3MN8A

Structure of drosophila melanogaster carboxypeptidase d isoform 1b short
Total Genus 121
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
121
sequence length
391
structure length
383
Chain Sequence
KEDESFLQQPHYASQEQLEDLFAGLEKAYPNQAKVHFLGRSLEGRNLLALQISRNTRSRNLLTPPVKYIANMHGDETVGRQLLVYMAQYLLGNHERISDLGQLVNSTDIYLVPTMNPDGYALSQEGNCESLPNYVGRGNAANIDLNRDFPDRLEAQSRQPETAALVNWIVSKPFVLSANFHGGAVVASYPYDNSLAHNECCEESLTPDDRVFKQLAHTYSDNHPIMRKGNNCNDSFSGGITNGAHWYELSGGMQDFNYAFSNCFELTIELSCCKYPAASTLPQEWQRNKASLLQLLRQAHIGIKGLVTDASGFPIADANVYVAGLEEKPMRTSKRGEYWRLLTPGLYSVHASAFGYQTSAPQQVRVTNDNQEALRLDFKLAPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure-Function Analysis of the Short Splicing Variant Carboxypeptidase Encoded by Drosophila melanogaster silver.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Hydrolase
molecule keywords LP15968p
total genus 121
structure length 383
sequence length 391
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2010-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00246 Peptidase_M14 Zinc carboxypeptidase
A PF13620 CarboxypepD_reg Carboxypeptidase regulatory-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1120 Mainly Beta Sandwich Immunoglobulin-like Carboxypeptidase-like, regulatory domain 3mn8A02
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 3mn8A01
1Y7EA 1PYTB 2C6PA 2RFHA 7CPAA 3PB8X 3IFEA 1OBRA 4MHZA 5LYIA 4FAIA 2AFMA 3I1UA 3BXMA 4PQAA 4NGQA 2XEFA 4ZYQA 3IJ3A 3S9LA 2Q51A 1FT7A 1HDUA 4W9YA 4OKOA 3HLPA 4MHPA 5AQ0A 4MMOA 4MCSA 4FL4C 3MRUA 4P45A 2ZOGA 4OC2A 3PBBA 2G9DA 3D7DA 4RUHA 4Q7AA 1VGYA 4FUUA 4FBEA 4CPAA 1NSAA 4OC3A 2PJ4A 1QQ9A 2PVWA 3WC5A 2GLJA 4MCPA 2B59B 4DJLA 3SJGA 1BLLE 1LAPA 2CIJA 3FEEA 2AFSA 4YWYA 3SJXA 4ZY1A 2QJ8A 4JYWA 4F9VA 1HDQA 2O53A 3VARA 3S9NA 1R43A 2FVGA 3D4UA 1BAVA 4R6TA 2VL1A 3VATA 6CPAA 3HUVA 5J1QA 3V7ZA 4AXVA 4MCQA 1TKJA 3FH4A 4OC4A 3G3LA 2ZENA 3WC6A 3NJVA 3KR5A 1UWYA 4YU9A 1F57A 1AYEA 2XEIA 4PXBA 1TXRA 2ZEDA 5F09A 3HN5A 2F7VA 3FVLA 1BPMA 3H8GA 1Y0RA 3KASA 5ELYA 2PJ2A 5LYLA 3GB0A 2PJ3A 1Q7LA 3KQXA 3PEIA 3QNVA 2PCUA 4ZY2A 3MN8A 3NA6A 3D68A 1XRYA 3D67A 2OOTA 3KZWA 5K8OA 3D7FA 2Q4ZA 2AFOA 1M4LA 4OC0A 2ZEEA 5K8NA 3RZAA 5HXDA 3KHXA 3B3SA 3B3VA 1YSJA 5JH9A 3E8VA 1ZG7A 2JBJA 3KCPA 1FNOA 4A39A 1EE3P 1LFWA 1VIXA 4WI0B 1H8LA 4R8FA 2CTCA 2HB6A 4BD9A 5THWA 5D29A 5I4MA 3IC1A 4NJQA 2XEJA 4NGMA 5DS0A 1ELLP 4OP4A 1CP6A 1YLOA 2PIYA 4P4BA 4NGNA 2C6GA 3H8EA 4R76A 3SI2A 1JQGA 3NJXA 3WC7A 2BCOA 2PJAA 5CBMA 4UEZA 3L2NA 5JM6A 3CT9A 3D66A 1F2OA 4PPZA 2V8GA 2IJZA 5LRJA 5LRKA 3LMSA 2ZEOA 3BI1A 2ZEMA 2ZEPA 5CPAA 1YMEA 3IO1A 3CPAA 1CX8A 1CPSA 4P4FA 2EWBA 4P4DA 4IAVA 4P4IA 2EK8A 1F2PA 2PJBA 3CDXA 4UIAA 3T8WA 1ZG9A 4ZX9A 1Z2LA 1Z8LA 4NGPA 2GLFA 2V8HA 3BHXA 4OIDA 4A37A 3B3CA 3PRTA 4UEEA 3H8FA 1VHOA 1VHEA 1XFOA 3KR4A 1LAMA 3PBEA 3WABA 3FJUA 2NSMA 2ANPA 1R3NA 3PFEA 3FF3A 2BO9A 2J9AA 4KSIA 4JZ0A 4MXUA 2POKA 3ISZA 5K39B 4EIUA 5K8PA 4OIWA 5IB9A 5LYDA 1XMBA 2GREA 3TX8A 1ZLHA 1XJOA 2GU2A 4PXEA 1NKGA 4OC1A 2EK9A 3PB4X 3SI0A 2JEWA 3RBUA 5HVGA 2PJ7A 1AMPA 2PJ1A 4DYOA 4F9UA 3TC8A 5G5DB 2ZEFA 1LCPA 1GYTA 2V8VA 3FECA 2V77A 1QMUA 3KI9A 4X3RA 3FX6A 3RAMA 4P6YA 1LANA 1ARLA 5D8NA 2I3CA 3ISXA 3GUXA 1Z5RA 4WWVA 4P4JA 3NH4A 4P44A 2PJCA 5LRGA 1TF8A 1YW4A 3NFZA 2ABZA 3JRUA 2C1CA 2ZEHA 1CG2A 2RB7A 3D7GA 3PB6X 3PFOA 2OR4A 2AFUA 2PJ0A 4NFRA 3KHZA 3WT4A 5JGFA 3B3WA 4PXCA 4H2KA 4X8IA 2IQ6A 2CF4A 4UF4A 1XBUA 2QVPA 4OMEA 2IMOA 3PB9X 4ZY0A 4A94A 2F8HA 1KWMA 4UIBA 3K9TA 5HVFA 2WZNA 2ZOFA 3B35A 4FWUA 3NH5A 1IY7A 2BOAA 1RTQA 1IGBA 1BPNA 2CTBA 4IYKA 2JBKA 2PJ9A 4OC5A 4ZX8A 3KGQA 4TWEA 2HC9A 4WJBA 2C6CA 4A38A 4EFDA 8CPAA 2PRQA 3SJEA 2O4HA 4YOKA 3K2KA 4GM5A 4PXDA 4NGTA 4ZI6A 5HVHA 1DTDA 4X2TA 3V38A 4IK2A 3KQZA 1ARMA 1PCAA 3NH8A 1ELMP 3IEHA 3D7HA 4U3SB 1ZLIA 4P4EA 2PJ8A 1ZG8A 2PJ6A 2PJ5A 2XHNA 1CBXA 1HEEA 3SI1A 1TF9A 1DE4C 1YW6A 2Q43A 3B3TA 4Z65A 2QYVA 2PE3A 4MRIA 1CP7A 3N5FA 3B7IA 1Y0YA 4MHNA 3IIBA 4NGSA 5LYFA 1TKHA 4F8ZA 4IHMA 5K8MA 2AFWA 2V8DA 4ONWA 4EMEA 2NYQA 2DEAA 3IWWA 4R7MA 3GLJA 4UEFA 3BI0A 3SJFA 2WYRA 4G1PA 2ZELA 3B2YA 2ZEGA 4NJRA 2XEGA 3KL9A 4DUKA 3CPXA 2PVVA 3LWUA 4TNUA 3FEDA 4O23A 4NGRA 4P10A 3DLJA 1LOKA 2AFZA 4MCRA 3PB7X 3S9MA 4FXTA 4MHYA 3DGVA 1TKFA 1CPXA 4LQGA 4EWTA 3VH9A 4B6ZA 3FMCA 4K3NA 2PIZA 2AFXA
chains in the Genus database with same CATH superfamily
2WQ8A 4Y5YC 4U3CA 2F2HA 2H5UA 4B0MM 7PAZA 2F1AA 2LU7A 4KOUA 4LVNB 2WVVB 1N26A 2OXHB 3NEEA 2Q10A 3NQIA 1TQSA 3V0FA 4X4ME 1WZAA 4YPGA 1EEYB 1FC2D 4ABWA 1VCAA 2IPTH 3I1UA 2JXMB 5I18L 3BXMA 4ONFL 4N0FA 3QEHB 1Y6NR 2J73A 4H5SA 4EN3C 4FQQA 4ZFGH 4P59H 4YSRA 2WV3A 5EZPA 2NNAA 2FL5A 4KDTC 1YC7A 1JI1A 1JXKA 3Q6FB 3RGHA 3Q2CA 5SWZD 3EO0A 4M7JL 4OZHB 4U9ZA 4G3YH 5JQHC 1YG9A 2B1HL 4I3RH 3BUBA 3MBEA 3ARWA 3Q9QA 5MERA 3MLWL 3DOHA 5BS0B 1CDHA 5FV1L 4OI9A 5B7EA 2A6IA 1FNFA 4ZNEA 3QXDB 2BP3A 1A7PL 2WQSA 3ZO9A 4B7LA 4FBEA 3OKLA 4KVCL 1AXTL 4LPXA 3MGOA 5ENWB 5ACLA 3D3VA 2Q5BA 1RJCA 1JD9A 2Q2EB 3CFKA 1YRKA 1BM3L 5F3BB 4RNRB 4A2LA 5ES4B 1LEIB 2KKQA 5C7XL 1U58A 1IO4C 1F3DH 3KCWA 2WY3B 5EIVA 4Y4KB 3ZJAA 1NGXB 4ZX4A 1EJ6A 4IQHA 5AG4A 5DGRA 3T4YB 3EUDA 1HL5A 2CA3A 1FAIL 5EF1A 4M61B 2VQ4A 4HS3B 2H6PA 5EU3A 2ZG3A 3A6OA 3CC1A 4KRNA 3GTNA 3IVKA 4WTZA 5F7MC 4GAFB 4LLVB 1AMYA 1EO8L 3E80A 1FCCA 1K8DA 2JJVA 3FSVA 5IFAL 4HALA 5H2BB 3CG8A 5B21A 4GXUM 5DC0A 4KOXA 1VJSA 5IVXA 4Z3JA 1GZQA 3O0LA 1DVFA 4GBXA 4FQ2H 3PNRB 3UTTB 3HN3A 4GBXD 4L5FH 1D9KD 3NIFB 1ZXKA 3H2PA 3HNTL 5GGUB 2IALB 5DS1A 2QQLL 5E2WL 1S7SA 5BMFH 4AC4A 1N6QH 4I3SH 4D7BA 3HKZA 1QFWI 4YS4A 5IROA 3LKPA 4PV6A 2DBLH 1VENA 5ENWA 5CJXA 4X9HA 2XPZA 3CDGA 5CD5C 2Z7ZA 2ZUYA 3AQZA 1JERA 5D70H 5HYEA 1QSMA 4RAVB 4LFHD 4NFDA 1IYLA 4R4FL 5ELYA 2ZZUT 7TAAA 3O11A 1B87A 5GGVH 1SN5A 5EOCH 1EXHA 1CYXA 2VUKA 3X3GL 5LN4A 1YMHA 2REEA 1CT8B 1V0CA 4OBSA 4Y19E 3BGFC 4GMTH 4I88A 4J28A 5CZVH 2B9BA 3UZQA 4AVAA 3K72B 2FBJL 2W91A 2X2HA 5KS9A 2R1WA 4WU5B 2CJTA 3R96A 2WXJA 4XH2A 1QSRA 1FPTH 3TA3D 3VI4F 3D7FA 4S2SB 2GW5A 2BNQB 5ESAA 1OAUH 1BAFL 1IC4H 3KPSD 3TVMB 2ID5A 3CSYB 3S5ZA 2Z0BA 4NSQA 4W9HC 2MKWA 4G2AA 5AW9B 1LE9B 2E46A 4NUJA 1U8LA 1OAZH 4M6NH 3KLAA 4ZOCA 2QEJA 4K7PX 4S1RL 3WTUA 4PU2A 3HW7A 1CTOA 1ZA6A 3CXHJ 4PJ5D 1TXKA 4LHUA 1DE4B 4R8FA 1WS8A 1P2CB 4D0DA 2ATPA 3PWNA 5J9PA 5LCVA 1DBJH 5D29A 4U4IA 4C7HA 5DXWA 5HYJA 5D71L 2AQSA 4MI4A 3M88A 4UFVA 2D4PA 2AXFA 1CFTB 3RG1C 3KR3L 4AJVA 1YYMH 2DWEA 1QFOA 3RL1A 3S96B 3IJ7A 4KI5D 5JW4Q 4P4BA 1CGYA 1F11A 2VW6A 1SFDA 5H35B 4H26B 3K2MC 4JREB 1F56A 1TQVA 4E9LA 5AOKA 3T2PA 3VG0L 2EDBA 3W9DA 3H55A 3I84A 3V0WH 2IJ0C 4UCPA 3R9GA 2Q3ZA 5CBMA 4RESB 2VR7A 5JM6A 4Z7WE 3TWCH 4GQZA 2JSFA 3MOQA 2DYRB 4J8RA 3ULVF 5I75B 4OCNC 3FXIC 1JZFA 4U4BA 4MAUH 1KCVL 3CHOA 4AGQA 2BM3A 3IDMA 2A77L 3DPBA 2IJZA 1AP2A 1J9SA 1U6AL 4H8UA 5LNGA 4OI8A 1QX1A 5EN2B 3VFPB 1F1GA 3QJUB 5ECGA 5H86A 3HLAB 3K3QA 4N2HA 1Y7VA 4H2AA 1MAKA 1ORQB 2VMJA 3NPSC 2Y72A 3L54A 3SCMD 4POZD 4OZIB 3K0YA 2G2RA 4GEJA 4Y4KA 4CVXB 1ANUA 1BWMA 5GGQL 4NN5B 1LYQA 1ZA6B 1V10A 3WAJA 1T0MB 5LGKA 4I49A 4U05A 3UYRL 3BPOB 3DUUA 2ZKWA 5IR1A 5IY5B 1SJEB 4PJ5E 1NMTA 3O6FA 3H7BA 4NO5A 1B2YA 4N5EC 3J8F7 5B8CA 3RFZC 1QO3B 3QC5X 3S34L 3RPBA 2E3VA 2XV3A 4FLOA 1CFNA 5C1MB 1HSBA 1IMHC 3NZHL 4XZUA 2B4CL 3P9MA 1FVCA 1Y9WA 1CGUA 4YDJA 2V4LA 2ZXGA 3BUYA 1KJ3H 3RU8L 3OJMB 1T7WA 3QAYA 1SQMA 4UQDA 1OF0A 4QRQB 2FEDC 3QS3A 4LPWA 5C0AA 3DTDA 3UYPA 5I1DA 1EVTC 2X4OB 4ZAKA 2BRRL 1HVXA 1B0RB 4PUBH 4XXWA 4H20H 1T89C 1V7MH 3UTSB 3B43A 3MLVL 3RZCC 2VCOA 2E8YA 1JZ4A 4YL4A 1OAKH 3OPUA 1KC5H 1DVZA 3BP6B 2JEVA 1RJYA 3LYRA 1N8OE 1RFDH 4LLYB 5CINH 3S5LA 5JYMA 4TNGA 3PU7A 1QUNA 5HTSA 2PF6A 1OZTG 3IE9A 5T1KA 4U6YB 4HIIB 5AW0B 5HYSB 5J8OA 2YD4A 2FJFB 1YQEA 2NUPB 4M9OA 2WIIA 3W6SA 2BNQE 3QAZB 4LSQL 2HT3D 2OMYA 1USQA 5KVDH 3JTTB 1CXIA 3DURB 3VD1A 2ZG1A 4OF8A 3SCMB 4L8AA 1BQRA 2YEVB 4NDMA 4YDVA 3DSFH 3I02A 5CFAA 4JRWA 2PW2B 2YKLL 5C7ZA 1AR1C 2EIZA 2VLJB 2GBUA 3S6HA 4FNQA 4X83A 4Z0XA 5H37H 1A6TA 1OAXH 2QPEB 4RMQA 4UANA 5FR3A 5H4YA 2V7HB 2DDQL 3EFOA 4AV0A 4FQHA 1R0AH 2VQYA 4O2EB 2NY2D 4UQ2B 5F7NC 4RGNE 2HJKA 3ROOB 2ABZA 2YS4A 1JNJA 4OGYH 2FIAA 3KAAA 1OE1A 4EI0A 5EOTA 1PIGA 1SRDA 1ZGLB 1ZO0A 5IMMA 1BLNA 2VBQA 4OGQC 4X7SL 3QQ9D 5E2UH 4XMPH 4DCQA 2X4TA 6TAAA 3CVHA 4A7GF 3SDXE 4YXHH 2E7BA 5C3TA 3G5VB 5JGFA 2IALA 3UJTH 3TBBA 1M44A 3PL6D 4DFHA 5IHUH 4UA3A 4G7YH 2Q7BA 2YA1A 1HHJB 1RUKL 4M1GH 2ZXCA 1XBDA 2NY4D 1HYSC 3EBAA 4O4YL 2NQ3A 3GI8L 3MRIB 5I24A 3HOGA 4PTTB 4PJAF 1GIGL 2DLGA 3VGAB 2R7EB 2QGDA 5I5IA 3WS6A 4ZY0A 2F19H 3KYOB 4L4TA 3FULA 3EJJX 5LGJA 1Y1DA 3X1GA 5CUSH 1D5ZB 4NXSA 1BQUA 1AP2B 1FHNA 3RBSA 3QIUB 2LW3A 5ANHA 3B2VH 2P5WB 2X70A 2SEBA 3ARBC 5TGBA 2EP6A 2IIJA 2FGZA 2R2HB 1DVTA 5CILH 1E3ZA 5HJ3B 2WQXA 5FGRA 4YR6A 1DDTA 3S36X 4V1DE 4LUAA 4NO3A 3KPSB 3VD9A 4KORA 3QW9A 2OZGA 2J2ZA 4Q2ZB 1UT1A 4UNTA 4UTBH 4HJ0C 3RWJA 4OFIA 3TA3B 4MFLA 3BH9A 8CPAA 3Q43A 1P7KB 4PW3A 1P84J 4YOKA 3PWLB 1IRAY 1JIBA 1N10A 1ZHLA 3UCQA 4WHYG 4LSTH 1XGUB 3ZE2E 4CN6A 5K69A 3ALPA 4ATTA 1I53A 2FBOJ 3FONB 4CYNA 3CQQA 4LLDA 4DVBA 3D25A 4K2UL 1WA1X 2Z3OA 4N87A 2PN5A 4P99A 1EEZB 1HHHB 3KQZA 1CL7L 1PCAA 3AQXA 3AVEA 5HYSG 2H8PB 3FTGB 3D7HA 1HHJA 4ALAC 3BYTA 1B0GA 2MH4A 3MV7A 3GUTB 3FFCB 3I3EA 1QVOA 2FEEI 2Q7YB 4EUPH 4DKFH 1ZLVK 2DTMH 3SY0A 4PJCA 4IGBA 1B6DA 3QUMB 5IQLA 2JTDA 2ICES 3R8BB 2GT9B 1PZ5A 1NZRA 4LLUA 4W9CC 2W38A 4MXWL 5LB1A 2FR4A 1RIVL 2HLEB 2PSWA 1SPDA 4Q6IC 1X44A 4NKIL 3RX8A 1S7UA 2D7TH 3OG4B 1RUMH 5BNXD 3DETD 3CK0L 2QV2A 4WHDA 2N56A 4YZFF 1YW6A 2OQJA 5JOPE 3SE8L 2FH8A 3MOBL 5HXMA 5ANMA 1QHQA 3KH4A 4GLRH 4GRLC 1NDMB 1QFHA 4B95C 1Y0YA 1MF2H 3I9GH 5HHPB 1NL0L 4LF3B 4QXTB 2XIIA 2R4SL 3LPGA 5ADOL 1WHOA 4LOUD 3ESMA 2DLHA 2V8DA 2DWXA 2B1AL 2DQDH 4F7MA 5AB2A 3UADA 2CK2A 1NC4A 1ZPLA 2NYQA 1UENA 4KJPC 3RDTD 4PM1A 2Z4QB 4J6RL 1E4HA 3O2DA 3SGDH 3NSFA 2VKWA 4G1PA 1X5MA 4A6YL 2NYZA 1L9PA 4KMLB 2X89D 1AGCB 2X6AA 3TZVA 3QUMH 4JPKL 2VJ0A 4X98B 4HULB 4OI7A 3KPQB 4C54A 3TX4A 2ZUXA 4MMXC 4F2ME 1PLAA 2X0VA 3U83A 4ACPA 2VJXA 4OLYH 2BMKA 4XMLL 5DJAA 2GJZA 1X5XA 2VDOL 2EO7A 3C60B 2Y0MA 2K6YA 1QW9A 2I69A 2N0MA 3DJTA 3GBLA 1CGXA 1WWCA 2EVGA 1AZZC 5TPWH 4FMFA 3NABL 2BINA 4OR1A 3BXNA 5DHYB 4KI1A 4NB7A 4L8BA 4DN4L 4NUGL 3P4NA 4ZO7A 1L0CA 1AG0A 2O5NA 3U2IA 5FUZH 1XSIA 3LXCA 3D51A 3IKCB 5FO9A 5GCNA 1KUXA 1RU9H 1GTFA 1FG2B 1I12A 4XVUC 2XZZA 4N2OA 4O5LH 5AVYB 2XG5A 3VFRB 5D2NC 1ZV5A 1WQVT 4TN9A 3S5LB 1PCSA 3AQYA 4ZFOB 4ONGL 5LYIA 4S10A 1CU4L 3EBGA 4LKXA 4HG4K 4OLXL 1E27A 5I6XB 4JNXA 5DQDL 3D33A 3VGEA 3IJSA 4XVSH 5A2JH 2QQKH 1MCLA 4L23A 5KUMA 1SHWA 5EMYA 4MHPA 3WIHA 1UHVA 2WQUA 3SE6A 4JM4H 3IMTA 1NFDB 3GPSA 2ZPKH 2YHGA 3HI5H 5T3XH 5A1AA 3UP1A 4F7TB 1EEUA 3PBBA 1UD2A 4OC2A 3AROA 3EXJA 4O9HH 3APNA 4HGMA 4MD4A 3ABLB 4I7ZC 2HTLC 3QJVB 2FQFA 4DEPB 3HIZA 4FUUA 2P44B 1J1XL 4NZFA 4XPDC 4I13B 1D5XB 1MZYA 2YZ1A 4Z7OE 5KSUB 4M6OH 1RJLB 4JPQA 3M1CA 2P5PA 2KMWA 3GGWA 3IMUA 4PJEA 3ZDXF 4WCYH 2UYLA 3JUWA 2PP8A 2VQUA 2J8UE 5DMGC 1G1CA 12E8L 5GGRB 2C8NA 4AQ8A 1PKQB 4RGNC 3TCLA 1NCGA 1DLHB 3J2PA 1VZHA 5CD3B 3C2AL 1P4BH 4GS7B 1CG2A 3LIZA 1UZ6E 4M93C 4N1CA 5DVLA 4MZ2A 4KOVA 4X6CE 1MJJA 3SQBB 5IGXH 4WLCA 2Q20A 4R96B 3WTWA 4G8AC 2DQHH 1CTMA 2BUEA 3VATA 3GZPA 2EH8H 4YSOA 3TBWA 4OCMC 4LXFA 2FDBP 1M3IA 2VE6A 1XTLA 3TNMB 3MRQA 1J48A 3CZFA 4AXVA 2YWZA 3TCLB 5BZWA 2OMNA 2BFVH 4OCYL 4HK0A 3UAJD 1F4AA 2MTPA 4MNHB 1WRFA 2Y5TB 4JY5H 2K9FB 2VERN 5EC2B 5E4EC 4Y4FA 3MLZH 1KMGA 4LVEA 3RX5A 2VXQA 3MRKA 3D3SA 1SN2A 3UEQA 4B9ZA 3GBML 3WJMA 1BF8A 4IOSD 3BQUC 1EQWA 5E8OA 2K9UA 3RBGA 3MRRB 1GSKA 2IV8A 1VEMA 5DWUH 4QGYA 4Z7NF 1QI5A 3QJRB 1KTRL 4LP5A 3D25B 4GMSH 5HHQA 3RI5K 3G04A 3CBRA 2EYSA 3V10A 2NXYD 2ZUVA 4OZHA 3HB3C 4NC2B 2Q76B 4DKDC 3OLDA 1NIAA 5DTFB 1OQXA 1XD1A 5CN2A 4U6TA 2J6EA 4CJ0A 1E50A 2ORBL 4Y1SA 4KVXA 1D2OA 1NGQH 1T5WB 2LAGB 4DP0X 1BOGA 1DVFB 4XCNB 4KC3B 2Y1AA 4Y88A 2J43A 3ZOAA 2GSMB 3BAKA 3MROA 5DZAA 1X5AA 2E4TA 1ES0A 2FYYA 2OMXB 4P57B 3V6FB 5J12B 2J44A 2VKXA 3B7UX 3H6JA 4RSVA 4HV8B 5EUOB 1LFWA 5MEQB 3MRFA 1NMCB 5EOQL 4UTAH 1A9BB 1QRNB 3DIFA 4BCXA 1A14L 1PCXA 4TS6A 5E8PB 4UT7L 4IOIB 1JE6A 3HI6L 1OF2B 4FQXD 3KZ8A 4ODXA 1L5GA 4ZUWB 1Q2CA 5F44A 2XYCA 4HCIA 3STLA 1ELLP 4Z3IA 2Z64C 1G9NL 4Z7QB 2P5ED 4UIMB 4F33A 1YMMA 1AXSA 2G60H 4D8OA 4KMTL 3UYPB 4PJ8B 1YEKH 4DAGL 2FWSA 3WNIA 3OJ2C 1KUVA 1XXDC 1OK8A 4R76A 1KEGH 4BMHA 4FQCL 4X5QA 4XCFL 2J8MA 3QIBB 3MUZ1 4Y49C 5E6RB 1V3MA 3NP4A 1S3KL 3IE4A 1G7HB 1WA0X 3HAEA 2ZKMX 1JWUB 2IFFL 1RIUL 2JCCF 1F2OA 4ELMA 4G8GA 2VZOA 1AI1L 4J3OG 5JIPA 5IMOB 4OZGA 1KXQA 1DJXA 4MZIA 3P73B 3ILPB 4G7QB 3U30C 1GGIL 3HE7D 3X13A 3VDAA 1T1XB 3DC0A 1MCPL 4I85A 4TUKL 2OR9L 1YY8B 2EIJB 1CPSA 4LOFA 4L8SC 1EZVX 2F8VA 3FB6A 3TN0C 1MJUH 2FSEB 3KPMA 4ZNCD 3GLAA 4B9FA 5IB4B 4FG0A 1A9BA 1QNZL 3L08A 1ML0A 2C9PA 1RUPL 3FTUA 3T8WA 1RUAH 3T9YA 3DOSA 3ZE0F 4I3GA 4ZXBA 2BOCA 4XVJL 1YZZA 1NUGA 4RIRA 1KNOB 1ZAGA 3BHXA 2WYTA 4PJDE 2ERJC 3AW5A 1SZNA 2ED9A 1P5UA 4TVPE 2FO4B 3PRTA 1BLIA 4DZ8A 3ZHFA 1CZ8H 2W60B 3TVMA 4HS8H 3W9DB 2Y7LA 2EIKB 2CNMA 5ADPL 4M4PA 5IX3A 1UOVA 4FJ6A 1HEZB 3BYYA 3MNZA 1IAOB 4IJ3C 4M6HA 2TAAA 3KPRA 3VW3L 4ZOAA 5JYLA 3KEDA 5KYXB 2Y6SD 4MNQA 5F6IB 5I23A 1XIXA 3FJUA 3GZOA 3C87A 5E9DA 4J39A 2FWOA 2P52A 4U0QB 4PJGA 4Y5VB 3ZR5A 1HE7A 4ZUUA 2ZOLB 1SDAB 3B1TA 3QR2A 4FFTA 2QZ5A 5F8QC 1LXMA 4HS6B 1RULL 4AZUA 3L3HA 4IS6B 5IOPB 2DL2A 2OSYA 3G6JA 2W59A 3UROR 3G6AA 1N2RB 3FFCE 2VOTA 3CFDB 3V6ZB 3W6XA 3P69A 4RLDA 5HD8C 3E9UA 5LWYH 3QDJD 1T0PB 2VRQA 3QZNA 3CHXA 3IETA 2K8QA 5FO2A 4H2CA 3PB4X 2K3TA 4NQCD 4IGBD 1CURA 1EAPB 1I7UB 2JEWA 5DS2A 3VB9A 1CD1B 1TFHA 1IE5A 4ZO6A 1C08B 4KJWC 3GK8L 2CR0A 5F0LB 5HVHC 3U6RB 5HGBB 4F0YA 2WMPB 3X1EA 2N59A 4X6DE 2VLKB 3Q2NA 4P2OA 2CDEB 2DQCL 2QQLH 3C5ZC 5E2WH 1FVEB 5BMFL 3BVNB 4HX1B 1X7QB 1RSFA 1L7IH 3IU3B 2JQAA 2IL4A 5TFSH 3LN5A 2XFGB 1KGWA 4MA1B 5EN2A 3VFPA 4N90E 2IQAB 4XPLA 1RPKA 3IVKB 3NN8B 3ISXA 5CSZB 1YCSA 4WWVA 2C7UA 1YHPA 2YC1B 2C3VA 4R4FH 4JWPA 5LRGA 1OSEA 4DKEL 4FC3E 5C2BL 2QHRL 3B5TA 1LDSA 1SJVA 4Z7QE 4O02L 2XWZA 3MLRL 3WEBA 5B1CA 3LNEA 4GMTL 4QKXB 3SE4C 1T0OA 4MAYC 3T0EB 4BFGA 2WXNA 5C0RL 1P53A 5CF3A 2FZ3A 4AIEA 1VRSA 3DGDA 1RHFA 4WI2A 3R06B 1IIIA 1IC4L 2YBGA 3ILEA 3QJSB 2OMTA 4NQSB 3JTSB 1ZLUH 5A2IH 4W93A 3QZPA 2QVPA 2OL3L 4Y2LA 5AZ2L 4ONHA 3WHXB 2EDFA 1PX4A 5H84A 1AFVL 1RZPA 3L7EA 4M6NL 5TH2B 4FERA 4M3HA 3ZMRA 2X4OA 4HUXA 1MFNA 3BD4A 5F9JA 1FNSH 2HX7A 3LSOB 4AL8C 3QUZA 1Q72L 1XH3A 2NR6D 5GSVB 1IFHH 1PNCA 5BRQA 3JVNA 5F7WC 2ZXAA 1K3ZA 2JCCB 1KG0B 4N2AA 4JG0L 4R5VA 4RFOH 4FQIH 4XP5H 5DRNB 3NT0A 3REVB 5J0BA 2H41A 2JQZA 2JWYA 2DI8A 3CFNA 3FFDA 5GRJL 2VRKA 1Z5HA 1GMIA 2BOCB 1ZT1A 4EMZA 3B5HA 4KY2A 4TSCH 1JPSL 2ODFA 1IGMH 3LS4H 3U36B 4ABVA 1A1NA 4LHUB 4L1DA 1RZIA 2E7HA 4TPRL 4P07A 3P3YA 4G6JL 5DHDA 1QTYT 3NIFE 3UP6A 4POYA 1UM5H 1U6AH 3LPFA 4LGPB 4P23C 4U3SB 5EDXA 3S88H 4LE8A 3C60A 1ZVYA 4AEFA 2OP4H 2ZSWA 1N0XH 2UZIL 4MJ5B 2NMTA 5G4OA 4XAKE 5K9JL 4OIIH 3GBEA 4YDNA 4MJ6B 3LPPA 3SDAB 4EF3A 4O00A 3COOA 5J5EA 3QYMA 3V5KB 4OF6A 5AYUH 2H1PH 3TO4A 4QYOA 2HX9A 4PP1D 4BQCA 2A1WH 5DQ9A 1TVBB 1M42A 1WUZA 3G6DH 3HZYA 4UF7C 5B22A 4KXBA 1SVZA 4DGWC 3KVPA 2YKKA 3P4MA 2QYVA 2C9QA 4NM4H 3B9KA 2B20A 3KPLB 5B7FA 4C2XA 1UCTA 5L8KB 3E8UL 2OSLB 1ZHBA 4CMMB 2FJGA 3EGXB 5PAZA 5I19H 4JREC 1T5XA 5FECA 1E4XL 2YK1L 3PF2A 3QEGH 3RVVC 3F62A 1JZGA 1KJ3L 3GRWL 2OR8A 5F6HJ 3L3KA 2N01B 4BELD 1NEZA 4NERA 4NRZA 1CIUA 1WAPA 3EHBB 1N3NB 3LKPB 2HG5B 2A83B 2D3VA 3N41B 5HI4C 3H7LA 3EGDA 4Z0BL 4AX3A 2GB2A 5B1KA 5IBUG 4ZW5A 2UUDH 3MJ7A 4QRUA 4FFYA 1V7ML 3MUGB 2BHZA 1QSFE 1TUPA 2ZEGA 2BNRA 4EN3D 2YD2A 2P8LA 3KDMA 1MW2A 5F9DC 1OAKL 5K1JA 3L9EA 4X2UA 5MI0B 4Y2OA 3S98A 4TVPL 4WWKA 2KZWA 1BPLB 4ABQA 5I1GL 4C83B 1E42A 3ARGD 1I8UA 4YSQA 2DWTA 3ASOB 4WU5A 1ZHKB 1DQVA 1JZJA 4QHKI 4MCRA 4ZFQA 5I1DB 2OYPA 1QASA 2YQ3A 3I6LE 4NZ8A 1CFTA 5D7IB 3T3PE 3WAKA 4W9GC 3F12A 3P2DA 1A1OA 4JRYA 1QUPA 2OFQA 3WE6B 1R3IH 2BY2A 4XVUD 3BDYL 1COBA 1IAMA 5GGRA 1KGIA 3GB7B 1PU0A 2Z92B 3SOBL 2YBRA 4RGND 2REFA 2QR0B 2YKLH 4X9BA 3RWGB 4V1DA 5TK2A 4D9RE 4NJ9H 2WAQA 3ARQA 1OPGL 1G6RH 3H9YA 3KLAB 5JIDA 3QDJB 3JVFC 1J1PH 3U4EB 2A4NA 1WFUA 1I9JH 1ZSHA 4RMBA 2O6FA 4MA7L 4JLRB 1IKNC 4PSPA 4BFNA 5F1IB 4C58B 3KVQA 4DUXA 2BDNL 3P02A 2FX7H 3ESVF 5EO1A 2YD7A 4QAMB 5CLYA 4NGQA 2PCYA 3KWTA 2ENPA 3AXIA 4JFEE 4KGJA 4R26H 5DC2A 5EV7A 4HWEH 3T6QC 3WTVA 3FT2A 1J05B 4NQDA 1MCWM 3QUYA 5E2UL 4CRPA 2JB6A 3MKGA 4AVHA 4TOYH 2KT6A 1AAJA 3U9UB 3F5BA 1TU2A 3UJTL 3MV7E 3ZHDA 5CNHA 1Q4NX 2FJSA 3FSAA 4PG9A 1NC2D 3N06B 3P3SA 4DEUA 1T4KA 2VT0A 1WZ1H 3BIKB 5LNEA 4F80A 1JWUA 4XBMA 4C47A 2BWDA 2YPKB 5DMJB 2AJVL 5E99L 2QVIA 2C3GA 4K7PY 2C1OA 4OZIF 4P3CL 4GW1B 1I3GL 3D0LA 1I9RL 2BJMH 3QDMB 5AYQA 3DVGA 3T8VA 3ZDYF 2R1XA 4IU2B 2I7OA 2YR3A 2V8LA 3BW9A 2WO2B 3BGMB 3I6GA 4BQBA 5FO8A 3WC5A 3DTXB 4OFYA 3S2CA 1FG2A 1MFAH 4DCQB 3KXFE 2QR0A 3DX7A 4PJ8C 1BLLE 3U7YH 1KF9B 2YD8A 3PAYA 1W72A 3WUWA 4H89A 2ZICA 4ODBD 4D3CL 32C2B 2WK2A 2C1OB 5A16A 3KD4A 3L4VA 3PHQB 5JHLA 5IT2L 4A2MA 2Y9RT 4YHPB 3D39E 3MRHB 4XE5B 4DK3A 4OD2B 4NQQA 3MRBA 2ZUSA 2Y23A 3T6XA 3VFNB 3MV11 2AE6A 5GGRY 4GQQA 1D5ZA 2CHNA 3MRCA 2BSWA 4MX7A 1HCVA 3NK3A 1DJZA 2IBZY 4UT6L 2L4OA 2XWDA 1M1XB 1N5AA 1IEBA 1F1AA 3MA9H 4ZK8A 1MCNA 3VX0A 3ULUL 5CD3A 1D7CA 3TO7A 1JDAA 4AKQA 5GGTH 3P3UA 3SGJA 5EF2A 1VKXA 3GLZA 4EN2A 1AS8A 2HJLB 1I1FA 4HPOL 4J3TA 1A6PA 3IJ9A 5EEWA 3ECUA 2E7CA 1UWYA 2RACA 4NQED 1HHIA 5JW5A 3QNYA 1TJHL 1AYEA 2W65A 4MB5A 3KL5A 3ZE1F 4JHAH 4MQXC 2IQ9L 5HDBB 5B7MA 3FK3A 2DQGL 1VESA 5DRWB 1IOIA 3DVGB 5AW6B 3IFOA 3OR7B 3SKMA 5FK9B 4AQ8C 1IVTA 1IU8A 1PS3A 5BWAB 5I76A 3G6JB 3UIZA 3ZDZF 2D03L 3QHFH 3ARFD 5D1XA 4WUUE 1DQDL 4YLBA 2PJ2A 4PGBB 1C16B 5IVZA 5IESL 1K4JA 3ML8A 1HDMA 3VO0A 4L0ZA 3V4VL 5C0BE 3SBQA 3GXTA 2VXUL 2FHCA 4DOHE 4YBHA 3A23A 4PJ9B 4YHML 1MF2L 2F54D 4P4KD 1XRYA 5D7IE 4KUCD 2A6DA 4GRLD 4HLZH 4HXAH 1DVFD 2Q4ZA 4E2AA 2JIXD 3GHEH 5ADOH 1X9UA 2GTZA 3FU8A 3JTTA 4PI0A 5EDSA 3RZAA 4NYLB 1ZV9A 4G9FE 3M7FB 4PV9B 3QE5A 1D5MA 3QI9D 1KIPA 1I8LC 3X12A 1XD0A 3UY5A 3KMDA 1SM3L 3SKJL 1TIQA 4Z7VB 5EC4A 1H0DA 4PVNA 1EXGA 4A6YH 1B4RA 3KBPA 2O5YL 2XXMB 4NNPL 4UM9D 2DI9A 4UV4L 5IJDC 1FZMA 3WL9B 2I00A 5F7HA 1N0LB 4K7FA 4LLMB 3A4FA 3EJSA 3X11B 4XX1E 2VZ3A 3TH2T 5HBBA 2DKSA 2KS0A 2LFEA 3TV8A 4HHAB 4AKPA 1T5XB 4K55A 4UU9B 4N2FA 1DEEB 1PG7W 1ET5A 2P7TB 3HPLB 4LKCB 4TNEA 1SMDA 1YNTA 3GRBA 1EZSA 4GUCA 5KSAB 4OZFA 4XR8C 2H0FA 2XY2A 1FH5L 1OB0A 2YMXL 4WUUD 5AUMA 4BGDA 2ITEA 4NHCL 1EGJA 4ZPTA 3FU7A 1F4XH 3L3DB 3PXJA 3OZLA 3T3PB 3WC7A 4XTRD 3QI9C 4FYSA 5FUZL 3L2NA 4NO2A 4XT1C 2P8LB 1M7DA 2BVOA 3IWVA 4KZDH 4ODUB 1F58L 1GC1L 1N70A 2ITFA 3PJLA 3O4OC 1Z5LB 5DA4A 2BY0A 2YGVA 4I48B 1KYUA 1KV7A 4MMXA 5CLTA 5FYJE 4Z8FL 2Q7NA 5IOKA 1X12A 2VL5B 1GYCA 1K72A 1MIEL 1Z1WA 2VMCA 3EFDH 1CLOH 2QQKL 1PG7H 1Q9OB 1E28A 3QCVH 1O5DT 3WDHA 3NIDE 5IG7B 5EO9B 4IRSD 4M5SA 5F8RC 4P4IA 2DAVA 1M2VB 4XCEB 3I6LD 2EC9U 3CU1A 2HSIA 4PJHF 4KTDH 2ZPKL 2WKLA 3D50A 2D4DA 4WV1A 1ZHLB 4PJ7E 3H6AA 3WEOA 3IDGA 1I8AA 3ZZIA 4JKLA 3VAEA 1VZGA 4JFUA 1CFMA 1KB5L 2GE3A 4A7SA 2NNFA 2BCKA 2IPKA 2NX5A 4BA0A 1JYWA 2EKSB 5B1BB 5EWIL 3CD4A 3VYNA 3TFKD 4UEEA 1MDTA 3PIQB 4L3EA 5FOJA 3OKYA 3ATBA 2NZIA 1V5JA 2E76C 2J4WH 2WZ0A 3RTLA 4B5OA 4A7VA 2XQYK 3HUJA 5AAMC 4P3DB 2V2WA 1AO7E 2XN9D 5JIKA 4UQIM 2FLRT 4M5YH 2XYBA 4A6YB 4KZCA 3NA9L 1NSNL 2EJ1A 4EOWL 5L2KB 4AYGA 1NFIB 2Z0UA 2Z0ZA 3CX2A 4RCAA 4PJBE 3GSOB 5KSBB 3JYCA 5BRPA 2WM0A 4PTTA 4L3EB 3KJ4C 3C2AH 3PCYA 3VG9B 3KYNA 3MAWA 4M6IA 1ILSA 1E2WA 1YYCA 4F2MB 2DLTA 1YNLL 4PRDB 1ET7A 1SXCA 3ME0A 1KBWA 1GZHC 4JFFD 2YMTA 3LRKA 1H9VA 4N8VB 4CAWA 1U95A 4WNSA 3RBUA 3OKKA 1XIWD 5D2NE 3LIZL 2VR8A 2PWEA 4LESA 2W1NA 2Q0YA 1YQVH 3LQZB 4KK6D 1ED3A 4JZJC 4KHTL 5AB1A 4BYHA 5JW4N 3FECA 3WE1A 4HUKB 1RURL 2VDNB 4NN7B 5I1IL 5MP6L 1T83C 1CTNA 4YPJA 5AAWC 4HAFA 3IDUA 5FM4A 3FAXA 1PFOA 4QTIL 1S3RA 4GS4A 4KITB 5IW1B 5T5FL 1DSFH 3VFNA 4L3AA 2R1YB 4AYEC 3HG1D 5DT1L 2NX5D 1OXYA 2E47A 4X6BA 1KJ2A 2C3HA 4DP7X 4MD0B 5LQBH 1TF8A 4N6RB 1FVEA 3BUIA 4P5RA 3RWCA 3KPQA 4W4OA 4RI1A 5DK0B 1S7LA 1YUKB 3LQZA 1SUHA 3B7TA 1WV7T 5E4AA 1UJ3A 1CE6B 1SF5A 2MPAH 3EZ8A 3ARBA 3O9WC 3OAUL 5C09B 1J88A 4I89A 1M05B 2WINB 4K3JH 1AQHA 1IBBA 3O6FB 4NO5B 1X5KA 5K9KB 4AW4A 4B3VA 3GBDA 2GT9A 3D69B 3M17B 5EC2A 4NFRA 4UQEA 1HJCA 2GJ6E 1PBYA 5MENB 1DSYA 5AG5A 1REIA 4AE0A 1URIA 4JFWA 2Y4SA 1UUNA 1S5HA 5TJWK 4Q4IA 2X0WA 1XBUA 4OW6A 3BUPA 1JRHL 2ATPB 3PWNB 2QMLA 4APQD 4KNUA 5KYYA 3WIAA 1P1ZB 2GQHA 4RQQA 4WTQA 3EOBA 3LHPH 1OTSD 1LEGA 3K1DA 2PW1B 3NCMA 4JMNA 4Y7OC 2ZUUA 1BQHB 1PKQE 2ZX7A 3CFJA 2CALA 4U1HB 3ZTEA 4X8JB 5ILTH 4HBCL 4UT7H 5DJYA 2Z11A 1CR9H 4OC5A 4YR6B 5DD6B 2XQBH 4XZUB 1X6NA 3ZDZE 1LP9A 4S1QL 5KVDE 4AG9A 5HHXL 3W38A 4LLQA 3JTKA 4NN6B 2C4XA 4WY7L 5M94B 3D08A 4TNFA 4DAGH 3G9VA 3FFCD 5DUPH 5C07E 1MCIA 1EO7A 1F42A 2O1AA 4MBRA 1WIOA 3NJLA 1S3KH 2PR1A 5CP7A 4P8QA 3F05A 1DTDA 1L6PA 2PLTA 3DO4A 5BZXA 3PP3H 5E8PA 1OP9A 4ZMTA 3C9NA 2QSTA 4ZUUB 4J4PA 4ZFZA 43C9A 2FYVA 1MQKH 3K80A 1ZV2A 3LNFA 4ANUA 4XOBA 4BWUA 4EEEA 4NOBA 2E4FA 1ZLIA 3HBPA 1AD0A 1NC4D 3CDFA 2XUWA 3QORB 2PJ8A 1ZHKA 1GGIH 2GIYA 3EGSA 3IMVA 2JIXA 5BVJA 4XN8A 3WN5B 4MQ7B 5DJ0A 4HD5A 1QTSA 1OM3L 1CBXA 1B6BA 3MACH 1KB5B 5CLZA 3U1SH 1XTMA 5DCCA 5D7EA 1TZGL 4FKEA 2APBA 4IRSA 1LDPH 3F85A 1Q0YH 4OM1L 3PYCA 5LG6A 2OK0H 1HYRC 3TO4D 2XTLA 2X4UA 3UABA 1VFAB 1EEQA 5ICYA 1KPVB 2GTWB 3S2AA 1IC7H 4AJWA 2IVFC 3NK4A 1CGVA 1S9WA 5DLML 3QH3A 3MZGB 2F58H 5LYFA 2KQNA 4K94L 4YJZL 2O61B 1RZ7H 4HQQH 2Q87A 1FYTE 5I1JL 4A7UA 3VWKB 2P5WE 4RGOH 3ABZA 3R1GH 2AFWA 5CZRA 1EHKB 1U33A 2PWHA 1MHPH 5AD0B 4OLZL 2A74B 5KWYC 3VW3H 2W0FA 4YSUA 4HK3J 5F6HI 4E0RA 4JFXB 3RIKA 3DGGA 2C9UA 1TQBB 4Y4KC 4PY7A 3GMOB 2R0KL 1AGDB 3PPEA 3RL2A 3V5DA 3VI4A 2EE2A 4XHJC 4JK0D 2D4OA 2DYPD 3SGKA 2HCZX 3VFUB 2XETA 2XTJC 3PUUA 5IVXE 2LU3A 1BJMA 4P2QA 2O26U 2WOBA 3R0MA 5FYLE 3GUFA 4G6KH 4QRUB 1JD7A 4YHNA 4Q9QL 4S1DD 4AL8H 2J5LC 5KTAA 3IPBA 5DTFA 2PUQT 1P6FA 5DJZB 4AEEA 3F58H 1Q38A 3RL1B 3T0AA 4MNQB 3WFBH 4MZRA 1SBSL 1VHPA 2HWZL 5DUMH 1Z0NA 1JRHI 2OCJA 2DLEA 2MFNA 3NCYS 5IEHB 1AIZA 4N2LA 4B9IA 3VWKD 4F57L 4OAEA 4BZ1L 3MJ9L 5KVGE 1GGCL 1SNRA 1YA5A 1L7IL 2LAAA 4KRPB 2C9RA 2FJFA 2PIZA 2WCSA 4CAEA 1TZIA 1AGBA 1PYTB 4G7RB 7CPAA 1XMEB 1WWWX 4GI9A 2XVLA 3P4OB 3BH9B 4XOEA 5DMYA 4G7VL 2CBTA 4YHIB 1SY6A 5IHWA 1NCCH 1TJGL 2QHRH 4AG4H 3UBFA 1NBCA 2G9KA 4X5PA 5EORH 4U6XA 1YAIA 2NXYC 1AQMA 2OJZH 5DD1H 2Z4TA 2JTYA 2YUVA 4DPAX 5J4MA 1VKXB 1A7NL 4RSYA 3IDIA 4U1MA 3D48R 4FXKA 2Q51A 3AQDA 4FNRA 4JQIH 2IXQA 1U8PA 2VC2H 5DEZA 4S2SA 5C3IA 2ZKYA 1DR9A 3GSWA 3MJ8A 3S4SG 1UD6A 4FD6A 1X5ZA 3H42H 4AYMC 5EUKB 5E96A 1JDCA 4HMCA 2RC4A 1QSEB 2GJPA 3VI3A 4QRRA 3HVNA 5LJYH 1JZ6A 4GW5A 1MVFA 2H3XC 2XX1A 1XVSA 5CMAA 1ETA1 43CAB 1MUJB 3P54A 4N20A 2B4BA 3CSPA 2PMZA 4N6QA 4PJXE 2APTA 4M56A 5ESQB 3AB0C 1WEJL 2V7NB 4MCZA 1YEGL 2GFBA 1DBBH 1L3WA 2ICEB 4RGMB 1VIWA 3K74B 1FZOB 3G5XB 4KQ3L 1QLRA 4WKZB 3TBVB 1NSAA 3RWEA 3U0TB 2Z7UA 3D2UD 2A9AA 4KKZA 1FBIL 4RNRA 4Z7UE 2RR3A 3VDBA 1UC6A 4X4XB 5BOZG 3ZGHA 3WR7A 1FL6A 4XP6L 3TIDA 1A4KA 4GG6A 5HHME 4GW1A 2HRLA 2OZHA 4K71B 4U0RC 3UXFA 4DESA 1WC7A 3F84A 4NPKA 1BBJA 3RWDB 3VXRB 4FQIL 3FOLA 3O4LB 4KROD 1BMWA 1NBYB 4OJCA 2JJSA 5D4JA 1G9EA 4EZLA 4CMMA 3T8MA 2O53A 5GRJH 4KX9A 4Z7WA 3DI2B 5CCGE 3L7EB 4KXDA 1MJJB 1FHGA 4IJ3B 1G7LA 5L4IA 2E86A 2ADJA 5E95B 5D2LF 1ERNA 1PFCA 2LFGA 3FU6A 2H26A 3JVGC 4DFIA 3DO7B 3V4PB 3QAHA 1UTDA 3S6FA 3R0NA 2YQBA 3VXRA 2G5BA 3WS3B 1UA7A 2FIKB 4OC4A 3F8UB 3VFOB 2VDRB 4L4VE 1CD1A 3RUGB 2QZQA 2OMZB 4XGZB 1Q9WB 3B2PA 1THCA 2NY1C 3BZ4B 3LY6A 2HQYA 3K6NA 2UZIH 1JGUL 4OD1H 2JJSC 3JWDH 1RAMA 1BFOA 2DJ4A 5F7FA 1F8TH 1QSVA 1A9VA 1E8XA 3CZUB 3DV4B 4YHLH 3TFYA 4NQTA 3L3HB 3K9UA 4LX9A 1V3LA 1QFUL 2EE3A 4NRYB 2GY7B 1N68A 5KUKA 1J8HD 4N2CA 3QRFM 4F9PA 3GB0A 3D8MA 5D93B 5C6TH 1Q7LA 1GYUA 1QPKA 2W0PA 4FA8A 3U9UA 3V4UL 3K6OA 3DYMA 3NA6A 2G75A 1VKCA 4WHTB 4H0IA 4JXQA 3MRDA 1N64H 4Z5RA 3I3DA 1DBAH 5D4HA 1MWOA 4E9VA 4BWTA 1ZLEA 5JDJA 4NWTL 1WHPA 1QSNA 4PRIE 3QG7H 2BO0A 1T7ZA 4F7PB 4JO5A 4IBQA 3D0AA 1J8RA 3E8VA 1ZG7A 4U5YA 1W8NA 5CJ8A 1KXHA 1JHLL 1SJEA 5HPOA 4H8HA 1MNUL 3U46A 2OMUA 2J6EH 4J3VA 1R3KA 2SODB 5KBKA 1RJYB 3KEHA 2ENQA 3BAXA 3RKDC 5JPNB 2FB4H 1N59B 4DPRA 4OCXH 4FXGC 1BBDL 2HKAA 2QPSA 2VIRA 5F71A 3C5SB 1R3LA 2WB7A 4ONOA 3F6LA 3OWRA 4UZGA 4NGMA 4ZBGA 3QZWG 3TFKC 3MA7A 2XBDA 3WU1A 3OAWA 4JDEA 4JDTL 5L2KD 2E9WA 4L0PB 1WPCA 5CSGA 3UO1H 3V2AR 3GSUA 4KFZC 3TA3A 3QQDB 4HWUA 3X14B 2HKFH 1VA9A 4Q9RH 2Y2WA 1RJLA 1CICA 4MDRA 3IJHB 1CICD 3N85H 3BDYH 4FNLH 4JFPB 4IIQB 5LCVH 5JIHA 4NZTL 4I87A 1FVDA 5ESQA 2OSWA 1Y0LB 5BZDA 3MXWH 1X5LA 1AGDA 5DVKA 3QCTL 1WLHA 4Z76A 2Y6SC 1I9EA 1OPGH 4ZDHA 1MCWW 4FTVE 4PRHA 5CEZL 3HE6C 4WW2F 4BE6A 3VFTB 3D39A 3X14A 5LRKA 3FOMA 3LZFL 1EXUB 1U93B 3LNDA 3BI1A 3VXSE 1A6ZA 2VABB 3RAJL 1A02N 2JKNA 1JNHB 2VLLA 3H9HB 3MRBB 4H88H 5DJ2A 3SGKC 2GTQA 1EFXB 4FFVD 4CVXA 2YA0A 4HF5H 1T22B 2CRZA 4FHJA 4URTB 1L3NA 4ZPVA 3DURA 2QBWA 2X28A 1S7WB 1MSPA 1EH9A 3WKYA 4B13A 1N59A 4KMQA 1GMEA 1E5UI 3ERXA 2VDQL 1OT1A 2WQWA 5BUPA 2IAMC 3OL2A 3FOMB 4KXAA 1P4UA 3MX0B 1HXYB 4ZMYA 1I9IH 5ANMB 4JO3H 2R8SL 5G21A 4K7PL 4PJIA 2BS8A 4LSUH 1M2OA 1NTDA 3TXAA 3TN0B 1YPZF 2OPCA 3AJ7A 4A37A 2W80C 4GXFA 4OJFL 1EDQA 2AJVH 2G3XA 5E99H 4ZTPL 4DGIL 1QI3A 5E1GA 2DQEL 3VRLF 1DDHB 2MCG1 4WSGA 3UPRB 2VLJE 3NCYP 1AR2A 1WZMA 4APXB 4Y9EA 1JNNH 3MTRA 4FD0A 5D1XE 3MSPA 1YEHL 2XFXA 1U8IA 2CM6A 2EDOA 4ZAKB 5I1KL 4Y5YB 5SWZB 2KDGA 1L9OA 2FJHA 4PS4L 1Z9LA 5KYXA 3KWUA 4YHYB 1XGYH 3LRSA 1NMAL 3TJPA 4AUYA 1LWHA 1OF2A 1AQDA 3BP4B 5BS0E 5J9PB 4NAMA 2OCFD 3IDYB 3WHXA 2UX6A 3CIAA 1ACXA 5CR8A 2OB0A 4H25A 4OCRH 3FONA 4AEHH 4NC1C 3BSZH 2QVFB 1KBBA 3QQ3B 1DTUA 1KULA 1H3VA 5FGCE 1YEFH 4ANVA 4JFHD 4Y4FB 1DN0B 5SWSD 1O6SA 3JWOH 4NQVA 3LRMA 4P4RA 5IJCC 1T0NB 2C3WA 3ARVA 1KJ2L 5T1JA 3FCSB 4ZMQA 4AXWA 1PZBA 3BXNB 2ITDA 1IEHA 1JTOA 3WY4A 3F12B 2V8VA 1TQCC 1FQ9C 3TBWB 1HNYA 1U8KA 5AVTB 3IU2A 3PNWA 4C55A 3EJZC 4G83A 5F48A 5CZKA 1DJYA 2IGTA 4TYUA 4TNWF 2E56A 1LANA 5D8NA 2V2WB 2ZWZA 1M7XA 5DLLA 4WSJA 4JAMA 5JDSA 3BWUC 4RA0C 4ZS6D 5FYJL 4G1EA 1LO0H 1DUZA 5I8OL 2J1YA 4GXVH 4NX0A 3ARFB 3V4VH 1VFBA 2B7DT 2VXUH 2XT1B 2G9HA 4XP4H 3NCJH 4XNDA 4QOKB 5DWMA 1AGFB 1FNAA 4PY8I 1DQKA 5IHZB 4O02B 1DQMH 2EDYA 3QUMA 3U9PH 4XGZA 3ME0B 3GHEL 1YEWA 3NPSB 1C1EH 4GUPB 4LIQL 3ZYZA 1FLRL 3D09A 2IQ6A 4UF4A 3P30L 3QDAA 2PCFA 5C09A 2W07B 3D4GA 2DEYX 5HYJB 4JVUA 5EF3A 4UCMA 4KO9A 2BVTA 3TO2B 4OMEA 3BZFA 1ILUA 2COVD 2P4AB 3IDNA 5IJVB 2AQRA 1T4KB 2WXLA 3SKJH 2OI9C 1UT2A 4A94A 2LT9A 1T03H 1OB1A 2PPAA 1N67A 2FWOB 4R87A 1DL7H 3D39B 3N41F 2GTWA 4XPFH 1YGHA 1T1YB 4NNPH 4AUUA 3O9WA 1E30A 4I1RA 1OKEA 3NH5A 3T4YA 3ZT5A 4JG1L 4NENB 4OZFH 4W4OC 4CVZA 1CF1A 4NF1A 5L7XH 3T77A 4BFIA 2JBKA 3E6HA 1I3RA 1BIIB 2OMYB 3HI1A 2IEPA 3ZQXA 5GJTL 3FCUB 4N2EA 4DF9A 4A55A 2Q3AA 1C7TA 1KFAH 2H9GB 4X8JA 5D7JD 1EO5A 3GM8A 5DVMA 5AAWA 2ATRA 4PWJA 3QK0A 4KJYA 2B1HH 3BPNB 4OIBA 3GZKA 3MUHL 3RHWK 3TT1H 4PJEF 1XB3A 3F7PC 3H4FA 3BEVB 5E9AA 4PXDA 3KLLA 2V7NA 4QRTA 2I26N 2YPKA 3FAWA 5KOMC 3FNCA 4IK2A 3W1ZA 3LMJH 1K4CB 1ARMA 3REWA 3OKDA 4WWOA 5I8CA 1XOVA 1C5CH 3U25A 3C08L 4P46B 2L7UA 2IANA 1F58H 3PDOB 1GZHA 1PZ2A 3ZQ9A 1LL1A 3NCBB 3CDGB 4U3HA 4X80H 4L8CA 5F47A 3MTXA 5KN5A 2MKLC 3WTSA 2ITCB 3GHPA 3BSHA 4NUJB 3D6GA 3ARSA 1MIEH 1R6VA 3DDGA 4DPCX 1HHIB 3HN8A 3DA0A 5JW5B 1UZ6F 1MNNA 4ELMB 5JXAH 1IJNA 3P2BA 2WZAA 4HKBB 2UY6B 3NIDF 5C0CB 4AGOA 3JWOC 4U7KA 2B5GA 5LG1A 1GJIA 3QFJE 4MAZA 4QC6A 5I1CL 4NENA 3QIUC 2JJWA 4IIQA 2N1KA 4XO4A 2WSKA 1EHNA 1FAIH 1TSHA 1CF8L 4FCAA 5EOCJ 3RGVD 3VXME 3B3TA 3NEOA 4M8QB 2V37A 4MX7B 1FNHA 2EYSB 3ULAB 1S7KA 2WWMD 1BV8A 1ADQL 4Z3EA 5IFAH 5F1OB 4IDJH 1S7QA 4LDLB 3OMIB 4L9LB 3QZWB 1MFUA 2OXGA 4GQRA 3L81A 2ED6A 3DBXA 3RX9A 4OB5L 2ZCLH 3MRGB 1TZHA 4GB9A 3DX6B 2Z31C 3HVDA 4XRCB 3S36H 5HY9B 1FWXA 4F91B 5SV4A 3QWQB 4FJZA 3DX1A 5ICUA 3QH3B 2NY2C 3NA9H 1UXLA 3DROA 3ATAA 3Q7JA 1X5JA 4UQ3B 2WYRA 2V3FA 3W11C 3S37H 1TPXB 2WINA 1M05A 3ARGB 3II1A 3FYEB 4P04A 4UI2A 4EAEA 2CD0A 2Z3MA 4H7VA 2VR3A 4F2EA 3ULVC 2IDSA 1KCWA 4KZEL 4FD7A 2WLHA 2H0EA 3OD3A 4FFZL 4OT1H 4GRWE 3PE9A 4FI8A 2HFGL 4FQXA 5TE7H 5EOCL 3X3GH 1HQRA 4P5KB 5H35A 1UGKA 2ZYSA 1NGZB 3H3PL 2DF3A 3GSQB 2FBJH 4QEGA 3FU0A 3Q2VA 3E3QC 1YMMB 1UYWH 4A6YA 1FG9C 3QUXD 1A21A 1NANH 4JFQA 4AIXA 1IC5L 3LIZH 5E6UB 1FGVH 2AKRB 3RIFK 1OAUL 4NI3A 1PKQA 2O61A 2X6BA 2J71A 1FO0A 4LQGA 2ZWKA 4ZMWA 5E8DH 5JW3H 2D31B 4WW1A 1EAPA 2WN2A 4GUOA 4AYDC 3VRLE 1R3KB 2ZOTA 1SOSA 2R2CA 3OTTA 5IV2A 5C71A 1Y7EA 2RFHA 3GLDA 4BKLB 1K6QL 3GINA 1OAZL 3F7LA 3FQUA 3QDJA 4HWBH 1CI5A 4JCMA 4GOSA 5ETUB 3OKLB 4S1RH 2WTRA 3P11H 1QPPA 5CKGA 4FAIA 2XN2A 4OD3L 1NICA 4TF4A 5A3IC 2MSPA 4Y9BA 4BFIB 3GI9H 1GJUA 2GC7C 4X5WB 4F0XA 4F8PA 1T7YA 4R0LC 4N3TA 5KTCA 2X88A 3KR3H 1BMZA 2ADGB 5EIIG 5E8EB 1RPQA 2VN7A 2FD6H 4MNQD 2I9TB 1HEHC 1BD2B 4ALAH 3ECWA 5MEOA 3ECVA 4W6YB 4CC4A 4A68A 4FXKB 2BW4A 5D5ME 1OT4A 3IFNL 1W72L 1C16A 3EYSL 3V0WL 4Q7AA 3DK2A 2Y69B 2KQMA 1GS7A 1H3GA 1MCOL 3GRWA 1T3FB 1FYTD 4G8GD 2Z65C 2FQEA 2WN3A 1ZS8B 3VFSA 1T5KA 1KCVH 2BP8B 3OKMB 1ZPUA 2VWEC 4PJEB 4K23L 4CN4A 5HDQL 1TZIB 2CGZA 4FYQA 3DTXA 4NQEB 1FY7A 1OAYH 4PQXA 2IDCA 1LD9A 5D1XC 2QQNL 4HLJA 3VWEA 3B6SB 1S7WA 5ITBH 1FZOA 3G5XA 3C2SA 2QPDB 1FC1A 4Q4EA 1S7RB 2YJLA 4KY1H 1D7FA 4S1QH 5D6CB 5LXGL 4PJDF 1YEDA 3I2CH 1HI6B 2D0HA 4G8EB 4MFQA 5D7SL 1GZPA 4WJKB 3EFAA 4PWIA 4RQQB 5D9SB 4HKXA 2XA8L 4NGHL 4WZ9A 3UJIL 4Z77B 2CR3A 5DHMC 3HJEA 1ZTMA 2EVHA 2PR8A 4UOW0 4D0BB 4OUUB 1L0XA 1K4DB 3C6SA 3PV7A 4JRFA 4PJ5A 3GS4A 3JWNC 2OYKA 5G20A 1C9SA 4JFOA 4J4PC 4MJ6A 2ZXDA 4KKAD 3TYGH 3WC6A 3MLYL 3UBXI 1MQKL 5KG9B 3OKKB 5FX3A 4M6AA 2NLJA 3GJEB 4R7DA 3S6CA 1XSKA 4U1GC 2DPKA 2RGSA 3DGCR 4BFJA 1LRZA 3E0KA 1IC0A 1HZHH 2NCMA 3LIUA 1RO5A 1DFXA 2UZPA 1KIRA 2E59A 3MACL 4OV5A 4DNCA 1LILA 2DMHA 1IQDB 3NJNA 2EUIA 2GJRA 4MA3A 3T3MF 1TZGH 3LEVH 2XWJA 3KYNB 1FRGH 3O6ML 5ERWB 4CU7A 2NPLX 3EYUL 3NJMA 5D1XB 1FFPA 1JZHA 4X6BB 4RAUB 2Y3NA 4LLAA 1NBVL 1HESA 2VM4A 4FEIA 3ZZQA 1FLTX 1S5KA 4K8RL 1U4FA 3EFFB 5DGQA 3ZE0B 3MRPB 4LAJH 3KZWA 3MNZB 1BZEA 2J7LA 1Q9KB 4PRBA 1QYGL 5E9DE 5KVDL 4RGOL 2C9SA 2R29A 1ODUA 3MODL 4OLZH 3ZKXC 4XBPB 1G7JB 1LO5B 3V55A 4OUUA 4NKOA 4LOVA 2QMJA 3LN4A 2WB1A 4N86A 4KKBD 3QUYC 3AXLB 5KBLA 3TYFA 1JFQL 3FFCA 4WDIB 4BH7A 1UWXH 2CUHA 3QAQA 4IKIA 3CZLA 3SE3C 1AGEB 1N2RA 3V6ZA 5FIEA 5TDPA 1H8LA 4JS7A 4QHNA 1R0AL 3WTXA 4PP2B 3P4NB 2D3JA 1PD0A 2AERT 4XC1H 5KSBF 2HB6A 3O4LA 2IAND 1RP8A 1UJ3C 3V0DA 1PZCA 2J8UF 4J4PD 1BX2B 2JQMA 3F2LA 2DM2A 2V33A 1CP6A 1Z9MA 4XMPL 2ESVE 4RMVA 2ZOKB 4N2IA 4WW2B 5KW9H 3KYMA 3SI2A 3C6LC 3VB8A 3SPVB 1ROWA 3SD2A 1OY3B 2D9QB 1RUKH 4IF5A 5D93C 1T83A 4F57H 1KN4H 1E5YA 2XKUA 3CVHL 1SLUA 3UAJC 3QUKA 2CNTA 2DIJA 1KYOK 2YC1A 4U1LA 5HHNB 5CJQL 2F1EA 4WWKD 4PPZA 2V8GA 4U1KA 4F7TA 1MJ7L 5LRJA 4YDKH 2Z4QA 2W95A 1VPOL 4Q74A 4P5TA 5FOBB 2N7BA 1IVLA 2F61A 4W9EC 1D6VH 3K0WA 2W0KA 2OMWA 3EIFA 4N22A 2X1OA 1IB1E 4HIPA 2ZKHH 1S60A 2OJZL 5DD1L 5CJBA 2DS4A 1A7NH 4C4BA 2R0WL 2VQ1B 3RPIB 4C56A 2VC2L 3HNVL 1P84K 3BQUB 3WY3A 1E27B 1BJ1J 2CJUL 2VQTA 1G7QA 5CO1A 4UWIA 1FFQA 1A6ZB 2VABA 5I1EH 2E9IA 4Q56A 1KB3A 3V0EA 3GGWB 1AOHA 3I50H 2ZF8A 4A2HA 3ZL4H 1R19A 4TTGA 3IGLA 1Q0XH 3QEQD 4ZX9A 2EO1A 2H5MA 4EI5D 1N8ZA 2K4WA 2QTVA 2V8HA 3NIFF 4OF3A 2UX7A 2WVSA 3N0AA 4GEIA 4F20A 4KWUA 4K2UH 4PGZA 4NAQA 3SDAD 3ZPDA 3T4AA 4JFPA 2XWCA 2YPLA 4DGVL 1RZ8A 1UWXK 1MFEH 2VDKH 3RI5F 2WXQA 2FT8A 2G3TA 2C4FT 2VUOA 2BSCA 1ZANH 3SHPA 3TO4C 1ACYL 2AABH 2GITB 1OGAB 4R4ND 5FYKU 3AADB 2VZSA 3EKCA 3F5WB 4YFLF 3BIBX 4F3FA 3IN2A 2WD0A 1RIVH 1NKRA 2XDHA 5IMKB 5IMLB 3FCBA 3FH8A 1KCRH 2YPLB 2AEOA 2YUXA 3HG3A 1D5IH 5TDNB 1XF2A 3TO2A 4BSVB 1AACA 3WELA 3VWJA 1KCKA 4K3EH 3VI4B 2XACC 1VERA 4PGEA 1H6TA 1JXGA 4V11A 3D2UA 1IGJA 1H15B 1E5ZA 3GO1H 4DZBB 1W9XA 5AOJA 1U8NA 2R0ZH 4G9DB 5DS8B 3BPCB 3ZHKA 1HXMB 2VR5A 1BWWA 1JGIA 5AOIA 1Z2KA 4Y1AD 3UPCA 3DMMC 4H25B 4AB7A 5B38G 3ARED 2G5UA 4ECNA 5GSRA 2LGNA 9PCYA 1JSYA 5TDNA 3FNKA 4OTXL 4Y4KD 3TBYA 1MFBH 2ZEFA 1QLFB 4YEFA 2PYFA 3OMAB 2K7PA 4UINL 3QO0B 3QCUL 8CGTA 5TF1H 5CWSB 3GIUA 3K72A 1CGSH 3LZOA 4JZOB 1J86A 3L9YA 2FQGA 2ODHA 3K8LA 5TQ2L 3GKRA 2JCCE 3CLFH 3OF6A 4YHLL 4Y0GA 5C2UB 3U2JA 4P4JA 2DKMA 2GSIB 2GUYA 1BEYH 2R7EA 1PZAA 3BLPX 5A2CA 5KYWB 4YRHA 3HNSL 4WSKA 3LTVA 3QUZC 1NH6A 1UKTA 3G08A 2E9BA 3E38A 1QABA 3L3DA 3NG5A 1HJBC 2VZ1A 3P4LA 3ZSSA 3IJHA 1A6UL 3SD5A 1E7VA 4JJ5B 4X99B 4WFGE 2ZCKH 2GI0A 2UVEA 4ZXBB 3MX0A 2UXVA 2YRBA 3FT3A 1AXIB 1EIBA 2BHYA 5EZIH 4X6CF 4CKQA 1OP5K 2FBRA 4P9ML 1WTGT 1W0VB 2ZWYA 1J5HA 2C5DC 3PAUA 2Z7YA 3V0IA 3CZFB 1G9ML 1PAZA 3N3EA 2IBBA 4JM2C 2ICWI 1Z4EA 2VZUA 3QXAA 4JL1A 3FRMA 4MAYA 1XMTA 4EE2A 2J6EL 5KEZA 3K9TA 5E9DB 3TTSA 3RZWA 1NFDF 2FJHB 3HG1A 4R5TA 2WKGA 2APVA 4WFHE 4OCXL 3FUFA 2BCMA 2I25N 4F58H 4M62L 1BPNA 3JV5A 4ODHH 2Y7OA 2WPXA 1RVFL 3KBEA 2HMID 5JHDE 1E9PB 4LSVL 5KOVC 3T3ME 3WOVA 4GAYB 4JDTH 3IFPB 3QFDB 2J6WA 4JN2B 2PYED 2FLMA 5F3HA 5KS9B 3SJEA 1NANI 3F8KA 2AP2A 4KKCD 5DR5H 3LOWA 1Y7RA 4FNUA 4KQ4L 4P2OC 5GGSA 2HVKA 4GT7A 1JPFA 4IBVA 1FNEA 1RZKH 1J0KA 2YQGA 4YXKL 4NZTH 3W0WD 4OM0H 2QFRA 5HVHA 4OKVB 2NCEA 5IB4A 1C5BL 5F3FA 5FYKE 1QKZH 1E28B 1YYLL 3ARGC 5I8EA 2YOCA 5C86A 1HQ4B 1W0VA 3GMPB 4NSKA 3SGJC 5JMOC 2Y5EA 2AJYH 4RETB 3IF1A 3MGTA 3CU7A 1DANU 4MJ4A 4P4EA 5ICXB 5L6YH 1ZDQA 4QGTA 3T0EA 4JPIB 2XKNB 1R4XA 4WCYL 4F9LC 1FJ1B 4PJBB 2M1KA 3AACA 3SQOL 1HOCA 3OJDB 2ISDA 3TL5A 4NNYB 4APQC 1FVCB 1NBQA 1DVQA 1HEEA 3BKML 4OQ1A 1IKOP 3ARFA 4N2NA 1FVDB 1GZQB 1WIUA 4OCSL 2VDQH 4EDWH 1NCJA 2PR9A 4K3DL 4EZJA 1CYGA 4QLRA 1GKOA 1FIEA 4Z77A 1PZSA 1YEEH 4Y1AE 3GS0A 4NWUH 3SHSA 4NIYE 2UWEE 4PJ8A 2B3RA 2HVJA 3CLEL 3P77A 5LLIC 4XVTL 2Z8RA 5CGYC 4DGIH 1EZLA 1P5UC 2DQEH 3N42B 3TNNB 3SOTA 4NLAA 3N1PC 4YQXL 4HIHB 5A6MA 2BOBB 2DEWX 1YEHH 2P6EA 4NHUA 2F54E 2E6QA 3H0TA 4TQ8A 5CHNB 3MRFB 1MFMA 4YBLB 3TJEL 5FPIA 4HGKC 4JUTA 4L4VB 35C8H 1NMBL 2R1IA 3MLZL 2JDCA 5AKVA 4Z7VA 1DZ0A 1I8KB 2AJZB 4EVNB 2ZYRA 2HLAB 2HH0H 4LB8A 2XZCL 5T3XE 3ML9A 4R7NB 2JK5B 4KKNA 1HSAB 4DN3H 4NJRA 4L8SA 2BZDA 2GFBB 3BMVA 2R59A 4OCRL 2VE6B 5C0CA 2VDKB 4O2EA 4UQ2A 3ROOA 3EYOB 3VCLA 3PGFH 4RISH 1NC2B 1V55B 3NN8A 3HC4L 3QWNA 3OQRA 1IKNA 4AK2A 2P7TA 3JWOL 5D7KE 5SWZA 1ZLWH 1WO2A 2BVPB 5A2KH 4PBXA 2NYKA 2ORBH 3FOLB 4YUEH 3T5WA 2JB5H 5I1HH 1L9NA 2ARJQ 3BUYB 3OKDB 5F9WC 1CS6A 4KZTA 2PWFA 4JRXA 2W60A 4EWTA 1CXLA 3KWXA 2YGNA 3FMCA 3MLUL 3STBA 3W0WB 1IYKA 4MD5A 1BQ5A 3KCPB 3EJYC 3U46B 2GSGA 4MRCA 3ISYA 2M26A 2D7MA 1VF5C 2X1XR 2J8RA 3MGOB 4GQ9L 3RRQA 2EE9A 3GYAA 3ZJ0A 2LU5A 4IBLT 4KBPA 3GMMA 1DJIA 3CSYA 2J1WA 4IRSB 4MFHA 1KEML 2D31A 3Q1SL 3VFOA 3PHSA 2ZOLA 4X0KB 1QWHA 4WWKC 2G4EA 5HJ3A 4HUUA 2WYZA 1BYOA 4QTHB 5DSCB 3KPTA 5AQ0A 4JX0A 2CIKA 5I6NA 5D7JC 3IFLH 1TU2B 3IU1A 4OZIE 1JTPA 4MQSB 3K81A 4FNPA 4Y4FD 2ROXA 1LEGB 3AT8A 3GHBH 4FL4C 1C12B 1M56B 4P2YA 3CC5A 3BJ91 2Z93B 3P30H 1NC2A 5D8JH 4HMEA 5DRXB 2BSEA 4RUHA 4JDZB 2OYMA 1VACB 4QXGH 2CPUA 5DK3A 3TZVD 1ZKAA 3QARA 4QOKE 3CFQA 4CPAA 2OMTB 2LU4A 3IJYA 1T03L 1RIUH 3QPXL 3NBNA 1LMIA 1S9VB 4H26A 4BD4A 2PVWA 3VSVA 5DVNA 3DROB 5I73B 2V3DA 5IUSA 1UCBL 4DH2A 1ZGLP 3QPQD 2Z35A 3O9WD 4N3UA 1M1DA 2ZW5A 1Q94B 3B9KC 2W88A 5DUJA 1DEEA 1G6RB 1UWGL 1CLYL 2XN1A 3BQUA 1RK1A 1T3FA 1Z9UA 5TTRA 3VFVB 5FFLA 1UT9A 4F7EB 3WE6A 1DVUA 1AO7D 4PJ6A 5EEXA 1JPEA 3AABA 2K6ZA 3HB3B 4XPTL 4YDZA 3T0WA 5FB8B 3ARFC 4U1HA 4Y4FC 2FLBT 5CBAB 3P2FA 3VARA 4APQA 5KZCB 2Q8BH 4K94C 3O3BB 4GKNB 3HUJF 3OPZH 3GSQA 2FVGA 4LASH 1Z7JA 3J07A 4F9LA 3D4UA 2R4RH 4ETQB 1N9PA 3ULVH 4IEFA 4U49A 1MN4A 3M8OL 5GGVY 4UAOC 3T0EC 3T65B 3EO9H 3QI9B 2WXMA 2EAEA 2P49B 4P23A 3MRIA 4HT1L 4UT9L 3F7RA 1OTSC 4TLSA 4HPSA 4MCQA 4NQSA 1M6OB 3RL2B 2Z3FA 2NY4B 5ADPH 1EFXD 5L8LB 3ARGA 2MHAB 4GRLB 3DX8A 5FVJA 2BSDA 2F54B 4ERSL 1RXLA 2XEIA 2ZW6A 4OJEH 1FAKT 3RKDD 3HN5A 2ZX5A 5BUAA 4MRBA 3FQ2A 4Z6AT 5IEKA 2JF1A 3UG5A 3EDFA 1KFGA 4HHGA 1QBAA 4FTVD 4W9FC 1JAEA 4NT6B 2P6GA 3GBNH 2WWKT 2J1KA 4JGNA 2A6IB 2Y1ZA 4N6RA 3RWCB 1MFCH 5JHBA 4LHUD 4Y89A 2UV3A 4CBPA 2XWEA 3P0VH 3AU1A 5HVHB 5FLVA 4G7SB 4EZKA 5MEQA 5IIEA 5JXEA 4MY3A 5C0GB 3BISA 5IFHH 2QGCA 1LHZA 3CFEB 4D94A 4M6MH 5J1TC 4BWWA 1E90A 3VYOA 2WSDA 5EEUA 5K8NA 4KKBC 3Q5YA 3QIWB 2BHFA 2UY6A 4ZS6C 2A2QT 4JM2A 4J5VA 4PJBA 1M6UA 1JK9A 1TVHB 1U91B 3VUAA 3BN9C 4J3OC 3FQNA 5JH9A 3WKMH 5HYSA 2PTTA 4IRZA 3AY2A 3EJZD 2AJXL 4X6DA 4ADIA 4K4KA 2YWYA 4WNQB 5FYLD 1MRFL 1INEL 2VR9A 3G5ZB 1B0WA 2HG5A 4YC2C 5ITFB 2H32B 15C8H 2IO5A 3W3BA 3ZDYE 5ID0B 5J11C 2ZUQB 3BPOC 3B56A 5I0WA 1FH2A 1HT6A 3SE4A 2WLJA 3RWIA 5F89B 3V8OA 5FEBA 4L8BB 1E3XA 1SLXA 2CTCA 5J89A 2R0LH 2VLRD 3ILQD 3BFWA 4MA3B 2IBGA 3IMSA 1EDYA 4LLWB 1RIHL 5D2NA 4JQVC 4EO5A 1BXXA 5JHLL 3BJ8A 1AS6A 1T1XA 2WYHA 3FB8A 4YE4H 4ATWA 2H0JA 4M48L 4QPEA 4YXLH 1KUYA 1FL5B 1LNUA 2JLMA 2WUBH 5IROD 3DMMB 3QQ4B 4OCWL 3X3FH 4XMXA 5EH1A 1FGVL 3LV3B 3QB8A 3JV4A 5LGHH 1NEPA 2CGYA 3GKZA 3JZ7A 5FUCE 1IT9L 2NDGA 3ZKSD 1YLBB 2FATH 3T0VA 3BWUF 2G0BA 4JDVA 5GS0H 3KGTA 1I8MA 4UBRA 1LP9F 3ELQA 3ALXA 3ETTA 3MV9B 3DMMA 5JLZA 1NCIA 2Z7WA 3F7VA 2ZXEB 4R8WH 1HI6A 5AVVB 3VE0A 4P4FA 3L1EA 1HFUA 3IXAB 2B3IA 1S8DB 4PD4J 3VQ1C 2AJ6A 1HHHA 2RCSH 2N7SA 1U58B 3MBWA 5ISZA 4X9YA 2GCYA 1H6UA 4P5TB 5EZOH 4M85A 3SYQA 1CMOA 4X6EA 2HB0A 3O0RL 3KWWB 2G3NA 1WFNA 4KVOE 4DP5X 2GFQA 4D9LH 5I28A 2FT7A 2F8OA 3ATFA 3CBKB 4NGPA 4WHCA 1HHKA 3IFNH 2VC2B 4G8FB 4M00A 4ZYKB 2DQJL 1SUJA 3MNDA 4ICXA 4LSRL 4YDLC 3FB7A 1M9WA 3JV4B 1R5WB 3U4AA 1JGLL 4H8QA 3TVMC 3DKHA 3T4AC 1QLEH 3GEWB 5HDQH 5CCHE 3O3DB 1ACZA 3QSKB 1BVLB 1CN4A 4AYSA 1HL8A 1YN6B 2GABA 4E5XG 2Z10A 2VH5H 3FF3A 1N0XL 2BVQA 3K91A 2J9AA 4ZXBC 4Q6IA 5PCYA 3TASA 4MXUA 3TPKA 1XF3A 3ZTNL 4A95A 1JUFA 4W6WB 3FTSA 1WSST 4P2CG 4UMGA 3ISZA 5IJVA 3L16A 1BMGA 3ZMEA 1MAMH 3U36A 5IB9A 4KRLB 4IGBC 2CIIA 4ODWA 3GSXB 2AV1A 3FQ1A 3LDBB 4WENB 4KJWD 3QULA 3TV3L 1UEYA 4HH9A 3RVTD 2YA2A 3A6BL 1BZ7A 5D1ZD 4Y2DA 4W81A 5TQ0L 1VLXA 4P5TC 1ID5I 4YDIH 3SBWC 5ID1B 1XR9B 3DO3A 4B12A 1ZTXH 3HI1B 2EDEA 2ICEC 1HILA 3DX6A 4XRCA 1ODAA 4XMUA 4FRWA 5IEHA 3UAJA 2NNXA 4YGVA 1ET8A 3HG0A 2BNQD 4AIZB 1KPUB 3KPPB 4PS3A 3BD3A 4BQ8A 4CMHC 2MCPH 4M7LL 4YDLB 3C6EA 2XVBA 3B4NA 3NDZE 3FX6A 3RNQB 2IV9A 4WW2C 3E1F1 2IQAA 3OAYK 3O81A 3P4MB 2BSED 2CMRL 1C5DA 4PG2A 3MPCA 3EYUH 3WNJA 3JRUA 2XWBB 2CNYA 3GMRA 1NFKA 2KDYA 1TENA 1S7TA 2CHWA 4MS6A 4BZ1A 3SO3B 4C7IA 4X9GA 3ARPA 1OSYA 3MNVB 3D3VD 5KANI 4LDCA 3BCDA 1NQBA 3D05A 3WS6C 2A4EA 3SE3A 3WMSA 4F33B 2VUYA 2R23A 2X42A 4YSCA 2CBMA 3O6LL 3M86A 3F64A 3D5OF 4BDVA 1KELH 2XWBA 3MODH 2F68X 5TDOA 1AE6L 4CADB 4MJ2A 5FGSA 4A2DA 3CZGA 1TKWB 5K39A 3D9AL 1RI8A 1A6TB 1G94A 1MHCB 4RZKA 1UZ8A 2KPNA 2KUTA 4WFEE 3WXVL 4MAYD 5KSVB 5DYOB 3B35A 4ISVA 2GITA 1MY7A 4MA7H 1KPUA 4UOJA 4YSPA 4YHPA 4XC1L 4IBWA 4HUUB 4P2RA 3FRUB 3ZIMA 5DD6A 1F90L 5FYJD 4IK7A 3T77B 4YDMA 5HDLA 1LD9B 2DLIA 5L88L 4QO1B 5F7KC 1IKFH 2OZNA 2X6UA 1ASOA 3V7MA 4ZFOA 1AZVA 1EHAA 3A22A 4FZ8H 3QO1A 4KPHH 1CUOA 1WBXA 3ETSA 3DUHA 3F3HA 2YEZB 2WYIA 4IKKA 5J6HA 1T0MA 4RAHA 2L7QA 5I9QC 4WTXA 3CPLA 4YWGL 5KVGL 4XNXH 3HCVA 1D3CA 1MRCH 1F97A 1MPAL 3BESR 4P3CH 2F7IA 4KAQH 2ZCHH 1I3GH 4QWWD 1MJ7H 1SYSA 2LABA 4YDKL 1RV6X 3V6BR 4FGMA 3PGDA 5ABZA 3FTYA 3CVHB 3BZ4A 5GRWA 5F9OH 5GRVK 2JKJA 3LQAH 2ZKHL 4IRZH 4PBVC 4DETA 4ZDHB 1NLDH 5IW3A 4AMXA 2XN9E 3HNVH 1F3JA 4NN7C 2QGEA 3VXTB 1NCDL 1V05A 4P05A 1WWZA 4UAHA 1W6WA 2NY5L 3FQUB 2UY7B 2AW2A 1Q0XL 4RWYL 3BJLA 4WI9A 3CVIH 3ZE1B 2ADYA 1A3ZA 5HHMB 2Y1YA 4L18A 3KW8A 4KUZH 3AS1A 4TULH 4MRIA 1WH0A 5BXFB 2Z6FA 5AB9A 3MA9L 4Z7UA 5AG9A 1G0XA 4R97B 4X7FC 3OKNA 3ZTCC 3ULUH 4B5PB 1W0YT 4GJTB 3V0GA 3SDDB 2EQDA 1F6LL 2NTFB 3FMGL 3LDBC 4IHMA 5K8MA 1MVYA 3DBXB 32C2A 5BO0D 3GLEA 3A6CH 1XSOA 5FHBH 5EEZA 4XC3H 2PCPB 1G5GA 1FZMB 3WL9A 3ZN6A 5C0EA 3QZMA 4R7MA 4NZUL 3IGFA 2QSVA 4JHAL 4PRPB 5EU6D 3RTQB 1TETH 2YQ2A 4LMQI 2DQGH 3GIVA 1TEFA 2BIMA 3BRFA 2HV2A 2ARJA 2BNRD 2WBJD 4UTAA 3KPNB 1DQLH 2VDMH 6FABL 3VFUA 3N7ZA 3VXQA 3C5ZD 2D03H 3QHFL 1E2ZA 4QR7A 2FGWH 4K3EL 5DRZA 4LPVA 4NNYA 4PIRF 2FWUA 2PVVA 5C0CD 2V7HA 1P7QA 4TNUA 1HZKA 5D1ZC 1BXVA 1LO4L 1PSKL 3EYFA 4OLUH 3SKUD 2P47B 2BERA 5MEND 4ZNEE 5DQJA 5C08B 3FT4B 1OGPA 4N8UA 2BIOA 2H6PB 2AK1H 4H4NA 5GRVL 1T21B 1FO0L 3PWVB 2EDLA 1CT8A 3NZUA 4QBJA 2WGXA 3O3EA 1JK8A 3ZT6A 2CXKA 1WC7B 5E08H 3HZ3A 4A04A 5CEYA 1CJWA 3EJTA 2K6WA 3WFCL 4Z7UB 4UV7L 4CJ1A 4P4RB 1UD3A 2H2PD 3DV4A 5I16A 3NA4A 4GW4A 1A6WH 3VXMB 4DUWA 1IBDA 1YECH 1NGWB 3QDME 4BH7B 3P4OA 1E6JL 4P0DA 1JFHA 1Q2YA 2R69H 1D5XA 1QWNA 3B1UA 2H9GA 4HWZB 3IFEA 4UV4H 4ABUA 1E5AA 2Q2LA 3KGSA 2ZOWA 4WUKL 4XCNA 2FO8A 4R4BB 2AJ3B 3PGCB 4HS6A 4OLWL 2VXTL 4Q9CA 4F5CA 1CFQB 1I1CA 3RA7L 3UJJL 3IJ3A 2NY7H 1IBGH 2GTZB 2QDWA 2X4PA 4FQXC 3NVQA 3P9LB 1A6UH 1NLBH 1EDHA 4XAWH 5E1AA 2CDGA 3TZVC 1XGRB 2DD8H 1JZ5A 1BQHA 1VB9A 3PWJA 3ULUF 4ZD3L 4L8CB 3SPCA 4P45A 1IAOA 3AGWA 1XGPA 1S7XB 2H1LM 1F4XL 1CFQA 1BHGA 3DDFA 4FZEH 5C07B 3STZB 1LWRA 2X4QB 4QHUA 1S5HB 1KJMA 4DSYA 4ORGB 5CEZE 1EERB 3ATDA 4PJFF 1GC1H 2WXGA 2EDHA 2D2CC 3F7KA 1NINA 1QQ9A 1R1CA 2L0DA 4MD5B 2ZD0A 4J3BA 1QG3A 4DJLA 3N9GH 1IFGA 3EF7A 4Z8FH 3MNVA 3AREA 3KG5A 2F08A 5DO2C 1AY1L 4Y1AA 3VXPB 4MBUA 2HP4A 1I1AC 3VRIB 1URZA 3EFDL 4C56B 5IB5B 3EDKA 1PG7L 3IKKA 4J3WA 3VX1A 4IIQC 5DK0A 1WDAA 3MXVL 2O5ZH 4NCC1 4OZ4A 2JMRA 4E2OA 1A5FL 4Y4HD 3ISWA 1A4BA 1L9QA 4KTDL 5DJZA 4HEMA 3T0XA 5JTWA 1AZCA 2AI0L 2HVBA 5B3NA 4BBWA 1KTLA 1WGVA 4YL9A 1MEXH 4L4TB 4MB4A 3UG3A 4B9KC 4EBQL 2CJSA 4UQBA 4LL9A 4OM0L 4Z76B 1KZQA 1U8CA 4HLZG 3QYNA 1JV2B 1C5BH 3CHSA 4PJ7A 3D4CA 1BM7A 2WQVA 1NKOA 1TIUA 2X10A 2GJ6D 1AANA 1BG9A 4AIOA 3QNFA 3BKCH 3G3LA 3IJSB 1D7DA 5JQIB 3L8QA 3KYAA 3NJVA 3MV7D 1E0OB 1DANT 4OAWB 5HHOD 1LEKB 3AG4B 3IYLW 4M5ZL 3GSUB 5SWSB 4A2GA 2A0LC 3D2TA 2F74A 3BP5A 1L7TL 3JV0A 4KZ0A 4JGJA 3SQOH 5ALBH 3PDOA 2QJDA