1R3NA

Crystal structure of beta-alanine synthase from saccharomyces kluyveri
Total Genus 151
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
151
sequence length
438
structure length
438
Chain Sequence
b'GTLNLPAAAPLSIASGRLNQTILETGSQFGGVARWGQESHEFGMRRLAGTALDGAMRDWFTNECESLGCKVKVDKIGNMFAVYPGKNGGKPTATGSHLDTQPEAGKYDGILGVLAGLEVLRTFKDNNYVPNYDVCVVVWFNEEGARFARSCTGSSVWSHDLSLEEAYGLMSVGEDKPESVYDSLKNIGYIGDTPASYKENEIDAHFELHIEQGPILEDENKAIGIVTGVQAYNWQKVTVHGVGAHAGTTPWRLRKDALLMSSKMIVAASEIAQRHNGLFTCGIIDAKPYSVNIIPGEVSFTLDFRHPSDDVLATMLKEAAAEFDRLIKINDGGALSYESETLQVSPAVNFHEVCIECVSRSAFAQFKKDQVRQIWSGAGHDSCQTAPHVPTSMIFIPSKDGLSHNYYEYSSPEEIENGFKVLLQAIINYDNYRVIRGH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords beta-alanine synthase
publication title Yeast beta-Alanine Synthase Shares a Structural Scaffold and Origin with Dizinc-dependent Exopeptidases
pubmed doi rcsb
source organism Lachancea kluyveri
molecule tags Hydrolase
total genus 151
structure length 438
sequence length 438
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 3.5.1.6: Beta-ureidopropionase.
pdb deposition date 2003-10-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01546 Peptidase_M20 Peptidase family M20/M25/M40
A PF07687 M20_dimer Peptidase dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.360 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1r3nA02
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 1r3nA01
3PB9X 1TF9A 3KI9A 5JGFA 2JEWA 2ANPA 3LWUA 4DJLA 4P6YA 2CTBA 2O53A 3KR5A 4OC2A 1QMUA 2CIJA 3FX6A 2PJ9A 4TWEA 4K3NA 1Z5RA 3VATA 2BCOA 3S9NA 4WWVA 3PBEA 3IJ3A 4IAVA 4ZY2A 2O4HA 3PB8X 2ZELA 3B3CA 4NGMA 2XEIA 3B3SA 4PQAA 1R3NA 1LAMA 1TXRA 3D66A 2ABZA 4MHNA 5CPAA 2NYQA 2WZNA 5HVGA 2V77A 2XEJA 4OP4A 5I4MA 2IJZA 3RZAA 4ONWA 4MXUA 4UEEA 2AFXA 1YW6A 2V8HA 3FEEA 1OBRA 3CPXA 5LYIA 3SJEA 4P10A 2RB7A 1Z8LA 3WABA 4A38A 3NH5A 4DYOA 3FEDA 3KZWA 2PIYA 4X8IA 3TX8A 2GLJA 3HLPA 1HEEA 5DS0A 5J1QA 2ZEEA 3TC8A 3CPAA 2ZEHA 4NGQA 4NGPA 3HUVA 4A37A 2GLFA 3SI1A 3D67A 5LRGA 2ZOFA 4Z65A 1CP7A 8CPAA 1XJOA 4MCPA 4R8FA 4P4DA 3QNVA 4P4IA 5K8OA 2HC9A 5ELYA 2ZEOA 3PBBA 1FNOA 3D4UA 1VHOA 3H8EA 4ZY0A 1Y7EA 4MHPA 2EK8A 4P4EA 3IWWA 2AFMA 2AFZA 4IK2A 1XBUA 2PJ5A 3V38A 1ZG7A 2PJ3A 3SJGA 4BD9A 4PXEA 1VHEA 5F09A 4MMOA 3B2YA 2Q4ZA 3D7FA 3PFOA 1YMEA 3BHXA 4NGRA 2C6GA 3SJXA 3FH4A 1Q7LA 6CPAA 2PVWA 1CP6A 4CPAA 4ZYQA 2V8VA 3N5FA 1GYTA 2AFOA 4JZ0A 3B35A 4F9UA 4R6TA 4NJRA 3KL9A 4YWYA 1ZG9A 2WYRA 3B7IA 4G1PA 3KQXA 3SJFA 2ZOGA 5LYLA 3KASA 3SI2A 3B3WA 2PE3A 3VARA 1VIXA 1XRYA 4YU9A 3PB4X 4UEZA 5HVHA 1IY7A 1NSAA 2RFHA 4ZY1A 1R43A 3H8FA 1F2PA 3IEHA 4UF4A 4P45A 2HB6A 4X3RA 1PYTB 3WC6A 1DTDA 3PFEA 1BLLE 2F8HA 3FF3A 3NH8A 1YW4A 1HDUA 4P4BA 3WC7A 3NFZA 3RBUA 3CDXA 3PB7X 4AXVA 5LYFA 1EE3P 5JH9A 4KSIA 5D8NA 3H8GA 3V7ZA 4MRIA 1BPMA 2XEGA 5LRJA 4PXDA 3KGQA 2PJ7A 2EWBA 5K8MA 3KQZA 4EWTA 2PVVA 4F9VA 2PJ4A 1TKJA 2PRQA 1RTQA 3WT4A 3KHZA 3MRUA 3T8WA 2ZEDA 4NGTA 2PJAA 4OIWA 2OOTA 4P44A 2C6PA 1Y0RA 3B3TA 3MN8A 1CPXA 2JBKA 4TNUA 4F8ZA 3FMCA 1ZLIA 4UIAA 1AYEA 3B3VA 2C6CA 1Y0YA 4DUKA 2BO9A 1JQGA 4JYWA 4UEFA 4UIBA 4EMEA 3GUXA 2IMOA 1BAVA 1ELMP 4NGSA 3VH9A 1LANA 4OMEA 1LCPA 1Z2LA 1YLOA 2NSMA 2ZENA 3KHXA 4H2KA 4LQGA 4OC0A 4ZX9A 2ZEPA 2FVGA 4GM5A 5LRKA 2J9AA 1H8LA 4WJBA 1ZG8A 3JRUA 2V8DA 1FT7A 2Q43A 2I3CA 3I1UA 1ARMA 4FAIA 4O23A 1XFOA 4OC4A 3RAMA 5CBMA 4MHZA 4ZX8A 3CT9A 1CBXA 1VGYA 3NH4A 3IC1A 3S9LA 4RUHA 5K8NA 3WC5A 2BOAA 3D7GA 3FVLA 2XEFA 2ZEFA 3DGVA 3PEIA 3NA6A 2CTCA 4EFDA 2PJ8A 1IGBA 2Q51A 1YSJA 4MCSA 3ISXA 1KWMA 2ZEMA 2C1CA 4B6ZA 4PPZA 2AFSA 1ZLHA 2ZEGA 1ARLA 4R7MA 3BXMA 3GB0A 1BPNA 4W9YA 3IIBA 2GU2A 4R76A 1CG2A 1QQ9A 3IFEA 2AFUA 4A94A 1DE4C 1HDQA 3L2NA 2QVPA 4P4JA 3D68A 3D7DA 2JBJA 3DLJA 1LOKA 4MCRA 2PCUA 3K9TA 4MHYA 3BI1A 4OC1A 4PXCA 4P4FA 2IQ6A 2PJBA 1AMPA 3BI0A 4MCQA 3IO1A 3S9MA 3FJUA 4OC5A 4OKOA 1F2OA 4X2TA 4PXBA 4OC3A 3FECA 2POKA 1TKHA 2PJCA 3KR4A 3PRTA 3PB6X 3D7HA 4NGNA 3GLJA 1UWYA 3SI0A 2GREA 1TKFA 4IHMA 4NFRA 2AFWA 2DEAA 2PIZA 3K2KA 4FBEA 5LYDA 4OIDA 1LAPA 5HXDA 1CX8A 5JM6A 4Q7AA 5THWA 2G9DA 3ISZA 3LMSA 1F57A 2PJ0A 1PCAA 4NJQA 4FWUA 1LFWA 2CF4A 5HVFA 2QJ8A 1TF8A 1CPSA 2OR4A 2V8GA 1ELLP 7CPAA 2PJ1A 2PJ6A 4FUUA 5IB9A 2F7VA 2QYVA 4A39A 2EK9A 4ZI6A 1XMBA 2VL1A 5K8PA 1M4LA 5D29A 2PJ2A
chains in the Genus database with same CATH superfamily
5HP1A 3JQJA 4C7IA 2V68A 4F3OA 2ANPA 1TTHB 2LEBA 1WHYA 2O53A 3OL6A 4A32A 2CQHA 1S1WB 3DKDA 4U67Q 2V9KA 4U7CA 4NRUA 4NGMA 2EK6A 2B5JB 3KHHA 3EGVA 4ZP9A 3D66A 4Y49B 5CPAA 3AA8A 1Y0HA 2XEJA 1T9UA 1ICEB 3MM6A 4FZVA 4N7TA 1YW6A 2XMWA 3RG6A 1YRUA 2Z30B 3NGTA 1R8BA 3ENVA 4BINA 4QC6A 1HEEA 1N6QA 1IR1A 2ZEEA 2CJAA 2W25A 2Y0SD 1RBOB 5J8CA 4NGPA 4C9DA 3NLCA 4MTPA 3M8PA 2GQQA 1CP7A 5DDOC 4I68A 4MCPA 2DY1A 2LP4A 4P4IA 2R2TA 3B54A 2MYFA 4J7CA 2ZEOA 1FCAA 1OY8A 3MEEB 4NLVA 3D4UA 1NHKL 1F5CA 4KZTA 2PDOA 3MMCA 4LFCJ 1CJTA 3ISND 1QSMA 1IYLA 5CCLA 4DL7A 1R7IA 3GFHA 4CH0S 1H6KX 4X4RA 3G82A 3HHEA 5B0BA 4A8KA 4CAVA 1PUAA 2MLZA 2V2ZA 2NYHA 3WC2A 3W64A 2BYCA 2QA4S 2ZBQA 2KXHA 4UW2A 1Q7LA 3MM5A 2OJ3A 4PWWA 1RK8A 2C27A 2RF2B 3SCKE 1YJWS 1SJ3P 3OFEA 3IAS9 1S6PA 1MN7A 1HPZB 2G2YA 4RUAA 5A6PA 2F8EX 4CAXA 3E01B 3TCVA 1VIXA 2EXUA 2JEJA 4NI2B 1X9MA 4AXJA 4OZ5A 3U7JA 3KHRA 1YVKA 3A13A 3O44A 3VWDA 1HHSA 3CDAA 2R7VA 4AL6A 4KH1B 2ZUAA 3IN5A 4JI6J 4CTAA 3CD5A 3MEDB 2W7AA 2FJAB 2GGPB 3DM2B 2VB6A 3NH8A 2EFGA 5DG8A 4IRCA 3FBCA 5HBMB 2G0JA 4C8NA 1FI4A 1RJJA 4ZJLA 4PK2A 1AROP 2DCLA 4LRDA 3R7BB 1RWUA 4K4WA 4ZPAA 5IQ6A 1RA6A 4M8LA 4I6YA 1X4HA 3QRRA 4J3GA 1N34J 3GFYA 3N6LA 1X4FA 2KTQA 1WG1A 5ETTA 1XR6A 3VWSA 2OUGA 5IT9Y 1HNZJ 2FHJD 3PW0A 3A3NB 2PT0A 2P6TA 4HYKA 2GC8A 2M70A 1RT4A 1UJ4A 1XQIA 3AD7C 4I4BA 1E6VB 4OLPA 3TO7A 1GMWA 5IM0B 2EPIA 3AFGA 2KT2A 3TZXA 1NUEA 5LXRA 3VQSA 3DLGB 5EWEA 1Q1KA 1DJ0A 2W7PA 4UEFA 3W8GA 5GAHU 3TAMB 4NGSA 5HMNA 4X62F 2ZENA 3KLVA 4X66F 1UAWA 1UW4A 3MM8A 1CC7A 2QFIA 5F48A 3ZTSA 1DQAA 2QLXA 2ADCA 4DR1F 2Q43A 4KGKA 2PA8D 2BUNA 2B4PA 1W2BR 5E3QA 2FLNA 4DCPB 2Z3MA 1Y5LB 2CPXA 4ECVA 1L5UA 4B9UA 2E29A 2ZD1B 1QJHA 4QQBA 2B0GA 1C4AA 4ZOSA 1IGBA 4DMZA 5D8HB 2LXUA 2AYGA 3OTOJ 3AAWB 2IRUA 4CLWA 3TW0A 3MD3A 4X65J 4CNYA 4B9SA 3R8YA 3KLGB 4M5LA 4DR4J 4OMFG 1RKJA 2Z58B 5CYMA 4QPTA 4USVA 3HZEA 4KGVB 5DQHA 2IM2A 3EZ5A 1NK4A 1MG7A 1SJQA 1NHUA 4FD7A 3M9OB 2FVPA 3EY5A 2C3UA 2JRSA 4IG3A 2JWNA 3OSNA 2RRAA 1REVB 2QA1A 1GX6A 3H59A 4HT7A 2DEJA 1FKPB 4ELTA 3TEGA 3CXQA 2XSJB 4ED3A 2PJCA 4X4QA 4NGNA 2EG1A 4LFAF 1UJ5A 3GJRB 3LALA 3BF4A 5JUMA 2CPEA 4FDFA 4ER8A 3HHLC 3MZIA 5AXNA 4YS2A 3HCXA 4KFBB 1L0CA 2QE5A 4OIDA 1PILA 1S3ZA 1KQKA 3IP0A 1CX8A 3EDRB 2EEYA 2J9CA 1LFWA 5KFZA 2HHPA 2B6AB 2VBYA 1HWJA 2Q1LA 4Z7CA 4ZI6A 2B58A 4Y2KA 1SI9A 3NWGA 1WWZA 2RIJA 2JEGA 1V3RA 1VISA 3LGNA 3VCDA 2MKKA 3F0NA 2XO7A 5EWFA 4AXIA 3VALA 1WTFA 1T94A 1ZBTA 4G3IA 2DNGA 2FGCA 4NPOA 4DR5F 3QFWA 2DJWA 5J2PB 1TAUA 1PU9A 2BCOA 2HNYA 2MY8A 4WWVA 3V6DB 3TO9A 3NBPA 4LF7F 1R3NA 1TXRA 2JLMA 2EFPA 3M7VA 3BS9A 2R2RA 3M6VA 4LIWA 5HROB 4OX8A 4B5PA 1VJWA 1NKCA 1TVRB 3CPXA 1HWKA 5DLGA 3FEXB 1Q7YT 1RTDB 1RP5A 3L3CA 4OLOA 3M2RB 4HLBA 4R5PB 4A38A 2BE2A 1JJHA 4RLEA 4PV6A 3C16B 1KQSR 3PW4A 2FB0A 4RU2A 2HHHJ 2CXAA 2RRNA 3MOZA 1OQ3A 4PUOB 1IUJA 1UCNA 1IXKA 4E98A 1M44A 1NPKA 3BLNA 5FDLB 4A37A 1I12A 3C2PA 2ZH8A 2RRBA 2VKZG 3DLKB 2AJ4A 1FVSA 2BJ1A 5LRGA 8CPAA 3G96A 3CJ4A 3M05A 3MF5A 4N8NA 4RNFA 5L9XA 1EP4A 3MUTP 1GMUA 2XMUA 3ZC4A 3D7SB 2AWZA 3R5GA 4ZN3A 2DNPA 2UXDJ 2RDJA 3FBEA 5KFUA 1X7VA 4CLTA 4F26A 3R7SB 5J2NA 3SJGA 4DQIA 4MFZA 4DR2F 3BGUA 3W6XA 1U25A 1S1UB 3SJXA 3GTYX 4NYOA 3Q83A 3LD2A 1TL1B 2C42A 4F0YA 4R6TA 2HSEB 1WDTA 2DNQA 2WYRA 1R8PA 2OMLA 3KNGA 3OBIA 3T9NA 3W63A 4C3KA 2XMAA 5IX3A 3UN5A 3KJVA 4PR6A 1FXRA 3IS9B 3VVTA 1KR4A 3HSZA 4WIIA 5KFMA 1LWCB 4DS5A 2VFRA 5J2MA 4E2AA 3L7UA 4K4VA 2WVDA 3U27A 3DU6A 1VRUB 3WC7A 3S6FA 2X1GA 4DPTA 2QC3A 1GH8A 3EUNA 2L9WA 1G3OA 4AVBA 1M5PC 4ED1A 4MKAA 2BJ8A 4J91A 4FF2A 2JZ5A 2BBEA 2PVVA 1BWEA 1GNKA 3PDNA 1WHXA 2GHWA 1VBKA 1UVNA 4Q8FA 4NGTA 3IGRA 2OOTA 1K8AT 1WEXA 3PHEA 3D3CJ 3B3TA 3SEOA 1RT1A 3PJ9A 3AB4B 4DG1B 1Y0YA 1Q53A 1Y10A 2JLGA 2MXYA 3NGRA 4I6AA 4UZBA 3GIIA 4F7VA 4AT1B 3PG9A 3I82A 2OEMA 3T1YJ 4DUZJ 2J9DA 4JV1A 4LSNA 1YR0A 2B4OA 4QUSA 1K47A 4ATNA 4R0EA 1C4CA 1GXLA 2XYPB 2MZSA 3PR5B 3T1AA 4KGZB 3CXCR 1FNXH 2Q04A 3DHXA 1T9VA 2QRRA 4PG7A 3OJUA 3UI3A 1FJEB 2UXCF 4HNWB 5C7PA 1WOOA 4AG9A 5KFRA 2P6SA 2WUUA 1NJYA 2ZEMA 3H40A 3IWXA 4B08A 1F3FA 3BBFA 2OGUA 1KTVA 2E9ZA 2HVHA 2JFDA 2RHSB 3K17A 3IFEA 1FXLA 4DL0C 3D3BJ 2VBZA 3K5PA 4UY85 1LOKA 2PQ8A 5A76A 4PK3A 5A27A 1NDPA 4O4GB 1LW2B 7AT1B 2R8KA 2H48B 2FJVA 4OX6A 3J7YU 1PC5A 2XNRA 2XZWA 4ED8A 1FRMA 1M1HA 1SQFA 5IT0A 1X5PA 3HF5A 2MMYA 1FRIA 5CZVA 1TKZA 2QLFB 1TELA 4QB9A 3ITHA 3OUYA 2OKQA 2B43A 2HG4A 1HI1A 1SJ4P 2UUAJ 1U1QA 1FTRA 3PB6X 1VQOS 3DR6A 4OJHA 5L1JA 5GCNA 4ZN1A 1APSA 4AVAA 3T41A 1S1VB 1UEKA 1PYSB 2V69A 4DV5J 2X3DA 3D1HA 3E2EA 1VC0A 4OZLA 2PN6A 3R6GB 4TLQA 3I3GA 4IO9Q 3BQ2A 1ELLP 2C2ZB 4JBCA 4B3MF 1DTQA 1S57A 2NS1B 3DLGA 2ZW4A 1RT7B 4OHWA 4ID8A 5BJRA 3KK1A 5K8PA 3W9IA 1KBRA 3OR2B 5IV3A 4ONUA 4ID5B 2VBXA 2KH9A 1Q8KA 2E5LJ 4DV6J 2HVZA 4FYXB 3D0HE 1HNWJ 4ZP8A 5FVJA 3E51A 3EZOA 1Y00A 4HL9A 1RAHB 4URGA 3AJ2A 1K73T 1MLAA 4C97A 2CKWA 4LF4F 1VLOA 5BR8F 1R0BG 2BVZA 4HH0A 3PYEA 3S7RA 4MXUA 3K9UA 3N6MA 2OD6A 1WOSA 1I5OB 3U1MA 2W4PA 1RLCL 4DFKA 2YNHB 4GS4A 1JK9B 4KO0A 4U9RA 4OYWA 1S9FA 4WKRA 4WBFA 3KLGA 4JI3F 3D5MA 2Q79A 3HI9A 4EZ9A 1BUXA 1YIJS 2HBYB 3PM9A 4Z65A 2Z3KA 3MPUB 3HSGA 3R5JB 4ELVA 4QBJA 1Y7RA 4XPEA 2ZNYA 2UXBF 2VI7A 4DF4A 3K5OA 1X4BA 4MK9A 2KXNB 3OLAA 4DV7J 3EXNA 2NXUA 4LT6A 2FY1A 3CD6S 1Y7EA 2JNJA 4MHPA 4ZCKA 3BO2A 2R8JA 1AT1B 3NNCA 1NHVA 3IBFB 1FKPA 2NPIA 2JFKA 2KVIA 3S6KA 3LODA 2FCKA 4PXEA 4OI1A 2W7OA 4GC6A 1XNQF 3TEHB 4P73A 1YMEA 3W1YC 1R6VA 4WU2A 2LVWA 4O0NA 4UOGA 3DRYA 3TZWA 4KVME 3M30B 1UA1A 4H6ZA 5KOWA 2IBOA 1S1XA 2V8VA 1GYTA 3DRRB 3SXNA 2R8IA 3IRXB 4CP5A 4F9UA 5AXKA 1XBWA 2VPWB 5FD1A 1BQMA 2ZOGA 2AP6A 2HHUA 2B6AA 4B11A 3KDNA 4DSIA 4UWJA 4V19X 5E3PA 4NZ0A 3C15B 3GCXP 4P72A 9RUBA 3I96A 4WP9A 3S6EA 5ETMA 4WFAQ 1FXDA 2BW7A 5DDPC 4QBUA 2BZ2A 3KK2A 4ZLLA 1CJKB 4Y65A 2W9BA 1IYKA 4R57A 5D0GA 3MURP 4MFPA 1GK8A 2AJFE 3GV5B 1LK7A 3KLFB 2QZ8A 1OQ6A 3GYGA 4M95A 4B9NA 2JVRA 5HROA 5D3GA 2WVBA 1TP7A 4C3MA 3TP2A 2PIIA 4ZP6A 3WT4A 1T03B 4E8OA 3HKWA 1RWOB 3UR3C 1SKRA 4WYLA 3G8TA 2BXJA 3VHQA 2C6PA 1IBKJ 4PUOA 1X4CA 2JL9A 1O0PA 1RT2A 1NAQA 3GONA 3DXBA 1MU2B 5E3CA 2Z57B 1ZTTA 4R0JA 4RZRA 1AUDA 2KCWA 4ITSA 5KT3A 3B3VA 2VG6B 1SC3B 5DZ7A 2PRBA 2F5IA 3D6FB 3CC2S 4D3HA 1TKDA 2UVWA 2DGWA 2A2CA 1VQNS 3ZTQA 3O5TB 4HHUA 2HFZA 3CCUS 2G2OA 3IU2A 4GKJF 3FRYA 4ZJOA 3QSYB 3PZPA 2WTFA 3N0VA 4I1TA 4WYWA 1PAEX 3A8IA 4ZPWR 1TQLA 4HR2A 4RX6A 2EVZA 3IMQJ 3GV7B 2ALZA 4DLGA 2HVDA 2IRXA 3WX8A 3BBBA 2WOMB 1IIDA 2KYZA 2BOAA 4JP8A 2CY2A 1A7GE 3J80Y 1CJVB 3DRXA 1JLFA 2PJ8A 3IS9A 4OYOA 4FYDA 3HVRA 1P1LA 1Z4RA 4KHPF 5DG9A 4IR1A 2RH3A 1ARLA 2O01C 5D0EA 1LWCA 1QSRA 3Q8UA 6AT1B 1NO8A 3DLJA 1VRTA 1NSPA 2AZ1A 1UEUA 4AQYF 1IWAA 1F3VA 1JJ4A 2A3JA 5CQGA 5LSLA 4KOTA 3BDEA 5LT5A 1YBAA 1ZM9A 1BQNB 4CYUA 5C88A 4OZ0A 3SSSA 3N01A 2R7HA 4ECXA 2YPYA 3ONQA 3Q8PB 3FBBA 1E6YA 4AG7A 3NAIA 5F8JA 5D4PA 2WSFC 2GA7A 2DEAA 4Y34A 3R5BA 1S9GA 3C14B 3DXSX 3MFHA 1TKXB 4WFNQ 1QUPA 3M2UA 2JSXA 3CO0P 5L1KA 1R8CA 1QAIA 3C6TA 5EBVA 3EGWB 2OFGX 2R7UA 4N56A 3PGPA 2AF6A 1M4LA 2HNZB 2XSFA 3LANA 4YY3J 1FWLA 3IA0A 2HFUA 2ROEA 2G3AA 2CQ1A 3SCLE 2ADBA 2CTBA 2XG8A 5CNPA 4ZPVR 4OC2A 5HL7Q 3DDNA 4USKA 2KL8A 4YR2A 5DZ6A 4CLPA 4OX9J 3EJMA 2LCWA 2DRAA 3WQPA 2YKNA 2VQFJ 1NZ8A 2AJ0A 3AHPA 1YJNS 2APOA 2G4BA 8ATCB 4X5KA 1U02A 3M6XA 4HT5A 1MSWD 3TT2A 4F4WA 3CGIA 1X9WA 1QVGR 3QO9B 4MFBB 2CPFA 3MR6A 1IKXA 2XB2D 4RKUC 4EBEA 1DLOB 1S0NA 1VQSA 3CJ5A 2R9LA 2UUCF 3KKWA 1FNMA 1JKHB 1H74A 2FHOB 4FF1A 1Y7PA 3DOKA 4FS2A 1HR0J 4LR9A 1PG5B 4YB7A 4HDHA 4WFXA 5HQLA 4O4GA 5L8RC 4F4AA 2OPQB 1N32J 3EE3A 3K57A 2XS7A 1MWZA 5K8OA 4ZLNA 2F9JA 1HNXJ 4MJKA 1YREA 1EQ0A 3LPEA 2CVIA 4ZY0A 2D9OA 1RYSA 2EK8A 4ILMA 3ZZ0A 2LQBA 1PC4A 4TXSA 3NCRA 3SXLA 3GE9A 3KJNB 1RT5B 5EC4A 2CA9A 4BD9A 1JXEA 3BV8A 2E66A 4MYUA 4C11B 2IDLA 2HFSA 4NGRA 4O3NA 3PCOB 2XMTA 2FLPA 1ZM2A 3FH4A 2GANA 2XYGB 2E9TA 3N5FA 4JI2F 2VHGA 4JOUA 1Q2YA 3D8PA 1C1CB 5J1NA 1SC1B 2YNFB 3B7IA 5E33A 1T3NA 4EO8A 5G1ZA 2BQUA 1KNZA 4EUVA 4LUAA 4NLYA 3TJAA 2QIRA 2H4YB 1A6LA 2R2SA 5HMXA 1K1SA 4MK8A 2RFHA 4ZY1A 3A8KA 3JUWA 1RB0A 2GAHC 3VGSA 1S77D 1B6BA 1T3OA 4ID5A 3PEJA 5LMUF 1SJ1A 3Q89A 2Y8YA 4KOYA 4KGXB 3O8WA 3BYPA 5C5JA 4IOBA 4M63A 3FF3A 3R1LA 3BJ7A 3CCTA 4UFWA 4I2QA 1CC8A 2EFNA 2GVZB 4DX7A 4GKKJ 3H8GA 2HFNA 2NSCA 4CAWA 4MRIA 4NMLA 3HVAA 4M6HA 4UCNA 4FN5A 1KP6A 5BXIA 3B4MA 4LMZA 3AT1B 3S8SA 5CYQB 1Q0NA 4RUBA 4UUXA 4LF6F 1WELA 1SV5A 4N8OA 3AY0A 4RPFA 1ZAVA 2FL4A 2ROGA 1JLEB 5HQMA 4JV5F 4LFBF 5KFVA 3I4PA 1KONA 3LA0A 1WSRA 1YGHA 4LBHA 1N4LA 1JQGA 3ETOA 2CDRB 5FLXY 4B12A 4LF8J 1RKIA 2RDIA 1VI7A 3GUXA 2NSBA 5DDQC 4FXWA 2IMOA 1CLFA 2RMLA 4USUA 2FVRA 3T5KA 1QM9A 1MWQA 3I31A 5F46A 4NEZA 3SSRA 4CH7A 4UUWA 3KHXA 3D3SA 2KRBA 2RNEA 5KG1A 1XIXA 4LF5F 3TUZC 2NLWA 3NRBA 3IU1A 2LA4A 4I56A 4ZVTB 1NK9A 1U1NA 1UFLA 3WR7A 1JLQA 1TL3A 1QSSA 1KVKA 2N7YA 3M30A 2BKOA 1CBXA 3HD2A 5KFYA 1ELOA 4OHVA 3B6BA 3ICLA 1SQHA 1UVJA 4Y2CA 2IBKA 2FGOA 1B99A 1R89A 2Q51A 1YSJA 1FK9B 1KQGB 1S1TA 5IC4B 3SYZA 2ZDOA 1V6HA 3L7OA 4PPZA 2P6EA 4M5KA 4P6QA 4DR6F 5F9NA 1TL4A 4DZ6A 1WF1A 2DTJA 3R9GA 1YTYA 4M6IA 2CQ0A 1CEZA 3HD1A 4RW8B 2EKNA 1FKOA 1CJKA 2CQGA 2HVEA 1RWWB 3PY8A 3RW6A 4GMKA 3NNHA 4KHMA 4BBYA 4DXLA 1F9HA 3HM9A 2ZHAA 3QJJA 2MQLA 1C1BA 2F63A 5A8WB 5IFMA 1M5SA 5DLFA 4UZCA 3MCNA 1Y9KA 2H51B 4NWBA 4RUCA 4JI0J 4OZ1A 4F3QA 2J6TA 1T03A 1KC8T 4LSLB 3IG1A 3OR1B 5A8RB 2KFNA 3CJ8A 4P2SA 2MQ8A 3R96A 1MU2A 2Z3PA 3G2XA 3ISZA 3CCES 4CLSA 1P9QC 5HVFA 3CCSS 2VG6A 1Q5YA 4K5SA 5LL6d 2NYIA 2D74B 5B0FA 5ISVA 1FRXA 4Q38A 3RNZA 1T9XA 3MAAB 1VBXA 2ALYB 4ECSA 5E41A 4IH7A 5GAGU 2ZE2A 2UUBF 2UVUA 3T9ZA 1LWFA 5AE2A 3V81B 2D4PA 2HRUA 1QMUA 1PBAA 2CIJA 2MPUA 2LQ5A 3S9NA 3PBEA 4UTGA 1RHJB 2YH1A 4U9YA 4Y2MA 1TMJA 2K8GA 4CCHA 3B3SA 3QMQA 2CPYA 2F9DA 3SCJE 3G87A 1FVQA 3RZAA 4XPCA 4FVMA 2WOMA 3PJWA 1YITS 1X8DA 1GXTA 4F8RA 1DARA 5L9NA 3FEEA 3IWEA 3OXGA 4YEAA 3G3SA 3CCRS 2NXJA 3NH5A 4EI2A 2BMBA 1RI7A 2J9EA 2H4WB 3AQOA 3RRGA 2HZAA 2R7RA 4ZDNA 5A2QY 3LGHA 1P27B 2QX0A 4PG5A 2IA0A 1XWLA 2EC0A 2QV6A 5EUHA 1NK8A 4TNOA 3FDSA 1HBUA 2RVJA 3J81U 3ZTRA 1EKRA 3KG4A 1N5YA 5AJ3F 4RR5A 2J6UA 2K7KA 4PAAA 1D8ZA 2IAJA 3JSBA 5JQ4A 3K5LA 1RHQB 4AE5A 2UU9J 4J9PA 2FZKB 3GCWP 2LU1A 2PI4A 4J9QA 3O3LA 2OTJS 2AD9A 2Q4ZA 5F3ZA 1LXNA 4DF8A 2IJRA 1B87A 1X9SA 4DPOA 4XDCA 3W9JA 1TKXA 1N33J 4CGNA 3FQKA 4IYQA 4RW6A 1HQUB 2CNKB 4IOAQ 3PZJA 4DFJA 1FX4A 1CSJA 1FRJA 2GVDB 3DDIA 2DGVA 3FFIB 2WW4A 4ED4A 2LEAA 2QL5B 4KOXA 3MECA 2HNZA 4MFQA 5GADU 2DPTA 1D3WA 2LKZA 1ZO0A 2ZFHA 1U26A 3BPDA 3TVZA 4J9SA 3M8QB 3RAXA 3QNWB 3N4WA 3BGOP 3K8VA 1LKZA 1Y5IB 3TZZA 4ZPTR 1MW7A 3C6UA 2CPIA 3QLHB 4LF9F 2ZEJA 3J7YI 4K50A 3BQ0A 3PB7X 3CCVS 4NCAA 3N9UC 1VQMS 1XNRF 4Q45A 1RAOA 3R9LA 3QWPA 2BM1A 4QWEA 3LP2A 2PA3A 4F4YA 2PJ7A 5KTAA 1XEZA 3EX7B 4USIA 4MFBA 1M4IA 2K2PA 1AUGA 1T7PA 3FRMA 2VZ9A 1DY3A 2P6FA 4O44A 1QAJA 5ETQA 3FMCA 1AYEA 1FDBA 4OYBA 3Q24A 2AGOA 2AEMA 2N82B 3QJLA 1TMMA 1RABB 2DHAA 1FEHA 1RAJA 3DI6B 2PDAA 3MR7A 4Y6IA 2X1FA 4XPLA 3DRSA 3BGRA 4ED5A 4DV1J 4IFYB 1Q2CA 3MGDA 4ZVFA 1YQHA 2LYVA 4JI1F 2HQYA 3L4BC 2YNIA 5B0GA 2QFJA 4DV4J 5AXLA 1RXTA 1EHWA 2D1CA 4O23A 2FXFA 1XFOA 3F44A 4F2RA 1H2UX 2Y3YA 2BJDA 1SVDA 1HWIA 3HHDA 1C1CA 3HVTB 2HBQB 2YNFA 4A8YA 2M2BA 1LV5A 4X2BA 4B13A 2OLWA 2P2CB 3MMAA 4N76A 4KSAA 4LRFA 1Z4EA 3BXMA 1PJ6A 2I79A 4F67A 4TY8B 2NCKL 3X1LB 1SIWB 1BD6A 4K0KJ 5CAAA 1D8YA 3OD2A 4DR2J 3L2NA 1RT6A 3QZ8A 2GHPA 2ZWPA 1RADB 2PCUA 4UCPA 2FUG9 2HQGA 4JI4J 5C25A 1WORA 5D78A 1WKKA 4A8FA 4TYBA 1B64A 5F8HA 4FD6A 1RHRB 1KVJA 1TK5A 3NGDA 3G6ES 1U1RA 2IC3A 2Q3PA 4E8UA 4EU0A 3I9V9 5E3AA 1TUGB 2ZDPA 2NREA 1RSCA 2YNCA 2B56A 1OPZA 1Q16B 1VR6A 3CSKA 3GLJA 4NOHA 4NYPA 4FP9A 8AT1B 2ZH2A 3GIRA 3W61A 4ILLA 2MLYA 3TUIC 4IHMA 4Q2MA 4KB7A 2GE3A 2PIZA 4WP8A 4IQMA 1A2ZA 3RW7A 3PKYA 4Y3CA 2BOPA 3GIKA 1LAPA 4JV2A 2HPUA 2ZM6J 5LSRA 2Q66A 1S48A 2VG7B 4QPXA 3SXOA 4QWDA 4K8RA 2V8GA 1IBLJ 2XI3A 2CZ9A 2F7VA 2CJ9A 4O4RA 3R97A 1OWXA 4HACB 5KTCA 1SCJB 1Q79A 3W2WA 3KLHA 3R9FA 4CYNA 1VHSA 2V8PA 4NLRA 3QFHA 1TV6A 3QT8A 3V4MA 4A8WA 2AJ2A 2ARHA 2KYXA 1RAEB 4NXMJ 3D6MB 1OO0B 3ENQA 1IM6A 2R1IA 3VATA 1RU2A 3CUNA 3BH7B 2M5YA 1PGZA 3M1VA 2NR0A 5CXTA 4DV2J 2RUGA 4RW4B 1SJRA 2GQCA 1IBMJ 1VK8A 1I94J 3GJTB 2E1PA 4ED0A 2K1RB 4WXOA 2WBRA 2YQ0A 5LYIA 1WACA 1RU1A 1VQ5S 4B17A 1Q82T 3D1OA 3LOUA 1FK9A 2YBVA 3TNVA 2PFDA 3FEDA 2RAQA 2PR8A 1MROB 3FZ2A 2DR8A 1JWWA 1PJ7A 1JXLA 4Q0BB 4E0AA 1SQGA 3UCGA 4BWMA 1D9DA 1UVKA 3THVA 3HUVA 1VQ8S 2OH1A 1WC4A 4RW8A 1UVLA 2C2RA 4A2ZA 2NQPA 1FFWB 3HJVA 3WHIA 4DV3F 1IOIA 4R8FA 3ZO7A 5CCMA 4YOEA 3PBBA 5B0AA 2FJWA 3ZZPA 3KLEB 4DR7F 3HHLB 5E3RA 1HHQA 3A4TA 3CMQA 2ILZA 1SKSA 1U2CA 2J8RA 3NS5A 4MI4A 1ZG7A 2PJ3A 2R7QA 1N88A 1N5VA 4YR0A 1VHFA 1PYOB 5ETVA 3K0JA 1Y9WA 1GQEA 2PEHA 5G20A 4CS0B 3D4JA 2MZQA 2M7SA 4NLQA 3CJ3A 1NSQA 4JZ0A 5F8IA 2FE7A 1NJIT 1FJCA 4KBIA 2REFA 4QWAA 4XPDC 2Q44A 5KFHA 5I3PA 3BSNA 3CXSA 1OSCA 2N3OA 4MKYA 3TOAA 1F2HA 3N28A 3MAAA 5IWAJ 3H8FA 1QSNA 2V94A 3QB8A 2DR5A 4F3MA 3CJ0A 3EGNA 2MKYA 4DPWA 1RTZA 2VV5A 4ILRA 3TI0A 2MEWA 1L3SA 4OYAA 4QYRA 2VOPA 5DGAA 2B9YA 3BB5A 1KHVA 4KSIA 4M5IA 1EETB 4ICLA 5I3UB 1XMOF 1W26A 2DH9A 3KK3B 2QIFA 3KGQA 3GQCA 1R8AA 1X5SA 1T05A 3OWCA 5HMWA 3FJ2A 5HQ8A 1KD1T 2FSRA 4II9A 2DGOA 2PJ4A 3VZIA 2QA2A 1OZPA 2CG8A 5C24A 2L08A 2L41A 2ZEDA 3KYLA 3RR7A 4P2FA 1S5ZA 2PO4A 4CLKA 4B3OB 5DM7Q 1NJZA 1I6JA 5K9FA 3TA0A 3PHTA 1S79A 1S7NA 4U8YA 3R3TA 3PO4A 4Y00A 1URNA 1VKCA 1FT8A 4ZBGA 4AL7A 3AD9C 2B4DB 2BO9A 3OXFA 3ZZOA 3SFGA 4FYYB 4UIBA 1ZS6A 4WZMA 2LFVA 4M5DA 1TAQA 4B9TA 1C0UB 2Y1RI 1X10A 2XY6A 2KZZA 4Q8EA 4ZGYB 4Y2AA 1NK5A 2WZ1A 3HFVA 2BKNA 1F5BA 3Q2SC 1S6OA 4WU3A 3W91A 1YX2A 2M9KA 2WONA 1S9EB 3UWTA 4JI3J 4L74A 1T02A 2B8PA 2KN4A 4IR9A 4YMEA 3V6KA 3Q22A 2PSWA 2WPXA 1RTIB 2H1YA 3BSOA 1VGYA 5B0EA 1NEEA 2HQDA 3K8WA 2CVEA 4OI6A 2IM0A 1LW0B 4P9SA 2VXKA 1HQUA 1S0OA 2X1AA 2BANB 1VQ4S 1UW9A 4EFDA 2OI2A 3ILLA 3FFIA 2J8SA 4P2MA 2BDPA 2C1CA 4WIQA 4RL1A 4USHA 1XJWB 2GU2A 4DU8A 3CULA 4LQ6A 4LR7A 4TU7A 2CG4A 1G7CB 1NDKA 5AE1A 2JBJA 4ED6A 3M8QA 4QJVA 2W1BA 2I1RA 4DI6A 2AYBA 3NEKA 5T14A 4K59A 4NZ6A 3QLHA 3D28A 1IBCB 3H7HB 1EX8A 2IQ6A 2ZZMA 3VQTA 3LWLA 2JLEA 3I5CA 1TK0A 1U0HB 4ZVUB 3J7ZT 3DR8A 4MFJA 1C0TB 2WK4A 1IKWA 1H7XA 2I38A 1CQNA 1Q8LA 3DU5A 4H4MB 4I69A 3HHKA 2CPDA 2V2KA 2W2NP 3MEGA 4NYZA 4N77A 5J1EB 3DYAA 2AFWA 1PIEA 4IG0A 4HHJA 2XCAA 5DGBA 2FD2A 4PPDA 4O3QA 2N4DA 4MFKA 1NDLA 2BQ3A 3G6VA 1PJ5A 1V5IB 4C2YA 3GZ7A 3WIUA 4DQRA 1NH8A 4X64J 2GQ2A 2OEKA 2XZDB 1P8GA 4F2SA 5D29A 4QIFA 3DI6A 1N54B 1S72S 5F49A 2NXEA 3PW2A 2COLA 1NMTA 4A48A 4PWDB 2H54B 3IR6B 3W2VB 3M2VB 1EARA 2CUYA 3MMJA 2MHNA 3KR5A 1QLNA 4LFCF 4P52A 3E3XA 3VGTA 4GVBA 3RU0A 4CRYB 1F9EB 3SCIE 4JI5J 5D6GA 1ON0A 1RXOB 5HVGA 1SUQA 3TRGA 1O6XA 3HXMA 4PG6A 2V4QA 4X4SA 2EW9A 1RHUB 3HSJA 2RB7A 3M9MB 2VODA 1U6MA 2CJBA 1SQEA 5DS0A 3RR8A 3TC8A 2QN6B 4PZVA 1MJAA 1NJXA 3CB4A 2G0BA 3V8IA 4J9KA 3TQEA 4KS9A 4YDDB 3KUHA 5DDRC 3I56S 2HAFA 4ECWA 4JI6F 5LSOA 2HZVA 3IM9A 4OI3A 2FYXA 4IFVA 1WTBA 2QA4G 2FC8A 2BACA 4V19J 5A8KB 4M5HA 1WUUA 4ED2A 4MAKA 3MMBB 2MKSA 3PX6A 3HSDA 2LEPA 4UWIA 1XBUA 3V38A 3SQGB 2A4NA 5K20B 3E0KA 5G4DA 3F41A 3QRPA 1WG4A 2RE1A 1N34F 2C2MB 3GSDA 3KOAA 3BHXA 5KT5A 2XWYA 3BR8A 6CPAA 1VCTA 3DNSA 2JDDA 1JLGA 2HHWA 1NB7A 1B7YB 2J7UA 4MH8A 4KKOB 5T7LA 1UWAA 3SJFA 3ZZUA 1WEYA 5LYLA 1B0TA 4ZPCA 2ZH6A 3DOLA 4FVCA 1RE1B 3M8WA 2XS5A 2B5GB 3CE8A 3IGNA 2FLOA 3L9ZA 1CPZA 2J9DE 3DOMB 3D0GE 5HVHA 1S7LA 5ETPA 4K4XA 1NE9A 2DNNA 2IJNA 3MR5A 3OW2R 2R8VA 3R9EA 3D1QA 3N7ZA 4OZNA 1PYTB 3UD3P 1HNIB 1O8BA 2HBRB 1OY9A 3FMWA 1YW4A 3I0SB 4OJGA 1QAYA 3GIUA 3P96A 1WK4A 1QDUB 3U1LA 5JH9A 4M5MA 4FS1A 4ZVEA 3H42A 3E8OA 5HSPA 4PXDA 4F6AA 3MM9B 2K1RA 2X7IA 1U1MA 3S6GA 5AG6A 3FBFA 2YKAA 2H65B 1M5HA 1XK8A 2PI5A 3QYYA 1CS4B 4NASA 4PQUB 5BYSA 4G65A 5FJ4A 3JSMA 4KYZA 1RZMA 2ERRA 1S4FA 4WCEQ 1BXNA 3PW5A 5G0RA 1NCLA 3TARA 2J5AA 3OTOF 1RDRA 4OV6A 3N6NA 2YKPA 4X65F 2MKJA 4YB1P 3LAKA 4DR4F 3X3UA 4JYWA 1MJ9A 1SH2A 4H6UA 4C8ZA 2DITA 1ELMP 4PSWA 1TKTB 1LCPA 1JLAB 2ZWOA 3NNAA 2Z56B 3LWMA 4LQGA 4YR3A 2ZEPA 3KLIA 3CDEA 3MM7A 1G4CA 5L39A 3HHLD 4OHXA 3GYNA 2XHCA 2V8DA 4QIEA 1KEKA 2IM3A 2RSQA 3FK4A 1WC6A 1IJFB 4MK7A 4FAIA 4IQXA 3M6UA 2N3LA 3FZBA 3V4IA 3LP1B 3V5RA 2DXDA 3THTA 3D7GA 2B4VA 1HARA 3B4DA 2RT3A 2JEVA 4HDGA 4BBHA 4AL5A 3ISXA 2CAJA 2OPPA 2AIRB 2VDHA 3FCVA 4C98A 1J5EJ 2OPRA 1QQ9A 3I5BA 5LXYA 4DL6A 2AFUA 2GAGC 1U6FA 2C3MA 2DCUB 4MCRA 1F1BB 1B4SA 3H2LA 3DSBA 1SKWA 4MY3A 2VQEJ 1ZAXA 3K7RA 2XGPA 1YVOA 1HBNA 2OPSB 4OZJA 4NF1A 3VWEA 4X4OA 2XMJA 2A6MA 1HMVB 4OC3A 2KT5A 4UFXA 3PRTA 4U6PA 3FIXA 1REGX 2CWXA 3KG1A 4DCJB 2GIVA 2W4CA 3H5XA 1H98A 4UA3A 1ZZNA 2DNHA 2Z0GA 3EPGA 1BOBA 4OYZA 3M32B 5I42B 1UTAA 4B3OA 4NCGB 4RW9B 4PKDB 2E9RX 4UOHA 3I55S 1K0TA 3HVWA 2L9NA 3A3PB 4Q7AA 1PCAA 4I2PB 3T6BA 1TF8A 2DY9A 3KJFB 2V2VA 2YNGA 2XHWA 1YBUA 2K3KA 2F3JA 1Z1ZA 4B3TJ 4OI4A 3GIMA 3C26A 3KI9A 3H0PA 2AJ1A 4XNHC 2MQMA 4S0MA 1I1DA 1W7WA 4DX5A 5HLFB 2XMMA 1N0UA 2XLJA 1S99A 2W9CB 4NXNF 4U7UD 2K7JA 3MWBA 2V9WA 2HHXA 4ENOA 2VZYA 5GMKa 5ITHA 2W01A 3R27A 2UXDF 3QZ7A 2CNNB 3NGUA 1KS2A 2ZELA 1TL7B 4JV5J 1LAMA 1N8RT 3ZZYA 3ILIA 3B82A 2NYQA 4I7FA 3TOQA 4JI8J 4CM0A 2D3UA 4QWCA 5LMNJ 1ZM3A 3P49B 4JYAJ 3KKFA 4W90B 4UEEA 4RN7A 2YPZA 4YB5A 1Z8LA 3DMJB 1QVFR 4WXWA 3WABA 5LOQA 1K1QA 4ECUA 1VDHA 2FHJA 2MKCA 3MCMA 4KOWA 2VJUA 2VIHA 3PW7A 4NGQA 2FIAA 1HA1A 3BSAA 3ET6B 4RW7B 2EFVA 2Z2YB 2LMIA 1N0VC 4KY3A 4QR1A 4AUKA 2VC1A 4DQQA 3NCPA 4P4DA 2VC0A 2YXLA 1UZDA 2I6WA 1ULRA 1N5SA 2YNDA 2Z2ZA 1K44A 4NX9A 2DGUA 1J5OB 2VU5A 1NDCA 1HKAA 2YQ3A 4CNZA 3MUVP 5K5MA 2AFZA 1BY9A 5C42A 4XTTA 2L48A 3JYTB 4DSLA 3IWNC 3MR2A 2LU2A 2GHVC 1JLBB 3TJ9A 2C6GA 5J1EA 2MQPA 2GMHA 3CWJA 1YZ6A 3DGPB 4TQRA 3J81j 5DG7A 1FD8A 1RUSA 2R3VA 3TA2A 4WTOB 2GV1A 4JUZA 3ULHA 4DBQA 4M94A 1F60B 1U45A 2D9PA 4I0WA 4WF9Q 3VARA 3JAMU 2AEFA 3T1HJ 4X4NA 1SKUB 3H20A 1U6BA 3FB3A 3AD8C 4X4TA 1S7KA 3IM8A 3ZTOA 4RO0A 1H72C 1FERA 2MY7A 2DT9A 2HQFA 4P45A 3CO9A 4HKQA 1HQEB 2Z0ZA 4J9NA 4XDDA 4DUZF 2HS4A 5F8MA 5KT6A 2AV5A 4KR0B 1PKUA 2EWHA 3QIPB 2ATRA 1W25A 4Q36A 5LRJA 2WRMA 2OZHA 1VK3A 4E0DA 2QLBB 5G21A 2YTCA 1YQEA 1CJWA 2C2NA 4WFZA 1KQFB 2QL7B 2J7WA 2YH0A 3MRUA 2X51A 1V9OA 4R8UA 3G8QA 1HW9A 5A0YB 4U96A 1Q8IA 2YGWA 4ANEA 2DGTA 5JPHA 4CO4A 3R1HA 5A28A 2ZW6A 2PE8A 1RWKB 5KT4A 2C6CA 4UOFA 4L72B 3G8WA 4MKVA 4EBCA 1NKBA 1DTTA 1U2RA 2WVCA 4RJVA 2GFQA 4K4YA 1JNZB 1YKWA 2QMXA 4WWSA 1LWEB 1R0AA 3P45B 3A1YG 1YLOA 1LK5A 2MGZA 1FO1A 1FWPA 4OQJA 1NK7A 2MB0B 4OC0A 4WFBQ 1S6UA 4ZVPB 2ZPAA 5LRKA 2DIUA 1U6ZA 3LACA 4E2FB 3JRUA 2Q7BA 3GPAA 2NXNA 2I3CA 2UUAF 3CJKA 1S6QB 2E5GA 2AX1A 4JLYA 1HYSA 4ZX8A 1UEVA 4LQ3A 2HMIA 2DHXA 3IR7B 4DV5F 2FJBB 2IFXA 1T11A 2DXQA 3OV7A 3P3DA 5LM7E 3NA6A 2H9ZA 2UUTA 1HBOB 2CRLA 1VIOA 2D7SA 2UVVA 3SBMA 1KWMA 2ZXVA 1IKYB 4CZCA 2IVYA 3DLEA 4B6ZA 1ZYQA 3Q8VA 4ZVRB 5H9FJ 2DKOB 2VG5B 3KUEA 4IF5A 5C82A 2YWEA 1URRA 1T9WA 1WI6A 2GJFA 2H5IB 1RT3B 4YHHJ 2ZC4A 1S76D 3I0SA 5HAOA 4DV6F 3GR1A 5ADZA 2AX0A 4RU9A 1S7IA 2GMLA 5H84A 1HNWF 4LR8A 3HJFA 1IN0A 3UVJA 5KFAA 1F2OA 3PRVA 1WG5A 5G22A 1BGXT 3KR4A 2R98A 4BMHA 1XR7A 5ETNA 3QGHA 4NLPA 3PYGA 1V3SA 1IM4A 3LPYA 2KRRA 4CH1A 2I0XA 3TOBA 3MUMP 1X4GA 4OADA 3T3FA 4ECYA 4HKFA 2DF5A 5HI7A 4XAKA 2F4VJ 4LF9J 1VQKS 4Z7YA 2Y1IA 5KFGA 1FJGJ 1VJQA 4C8YA 2C2KB 3RBDA 4DS4A 4ECTA 5JGFA 3BGLA 1TKTA 1JLAA 2FVCA 2ZOMA 2Q6CA 3JQMA 4Y2IA 1ZM4A 1TUWA 2HEKA 3C66A 2FT0A 3HT0A 3TO6A 4OV1A 3C46A 4TWEA 4IRDA 3HPOA 3C3LA 3OQ2A 2JDCA 1H2VZ 1AFIA 2NZCA 2B4BA 1N6QB 4NMXA 4Q44A 2RD5C 3I5AA 1Q86T 5H9FK 1BHNA 3M8PB 1NLKL 1ZPWX 1H0HB 1S1WA 1X4DA 4AD6A 4CT9A 7FDRA 3KZWA 2DRDA 3HLPA 2B5JA 5GAEU 4LF2A 4GO7X 3MMCB 2GLFA 1CJTB 2J0SD 3CCWA 3G82B 1QD1A 4NEYA 5KFTA 2IJFA 4R25A 4DQSA 2YWWA 3MM5B 2I00A 1WHVA 1HMVA 1S6PB 4MY0A 4IUSA 3B78A 3PACA 5E7OB 4EYIB 4C7QA 4DZDA 1RLDA 2VPZB 3AQPA 4PWUA 1PO6A 4C6AA 4LRBA 4FNIA 3MEEA 1QSYA 3U1NA 3HK2A 5SUHA 3KWMA 4Q5VA 2J8AA 5I42A 3IAM9 3NOGA 1DAXA 1NB2A 2V5HG 2NZ4A 4I2PA 1IBKF 1F6TA 2Z2MA 4L73A 3K59A 3G71S 3CTRA 2RILA 2NMTA 1NSAA 4CO0A 2Z3OA 2RF2A 1D9FA 2HFOA 4FYVB 1LEOA 3IEHA 1KFDA 1HPZA 1S4EA 3R6LB 3UDLA 4C8MA 2F8HA 2B9WA 3E01A 1IU8A 4RNMA 2CQBA 4P4BA 4NI2A 3BEGB 3CNQP 1RT4B 3NKYA 2JC1A 1VBYA 1EE3P 2R8GA 5JVGQ 2AJQA 3I6PA 2LDIA 5A2QU 1SIZA 4CWBA 3MEDA 3NWRA 2CJXB 1CULB 3W6SA 4ZIWA 2GGPA 3DM2A 5EWGA 2CNLB 2YNCC 4EWTA 3CCMS 4NCZA 1ZAWA 4B9LA 2YVSA 5DRKA 4KVOE 2W2QP 5HBMA 5D15A 4B3RJ 2REEA 3CMES 4LBIA 4DV0J 4L3KA 2ZKUA 1Y0RA 4QVTA 1HD0A 1IOFA 2AKWB 4F8ZA 4A8OA 1PSDA 2CJYB 1ROFA 3MM8B 5KFSA 2ZVSA 4H4KA 3MOJB 1RYRA 2MHEA 2E1MC 2NXCA 2Z3LA 2XZTB 2LDYA 4URSA 1E6VA 1RHKB 4D3GA 1CM0A 1RWNB 3PP9A 3H8YA 5IM0A 3AXKA 2D3ZA 1JJ2R 2NSMA 2G13A 2HURA 3QAUA 1K9MT 1BWVA 2W2OP 2FVQA 2P9GA 3V6HA 4YB6A 3JYTA 2KFZA 2HWHA 1Z9UA 4OHZA 4X4PA 1J4JA 3TAMA 2FTRA 2DNZA 1IVZA 4RI1A 3RAMA 1F9FA 5A6WA 2DEIA 3NH4A 2PSZA 4ZMMA 2AJ6A 4DV3J 5HO4A 5CYMB 3TUJC 2A2DA 3PEIA 5HATA 3MXHP 3KDOA 2KHDA 5B08A 5BWAB 2V34A 4MCSA 3FXTA 2XMKA 2ZJRQ 3KJQB 1EB0A 1ZLHA 4IG3B 3T90A 4J9MA 1RBLA 2ZD1A 1I51B 1HDQA 2QGFB 1N5TA 1HQEA 2HWTA 3HKZD 4YY3F 2VJVA 3EPIA 5DWNA 3GR0A 1YBTA 4G1IA 1P6TA 1U1KA 4P4FA 2V0NA 3MDFA 4MCQA 6FD1A 5DO2A 3C8YA 5KFXA 3FJUA 4OX9F 2W2MP 2KM8C 2VQFF 2POKA 1KRPA 1KFSA 3OTEA 4CO1A 2MSTA 1AZSB 3CCLS 3MCSA 7FD1A 2UVRA 2PR1A 3SI0A 4EGLA 1VLYA 3JTPA 1SC4B 1TKFA 2A6OA 1REVA 1KHWA 2VA3A 2HHVA 2I9SA 4IDKB 5LYDA 1U09A 3S01A 3MAHA 2XSJA 1N36J 2CJKA 2OP5A 1CPSA 2XY5A 2PJ1A 4FUUA 2EFQA 5D4OA 1HR0F 4YN3B 3HX9A 2VL1A 3K5MA 3CIZA 1KN6A 4KFBA 1N32F 2QYGA 2DPSA 1R57A 3P6YC 3QBCA 2ASYA 4F0XA 1D1UA 4P6YA 3K2YA 1HNXF 4B5PB 5B0DA 2XTJP 4KT0C 2IDEA 4K3NA 1Z5RA 1BC6A 4IAVA 4DUYJ 4ZY2A 3PB8X 1KOOA 2BE2B 1L3VA 3A9LA 1OYEA 4P75A 3M9NB 3NL0A 1H3DA 3PIOQ 2CDQA 1P9YA 2XULA 4ZP7A 1FE0A 4KSEB 5D77A 1UFKA 5J2PA 4LVOP 4J9VA 2MZ1A 4JI7J 4ETZA 3V6DA 1UPMB 4P2XA 2HNDB 1WEZA 2R7XA 4EK2A 3FRZA 3RGIA 3QGPA 1YK3A 2ZEHA 5HMYA 4URQU 1T9YA 1TVRA 1JB0C 1RTDA 4OL8A 4OJ1A 1RT3A 4FXVA 3M2RA 1M5KC 4R5PA 5J2NB 2R42A 3J81Y 4YGOA 4QYZK 1VC5A 3KMQA 3C16A 4WFYA 3V2UC 3IBCB 2QMWA 4KLWA 2K06A 1VHOA 3T5JA 5FDLA 1RISA 3Q8YA 4PABA 2MLXA 3DLKA 3UD5A 1FFSB 2O67A 2DHHA 3FGVA 2PD1A 3OTCA 2AT1B 1MJBA 2OFHX 5MLCV 3KJVB 4MMOA 1A9NB 1UWBB 3NXZA 5DS7A 2B9XA 2DH8A 2CQ2A 1CP6A 2R7TA 1U47A 4DOZA 3B35A 5J2MB 3EXYA 3KL9A 3CJQA 4R3KA 1ZG9A 3KQXA 3AOBA 3SI2A 2NUUG 3GMGA 3EXCX 2CNTA 4EEYA 1I1GA 4RBTA 1S1UA 2C22A 3R1KA 2ZJPQ 2BA9A 4B10A 5GMEA 2XYHB 3NCQA 4DSKA 2DNKA 1TL1A 4LF8F 4TY9A 5KG2A 5ETOA 4U5YA 2OZGA 4UF4A 1DQ9A 5H9EK 3D2PA 1FX2A 3ENAA 3VR1A 2OB0A 4NLGA 2GO9A 2MTLA 3PTWA 2MKIA 4TQSA 3PEHA 2Z11A 2W9AA 2J0XA 4HTJA 4USWA 2ASJA 5SZTA 4K4SA 2EFOA 3KMSA 4MFLA 4C68A 4MIAA 3ZJ0A 1RT1B 4NL5A 4ZCMA 4DX8H 3M8ZA 2X3GA 1WKJA 2ACMA 4JV0A 1VRUA 2A1BA 4HTIA 2CYYA 2CFXA 1AB8A 4JJXA 4ANDA 2IRYA 2VKRA 4FD4A 1FRKA 1UJ6A 2PJAA 1SH3A 3EM1A 5KFJA 2I2YA 4EFAC 3F5BA 2EG2A 2WSAA 3MN8A 1YHQS 4LSNB 4C2XA 4A47A 4NZ7A 2JH3A 3O6QA 1TU0B 2VASA 2NUHA 1D0EA 3VGUA 3LTOA 4NLWA 4EMEA 1WF0A 3Q8RB 1VQ6S 2HHQA 5L38A 2WB4A 2VOOA 1DFDA 1X4EA 5B09A 4EVYA 2GCFA 4BC9A 4DG1A 4GO5X 4GM5A 4XPDB 1T8EA 2PFFB 4KIAA 3TE4A 4BWJA 2F4FA 2PMWA 3BH6B 3EZUA 5CBMA 1U1OA 2XCPA 4JI0F 2F8MA 4DSFA 4CDIA 4LQ9A 4CYOA 4RUHA 4C0HA 4U8VA 2ZKTA 2P8IA 4M3SA 4F36A 3RYLA 1N52B 4NLUA 4HEA9 3ILOA 4PYAA 2PC6A 3W5XA 3LH2S 3G4SS 1U4BA 4RBVA 4C4WA 1TKZB 4UT4A 2RKIB 2VBWA 3HP6A 4P4JA 2LA6A 5IC6B 3ITHB 3OUYB 3K9TA 2GJIA 1WDDA 3F0AA 1FESA 1VRQC 3CJ2A 3GILA 2EI5A 1FEEA 4M5JA 5D0RA 2AHOB 3QGIA 1CULA 4IH5A 1YWXA 1LW2A 3FUYA 4USTA 2B51A 2HS0A 4DEZA 1WWHA 1DTQB 1D09B 5GAHI 1GMWD 3KK1B 3QSIA 2M88A 4FBEA 1RHMB 2FY8A 3ILJA 3EFAA 4F0MA 2AE6A 3TR5A 2O3DA 3ADAC 2GNKA 3Q23A 1F57A 2PJ0A 3R5CA 4B3SF 4IRKA 3H5YA 1MN9A 4UY8T 5H1SV 4A39A 1S1VA 1IICA 2J7KA 3GP9A 4Q43A 1QTMA 3LGMA 1XMQJ 1B3TA 2JEWA 1ZTWA 3TAQA 3FKBA 2XS2A 4G1QB 4USMA 4DDFA 3D2MA 1ZPVA 1U1LA 2ZZTA 1RT7A 4K2XA 5KT7A 3P5TL 3IJ3A 1KUYA 1M5OC 2UU9F 4WZQA 4KO0B 1DQ8A 1RCOB 2HWIA 4CRJA 1FA0A 2XEIA 3OR2A 5KG6A 2ABZA 4J5OA 4F4ZA 2GS8A 2CPZA 1Q4RA 1X5OA 4O0IA 4ONWA 2AFXA 1WF2A 1FRHA 1OBRA 3EVMA 4OYMA 4EMDA 1N33F 2DHSA 4RNOA 3CW2C 2GLJA 1RWXB 2VH7A 4DR3J 3KNAA 4X4UA 1RTJB 1YI2S 3CPAA 2EK1A 4PEOA 4XIUA 2DVIA 4ZVHA 4B9VA 2YNHA 1N5QA 3DNCA 1WC0A 4ALZA 3AB2B 1FE4A 2FZGB 3H8EA 2XWXA 3LO3A 2OH2A 1S1XB 2ABYA 3ZFVA 3IWWA 2VFUA 2LQ9A 3PKMA 4IK2A 3OVAA 2PJ5A 3MPWA 1BQMB 5HANA 1TFYA 1AZSA 1QSTA 1SC6A 1OYDA 4UOCA 3H25A 3B2YA 4L6V3 2W8LA 1JIHA 4BS2A 1MMNA 4K4ZA 2G1HA 4QIVA 2FQQB 2I5JB 2BJEA 4J37A 4IDKA 1QY7A 2CQIA 1LQ9A 2G1DA 2FHKA 2OAUA 4KC5A 5F8LA 3KK2B 2Z2LA 2XMVA 5ETRA 2M4MA 2EBGA 3OSPA 2W9BB 2V2QA 4HH1A 1XRYA 2HW3A 1Z2ZA 2DPJA 4UEZA 1S49A 1FTCA 4YUDA 4HI1A 3DRRA 5E96A 3IRXA 4UQTA 4DWIA 3VAFA 2HB6A 5F41A 2AYMA 2RS2A 5D3GB 1XERA 4ZVQB 2GMJA 4PSXA 1RGVA 3PFEA 1NSLA 4DV1F 3R2DJ 4MJ8A 2RHQB 3CZXA 4M6GA 5KG0A 3C15A 2SXLA 2G9OA 3CCQS 4GC7A 2XLIA 3BQ1A 2QLJB 2GIRA 3J7AN 5KTDA 2BE9B 3CCJS 4DV4F 1RT2B 2JC0A 2ZITA 2ZH4A 5E0OA 3PX0A 5L46A 2OHDA 3ISNC 3R95A 1L3UA 4YFUA 2HNDA 2AU0A 4CYPA 5KFDA 3KLFA 4XPKA 4C7HA 3AOAA 4NXNJ 4M85A 3BZQA 2BM0A 2FJEB 2CQPA 1X0FA 1MK4A 4UQGA 4ZLJA 4K0KF 4K7QA 3H4DA 2K5TA 4N47A 2HLTA 3IWLA 3OXLA 1NKEA 1BAVA 3G86A 1IQTA 3UCUP 4A8QA 3TVKA 2B3TB 5FIIA 1B0VA 3JSRA 3OLBA 2C1EB 3A3OB 4JI4F 2MDAA 1HI8A 1KLMB 2UZAA 2P6GA 2WPWA 3UO0A 5I3QA 2J9AA 1VBZA 1JLFB 3BN4A 4RWXA 2D41A 1FT7A 2KT3A 1U8SA 1UWBA 3I1UA 2OSQA 2BX6A 1ARMA 3P2FA 3LF0A 4MHZA 4LREA 3CT9A 3JSYA 4DFPA 1NU4A 1XIQA 5DETA 5K8NA 3H4BA 3FVLA 1FF2A 4A31A 3I4HX 1WC1A 2MJUA 1VRTB 4KPCA 2VFSA 2ZM6F 3GYXB 4CGLA 4DLEA 2AFSA 2X1BA 1IBLF 5GAEI 3US5A 5J2QB 3GB0A 1BPNA 2YQ1A 3IIBA 4W9YA 3TZYA 2HIQA 3CDWA 1U1PA 3N5BA 3J7A1 5ETLA 2E44A 3FSXA 1FDDA 2PGCA 5CD4H 4CYUB 1CJVA 1QE1B 1H7WA 4QU7A 4QU6A 4ZITA 4MHYA 3H2UB 4X62J 4CGPA 5IB0A 4PXCA 3EDQB 4X66J 1E6YB 1WNEA 4NXMF 1AMPA 3BI0A 1CQMA 1EKSA 3JTKA 1S9GB 2H5JB 2OELA 1QSLA 4DR1J 4DNCA 1Z8TA 3SDEB 1MWYA 2IIHA 4X2TA 4PXBA 5D4NA 1HNVB 5CZXA 2RS8A 3M2UB 4DV2F 2YX1A 4TYAA 3C6TB 2JLFA 1IBMF 4KQZA 1I94F 3IWGA 2MZRA 2HGMA 3FEZA 3G6YA 4M5NA 4ERDA 3IBWA 3QT6A 2WCXA 5E5NA 2KO1A 4Y28C 1BQNA 3H98A 5HXDA 2WVEA 4L75A 5JM6A 5LJ5Y 3BR9A 5M2RA 3BDPA 2E5IA 2Z10A 1R6YA 4X4VA 3B8HA 3SQOP 3QIDA 4FYWB 1KTQA 2IY5B 1NJWA 2YNEA 3D9BA 3NY0A 4L76A 5JVHQ 2CQ4A 2YKNB 3C14A 2MQQA 3BO4A 2VONA 1VFJA 4OYIA 3WDOA 2ZJQQ 5IV0A 2FPHX 1V0CA 1NK0A 1P1TA 4ZHRB 4DL2A 4Y0FA 4KV8B 3QQCD 5KG3A 1IKXB 2WB1D 4WK1A 3T19A 1FD2A 1U7LA 5H86A 3BJ8A 4OP4A 4LFAJ 1AA1B 2J76E 1YK9A 3R7NB 3DOKB 1FHTA 1BO4A 4GVLA 2P0WA 3Q86A 2XQCA 4DQPA 4DX6A 1SL0A 4DYOA 4J9UE 1HW8A 3AA9A 3D6HB 1KOHA 3VGVA 2D69A 4RBUA 1JLCB 3NGKA 5BYQA 1S0MA 2DNRA 2RKIA 4W98A 2YWKA 3SI1A 2MQOA 3BYRA 3D67A 5IWAF 3QO9A 2R7OA 3CMAS 1MMLA 4IUFA 3LUYA 1DLOA 3G8SA 2R7WA 1JKHA 2DNLA 1FNOA 3KG0A 3ZTPA 1Q8BA 4DR5J 2KXFA 3WBZA 3DDKA 5KFNA 2A18A 1QTNB 2OPQA 4LF7J 1UA0A 1K0VA 4QOTA 2HUZA 5D0HA 3I9SA 1L3KA 2FHMA 2HAIA 4UBRA 3CJTA 2PVWA 4C3LA 2J6SA 4CPAA 4ZYQA 2AFOA 1Z8XA 3GFXA 1LNQA 4XNHB 1RT5A 1J27A 4ZKAA 1VQPS 2DYAA 2HQCA 3CDBA 4C11A 2DK2A 2PE3A 4QR2A 4YU9A 4I2QB 4AFFA 2B7CB 4DL4A 1UVIA 2CPJA 1U2FA 4KHRA 3HT3A 4G1QA 1Q78A 1KVIA 1G6BA 4KVXA 3VAIA 4P74A 1Z4UA 4P7TA 4NA3A 2CNSA 4TU9A 4TKTA 1BE4A 1JJCB 3NFZA 3NMRA 1SV5B 1SJFA 4WTYA 2O5DA 2W24A 5CYJA 3I9ZA 3CCZA 4HNYB 3W60A 1BPMA 3HHNB 3CC7S 4DU7A 2EWBA 4WK3A 5K8MA 2QSWA 5IT9U 3NGSA 3WZ0A 3CD0A 4JD6A 5DM6Q 2EKYA 2AGPA 3QRQA 3PNIA 2PRQA 4DPYA 4CAFA 2GVZA 3T8WA 4B5OA 4KE5A 1RTJA 4P44A 3VAMA 4PG8A 3ELHA 4LBPA 1FJ7A 4TU8A 4NLSA 4A30A 2VUGA 1NRKA 4KOUA 5CYQA 4DL5A 2HHTA 2JX2A 1VOMA 1JLQB 1TL3B 9ATCB 2DD8S 2ZH3A 5T41A 2BE7D 1LANA 2DR7A 3TA1A 1JLEA 3VAJA 1HIYA 2DISA 3G9CA 2VD3A 3BPSP 4CT8A 4W92B 2GJ2A 3UDCA 1H8LA 5HH1A 1X0PA 1XN9A 1S1TB 1LFPA 1UKUA 2KHCA 4KRWA 1FKAF 2YX7A 4OC4A 2I5JA 4NLOA 3GV8B 4N5SA 2M52A 4ZVOB 2D4OA 1P4NA 1D9AA 2BL1A 3CPWR 2XEFA 4ZIVA 4U9ZA 1FKOB 2DXEA 4LJMA 4B02A 4IOCQ 2DH7A 3I87A 4WKYA 3IRWP 2HHSA 3O1LA 3MPVA 3UCZP 1RAGB 1MMDA 4R7MA 4Y49C 1NH7A 1VMBA 4X64F 1C1BB 2U2FA 1KDNA 2EC2A 3OVSA 3MTJA 4R9MA 2G3TA 5M2PA 3DLHA 2RU3A 3MCOA 2UP1A 4H4OB 1YJRA 4QZVB 3IR5B 5KFKA 3RB6A 2Q4YA 2QL9B 2LQ8A 1P0HA 3IG1B 3QT5A 3GWCA 3IO1A 1HWUA 4OC5A 3W7BA 2V50A 4OYXA 4JI5F 1BLUA 3FECA 3PYDA 4KUBA 3OL9A 1U48A 3D7HA 3NAHA 1UWYA 4LRCA 1S12A 2ZUGA 2G0IA 3RTVA 1Y4ZB 2C3PA 1T9TA 3DLBA 5KFFA 3P4UB 1WC5A 3K2KA 2UXCJ 5F47A 2KB2A 4DPUA 3RB4A 3T9YA 5A8WA 1T95A 2ZE2B 1O5JA 2QJ8A 1LWFB 1QAXA 2XNQA 2PJ6A 5IB9A 1BQXA 2EO8A 3SV3A 5AXMA 3UPFA 4LSLA 4DHVA 3S6HA 3ETMA 1HQ2A 3OR1A 5A8RA 2FIWA 2WAQD 2Z4PA 4ECQA 1T0TV 1S10A 3QWUA 2RQ4A 3LWUA 3UR0A 1KLMA 3UDVA 3RAQA 2KVQE 1SL1A 2MKHA 1NM2A 3FX6A 2PJ9A 2HQIA 4USJC 4ANCA 4U7UK 3P2HA 5I4MA 2IJZA 3V81A 4CM2A 4OZ2A 3SJEA 4P10A 1HBUB 5HN0A 2IHR1 1M4DA 2WW8A 1FDNA 1Y3JA 4X8IA 3M8SA 4YFJA 1N5YB 1XR5A 4OI2A 2QECA 5J2QA 2RDDA 2IAJB 5CH7B 4JXQA 5KT2A 4B3MJ 4KSFA 5CABA 3GFZA 1M0SA 3MTKA 1RWMB 1QE1A 2G0CA 3F8KA 4H4KC 5F3TA 1XJOA 3HMJG 3P8BB 3UW1A 2YWHA 4H54A 2HC9A 4QW9A 2YWGA 3A8EA 3VAGA 3C19A 4NXYA 2DO0A 1G2EA 2VZZA 4MBUA 1V5VA 4PRFA 2HQ3A 1SB6A 3SDEA 1BMQB 3H90A 1HNVA 4RW6B 1TIQA 2RJZA 2Y0BB 4ZPDA 1DZ5A 2DNOA 4LF4J 5BR8J 1HHTP 2F65A 3PFOA 4CYQA 1ZA2B 2IVFB 1ZETA 3MECB 3POTB 4BHQA 2CZVC 4HI2A 1GFWB 5IS2A 3CXPA 1VYAA 1XF8A 1ZZFA 1EJ7L 2QYCA 1UFHA 4RNHA 2HGLA 1AUSL 2Y8WA 3DRPB 1I3OB 3C6UB 1Q95G 3JAMY 3HDSA 4BC7A 1DRZA 2H3EB 3FVYA 1R43A 2AMCB 1F2PA 2HK3A 2I8EA 4M5GA 4A46A 4K30A 2O66A 4YDXA 5AG4A 2HBZB 2XC9A 4C0OC 3FQLA 4ZS6A 3LP2B 2UXBJ 4ETXA 2GVDA 4TN2A 4J9OA 4KTQA 4ZHRA 1S0VA 4KV8A 2KKHA 1N56A 1UP1A 1Y3KA 1YDLA 5AG5A 3UY5A 5KFPA 2VQYA 2JEIA 4CLFA 3HZGA 5F0UA 3VAKA 4IKAA 3ZNUA 4O44B 1XNQJ 3EVWA 3MEKA 2ZBIA 2DRBA 3CEDA 3KHZA 1OMSA 1RCXB 1Y11A 3EVOA 4C8LA 4WE1B 4PG4A 3DRSB 1JLCA 3PO5A 3BGRB 4TNUA 4PYDA 3T6JA 4P7VA 4NCBA 1ZLIA 1J5EF 1OIAA 4ZCLA 3SMZA 3M8YA 1NZAA 2YNIB 4KGMA 1I21A 4ZLPA 4WP3A 3JTOA 1JWQA 3AH6A 5J1PA 1ITPA 3VH9A 5AE3A 1Z2LA 3GYAA 1FFGB 4KH0B 2VQEF 2Q7SA 2AYEA 4H2KA 4TVAB 4ZX9A 2NPFA 4WJBA 3LW5C 2ZBRA 4RNNA 1O51A 4HNXB 2H5EA 5U47A 3FBUA 2WHOA 3MMAB 4QIGA 3TUPA 5J8FA 2BRKA 4IFYA 1PBUA 1AXQA 4B9MA 3WC5A 1RT6B 3DGVA 5KOXA 1TFWA 1R0CB 3RBXA 3TAPA 3ZXWA 5C25B 4RWWA 2VFTA 3EWGA 4PCQA 1LOUA 2BABA 2B3VA 2JJ4D 3RBEA 3LP0B 4R76A 1CG2A 2DGSA 2BJ7A 1DE4C 4B3TF 2Q0YA 3HVTA 2IC3B 1S7HA 3D68A 1GT8A 1ZOTA 1H2TZ 4DSEA 1HLWA 4GKJJ 5HJYA 2A10A 1XC9A 4MT1A 2PJBA 1GHEA 2EBJA 1VS3A 4IH6A 2LLZA 3JS9A 4TY8A 3CD7A 3S9MA 3GU0A 2KJVA 1YJVA 2BRLA 3KFWX 2KJWA 3RJMB 3LAMA 4JI8F 2W2PP 5KFCA 5LMNF 4JYAF 2R4FA 1X4AA 3W2WB 1F5AA 3KLHB 4Z37A 3NS7B 2G9DA 1TV6B 3Q8SB 4ZK7M 2Y9HA 2XI2A 3AODA 4KHPJ 2GW8A 1TR0A 2ATLA 2OR4A 3OJSA 2QG9B 3H4QA 2QYVA 3GG0A 4WPAA 1HNZF 3JQKA 4JB8B 3RUBL 3BM7A 5M2UA 2D3O1 1Q81T 3M1VB 2WSCC 1RAFB 2OEJA 4OIXA 3W8PA 6FDRA 2FC9A 2VG7A 3L95X 1HBMB 4AQYJ 2ZH1A 2DIVA 2O1PA 2HK2A 3WC0A 4HACA 2P5VA 1SBRA 2ASLA 2DO4A 4DCOB 1OS5A 1YJTA 4PQAA 3EC4A 2WZNA 4NE9C 1RWPB 1R27B 4NLTA 3M8RA 3RB3A 4ECRA 4LSZB 2AQ4A 2CPHA 2OTLS 5B7WA 2PIYA 4F0KA 4RW4A 5J1QA 4KORA 1RWVB 5EX0A 3T1HF 2HVIA 2PMZD 2DB1A 3R2CJ 2RC4A 2KM8B 2MZJA 3PIPQ 2Y1JA 4H4OA 1DHMA 3PXGa 5JXSA 3UE2A 2VFVA 3QNVA 2RQCA 1MROA 1YVFA 4NA1A 5DQGA 5K14B 3EICA 4Q0BA 5EMIA 1GX5A 3HFZB 1YJ9S 1JXVA 1JX4A 4CGOA 1OJ4A 3OHBA 5DQIA 3FSIA 2W8KA 4CO3A 3D7FA 4CO5A 3KLEA 3HHLA 3AJDA 1DBDA 1W2IA 3OL7A 3BGFA 4ECZA 5GAGI 1OPIA 3TVYA 4YWYA 2BUEA 4G1PA 2UUCJ 4CO2A 2N7CA 2CQ3A 3B3WA 2XGQA 3BREA 3I32A 3UNGC 1KSPA 1FRLA 1IKVB 4LF1A 3OFGA 1F0XA 3UDEA 2QJ3A 3WX4A 4ICLB 3BKFA 5JJBA 1M1DA 5B0CA 1M5VC 2BJ3A 4EYHB 4B14A 3PV8A 1VC6A 4HPSA 2IYGA 4LVNP 5KFBA 2P9CA 1T05B 3OT9A 2C2DA 3T5LA 3QGGA 2V63A 5C24B 1QSOA 5IQQA 3D0IE 1QUVA 5DJBA 2ZW7A 5D8NA 3FEYB 3DDDA 4A8XA 5C2GA 3QPIA 4U95A 4FBUA 4ES2A 1RA7A 4B3SJ 2ATCB 2KG0A 2PC1A 2VEZA 4KOSA 2B7BB 4DFMA 3D54A 4G6VB 1GAOA 2M8DB 2B4UA 3NG8A 1X5TA 1HWLA 1XMTA 2ZVIA 4JI2J 1RTQA 3VTIA 4DN0A 1EETA 3RBZA 5I3UA 4OIWA 3PVXA 4M5DB 3KK3A 3M6WA 2JOQA 1XTZA 3OTDA 5CHCB 4NLXA 2H5MA 4J9RA 5KFWA 2JVOA 2WONB 5KG4A 4YHHF 5LMUJ 2DNMA 4EZ6A 3PRBA 4LX9A 4YP3A 2VF3A 3QAHA 1YZ7A 1V3ZA 4F04B 1X31C 2HHHF 1LXJA 2L3MA 2B4DA 2F1FA 2DNYA 2FVGA 3A12A 2V4RA 3KHLA 5HJXA 3PJXA 4NSQA 5GADI 2HYIB 3J7Z5 1C0UA 2LXIA 2U1AA 3POTA 2E5JA 1S59A 4A8SA 2HFVA 5KFOA 2BEIA 3S9LA 3KTQA 3TO8A 3G6XA 4LF6J 2QEXS 3J80U 3TX0A 5AG7A 5IT4A 4O3SA 3QJPA 2KG1A 3ZNJ1 2EUIA 1S9EA 4FF4A 3NMAA 3DRPA 2F4VF 1L3TA 5KFEA 4LFBJ 3BKUA 1RTIA 1FJGF 2B8QA 2CQDA 1IJEB 4Q2LA 4F25A 1LWXA 3I0RB 1LW0A 2HV2A 3VVUA 1IKWB 2ACYA 5L1IA 3OFFA 2BANA 2PEBA 2KDOA 4OC1A 1TK8A 2OZUA 4ZPBA 3MEGB 5F8GA 1N48A 3DYAB 4LF5J 2BKPA 5CA5A 4IG0B 2V6AA 3Q2TC 4I64A 4A95A 3R5DA 1U0SA 5L1LA 2ILYA 3F56A 2DPIA 1SL2A 1GMVA 2HIYA 4AB7A 3BSCA 2J8NA 2W4DA 3RYOA 2IPOB 3DN9A 5AGEA 3UNYA 1YLXA 4MIWA 1B7FA 2UV8A 1RBAA 1WKLA 1U0HA 4C8KA 2IA6A 4WE1A 2ZBCA 1XEBA 3K5NA 1C0TA 3FMBA 1H38A 2KI2A 1NPRA 2FLLA 5THWA 2KU7A 4BLGA 4H4MA 2OU2A 4R87A 1WD6A 2E7XA 4DR6J 4C2MA 1M1GA 2M3DA 2ZHOA 3MAQA 2EK9A 3O2IA 4ZJQA 5KFLA 1XMBA 3L09A 4JWPA 4GVBB 2OSRA 4NEXA 2QLWA 4K2JA 3PB9X 4UFVA 2N4CA 2CNOB 2E7VA 5AT1B 4DJLA 1SUQB 3H2VE 3OVBA 4C2ZA 4KUAA 2AGQA 2O4HA 3NOCA 3GSIA 4QIWD 3B8GA 3DHWC 4ED7A 2R8HA 3ZZTA 2AZ3A 3DFEA 1YJUA 4FBTA 3OTBA 1ZH5A 2MQNA 4PWDA 2XEXA 4Z2XA 4L89A 3W2VA 3M2VA 2M8HA 2L9DA 3T1YF 5IZHA 4HHHA 2UUWA 3W66A 2FVSA 2B9EA 3IGVA 2E5HA 1CJUB 1KLNA 4NLDA 1VQLS 1DURA 4IFVB 2C2EA 3LP0A 3VV2B 5GMDA 2MJNA 2E1RA 2VICA 4EO6A 3EYZA 1S7FA 3VF0B 1NMEB 2UUBJ 5ETKA 1IWGA 4MHDA 5KG5A 1GTHA 4QWBA 1NNDA 4K4TA 4P4EA 1WHWA 1JLGB 2YKMB 4W4MA 3AOCA 5T7LB 4O3RA 5F8NA 3W5ZA 4R3LA 2ZC3A 3DOLB 2PMHA 3LQVA 5F09A 1RTHB 1WSVA 4KJIA 2JDJA 1S97A 1IR2A 3DLLQ 4ORFA 4CGMA 5A8KA 3OHAA 3MPYA 3MMBA 3FSYA 4B3RF 4NJRA 4GXHA 4CQ1A 4F02A 4DV0F 3JVNA 3SQGA 4O3OA 3PX4A 3CDUA 2OIHA 2ZZNA 4A4JA 4TLRA 5EDWA 1IY7A 1RACB 4CRZB 1M1KT 4UCMA 2G2ZA 2E7WA 2JHEA 4KKOA 4X3RA 3TFYA 3WC6A 1HBMA 5AJ3J 2B5GA 4OHYA 1IB1E 2CQCA 1UZHA 2D3OR 2UV8G 3QATA 1OSDA 1HDUA 8RUCA 2E1AA 3DOMA 3CDXA 3JSMB 4I67A 3BBCA 1KKHA 3JB9k 3SFUA 5G0RB 2J0QD 2BEFA 4OX7A 2GIQA 1PYTA 1NBEB 3IXQA 1HNIA 5HK4A 4V1Ak 3KQZA 2WSEC 3GIJA 3OPKA 2V4JB 2E5LF 5D4LA 4CLLA 2QTWA 4DL3A 1UPPA 2HZCA 1KUXA 2FJXA 3PYFA 4C48A 3MM9A 4DJBA 2JBKA 3P5BP 4UIAA 4EBDA 1VQ7S 2R2UA 4DUKA 4FF3A 3KLIB 1CS4A 4PQUA 2XY7A 5FLXU 3MM7B 2ZH7A 2JEFA 5DWMA 3HULA 3UD4P 4X84A 2CIMA 2YX4A 5IV4A 1VQYA 4ZVGA 5K14A 3H5ZA 5HP1B 1R8HA 1YRXA 2VPYB 1XE4A 3V4IB 2C3YA 2WBMA 3F73A 2AW0A 1NK6A 4OLLA 3ZZIA 1B0PA 4XO0A 1RAAB 1X12A 2VA2A 5KFIA 2AEJA 1UETA 1XNRJ 2ZBPA 1YG0A 4BDPA 4MIBA 2OPPB 5EGYA 2K3IA 3THPA 1JNRB 3UQSA 3IC1A 3TTHA 2OPRB 3NS6A 3MM6B 2GZOA 4DV7F 4P71A 3QT7A 4JXRA 5LJ3Y 2KZMA 3SI8A 1KZFA 3K58A 4DSJA 1IKVA 4F50A 2IM1A 3EO4A 3CC4S 1GTEA 4GRSA 1N36F 1SXLA 2ZEGA 2BR0A 2VDIA 4QR0A 4FD5A 3LP1A 3CJRA 1HBNB 4A94A 3H5UA 2RQKA 3PRDA 2CJQA 4YRHA 2FDNA 2YKOA 1UMJA 3VZHA 2DXFA 1IR0A 3RRKA 3BI1A 2Q6BA 1J2VA 3A8JA 3ENWA 2XO6A 1XOVA 3HLUA 2J0WA 1B70B 1WOPA 4JI1J 4DUYF 4AYBD 3SSQA 4OKOA 4AVCA 1EAYC 1S60A 2ZH5A 2DR9A 2E1CA 3NE7A 4OJ3A 3FNNA 2DR6A 4FXDA 3S1TA 3DC2A 3EMTA 2YNGB 4MKBA 3R5AA 3CIMA 4LIRA 4BCAA 1MNEA 4NFRA 1RO5A 2OPSA 1Q7LB 4JI7F 4CAEA 5IXUA 4ES1A 2IMWP 4HVZA 4N41A 5HMZA 2CF4A 2V67A 1YLEA 1GXUA 7CPAA 3HO1A 3SV4A 3ZZZA 2QSFA 4KLVA 1WI8A 4FKXA 3V6JA 2Y0MA 2HGNA 3TJ8A 3VAHA 2PJ2A 3M32A 2BJ9A 4NCGA 4OZ3A 4RW9A 1TF9A 3JTNA 2VBQA 2QO3A 2ZNZA 4I7FB 2Q4VA 1YGYA 4CTAB 5F9LA 3GY9A 3SIPB 2BW2A 3KUGA 4ZVSB 1H73A 4FNHA 3SHPA 3RO0A 4OYPA 1U24A 4CLZA 3B3CA 2XLKA 3W9HA 4MHNA 4I6WA 3GKRA 3L7PA 2LECA 2V77A 4ZA1A 2ODFA 5HLFA 2DHGA 2W9CA 4A8MP 1YX0A 2V8HA 2MSSA 5MAOA 3BJYA 4FPIA 1X60A 4DN9A 3FCHA 4H89A 3TX8A 1TL7A 1FWKA 3K89A 5EHHA 5I0CA 1NXIA 3I0RA 4CLUA 2FS5A 1AW0A 1RQ0A 2ROPA 2HS3A 3GJSB 3CF5Q 1HFEL 2GIFA 2RUSA 2ZOFA 3H5SA 4ELUA 5C42B 1Y9OA 3DMJA 2FIUA 4DUTA 3OL8A 5KAKA 2EBEA 3UN3A 5ELYA 2Z3NA 3TWZA 1UL3A 4M1KA 2LQJA 3GJQB 5GVQA 3TQ1A 3ET6A 4RW7A 2MZTA 1F2GA 2YY3A 2DBBA 1HD1A 1TL5A 2AFMA 5KTQA 2IL4A 2GO8A 1CVJA 2FZCB 2R7SA 1U8WA 3UFCX 3QAEA 1VHEA 1K4JA 3GG1A 1PAUB 3BO3A 1J5OA 3T5HA 5BYRA 5CD4A 4K5RA 3Q8QB 1HL6A 3KASA 1FY7A 3WIVA 4J9LA 3SZ2A 2GFFA 2ZW5A 1JMTA 2GX8A 2BSWA 3W5YA 1JLBA 1HI0P 3PB4X 1UFWA 3DGPA 2Z8QA 2OO4A 3FNCA 1SH0A 1N71A 2ASDA 5E2QA 2O28A 4OFZA 3RB0A 1DTDA 4L8AA 4DR7J 1GEHA 1BLLE 1WC3A 3RRHA 2HRYA 1M4GA 4RS2A 3MD1A 4FKYA 2DGQA 4XK8C 2CNMA 4QW8A 3RBUA 4AXVA 3M4XA 5LYFA 4R8UB 3V7ZA 2M0GB 3KXDA 4CIOA 2XEGA 3NE8A 1Q5VA 3W65A 2FJDB 3N79A 1R31A 3HFKA 4F9VA 3CVKA 4A33A 2DGXA 1CJUA 1TKJA 5EN1A 1DTTB 3PR4A 3QIPA 3FC9A 4J90A 3KHGA 3CJSA 1S5KA 1R0AB 4QYZJ 2A0FB 1CPXA 2MGZB 3TANA 4DPXA 1NSKL 5JMNA 3FYNA 1YJ7A 2OD4A 2YWFA 1NPPA 4CLYA 2B3UA 1FDAA 4I49A 3QAYA 3D6TB 2J8MA 3MI7X 5A0YA 1EQMA 1M90T 3CJKB 4OMEA 1CBKA 2F5GA 4LUBA 3Q0AA 1HYSB 2OMOA 4FPRA 3TYTA 2YKQA 2QMLA 2HMIB 4YQWA 3DCAA 2YKMA 1G1XA 5KFQA 2CADA 4L3NA 2C28A 4F0HA 1UVMA 2C2OB 1Z8WA 2CXEA 4LRAA 3W62A 1ZG8A 1XMOJ 2IYIA 2HNYB 1RTHA 4CI0B 2LXFA 3DLEB 1LWEA 3NBPB 3NP5A 1SPBP 4QCLA 1AFJA 2QT7A 1ACMB 4OI0A 1TUVA 5C2CA 3W3SA 2QMUB 4ES3A 2ZEFA 2Y1LB 1WJ9A 2CTCA 4NA2A 3FCWA 4OAEA 2F40A 3BKTA 1U49A 3MFIA 1TZ0A 5H9EJ 2RQMA 3MHYA 1S6QA 3BN7A 3UN2A 3MGJA 5EX3A 1YRTA 5ETSA 2QVPA 2KFYA 3UVJB 1KUVA 1XMQF 3D7DA 4C8OA 4IO1A 1HBOA 1IQZA 2BV3A 4MYTA 1VHIA 2WVFA 3MPDA 1IKYA 2HLUA 4NRTA 4F4XA 4K4UA 2P9EA 1EZZB 2HKEA 1EP4B 2VG5A 1A0OB 4O3PA 1OY6A 2XM3A 1TKHA 1ZA1B 4KAIA 2X7BA 2V4JA 4ZCIA 4F4KA 2GREA 4KOVA 2EVNA 3ZZRA 3D2WA 2BQRA 5RUBA 2RU9A 2CZ4A 1RAIB 2HRTA 1VQ9S 2VPXB 1EIYB 5IOLA 4GKKF 3AJ1A 3LMSA 4NJQA 4DR3F