JQGA 3R5JB 1PJ5A 2XTJP 4AXJA 2NR0A 3TX8A 3ZZPA 3DOLB 2X1GA 3QO9B 4BBHA 3GY9A 1D0EA 4Q2LA 3B3VA 3MMCB 4DF8A 5AJ3F 1U7LA 3HJFA 1UA0A 2N3LA 1YRXA 2KHCA 3A3NB 3V6KA 4PAAA 2I0XA 1H72C 4ECYA 4CO4A 1Q7LB 2VDIA 2K3KA 2LMIA 3PO5A 3GR1A 3MXHP 4NASA 1NZAA 3R6LB 5KFLA 4NI2B 2GE3A 3D3SA 3Q86A 1T0TV 2RF2A 4HHUA 2MKKA 3B54A 4RW4A 3GQCA 3C2PA 1N32J 4PSXA 1UMJA 4WP8A 4QIVA 2WOMA 4WP9A 2J8NA 2AFWA 1SJ3P 3FEZA 2MQLA 3RU0A 4CAXA 3JAMY 4JI0J 4LF5F 2B4VA 1E6VA 5CBMA 2C22A 5CQGA 1ZLIA 5D78A 2J8RA 2Z30B 1Q16B 2QYGA 1VQOS 4UFVA 1YLEA 1RWWB 4QYZJ 3HLUA 3KLEB 3KHZA 4J90A 3K58A 2FLPA 2ZBIA 5ETRA 3EZOA 3M2RB 5D4NA 1HNIB 1ARMA 3RO0A 4OX6A 1YJ7A 3DYAB 3VAIA 3C16A 2VBZA 4UY85 4MHYA 2AJ6A 4X5KA 4KO0A 4F7VA 2QT7A 3FJ2A 4DFKA 3IM8A 5LYDA 4P6QA 4G1QA 1T8EA 3VAFA 3NFZA 4NWBA 2BSWA 3N0VA 4IFVA 1U6BA 4KTQA 2DHHA 3SZ2A 3WC0A 3GPAA 4F4KA 1RAOA 3NCPA 1JLAA 5A27A 1VBZA 3N7ZA 1XMBA 2WCXA 4CP5A 2J9AA 2CPEA 3BXMA 2JFKA 4KO0B 4USIA 2YX7A 3KQXA 2DR8A 4PKDB 2IJZA 3MD3A 4ZI6A 4MJ8A 1BGXT 1H2UX 3SQGA 2XC9A 3B3WA 4OKOA 2RF2B 4YU9A 2ATRA 5A6WA 2YVSA 1SXLA 1PJ6A 2R2TA 2XMJA 3UDCA 3U27A 2E66A 3KFWX 3CDEA 1RGVA 1UZHA 4OMFG 1QSNA 1IU8A 4Q8FA 1KLMB 1F3FA 1V5IB 4UW2A 2QGFB 5K8OA 1H7WA 3GYXB 1SVDA 1XMOJ 2H5MA 3JQKA 2JNJA 1D09B 1S12A 3ULHA 1QSSA 4RNMA 1BWVA 8AT1B 1LW0B 1YVOA 4YB5A 4ZITA 4JZ0A 3V4MA 4B14A 1C1CA 2CJYB 1NUEA 3IGVA 4NLQA 1VQNS 4ZVTB 2CDQA 1VC0A 3FBUA 2OMOA 3OTEA 2EPIA 1MLAA 3SI2A 5ADZA 2YNIA 1CLFA 3QFWA 4HVZA 5HVHA 3QZ7A 2BE9B 3NAHA 2XEFA 1X0FA 4FWUA 4IRKA 4IDKB 4F25A 1YTYA 3R6GB 3FK4A 5GAEI 4PG6A 2KI2A 1MN7A 1RT1B 3IRWP 5L1IA 3LPEA 1JX4A 5K14B 4QIWD 3QFHA 3H8FA 4R5PA 3W2VA 3HT3A 2O53A 1T95A 2DBBA 1OJ4A 4HYKA 4EBDA 3OHBA 2UUWA 4NLVA 3FRZA 2ZE2B 1SUQB 2N4CA 2DRDA 4R8UA 1B4SA 1S48A 1GX5A 4J9OA 4UUWA 1ZG8A 4K0KJ 4DI6A 3GIMA 1T7PA 1KC8T 4KBIA 1TK0A 1N33J 5FDLB 1YZ7A 1NB2A 4ZVUB 3DI6B 3MMBB 2W2PP 4NPOA 2CQ0A 3I5CA 1Y9KA 4CCHA 3DN9A 3V5RA 5M2PA 3RBUA 2AYEA 2AZ3A 2EG2A 4RW8B 4B9SA 1JJ4A 1RAGB 5IM0A 3JTKA 2E5HA 2W2MP 2CQHA 4LX9A 4FYXB 1HBNB 3DDNA 4DX8H 2B7BB 3UD3P 2MHEA 2I6WA 4PSWA 4ED6A 5B09A 3PEIA 3HZEA 4HDGA 5KG7A 2PC6A 4UCNA 1RT2B 1TQLA 1H8LA 1UFWA 2NLWA 4CH7A 4F4WA 3RZAA 2CQ4A 3ITHB 3KMSA 3NRBA 2CJBA 3RBXA 3PR5B 3QAHA 2VOOA 3POTA 2KVIA 2VI7A 2K1RB 4DV7F 2UUAJ 1T05B 2CZ4A 1Y00A 3CDBA 4LBIA 3CDUA 5LRKA 2Z56B 3MR6A 3Q2SC 2RU3A 2EUIA 3Q8UA 2QA1A 2GCFA 1PU9A 4TLQA 1FT8A 4O3QA 1U45A 3TE4A 1Q79A 2PIZA 1WOSA 1RWNB 3D6FB 1DLOB 3D1QA 4TKTA 4LSNB 4XO0A 2VL1A 1IBCB 4GKKJ 3IBWA 4OJGA 1M1GA 4H4KA 3VGSA 2RMLA 3EXCX 2OZGA 1IBLF 2X1BA 5JXSA 3TAMA 3U1MA 3RRGA 5DM6Q 2H51B 1BQXA 1PCAA 3MM5B 4LF1A 5DS7A 5E7OB 4FPRA 3A8JA 1IIDA 3KLGA 2YKMA 4C98A 1EHWA 3J81Y 4LIRA 4JI7J 1ON0A 2MZRA 3TUIC 3K2YA 1JXVA 4TYAA 2PJ8A 2MTLA 1EJ7L 2BL1A 1TK5A 3D7FA 2MZQA 2Q04A 3SMZA 3OVSA 1EETB 2D74B 2LP4A 5E33A 1GFWB 4AVAA 7FDRA 5ETOA 3DC2A 2E5IA 3KLIB 2ZC4A 1J5OA 3I9ZA 4R3LA 1S6PB 4QPXA 2V0NA 2GMHA 4C3LA 5KT6A 2G0CA 5DJBA 4ECTA 3MR2A 1RI7A 2BDPA 1DTQB 2BV3A 2CVIA 2Y1LB 2Q43A 4KY3A 2BJ8A 2XNQA 2V69A 5ETTA 4O44A 1UPMB 1VHEA 3BQ0A 4I64A 4MYUA 5J2QA 2K5TA 4ZMMA 2DEAA 3C66A 3KHGA 2RC4A 4XAKA 2YKNA 3GIUA 1D8YA 3Q83A 4RR5A 2LDYA 2F5GA 2F4VJ 2VFVA 2KG0A 5KFMA 4L75A 3RB4A 2CNLB 2PT0A 2KM8B 2BEIA 3IS9B 3EUNA 3ENAA 2NPIA 3HM9A 1XIQA 2RUSA 3HPOA 2VPZB 4AD6A 1W26A 2CA9A 4DJLA 2LXFA 3IAS9 1U09A 1I6JA 3AQOA 2ZOGA 3MR5A 3GILA 1YREA 1P6TA 2DK2A 2GX8A 4HL9A 1DURA 1U6ZA 1S7HA 2CQGA 2CPFA 3KWMA 2YPYA 4BHQA 1KR4A 4HACB 1FRKA 2NZ4A 4B3MF 1ZA1B 4MHNA 4DV3F 2XMKA 2FE7A 2CDRB 4IG3A 5J2QB 3TQ1A 2B6AB 3VWSA 1RADB 3T5LA 1OS5A 2CZ9A 3UDEA 1NJWA 4RO0A 2WZNA 5FDLA 4YEAA 2PDOA 4UF4A 4X3RA 1M90T 4R9MA 2JWNA 3LTOA 4I49A 3IS9A 2KRRA 3GV8B 4ANCA 2ARHA 4M6IA 3BYPA 1LFWA 2QL5B 2FVRA 2DPIA 2NXNA 4LF9J 1NJXA 4QYZK 2A2CA 2NMTA 2ZELA 2HHUA 3K8VA 3WC5A 4OX7A 4CLLA 4YB6A 1NO8A 3KKFA 3TFYA 2EFQA 4EBEA 3ETOA 3H0PA 2MSTA 3DRRB 1BD6A 3RBZA 2DRAA 5IXUA 1RTIA 1WC4A 3QZ8A 2E1MC 1VYAA 4E8OA 1RT5A 3SI0A 1HARA 2CYYA 4DL5A 4JI1J 1WWHA 3TEGA 5B0CA 1WDTA 1N36F 4NLWA 1TVRA 2HB6A 4E0DA 2VODA 4RI1A 2U2FA 3PYDA 3TA1A 2G0JA 4DNCA 3MM5A 4C7QA 2YBVA 1EE3P 3RBDA 4ONWA 1VQ7S 2MLXA 2MKIA 3CC2S 1JKHB 1Q2DA 1LW0A 3Q2TC 2R7QA 4Y65A 3IMQJ 1ARLA 4MY3A 4LQ9A 3MEGB 3QWPA 2M5YA 3Q24A 1X7VA 4JI6F 1EETA 4CDIA 3M9NB 1XQIA 2D3OR 2R8HA 1FRLA 3GE9A 4QR2A 1FESA 5FJ4A 3AQPA 2HFZA 2DH8A 4KSAA 3ILOA 2BMBA 1JB0C 3BH7B 1GYTA 4QYRA 4A95A 1XTZA 2HMIA 4F3OA 2FT0A 2VA3A 4C48A 4DL3A 3ADAC 4Y2CA 4CRZB 2H1YA 3I4HX 5ETQA 1FRMA 4CGNA 1X10A 4F2SA 4C0OC 1S0MA 3CTRA 4NLUA 1QVGR 4NA3A 4ZCIA 2JEIA 5DDOC 4RNOA 3SSRA 3CCJS 2PD1A 2HWIA 1ZS6A 2C6GA 2XZWA 2OJ3A 4DUYJ 3QMQA 2ZOFA 5HBMB 3BO3A 3CPWR 4ONUA 3MZIA 4EMEA 4X66J 4I4BA 5B0GA 1W7WA 3ZTQA 2G3AA 3E8OA 3OBIA 1WOPA 2PVVA 3AOBA 2H5EA 3M30B 1QSLA 3WT4A 3OR1B 3BGOP 1RE1B 3I96A 2HAIA 1OSDA 5JVHQ 4J91A 1KHWA 4K5RA 4DMZA 5L9XA 3HD1A 4F4ZA 4FNHA 5LOQA 1HBMA 3SV3A 2DO0A 3PXGa 5A8WA 3EJMA 1U1RA 3A4TA 2OPPB 2ILZA 4EYIB 4Y0FA 2R8JA 2KO1A 2DNNA 1H38A 3MM6A 5KFHA 2UU9J 4B3SJ 5DO2A 4PR6A 5H9EK 3ZJ0A 3VAGA 4OLOA 3W5ZA 2HYIB 1YMEA 4HNXB 4KPCA 3MEDA 2FJEB 1GTEA 4FF3A 3LAKA 2DD8S 3WC6A 1FEEA 1X4HA 3TX0A 4ZP9A 1S97A 4UOHA 1V9OA 4MCRA 3UR0A 4X4TA 2C42A 3HHDA 3KGQA 4FXVA 3OTBA 2UV8G 5GVQA 3GUXA 5IT9Y 5IM0B 2CTCA 1S4EA 2HSEB 3M9OB 1VQSA 4ICLA 3SEOA 1AW0A 4NZ6A 1ZH5A 1REVB 5KFTA 4TNUA 4CYPA 5D6GA 2ALZA 2VUGA 4M5LA 1XNQF 3WX8A 1SH0A 2HHSA 1HHSA 3M6VA 2GVZA 4WFNQ 2N7YA 4DL2A 3S8SA 1S7FA 1X4BA 2AX0A 2CFXA 3R2CJ 3ILJA 5THWA 3KK2A 3ZZYA 4G6VB 1RTHB 1U2FA 2VG7A 4YDDB 3CEDA 1C1CB 1V3RA 1S1VA 3FRYA 1XMQF 1CQMA 2DHAA 1NDPA 4U9ZA 2B3VA 4F4YA 4NA1A 4LF2A 2MGZB 1RWPB 2N3OA 3DLGB 4ETZA 4H4KC 2GQQA 4X4RA 1YITS 2N4DA 4A48A 1IBLJ 3S6HA 4A30A 3BSNA 2XZDB 1Z8LA 3DDDA 5JM6A 4QWCA 4ZPTR 2VFSA 3L95X 4R25A 4ZPAA 4Y2IA 3C6TA 4JLYA 8RUCA 1HNVA 3M2UB 4LUBA 1KZFA 2GO8A 3M8PB 4P4EA 4K4XA 4DX5A 4R0EA 1U1PA 3QRPA 1BPMA 2I8EA 4E98A 3PJWA 4A31A 5BXIA 3RR8A 3K89A 5KT4A 3UNYA 2R7XA 4C3MA 3H40A 1KUXA 1HQUA 2AV5A 5HVGA 3BGLA 1ZM2A 3KDOA 3D6TB 1SH3A 2Q7SA 1H98A 4IAVA 3VQSA 4AT1B 3W1YC 3PW5A 3K9UA 3PFOA 3G2XA 2AJ1A 4OI1A 1VOMA 2ROEA 2VDHA 3SCIE 1C0TA 1E6VB 3TVYA 2HHVA 1N71A 4ANEA 6AT1B 2JHEA 2DNYA 3CXPA 2JJ4D 2ZEDA 3SQGB 5KT2A 4JP8A 3P49B 4NRUA 3SQOP 3OTOF 3POTB 1G7CB 1FX4A 2PFDA 1C4CA 1QE1B 1HFEL 2V94A 4O3PA 3C6UB 3EVOA 5JVGQ 3CB4A 2BA9A 2B8PA 2M9KA 4NXNJ 1JLAB 4WU2A 4JJXA 3M6WA 1N5VA 2FCKA 4A8MP 3I3GA 2EC2A 1SKWA 3GIIA 3TJ9A 3C15A 1R7IA 5DQGA 3MRUA 3CCZA 2ZXVA 3IJ3A 2OFGX 3M2UA 2HZCA 3K8WA 1H2TZ 3HKZD 4Z37A 3DRPB 4OC4A 1SQEA 2ZJRQ 3KR4A 2AEMA 4IG0A 4ERDA 5KFXA 2FJAB 3AD9C 4K4TA 4CNYA 1DRZA 2PI5A 3TZWA 2UXCF 5FIIA 4L72B 2YNHA 1J4JA 4ZX8A 4DYOA 2JEWA 5F0UA 2VONA 3U1NA 4KKOA 3BJ7A 1K8AT 3NGTA 4BWJA 4ID5B 3GYGA 4ZGYB 2CPYA 5HSPA 4DFJA 2WONA 1S7NA 3C14B 4E0AA 2PSWA 5E3PA 3M7VA 3RGIA 2V4QA 3FNCA 1WF2A 2GIRA 4MHZA 1LAPA 5LL6d 2HV2A 4NMXA 2M8HA 4YY3F 4GVBB 4FD5A 3DCAA 4GMKA 2IJFA 3UPFA 3AJ2A 1WORA 4KOUA 2QLFB 3E01A 4DL7A 5F8NA 2WK4A 1VBYA 4F02A 2HGMA 4AUKA 2QEXS 1KQGB 1K47A 3JYTA 4LR7A 2J7UA 5HQ8A 4M5IA 5T41A 2REEA 4NJRA 3V38A 3IRXB 4YHHF 1FK9B 3NGKA 2UV8A 4QB9A 4PWWA 5IB9A 1QLNA 1MK4A 2VXKA 1SL0A 2EK6A 4DPTA 2FY1A 4RL1A 3VGVA 1YGYA 3GSDA 4ICLB 5H9EJ 3AD8C 3DOLA 2DY9A 4M5DA 3JAMU 1NK9A 2DGOA 3UI3A 2AJFE 4R3KA 3PRDA 5U47A 3NKYA 2ZH1A 5HQMA 4L6V3 3RG6A 4Q36A 2DR7A 1YWXA 1V6HA 1RT4A 3I4PA 2OPRB 4NYPA 3K57A 2ROGA 4FF1A 2CG8A 4GXHA 4ZP6A 3C15B 5E5NA 4R0JA 1S72S 1PC5A 1L3VA 1S59A 3SCJE 4QQBA 3PJXA 3D2MA 2GVZB 2MZTA 2HURA 3EDRB 5M2RA 2GZOA 4B9UA 2ZUGA 3Q8QB 1UJ6A 2M8DB 1L5UA 3M30A 1FVQA 3OR2A 4C8LA 2ZVSA 2Y0MA 4CLWA 4KPYA 5DS0A 2VFRA 4FKYA 1P27B 5E41A 5HLFA 3FKBA 4KR0B 3LA0A 4ELUA 3THPA 2B5JA 3TAQA 3HVAA 2Z3MA 3DNSA 1HIYA 2G1DA 3FEYB 1UW4A 4IK2A 5CNPA 3R7BB 1R8CA 3OSPA 4KS9A 3R95A 2GMLA 3TARA 1X5PA 2HNYB 1NEEA 3V8IA 5KFFA 3EICA 3ENQA 3CCTA 4UOGA 1N88A 4NLRA 2GA7A 4KOWA 1QE1A 4WK3A 1FRXA 2V8DA 1IN0A 3CD0A 4ZY1A 4YB7A 3S9LA 1HBMB 3KKWA 4UT4A 2FHJA 3FQKA 4F0YA 4KRWA 3ONQA 4ZY0A 3HLPA 4U67Q 1S1TA 2YNEA 3R5GA 2XWYA 2ZBQA 3K2KA 4DV0F 4M5NA 2ZFHA 1S6QA 3CMES 4C0BA 3HVRA 4A8FA 3NA6A 4UCPA 1Q81T 3PB6X 3NH5A 3M32A 1HYSA 3T6BA 4C4WA 4J9KA 1PGZA 2KVQE 5HP1B 4NSQA 4FVCA 4N7TA 4H6ZA 2XLJA 5A2QU 4FYVB 1GH8A 5LXYA 1CJTA 2HRYA 5BYRA 4JI3F 5MLCV 2ZEFA 3CJ3A 4KVME 5GAHI 3KK2B 2DGWA 3KJNB 3RB6A 1VQ5S 4NGSA 4JI4J 2OTJS 4YR2A 4USUA 2D9PA 3IWLA 2PDAA 2NYIA 4WBFA 1RT5B 4AQYJ 3QWUA 1HPZA 2FIUA 1UAWA 4G65A 4ORFA 2YXLA 3S7RA 2W4CA 1R8BA 2VG5B 4MHPA 3JQMA 2ZH5A 3IBCB 3V4IB 1RABB 1Y7PA 4W4MA 4EK2A 3BSOA 3E51A 1N36J 4IUFA 5J2MB 3F8KA 2RQ4A 3G6XA 3OD2A 2QSFA 4K2JA 3HFZB 2Z3NA 2FS5A 1RTQA 3NL0A 1QAXA 4U9YA 3A8EA 1XBUA 4ZJLA 4PUOB 2BM1A 4LF5J 2J6TA 3FYNA 3MEKA 5E3AA 3MEDB 5CYQA 1H0HB 2E1AA 2IAJA 2ZD1B 3DXSX 4RWWA 1X9MA 3MDFA 2FDNA 3IWGA 3OL8A 2B9WA 2D9OA 2HK3A 4USHA 1L3KA 3W62A 5F0WA 3SIPB 2QSWA 4MY0A 4P7VA 2V68A 3OUYA 1HQEB 3D0HE 4NGPA 5I3QA 4AG7A 1U2CA 5D4OA 4L76A 4KOSA 3KASA 3JRUA 2P5VA 2NSMA 2W9BB 2FHMA 4ED2A 4M63A 2XY6A 4QCLA 4X2TA 2ERRA 1FXLA 1GTHA 3LF0A 3UN3A 4IR9A 3EM1A 4DV3J 3FGVA 4CZCA 1D9DA 1M0SA 2ATLA 1Y7RA 4AVCA 2LLZA 3H42A 2PEBA 1ULRA 5KOWA 2ZBPA 4X8IA 4FD4A 4HLBA 4QVTA 1IJEB 5D15A 4CLUA 4LRDA 1TKTB 1R3NA 5J2NB 1UEKA 5L1LA 1Q5YA 2FL4A 5I0CA 1HW9A 4GS4A 3JB9k 2AHOB 3OR1A 2P9CA 1RT3B 4B10A 4L73A 3OV7A 2AMCB 3NLCA 3UD5A 2AP6A 1WSRA 1MJ9A 3DDKA 2KN4A 1VRUA 3GJTB 4DR2J 1FHTA 1I1DA 3G3SA 2V8GA 5A8KA 2WVBA 3W8GA 4F36A 2KHDA 2IAJB 2NREA 5CYQB 4P9SA 2Q6BA 2GJFA 2HKEA 4RW7A 3QPIA 1Q78A 4FPIA 4FP9A 3GKRA 1YRUA 2LXIA 4CYUA 5EC4A 3V6DB 4OZLA 3NGSA 4HH1A 3P2FA 2DXDA 1IVZA 3L7PA 3W91A 4F50A 2IC3B 2ZH2A 4J9LA 1FERA 1ZBTA 2RUGA 4BDPA 3R5AA 4HKQA 4HTJA 5LJ3Y 5DM7Q 3AFGA 1M4IA 2REFA 5BYQA 2LQ8A 4A37A 5CAAA 2M4MA 2VD3A 3ISND 4QIEA 3ICLA 2IVFB 2AWZA 4DV4F 2JDCA 1NHKL 5L39A 4I2QA 1D8ZA 1VKCA 2AW0A 2HFOA 2ZEEA 4IOBA 1G6BA 3AB4B 1LW2B 2YNCC 1Y4ZB 2PJ0A 4DUYF 2GW8A 2V4JA 1NH7A 4LVNP 3D66A 3GV7B 1VQ6S 5KFKA 2YKMB 4B08A 3GIKA 4G1PA 2CY2A 4CAEA 4W90B 2J9CA 3PNIA 1GXTA 1X60A 2XSJA 1UJ4A 2ILYA 3D28A 1QSOA 3A12A 4OFZA 3FBEA 4LQ3A 2GREA 2Q7BA 4FAIA 4RZRA 1PBUA 1MMNA 2Z0ZA 2CQPA 1J27A 2DGQA 2DIUA 2F63A 4EWTA 2Z3OA 3MPUB 1S6QB 4YDXA 4LFAJ 5L1JA 3GIJA 1WTBA 1RT3A 3K5MA 4WIQA 2MDAA 3D1HA 2RSQA 4X66F 3AY0A 4ES3A 4ECVA 1RU2A 2E7VA 3G82A 3O44A 1ZZFA 2YWHA 5GAGI 2VF3A 3KLGB 4KV8A 2A3JA 3TWZA 2FJBB 1JJHA 4PWDB 4RW7B 3I0SB 3E3XA 5ITHA 5D0EA 1DY3A 1VBKA 2ASJA 1YJWS 2HHQA 4P4IA 3CZXA 1Y0HA 3JUWA 1XR7A 2XS7A 2R42A 3S01A 1T9WA 1WOOA 3RR7A 3NNHA 2W9BA 3MAQA 1HYSB 2A0FB 3GONA 2H4WB 3JSYA 4IFYB 1QSYA 2W7OA 4DR1J 5C5JA 2BACA 3KDNA 3EXNA 2J8MA 2CQCA 1N0UA 2HLUA 5CPAA 1UW9A 3ZO7A 1S1XB 4KH1B 2EFPA 3M9MB 3K5NA 4I6AA 1Q8BA 1R8PA 2Q44A 1QSTA 2ZW5A 1RISA 4NCGB 3HHNB 1JJCB 3EE3A 5A8RA 2HRUA 1T3NA 1OYDA 4OYMA 3FSIA 4DX7A 1LXNA 2DHSA 1N5SA 1SJQA 4OIDA 1ZYQA 4ECRA 5F3TA 4X84A 3HULA 4DSIA 3MAAB 1VHFA 1SL1A 4ILLA 4M5KA 1VIXA 1RSCA 1NKCA 4IKAA 3MECB 3D5MA 3OFEA 2ZH9A 2K7JA 1AYEA 1UKUA 4WXWA 3LWMA 3J7A1 2IRYA 4LREA 1FX2A 1LWEB 1F2GA 4XPCA 4ED3A 1RWXB 2RQCA 5HJYA 3DRSA 2DJWA 2VPXB 1XOVA 3VVTA 3FMWA 2UUAF 2VG6B 1S0OA 4H4OB 4LBPA 2NUHA 3H5ZA 1U1QA 4RW8A 2WVFA 2J9EA 1OQ6A 2W7AA 1WHWA 3KYLA 2RNEA 2ZD1A 3ZTPA 1SKRA 5L46A 2BEFA 2VZYA 1WKJA 3R8YA 2KZMA 4DV5J 3VGTA 1YK9A 4F4AA 4OZ3A 2G2YA 3ZZIA 1YHQS 4CIOA 2VPWB 1FRJA 1KVKA 3MR7A 4RW9B 1RT4B 3DGVA 1FWKA 4WF9Q 3GG0A 4GKKF 3AJ1A 1OBRA 1S79A 4J9MA 4DV5F 4PQUA 4A8QA 1LNQA 2MKHA 4ED7A 2PR8A 1WUUA 4HTIA 1TUGB 4C9DA 3KG1A 5DG9A 4Q44A 3LODA 1RLCL 2FGCA 2MLYA 4ELVA 3HHLB 3T9ZA 4WKRA 2C27A 2KFNA 1DTDA 2VEZA 2C2MB 4LJMA 2Z57B 2PN6A 1G2EA 1L3SA 5T7LA 5G0RA 2N82B 4Y49C 1XN9A 3VATA 5EX3A 4RBVA 2FIAA 3CCVS 1TL3B 4TU9A 1IKYA 3K5PA 4AFFA 2E5GA 5D3GB 4MFBB 3IU1A 2Q4YA 4P2SA 1Q8KA 3TAMB 1RWMB 3BGFA 4PXEA 2W8KA 2XY7A 2J6UA 2HQCA 2QA4S 1WEXA 4OADA 4YR3A 1FF2A 4N77A 3NNAA 3MGJA 2BO9A 5C2GA 1N6QA 4DL4A 3TZZA 1IOIA 4CRYB 5IOLA 2DGXA 1QD1A 1BQNB 5H84A 1RWKB 4CLSA 3DHXA 1GMWA 4DZ6A 3M1VA 4LQ6A 2HBRB 3A13A 4DV6F 4LF4J 4G1QB 2ZEPA 1EAYC 2VHGA 4DV1J 1ZA2B 2VH7A 4HEA9 2RJZA 4II9A 1QAIA 3IG1B 5HLFB 2BQ3A 4F2RA 4O4GA 4BC9A 5G21A 2WPXA 4WFXA 3G8SA 4EMDA 1RUSA 4CT8A 4M5GA 4ED0A 1R0BG 1Z8WA 2B58A 4DQQA 4ILRA 2X3GA 3IN5A 3UFCX 2VBWA 3DLJA 2DT9A 4JI2F 3UN2A 2OMLA 4LRFA 4A2ZA 3FECA 3LO3A 2XI3A 1YJNS 3ZZUA 3N01A 3Q89A 2E1PA 4F26A 4H54A 4Y2AA 1T9YA 1VJWA 2CXEA 4QW8A 3DGPB 4CH0S 2FHJD 3LGHA 2OPSA 4I0WA 3W2VB 3O2IA 3EDQB 1YJRA 3D3CJ 5HMXA 2FZGB 5CYMB 3H90A 1U1LA 4IO1A 4P52A 2OAUA 4PK3A 4C7IA 4E2FB 4UWJA 4CYQA 2BUEA 1B0TA 3VWEA 4X4SA 4CQ1A 3P6YC 1RYSA 3W9IA 2R1IA 1GMWD 1JXLA 3FSXA 3JYTB 2B4DB 3MCNA 4QUSA 1CP7A 3GYNA 3IGRA 3AH6A 1UEVA 2HC9A 1H7XA 3KL9A 1K4JA 4DUKA 1S9GB 4AL5A 4U7CA 1ZZNA 4OLPA 5B0AA 2X51A 3NWGA 4RW4B 4DV6J 3PYEA 1DHMA 4GVBA 4UA3A 3OWCA 2WTFA 1S0NA 2LEPA 2MHNA 4ZN3A 4B3MJ 1KUYA 1RWVB 1UWBA 3EGVA 4CM0A 2QYVA 3J7Z5 1GAOA 1WD6A 4G3IA 5DWMA 5EX0A 3PFEA 3PV8A 3PHTA 4I67A 1DJ0A 1IM4A 3NCRA 4RN7A 4QIGA 1A7GE 1I1GA 4Z2XA 2GJIA 2GHVC 4PQAA 3TA2A 2FLOA 4WWVA 3O8WA 1WG5A 4RWXA 3TO9A 2EFOA 1RAFB 3T19A 1WSVA 4CYNA 1R0AB 2NZCA 2DO4A 1KRPA 3ZC4A 5HMYA 1EB0A 1ROFA 3SI1A 2CNSA 3VZHA 2QJ3A 2GGPA 4IUSA 2BJ9A 4ZOSA 3VV2B 4LF7J 4KORA 3GU0A 2Y1IA 1FD2A 4IHMA 2BX6A 1S9GA 5AG4A 5KFUA 2YNGB 3TO8A 1NDKA 1BLUA 2QO3A 4K4YA 2ZBCA 4DX6A 3N5BA 4YS2A 2RKIB 3T6JA 1RTDB 4EFDA 2FJDB 2KKHA 4C7HA 1Q4RA 2HIQA 2KT5A 4FDFA 1CBXA 3LALA 4MK8A 4QW9A 1Y9OA 2LU2A 3M8SA 4X4PA 1VCTA 4RNHA 3EPGA 4DFMA 2C3YA 4DR2F 4DL0C 3JVNA 1HWKA 4RJVA 3CJ8A 2Y8YA 1U1OA 3GR0A 3DR6A 1SJ1A 4YFJA 4PYDA 2EC0A 1X5TA 3B4MA 3JTPA 4WXOA 4K2XA 4QJVA 4XNHB 4NXMJ 1C1BB 2QMWA 3H4BA 3M1VB 3KZWA 4C8ZA 1VISA 4QBUA 3L4BC 3CXQA 1F5CA 2PRQA 4CAFA 5DRKA 4NGNA 2Y0BB 2RIJA 1NSKL 2OEMA 5IV3A 2WB1D 4ED1A 3OPKA 3JSBA 5SZTA 1RBAA 5KFGA 3I31A 4Y49B 1XWLA 2OPPA 3OLBA 5D3GA 1TKFA 2D69A 4JYAF 4WYWA 3LH2S 3M8PA 2GIFA 3LD2A 1TL3A 2DNOA 1N0VC 1HNVB 4RLEA 3G82B 1XR6A 5LXRA 3IXQA 3BQ1A 4ZBGA 1G1XA 4N8OA 1KTQA 1WWZA 4ZVGA 4H6UA 1R6VA 5MAOA 4B3OB 3MM8B 2HMIB 1YVKA 3MMAB 2JH3A 2E5LJ 4A46A 1BWEA 4MKAA 1OIAA 3R27A 4RW6A 3ZTSA 3I9SA 2D41A 2CJXB 3KLHA 3H25A 2VBQA 1PYSB 2CQ2A 1JMTA 4Q7AA 3WX4A 2EWBA 1XIXA 3F0NA 3P96A 4B11A 1BMQB 2J76E 3W60A 4IOAQ 1TKXA 4NEYA 1S5KA 4OL8A 1HBOB 1LW2A 2H65B 2V67A 1M1DA 3BQ2A 1H2VZ 4Q43A 4XPKA 1FEHA 3FF3A 2FLLA 2QA4G 3UN5A 1YKWA 4RW9A 3PO4A 1XNQJ 1XNRJ 4PABA 2MGZA 4KC5A 2KYXA 2V4RA 2IPOB 1S49A 2L9WA 5G0RB 3VAJA 5K8PA 3OTDA 5EWEA 2PRBA 3N6MA 5JH9A 4M6HA 4UOFA 4XDCA 3FSYA 4QR1A 5A28A 1ELLP 2A6MA 1NHUA 2AJ2A 3ENVA 3TW0A 2XG8A 2R7UA 2GIQA 2LQ5A 4K4UA 1QUPA 2E7XA 3A3PB 1Z8TA 3NS7B 3PW4A 3BREA 4OC0A 2I2YA 4ETXA 2XLKA 1T3OA 5A8KB 1YX0A 3FEXB 5JGFA 1ACMB 4LSLA 3GG1A 4DQPA 2L08A 1B87A 2CQDA 5IX3A 2HS0A 3LGNA 3H5XA 1PO6A 2KM8C 1KOHA 4NLYA 4BS2A 1KWMA 2QLJB 1T9TA 3QIPA 2RVJA 1S1XA 2B5GB 1R43A 2F4VF 5BYSA 3TO7A 4F8ZA 1HLWA 5ELYA 4CO5A 4MKVA 2DCUB 3H8YA 3HD2A 3DRXA 3S9NA 2Q3PA 4RNFA 4DS5A 1TMJA 2M0GB 3HKWA 4I7FA 1FNXH 1JLCA 5ETNA 1ZTWA 3DM2B 3X1LB 2IJNA 4FZVA 3OVBA 4I2PA 4KE5A 1D9FA 5C7PA 3I0SA 1FCAA 4YB1P 4C2YA 2UXCJ 3V7ZA 1QAYA 5K5MA 2YNCA 3PHEA 1NBEB 3HSZA 4MFZA 3W6SA 4PCQA 2Z2YB 3RJMB 2BR0A 4UQTA 2D4PA 4O3NA 2VKRA 5F9NA 2MSSA 1ZETA 3M4XA 2FD2A 3DOMB 5CZXA 5KFEA 4DS4A 2QE5A 2HHPA 3R1HA 1L3UA 2F8EX 3R9LA 4FF4A 1N52B 2ZHAA 2PMWA 5KFAA 3RB0A 1CJUB 5CHCB 4NXNF 5J1EA 2YQ1A 4YMEA 2K8GA 9RUBA 1KKHA 5KT3A 3F5BA 2VQEF 4DPUA 3B8GA 1X31C 2OPQB 5LYIA 2D3ZA 3T3FA 3T5HA 4J3GA 4OZJA 1XK8A 2HBQB 3TC8A 4ED8A 2BJ7A 1FTRA 5E3CA 3WC7A 2MKCA 1YJVA 1SJ4P 4FYYB 3HI9A 3KHXA 2B4BA 3G8WA 3QLHA 5HAOA 3DDIA 2EVZA 3CCUS 2Q79A 2VQFJ 3CJ0A 1YLXA 2K7KA 4B9TA 3UQSA 1KFDA 2UZAA 3N6LA 2AIRB 3EZ5A 3FZBA 3I9V9 2O1PA 5HN0A 2HGNA 4I2QB 3H98A 2C3OA 3V81B 2PMHA 1N5TA 4CTAB 3EGZA 4B3SF 4WU3A 1P4NA 3DNCA 4C0HA 4X4OA 1VQ8S 3BEGB 3UR3C 4EFAC 2DNLA 2AYMA 2HFUA 1WC5A 2E29A 2E9TA 3DLKB 1VQPS 1WEYA 5J1EB 1S6PA 2RHQB 3DLEA 1I94F 3R5DA 2Z10A 3GFHA 1RYRA 2WSAA 1DLOA 2RQMA 3ET6A 4FBUA 3M32B 2OUGA 5HXDA 3FBCA 1Q95G 2EBGA 3VH9A 5LJ5Y 3M2VB 3TUPA 5G20A 4TN2A 4CAVA 4LVOP 3TA0A 1Z4EA 1F0XA 2RB7A 1HWUA 1W25A 4TLRA 1L0CA 1U48A 5KT5A 1FXDA 1S7LA 5KFRA 4M94A 4O0IA 3EY5A 1H6KX 2R8VA 2CIMA 3PCOB 1VJQA 1IQZA 2XSFA 1VRUB 2WHOA 4KOVA 3Q0AA 2KXNB 2QLBB 2K1RA 4AXIA 3CXCR 2LYVA 3ENWA 2BQUA 2B51A 4ID8A 4CH1A 2OZHA 3NCQA 4UEZA 4DU8A 1HI1A 4CGMA 1EARA 4KOYA 1HWLA 3D7SB 2DGVA 2KFZA 1IGBA 2RDIA 4CYUB 3FEEA 4P72A 2UUCF 1Z2LA 2OPQA 2HS4A 3FMCA 2ZH8A 2RILA 4OYWA 2Z0GA 5HANA 1CS4A 1EP4B 1CBKA 4ZLNA 4IG3B 2C3MA 1XE4A 1AA1B 3FBBA 3Q8VA 5HK4A 5E96A 2ABZA 5ETKA 4M85A 2JZ5A 2WBRA 5DDRC 2XHWA 1H73A 2VPYB 5L38A 5F47A 4KYZA 2GMJA 2JSXA 5LMNF 3HF5A 1CJWA 2W4DA 3M2VA 4XTTA 2MZJA 5ETPA 4WK1A 4A38A 3P2HA 1JWQA 4XPDC 5I3PA 5J2MA 1Q0NA 5IWAF 1DQ9A 2ZNYA 2E44A 4KH0B 1FFGB 1XF8A 3EVMA 2JEGA 3IR6B 4UBRA 2KRBA 4ZVOB 3PW0A 1PUAA 2MKJA 2UUTA 4DSFA 1AFIA 4WJBA 2IY5B 3T5KA 4NEZA 4PXBA 2MKSA 4L3KA 3KK1A 3NE8A 5JJBA 2GFQA 1AT1B 8CPAA 2FHKA 1YK3A 2HWTA 2CIJA 1IYLA 3UO0A 1OY9A 2P9GA 3O6QA 1CM0A 3TRGA 3D54A 3CC7S 1TAQA 2PJ7A 2Z2MA 2FVQA 2YQ0A 2HG4A 3D2WA 1NXIA 3R5BA 4OYXA 2PCUA 1C0UB 4ALZA 2PE3A 4DV0J 3BO2A 4CLFA 1X8DA 4LRCA 1HA1A 2CADA 2COLA 1TL1B 3D2PA 1ZPWX 2QLXA 3W6XA 2KXHA 4D3HA 5IB0A 4W98A 5KFJA 4ZHRA 1APSA 1ZM4A 3CJRA 2Y1RI 3MM8A 1WI8A 2HNDB 4FBTA 1M5VC 2KG1A 2L3MA 4O3SA 3VVUA 4Y00A 1S5ZA 1RAEB 1A9NB 2KFYA 3DOKB 1PBAA 1UETA 3S6KA 3OSNA 3MURP 4MAKA 2BOAA 2HAFA 3PB8X 5A2QY 4OZ5A 4ES2A 3V6HA 2SXLA 4B02A 4KZTA 4O4RA 3SSSA 3BS9A 1NJIT 1EX8A 2VQFF 2DGUA 2J6SA 4CNZA 3LP1A 2FC8A 4Y2MA 1RT2A 1LWXA 5KFCA 3T5JA 5I3UA 3EXYA 1SH2A 1Q2CA 3D1OA 5A0YA 1S99A 4DR6J 3BBFA 3BLNA 2B9YA 2J7KA 5IC4B 5KFBA 5SUHA 2XMWA 4XK8C 1RBOB 3CE8A 5GAGU 3TCVA 1I21A 3R3TA 4CT9A 3N4WA 2QMUB 4B9VA 1MROB 4GC6A 4IO9Q 4MIAA 3MR3A 3J7ZT 2CF4A 2FVCA 4O3RA 2E5JA 3FVLA 1JLQA 4OLLA 5KFWA 2HVIA 1VQYA 3KLEA 5GMEA 1HW8A 3LP2A 2ACMA 4PXCA 1RA6A 3VQTA 1MNEA 2FJVA 4CGLA 3PX0A 4MRIA 5GMDA 1X9SA 1QTNB 1NK4A 2HNYA 2LEAA 3W5YA 1CPXA 1XFOA 1Y5NB 6CPAA 2GHWA 4EU0A 2HVHA 3LWUA 1FJ7A 1LOKA 2GLFA 2YKQA 2PSZA 3MM7B 4LSLB 1T11A 4QWDA 3T1HF 2IA6A 4X65F 5DZ7A 3MEEA 3U7JA 5CCMA 4N5SA 3D0GE 1N34F 2NXCA 4ES1A 4LFBJ 3CVKA 4H89A 3Q8PB 5D29A 4X4VA 1U1MA 4NLSA 5A6PA 3QNVA 1PAEX 3TI0A 5KFIA 2VU5A 4DUZJ 1NSPA 1MU2A 5AT1B 2XYHB 2XO6A 1R0AA 5F8IA 2G13A 3KLFA 2CXAA 2QV6A 4JV5J 4NE9C 4A32A 2MPUA 3MWBA 4YY3J 3HO1A 5L9NA 3OTOJ 4WKYA 3CMAS 2R2UA 5C2CA 3KQZA 2CWKA 2PC1A 2ZH4A 1HD1A 5F46A 3MPDA 3WHIA 3PYGA 2AYBA 4OYOA 4CRJA 5C88A 3KJVA 2K2PA 2G1HA 4C3KA 3S1TA 1WKKA 1F9HA 2CJAA 1TU0B 1KOOA 4AVBA 4TQRA 1GXUA 3HHKA 3QBCA 2ZEMA 4NZ0A 5KG1A 1CULB 1RACB 5C24A 4UIBA 3CDAA 5F49A 4UZBA 2VZZA 1RTZA 4UTGA 1VGYA 4DR4F 4OIWA 1UVMA 4KLVA 1MMLA 3C3LA 3TOQA 4UCMA 1SBRA 2EI5A 2BZ2A 3CCLS 2OH1A 4F8RA 2BKNA 1K1QA 4B3TJ 3LP0B 4DFPA 3SBMA 4NYZA 4MK9A 4DUZF 3PZPA 2HFVA 4LT6A 2PI4A 4F6AA 1R27B 5CD4A 2IM3A 1VS3A 1X0PA 3ZZ0A 3ELHA 2JC1A 4MJKA 3PYFA 3Q8YA 1YQEA 1FY7A 3IO1A 3KK3B 1M5SA 4XPDB 4X65J 1CG2A 3S6EA 3CJQA 1M1KT 2PA8D 3LPYA 3DLLQ 4CO3A 2ZEGA 2N7CA 1KDNA 2GAHC 4NOHA 1RKIA 3EX7B 1TKJA 5H9FJ 1JJ2R 2BANB 2ZENA 4QWBA 2R7RA 4Q0BB 5B0BA 2CJQA 1Y7EA 1UWBB 3PP9A 3HFKA 4HI2A 1F2PA 5DWNA 1NCLA 2OHDA 4MCSA 2AFZA 3BDEA 1S77D 3L3CA 2OELA 3RW6A 1RT7B 1Q82T 1O51A 1KLNA 4DSLA 1T9XA 3RAMA 5IS2A 2VJVA 4O4GB 4NXYA 4NXMF 3H20A 3G8QA 1KVIA 6FDRA 5EGYA 2YGWA 3G9CA 3N79A 2ZITA 2ZKTA 4B17A 3CIMA 5L8RC 3PTWA 5KFYA 2R7HA 1SI9A 2XCPA 2J0QD 3LQVA 3W7BA 4CM2A 3BN7A 3I0RA 3K59A 3C6UA 4CYOA 2AYGA 2WUUA 5J1QA 4RU9A 5DZ6A 1FNOA 2ZM6F 2PIIA 2V2ZA 4U9RA 4WFBQ 4OYZA 4CLPA 4JBCA 3TT2A 3B82A 1NPRA 3MUVP 4OJ1A 5KTCA 1K9MT 3P4UB 3SDEA 1RCOB 2J8SA 2LCWA 1Y0RA 1ZAXA 3DYAA 3KR5A 4MFBA 2H48B 4WYLA 5LMNJ 1LRZA 1EQ0A 1NAQA 3SYZA 3K17A 2VQYA 4LQGA 2E5LF 1IKYB 3HFVA 3BKUA 5H86A 2DR5A 3IM9A 3LP1B 2DB1A 1X5SA 3KJQB 1Z4RA 4NLOA 2CVEA 5IWAJ 4DQSA 1R89A 3KG0A 2QC3A 1TF9A 1P8GA 3TUJC 2F9JA 2HW3A 3OJUA 3RRHA 3B3TA 3M6XA 1YBAA 3D4UA 2I3CA 2HFNA 1JXEA 2PEHA 3I0RB 4ZVEA 5JPHA 1X5OA 4ZVFA 4BCAA 3LMSA 3NGUA 3JTNA 4UZCA 5DQHA 5KG6A 2JRSA 1BOBA 4LR8A 4R7MA 2A10A 5DGBA 2B7CB 3D9BA 2Z3KA 2O66A 2GHPA 2H54B 3A8IA 4OC1A 1BLLE 2NUUG 2WOMB 4J9RA 2DHXA 2IRUA 3G71S 2YX4A 4BMHA 1RU1A 2CTBA 3T9NA 1VHSA 2ZEHA 3B7IA 1GMUA 2RQKA 4OYBA 1WEZA 3NP5A 2I1RA 1NPPA 4Y3CA 1S1UB 5D4LA 1NH8A 4F3QA 4K4VA 1FK9A 2OD4A 4GRSA 2W9CA 2AFMA 2B4DA 1KNZA 4V19X 3T8WA 3M8ZA 3LAMA 3DOKA 1LWEA 2LQ9A 3NH4A 1R6YA 1LWFA 2X1FA 2HVZA 1L3TA 1PYTA 4WWSA 5F09A 1R31A 1MN9A 1RTHA 2FJXA 1K0VA 3CUNA 4MMOA 4C2MA 3MECA 2F8MA 3EWGA 1RTIB 1X4DA 2ZWPA 4PV6A 4ZHRB 4JOUA 2AX1A 1R0CB 1OYEA 3AODA 3UWTA 3H7HB 2W2QP 2MJUA 1YW6A 2DPSA 3LP0A 1K0TA 3MM9B 1FWPA 3MM6B 2BE2A 2HEKA 1N5YA 1IUJA 1FFSB 1QJHA 5AXLA 3PG9A 2J0SD 4QC6A 2CPHA 2W4PA 3PJ9A 4KKOB 4CPAA 1CULA 2NSCA 3ILIA 4ATNA 2CG4A 4G1IA 1NK8A 3KLFB 1S1WA 4IH6A 1Z2ZA 4H2KA 1O5JA 2JLFA 3PB4X 1FFWB 1E6YA 1JLQB 2DNZA 2QN6B 4FKXA 4WE1A 3T1HJ 3OXLA 5F8GA 4GKJF 3Q8SB 1IR1A 5D0HA 2VC0A 3NMRA 1VI7A 4DU7A 4NCGA 3P8BB 1NHVA 3SFUA 1HDQA 5KFNA 2A18A 1N54B 2MY8A 2GU2A 5LT5A 2GNKA 2AGOA 1DQ8A 4A4JA 1UVNA 1HBUA 1EP4A 1WDDA 2EWHA 3A3OB 2P6GA 1SQGA 1N32F 2X7IA 4FF2A 2ASLA 4HNYB 2WPWA 4DQRA 1SV5B 2WVEA 3DLHA 2EEYA 2GQCA 2ZHOA 1S6UA 3H2UB 2R2RA 1FI4A 3HMJG 1YR0A 2XS2A 2M52A 1VR6A 4EO8A 1LEOA 1MWZA 1FJEB 1NKBA 4WPAA 3CDWA 4GC7A 4QWAA 4RPFA 2UP1A 4IQXA 4F4XA 1S9EB 4A33A 1UFLA 4KIAA 2POKA 2HVEA 1U8SA 5KFVA 3NOCA 3D0IE 1RHQB 1FKOB 1LCPA 2MY7A 4X4QA 2HQFA 1RZMA 3R7SB 4O23A 2XM3A 3FCWA 1FRHA 2XCAA 2CRLA 2R7TA 1M1HA 4F0HA 1BQNA 1TK8A 3O5TB 4KGZB 4I68A 4I1TA 2ALYB 5KT7A 3R1LA 4UOCA 2LKZA 4P73A 4FVMA 5GAEU 2FVSA 4USKA 2V77A 3MUTP 2NQPA 2I5JB 3CJ2A 3OVAA 2QYCA 1WELA 4PG7A 2MQPA 1TL1A 3HCXA 3Q22A 5LRGA 2AF6A 1HKAA 4RUCA 2OSQA 4NL5A 1RTJA 1IICA 2Z2ZA 3UE2A 2P8IA 4B3RJ 1HI0P 3PW2A 3PY8A 4ZJQA 5D0GA 3QJLA 1SC4B 4YFUA 4NCBA 1DQAA 3AOAA 2OTLS 2B0GA 1FO1A 2Y0SD 2IYIA 5KFZA 4K3NA 1ZPVA 2IMOA 2QIRA 5CD4H 3G96A 2RRAA 3C8YA 4B3TF 3BBCA 4CAWA 1UCNA 4ZVPB 1FD8A 1S1VB 3FVYA 3RYOA 4W92B 2JVOA 3KUEA 2OKQA 3EC4A 4RKUC 2AD9A 5ETSA 4DR7F 3D7GA 2PJ6A 3TNVA 3RUBL 3BH6B 1TVRB 2VFUA 2JBKA 4J7CA 2NXUA 3FCVA 3L09A 5B0FA 3SHPA 3E0KA 4WP3A 3O3LA 2YH1A 2OEJA 1Z4UA 1NE9A 1AB8A 1VLYA 4MCQA 2GIVA 1M5KC 2C3UA 3DRRA 3QGPA 4YHHJ 2ZKUA 1B3TA 3D4JA 3JSRA 2AFSA 1XEBA 3B6BA 1R57A 2R9LA 1QVFR 2WZ1A 1TZ0A 4URQU 1TFYA 2DPJA 1YX2A 2V8PA 2OZUA 4OJ3A 5GADI 2CPZA 2CJKA 3TVZA 4CS0B 1ZG7A 4JYAJ 4MK7A 5I42B 4BC7A 2V8VA 3QAYA 2YNFA 1KP6A 1NK0A 2R2SA 3GFXA 2AFUA 5IT4A 4YRHA 1V0CA 3PR4A 2HUZA 2JLGA 2PJ1A 1VFJA 4NCAA 2F8HA 4LUAA 1QY7A 1HBNA 1W2BR 4BINA 1M4LA 2APOA 2QL7B 3W61A 4IH5A 3B8HA 4DG1A 4H4MB 3GJQB 4ZCLA 2F4FA 2Z8QA 2PJAA 2QFIA 1X4FA 3G6VA 1F9EB 1T03A 3K0JA 4LR9A 1RO5A 3TEHB 1DBDA 4DSEA 4OHXA 4DLEA 4FYDA 2CNKB 3R2DJ 3QAEA 3I5AA 5F8LA 2WSCC 3S6GA 1C2PA 2UUBJ 1V3SA 3TO6A 4DV7J 1QSRA 3W65A 2IL4A 5B7WA 1YSJA 5ETLA 3B78A 1QMUA 2ZC3A 3AAWB 2RD5C 1F60B 2QFJA 1JLBB 1B0VA 2W2OP 1YVFA 2YH0A 5DDQC 4DPYA 1UTAA 2MLZA 2PE8A 5EBVA 3I82A 4PUOA 2YNFB 3PM9A 2DGTA 3HXMA 4P45A 4DL6A 1N56A 1DTQA 3AT1B 2D4OA 2MQNA 2FB0A 1LWFB 2XGPA 3HVTB 3KI9A 4NMLA 3ZZZA 1D9AA 4Z7YA 4AXVA 3F41A 4NLTA 1XERA 2UXDJ 5LYFA 2V2QA 3CCMS 4WZQA 1CP6A 3KLIA 3ET6B 4DV2J 2W01A 4OZ1A 4JXRA 1LOUA 1Z9UA 4J9NA 1CJVB 2DHGA 2YNDA 4BD9A 2LA6A 3X3UA 2V5HG 4YR0A 4Y2KA 2VBXA 1FE4A 5J2PA 4ZVHA 3FB3A 2XI2A 3CDXA 5J2PB 2JOQA 2A2DA 3N6NA 1HNZJ 3IFEA 1EQMA 4AB7A 5AG6A 2FTRA 3DLEB 2CQ3A 5IT9U 1JKHA 3CT9A 2BJEA 3VGUA 2JDJA 3PEJA 3OFHA 4ED5A 2CWXA 4J9SA 2I79A 3W9HA 4E8UA 3V81A 4P44A 1UVLA 3CCQS 3QQCD 3DOMA 2F3JA 5GAHU 2PQ8A 3BHXA 4X2BA 1WKLA 4C11B 4C8KA 2QRRA 3GFZA 4E2AA 2AT1B 3PIOQ 1TTHB 1NSAA 4ZLPA 4FS2A 5F41A 2V34A 2KYZA 5K20B 3B3CA 4LSZB 4DN9A 3PRTA 1PKUA 1IR2A 3MCOA 2AJQA 4NF1A 3W9JA 2YKAA 3QT5A 1DZ5A 1VK3A 4MKBA 2GFFA 2U1AA 3FFIA 5HP1A 2L48A 3CJSA 1OY8A 5K9FA 4DSJA 3BGRA 4B3OA 5BJRA 1NMTA 3NWRA 2AEFA 1QSMA 1S1TB 3CD6S 1CJKA 2GANA 1HNXF 2CJ9A 1F9FA 3P3DA 4WTYA 2ZW6A 1FXRA 4R8FA 1KQSR 2DH9A 1EKSA 4P71A 2Y3YA 1T05A 1UWAA 3M8YA 3HT0A 4AL6A 1MJAA 2B43A 1R8HA 2W8LA 4ZDNA 5IC6B 4RBTA 3MM9A 1CSJA 1RT7A 3DI6A 3MMBA 3J80U 3SI8A 1V3ZA 2HHHF 4MFLA 2FSRA 1RWOB 4YP3A 4P4BA 2HHWA 3I1UA 4NI2A 1AMPA 4KSEB 1RT1A 5I42A 2JLMA 1KTVA 2GS8A 3EYZA 4C6AA 4TY8B 1Q7LA 1RP5A 2MQQA 4IDKA 1KONA 1DFDA 4FD6A 2HK2A 2BOPA 2MQMA 3VALA 5JQ4A 3W5XA 2DH7A 4R8UB 2YKNB 3IR5B 3J80Y 4TYBA 4OI6A 5K14A 2DF5A 1PC4A 1Y3JA 4LF8J 2GJ2A 1WC6A 3BSCA 3EZUA 1FJGJ 5K8NA 3NS6A 2BKPA 4TWEA 3T1YJ 1O0PA 3BPSP 1M4DA 2FUG9 5AE1A 1S1WB 5G4DA 1XJOA 4K4WA 3R9FA 3FEDA 2HNZA 2ODFA 3PDNA 2ZZMA 3UCUP 3L7UA 4A8YA 3NAIA 4IQMA 4ZVRB 4UFXA 3GCXP 4LF8F 5IV4A 4MYTA 2FVGA 4PK2A 5KFOA 1KLMA 2YX1A 3LUYA 1VHOA 3ZTRA 1UVIA 2CPIA 2FGOA 1A0OB 1PJ7A 4ECSA 3UW1A 1LAMA 1CJTB 4W9YA 4R5PB 5IT0A 5BR8J 1JWWA 1J5OB 4RW6B 2YNHB 4JWPA 2BQRA 1IKXB 1GEHA 1IQTA 3TP2A 3G87A 4X62F 2EVNA 3LWLA 4FN5A 1PYTB 2EG1A 2ZUAA 2I9SA 1Y10A 2MZSA 1B7YB 4F0XA 1LKZA 2MQOA 1LXJA 1FT7A 2YNIB 2EFGA 2HHHJ 4USJC 2ZDPA 1GT8A 1GQEA 4R6TA 3VR1A 2RT3A 4HHHA 4P4DA 4TU7A 3L9ZA 4J9PA 2C2KB 1N8RT 4L74A 4KGMA 1PAUB 1B64A 3GWCA 3W2WA 1JLGB 2YQ3A 1HHTP 3HP6A 1EIYB 5E3QA 7FD1A 4WFYA 5F9LA 2YWKA 1KQKA 4MFJA 1UVJA 5LYLA 4F9VA 2MMYA 1K73T 3DRYA 1C1BA 2B56A 1KQFB 2KXFA 4MFQA 2XY5A 4N76A 1AUSL 1VRTA 1XNRF 4RBUA 3BI1A 2B5JB 3MI7X 1X12A 3W8PA 1KD1T 3ZZTA 2ZDOA 2FYXA 3MFHA 4AL7A 2G0IA 4PPDA 3CC4S 4X4UA 3BGUA 2AQ4A 2DIVA 3S9MA 3KG4A 4C2ZA 3QATA 2KH9A 3SDEB 2BKOA 5LSLA 1XC9A 3BBBA 1MWYA 2QG9B 2JC0A 2JBJA 2J9DE 3NH8A 5D8NA 2J0WA 5AGEA 2C6PA 5CH7B 4LBHA 3CWJA 2IHR1 2E7WA 4Y34A 3WIVA 1HQUB 3DKDA 3NXZA 1YJUA 5AE2A 2HIYA 1XRYA 2JL9A 3RRKA 1GK8A 2IJRA 2HQ3A 2OB0A 2RRBA 4DPXA 4OZNA 2FJWA 1IM6A 4FNIA 2DPTA 1LK7A 2YWEA 3QB8A 1M4GA 3M05A 3HJVA 1C0TB 3C26A 2Z4PA 2AEJA 2CKWA 4MCPA 1NK7A 3KK3A 2XS5A 4DR5F 5J1NA 5E0OA 2BANA 1HNZF 1S6OA 3C19A 5HMNA 3GCWP 3WIUA 3OT9A 4LF6J 4KFBB 1AZSA 4NGRA 2JLEA 3E01B 2UXDF 4OI4A 1KHVA 2G9OA 4IRDA 1Y9WA 1QQ9A 1N6QB 1TKHA 3RBEA 3D6HB 2I38A 3US5A 4Q45A 2C2EA 4OHYA 3LW5C 3DLGA 1Q8LA 3FC9A 2GGPB 4CI0B 5AE3A 1IXKA 3CIZA 3PACA 5F8JA 2ZH3A 1NLKL 1TL4A 3C14A 4CO1A 3D8PA 4J9QA 4OZ2A 2OFHX 4UIAA 1WF0A 2O5DA 3JQJA 2XMTA 3VZIA 2M3DA 4OX9J 1UL3A 3MHYA 9ATCB 3C6TB 2WVDA 5FLXU 3H2LA 5CA5A 1H3DA 4OV1A 2EKNA 2OSRA 2YTCA 3HSDA 5KTDA 3TZYA 3OW2R 2AGQA 5FVJA 3CF5Q 4MKYA 3QJPA 2HHTA 3DMJA 1YDLA 1P0HA 2LQBA 2JEVA 5DLGA 2Q0YA 2X3DA 5C24B 5CYMA 3R7NB 1YJTA 5DG8A 1BHNA 3DRPA 3BN4A 2KU7A 4EO6A 3DGPA 4KQZA 4R76A 4JV1A 3KJVB 1SC3B 4CGOA 2QX0A 4HKFA 4BBYA 4DHVA 1WG4A 2WB4A 2GLJA 2DNMA 2H3EB 4OI2A 3IGNA 1K1SA 1Q5VA 1Q8IA 1MSWD 2XMUA 2KT2A 2C1EB 2DNRA 2IFXA 4UUXA 4RUHA 4H4OA 3EMTA 2UXBJ 2R3VA 3MEEB 3FFIB 2ZBRA 3CMQA 1YZ6A 1AUDA 1Y5IB 1VRTB 3SV4A 3GZ7A 3ISNC 2YPZA 1HNWF 2DITA 2IMWP 2DR6A 2ZH6A 1CQNA 3GIRA 3GJRB 1FA0A 1B99A 3RW7A 3CD5A 4MFPA 4IFYA 1CC8A 2PA3A 1ZOTA 3AHPA 2EBJA 2NPFA 1FKAF 3SXLA 1MROA 3IWNC 1U0SA 1VHIA 2R7VA 2GO9A 1QUVA 1VQMS 1FTCA 2HVDA 2QMLA 2VQEJ 1DE4C 4B5PB 1VMBA 3HZGA 6FD1A 4DCPB 2XULA 1U1KA 1PILA 2P6TA 1BO4A 2WVCA 3KMQA 3FDSA 3OJSA 4PWDA 1XMOF 1OY6A 3IG1A 5A8RB 1N34J 4AG9A 1JLFB 3QGHA 2VKZG 4OC5A 3PGPA 3CCSS 1LV5A 1NKEA 4DOZA 4QIFA 5HI7A 4JI1F 3FBFA 3IC1A 3MGDA 1FDNA 3QIDA 4ANDA 4XIUA 2R8KA 1SJRA 5ETMA 5KTAA 3L7OA 1Z5RA 2C6CA 2HQIA 5KG3A 1NB7A 4HH0A 5AG5A 4EUVA 3SCKE 2RRNA 3IWWA 4KJIA 4A8WA 4P75A 2AKWB 1WHVA 4M1KA 2CPJA 3KXDA 4DXLA 4J37A 2B9XA 4X4NA 2ASYA 2Q1LA 4KUAA 3GSIA 4RNNA 4Q2MA 4OQJA 4KOXA 3SXOA 2R7SA 3A8KA 5HATA 4A39A 3HVTA 1J2VA 4C11A 3IEHA 4A47A 1AUGA 1CJVA 1I3OB 1WC0A 3M8QA 4GO5X 4M95A 3B3SA 1REVA 2PJ9A 2QVPA 3BI0A 5B0EA 3VHQA 2OH2A 3KHRA 2MKYA 4LFAF 1FDDA 1U24A 2W24A 2XMMA 4URGA 4DR7J 1IYKA 1YRTA 1GNKA 4LF7F 4PQUB 1NK6A 3SFGA 1DAXA 3QGGA 2F40A 3EFAA 1KEKA 4OHZA 4Q38A 2J9DA 1U49A 2Y8WA 2C2OB 2RS2A 1TR0A 2VIHA 3V6DA 4GM5A 2V4JB 3KHHA 4JD6A 4ZVQB 3K5OA 4URSA 4JI5J 2VASA 3SJGA 1A2ZA 2HNZB 4U96A 3QSIA 4UFWA 2B6AA 1VQKS 1IB1E 3UNGC 2B8QA 4DV4J 4P4FA 2ZW4A 1C0UA 4EI2A 2V50A 2VG6A 4IOCQ 4DLGA 4I6YA 2R8IA 2DISA 3KUHA 2B4PA 1VBXA 4ZCMA 3B35A 2HBZB 2E1CA 2R8GA 1WNEA 5CCLA 5J2NA 1U0HB 4NLGA 3ZFVA 2BUNA 3NEKA 1RT6A 2HQDA 4FBEA 3R5CA 1HR0J 4CLTA 3MOZA 3BO4A 3BYRA 4I2PB 1TL5A 1RK8A 3QRQA 2YY3A 3T41A 2IVMA 1WJ9A 3DM2A 1QAJA 1TV6A 2XBPA 3MM7A 2NYQA 4DBQA 2YWFA 2WSFC 4DDFA 1CS4B 3H4QA 1IKVA 1J5EF 5DLFA 4JI6J 3T1YF 4B13A 4HPSA 2KDOA 1EKRA 1HMVB 4ZY2A 4Y28C 4KV8B 4OX9F 2MXYA 2KT3A 4DR1F 2BABA 4NGMA 3BPDA 3AB2B 2F1FA 1HQEA 1JNZB 4C8MA 1Q53A 1VQ4S 3BSAA 1U4BA 4F0KA 5LMUJ 3H8EA 4OMEA 3NMAA 2FXFA 2EW9A 2CNMA 1IKVB 4KT0C 1NRKA 1PSDA 1HL6A 5KFQA 5HO4A 3F0AA 1X4AA 1MW7A 1TV6B 1TKZA 3CGIA 3DLKA 1BAVA 3MF5A 3R9EA 4OIXA 3KLVA 2OI2A 2W7PA 2HRTA 1UA1A 3QSYB 4DR5J 3H5SA 5CABA 1FJCA 2DGSA 5J8FA 4K50A 3MTKA 4JI8F 2HQYA 3NOGA 4ECQA 2IYGA 3CD7A 3AA8A 3CCES 2PVWA 4FD7A 5KFDA 1CPZA 4PYAA 2R98A 1ZG9A 2ZM6J 1QTMA 1CC7A 4B6ZA 1CPSA 2L9DA 4L89A 2QIFA 3B4DA 4J9UE 4YQWA 4C2XA 4M5JA 3ZTOA 1Y0YA 1FKPA 1S60A 1U6FA 2PFFB 2BJ1A 1SL2A 3J7YU 3GV5B 1QM9A 3WQPA 5IQ6A 2PJBA 4N8NA 4USTA 2EFVA 7AT1B 4QZVB 4CGPA 2HNDA 2Z58B 1HHQA 4LRBA 2JFDA 4JUZA 1NJZA 3MTJA 2Q66A 3TJ8A 1YJ9S 2IM1A 5B08A 2X1AA 1WHYA 1OMSA 5E2QA 4ZN1A 4RUAA 1UP1A 2DNHA 2RHSB 2XSJB 4LSNA 3R97A 4ZP8A 2CNOB 2EK8A 2DRBA 1B70B 3CO0P 2HHXA 3DLBA 1TMMA 1U8WA 3CJTA 3R1KA 3MMJA 3CCWA 3DXBA 4L8AA 3FUYA 4KHMA 3IA0A 1FKPB 4JB8B 3RYLA 1EZZB 4P2MA 2MYFA 3VAMA 3H8GA 4A8KA 3PVXA 4NLXA 5J8CA 3AJDA 3THTA 1T03B 5B0DA 4I69A 2IQ6A 1NNDA 1Z1ZA 1LANA 2O01C 1U47A 2R7WA 1RCXB 4O3OA 1S7IA 1JLBA 3CSKA 4DR4J 1REGX 2GAGC 4OI3A 2A4NA 2DNGA 1NZ8A 5D4PA 2UXBF 4R87A 1TP7A 3RB3A 2WW4A 1TL7A 3NNCA 4MI4A 2FC9A 5IV0A 1IR0A 4DV2F 2D1CA 1VRQC 4UEFA 1OPIA 4X62J 3F73A 1IKWA 4OAEA 3MN8A 3BKTA 1NU4A 1LK5A 3UDVA 3FRMA 4V1Ak 5KFSA 3PBBA 4ZPBA 1VIOA 2GVDA 4LF9F 4C68A 8ATCB 3OR2B 2DY1A 1OWXA 3OTCA 3U1LA 4MBUA 4YUDA 1PYOB 5C42A 1T9VA 3I55S 2AFOA 4GKJJ 4N41A 5H1SV 2O3DA 1RHKB 4DR3J 4CLKA 5DDPC 3QIPB 2C3PA 3D68A 3FJUA 1VLOA 1KFSA 2WRMA 3O1LA 2FLNA 1F6TA 2P2CB 3BKFA 2R7OA 3AA9A 4U7UD 3IIBA 2V9KA 5G1ZA 4U8YA 4OYPA 1FJGF 2VB6A 4IYQA 1WACA 4U95A 1B6BA 2QTWA 4I7FB 2WYRA 2Q4ZA 4NFRA 3GYAA 1LFPA 1FWLA 4JI2J 4PWUA 1RB0A 1U25A 2K06A 3S6FA 4QR0A 3OFFA 2V8HA 1XEZA 3CXSA 2YWWA 1BUXA 4ELTA 3IRXA 4ZLJA 5K8MA 1IBKJ 4ZPCA 2DNKA 1TAUA 1HI8A 4PEOA 2W9CB 1I12A 2HQGA 2BE2B 3P45B 2ZW7A 4ECUA 5DETA 4YWYA 4ZPVR 3QAUA 1WI6A 1LWCB 2RH3A 2VOPA 3IR7B 4HI1A 1IBKF 1ZLHA 1P9QC 3WABA 2HPUA 3NE7A 3ETMA 2QECA 2B9EA 3G4SS 2PMZD 1XBWA 2DXQA 2Y1JA 4OHWA 4M3SA 3M8QB 1SPBP 1S3ZA 1N4LA 3DMJB 4BLGA 1VK8A 1D3WA 2HGLA 2ASDA 4XPLA 3MPWA 1F3VA 4ZPWR 1WF1A 2ZWOA 2EXUA 1A6LA 4K0KF 4MFKA 1NK5A 4OYIA 2BXJA 1U26A 3M6UA 2KJWA 3IBFB 4MT1A 4RU2A 1K44A 2VG5A 5D77A 2P6EA 2XQCA 2XEGA 2H4YB 1HEEA 1TF8A 4DPOA 5HMWA 3OQ2A 2JX2A 1AFJA 3CJKA 4ENOA 3PX6A 4Z7CA 2BBEA 2KTQA 3B2YA 2PJCA 2H5IB 1DTTB 5CYJA 1T9UA 4P6YA 3TUZC 3EO4A 3ZZOA 4JI7F 4ILMA 1X9WA 3MAHA 3DU6A 2HLTA 4A94A 1SKUB 1WTFA 4OZ0A 3M2RA 1BY9A 3UVJA 1KSPA 4P7TA 5LSRA 4KGXB 3NG8A 1X4EA 2BJDA 2HZVA 2XB2D 1SCJB 2OP5A 5F3ZA 1B0PA 1ZTTA 2HBYB 4KOTA 2CPXA 2EKYA 4KSFA 3GFYA 4A8XA 5EDWA 2PJ3A 3A1YG 1GX6A 3BR9A 1UZDA 3I87A 3PZJA 2FZKB 5EHHA 5AG7A 4NGQA 2G4BA 5CZVA 4B5PA 1TUVA 2LU1A 1Y5LB 4ER8A 2Q6CA 2MZ1A 4NYOA 1KN6A 3ITHA 2XHCA 1NSQA 1S57A 2LVWA 3E2EA 4B9LA 3TR5A 1JNRB 2B3TB 4GVLA 1GXLA 1XMTA 2DNQA 3L2NA 3T1AA 3TZXA 3C46A 5F8MA 2FIWA 2ZE2A 4NGTA 3DR8A 1G3OA 2HWHA 4USWA 1JLCB 4O0NA 5F48A 1S9FA 3HDSA 2DXEA 3LANA 2WAQD 3MMCA 2BYCA 1MMDA 2GQ2A 3TYTA 1XR5A 4DEZA 1HNIA 1I51B 3R96A 2Q4VA 4USMA 4OYAA 4KGVB 2LECA 3TJAA 1ZAWA 4WCEQ 3PW7A 2CQBA 3MPYA 4F67A 3PRBA 3H5UA 4TY9A 1HR0F 4ZX9A 3ZNUA 4ZP7A 4EZ6A 2F9DA 1SJFA 4PXDA 4EEYA 3HHLA 2UUBF 1BPNA 4KUBA 1RKJA 2ZHBA 4DR6F 2I00A 3FCHA 3KUGA 4ZPDA 2ZZTA 3RAXA 2RAQA 3QO9A 1ZAVA 2OIHA 1NPKA 5C82A 2C2DA 1RAJA 5IQQA 1YG0A 1JLGA 3QT6A 4ZCKA 4P2XA 2C1CA 4F3MA 3MUMP 2W1BA 4DUTA 4OP4A 2BW7A 4XNHC 4Q0BA 2G2ZA 3AXMA 1O8BA 3FH4A 2FZCB 3J7AN 1OQ3A 5FLXY 1YLOA 4EYHB 4ECZA 2YKPA 1JLEA 1UPPA 2ACYA 2RU9A 3P5BP 1AROP 3QT7A 2K3IA 5KFPA 4DQIA 3CPXA 1RHRB 4M5DB 4PG5A 4QU6A 1CX8A 5EWFA 1X4GA 2F5IA 3SJFA 1M5OC 1IJFB 1HD0A 3LACA 3LGMA 4NEXA 5DG7A 1J5EJ 3KNAA 4P10A 3KNGA 3IWXA 1UEUA 2KL8A 4QU7A 2RFHA 3ZXWA 2V9WA 1UWYA 4BWMA 4KGKA 3W66A 4PRFA 4CO2A 2HS3A 1MU2B 3D3BJ 3BF4A 5GMKa 4EVYA 1C4AA 1O6XA 3RNZA 2ZVIA 2A1BA 5AJ3J 3BZQA 4TQSA 4HR2A 3UDLA 2CPDA 4USVA 4B9NA 2AU0A 5HQLA 4DV1F 1FE0A 1TFWA 1HWJA 1RJJA 4NZ7A 2RDJA 2ABYA 3EPIA 2QLWA 3FZ2A 2IBKA 4ECWA 2ANPA 4L3NA 4KSIA 4IG0B 3T9YA 3U02A 3VWDA 5CXTA 1D1UA 1IKWB 1Y11A 1ZM9A 3QGIA 2NSBA 2BJ3A 3MOJB 2P6FA 5L1KA 3OL6A 2G9DA 4TY8A 3D7HA 3FNNA 2HFSA 2KJVA 1YI2S 3FXTA 4B12A 4NCZA 4ZS6A 1S10A 3I32A 3MPVA 1SIWB 4ZJOA 2DCLA 2BVZA 2D3O1 5J1PA 4KVXA 2OPSB 4ECXA 2JEFA 4C8NA 5LM7E 4R57A 2CQIA 3PX4A 3ILLA 3QRRA 3VTIA 2V6AA 1NMEB 2YWGA 3BM7A 1KUVA 5A0YB 1U6MA 1RHUB 2P9EA 3IP0A 1S76D 2BM0A 1FVSA 2XYGB 3QNWB 4M8LA 4LIWA 3BB5A 3J81U 2F7VA 1UFKA 1P1LA 2EO8A 3LP2B 3PBEA 1IOFA 3UCGA 5JUMA 4F9UA 4PZVA 1HNXJ 3TANA 3T90A 3NS5A 2WBMA 1MJBA 2XEXA 3QT8A 2ADBA 3DFEA 2C28A 1F5AA 4K5SA 4OJHA 1UVKA 2ATCB 5KG4A 3I56S 5HBMA 3CJKB 2JEJA 3CPAA 2Z11A 2PO4A 4IR1A 1LWCA 5EN1A 3H5YA 3OL9A 4ZA1A 4LFBF 5F8HA 3GB0A 3MEGA 1CVJA 4Q5VA 1VC5A 2X7BA 2MQ8A 2C2RA 3D6MB 3BJ8A 1HDUA 4MHDA 3IU2A 4YGOA 2OOTA 1U2RA 4JYWA 3KK1B 1RHMB 1CEZA 2XZTB 1F2OA 5LSOA 5HH1A 1TKDA