1R3NA

Crystal structure of beta-alanine synthase from saccharomyces kluyveri
Total Genus 151
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
151
sequence length
438
structure length
438
Chain Sequence
GTLNLPAAAPLSIASGRLNQTILETGSQFGGVARWGQESHEFGMRRLAGTALDGAMRDWFTNECESLGCKVKVDKIGNMFAVYPGKNGGKPTATGSHLDTQPEAGKYDGILGVLAGLEVLRTFKDNNYVPNYDVCVVVWFNEEGARFARSCTGSSVWSHDLSLEEAYGLMSVGEDKPESVYDSLKNIGYIGDTPASYKENEIDAHFELHIEQGPILEDENKAIGIVTGVQAYNWQKVTVHGVGAHAGTTPWRLRKDALLMSSKMIVAASEIAQRHNGLFTCGIIDAKPYSVNIIPGEVSFTLDFRHPSDDVLATMLKEAAAEFDRLIKINDGGALSYESETLQVSPAVNFHEVCIECVSRSAFAQFKKDQVRQIWSGAGHDSCQTAPHVPTSMIFIPSKDGLSHNYYEYSSPEEIENGFKVLLQAIINYDNYRVIRGH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Yeast beta-Alanine Synthase Shares a Structural Scaffold and Origin with Dizinc-dependent Exopeptidases
pubmed doi rcsb
source organism Lachancea kluyveri
molecule tags Hydrolase
molecule keywords beta-alanine synthase
total genus 151
structure length 438
sequence length 438
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 3.5.1.6: Beta-ureidopropionase.
pdb deposition date 2003-10-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01546 Peptidase_M20 Peptidase family M20/M25/M40
A PF07687 M20_dimer Peptidase dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.360 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1r3nA02
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 1r3nA01
1F2PA 4IHMA 2GU2A 3HLPA 2ZEHA 3FMCA 1CX8A 4R76A 1QMUA 3B7IA 3D7FA 3D68A 4X2TA 3NH4A 4MCQA 3B2YA 1IGBA 4MHPA 2F7VA 3FJUA 4OC3A 4BD9A 1RTQA 3CPXA 3WC5A 1R43A 3NA6A 1ARLA 1DTDA 3V7ZA 3BHXA 1Z8LA 2DEAA 3FX6A 3H8GA 2PVVA 2XEIA 3KQXA 1XRYA 1TKFA 4EWTA 5K8OA 1Y0RA 2AFOA 4UEEA 7CPAA 3PRTA 4F9UA 4P45A 5JH9A 1TF9A 2HB6A 2PJ8A 2WYRA 2BCOA 5CPAA 2PCUA 2JEWA 2POKA 2V77A 1Z2LA 1ZG8A 2EK8A 5LRKA 5THWA 1HDUA 4YU9A 3WT4A 5CBMA 4ZX9A 1ZG7A 3BXMA 4TNUA 1LCPA 1CBXA 1AMPA 2PJ5A 5K8MA 2PJ2A 3VARA 2QVPA 2BOAA 1CG2A 3N5FA 1YMEA 1FNOA 1YSJA 4A94A 4FUUA 4PPZA 1FT7A 4CPAA 4OC0A 2CF4A 2EK9A 4R6TA 4B6ZA 1OBRA 1HDQA 1JQGA 3GB0A 3IWWA 4ZYQA 4PXDA 5HVHA 3D7HA 4OC2A 2C1CA 4P4JA 5LRGA 3B3WA 2BO9A 4NGNA 2PJAA 1LAMA 2V8GA 3B3TA 3PB7X 2AFWA 4ZY2A 4OP4A 4W9YA 1Z5RA 3SI1A 1VGYA 3KASA 2ZEPA 2F8HA 4TWEA 3KL9A 1KWMA 3PB6X 4R8FA 4IK2A 5DS0A 3L2NA 2GREA 4X8IA 4NFRA 4LQGA 3S9NA 3D7DA 2JBKA 1DE4C 3S9LA 3IC1A 4NJQA 1LAPA 4OC1A 4PXCA 4DYOA 4MMOA 1CPSA 3FH4A 3ISXA 1Q7LA 1H8LA 3GUXA 4H2KA 3BI0A 3VH9A 2AFUA 1HEEA 2PJCA 4P4FA 4OC5A 5LRJA 3PB8X 4NGTA 4UEZA 4P44A 3D66A 1LOKA 2QJ8A 4JYWA 2FVGA 2G9DA 2XEFA 5D8NA 4NGSA 3GLJA 2ABZA 4PXBA 2RB7A 2O53A 4GM5A 3MRUA 4UEFA 2PJ6A 4A37A 2V8HA 1VIXA 4F9VA 4WWVA 4DJLA 1XJOA 2NYQA 5ELYA 3B3CA 3CDXA 3PB4X 3QNVA 1LANA 4A39A 2XEJA 4EMEA 1ZLIA 3PFEA 4UIAA 2ANPA 2CTCA 3H8EA 2WZNA 3KI9A 1ARMA 2O4HA 1ELLP 1XBUA 4A38A 3CPAA 4MHZA 4RUHA 4ZY1A 6CPAA 1Y0YA 2CIJA 4G1PA 2ZEOA 3PEIA 4O23A 1CP6A 2OR4A 3KHZA 5F09A 4NGRA 2ZEFA 3K2KA 4FAIA 2ZEEA 4P4IA 4MCSA 2VL1A 2C6CA 2IMOA 2GLJA 4MHNA 2PJBA 2ZEGA 3JRUA 2CTBA 3KR4A 2AFMA 2ZELA 3KZWA 4OIDA 3KHXA 2ZEDA 3IJ3A 1CPXA 3FECA 1NSAA 4ZI6A 5LYFA 2PIYA 4OMEA 5K8PA 3NH8A 3FVLA 2PJ9A 2JBJA 2XEGA 5LYLA 3FEEA 4YWYA 3FEDA 2ZENA 2RFHA 3HUVA 3D67A 2PE3A 4MXUA 3V38A 4NGQA 4DUKA 3PB9X 4ZX8A 4R7MA 3D7GA 4MHYA 3FF3A 4MRIA 1IY7A 1ELMP 4WJBA 5HVGA 2PVWA 3RAMA 2PJ1A 4PQAA 3KQZA 1VHOA 1QQ9A 5HVFA 3D4UA 3IFEA 1XFOA 4OKOA 1F57A 3SI2A 2QYVA 1AYEA 2Q51A 3WC6A 1M4LA 4IAVA 2HC9A 3SJEA 4NJRA 4F8ZA 1F2OA 4UIBA 5D29A 8CPAA 4KSIA 3ISZA 3TC8A 2ZEMA 4X3RA 3WC7A 2PJ3A 3RZAA 1YLOA 3PBEA 4AXVA 2OOTA 3RBUA 1PCAA 5I4MA 3DLJA 1BPMA 4Q7AA 3TX8A 3CT9A 4Z65A 1CP7A 3DGVA 4P4BA 1ZLHA 2PJ7A 3VATA 5LYIA 4FWUA 2Q4ZA 1TKJA 3MN8A 1GYTA 4MCRA 1BAVA 2C6PA 3NH5A 5JGFA 2V8VA 4P4EA 1TF8A 1YW4A 3BI1A 2NSMA 3NFZA 2IQ6A 1LFWA 2PJ4A 3S9MA 1R3NA 3KGQA 1BLLE 3KR5A 4K3NA 3PFOA 3IIBA 1YW6A 4UF4A 2Q43A 3B3VA 5JM6A 1EE3P 4ONWA 5HXDA 2GLFA 2AFXA 4NGPA 4P10A 2PIZA 2AFSA 1Y7EA 3SJGA 4OC4A 3SI0A 3WABA 2AFZA 2PRQA 3SJFA 4NGMA 5J1QA 4PXEA 4OIWA 3K9TA 3LMSA 3H8FA 1PYTB 3PBBA 2V8DA 3T8WA 4P6YA 1VHEA 3SJXA 2C6GA 3IO1A 2ZOGA 1ZG9A 3I1UA 4P4DA 4ZY0A 2IJZA 2J9AA 4FBEA 4JZ0A 1TKHA 2EWBA 1BPNA 1UWYA 3B3SA 4MCPA 3IEHA 5K8NA 3LWUA 1XMBA 3B35A 2I3CA 1TXRA 4EFDA 2PJ0A 5LYDA 5IB9A 2ZOFA
chains in the Genus database with same CATH superfamily
1ZAXA 4IHMA 1G3OA 3F41A 2UU9F 5DZ6A 1FVSA 4OFZA 3WC2A 3M8PA 5DDRC 4ZS6A 1IGBA 2D7SA 2W7OA 5L1IA 4CYUA 1XR7A 1GQEA 2GE3A 2DGVA 3IG1B 1UVIA 1R43A 3BHXA 1LK5A 1WHYA 2XEIA 1J27A 3QB8A 1KFDA 1VK3A 3KLGB 3JTNA 1KNZA 5K8OA 2CPEA 3PRTA 4F9UA 3ILIA 3E0KA 1AA1B 5KFGA 3NG8A 2HGLA 2JEWA 1WOSA 1PBUA 2HQ3A 4ED0A 1ZA1B 2QEXS 4KKOB 4DSIA 3C14B 4M5KA 4CLTA 3DDDA 3Q83A 1D0EA 4OMFG 3QWPA 1AMPA 3LF0A 3G8QA 4LSLB 2GNKA 3CMES 1YIJS 3I3GA 2R7RA 2KRBA 3QGPA 1FE4A 2KT2A 3HSZA 2CNTA 2FJVA 2KFYA 4CO2A 2VXKA 1Q82T 1HBNA 1VC6A 3VCDA 5KT7A 3C26A 1F2HA 3R96A 3TCVA 3T5LA 5DQGA 4AQYJ 3HHDA 1T9UA 1LW0B 3I6PA 4J5OA 2MB0B 3JSMA 2DXDA 2ZEPA 2J5AA 1RCOB 4OI6A 4ICLB 2XLKA 5ETKA 4DR4J 3J80U 3TJ8A 3WBZA 3M6XA 4NLWA 5E3RA 2HNZB 1YGYA 4R8UB 1BGXT 2JLFA 3IWXA 3NXZA 3WDOA 3IR7B 1FNXH 1DARA 3DRSB 3OSPA 2ZUAA 3OR1B 3OL7A 3R1KA 1FRMA 5IT9Y 3D54A 1IBLJ 1KUYA 3MM7A 4QC6A 3R5BA 1QAYA 1PBAA 4RKUC 4RW9B 1Y11A 2CXEA 2P9CA 1LOKA 3QLHA 3C66A 2GGPB 4CAFA 2N7YA 4G1QB 1QE1B 3KTQA 2VPYB 2DNRA 4YDDB 4ZLLA 1XN9A 5D8NA 1HQ2A 2HHHF 2QV6A 1VC0A 2GVZA 3V6HA 2AJ1A 2HFNA 2XNQA 1N32J 3M7VA 3HXMA 2ZH2A 2MSTA 5H9FJ 3L7PA 3A8JA 2CWXA 2CJBA 2W2PP 2QIFA 3I96A 3TTHA 2FLLA 3DLEB 3HVTB 3OBIA 4ZHRB 1MN9A 2IJNA 4CAEA 1NPPA 2FYXA 2RD5C 5GMKa 4OX6A 4PABA 1XEZA 5F46A 2DPJA 2JNJA 2ZEFA 4MI4A 2DXFA 4DR7F 4LSZB 1O51A 2W1BA 4DX8H 4MCSA 4R9MA 3VWDA 4A33A 2CTBA 2GC8A 3MEEA 4X66F 2NR0A 3AB4B 2YWFA 4OJHA 1NXIA 1CJUB 1TTHB 3VAIA 4DQPA 4O3PA 2OH1A 4QOTA 3I55S 4OL8A 4I6WA 3MDFA 1Q1KA 2X3DA 5LYFA 2CIMA 5K8PA 4MK7A 2ZH1A 2E1RA 1YK9A 3HFZB 3DRRA 4U7UD 1JJ2R 1C1BB 3ZZRA 4LQ3A 1RT6B 3ZZUA 2WOMB 1RQ0A 1SJQA 3CVKA 2I38A 2XCAA 2BV3A 2PVWA 2PJ1A 2BJEA 3IFEA 1OY9A 3L95X 4A8XA 4WZMA 3WC6A 1M4LA 4IAVA 3SJEA 3HLUA 4DCPB 1FF2A 2ILZA 4UIBA 3OTBA 5IV0A 2RT3A 2KVQE 3QRQA 2MZTA 4X3RA 3V2UC 3O3LA 1CQMA 2UXBF 4URGA 1X5OA 2WPXA 3N6MA 4BS2A 3CT9A 4HKFA 4Q2MA 3OLBA 5A8RB 1SC1B 1RKIA 2FJBB 5FDLA 1WNEA 2A6MA 4MCRA 1S6PB 3V81A 4CLLA 1TELA 2XTJP 1CS4B 3NCRA 3BH6B 2EKNA 1XOVA 4OHXA 4QCLA 1S9EA 4I0WA 5CZXA 2R8VA 1D3WA 4A8WA 1HBMB 3P45B 4IFYA 2VBWA 3IWEA 5CA5A 1O5JA 3KK1A 4MFKA 2FSRA 1UP1A 5E3PA 1X5PA 4M5NA 2MQNA 2JFDA 1RO5A 3CSKA 5IM0A 3H8FA 5IOLA 2W9BA 3K7RA 2XMKA 3IWLA 1SKSA 4FYWB 4DCJB 1ZG9A 3I1UA 3KDOA 2Z3KA 4ELTA 5D3GB 2DHGA 1QJHA 2XSFA 4Z7CA 4L8AA 4JJXA 4RI1A 4H6UA 2EC2A 3OJSA 1T9VA 4YRHA 5IB9A 1QLNA 1VKCA 3Q24A 2PQ8A 2APOA 1RTDA 3CDAA 2XEXA 3CC4S 4C7HA 1N0UA 4DFPA 1VQMS 3QZ7A 4EBEA 4F36A 4O44A 1VQ9S 2RU9A 3LUYA 1HWLA 2ZH6A 4FS2A 3TUPA 5KG2A 1JLQA 4N5SA 1IUJA 3QMQA 3K58A 2KXFA 3ILJA 5JH9A 2RUGA 2WSAA 4U6PA 3EXYA 3FNCA 1HNZF 1RT7A 1QTMA 4MKBA 4Y3CA 4RW6B 5DGBA 3GR0A 4IDKB 1NE9A 4MFZA 3WT4A 2XS5A 5CBMA 2DR7A 4X4TA 3EM1A 4TY8B 3RNZA 2DO4A 2KG1A 4E0AA 2KH9A 2ACMA 1U45A 3IU2A 1YITS 1PJ6A 5C42A 3P49B 1KD1T 3JUWA 1JWQA 3CD0A 4H4KC 2C3PA 1N5VA 1RT4B 3G87A 2YH1A 3KHLA 5KTQA 2JEFA 3UD4P 4ZPCA 1HYSA 3CCVS 4ERDA 1H73A 2Q4VA 4ITSA 4P4JA 4JI0F 1FT8A 3SDEA 3QNWB 3K89A 3PYDA 1RTHB 1MWZA 2PEHA 4JI4J 2V2ZA 2XS2A 2PFFB 2C2RA 4ANCA 3M4XA 1ZOTA 1A9NB 3R9LA 4M5GA 2JEGA 2UXCJ 1IR1A 2DGSA 3A8EA 3KUHA 1YVOA 1T11A 2D3O1 3W60A 3CIZA 1IXKA 1DE4C 1XNQJ 1SJRA 1S0MA 1P4NA 2VG5A 3D0HE 5I0CA 1S1TA 5DM7Q 2D3UA 1JX4A 5GAGI 1MMLA 3ISXA 4B3MJ 3CZXA 1QSMA 2HLUA 5KFZA 1HARA 3BI0A 3WHIA 4JI7F 3QAYA 4K5SA 2PC1A 1TL5A 4B3RF 3EJMA 5LRJA 4ELVA 4WP8A 3ZTQA 4NGTA 4RU2A 4YMEA 4P44A 4B3RJ 4BWJA 1RHMB 3NL0A 3D6TB 4UWJA 3IGNA 3A8IA 4JI2J 3MAAA 2G9DA 2Y1LB 3MPWA 1YK3A 5DS7A 4FKXA 4BLGA 4LVNP 2MGZB 3JQJA 1S1UA 2IRXA 4FD4A 2GVDB 3VR1A 4I69A 2PEBA 2BM0A 4PXBA 1NSKL 1RT2A 1U2RA 3PEJA 1HW9A 5KFDA 1NMTA 4GM5A 1YG0A 4NLVA 1R8CA 2NCKL 1RT3A 2Q44A 3BH7B 3KMQA 3MPYA 2FQQB 2W8LA 1B0TA 2ODFA 4MKVA 3Q8YA 1GK8A 4X62F 1F9EB 1XK8A 3MR3A 2CQBA 3MM9B 1S6QB 3FNNA 3C6UB 1FXDA 2VICA 5F09A 4NGRA 2CVEA 2R4FA 5F0UA 1S7LA 3MMBA 1FHTA 2HZVA 2XS7A 2R7OA 4I7FB 4OIDA 2B6AB 2KFZA 3MR5A 2ZKTA 2ZBQA 3ZXWA 3SXOA 3KJVA 1RAGB 4D3GA 2OPPB 1TQLA 4I64A 1S7HA 4UOFA 5DWMA 3B8HA 4F0YA 1ELOA 2PIIA 2DTJA 2ZW7A 1XNRJ 1UW9A 1U1OA 2MZRA 4F6AA 3G82B 5C42B 4MHYA 2RF2B 2HNYB 3GSDA 3BKTA 1PO6A 4J9RA 4C8ZA 2H5EA 2P6EA 4LFAF 2DH8A 3CDUA 3ZZOA 2MHEA 4PK2A 2DT9A 2VC0A 3W66A 3IXQA 4GKJJ 2AX1A 1LW2B 5KFAA 3GCXP 2BW7A 3CCLS 2CNOB 2WW8A 2K5TA 2YQ3A 1M1GA 3R6GB 4KHPJ 3PBEA 4L75A 5B0DA 2D9PA 4LIWA 4C2YA 1LQ9A 4CYPA 1UETA 3QYYA 3TUZC 3DYAB 1PYTA 5ETQA 5BYRA 4Z7YA 3TA2A 1RT1A 2HS3A 5T7LB 2C42A 5K14B 1JB0C 3KLIA 1LFWA 4O44B 2R7UA 5AG5A 2XY7A 2W4CA 1F2GA 3KK1B 1O6XA 3A1YG 3W2WB 3PY8A 3ETMA 4DR1F 2EFQA 2M3DA 1AFIA 1V5IB 4CRJA 4UOGA 2AJ0A 2BJ7A 1K0TA 2V50A 2HZCA 3PZPA 1I6JA 2ZE2A 3UN2A 1ZETA 1VQ7S 3JSBA 2CPJA 2HQDA 1VBYA 2WSFC 4PXEA 3LMSA 3C6TB 2EC0A 1YREA 2F5IA 3TZWA 5H1SV 2M88A 3HHNB 4XPDC 2FT0A 4JXQA 2OD4A 3PV8A 4NLTA 3DI6B 1VQPS 4A30A 3FSXA 3GJSB 3MM7B 1TUVA 2OO4A 2E5LF 2Y8YA 2JRSA 3TAMA 1WJ9A 1W26A 3HP6A 1YJ9S 2Y9HA 1F2PA 3DOMB 3SSRA 2NPIA 3NAIA 2CJKA 3FYNA 2DNOA 4MHPA 2ZNZA 3K5MA 4DV2J 2K06A 2DGTA 2JVRA 3V7ZA 5IS2A 3MD1A 2AZ1A 1LXNA 1LNQA 3BZQA 2RDIA 1LWCA 3KLHB 1BY9A 5SUHA 3NCPA 5JUMA 4ED2A 5B09A 3PHTA 4P45A 3TE4A 4NXNF 2NUUG 1Y3KA 4FYXB 4CYOA 4ZN1A 4B17A 1Z2LA 2W9BB 3BO4A 2J9DA 4K4WA 2HFVA 4M85A 3NEKA 2PJ5A 3VARA 1ITPA 5MLCV 4FP9A 4KY3A 4FF3A 1NHVA 1P9YA 1RDRA 1T3OA 1S9EB 3MOZA 5CCLA 4NMLA 1H7XA 4ZP7A 4C7IA 1R0AA 2FHJA 3PM9A 2LYVA 4WU2A 1HWIA 1MG7A 1QAIA 1FA0A 2OSRA 4B14A 4D3HA 4OX8A 3OFFA 5HJYA 4W9YA 1Z5RA 4QU7A 2VZ9A 1NK4A 2X1BA 1RHRB 4OZ5A 2F8HA 4FPRA 5HMWA 1G1XA 3PR4A 1RWWB 1HNIA 3E01A 1T8EA 4KSFA 3CCRS 4J9OA 2LA6A 2UUCJ 1V3ZA 1UEKA 1IWGA 2NXEA 2UUCF 3S9LA 2GIRA 2EFVA 1EZZB 5J1NA 5D0RA 2W2MP 4PXCA 4DYOA 4MMOA 4OI4A 2PRBA 3NAHA 2ATRA 2FVCA 4DCOB 4P4FA 3VAHA 3DDIA 3HSDA 5HP1A 1FKOA 2MZSA 4UEZA 3V4IA 3LGMA 3IAM9 1VMBA 5KG7A 5T7LA 2AYBA 3GPAA 2HQFA 4MK9A 3L09A 4P71A 4LT6A 2BUEA 2V9KA 6FD1A 1JLCB 2PJ6A 2UUTA 4ED7A 2NYIA 1RAFB 4XTTA 1XJOA 4JWPA 4PYDA 2DY9A 4U9YA 3M32A 1R57A 1REVA 4DV5J 2HMIB 5JQ4A 4IDKA 5DWNA 4W92B 8AT1B 4KGVB 4S0MA 4CIOA 2YKNB 3FEYB 4F4ZA 2AJ4A 1RYRA 4A8FA 4B12A 2BJ9A 4DXLA 2V34A 5CYMA 3TYTA 4ES1A 3KHZA 4DV3J 3U7JA 2VQFJ 3AA8A 1B4SA 4C11B 2IMOA 4MHNA 2PJBA 2GVZB 2JH3A 1GT8A 1TKXB 2Z2MA 3T1AA 1KLNA 3Q8UA 2UVRA 2PIYA 4A47A 4JI1F 1HNWJ 3M8QA 4WE1B 1CJVA 5E7OB 1I1DA 2RFHA 3PRDA 3M32B 3UDCA 4Q44A 3V38A 2ZBIA 5ADZA 2VBYA 5DQIA 4KOTA 1WC6A 2HQCA 4WJBA 2BKNA 4CLYA 2BANA 4P52A 3CJ8A 1XFOA 1OQ6A 5DLGA 3H20A 1WTFA 2MEWA 4K30A 4TKTA 1AYEA 2HC9A 3H42A 5A6PA 3RU0A 4FF4A 1Z2ZA 2A1BA 3GIKA 2M5YA 1WEYA 2KCWA 3BN4A 2DEJA 5D29A 1X5SA 3Q2SC 4P72A 4X2BA 3D7SB 3G86A 3TVKA 3M6UA 4AE5A 3UWTA 1TFYA 4CRYB 1YRUA 3TX8A 1RTHA 4NLUA 4QW9A 3PW4A 4OYWA 2ALZA 2JDDA 2K1RB 5IZHA 4X4QA 3CJKA 3EVOA 2R2RA 4C4WA 5BYQA 1RHKB 4OIXA 3LTOA 2V67A 1REVB 4PQUB 3WX8A 2R3VA 1JXEA 4KH0B 1IKXB 3D6FB 5LSOA 2YKPA 2IIHA 2LCWA 1T05A 3CXPA 1HWJA 4USHA 3W65A 1OO0B 7FD1A 3CNQP 2HW3A 1YBAA 2QT7A 3K57A 4OX7A 3RBZA 4CLWA 1B7YB 4IO9Q 3D8PA 1RHUB 2V8DA 4DV4F 1UPPA 2IDEA 2CZVC 4L3NA 1S9FA 3TUIC 5D77A 1N34J 1RHQB 2MKSA 2BOPA 3PRBA 3ETOA 1RBOB 4DG1A 4KQZA 2MKJA 2B5GA 1BPNA 5K8NA 4M5JA 2BANB 5KFWA 1TXRA 2KZMA 4MJKA 1N5QA 2R7QA 4F02A 3TOQA 2YH0A 2ZEHA 2V4JA 4RW7A 3B2YA 1RLDA 5EGYA 4PUOA 2A0FB 4QQBA 4P2SA 4DX6A 3AD9C 1N36J 3MEEB 1NSPA 3SXNA 2VBQA 3Q2TC 4CAXA 2I2YA 2ZKUA 3BM7A 4EMDA 1X4BA 1H72C 4K0KF 2JL9A 2C3MA 3HKWA 4X64F 3O2IA 1TUGB 4NYPA 1G2EA 4YB6A 3HVTA 2M8DB 5K8MA 3IM8A 2E1CA 2GX8A 1FNOA 5DG9A 4CRZB 5M2UA 2VFTA 1FT7A 4OC0A 5BR8J 7FDRA 4QYZK 4O3RA 4J9NA 4RW4B 4F0KA 5KFKA 5EMIA 4ECQA 4J9MA 4CNYA 5LRGA 5GAHI 3KYLA 4XO0A 4HYKA 2JEJA 2HYIB 1KVJA 2LDYA 4J9VA 4Q2LA 3ILLA 4C98A 2VDHA 4UZCA 2ROPA 2D1CA 3JTOA 3AT1B 1FE0A 1PKUA 5KFCA 1MJAA 4DLEA 4OZLA 4UW2A 1IKXA 2FCKA 2P0WA 3OR1A 2OJ3A 3VHQA 2V94A 4NFRA 4OX9J 2KTQA 4ILRA 2Z2LA 1RE1B 3SV3A 2A6OA 3K17A 2DNQA 3EPGA 2R9LA 4P7VA 1PIEA 1IICA 2E7VA 3H7HB 2G9OA 1BWVA 2PJCA 2B43A 1Y3JA 1Z8XA 2KJVA 3RW6A 4KJIA 4ZDNA 2AX0A 4B3TJ 1VQSA 4DQIA 3F44A 1SL2A 2AW0A 3LP2A 2VEZA 1I51B 2KJWA 3IGRA 2CQIA 2NXUA 2V5HG 4C3LA 3GTYX 3C15B 1JK9B 2HKEA 1SIZA 2XBPA 4LF9F 3JAMU 3R2DJ 1EJ7L 2P6FA 3P4UB 4W98A 1O0PA 5DZ7A 4N7TA 4ZVFA 1RWUA 1VIXA 4MIAA 2CQ4A 1ZO0A 4ZHRA 2EFGA 2H3EB 2OEJA 4KGKA 3B3CA 3I0SB 4DV7J 1P0HA 4I56A 1H3DA 5K14A 1U48A 1Q81T 3BDPA 2JC1A 4U7CA 1QAXA 3D0IE 5F8LA 5J8FA 1UTAA 3AOAA 1NKCA 4QIEA 3LWMA 2DISA 2PGCA 2E7WA 3IR6B 2CIJA 4FPIA 2HK2A 4YR2A 4RL1A 2L08A 2PI4A 4U5YA 3AODA 4CH0S 2CG4A 3KR4A 1OWXA 4X4PA 5F48A 2ZEDA 2DHXA 1CPXA 3TQ1A 3HULA 2V4JB 5BXIA 2F8MA 4JYAF 5DQHA 2BX6A 3MEGA 4K2XA 1XTZA 1YKWA 2ZENA 1S77D 4NRTA 1UJ4A 4RBVA 4OZ2A 4ED6A 1SH0A 2R2TA 2KYZA 1X4DA 4MT1A 2RDJA 1P6TA 5F0WA 2VONA 3FRZA 1X0FA 2JX2A 4PWUA 2G1DA 3R9EA 3NE8A 4WFYA 1U0HB 4IF5A 4B9SA 5E3QA 5HJXA 2B4VA 4KGXB 4ATNA 3Q8PB 2YWWA 4UT4A 2PSWA 1NUEA 1FEHA 4CTAA 1YBUA 5DDQC 3FKBA 1BPMA 1HLWA 1PYOB 1KSPA 1LW0A 2D4PA 4NI2B 3ENVA 3TA0A 4Y65A 2VDIA 1RXTA 2YKQA 3LH2S 3I5CA 1BAVA 2C2NA 1TP7A 1S1TB 3S9MA 3IBFB 3TP2A 4J9SA 4EZ6A 3CJ4A 3BJYA 3B3VA 3TJAA 1U0SA 5ETLA 3NNHA 1TKDA 3THPA 4PQUA 3WQPA 1FFSB 2GLFA 2IYGA 2AZ3A 4WTOB 2RILA 3BPDA 1URRA 4A8SA 4R8UA 3ZNUA 4OLLA 4NGMA 2E7XA 3VAKA 4QW8A 2R7VA 1PYTB 2NS1B 3KLEB 2DRBA 1OMSA 1S76D 4E8UA 2FGCA 4JXRA 1N5YA 2C6GA 1IOFA 4I7FA 5GCNA 3R1LA 3W1YC 4M3SA 2YNEA 4X4OA 2IJZA 5AG7A 2ACYA 4ZGYB 3VAGA 3BPSP 4NL5A 5A6WA 2Z0GA 4CGPA 4HTIA 1XEBA 3ZZZA 4O0NA 5KFVA 4LREA 1L3UA 1ZTTA 2VFRA 2D41A 2DYAA 2L9NA 4X2TA 3NH4A 3TVYA 1FEEA 3THVA 2RQ4A 3U1LA 1QSNA 5KFIA 2F7VA 3TA1A 3FJUA 4Q0BA 4E2AA 4QUSA 4BD9A 1FRIA 1YLEA 1TL4A 3AFGA 5HLFA 3HK2A 4WXWA 3IN5A 4C8OA 3T5KA 1CPZA 2BR0A 4PAAA 5A0YB 2YNHA 1OZPA 3KQXA 1YX0A 2QLFB 2ASYA 3QO9A 4CM2A 4F4XA 1Z4EA 1R0AB 4TN2A 3TW0A 3H5XA 4NEYA 4Y2CA 1RISA 3N01A 2QL7B 5LJ5Y 4WFAQ 3DOMA 2JZ5A 5T14A 2G2OA 4TNUA 4RNMA 2AQ4A 3VV2B 5ETNA 1Q79A 1MMNA 1RKJA 3HZGA 5IQQA 2DHHA 1TK8A 3MMAA 4KS9A 5LXRA 4CPAA 1RB0A 1WKLA 4R6TA 1WKJA 1OBRA 3IWWA 5AXNA 4AL6A 3ULHA 2D74B 2C3YA 2PMWA 2RHQB 4OC2A 3LP0B 1FDDA 2BA9A 1ZZNA 5J2MB 5HK4A 3MGDA 5HH1A 3K8WA 1JJHA 4HNYB 1KQKA 4OZ1A 4ZPBA 3V4IB 3LW5C 1XMOF 2QMXA 1SVDA 4WKYA 3QGGA 3LO3A 4JI3J 3IRWP 1HBOB 4HL9A 4OJ3A 4HHUA 4RJVA 1QTNB 2QTWA 2VPWB 1T9XA 5BYSA 2W4DA 3L2NA 4OLOA 4KGZB 1S5KA 3H5UA 3LAKA 3EMTA 1NK8A 1DTQA 1LAPA 3IM9A 4G6VB 1XNQF 2CYYA 3NGDA 1Q7LA 2CJQA 2W4PA 2AFUA 4PG7A 2QA2A 3QAUA 3S7RA 4CYNA 3SHPA 4ES3A 1EARA 2EFOA 1WUUA 4NCGA 1U1MA 4EYIB 1EKRA 4CYQA 1M5VC 1QSSA 4NMXA 1J5OA 3GYNA 4Q8EA 3R9GA 4JI6J 1IKWA 4BINA 1RACB 1Y0HA 3HFVA 1QSTA 1S72S 4OI0A 4PWDA 1YHQS 3J7YU 5DRKA 4UEFA 1S0VA 4I49A 4ER8A 4ANEA 3OVBA 3G6YA 4DJLA 4YFUA 2QO3A 2I79A 4LBPA 3PB4X 4RR5A 3QNVA 2Y0BB 4EMEA 2M70A 2R7HA 3RBXA 2YKOA 1UJ5A 5KTDA 2QL5B 1N33F 5A8KB 4OYIA 1C4AA 2C2DA 1A6LA 4AXIA 1Y0YA 4G1QA 2J0XA 1W2IA 5F8MA 3W6SA 5LSLA 4Y49C 4DV3F 2IM0A 2J9EA 4DN0A 3MCSA 1FERA 1ZTWA 4DV1F 4MFJA 4A8YA 3D3BJ 3FMWA 4Y2MA 4RUBA 1Q4RA 2EEYA 1C0TA 3GONA 4X4UA 2CVIA 3EGWB 2KB2A 1KN6A 4Q0BB 1VISA 1KHVA 1UZDA 1QVFR 3NMRA 4YQWA 2VFSA 3L7UA 4TU7A 1UFWA 2X7BA 5HN0A 5E96A 1OSDA 4PEOA 5CYQB 3TARA 4LFAJ 4OYZA 1SKUB 2BE7D 2R1IA 4WIIA 3WX4A 5DDPC 5B0GA 1YWXA 2PDAA 3HT0A 2KZZA 2FZGB 1HPZA 2OD6A 3J81Y 4HT5A 3HM9A 1PCAA 2AU0A 1GFWB 4UFVA 4Q7AA 5IM0B 2AEFA 4QIFA 2MZJA 2G13A 5KFSA 1D9AA 3WIVA 3QJLA 2FS5A 4MYTA 1RZMA 1UVKA 2R42A 2QLXA 1C0UB 4ZVEA 5D4OA 3DN9A 1R3NA 2Y8WA 5KFNA 1BLLE 4KOUA 3EXNA 3B4DA 3ZZPA 1MROA 4MY0A 4CGOA 2C2MB 2X7IA 3CCSS 5C82A 2BXJA 1SV5B 1NZ8A 2EVNA 2QX0A 3JSMB 2HWTA 4AL5A 3DI6A 4EFAC 2I6WA 5DGAA 4OIWA 2FGOA 4PRFA 4B3OB 2ZH9A 1SXLA 4DZDA 4FZVA 2ZH8A 2UZAA 5F8NA 2UXBJ 3VWSA 5HROA 1S79A 2J7WA 1FX4A 2YPZA 3RUBL 2O5DA 1U1KA 1OJ4A 2Z11A 5AE1A 2VC1A 1N5SA 4DDFA 2XMAA 3CCJS 1SKRA 2YX1A 3IEHA 2NREA 4RLEA 1F5BA 1U8SA 2LECA 4ZMMA 4NCBA 2HRYA 3D3CJ 3TAQA 1R8AA 1LWEB 4DR1J 5C5JA 4QWEA 2EPIA 2QIRA 2HVHA 5ETTA 3KG0A 2VZYA 1XQIA 2WHOA 3F0AA 3UDEA 3KWMA 1FJCA 4E98A 3OHAA 4DL4A 3BSCA 4NLQA 3H90A 3FX6A 1XWLA 3GIUA 2PDOA 3R5DA 3W61A 3CC2S 2DXEA 3NNAA 1K4JA 4DL7A 3BGLA 2CQ1A 5IC4B 4DSJA 3EICA 3KKFA 3R5GA 1HD1A 4ZP9A 5DM6Q 4LRFA 2V77A 3I56S 2J8RA 1JKHB 3QIDA 3BQ1A 4WK3A 1FK9A 3BXMA 3KKWA 4MIWA 1PAEX 4C8NA 5F8HA 1QSYA 4HR2A 4KHRA 1PUAA 3HCXA 3DU6A 3FBUA 3QJPA 3C14A 2IBKA 5LL6d 3SI8A 1R6VA 1QDUB 1T0TV 1FD2A 2H4YB 3N9UC 4PXDA 5HVHA 4AVBA 5F3TA 4KOVA 2C1EB 2G3TA 1S6PA 4PPDA 3LP1A 2D3ZA 2BO9A 6AT1B 4P2MA 1LW2A 4B9UA 4F3QA 3K5PA 1NZAA 1RWVB 4YEAA 1PSDA 5HMYA 1RAJA 4USVA 4QPTA 1DTQB 2AEMA 5DS0A 3J7ZT 1WG1A 4OZNA 1CULA 4MKYA 2AWZA 2QYGA 1LEOA 3K59A 5E3CA 3K2YA 3PKYA 5CAAA 1FDNA 5D0EA 1H74A 1GXLA 2X51A 2J8AA 3HJFA 3CCWA 1VBXA 2ABYA 2OZUA 3QPIA 5JPHA 1HEEA 1S7KA 3VWEA 4QVTA 1RWPB 2FZCB 4LQ9A 3F8KA 1IKYB 3PYFA 4HI2A 2JLMA 4NE9C 4DLGA 1J5OB 4AVCA 4OADA 2BBEA 1QUVA 2CPXA 5A28A 1DLOA 2IJFA 3GFHA 3CCZA 4IR1A 5HATA 3CD6S 2YKMB 1U1QA 4NXMF 4KOXA 1XJWB 2VBZA 5EWEA 3H4DA 3GLJA 2ZH7A 1RTZA 5FLXU 4M5DB 4IFYB 3A12A 2A2CA 1AZSB 2BZ2A 3BGFA 2L9DA 3NS7B 2PFDA 3BR9A 4WWVA 3MEGB 5CD4A 5GAGU 1AROP 2RC4A 1FO1A 3O6QA 4RN7A 2RDDA 2DRAA 4QWDA 2J6TA 2C2ZB 2ANPA 1YR0A 2LQ9A 1YI2S 1GTEA 2IA0A 4MHZA 3GYXB 2GAGC 4ZVRB 2IC3B 3UQSA 5KFHA 2CNMA 4C2XA 3W9HA 4OZ0A 3GWCA 3QZ8A 2ZEEA 4P4IA 5KTCA 4KV8B 3M2UB 1AUGA 4PYAA 2GLJA 2E1AA 1APSA 1H2UX 2JLEA 3HX9A 4ZJOA 4NRUA 3PJWA 2ZELA 3QFWA 1IM4A 5IX3A 1N52B 4X66J 5IWAF 1NSAA 2W7AA 4JV5F 2B3TB 2E1PA 1HBMA 4NLOA 1RT4A 2JBJA 5LOQA 1X9SA 4JYAJ 3HVWA 1TVRA 4MXUA 3EXCX 3QT8A 1VRQC 4E8OA 5IQ6A 1WC3A 4DPXA 3UR0A 3X1LB 2OPRA 1VJWA 2R7TA 3D7GA 1FJGF 4TVAB 4M6HA 2WSCC 2W01A 2HV2A 3Q8SB 3FVYA 2E1MC 2QYVA 4KC5A 2AGOA 1TK0A 4P75A 2FHOB 3GZ7A 1TK5A 5CYQA 2VQFF 4DFJA 3K8VA 3PW7A 4WCEQ 4NA1A 3SSSA 3DLGB 1N88A 3BV8A 3QAHA 3NGSA 4F0XA 2ZJRQ 4CGNA 1MNEA 3W63A 3P3DA 1VRTA 2V8VA 3BKUA 3BQ0A 1FDBA 4PZVA 1BQNA 2CRLA 2ZW6A 4BC9A 1WSRA 3IIBA 2CQCA 2CQ2A 3MGJA 5H9EK 5HQ8A 4WFXA 2Z2YB 1WI8A 5J1EB 2XG8A 4IQXA 3H40A 2ZOMA 3D1HA 5IXUA 4AB7A 2MKHA 2QMWA 1MWYA 1CC8A 4ECYA 2JEIA 2BJ3A 3R7BB 2J7UA 4I2PA 2Z0ZA 3W2VA 2EBEA 2FY8A 2NLWA 5K5MA 3BSAA 1NK0A 2J8SA 2YNFB 1C1CB 1M4IA 3IO1A 4CO1A 5GAHU 3TZZA 1QSLA 2ZOGA 2V6AA 3DMJB 2XNRA 2G0BA 4CGMA 3VGSA 2J9AA 4TXSA 1SL0A 1RT5A 3QSYB 2FIWA 3FIXA 2A10A 1H7WA 2G2YA 4GVBA 1U6BA 1BUXA 3AJDA 4LFCJ 4XIUA 3N0VA 1SL1A 4OYMA 3B7IA 5AXKA 4ZVTB 3CDBA 1U1NA 1RT6A 4DMZA 2ZM6J 1N36F 1TU0B 1N5YB 4IYQA 4F3OA 5A8KA 4FVCA 1ZM3A 5LM7E 4U9ZA 3W8PA 1S0OA 1RHJB 2IHR1 1T05B 5F9NA 1XR6A 1F3FA 5J2QA 3MAQA 2JHEA 4UCNA 1TF9A 4R25A 4LF2A 2HB6A 3KOAA 2BCOA 5BJRA 4RU9A 4MJ8A 3O44A 1VHIA 5GAEU 4AT1B 2W2OP 2RS2A 2MSSA 4CLPA 2EK8A 2KVIA 1ZG7A 1HBOA 3M8QB 4TQSA 4DQSA 3ENAA 1FX2A 3K0JA 4JLYA 1RT7B 2UU9J 1Y5LB 3DR8A 2V0NA 2WOMA 4CS0B 1TKXA 3GV5B 2QLWA 4PPZA 5HANA 2FL4A 2CPHA 5HLFB 5A76A 3IRXB 1LFPA 1SJ4P 5B08A 3QQCD 2XULA 2B7CB 2VZZA 2XYGB 3O1LA 4KLVA 1KTQA 4IFVA 3TVZA 3J7YI 3OV7A 1QSOA 2I8EA 3QSIA 4NGNA 2DNZA 3V6DB 2CNKB 1WD6A 2PO4A 4H4MB 2JWNA 3MUTP 1JLFA 3OTOJ 4I68A 3KLFB 3EY5A 4LVOP 4NLPA 4YB5A 1JLEA 5J2PA 1S4FA 1H38A 4CO5A 4MIBA 2FC8A 4RBUA 4DR3J 1SIWB 3L9ZA 1KDNA 2NMTA 2AMCB 4HDGA 3FFIB 4H2KA 3I87A 2B6AA 3ZNJ1 1B87A 4YHHF 5KTAA 4OC5A 5HO4A 3H59A 2FXFA 4N8OA 3NGTA 5EDWA 4Y49B 4QZVB 4M5IA 2BRKA 3UVJA 2OELA 2Y0SD 1RAHB 4KIAA 4NLRA 1RTJA 2XM3A 2EKYA 3MD3A 4KSEB 1XMQF 3MM5B 1DZ5A 2OPRB 3D5MA 1U6ZA 1S0NA 2M4MA 4LSLA 3W64A 4N8NA 1EP4B 5J1PA 3C3LA 3V81B 2W9CA 2YKMA 2AYMA 1WC4A 4GMKA 1CJVB 4RNHA 1NB7A 3I9SA 2HBYB 1HBUB 3T5HA 2XGPA 3N79A 3GIIA 1S1XA 1M5SA 1ZLIA 3PFEA 4H89A 2FJWA 2XSJA 3CO9A 3KJQB 2CTCA 1ARMA 3BGRB 1NPKA 5KFJA 3T3FA 4FD6A 3JYTA 4I67A 2LLZA 3F56A 2BVZA 2OR4A 1YRTA 5G0RA 2RRNA 5BWAB 1RAOA 1F9FA 4EI2A 2ZWOA 3M8YA 5CXTA 1FRHA 5F3ZA 4UFWA 2NSCA 2VG6A 2JLGA 1Y9KA 2U2FA 4WBFA 2XEGA 2RQKA 3FGVA 1FRJA 2C2EA 2ZH5A 4HHJA 2LXFA 2BQRA 4K4YA 2PE3A 2YPYA 4OQJA 4BBYA 4B9MA 5L9XA 2F1FA 1N56A 3UI3A 3UE2A 5B0CA 1R31A 1A0OB 4MRIA 2N3LA 5CH7B 1KZFA 3RAMA 1X10A 1P8GA 3RTVA 4DUYF 3T6JA 3FRYA 1XIQA 1RTIA 4NYOA 2HHWA 2B4OA 2DNMA 2CY2A 4F8ZA 4KAIA 4GO7X 1HNVB 2R7WA 4NF1A 3QRPA 4KSIA 2X3GA 1P9QC 5ETRA 5HL7Q 5GVQA 1TIQA 1DQ9A 1S5ZA 4A8MP 2OOTA 5I4MA 3JAMY 2KM8C 3OJUA 1CP7A 3PX0A 3PJ9A 1F9HA 1G6BA 5JGFA 1ZM9A 4ED4A 3PXGa 2VOPA 3HT3A 1O8BA 2WW4A 4C9DA 1R8PA 1FCAA 4K8RA 1ZPVA 3MF5A 5K9FA 2MJUA 4ZCLA 3KUEA 4ONWA 5EWGA 1WG5A 2AFXA 1BHNA 4ZJQA 2BJ8A 5ETSA 4TLRA 3NKYA 1WF0A 3DM2B 3JYTB 2DGXA 1ICEB 1P27B 1NH8A 1F1BB 3Q22A 2AFZA 1EETA 1VFJA 3US5A 3T6BA 4OAEA 1BLUA 1HYSB 3T8WA 1BE4A 1SJ1A 3SDEB 2W9CB 4F04B 2CFXA 2PC6A 4C48A 2H9ZA 3HKZD 4ZY0A 2GQ2A 5KFYA 1NJZA 2ZJPQ 1IKVA 2GZOA 5ETMA 1XMBA 3MR2A 2REEA 5HMZA 3KK2A 5F9LA 2WAQD 2Z3MA 3CCES 2GVDA 3MEDB 3IS9B 4PSWA 1N5TA 3EC4A 2LQ5A 1JLBA 3KLVA 2XZDB 4LR9A 4YS2A 1CSJA 3HI9A 2BDPA 3M2VB 2PR8A 4Q43A 3NOCA 1K73T 4KO0B 1JJ4A 2Y3YA 1M90T 4DF8A 4WPAA 2Q7SA 2GJIA 3WIUA 1JLAB 3MM6A 3I82A 3ZO7A 2N3OA 1HL6A 4KOYA 3R2CJ 4A95A 5LRKA 2P8IA 3LWLA 2PSZA 2VA2A 3PZJA 4OX9F 3CCTA 3SCLE 4O0IA 4UUXA 2MKCA 3UVJB 4FUUA 1UL3A 4YB7A 1WC5A 1S97A 2CPIA 4B3OA 2OFHX 2GQQA 4J7CA 4PKDB 3BO3A 2AP6A 2FE7A 3EX7B 3VALA 2OPQA 3HHLA 3DDNA 3PG9A 4H4OB 2E5JA 3OSNA 2QECA 3SFGA 3CE8A 3IRXA 1S6QA 4IH7A 1XR5A 3T9ZA 1KVKA 1FXLA 3CJRA 3ZFVA 4QIGA 2DNGA 4HLBA 1B7FA 3KL9A 1PG5B 1KWMA 1HD0A 5HAOA 3W8GA 4B9TA 4H4KA 4JI8F 3ENWA 2AF6A 2E5GA 4UQTA 4ZCKA 3OUYB 1JLFB 2B5JA 3KJVB 2H54B 4G3IA 4LQGA 3S9NA 1CEZA 4RUCA 3PTWA 3OFHA 2JBKA 4QWAA 1DFDA 5LXYA 1K8AT 1CJTB 2ZPAA 9RUBA 2OGUA 4NZ0A 5KFQA 5LMNF 5IFMA 3HZEA 3AD7C 3P96A 2A4NA 4NPOA 3OL9A 2RJZA 1V3SA 2GV1A 1Y5NB 2DNKA 4ALZA 3PB8X 5ETOA 2XYPB 3MPUB 1U0HA 2J6SA 4MFLA 1X12A 1Q0NA 2QJ8A 1NHKL 1HR0F 4U8YA 4ILLA 4JI6F 2ZITA 4CLSA 3T1YJ 1OY8A 3RGIA 1Q5YA 4RW9A 2YNGB 2DR8A 1HQEB 2DCLA 2BABA 4NGSA 1SUQB 4IOBA 3KG4A 4ILMA 1YTYA 2UV8A 2VB6A 2UUBF 1Q53A 1KOOA 2OZGA 2MZQA 3ISNC 1IBCB 3AA9A 3CDXA 2LEAA 4ICLA 1DURA 1IKYA 3DCAA 4QU6A 1RA6A 4KE5A 1ON0A 1EQMA 3ZTSA 1Q8BA 4ZJLA 4FKYA 3CPAA 4G1PA 2ZEOA 4RO0A 4C2ZA 3VGUA 3K2KA 1MU2B 3T41A 3ICLA 1YJTA 4HACB 2YTCA 3FBCA 3PP9A 2GS8A 4DR6J 2NUHA 1KQFB 2B4PA 4P74A 4XDDA 2DGOA 5F8GA 4TY8A 1R8BA 3NGRA 1Z9UA 1R27B 3LODA 4TY9A 2W9AA 3K5NA 3QO9B 3BS9A 3ET6A 1RWOB 4LFBF 5KG1A 2WVBA 3FJ2A 1VQ6S 4CO4A 1FRKA 5A27A 1DHMA 2VH7A 2UVUA 3DNSA 4LF4J 2RH3A 3MMBB 2JFKA 4NJRA 3IG1A 4Y28C 1NK6A 4U9RA 3WC7A 4IKAA 1KONA 4RWXA 3OXGA 4WTYA 3LANA 2IM2A 1NB2A 2QLJB 5C25A 2HFOA 4MY3A 3RRKA 3SBMA 2V68A 9ATCB 1TVRB 1SUQA 4J9UE 3E3XA 4DJBA 1UVNA 2HURA 3M8WA 3GE9A 2RF2A 1SQHA 2B56A 1GMWA 1B70B 1U7LA 4K3NA 1UWBB 4E2FB 2QA1A 1YW6A 2IC3A 4NYZA 2UUAF 4P10A 3B6BA 1VK8A 2B9XA 1VLYA 3SJGA 3DC2A 4OC4A 5DETA 2XQCA 4ECSA 2OEKA 4USWA 3Q86A 5AE3A 3OQ2A 2XZTB 3R8YA 4U95A 2CKWA 2Q3PA 4ZVGA 4LF8J 2QZ8A 1URNA 1C2PA 1Q7LB 3R9FA 3VQTA 2HHTA 3NE7A 1NK9A 4JOUA 3EVWA 4ECWA 3B3SA 1KVIA 5B0AA 4DU8A 1SH3A 5K20B 2AYGA 4B08A 4EFDA 2CQ3A 4R76A 2LEBA 2ATCB 4KKOA 3OR2A 3BN7A 2HNZA 1VBKA 3CCUS 1IBMJ 4M1KA 2KFNA 4ZVHA 2RAQA 4OHYA 4F7VA 3CPXA 4DV2F 3GV8B 3BF4A 2WBRA 4NCAA 3DXSX 1R6YA 3IBWA 5L39A 4GO5X 3ELHA 2F65A 2IY5B 4JV1A 3MI7X 2R8KA 1ULRA 1R7IA 3KDNA 2ASDA 2QFIA 4AG9A 2OMOA 2RE1A 1V9OA 4QBUA 5L1LA 1I3OB 3GYAA 4XDCA 1S6UA 2MKKA 1HHTP 5HBMA 2EG1A 3M05A 1S1WB 5A8WA 2HNYA 4ZPVR 1LCPA 5IT0A 4C0BA 1MMDA 2W2NP 3T1HF 2OI2A 2BUNA 2PJ2A 5E41A 2ALYB 2GCFA 1PILA 2DIUA 1D09B 3N5BA 4U7UK 3RRHA 1R8HA 1KS2A 2FHJD 3UCGA 3I4PA 4KFBB 5E5NA 4B3MF 2AYEA 4H54A 1Q8LA 3MAAB 4B6ZA 4ZYQA 2RQMA 1C4CA 5A0YA 2PMZD 4B3TF 5KG5A 1TR0A 1J4JA 4X4RA 2VV5A 2C1CA 5LSRA 2NSBA 5KFPA 4ETXA 3H8YA 2BKPA 3DU5A 4JI2F 1RAIB 1SQFA 3E51A 4DR5F 4OZ3A 3PYGA 2K8GA 2DITA 2H1YA 4CNZA 4ZY2A 3MPVA 4A8OA 1B0PA 4ZIWA 3I5BA 2ERRA 1LKZA 4NA3A 3VQSA 3GKRA 1RYSA 3D2WA 3BGOP 2BE2B 4M63A 1M5HA 3D2PA 2LQJA 4DX7A 3HDSA 2CADA 4JI5F 2VKRA 3D7DA 4RS2A 3I9ZA 4DS4A 2ZH3A 5KFMA 3VAMA 3Q8RB 4KOSA 4PG6A 4NJQA 3H2LA 5DLFA 1GMUA 2K1RA 4P2FA 4IFVB 2O3DA 1SB6A 3VH9A 1AW0A 1JLGB 2MXYA 1GAOA 1KOHA 1YQHA 4YGOA 3GQCA 4C0OC 3JB9k 1VQKS 2ZHAA 1X9WA 1FFGB 4HNWB 4Q8FA 5KT2A 3CD7A 2BKOA 2GFQA 6FDRA 1SJ3P 5JMNA 2BE2A 2EFPA 4KR0B 4ETZA 2XI2A 2ABZA 4MYUA 1AB8A 1QD1A 4A37A 2B4DA 1FTCA 1NU4A 2H5MA 4F9VA 1XBWA 5CHCB 2CDRB 3DOKB 3S6FA 4XPLA 1RT2B 3FSYA 1NDCA 3T9YA 3KLHA 4RNNA 3LGHA 5JVHQ 3C6TA 4L3KA 3UR3C 4K7QA 2KKHA 4CTAB 4N47A 4NLSA 3MXHP 3NOGA 3TZXA 4HDHA 3PHEA 4RUHA 6CPAA 4CT8A 2B51A 4WWSA 1VC5A 4J90A 2YNIA 4G65A 3VAJA 1HR0J 2KM8B 1S57A 1N6QA 2YXLA 1HHSA 3KJNB 4UOHA 1GNKA 3BBCA 1ZAVA 3FECA 1UFLA 2OP5A 4KT0C 4ECXA 4ID5A 1GMVA 5LYLA 2R7XA 3C16A 2Z3LA 2GHWA 3R7SB 2DXQA 1SPBP 2DIVA 2WZ1A 4UY8T 2LFVA 2EBGA 3OFEA 3C15A 4M5LA 1S10A 1ELMP 4DZ6A 5EN1A 5JJBA 4Q38A 1M4DA 4BC7A 4RW6A 3P2HA 2GHVC 4DL3A 1HBNB 4OKOA 4CLUA 3FDSA 3RR8A 3BYRA 4TU9A 3DNCA 2G1HA 5KOWA 2PJ3A 4A2ZA 1T9YA 2LQ8A 4XAKA 2FLNA 5D15A 3GFXA 3I31A 1S49A 5EUHA 3CTRA 4II9A 3MWBA 2C2OB 4UUWA 1FFWB 1RT1B 3DSBA 4ED5A 4R5PA 3CULA 1IBKJ 1TMMA 1EE3P 3JS9A 1TKTA 1QE1A 3DXBA 2A3JA 2HAIA 2VODA 1CJTA 2AFSA 5G21A 4PCQA 3SI0A 2R8JA 2GMJA 2WRMA 3WABA 3J7A1 4DV4J 3G6ES 4DL6A 3BQ2A 3QGHA 3PBBA 4P6YA 5C24B 1K0VA 1ZAWA 3RB6A 1TL7A 5E33A 2BACA 4IG3B 4WF9Q 1C0UA 3V6JA 2FY1A 3ZTRA 2P9GA 2O66A 2YNGA 4Q36A 3LWUA 2ZEJA 2I3CA 5D8HB 3IGVA 4OYAA 4MFQA 3LQVA 1AT1B 3VAFA 1CX8A 3JQKA 1QMUA 3IMQJ 2ZDPA 1ZYQA 2VBXA 1RA7A 2AE6A 3H5SA 4OC3A 4A32A 2KO1A 1VHFA 2IAJB 1SQGA 4LF1A 2ZM6F 4CZCA 3RB0A 3C16B 1BQXA 3R7NB 1DTDA 2AHOB 4QPXA 4I2QA 2QC3A 2VG6B 3QFHA 4B11A 1BO4A 2DKOB 3M2RA 2H48B 2D3OR 1HKAA 4O3OA 2Z10A 5CABA 1WK4A 4TQRA 4A4JA 2FJDB 4F26A 3FMBA 5LMUJ 2AJ2A 2QVPA 2BOAA 3R5CA 2QRRA 2CG8A 3AB2B 5D0HA 4A94A 3FCVA 3M8SA 5L1KA 4KB7A 3SFUA 1OY6A 1K1QA 2VASA 5J8CA 2FD2A 4M5HA 1IQTA 4K4XA 1ZH5A 1KEKA 4KUBA 4OI1A 5HI7A 1J5EF 2J0SD 4ZITA 4B02A 4C8MA 4R0JA 4I1TA 1U49A 3EGVA 1F60B 3H4QA 3UN3A 5EHHA 4TU8A 4HNXB 4OP4A 4I6AA 4F2SA 1VGYA 2GANA 5IB0A 3KJFB 3HHLC 4PWWA 4NXMJ 1XMOJ 2JJ4D 4DG1B 2MDAA 4XNHB 1Y9WA 1RU2A 4R8FA 3DLEA 2OH2A 3VTIA 2IPOB 1WHVA 1X31C 1S3ZA 5JXSA 1N71A 2HNDA 1VHSA 1W7WA 3UY5A 2HPUA 2VJVA 2K2PA 2B9WA 4C11A 4ZLNA 3W62A 1G4CA 3OWCA 1H8LA 3LP1B 4UWIA 2HIYA 4MFBA 3S1TA 3CGIA 4RBTA 4Y6IA 3MCMA 4O4RA 5CYJA 1V3RA 1X4FA 5D4PA 1S99A 4DSFA 4R3LA 2AJ6A 4WFBQ 4JYWA 1DQ8A 1JMTA 2JC0A 1EP4A 4LUBA 1TFWA 2XEFA 3TEHB 3J81U 3EWGA 5IWAJ 1VQYA 1KR4A 4HACA 5E0OA 4JV5J 4DL5A 5FVJA 3L7OA 1VOMA 4NEXA 1X4HA 4LR8A 4BCAA 3BBBA 1UVMA 2F4VJ 1Z1ZA 3GMGA 4HI1A 1IVZA 2IM1A 3PO4A 4KPCA 3OTDA 3HSJA 2DPIA 1HIYA 5HQMA 2XLIA 4PUOB 2VF3A 2PA3A 3NCQA 1L5UA 3KI9A 2R8IA 1X8DA 4LF4F 1HBUA 2WCXA 3RBEA 4X4VA 4L76A 4O23A 1CP6A 3S6KA 2IL4A 4KTQA 4ANDA 5MAOA 2MJNA 8ATCB 2VL1A 3CF5Q 2F40A 4JP8A 1WG4A 2AFMA 3BR8A 3U02A 3P2FA 1LWFB 2F63A 4FYDA 3IJ3A 4ZI6A 1XF8A 3CUNA 3NH8A 4K4TA 2V63A 3BGUA 2MY7A 2HG4A 2KXHA 1NDKA 2X1AA 1Z4RA 4ZX8A 2BRLA 5L8RC 1BWEA 1EB0A 4O3QA 1E6VA 4Y34A 3MM8A 3GU0A 4CO0A 2B9YA 1F5CA 3JSYA 4LFBJ 3LGNA 1NHUA 4FS1A 2B58A 4RNFA 1F57A 2MLXA 2MKIA 4KRWA 3SSQA 4ZLPA 4ED8A 8CPAA 5CCMA 1WF2A 2XWYA 2FZKB 2CNSA 2MQPA 2M2BA 4K4UA 2X1GA 1FKAF 3I0RB 3MECB 5J2QB 3UDVA 4AG7A 2CWKA 3EPIA 4UCPA 4UTGA 1FD8A 4AYBD 1KQGB 3GR1A 2DK2A 1GYTA 1VRUA 2PD1A 5D4LA 3JQMA 1OPZA 3P6YC 3TO9A 1NK5A 3A3OB 3KGQA 3GP9A 3KR5A 3MMJA 4ZPTR 2MZ1A 4UFXA 2ZVIA 5L9NA 3CWJA 3CMQA 2VI7A 2I9SA 2ATLA 4IRKA 1RWXB 4ED3A 2DVIA 1S1VB 2VA3A 4FXDA 2WB4A 4MAKA 2VG7B 1L3KA 2B9EA 2KN4A 4ZPAA 2DR9A 2ZBPA 4TYBA 4DX5A 4RW8A 2JDCA 1JXLA 4XPKA 2GIVA 1U47A 3D0GE 4LF5F 1VQ4S 2C28A 1RADB 1DAXA 1NLKL 4NOHA 4Y2IA 1IJFB 4B9LA 2L3MA 5F8IA 2M52A 3PVXA 4NLXA 1LRZA 2MLYA 1JLGA 1U8WA 3BSOA 4IR9A 3G6XA 4X64J 2BM1A 3KHHA 4UZBA 5KFEA 1RTDB 2MTLA 4IRDA 4K4VA 3B78A 3RJMB 2FHKA 4USJC 2V4RA 2B4BA 2PJ0A 3R6LB 5ISVA 3KUGA 3HLPA 3FMCA 4M5MA 3H5ZA 2Z56B 5BR8F 1I94F 1WHWA 4ZP8A 1JNRB 3H0PA 1Q78A 2OHDA 1I94J 1VQ8S 1RCXB 1TV6B 2VOOA 2OIHA 5C2GA 2GJFA 4YY3F 2HHXA 4NWBA 4URQU 4PK3A 2DNHA 3V6KA 2IA6A 5KT6A 4DR5J 1TKFA 4EWTA 2IVMA 4UEEA 2XMVA 5A2QU 1FY7A 5KOXA 1JWWA 3ISND 2ZNYA 3CCMS 2EI5A 3NMAA 5CPAA 1RAAB 4J9KA 3QT5A 4WU3A 4UQGA 2EW9A 2W24A 5THWA 3PX4A 4CAVA 2B0GA 1E6VB 3R97A 3UW1A 2WONA 1IN0A 3CCQS 4KSAA 2VQYA 1NDLA 1YSJA 3BYPA 1ACMB 1JXVA 1KQSR 2CF4A 4WYLA 2EK9A 1TL3B 4USKA 1QUPA 1HDQA 1Q8IA 1XIXA 5AXMA 2KI2A 4PG5A 3N4WA 4WP9A 3NP5A 2RKIB 1FDAA 1VRUB 1S1XB 1FWLA 3OXFA 3FCHA 4ZVSB 1QAJA 2N82B 2Z58B 3RAXA 3TT2A 3PJXA 3CJQA 2DHAA 3TEGA 1U4BA 4R87A 3C2PA 2FIAA 1DJ0A 4ZVPB 4LF9J 2X1FA 4DNCA 3GILA 3PB6X 1REGX 2XO7A 4IK2A 4BWMA 4O3NA 3QT7A 1KC8T 1UEVA 4DWIA 2GREA 4CLKA 1WEZA 4BMHA 1VQOS 5L46A 4DUZJ 2JSXA 2WSEC 1EIYB 3IC1A 3E2EA 2BL1A 4DEZA 3OTCA 1UEUA 2EXUA 4C97A 2RNEA 1ZA2B 3QATA 2YWKA 2MQ8A 1CJKB 3EFAA 1GXUA 3ONQA 4C3KA 2RSQA 1YJVA 2OSQA 4C2MA 2HAFA 2HHVA 4BHQA 1UFKA 2HMIA 1HWKA 2ROEA 5D4NA 5HMNA 4RW7B 3S01A 4J3GA 2AEJA 2Q0YA 1T03A 1N8RT 2HVEA 1QSRA 1VI7A 1GX5A 2L41A 5G0RB 5DDOC 4UY85 2BYCA 1Y9OA 4OHWA 2HGMA 2V9WA 3V4MA 2CXAA 3BJ8A 3MRUA 3PW0A 2ZW4A 2FHMA 4LBIA 2REFA 1CC7A 5KT3A 2B5GB 2FUG9 4I2PB 1FJGJ 2B3VA 2EBJA 2ZVSA 3KLGA 1DTTB 2D69A 3FSIA 3MCOA 2GAHC 5I3UA 2JVOA 1WORA 2C22A 4QJVA 1Q95G 1XBUA 3I0SA 2CPDA 1K1SA 3FQLA 3AOBA 3X3UA 2UVWA 4U96A 2XZWA 1CVJA 2NXNA 3OVAA 2J9DE 1F5AA 1FWPA 2ZEGA 2ZW5A 5GADI 3W5ZA 4O4GB 4LRAA 3NGUA 4YB1P 1FESA 1NM2A 3MEKA 3KZWA 2DR5A 3P5BP 2CQ0A 4JI1J 1HNIB 3FEXB 3TNVA 2E9ZA 4DSKA 2EG2A 3A4TA 1NJIT 8RUCA 4DR2F 1V0CA 3U1NA 4WXOA 3HJVA 3GV7B 2F4VF 1EKSA 2AIRB 4LIRA 3PB9X 5I42A 4B9VA 2COLA 4NZ6A 4BBHA 1IY7A 5HVGA 2OZHA 3FFIA 3FC9A 1HMVA 4FD7A 2FLPA 2HNDB 5KG6A 2DBBA 3OHBA 1FK9B 3H25A 1F2OA 3G8SA 3I9V9 2C27A 3CDEA 5KG4A 2RRBA 2WPWA 1EQ0A 1EX8A 2FLOA 2XMTA 1Q2DA 1CM0A 3ZTPA 1NSQA 4I2QB 4B5PA 4KVME 3MM9A 1N4LA 4WE1A 2Q79A 3KLFA 1IYKA 3BLNA 2OTJS 4FXVA 4DV1J 2PJ7A 2DF5A 5LYIA 3M8PB 2BJ1A 4HEA9 3UCZP 2E29A 3MM6B 5AGEA 2Q4ZA 3MN8A 5IV3A 3NFZA 4RNOA 4EUVA 1S1UB 3PFOA 3TO6A 5H84A 3OUYA 4OJGA 1B64A 1NBEB 5J2NB 4F2RA 4WYWA 3RG6A 4YR0A 3R27A 1E6YB 1MK4A 4O4GA 3VGVA 4ELUA 1WDDA 5G22A 2IMWP 2O1PA 4F4KA 2RMLA 3M1VB 3GJTB 1S59A 4OI3A 4H6ZA 2V8PA 2DNLA 2ZWPA 5EX0A 2RHSB 3FQKA 3EDRB 3SMZA 1DY3A 3G4SS 4KHMA 4JZ0A 1TKHA 3NGKA 1SQEA 4FYVB 1WOOA 1DRZA 5KFBA 1C1BA 2DHSA 4OHVA 1UWYA 2VUGA 5C7PA 3B35A 4OLPA 3DOKA 4XK8C 2QMLA 2EK1A 1R89A 4YN3B 4GXHA 3V5RA 3O5TB 4QR2A 3EGNA 4DSLA 4N41A 2B7BB 2F9DA 4LF6J 3JTPA 3PO5A 5CQGA 1X7VA 3DLKA 2N4DA 3FBFA 3WC5A 1OIAA 3H4BA 1YJWS 2NQPA 2I5JB 3KXDA 2WBMA 4UBRA 1KLMB 2HQGA 3CEDA 4NEZA 5KFLA 1MN7A 2HBQB 2Z30B 2GO9A 5A2QY 2WYRA 1FWKA 1HNXF 3FEZA 5RUBA 1IU8A 4IQMA 3VZIA 2ZBRA 2VPXB 4YU9A 4GKKJ 3SXLA 1DQAA 4C3MA 2CQPA 4F4YA 3IBCB 3AJ2A 2IRYA 4EVYA 2HFUA 3SQOP 3H2VE 3L4BC 5B0BA 2B5JB 3PW2A 3G9CA 1CBKA 3GB0A 4ECUA 4YHHJ 1RWKB 2HS4A 3PKMA 3GSIA 4AQYF 5LJ3Y 4ID8A 4NCZA 1FVQA 3B3WA 3PIPQ 3G8TA 2KYXA 4LMZA 2PJAA 1J5EJ 5FJ4A 1WTBA 1IB1E 4IUFA 1FXRA 2UV8G 3OTOF 2E9RX 4ZA1A 1JKHA 2M8HA 3ENQA 3VF0B 4RW8B 1M0SA 3M8ZA 3HHLD 4M6IA 4TWEA 4P6QA 1A2ZA 1YZ7A 4X8IA 1LWCB 2A18A 1M1KT 2J0WA 1OS5A 2LU2A 4B3SF 3DYAA 3FBEA 3RB4A 1D9FA 2FPHX 2WVDA 2CDQA 1M44A 3JTKA 3HD2A 3KNAA 1CPSA 2F5GA 5B7WA 3GUXA 1L3VA 1OQ3A 4J37A 2CJYB 4FBUA 4MHDA 3G6VA 4FF2A 1WHXA 5LT5A 2BE9B 3MZIA 2YBVA 3S6HA 3MPDA 3W2WA 1X4CA 1WOPA 3MTJA 4KPYA 4P9SA 1UCNA 1N0VC 3R5AA 2XWXA 5B0EA 4EYHB 2OU2A 7AT1B 3AOCA 2AJQA 4Q45A 1QM9A 1XMQJ 2EFNA 4X4SA 3D6HB 3PX6A 1X5TA 5J2MA 5DG7A 1F3VA 3CDWA 4J91A 1MLAA 2UP1A 2V8HA 2AGQA 2E5IA 4OYBA 2CQHA 2RS8A 3TI0A 2WVCA 1H0HB 1LXJA 2KDOA 2XEJA 3QBCA 3GG1A 1S1WA 3CD5A 3UD3P 3MHYA 4RW4A 3HFKA 2O4HA 3LD2A 2Y1IA 1NEEA 2YX4A 3S6EA 5GMDA 5C88A 1WWHA 2LU1A 4AVAA 2XMJA 3DGPB 2EWHA 2V2KA 2YX7A 5HQLA 2ADCA 4YFJA 3JRUA 3D1QA 3CJ5A 3ZC4A 5AT1B 1HQUB 3HVAA 3LP0A 2HHQA 3M30A 3DOLA 1U1PA 2PJ9A 3GY9A 2LDIA 5B0FA 1NH7A 2Z3NA 4E0DA 3FEDA 4LF7F 1CJUA 4EBCA 1T94A 3D67A 1VQLS 3W3SA 3KK3B 5EC4A 1TZ0A 3FRMA 2EO8A 2XYHB 3BB5A 3SQGA 4HHHA 1YVKA 1AXQA 3HF5A 5HVFA 2GJ2A 2HS0A 5HBMB 3D4UA 3HO1A 4ZOSA 5ITHA 3SI2A 3M8RA 2C3OA 4B5PB 3SV4A 2H5JB 1YLXA 3HSGA 4EBDA 1TV6A 4K5RA 2O01C 1K47A 2NYHA 3ZZ0A 3UD5A 4CI0B 2YNCA 2C3UA 2P6GA 4DUTA 3PDNA 2J0QD 3DGVA 3UNYA 5FLXY 3VATA 1T02A 3OD2A 2EUIA 4DV0J 2J8MA 4OV6A 3NH5A 5FD1A 2KHDA 2NSMA 1RABB 2I1RA 2Y0MA 1GH8A 2LKZA 2HVIA 5J2PB 5HXDA 2UXDF 3QJJA 2G2ZA 3PEHA 4ECZA 2WONB 3UPFA 3OTEA 4G1IA 4C7QA 2PRQA 2J76E 3VZHA 4U67Q 4RWWA 2ZFHA 4OHZA 1RI7A 1LWXA 4LR7A 4CQ1A 4EZ9A 3KMSA 1LWFA 4X65J 4XPEA 1CJWA 2W8KA 5HMXA 4M8LA 3MFHA 5D78A 4ECVA 3HPOA 3ZJ0A 2U1AA 2M7SA 2DH7A 1WELA 1UW4A 5AG6A 5DG8A 2E5LJ 2HRUA 4V1Ak 4LFCF 5JVGQ 2YQ1A 5DO2A 2G0JA 2ZOFA 3WC0A 2B4UA 3RBDA 1KUXA 4ID5B 2V2QA 1T9TA 4MCQA 1IYLA 2ASLA 4QR0A 3ZTOA 2XMUA 3N28A 3NA6A 4QR1A 5H9EJ 1SBRA 1Z8LA 2DEAA 4KOWA 2PVVA 3G2XA 2NPFA 1Y5IB 3M9MB 2VQEJ 1E6YA 3NWGA 2LQBA 2FJEB 1N34F 2HK3A 3CC7S 1HNVA 2FVRA 4A8KA 3LACA 2F8EX 3KK3A 1Q5VA 1H2VZ 2XY6A 3AJ1A 1L3TA 3LOUA 1HDUA 4KZTA 3A3NB 4NZ7A 2MQMA 4ED1A 2LXUA 1NJWA 1U2FA 3RRGA 4K59A 3AH6A 1X0PA 1NKEA 2G3AA 4DPYA 1JJCB 2HVZA 1ZS6A 3BBFA 4FNIA 3MCNA 1YJRA 1IBMF 1UPMB 3UO0A 1JQGA 2HHSA 1ZZFA 4LSNA 3EVMA 1HQEA 3Q8QB 4Y0FA 1MROB 4IUSA 3DMJA 1T95A 2RRAA 2QG9B 4LUAA 3TOAA 5C25B 4K2JA 2MQQA 4A8QA 3W91A 2G4BA 4WIQA 1HPZB 3W9IA 1Z4UA 1FNMA 4LRBA 1S1VA 4J9PA 4W4MA 1H6KX 1VBZA 1KBRA 1OYDA 1IQZA 3TOBA 1HNZJ 4J9LA 2YY3A 3DRPA 3SQGB 2GO8A 2Q4YA 5IT9U 3NS6A 4CCHA 2JOQA 2MMYA 1JLQB 2NZCA 4JI8J 1SH2A 4KFBA 3AHPA 2ZC3A 3R95A 5GAEI 1FI4A 3RYLA 3KHGA 4KVOE 1NPRA 1UKUA 1WSVA 4GC6A 3I0RA 3MECA 4F4AA 3RYOA 3RO0A 1S60A 4DPUA 4EGLA 2HUZA 2QMUB 2IDLA 4X84A 4DR7J 2UVVA 1LOUA 1VR6A 2GQCA 3T19A 3AXMA 4FXWA 2FVGA 3BKFA 4CM0A 3CPWR 2Z2ZA 4DR6F 1NMEB 1U02A 1KFSA 3SCJE 5HROB 2PI5A 2I5JA 5H9FK 3LP2B 2ZHBA 1FTRA 1H98A 2PN6A 3FZBA 2PMHA 2VG7A 4ZVQB 3B8GA 4F0HA 2VIHA 4L72B 2NYQA 2UUBJ 4FF1A 4DR3F 1LANA 2IYIA 2J9CA 4A39A 2E66A 2MY8A 1PJ7A 2FIUA 4OJ1A 2DCUB 1WKKA 2F9JA 1KHWA 4OI2A 4JI7J 4EK2A 3C8YA 1OSCA 4QWCA 2XGQA 4F4WA 2RQCA 3QIPB 4FAIA 2ZHOA 2EVZA 2QE5A 3CJSA 1IR0A 2C6CA 1IKWB 5KFRA 3PR5B 3KLIB 3TANA 2DNYA 4U8VA 4N77A 2H5IB 3K5LA 3NRBA 4DI6A 4DL0C 2AV5A 2B8PA 4XNHC 3OL8A 3Q89A 2DJWA 2DY1A 1S48A 2ZC4A 2LMIA 1B0VA 4WKRA 1AUDA 1X9MA 5CD4H 4QB9A 2J7KA 2BEIA 3HUVA 1HNWF 4TLQA 2DPSA 1X4AA 5EX3A 3BREA 3G3SA 1RXOB 4K50A 4UCMA 4RX6A 3J80Y 2YNCC 1BQMB 2ZJQQ 3KK2B 4IRCA 4DUYJ 4X5KA 4X62J 3KQZA 4FDFA 4Z37A 3D4JA 2CZ4A 3ET6B 1BD6A 1PC5A 1CQNA 2Q66A 3PYEA 2DH9A 1KUVA 3Q23A 1YLOA 1SJFA 3OT9A 2FB0A 1SC6A 3R1HA 5KG3A 4Z65A 4F25A 4MBUA 1YX2A 3GFYA 2C6PA 4DHVA 1TF8A 3MR7A 1YW4A 3BI1A 4V19J 3KHRA 2HZAA 2K7JA 2Z57B 5SZTA 1GTHA 4CH1A 2MPUA 2Y1RI 1I21A 3QLHB 1GHEA 3D1OA 3P5TL 4P7TA 3DOLB 3CXQA 2JDJA 1GX6A 1UAWA 4DV6F 3B4MA 2N4CA 2ZD1B 2R7SA 2R2SA 3SYZA 1T03B 1N6QB 5F49A 2QGFB 2Z3PA 4PWDB 2BSWA 2ZXVA 1TL1A 1U1LA 1XMTA 4CLFA 2YWGA 3A8KA 3W7BA 2HWHA 1YQEA 2AGPA 4V19X 3TAMB 4Q5VA 1RWNB 3D9BA 2BMBA 4RZRA 4H4OA 3NBPB 1MU2A 1C1CA 3QT6A 1Y00A 3FZ2A 5I3QA 2EWBA 1BQMA 1RUSA 4OYPA 2OB0A 3F0NA 4IOCQ 2QSWA 2HBRB 5LMUF 2QL9B 4DBQA 3H98A 2DPTA 2E5HA 3D7FA 5E2QA 4DS5A 3TAPA 3D2MA 4WP3A 2GGPA 3OL6A 1NNDA 1K9MT 2MQLA 1RTQA 3NY0A 3MM5A 3GCWP 1BQNB 4CO3A 4B9NA 3AQPA 1RT3B 2GHPA 4NA2A 2AKWB 4CYUB 3G8WA 2HHPA 1UA0A 1NK7A 4DFMA 3K5OA 1TUWA 3KNGA 2AFOA 7CPAA 2XC9A 2E9TA 3U27A 4TYAA 1T7PA 2MQOA 1U26A 3DRRB 3CJKB 2DGQA 4WK1A 3U1MA 3CJTA 4QIWD 2YNHB 3W2VB 4R0EA 4ECTA 5T41A 2POKA 3QGIA 1HNXJ 2QFJA 1ZG8A 2OPPA 2YNFA 4QIVA 3CIMA 1LWEA 4MTPA 3DHWC 1FKOB 2FTRA 4B3SJ 1S7NA 1VYAA 1CG2A 1YMEA 1KP6A 2Q04A 2WTFA 3W5XA 4QBJA 1N54B 2FJAB 1Y7PA 2DR6A 4URSA 5F8JA 1SC4B 1VQ5S 1Z8TA 3KFWX 1L3SA 3DRXA 4WZQA 2NXJA 4I6YA 4XPDB 1WDTA 3FXTA 1VQNS 3OFGA 4EO6A 3OW2R 3DKDA 2GW8A 3E01B 3FBBA 2YNDA 2BEFA 1RAEB 1PYSB 5FDLB 4ZLJA 3KASA 2NZ4A 1TKTB 1TKZB 1DTTA 3EZUA 2LP4A 1N32F 3K9UA 2M9KA 4LRCA 2WUUA 3QRRA 2NXCA 3IS9A 3A9LA 1JLBB 5KFXA 3IP0A 1A7GE 3SZ2A 2AD9A 3MEDA 4OC1A 5KT5A 2IVFB 2F4FA 4W90B 1JLEB 3FH4A 4C0HA 1HI8A 3E8OA 4L73A 1IOIA 1IWAA 4DL2A 4AXJA 1WACA 4MK8A 1UVJA 3MR6A 2EK6A 3IAS9 4DPWA 3RB3A 3D66A 4LRDA 4KORA 3T1YF 1CJKA 2DO0A 1ROFA 1TAUA 2R8HA 3KG1A 4AL7A 1MWQA 2HHHJ 2QSFA 5IV4A 3DLGA 4KV8A 3A3PB 2AT1B 4JI3F 4DPOA 3EZ5A 3M9NB 2MLZA 5J2NA 2G0CA 4F0MA 4F8RA 2VJUA 4WFNQ 3H5YA 3DFEA 3UCUP 2HLTA 2KT3A 2PA8D 2H4WB 3W6XA 2YQ0A 3TRGA 3LA0A 4UA3A 2ZH4A 2ZUGA 2ZZTA 1S7FA 1ELLP 1AFJA 1P1LA 4ZY1A 5D0GA 4C68A 3PEIA 4ZVUB 1YRXA 1WI6A 1NJYA 3D3SA 2CZ9A 4FNHA 2IRUA 2GMLA 1V5VA 2IM3A 4F50A 1LV5A 4FN5A 1NSLA 4RUAA 3KHXA 2HQIA 2W2QP 4DR2J 1TMJA 4IG0B 3FVLA 2ZBCA 4AD6A 2HRTA 5ETPA 1X4EA 2FC9A 3P8BB 4NASA 4GS4A 4R3KA 1IR2A 4MKAA 2BW2A 3RR7A 3IU1A 2OAUA 3ITHA 1Q16B 4LF7J 4NGQA 4DUKA 5GADU 1BMQB 4J9QA 2CNLB 1W2BR 3DRPB 2L9WA 4I4BA 4GVBB 2DNNA 3SCIE 3C6UA 1FKPA 1VHOA 1UWBA 1QQ9A 2ZDOA 3AD8C 1U1RA 1N33J 4YR3A 5EBVA 3TWZA 2Q51A 2KT5A 2Q6CA 1JLAA 4USIA 2XMWA 2VFUA 1VJQA 3CW2C 2ZEMA 5IT4A 3RZAA 1FJ7A 5IC6B 2OMLA 4X65F 1FJEB 1IJEB 3FUYA 2HQYA 4K4SA 4X4NA 5AG4A 2W7PA 1YJUA 3D6MB 1HHQA 4BDPA 3IA0A 2LVWA 3TO8A 2HFZA 2QJ3A 3CJ3A 2JEVA 2DGWA 1F6TA 4P4EA 1SI9A 2YGWA 1RLCL 4EEYA 2K7KA 1Y4ZB 3CXSA 2OUGA 1NAQA 1YVFA 3MMCB 3EUNA 5JM6A 3AY0A 2PIZA 1U2CA 3TJ9A 1Q8KA 2YWEA 1MW7A 5HSPA 3T5JA 2E44A 3I5AA 3B54A 1YZ6A 4NLGA 1BC6A 3J7AN 4CLZA 4Y00A 3M2UA 4YP3A 4KBIA 3WZ0A 2DEIA 4M95A 1M4GA 3HHKA 1VHEA 4ZCIA 2WK4A 3ZZTA 2FVQA 3DDKA 4H4MA 2GA7A 2WB1D 2P5VA 4C8LA 1RP5A 2OKQA 3GFZA 4MCPA 1DBDA 3SCKE 4DOZA 2CJ9A 5LYDA 2CQDA 3B82A 1NO8A 1VS3A 3N6LA 1YJ7A 3D68A 1B3TA 4FD5A 2Q6BA 2UUAJ 3TO7A 3TFYA 1S12A 1IIDA 1VDHA 4LF6F 4KVXA 3PGPA 2ADBA 4ENOA 2GMHA 3CJ0A 1U09A 3DLHA 1ZM2A 3PIOQ 4LSNB 4C6AA 3H8GA 1XRYA 3MUVP 3THTA 1Y0RA 4ZPWR 4LF8F 1UWAA 3C46A 4K0KJ 2XSJB 4ONUA 3GJRB 1MJBA 3MM8B 3PCOB 3UDLA 2PJ8A 2SXLA 2DNPA 1Q2YA 2HBZB 3PRVA 4NCGB 2VQEF 3EE3A 1D8ZA 1Q7YT 2VU5A 3M6VA 2UXCF 2XY5A 4O3SA 5KFUA 1BXNA 4ZX9A 4B5OA 3MOJB 1D9DA 3BJ7A 4HVZA 4LBHA 3EGZA 1RWMB 4CT9A 4ZKAA 2BQ3A 2ZE2B 5J1EA 2Z8QA 1KTVA 2ASJA 2QA4G 2XMMA 3S8SA 1KRPA 2FDNA 1CLFA 4ZP6A 1RK8A 4M94A 3D7HA 1W25A 1I1GA 1M5OC 2CA9A 2P2CB 1Q86T 1VRTB 3UNGC 1Z8WA 3POTA 1X60A 1RT5B 2VKZG 1OPIA 1LAMA 2V8GA 3PB7X 3W5YA 2AFWA 3MMCA 1H2TZ 4OYOA 5KAKA 4Z2XA 3SI1A 4JI4F 2GFFA 2UUWA 2O28A 2O67A 4R57A 4A48A 3BDEA 4JI5J 2OPSB 3T1HJ 2CUYA 5AXLA 2IFXA 2B4DB 4NLYA 3DR6A 3AQOA 1CULB 3TQEA 4A46A 2DB1A 4ZBGA 3M6WA 3C19A 3V6DA 2XHCA 1SKWA 1NJXA 5CZVA 4CH7A 1WF1A 4PG8A 2ZZNA 4YOEA 1YDLA 4UOCA 3MTKA 3DM2A 2OPQB 5G4DA 2D4OA 2QYCA 1JNZB 4DR4F 2HWIA 4JB8B 2RB7A 4DSEA 3VGTA 2B3UA 3J7Z5 1ZPWX 2KG0A 1I12A 4IH5A 2H51B 3GJQB 5ELYA 3QWUA 4RPFA 1S9GA 2LA4A 1PC4A 2YVSA 2P6SA 1F0XA 4UIAA 3DGPA 3W9JA 3H8EA 2HGNA 5M2RA 3HD1A 4NI2A 4IOAQ 2OFGX 4EO8A 2HHUA 2N7CA 4ZPDA 3H2UB 2VHGA 2VG5B 5C2CA 1QVGR 1V6HA 4HH1A 2IAJA 2J8NA 5ETVA 2R8GA 4KYZA 1PJ5A 1WC1A 1PU9A 1UFHA 3Q8VA 2GIQA 4MFBB 3R3TA 3DLKB 3R5JB 4DN9A 5D3GA 3OR2B 1U6FA 1S6OA 4YWYA 2M0GB 4HTJA 2FVSA 1U6MA 1EHWA 4IG0A 3M30B 2Z3OA 1M5PC 1TKZA 2BQUA 2LEPA 3CJ2A 4F67A 4DV5F 2LXIA 1VIOA 2R98A 2R2UA 4M5DA 1GEHA 3FB3A 2MKYA 2QLBB 4QYZJ 1HI1A 2C2KB 4KLWA 2ZD1A 3CXCR 4QWBA 3ISZA 3TC8A 3J81j 1SC3B 5G1ZA 1WEXA 3DLJA 3G96A 4KHPF 3ZZYA 1M5KC 4P4BA 4DFKA 4JUZA 2B8QA 2OPSA 4CGLA 3CO0P 4ZN3A 1X4GA 1D1UA 3NBPA 3ADAC 2PJ4A 1IKVB 4YUDA 2D9OA 3IWGA 1M1HA 2RUSA 1U25A 2I00A 3FK4A 1NRKA 2YKNA 4L6V3 5CNPA 4Y2AA 1U24A 1HQUA 3T9NA 4ORFA 5KG0A 2J6UA 2IJRA 2KXNB 3POTB 1GMWD 1Y7EA 4NX9A 4MH8A 4USMA 1Q2CA 2Z4PA 4OV1A 1XE4A 4LF5J 4JV2A 3SJFA 4JV0A 4YY3J 3K9TA 1RTJB 3HHLB 1UZHA 2BJDA 1RSCA 4OYXA 2ARHA 4HPSA 1S4EA 3OLAA 3SJXA 3I4HX 2PE8A 2V2VA 1JIHA 2PR1A 2L48A 3PACA 4NXNJ 4P4DA 3WR7A 3M2VA 3RW7A 3TR5A 1M1DA 2CJAA 3BGRA 4PV6A 4GKKF 1HFEL 2MYFA 4M6GA 5DJBA 2WVEA 4AUKA 3MURP 1YBTA 3GIMA 4HT7A 2GU2A 1IBKF 2YKAA 1LK7A 1RBAA 5F47A 1XC9A 1HI0P 1FRXA 2ILYA 3F73A 5KFFA 4HH0A 1UJ6A 4GVLA 1UA1A 3ZZIA 1HWUA 4IO1A 2I0XA 4ZCMA 2YNIB 1TL7B 1ARLA 1EAYC 3MAHA 4CWBA 3NS5A 3EZOA 5A8RA 2XLJA 4NLDA 1IM6A 1D8YA 4AFFA 3G71S 2GIFA 1JLCA 2XHWA 1QY7A 4QYRA 3HVRA 2A2DA 4PG4A 4FBTA 2AJFE 2QN6B 4FVMA 1N48A 1VLOA 3LAMA 1TAQA 4F3MA 2PCUA 5AJ3J 5EWFA 1R0BG 1HMVB 2W25A 2OEMA 5AJ3F 3RAQA 2CPZA 4CDIA 3MMAB 1B99A 1RGVA 4R5PB 2H65B 1AZSA 3QAEA 2YWHA 1CBXA 4MFPA 3D28A 3DRYA 3N5FA 3QIPA 4WFZA 3IWNC 1R0CB 1TL1B 4YDXA 2FVPA 1IBLF 2IVYA 4TNOA 1B6BA 4JI0J 4IG3A 3VVUA 3OPKA 1UMJA 3SEOA 3JSRA 5C24A 1HA1A 3VVTA 2DRDA 1CS4A 5M2PA 3B3TA 4USUA 4JD6A 2IBOA 2XI3A 4LQ6A 3LPYA 4K4ZA 3T90A 2MHNA 2VFVA 3GIRA 1NKBA 3GG0A 4DUZF 2DGUA 3OVSA 4ZIVA 3BEGB 2P6TA 1I5OB 2HSEB 3M1VA 5LMNJ 1OYEA 3M9OB 3G82A 4FYYB 1KLMA 1ZBTA 4ZK7M 2CQGA 1FRLA 3PNIA 1VCTA 3DLLQ 1YJNS 2CNNB 1WC0A 4C8KA 5G20A 5AE2A 2RVJA 4C8YA 4DQQA 1TL3A 3S6GA 5I42B 4OZJA 4LX9A 1G7CB 4KGMA 3SIPB 1L0CA 1J2VA 3I32A 1NCLA 1T9WA 2O53A 1S7IA 2VD3A 2XB2D 1MSWD 4ES2A 4EU0A 3V8IA 1WWZA 4KH1B 5FIIA 2KRRA 1GXTA 3EYZA 4XPCA 3EDQB 3UFCX 2WZNA 1Y7RA 4IH6A 4A38A 1BOBA 1S9GB 3M2RB 3JVNA 1ZM4A 2HIQA 4L89A 1FKPB 2WVFA 3GIJA 4KO0A 2Q7BA 1RU1A 3EO4A 2V4QA 3NNCA 1P1TA 3UN5A 2MGZA 3A13A 1C0TB 3AAWB 1Y10A 1NDPA 3LPEA 3OXLA 2KL8A 2RKIA 2F3JA 3DLBA 4OMEA 5I3PA 2Y1JA 3L3CA 3FEEA 2KHCA 2CAJA 1SV5A 3MFIA 3BO2A 3PW5A 2ROGA 4ECRA 4B13A 5GMEA 4DU7A 3HMJG 4R7MA 5L1JA 2HFSA 3FF3A 4NSQA 5KFTA 4DV7F 3HHEA 2UXDJ 4NXYA 4PR6A 1XERA 4GKJF 1PGZA 4ZVOB 4PQAA 3O8WA 1KKHA 1K44A 2HVDA 4B10A 1PAUB 2CPYA 3ILOA 4DQRA 3NLCA 4CAWA 1DLOB 4P73A 2QA4S 3BSNA 4DPTA 4N56A 3LALA 3FCWA 4AXVA 2P9EA 3RBUA 2Q1LA 4Y2KA 2RU3A 3KLEA 5HP1B 2G0IA 5KFOA 3MUMP 4JBCA 1ZLHA 5H86A 4FWUA 1TKJA 3ITHB 4CP5A 4N76A 1MJ9A 1SCJB 2FJXA 4HKQA 2CJXB 2XCPA 3TZYA 4L74A 2CPFA 2IQ6A 1XNRF 1AUSL 4LJMA 4PSXA 5A8WB 4GRSA 4UF4A 2Q43A 3DHXA 1UVLA 4DV6J 2KU7A 1RJJA 4NGPA 2OLWA 3GYGA 3N6NA 3DRSA 5E3AA 2VPZB 1HW8A 3F5BA 3TUJC 4P2XA 5KT4A 2XO6A 5L38A 3TX0A 3NWRA 2K3IA 5J1QA 5D6GA 2RIJA 5U47A 1YGHA 3IR5B 2HEKA 2DD8S 5I3UB 2K3KA 2V69A 3JXOA