3MN8A

Structure of drosophila melanogaster carboxypeptidase d isoform 1b short
Total Genus 121
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
121
sequence length
391
structure length
383
Chain Sequence
KEDESFLQQPHYASQEQLEDLFAGLEKAYPNQAKVHFLGRSLEGRNLLALQISRNTRSRNLLTPPVKYIANMHGDETVGRQLLVYMAQYLLGNHERISDLGQLVNSTDIYLVPTMNPDGYALSQEGNCESLPNYVGRGNAANIDLNRDFPDRLEAQSRQPETAALVNWIVSKPFVLSANFHGGAVVASYPYDNSLAHNECCEESLTPDDRVFKQLAHTYSDNHPIMRKGNNCNDSFSGGITNGAHWYELSGGMQDFNYAFSNCFELTIELSCCKYPAASTLPQEWQRNKASLLQLLRQAHIGIKGLVTDASGFPIADANVYVAGLEEKPMRTSKRGEYWRLLTPGLYSVHASAFGYQTSAPQQVRVTNDNQEALRLDFKLAPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LP15968p
publication title Structure-Function Analysis of the Short Splicing Variant Carboxypeptidase Encoded by Drosophila melanogaster silver.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Hydrolase
total genus 121
structure length 383
sequence length 391
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2010-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00246 Peptidase_M14 Zinc carboxypeptidase
A PF13620 CarboxypepD_reg Carboxypeptidase regulatory-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1120 Mainly Beta Sandwich Immunoglobulin-like Carboxypeptidase-like, regulatory domain 3mn8A02
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 3mn8A01
3PB9X 3TX8A 3H8FA 3NJVA 1F2PA 1OBRA 1XBUA 3IJ3A 1HDQA 4KSIA 1FNOA 3S9LA 1Y7EA 3IWWA 3FH4A 4IHMA 4OC0A 2PJ8A 2XEIA 2ZEGA 2CTBA 3H8GA 3MN8A 1QMUA 2PVVA 1RTQA 4P4JA 1Z5RA 2BOAA 3JRUA 3WC7A 2PJCA 3PB6X 3IO1A 2GLFA 3NH5A 2C6CA 2ZEFA 3RZAA 4ZY2A 3B3TA 3ISXA 2PJAA 1BAVA 5D8NA 8CPAA 5ELYA 4NGTA 1YSJA 4OC4A 2PJ7A 3KQZA 2PJ3A 1Z2LA 2V8GA 3K2KA 5LYLA 2RB7A 1TXRA 1ELLP 1BPMA 2PIYA 2XEFA 4EWTA 3CPAA 5JM6A 4X2TA 4B6ZA 3D7FA 5D29A 4FUUA 3GUXA 4MHYA 3S9MA 4A39A 3CPXA 1VIXA 2PIZA 1LANA 4UIBA 3IC1A 4ZYQA 2ZEHA 2XHNA 1BPNA 2PJ2A 4FWUA 4FBEA 1Q7LA 1ARMA 3NH8A 1LAPA 2B59B 4P45A 1BLLE 1CX8A 5LRJA 5J1QA 4OP4A 4JZ0A 3K9TA 1ELMP 3KHXA 4ZY0A 3D4UA 1NKGA 5K8OA 2PJ0A 4F9VA 5G5DB 4OIWA 4ZY1A 1QQ9A 1CP7A 1VHOA 1UWYA 3V38A 5JH9A 2V8DA 2CTCA 2AFMA 4EMEA 1CG2A 3PFEA 1ZLIA 4WWVA 2QYVA 1LCPA 3D68A 5LRKA 3CT9A 4NJQA 3G3LA 4NGPA 3KL9A 1PCAA 2NYQA 4NGRA 3NJXA 2O4HA 2Q4ZA 4PXDA 2AFZA 4A37A 3L2NA 4OC1A 3FVLA 3N5FA 4OC5A 5K8PA 3D67A 3B7IA 4MCSA 3GLJA 4IAVA 1Y0YA 2V8HA 2HC9A 4ONWA 4PXCA 4MHZA 4FXTA 2POKA 4PXEA 3WABA 3B3CA 3NA6A 3NH4A 3S9NA 1YW6A 2ZOGA 4MXUA 4X8IA 2CF4A 5LYFA 4OMEA 4ZI6A 3RBUA 1H8LA 5HXDA 4U3SB 1VHEA 1PYTB 4P6YA 5THWA 3B3VA 2ZEMA 2PJ6A 4R7MA 4K3NA 4MRIA 4A94A 2WZNA 2JBJA 4H2KA 4EIUA 2IJZA 1CP6A 4MMOA 4NGQA 3IEHA 4MCRA 1TKFA 1TF8A 1TKHA 3NFZA 4A38A 1IY7A 4RUHA 4R76A 1Z8LA 4OKOA 3HLPA 3KI9A 1R3NA 2F7VA 2C6GA 2GLJA 5LYIA 5I4MA 1TKJA 5AQ0A 1IGBA 2AFUA 3WT4A 3FF3A 5LRGA 4PXBA 1XJOA 3FEEA 4CPAA 2ZOFA 4ZX8A 4IYKA 2WYRA 3SJFA 6CPAA 5CBMA 3WC6A 2AFXA 4UEFA 2G9DA 2XEGA 3PRTA 3FEDA 3FECA 4F9UA 4MHPA 3B3SA 3D7GA 1HDUA 1ZLHA 1HEEA 3T8WA 3FMCA 4P4BA 3LMSA 4EFDA 2EK9A 3SJEA 2EK8A 2JEWA 2PCUA 3KASA 4BD9A 1CPXA 2PVWA 4P4IA 1LAMA 3BXMA 3D7HA 4X3RA 2Q51A 3B3WA 3KQXA 1KWMA 3WC5A 4UEZA 3MRUA 2AFSA 3H8EA 2C1CA 4MCQA 2IQ6A 2OR4A 4YU9A 2PJ5A 4P44A 2ANPA 2V77A 3I1UA 5HVGA 4UF4A 4NGSA 2BCOA 3QNVA 1VGYA 2RFHA 3SI1A 4PPZA 3PB8X 1JQGA 4NGMA 2F8HA 1YW4A 4TWEA 1DE4C 2VL1A 2PRQA 4MCPA 4P4DA 5HVHA 1ARLA 1XRYA 3LWUA 4P10A 5K39B 3KR5A 2ABZA 1YLOA 2BO9A 1Y0RA 5JGFA 1ZG7A 4OC2A 4IK2A 4R6TA 1XMBA 3SI2A 4OC3A 3KR4A 1TF9A 5K8MA 5F09A 2AFWA 2PJ4A 1LFWA 1ZG9A 3TC8A 1YMEA 4F8ZA 3V7ZA 4PQAA 3D66A 3IIBA 2PJ1A 2IMOA 1M4LA 4NGNA 2FVGA 3DGVA 5IB9A 4WJBA 3BHXA 3SI0A 4FAIA 4Q7AA 4GM5A 3HN5A 2DEAA 2O53A 1XFOA 2ZEDA 4O23A 4W9YA 1F2OA 4DUKA 2Q43A 1GYTA 5LYDA 3ISZA 3PB7X 2HB6A 5HVFA 2OOTA 2ZEEA 3DLJA 2XEJA 2CIJA 5K8NA 4FL4C 3KGQA 1DTDA 1R43A 4JYWA 3HUVA 1FT7A 2I3CA 3D7DA 3SJXA 2NSMA 3PBEA 1F57A 1AYEA 4YWYA 4G1PA 4AXVA 3FX6A 1CBXA 3KCPA 4LQGA 3IFEA 2V8VA 3KZWA 2EWBA 3RAMA 4WI0B 4P4FA 1CPSA 4Z65A 3PEIA 3SJGA 2PE3A 4OIDA 2QVPA 2ZEOA 1AMPA 3E8VA 3PB4X 3B35A 4P4EA 3GB0A 3PBBA 3FJUA 3KHZA 2QJ8A 1NSAA 1LOKA 4NFRA 4TNUA 4ZX9A 2JBKA 4NJRA 2ZELA 3CDXA 2PJ9A 1ZG8A 2J9AA 2C6PA 2GREA 2ZENA 2GU2A 4DJLA 4DYOA 4MHNA 4UEEA 5DS0A 2ZEPA 3PFOA 4UIAA 1EE3P 4R8FA 3VATA 3VH9A 3BI0A 3BI1A 2PJBA 4YOKA 2AFOA 3VARA 5CPAA 7CPAA 3B2YA
chains in the Genus database with same CATH superfamily
1FV1A 1GS6X 4BFIA 1GJUA 3ARQA 4ZZKA 5EOTB 3LS5H 1HEHC 1GOHA 2ODIA 4P3DB 1S7UA 4QT5A 1MJJA 1GYCA 4L23A 5CN2A 1T1YA 2J6EL 2Z6FA 3CDCA 3KCWA 3O8XB 4EE2A 4O02A 1M3IA 1M4IA 3W37A 4B7LA 1RUML 1FNSH 4PJHA 1U58A 4HLZG 3KGRA 1YJDL 4AZUA 2YBRB 1NC2A 5EV7A 1KJVA 3BKCH 2W0PA 3L4XA 3GSOA 5EBGA 4C56A 4PREA 2P80D 4N24A 5FCUH 4JMNA 3RDJA 3U4EA 4UCPA 4CYNA 5I9QB 5AW8B 1KTDB 3QHTC 1KDIA 2XYCA 3FQUB 4LZKA 1TJHH 1ZLSH 2GLFA 1SJXA 2ICWI 2KLSA 4JRYB 4XNXL 2DQJL 5CGMA 3O3DB 1FDLL 3FU9A 4UDTB 4E36A 3BH9B 2UVFA 2AQ1A 5D1ZA 3BRGC 3NZUA 5F1IA 3NP3A 4TUKL 3IJSA 1MIML 3KQZA 4N6RA 4NUGL 1FPTH 4N9GB 4ZUWA 3QFJD 4CGOA 1ZMYA 4X98A 4XAWH 2G30A 2HVJA 5JM6A 1A25A 3JV4B 1GGCL 4UF7C 3JWOL 3MA7B 3QUYD 4BE6A 3HE7C 2BNQB 1CICD 2O5YL 2K5TA 1D5MB 3GUXA 1PY9A 4I77L 1HI6A 4PCYA 4NO0A 3ZHDA 5KSUB 3EF7A 4HKJB 2H6UA 3ORJA 4GAYA 1KXHA 2WVVA 3FZUD 1C12B 2BP3A 3NCCB 4O4YH 3CFKB 5FV1L 4UIBA 3BP5A 5JUEH 5GRXG 4HALA 3RGVA 2EDQA 2WV3A 5IHBA 4RZKA 1UWGL 4HJ0D 1UVQA 3HS0C 4IJTA 4JCLA 3MROB 4E9SA 1BD2B 3BVXA 3FONA 5FUZL 3CVBA 1U8HA 2LR4A 2V2XB 1S5IH 4OLWH 5C0BE 3ROLA 2NYZA 2Y2WA 5FFGA 1SN0A 2MQCA 2IADA 2BVTA 2O6CA 3QZNA 4X8CA 5CNPA 5EUOA 1KEGH 2VEZA 3ULVE 4TULL 1NGQL 2UWEF 1BYPA 2H0FA 3RILA 3BZFB 4HD5A 4M8UA 4MSWA 5F3HB 3T2OA 3SDDD 4PG9B 5DRXA 3FCGA 3PABA 2MOQA 3A21A 3BLNA 1XH3A 4KUZL 4KQ0A 4XOBA 1UOVA 3QUZD 3L5IA 1IL1B 2B1OA 4GG6A 2WB7A 1RSYA 1MPAH 5GGRY 2WVSA 1DDHB 3QCUL 2Q8AL 4ZJ9A 4HUVA 1I7RB 1Z5LB 4Y1AA 2HV2A 3MCYA 1U6AH 1G9ML 1QLFA 1MCOH 2XIIA 1T1XA 2HH0L 3LZFH 4JFYB 3SCMC 4HIHB 5DHXB 4AE1A 1GJWA 3CHXA 5DWMA 3Q6GL 4F0YA 1TZIA 1CG9B 4WIQA 4UQDA 1FF5A 4O2FA 4JAMB 4AEIL 2PXYA 3D39D 4WNSA 2AV1B 5TQ0H 2DI8A 2ERJC 5K9JH 1BWMA 3ETBJ 3FT4B 5CGYD 3T0AA 5I1HH 4N90D 5HHQA 1JGLH 4NKQB 3HHSB 5IESH 3N5FA 5D2NC 4U3CA 4P2RA 1IZKA 2OXGA 4L29A 2FNBA 5E1AA 4AMXA 5C6WH 4OLXL 3WN5A 2C4FT 2DQTL 2IWFA 3QIUC 1AIFA 4HFUL 3GIVB 1NEUA 2Z3LA 3NABL 4M1CC 4NKIL 3O2VL 1BZ7B 3QDMA 1WFOA 3ZIYA 1MWOA 1I53A 2IO5A 3RWIA 3TYGH 2VW6A 4NC0B 3WMPA 1X12A 2HC9A 1KB5L 1LO3H 2H32A 4CNIB 4FXTA 2JLPA 3P9LA 2ZAHA 1UWEL 4PMEA 3WEXB 3VG9B 3LNGA 3NA6A 5D2LF 3QIBD 4F80A 1MRCH 1L7IL 1B6UA 1BECA 2WP3O 3EJSA 1TEGA 3H85A 1DDTA 3IDYC 4IU2B 4M9PA 5GGQH 5LYFA 1EEQA 5E7FA 3V4VL 1DQJB 3DUHA 3MX0B 2Y07L 4OD2A 5DRZA 1WA1X 1H8LA 3HUJF 2VDLH 1BG1A 2EDJA 1IC4H 5A2KH 1DLFH 4W4OA 5F6IB 3BGAA 4LARH 4P3CL 3R06A 3OKMB 4OGAD 4GG8B 1N6UA 4NQTA 5I5RA 5DMGD 3GBMH 3IJEA 3X12B 3DIVA 4ALAH 2HVBA 3DBSA 3BESR 3H3PH 2HUHA 4JKNA 4XVTL 3D0LB 6PAZA 3WL9A 1ZGLA 2HPTA 5JW4R 2IJZA 4CADB 1F4AA 3LIZL 3EYUL 1SJEB 3QO1B 2FHCA 5G1ZA 1TF8A 2VABB 2PABA 5L88H 3VXMB 5F88B 5CLWA 2X4NA 1IGIH 3NFZA 4QD2E 3OKDB 4DQOH 1YMHB 2AJSH 3ENEA 2WUBL 3G5ZA 3MLRH 3NZHL 4V1DA 1XO8A 4C4KO 4R96B 4P4KA 4P5TC 4AW7A 4HOWA 2FGWL 1IBBA 4PLKC 5IFJA 1TKJA 3H7LA 1Y9WA 2WLYA 5F1NB 3JUYA 3U7WH 2R2HB 2Z7ZA 4E9VA 5IKCB 1T22B 1M4DA 3WT4A 4XB3A 4L05A 1KIPB 5E8NB 1WEJL 2X70B 3RVTD 1Z9SA 1WGOA 1LDSA 1QFUL 1W0YT 4UV4H 1I1CA 1AS6A 3U6XS 4IJ3C 5IREA 1EJ6A 2WANA 4U1IA 5E9DB 5TDNA 5IB0A 5BUAA 3FMGL 3BFOA 5L2KB 4OIBA 3RNQA 2D73A 1KGUA 1R57A 3FFCA 4U6HB 4ZFGL 5D1XD 2JXMA 4P9HH 3UABA 3BZEB 3TCLB 3MGDA 1YY9C 3RVXD 3QCVL 3FSZA 4XPBH 4M62H 5KSBF 4JO5A 4KU1A 3BLPX 3O2DL 1XT5A 4DEUA 3T8WA 1GTNA 1YHPA 3FU7A 4Y89A 1EDYA 4ZFZB 4ZDHB 4P4BA 1YC7A 1CFQB 2H6PA 1ONQA 3WN6A 1QNZH 4P9ML 1LO4H 2IVFC 4P2QA 3WCYA 3EH1A 2PVWA 3WU1A 3PHOB 1ZY9A 4ZPTB 1DBML 1RI8A 3O6KL 4OQ1A 1AR1B 1LD9A 4RMSA 2J3SA 1AZVA 5E23A 4H0HB 3IETA 1EWHA 4PJIA 3ZKND 4Y4HD 1YEFH 4N2FA 1A6VL 3UBHA 4F5CA 3MKGA 3E8UH 1QEXA 2QSTA 2ZSVA 3SPCA 3ASWA 3P4OA 3OB8A 4MS8C 3W11C 1L9OA 4AH2B 5E6SB 2AXHA 4LB8A 4QJ4B 3KNBB 1YUKB 4A04A 3H9SD 3WI9A 3PAZA 3OXSB 5IBUB 3QDJB 3V4PL 4BZ1L 1P4IH 3OSKA 1KNOA 4K5MA 4NRYB 4BSJA 1DZ0A 5C86A 1F4WH 1JZHA 1HXKA 4CS0B 1BQ5A 3VFSA 4CVWA 3WXWH 4KK9D 4JQVC 3PP9A 2COQA 5DQDH 1TITA 1A9EB 1CFTB 3ASNB 4HFWA 2D9QB 3VX1A 4YQXL 1BFVL 4XN4A 5CJXC 2A4EA 1ROWA 4HT1L 3VB9A 1XXDC 4IK2A 5HYJA 4NQCE 5GS2D 1YDPB 4YC2C 4NSKA 3UIYA 5AW0B 3V6OC 5IJCC 5JA9A 2GT9B 5CBEB 1WFJA 4OGYH 3ET9F 1ZTMA 2NLJA 1R46A 2EDNA 2QVFB 2XYBA 2WNWA 2ZCKH 5AKRA 3ZVVA 3KR4A 1LWRA 2ZJSL 4LRNL 1GGTA 4ODVL 5EWIH 1LO0H 4FFWD 4LKXA 3IU1A 2MMXA 7CGTA 1TOXA 4GXVL 4PH8A 5F09A 3CC5A 2YEZA 2EYTB 4HS8L 5F7EL 3NEOA 3CCHB 5I1EL 5DZPA 1P0SE 1SVCP 1UJ3C 2CDGB 1CXHA 5D71H 2X4SA 3IJ7A 4LGRB 4B97A 5IHUH 4XMPH 1WUZA 2EH8L 5A2IH 4XC1H 1D9KB 4RIRA 1EAJA 4Y2OB 1HQRA 1IU8A 3AMLA 3RGHA 3HG1D 3F7PC 1B87A 3UGXA 2QPFA 3L8QA 4PMFA 3TYFB 1WP6A 2AJUH 1M05A 2YN5A 4O23A 3QISA 4W9YA 4YDMA 2OQJA 3CFQA 3D3VD 5IIEA 2CDFB 3ABZA 3L9RB 3QFGA 3CPUA 4UAOB 2OJZH 3SODB 1QBBA 4WI6A 1AKJD 3MV8A 1HCFX 2J8HA 4FI6A 1XD0A 4DP1X 4Z3FA 4ZSOA 1IEAA 1T6BX 2EDOA 4XBPB 3OL2A 1D7CA 1A1MB 2O30A 1C1EH 5K9QG 1FG2A 3TIEB 2VLJE 2PUQT 3STLB 1LQBC 1SYVA 3UY5A 3SJXA 5HGAB 4G7VH 1IGML 3KYOB 2YD7A 4BK4A 2PCYA 2PCPB 3APMA 4LU5H 5D4JA 2JQAA 5DD1H 2DWDB 3V5DA 5KZCD 2P0WA 3ZT7A 1Y7VA 1BQUA 1JPSL 5E4IA 4JVUA 2AJVH 1OT4A 1A7OL 1A5FH 1FC2D 3NJKA 3QR0A 2N1KA 2WLNA 4LQGA 3MRPB 2CXAA 4QHUB 3WJLC 2BSBA 2ENSA 4N8VG 3KYAA 3RY6C 1CGTA 3ALPA 2G4EA 2OL3B 1OM9A 1T7WA 5ALCL 1OARH 1GW6A 1FGNH 1SY6L 1V10A 2BIMA 4G6KH 2AQ2A 4X9HA 1ZE3C 4AM0B 1ETA1 5C3LD 3FUHA 3GSNH 3UTSE 5JYMA 2VDMH 3L9BA 4NBZB 1VACA 4NJ9L 4MXWH 3PB4X 1MCDA 2L8AA 5F9WB 1SYSA 1JTOA 3ML8A 4JFWA 3DYMA 4KROD 4MBOA 4IK6A 1EXHA 4PVMA 2DL2A 3KCPB 3MRGA 4KKBD 4X5LA 5D96B 4NENB 4FHBD 2ROXA 2V17L 4MA3B 3TLRA 4NF1A 3OAYH 3NE7A 1U3HD 3DO3A 1TQTA 2V9TA 2X3BA 3BFWA 2JCWA 4QOKD 2WINB 2MKWA 2DJSA 3S3CB 1OSYA 3W0WB 2F5AH 5BRQA 2KT6A 2WGXA 5ECGA 4QDGA 3IGFA 3BP6A 1JNNH 2GU2A 3FUIA 4Y49B 4DYOA 3H0TA 4K3DL 5KVEL 3PFOA 2QQKH 4L8SB 3QHFL 4Z7WA 4CGNA 4UIMB 4QRRB 4CYQA 2DJUA 3FO9A 1JNLL 4MLSA 1YPZB 3DVNA 2WBJB 1UKSA 4OIAA 4KXZI 4NAJA 3WIFB 3NGBB 4N2MA 1XBRA 3PB9X 4ZUTA 4HS3A 3MXVL 5D72L 3K74B 2DDQL 3O6LL 4CL7A 5TQ2H 4U6XB 4D9QD 1FO0A 1JRHL 3VFRB 5IWLC 3CZFA 2BPBA 2CMRL 4P4RA 2FCBA 4K4KA 5DFWH 1JF6A 2Z31D 4KSIA 3S9LA 1J8HA 1J8RA 3A6BH 5H2BA 1PIFA 3RFZA 3MRNA 3P3UA 3N6YA 2IFFH 2YPLD 1EMTH 4FNLH 3VXTA 1BFSA 1RZ7H 4FJZA 2XV3A 4PRHB 5D1QB 4OSUL 1U4FA 2C1PB 1LEKB 3OKEB 5FPIA 2OMUA 3VD1A 1JV2B 1N3NB 2EZ0C 3V5HA 3V6BR 2IXQA 2FECL 4PCTA 2ORBH 1XGYH 4PS4L 2VDOL 2XA8L 2B3VA 3O9WC 3S3SA 1TQUA 4HCIA 1F58H 1OEZW 3U36B 1P5VA 5T5FH 3JV5A 1Z5YD 4PJ7F 2FT8A 2EP6A 1TXRA 2WNGA 3B1TA 2G5UA 4FS0A 4HUXB 3TVMA 4BFRA 3GJFA 4JPWH 3S0PA 3EXLA 4AVBA 4AEHL 2AK4A 2RBLA 2BP8B 3QDGE 4K23H 1QSEE 3B6SA 4JMXA 2Q1EA 4LKCA 2HWZH 5EU7C 2OMXB 2OPCA 3CVHL 4R7XA 3VQ1C 1MFDL 4YHKL 2CJUH 1DR9A 2ZZUT 2QIRA 2AAAA 3QWNA 2D7QA 2IAMC 3BWUF 4ONGL 2H3XC 1DQMH 4QRBA 4QXTA 1X5GA 4WFGE 1A9BB 3ULSB 2QBWA 1NMAH 2GTQA 1N0XL 4X0NA 5GJTH 4FZEL 4M4PA 1I7TA 1J5IA 3N2JA 4QRPE 2PJ2A 1ZS2A 2CK0L 1Q7LA 1NZRA 4BJLA 3BUTA 3P0VL 4H44C 4FTVE 4KRNA 1F6FB 1I82A 1U95A 2GABA 2H8PB 3CXHJ 1MCHA 2JCCE 3PWNA 4ODUA 3QUYC 3KR3L 1MKFA 1WITA 4XVJL 5F0JB 4R4FH 2CXKA 1M9WA 5D9SA 1CICC 3RWFB 5JHAA 4FI8A 1S7SB 4NHCL 3GI8H 3ZZIA 4P59H 1JG9A 1NKGA 4OZFA 3ZDXE 3IJYA 3FT0A 4XVSL 1AZCA 3TO9A 1KXTB 3QGVA 2W0LA 5IHHA 4OIWA 1EUUA 3GJFK 1VHOA 4YPJA 3GMOB 3PWUA 4C54A 4U0QB 2BDNH 4HP5A 3T8XA 5CGTA 3LKSA 3FZUC 1OWWA 1U2HA 4QUSA 1OCOB 4R7VA 1YGHA 1JV5A 3U30B 1XGQB 3MUJA 3H53A 3FO1B 3PFEA 3DXAB 1LCPA 4HJ0C 5DLML 2PO6B 1DJYA 5H37G 5T1LD 3GHBL 4X9YA 4PWEA 4KV5F 5DVPA 4YUEH 2X09A 4OGZA 3KL9A 4H26B 4DVRH 4YFDB 3FB8B 1IGFH 2UXFA 4FQXD 4TSBL 3ASOB 2EE9A 1RURL 3ZRSA 3MBEA 5EC1B 1QRNA 2A83A 2HX8A 3C60B 4OJEH 4XC3H 3PE9A 4PRAA 3AREA 3SDDC 2O6DA 5KS9E 1M1DA 1D6VH 3G5YA 1P6FA 1EQWA 2GSIA 3QRFM 4Z8FL 4HHAA 4JY6B 3MZGB 5C0RL 1T21A 2VIRA 1OK0A 2H4EA 4ERSH 1VEPA 1B4JL 4L8DB 2WQAA 5JOPD 3JVGA 4MNHB 1BVLB 4YX2H 5E5LA 3WO3B 3TNNB 2BX5A 2IQ9L 2NXZD 2Z3OA 1IGTB 2BWQA 3UJTH 3KPQB 3HJ0A 3NRQA 5GS1B 1B2WL 4U1JA 1G9HA 4W9LC 3ABGA 1TCMA 1IKNA 4PJDB 5GGTH 2X4RA 1PCXA 5C8JA 5L6YL 1R24B 4ZOCA 1FNFA 3Q8FA 1L6XA 5CGYC 4X8IA 4XH2A 3S36H 1RZQA 2IOOA 3QEUA 1P4BH 4LQ1A 4X5KA 2AGJL 1I4FB 1QSFA 4BFFA 3TO2B 1G6VK 2ESVA 3D85B 4YE0A 1QBML 2XKNA 3FRPA 5DJAB 3MRBB 5M94B 2VQYA 1J87A 5THWA 3NA4A 1IQWH 4XN7A 3OKLB 4RGNE 5HJ3A 3RWDA 4FXGC 4EBQL 2PJ6A 4MA7L 3B7TA 5KN5B 1J5CA 1QNIA 2Y7MA 4F8QA 3FTUA 4HDIB 4PGEB 4Y19D 2VXUH 1JN6B 2H1PL 1MH5A 4KJQD 1JZ6A 5D2NB 3GS7A 2PW2B 4WU5A 5I30H 3TWYA 3OJMB 4B53A 1CD1A 3QIBC 5D70H 3L3HA 5F9AC 3VUAA 3KLHD 4M6NH 2FBJL 3DUUA 3GSXA 4B13A 4AK2A 3VXUE 2O1AA 4OIIH 2VAAB 2OYMA 1T20B 4X4XA 5C0JA 4PTUB 5IVZA 4P2AA 1IGCL 3RI5K 4PUBH 3T1FA 5AQ0A 5DD0L 1JZ8A 2IALB 4NSQA 2NUTB 2VDLB 3LH2H 2XZAL 5DMGC 3GRWA 3FF3A 1FFOB 3UC0H 1AQKL 2W95A 3WENA 4DEPC 1WZLA 4M48H 2WQVA 1GZPA 2E6PA 3H6AA 3FUKA 1VSCA 3T6VA 1BZ9B 1SDDA 1TQWA 3HE7A 4EN3B 2JJTC 4KQ3H 1FL6A 4OLUL 5LAXA 1KLFA 2X28A 6CPAA 4E8OA 1Q90A 1EUTA 4KHTH 3NCJL 5FO2A 2D3JA 4NZ8A 3DK0A 5FYJU 2XCMC 4X5WB 4BK5A 4JLRB 3QAZB 4HAKA 1LLAA 3SJVE 5KWYC 4MHPA 4KVCH 4AW4A 3EFFA 4N2OA 4NUJB 1INQB 4LXFA 2EO8A 4M3KB 4QXGL 4Y2NA 3BPLC 4YHLL 1I8IB 1AOZA 3ARUA 4JVWA 4XNMA 4Y1TA 2W0FA 5HDOA 3HS0A 3QWRD 2VWEE 2XVLA 4HEMA 5A43C 4J8RB 3ARPA 1TJMA 2JQZA 1CLOH 5I8KL 4E9XA 3MRHA 1ZVSB 5JIHA 2J5WA 1JK8B 4ODHH 1QQDB 1JWMB 2PWHA 3BCFA 4ADIA 4OFIA 3QIWD 3KVDD 1YECH 1A4KB 4IEFB 3AACA 1X4ZA 1UM6H 4DPCX 4MCQA 4GAGL 2WXHA 1MW0A 1MVUB 5FO9B 2Q9OA 3MYZA 3TONA 3A6CL 3LXUX 3NCEB 3NTCH 5D1XC 3V0IA 5E6IA 3ZKSD 2Z4TA 1BSIA 4WI3A 3QG7L 2RFHA 4ZPVA 1CXFA 3R8BB 4BXVA 3ABMB 5D1ZI 3E38A 1YEIL 4IHOA 3MRLA 4QY8B 2W94A 5INDA 3FQ4A 4NPYB 1E8XA 3WLWC 5D8JL 3AU0A 2OR7A 3OKKA 3SCMA 3SGEH 4JFDE 4KUAA 1JHTA 1L9NA 3U2JA 1EX0A 2C1OB 3IKKA 3C8DA 4B9GA 4P4DA 4C2ZA 1XBDA 4HEPG 1JXGA 2XV6B 1U3YA 1IM3D 3HR5A 2BH0A 3UTTD 2AJXH 3V0FA 2B5GB 3D12B 3GO1L 1DBBH 2FUQA 4EDXB 3VM5A 4YLBA 3SB3A 1XF5B 1I1DA 5DZLA 2GVYA 3ECBA 3B5GA 3MV7D 4GMSH 1R3JB 4JM2A 5DJCA 1R0AH 2Z92A 1XMBA 3QIUA 1A7RH 4GFXA 4UT9L 4OAEA 4KXCA 3F5BA 3PYCA 2N56A 4RFNB 2NQDA 4L4TD 4NCC1 2L4OA 1Q1JL 4IMKA 2E9IA 3O3AA 1PF3A 1UT1A 2Z35B 2D03H 4U1KB 4YHOL 1J5HA 4HGWA 2C3XA 5D5MB 1JBJA 5HI4D 4H5SB 4G8GA 5FO7B 4TTGA 4KK9C 3E6HA 1V0CA 2ZG2A 4F8ZA 5A16B 2R4SH 2Y06L 5B21A 4UM9D 4ORGB 4L1DA 1XH0A 2J43A 4PJCA 5GRJH 3UO1L 3VXNA 4B9ZA 2CR3A 5B3SB 1T4KB 4JO4H 3T3MF 3VJ6B 5I28A 3DGVA 1T5WA 2PCFA 1B4TA 4MJ6A 4Q7AA 2YAEA 4MHHG 2ZEDA 2CGRL 4GSDL 1ZDSA 4EJ1C 1W72H 4HBQA 1T1WB 4XCFL 5KAQG 2A77L 1YYCA 2LAAA 1KCLA 2DD8H 1Q9LA 1AXIB 4XPAL 3OG4B 5GS2H 3KWWB 3VA6A 1KCVL 2HMID 1OE2A 2ADIB 3S35L 1KCUL 3ZE0B 3CK0H 3I6GA 4EAEA 3SPVA 3LPWA 1MCWM 1DQLH 4YXLL 4N0FB 4NQDB 2VLLA 3HUVA 2WKLA 5IB1A 1R3KB 1E4JA 4RAUA 1Z8WA 1Q0YL 4L3EE 3S88L 4P5TA 3TNMA 2Q86B 2XV0A 2OMYB 1JYVA 3T4YB 1AGDA 5KVDL 3MUY1 3F05A 4OCSH 5LG6A 3NJIA 3KGTA 4JGNA 1QEWA 1B90A 2EYRA 4J3UA 5F3FA 1WWZA 4A2HA 5J12B 5A2AA 4DEWA 1A6WH 2WQSA 2F19L 3FUNA 3EO9H 5FUOL 4C8XA 2P6GA 3LN9A 2I9LA 2WBWB 1MW1A 4UZSA 3IGLA 2K78A 5I18H 4XRCA 5HHOA 4M85A 2IFGA 1MJUL 2EDBA 2LVEA 4WZ9A 1P7QB 1VESA 2F54E 3B2VH 3DHPA 2AJ3A 5DJ0B 5CN3A 4XPKA 2WN2A 5HMNA 3G3SA 1CF1A 4R7NB 4WWKD 5D4QA 3VH8A 4P99A 5GS0D 1I8MA 3PL6B 3Q48A 3B35A 1SNRA 1M1XA 2R4RL 4L0PB 3ZMNA 2BJML 3OAZK 3ZL4H 2E7LA 4ANVA 2C7UB 1A6UL 2VZTA 4HULB 2B8OT 5I8CA 5C9JB 2QJ8A 1EFXD 1KGWA 1PQZA 3FDWA 4H25B 1S3ZA 4JL2A 1DL7H 1EHKB 1Z9MA 3GHEL 2CH8A 4BQCA 1F1AA 4R7DA 1AFVL 3QG6A 4LQ6A 1CE6B 2CK2A 1JP5A 1HH6B 5JHBA 1MHEB 2C6PA 5DJ6A 1CDJA 4JFED 4PJFE 3EG9B 4JN2A 4NM8L 5FECA 4PJ9B 2W91A 1ZHNA 4RETB 3DV6A 4EUPG 4Z7VF 1EAPB 4JRXD 4IOSD 3ARGD 4IDJL 3WFZA 1SXZA 4I0CC 4YDIH 2JJSC 2DQ6A 3RIFF 4JQIA 1T66C 4L4VA 4RBPH 4PWHA 1PLGH 3GSNB 4P46A 4XCNA 4Q2ZB 4NO5A 5C07D 2HFGL 2VDMB 2VLRA 2K45A 2XKSA 1PSKL 5CCKL 4QCIA 2OJEB 3H8FA 5D4IA 4JFFA 3F7VA 1VFOA 3MJ9A 4I9WE 4GS7C 4ZFQA 2WXJA 2VXSL 1XSOA 5IMOA 3ARDB 1KTJA 1GR7A 4S0SD 4LEXH 2RA1A 5JHDA 2WO3B 4NHUA 4Y4KC 2YFOA 4KI5E 3DV4B 5BVPL 4M8QB 1DSFL 2I85A 2YN3A 1THAA 1IC7L 2B2XL 4A68A 2J8OA 2GIMA 3HFMH 3DR8A 1HHGB 1G7PB 2DQIL 4H20L 1K8IA 5CJXA 4EIGB 4TTDC 2GBUA 4J4PD 4E9YA 2PPAA 3BQVA 2D2OA 2LLLA 3ZE0F 5DVNA 4C2XA 1EK3A 2CGYA 5IQLA 4HK0A 3V6OA 1AO7A 5DC4B 1BW8A 3F01A 3GLZA 4NZFA 4KY1H 3B2UD 1BREA 4G5AA 4NI6A 3VRIA 4N5EC 5AAWA 5C0CA 3DRQB 3R7QA 5B7FA 2VSKB 4ZW8A 2C6CA 4RAVA 5EU3A 3GSRB 1VJSA 3OMAB 4H0GA 4AVKA 2MEJB 2PR4H 4RDBA 2E4FA 4H1LA 2DMGA 2XWBA 5EFIB 5IROD 2UXVA 2HN7B 4I87A 1J0KA 5AYUH 4AY0A 5BMFH 2Y5EA 2WWNA 4WHTB 1UZ6E 2OK0H 3POHA 2PIYA 1TZGH 2VBQA 3A67H 2NDGA 2FEEI 4PY7A 5BRZD 3RWCA 2G3ZA 4ZQTA 5I1LA 3ULVL 1MJAA 1UXSB 2R29A 2X12A 3F12A 3MMEB 1DBKH 4PP1C 5HGBA 5IMKA 4XCYA 2PPEA 3VD4A 1KBKA 1T04A 3JUWA 3FCUB 3C5ZB 1T3FA 5H37H 3N41F 2O61B 3BLBA 3BDYL 1UHVA 3QXAB 5FB8B 2IH8A 1MWAA 3D7PA 5EPMB 5JIDA 1AS7A 2G3XA 5EBWA 4D0BA 1NDMB 3MRFA 4NI3A 1NAMH 1ADWA 4G2AA 2GITB 4OH2A 2NPLX 4AKPA 3S5ZA 3EJUA 1L9PA 1ORSA 1PZ3A 2XHNA 3MLVL 2P8LA 2E7DA 1F3JA 1MQKH 2NY0D 2RQEA 1KBVA 4FFZH 1ARMA 2ED9A 5HYEA 3BYTA 1CGVA 3T2PA 2ED7A 5SX4H 2JIXD 2NY3D 4XO4A 4R8WH 4UAHA 3D4CA 3F62A 1RJZA 2UY6B 3EAKA 3IDXL 4PCKA 4HIIA 4DUWA 5F49A 4MFHA 3BQUD 1X5AA 1JI1A 3RY4A 1YNTA 4MGXA 3A22A 4AQAA 2V5RA 4JFTA 1GGUA 1GOFA 3WJLA 5KYUB 2RC4A 2GIVA 5FW6A 1LK3L 2RACA 1RUKH 5D93B 4YDVA 4PJXA 4X9IA 3UTQB 1EIBA 3RBGA 2QR0B 4FLRA 3KS0J 4GO8A 1E27A 1XF4A 3DGGB 5HYSG 1BM3L 5FKPB 1EVUA 1KGCE 2ZPAA 1S7WB 4OTXH 3TTYA 5M7QA 5E00A 2CBMA 1INDL 1MQ8A 2NX5A 5DSCB 1CDUA 1MFUA 3R1KA 2ATRA 4OV5A 1AXTH 3FOLA 1R5IA 2EABA 3QEHB 1OGAD 2FL5A 5HDQL 5CSZB 4WSJA 3UAFA 5EBLA 4D94A 4GXUN 3NYKA 3QZOA 3HHRB 2UY7A 4B9KC 2ZNXA 3L7FB 3THMH 3QFJB 5F7MC 5F7AA 2NW2B 3QJFB 3E6FA 2NY5H 2EH7H 1J0YA 1DYZA 3D4GA 4GAJL 4Z7AA 4JDVA 1FVEA 2ZOKA 1FZJA 2A6DA 4XXDA 1AGFB 4ES8A 2ADJA 1NFAA 2NY1D 3BEVA 1HTYA 2YD2A 4JFZH 2JJVA 1KJ2L 2UZYA 4XAKD 5IW6A 3NT0A 4QB9A 4A33A 4NKOB 5EF1A 5TE6H 4HG4J 2GQHA 4JM4L 4H8WL 1AQ8A 1OVZA 3GK8H 3QUGA 1FGVH 1GGIL 5DMIH 1GAFH 4S0TD 1IZJA 2C26A 3NH4A 2BXYA 5DTFB 3S96B 4M29A 2Q6WA 3C09C 1RU9L 4WK2B 4ILDA 1MI5B 4GMTH 5C2BL 1RZKC 3ABKB 5IWLA 3K4ZA 5F7YC 4KMLB 3OAYK 2DIJA 4LL9A 4MB3A 3IYLW 1I1AA 3S8WA 3U82B 4U0RC 2YD3A 2AQRA 2A9AA 5K9KA 1U3JA 3T6ZA 2WKOF 5FYKD 1H9DA 1RH8A 4JEGB 3AC0A 2VYRE 1YC8A 3RYOA 1I9RL 4WHYG 3BH4A 5JW3L 5KOMC 5F9DC 1U33A 1YEHH 2NXZC 4LCUB 1ORQB 5LBSL 3WSQL 2MHAA 3LAFA 3CPLA 3WJMB 4WQOA 4R5TA 2H45A 2KERA 5K69A 1EERB 1NJ9B 5FWRA 3QUZB 4BA8A 4LCIL 3TBVB 3WKML 4TSAH 1TTGA 1DP0A 1RIUH 1MFNA 2Q7BA 3CBKB 4OKOA 2XN9E 3NH7L 3GSUA 3O9WA 3KI9A 4TPRH 2GLJA 3FRUA 1FBIL 1KB9J 1YEJL 1IJ9A 2AFUA 4RQQA 4RX4A 3QXVA 1C5CL 3RTQD 1RZ8A 2WXPA 3Q5TA 4A7SA 4TUJB 4WI9A 2OYKA 3T71A 3D39B 2KLTA 4AL8H 3JXAA 3BEWA 3F7YB 3BW9A 3BOVA 2Q20A 3MOBH 5F70A 2AJYL 3L5XH 2W1NA 2P1YA 3FB6B 1AJ7L 4HIEB 1BOGB 4PRPD 3CSGA 1LEGA 1AHWC 4MAYD 1BBDL 4KJQC 1UUSA 2YJLA 4M4RB 5DHDA 2HRGA 2EEXA 1CLYH 1F86A 1OP3H 1AYRA 4DH2A 2AK1L 4PVLA 5E2VL 4B5PB 2DWSA 1UYWL 2IAMA 4Y9EA 3DHMA 3MCKA 1W91A 3PRTA 3U0PB 4RCAA 2NTSP 2ZCHH 1QZNA 4Z95H 2O28A 5I17B 3B83A 1QSMA 4XOCA 4PJGA 4N3UA 5DZ9A 1ZGLM 1YMMD 2E4TA 4E9RA 1T5XA 1PUAA 4N0YL 3GWJA 3TBSB 1ETJA 4U1HB 5KJRL 4UFXA 3RGVB 1ZA6B 4EFDA 4WRLA 3S34H 5KUMA 5C0NC 1XL6A 2BIOA 4X7TB 4F1SA 3QIBB 2C34A 3FHQA 1WFTA 4IM8A 4XMTA 2WQUA 4XCCL 3NFPB 3UPCA 3KYNA 1BBJA 1S78D 5AUMA 5CMAA 2Q51A 4EDWH 2KZ1B 3WC5A 3KJ4B 3O3BB 5D7IA 1CICA 1PAZA 4RGOH 4U2ZA 1MW3A 2YKKA 3CHPA 2KDGA 3M1CA 3HCVA 4IGBD 3VG0H 3MRMA 2IQ6A 2Y7SA 2FWLB 2FCKA 1NGYA 3RNKA 1KY7A 5IT2H 4RVBA 1ACYH 4KMTL 2ANPA 3U6RB 3QNVA 2BZCA 2Z4QB 4Z7OF 3N44F 1E5BA 2GTWB 1DLHB 3BP4A 3ZTJH 5IR1B 3R1GL 2R15A 4G5ZH 5KTEH 4AXWA 3UZEA 1YW4A 25C8L 3ZSSA 3KPRA 2NOYA 1MW2A 2BNQE 1VADA 3I50L 3LNEA 4ORZC 4M6OH 5TE7L 1Z32X 1L9TA 2DLFH 2WIIB 3OHMB 3MRDB 1YX0A 4A31A 2C3HA 3LEXB 4ISVB 1AIZA 4CILA 1A3QA 1I3RB 1WAAA 1ON0A 4W9CC 3QIWC 4Y2LA 4HKBA 5TFSL 5HY9A 3DA0A 1CYWA 1OZPA 5HHQB 4PJHF 4DN4L 3IVKA 3SDDA 3VWJB 3JT0A 1QABA 2AQSA 2DYPA 5DJYB 1LK2A 2PR8A 1RHFA 5SV3A 1BMGA 4UU9A 1BD2E 1HHKB 2PCXA 2GPZA 5E8DH 1FYHB 1CUOA 1E7VA 1OY3B 4FHKA 1UADC 2PJ4A 4DGVL 1MLBB 3GF8A 5D1XB 4U9ZA 1LEIB 4LQFH 1ZLWK 2D7TH 1KELL 3MRKB 5AG6A 4YRHA 4LCCC 1TEFA 2AHIA 1DVQA 2AERT 3ERXA 4JXRA 3QULB 4ZFOB 3UJIL 1MHPH 3VYOA 1Z3GL 4ETQB 4YGVB 4WJBA 5JNYA 2R1WB 1GY2A 5KYXB 2EDWA 4FAIA 2NR6C 2OCFD 1VAHA 4APXA 4HWNA 5T1MA 4YVUA 5EC2A 1F8TH 4EI6A 2CPUA 1HL9A 3R06B 3BYYA 3SKNA 1DVYA 3F7LA 1KN4H 4FXGA 3LSOA 4NYLA 5ESAA 1TJGH 3KGUA 3FT3B 3TT1H 4Y4HB 5ID1A 1G0DA 2KLRA 1Q94B 4Y7OC 4Z3JA 2CIJA 4WSGA 1UH4A 3PGFL 2VH5L 2VO8A 5FKAB 1JDAA 4J5VA 1Y9KA 2CALA 3H9SB 1YNLL 3DSNA 3NA9H 4KVPA 4ZMTA 2R0ZH 2R69L 2I9TB 1E67A 4DGIH 1TJIH 3APCA 3NPSB 3OLDA 4NUMA 4YSCA 3WFDH 3D7DA 1JF1B 2Q7SA 4CW1B 3ZO9A 4HJJH 1VGKA 2CE6A 2J8RA 4JHBA 2W65A 3IRPX 1A66A 1JZ2A 1MEXH 4Z77A 4XMZA 1GS7A 1HJBC 4I1PA 5D4HA 4HOXA 4UT6H 4GW5B 3TIDA 4EUPH 5HVFB 3UIZA 5EUOF 1C9SA 4HOZA 1Z9SB 3EDDA 1V54B 2AVFA 2W81C 3HN8A 3T9WA 1W72B 4MMYA 2V8VA 5F7BA 3MNZB 4OFKA 3ARXA 5BZWA 3AB0C 4J3OD 3AADB 3EGDB 3G6JA 4HKZA 1PTZA 2HMIC 1IAKB 3VMOA 2WQWA 1I1RA 3CTTA 1HCYA 1CPUA 2JJTA 4Z65A 3ILEA 3ZZQA 5CJOH 4RZCA 4QLWA 2RFXA 3QB8A 3OXRB 4PWGA 2FWUA 5E4EC 3ZKXB 3FFCB 1HINH 1UD3A 4FQHB 5JW4Q 3DIFB 2OR9H 5ADOH 5MENA 3W5MA 3FUJA 4RGMB 1GJIA 4P4EA 3V4VA 4FAAB 2X89A 1NM4A 2O6PA 4LPTA 5B38B 3N0PB 3KH3A 1OOAA 3D4ZA 4G6ML 4QHNA 1KUVA 3KPNB 3ATBA 2E9JA 2YKLL 1E4XL 4FERA 4JRWA 3ROOA 5AB2A 3RWHA 2P8MA 4OFPA 2H1LM 3MFFB 4PK2A 2ZOLB 4ZMZA 1L5GA 4AC4A 4ZOBA 2Q0ZX 5B4MD 5A40E 4FFYA 2NNAB 5IEKA 2BVEA 2GREA 3HG1B 4LP5A 3DSFL 3H55A 4Q4EA 4GBXC 4TVSa 1Z9LA 1XF2A 2F1AA 1JCKA 1AP2A 3R0NA 5T1KD 1JWUA 2ILLA 3K0YA 4UOZA 3D3VB 2CUAA 4G9DB 5ACZB 3T0BA 3TO4C 1EJFA 1KFGA 1XF3A 3ATEA 3EZJB 4TVPE 1KJ3H 4ZNEE 3BT0A 4JZOA 4R3LA 3VMPA 3HZKA 1IOIA 1MAJA 1G6RH 1AKJB 1DVFD 3AABA 3WNMA 4WJKB 3CQQA 5GS0H 2OSWA 4JREB 1E3FA 2IAND 5E9DE 3QXUA 4UT7H 5T1DL 1N59B 1FZOB 5L2KE 1GSKA 5IVXA 2BCKA 4V33A 4GSXA 1GKEA 3I2CH 1L9RA 3Q2WA 4FP8H 2VRKA 1NLDL 4MQSB 5B1JC 3WFBH 1T5KA 4HK3J 3LEYH 4ZO7A 1ZT1A 3Q43A 4AV4A 2YQGA 2CA3A 4KZEL 3D2UB 4KPHL 5EORH 5IK3B 2ZEGA 4WV1C 1G4MA 1E0OB 3PDOB 3DMMD 3ARGC 3T0DA 1HXMA 2XY2A 2JKWA 2MTPA 5BV7C 3JYCA 3QCTH 4JO8A 1LVEA 1IB5A 4P5KB 4Y4FD 3O2DA 3TN0D 1VPOL 2TSAA 2F5BL 2NLJB 5AVTB 3WC7A 1YEKL 3PWPD 3EFOB 1KYOK 3VXPA 5C0IB 3NH5A 4NKMB 3JV0A 1J8KA 2PJAA 3MLTA 4J3OG 4OZGB 3MREA 1UOWA 2UX7A 3MJ8A 4Q0XL 4HWUA 4N8VA 4FADA 1LE9B 3RAJL 4UTAH 3BAWA 3SKUD 4KROB 4ODWA 5DS8A 3TWCH 4MMZA 2QTVA 3DNSA 5G4NA 3VFOA 2XBZA 2YOCA 3IDNA 4BQ9A 3B2MA 4RWYH 3EXJA 2K1MA 2VSCA 3SDYH 4EN2A 5HD8D 1U3HB 3NACL 4X2TA 5CFHA 5HYFA 3LQZA 3VTMA 3PXJA 1PZ5A 4LPCA 4QOKB 4I0PC 3J7HA 5I15H 5D29A 3WIHA 3KYMB 2VDRH 1L7TL 3HE6D 3QDJE 1YN7A 2WB1A 4PJBA 4PVBA 1RUQL 3R19A 1A6AB 4JG0L 3B2UC 3F84A 3IGRA 1MXDA 3VFMA 2ITCB 32C2A 4QTIL 4A39A 3JTTB 3GMMB 1VZIA 3VYNA 1GY1A 1S7XA 4XPGL 4E2AA 4QRPD 1CR9H 3N1PC 2B4CC 5FXCH 1U8QA 3L4ZA 3U1SL 4YR6A 3EO0A 2ZX9A 3R96A 4U4IA 4AB7A 3L4VA 5IROC 4FTVD 3FFOA 5IMMA 2P42B 1H19A 2LU5A 2Y23A 1ZANL 2LLNA 3BAJA 3GSQA 4OZIA 4FBEA 5FWQA 1TDQA 3PHQA 3SQBA 1AY1H 5DEZA 4OZHA 1KUXA 5K93A 1IVLA 4KUCD 4HYTB 4NN6B 2BLFA 3QQ4A 4XP6H 1EHLH 4OFQA 1B0RA 3FTGA 1KXVA 2NSXA 2Z31B 2FK9A 3C5XA 1IX2A 4AIZA 1R5VA 2PJ0A 4PJIF 1KYAA 2EIKB 4HMDA 4GO9A 1DQDL 1VZHA 1YQVL 2YPLB 1UKTA 5HYQA 1MIEH 2GFQA 4F7KA 1AD9A 4NO2A 2F58L 4K3JH 4ODSL 1URIA 2YUVA 3VGEA 4NP4H 1U8PA 3NIFF 1NAMB 2DF3A 2JF1A 3CNKA 3WEMA 1J5OH 2DICA 3QNYA 2HG5B 4HS6A 2FHFA 3BO8A 3SBQA 1XX9C 1DHKA 2Y3AA 3ULUF 2FQFA 1BLNB 4YAQB 4OLEA 2B20A 2QT6A 4D0CA 3Q01A 3WTXA 1NMTA 2R1YA 4YIQA 3VWKC 1EZVY 2COVD 3MJ9H 3I3BA 4TQHA 1I1YA 2X9YA 4E0RA 2QHRL 1VFBA 3PDGA 4GP5B 3WJJA 5F1OB 2ITDB 2DJMA 5KBMA 2FWOA 2NCMA 3CBRA 5D7LD 1EAQA 4HQQH 3V95A 4AT6B 3EOBA 1U8OB 5CEXA 3D3SA 1JHKH 1E2ZA 1FFPB 2PPDA 3T9YA 4LIQH 5J56B 1ZA3B 2R2CA 4CVXA 4GFTB 1BIIA 1WFNA 2WPGA 3D9AH 4QR7A 4S1QH 4P0DA 1FL3A 3GMNA 4MJ2A 3TFKD 4GKNA 3DROB 4XP1H 5JDSB 1FP5A 1CVSC 3GKZA 3QZPA 1EH9A 2JJSA 2JQMA 4MHZA 1KTRL 2EYSB 4N2KA 1U8MA 4PYHA 2WXIA 3MUUA 5D6CB 1OPGH 2EDXA 1NWPA 1GA2A 4HXAL 1K5WA 4HS3B 3DUSB 5C7XL 4MXUA 5T5NF 1F0LA 4NWTL 2PETA 2EBJA 1WCQA 5BZDA 1M6OA 1ROCA 2ADGB 3CZFB 4APQC 4OCNC 4Y4KA 5GGUA 3P3YA 1QRKA 3HBPA 1SY6A 4ACPA 2J1KA 2JDCA 1UT2A 3JQOB 3QZMA 3V9CA 4XBGB 5EIVA 4D0DA 5CFAA 5CINL 4PJEB 1GZQB 4WJ5A 4FULA 4ANUA 1OP4A 4Q9RH 4L5FH 5ETUA 1EO8H 4XP5H 3VXUD 4HXBH 1ZHBB 1CL7I 2DWEA 3TO6A 1Z3RA 1WIPA 2APFA 4GUOA 1NFIA 2NY4D 1HXYA 3TEWA 3N0AA 3W0WE 1ZRUA 4CA4A 3UACA 3W39A 3HVNA 1VFUA 4R76A 4BA0A 1IFHH 1ZLEA 5DD3L 1FJ1A 4MFJA 4EI5C 5LYIA 5T1LB 3CMGA 4PM1A 4NQQA 5EU4A 4B50A 3MBXH 4P57A 1O6SA 1FNGA 1UD5A 1Q0XH 1QSOA 2Z3MA 4FQXB 1NUDA 4FNRA 4G1EB 3C09B 4ZT1A 3VWEA 4QRRE 1P7HL 2Z91B 3TVMB 3FEEA 1YPZE 4WFED 3V55A 1UXLA 3MLUL 2O6EA 1MAMH 2VXKA 1IBDA 5DD6A 3SE9H 4BKSC 3NAAL 2DKSA 4QYOA 5EO9A 3QEQA 5FYKH 3VDBA 3BSHA 4XP4H 2TSBA 4U0RB 3QUML 5EZPA 5C6TL 3TFYA 3CN0A 3EDFA 4GPVA 4URTB 3P2TA 2NYKA 2NSQA 1MRFH 3ML9A 2HJKA 4CSPA 1A1NA 3RX9A 2BMKB 4PGCA 1KLGA 3IXTA 1IFGA 1MREL 2NXZB 2ICWJ 3ZMEA 5DJXA 2WAQA 2AXWA 4KO5A 5IB5A 2EKSB 4JJOA 4Q52A 4UCFA 3FMCA 2GTZA 4NZUH 5JPNC 3RTQC 2ISDA 4KKCD 2XZQH 2HKFH 4O5LL 4P06A 4UZUA 4LDOB 4ZMWA 3CHSA 2EUIA 3JWDL 4QRFA 2G9KA 3C5SB 3LJ3A 4RRPG 3U4BL 4PRHE 4RISH 5D1QE 1BQHG 4F7EB 5I75C 3KBHE 3MLSL 1GOGA 4S2SA 2VZYA 2FQDA 4ODUB 4CN4A 3MRUA 2V7HB 2RCSH 3OBAA 1LE5B 4LVHC 4F57H 4CGTA 1LNUA 4HH9A 5E8EB 3DX8A 2E8ZA 2W07B 3NRFA 1J0JA 4XPHH 1HOCA 1A7BA 4XVUD 2FEJA 3CLEL 5E2UL 4G8IA 2OTWB 4D8PB 2DQHL 4OJFH 3VGFA 1NMCC 1UZGA 3IF1A 5F0MB 3HB3D 4MJ5B 5E1IA 5HGDB 1KCSH 4Z7WF 2V77A 3ZRCC 4Y19B 4NLAA 5JW4M 1U9KA 3Q1SL 3HKFA 2WC7A 4JFXB 1VZGA 1IT9L 4EQ3A 5IHLB 3N85H 2F7OA 4EZLA 2NY2C 2K4WA 2XEFA 1S7NA 2H1XA 2UZPA 2Q3XA 4PR5B 2PRQA 4K9EL 2VR9A 3RDTC 3V0AC 4JY5H 3PJLA 1S78C 2XSKA 4L2LA 1YSOA 3RPIB 1ARLA 3QRLA 3QZWG 2N7SA 2J1ZA 3TT2A 4P10A 5EU5A 1L0XA 1CN4A 3UJJH 3D5OF 3QWOB 4GKLA 4IGBC 4UOQA 5IB3A 5EBMA 5AB0A 4LAJH 4PRAB 2E56A 4KXDA 4KJWD 5E5MA 4ZUVB 4JUSA 2DQDH 5DS1A 4ES9A 2N4IA 2BS8A 3MRCA 5IGXH 5I6KA 3VXRD 1E28A 4PWIA 4AMKH 4WEUD 1QBLH 4ODTH 3DI3B 5HVHB 5C7ZA 4DETA 5HBBA 1JZFA 4LPWA 3E0KA 2DRUA 1XDTT 2KPNA 3FO0H 2VW4A 3LKOA 1K2DB 4MFPA 4ZMXA 3QP3A 1K4CA 1M44A 3H9ZA 1E50A 5ISZA 1N9PA 4AWJC 1FHGA 5LWYH 3VI4B 4PJAB 1FFNB 3QPQD 3F8KA 2GBAA 2C9QA 5A7EA 1B9KA 4LMQE 1HHIB 2Y7QA 4C57C 2O53A 1XFOA 1T0PB 2K70A 3JZ7A 2UYLA 3DXAE 4CGLA 1OSZB 3C5JB 3IGAB 4LSVH 2BP5M 5F44A 2CHWA 4JE0A 4YO0A 5FA3B 4UCMA 4GO6B 1CZ8L 5AVVB 4HLEA 1MHHB 2CKBH 2VR4A 3LDBB 1BM7A 1MNUL 4OF7A 3TL5A 3EOAB 1RZGA 4YXKL 2G5BA 3CFDA 4LSQH 2QKIB 4WWID 1RZFL 4PRIA 2Y36H 4A2DA 4WO0A 4ELKB 1QSTA 1OAQL 4QPEA 4L3ED 4A6YL 2BHFA 2GCYB 5TPWL 5ITBL 4JYWA 4TXVB 5J6HA 2RGSA 3MI6A 3II3A 2I3CA 1SRDA 5EUKA 4NNXA 1X9RA 1BFTA 3ARBD 1BF8A 3HNVL 3G5XA 4X83A 2J6EH 1QLEB 4I88A 1A9VA 1OSPH 4PGJA 5LHDA 1WWBX 1EV2E 1AD0B 1IM3B 1RUMH 2A9BA 4HIXL 4E68A 3UTTB 3B4NA 2W9LA 3NE8A 1YJDH 4UQIM 1D5XA 3IRZA 3OTTA 3V6FA 1NGWB 5KTAA 2VXQA 3IFPB 1U21A 3W57A 3SDCC 3T0ED 5I24A 4PJDE 1AHWA 2VDQB 3PWJA 3DO4A 3U9UB 5EMYA 3MV7B 1A14L 1CPSA 35C8H 4HEPA 5ID0A 4HKFA 1A6ZB 1QWNA 2WLMA 3HI5L 4IRJD 5F8QC 1FG9C 4WO4D 4QRTB 4XNXH 2DQJH 4L4TB 1FDLH 3B37A 1H8NA 3CXDL 3EBIA 4RDQG 3GB0A 4D9LH 4AJ0A 3CDGB 1NDGB 4TUKH 3QEGH 1MIMH 2R59A 3BUPA 4NUGH 4ZODA 3VX0A 2PSWA 1BX2B 3TASA 5H84A 4N3TA 1JD7A 2ZUQC 4UM9B 4R2GC 4K7FA 5EIIG 4ANKA 1GGCH 3ZKQD 4X6EA 5K59E 2A2QT 3JYBA 5C08A 4HPHA 3RVWD 4EUPB 5CJ8A 3VFWA 2PJ9A 2IJ0C 4J3OC 4I77H 3CZLA 3GXNA 4MXVE 3WXVL 5GHWL 1IE4A 2ZUTA 1R3HA 2X41A 1EE3P 3SBPA 3CX2A 3WMSA 3VATA 5IQ9A 2CO7A 2A5UA 2X6BA 2QL1A 3RI5F 3HMXL 3MGAA 1OHQA 3FTZA 1AMYA 2AMUA 2VSMB 1UFGA 4KK6D 1NCWL 2YGPA 5FUZH 5KYWA 3X3GL 2Q8BL 1E42A 3KL0A 4BE5A 5B3NA 5I1DA 3I9AA 4HGKC 3E7JA 5JYLA 3OKKB 3PQYD 5B4MC 3US1A 3OKNA 1W6WA 2ZF8A 4F8NA 2W80C 2APSA 2CJ3A 4KH9A 4MJIA 3CN3A 1NGQH 3QIWA 2BY0A 3ZTDC 2W38A 2A0LD 1CFNB 2C8NA 3MNWA 4OLYL 3EYVA 1YN6B 4L37A 3BUQA 3I75B 4KUZH 4M7LL 4MD4A 3W91A 1W6LA 4KOCA 2BP0B 3FQ1A 4D9RE 1X5MA 2Q8AH 3QCUH 2P5EA 1LP9B 4LP8A 3G6DL 2ZX5A 4YK4C 5E99L 4L0ZA 4G42B 1DVFC 3WE6B 1G9MH 4BZ2L 3DRTA 2HH0H 1G6RB 4U1SB 4ZY2A 2GFBB 4I4WB 1AG0A 4WWKB 2YGVA 2IV9A 3BI9X 5AALA 1OGSA 3MLZL 4M7ZC 1MCSA 1SXCA 2YD4A 3O6MH 2WM0A 4LCCA 1AZZC 3VSVA 1CGSL 5KYYB 1KIRB 1R5WB 2BSEA 3S98A 5IEHB 2XWDA 5IBTL 1EFXB 3DPBA 3QJTB 3EGSB 4OUUB 2FO4B 1AS8A 3CPAA 2E27L 5L7XL 1EZUA 2SEBA 1Z9NA 4JB9L 3D7FA 4OLXH 2FEDD 2NR6A 1ET5A 3EH4B 3LH9A 4ICXA 4HFUH 2B3IA 2B59A 1HSBA 3NABH 4X6DB 1N6QL 3JWNH 3NIDF 4NKIH 3O4LA 1TO4A 3O2VH 4Y4FC 3LX9A 3TN0C 2ZYHA 1A3ZA 1T7YA 4JRLA 2XG4A 4WFFE 2XRAL 4F15C 1DJZA 1E4HA 2B1AL 3WTVA 3BC9A 4RFEA 1KB5H 2YD8A 5HPOA 3TCVA 4WV1B 3U48A 4JRXB 2DM3A 2OBGA 3II1A 1EEYB 4IMLB 5AW3B 5DMKA 3GHPA 4FQPA 5FA4A 3X14A 3GXIA 4QHKI 5F7DA 1L7IH 1KXQA 1PNCA 4WCYL 2DMKA 1EZSA 5C07B 3HMWL 4Z7NB 3AUVA 4MNQB 4IKKA 3V4VH 3TZVD 4DZBA 1LJMA 2ZOWA 1RUAL 2Y07H 3ESNA 3A24A 3GBDA 5J1QA 4HJSA 5HD8C 3MNVA 4OP4A 4P3CH 4BYHA 1XZ0B 2PYED 3H9HA 1VKXB 3WFHA 1ELMP 3HE6C 4Z7VE 3NSFA 4GNKB 3MRQA 4TLUA 4XVTH 2VDRB 4YPGA 2GI0A 3SKOB 1X5IA 1S7TB 5D5ME 4HPOL 4HOMA 3LIZH 2V8LA 3WHXA 3EYUH 2XX1A 4Z7QF 1UWYA 3B9KD 3C8HA 1BOYA 1VFAB 2VOTA 3DO7B 1KGCD 4OCYH 4QNPF 3EJQA 1I8KA 1OD9A 3CAFA 3KDMA 5DZOA 2WUBH 1ES0A 3NZHH 2CGZA 4FQIL 5I1AB 5FYJL 5F2FA 1ITBB 4YZWA 5LRKA 3VFTA 3QR2A 5CR8A 1K8DA 3U2SA 2XXMB 1M42A 2QADD 2FGWH 4L3CB 4F8PA 1GXEA 4C7HA 2XWTA 1N19A 3OB0K 1H8OA 3GMQB 5DYOB 4U3XA 3GJEA 5K1VA 3S6GA 3UZVA 1IBHA 1WEJH 4ZYKB 1Q38A 2X6AA 3T3PB 2ZOTA 1QFUH 2HJFB 5DQ9A 1CLZL 2WXQA 4QHPA 4OD1L 2VZZA 5PAZA 3ZE0E 4AENB 1WO2A 2OMWA 5AKSA 3QQDA 2EUVA 3FYIB 3FMGH 1Z5HA 2A6JB 5BRZB 5J89A 4JHAL 4MRBA 4JM2F 3DK2A 1LP9F 4MVBD 4NQDE 3TA3B 4GBXA 4ONHB 4ZFGH 1L9QA 2A7BA 3H2WA 4V11A 2HAZA 2ZP9A 5JORA 1IQDA 3X1GA 4WFHE 1TNNA 4GUPB 3DX4A 2MPAL 3KLQA 3KEDA 5DK2B 2QLVB 3I84A 3QCVH 5DWUL 4FMVA 2ZAIA 3KYKL 5FOBA 2VR3A 2XVBA 5D7KD 3TO4A 3JBG7 4HISA 5C1MB 2VL5A 4Y5XA 2POKA 4FG2A 3JTKA 3DDDA 2AI0L 4LVOC 3KPSA 2AXFB 1XR8A 4HK3N 1G1OA 3LRGA 2OYLA 4P9MH 1SJHB 2H6OA 3ZHKA 1GZHC 4PJCF 3ZXAC 2NY0B 1EANA 1OB0A 4R9HA 1DBMH 2BOLA 1X5XA 2OZ4L 3HPLA 3O6KH 5EU6D 1TVBA 3ZZSA 3O41A 2JIXB 4HWBA 4HZAA 4J6RL 4XX1E 4YNYA 2NY3B 5F89B 3BWSA 3G5VB 3IWUA 4QTHB 4JFEA 1FAIL 4FMFA 3IFNL 2VJ8A 4RS2A 2ZYRA 5B1JA 4Y2DD 2QQLL 4DP9X 2F53A 4NBXB 5CCHE 3SZ6A 2WZ6A 1T7XA 1A6VH 3BQUB 1KCKA 2B15A 3WDIA 5ABDE 3IDJB 3UTOA 4ZS6D 3TFKC 2MNJB 5FF6A 4NGQA 1P4LB 5BUPA 3ARGA 2CLZB 3PREA 3PY9A 4FA8A 1BZOA 1UOLA 3FBKA 3VE0B 5B39G 3V4PH 4BZ1H 3V6ZA 3OGOE 4XMLL 4XNUH 3G08B 3A47A 3NP4A 2F8VA 3RE0A 2J8MA 3VXOB 1IGYB 4FZ8L 2B4BA 4JFSA 5LCVA 4MD5B 2EIZB 2HFFA 4D3CH 1Z8LA 4BFGA 2ZKHL 4J7RA 1UXWA 4Q6YA 1UD8A 3VXSD 4RGNC 4KHXL 4P23A 4G11A 1KGXA 3FCTA 3L95B 2DY2A 2X38A 3X3FL 3Q3GB 2QVIA 2X2YA 3H1ZA 4OI9A 12E8L 1HDMA 1WC7A 2IQAB 3EIFA 1OGAB 3O4OB 4YQXH 1BFVH 2QSVA 1D5ZA 4HT1H 5G4MA 4X6BA 5HYSA 3OQRA 4Q4IA 5DS2A 5I5JA 3K4DA 1S7FA 3RKDC 5E8PA 4I0PA 3EJYD 1AQHA 3KHQA 1XGUB 4ZUSB 5TK2A 5JLZA 3SJFA 3PV6A 2ZJSH 2AQTA 4GIOA 4LRNH 4IIQA 4ODVH 3VMNA 1MHCA 3WC6A 1TYEB 2AFXA 1E65A 1NA8A 1T3FB 1AE6L 3H9YA 4GXVH 3HW7A 3EBAA 4HJEA 2LAGB 3O6FC 2NY4C 4HS8H 3P2DA 3D25B 5F7EH 1NEZB 5I1EH 2XOTA 2NY1B 5KSVB 2Q0YA 4NLHA 1NANI 3B3SA 1J9QA 2XPGA 5FGSA 3DNKA 3X1NA 4DKEL 2H0PA 3VFGL 2K0RA 3QT2A 1CGXA 3KVQA 4WKZA 1NWOA 1HEEA 2R1XB 4G70B 4X7EC 2H2SD 4LVNC 2Q7NA 2EH8H 3T3PF 1ORSB 1DTUA 4OT1H 5GSVB 2MFNA 2EK8A 1WBYA 4P49A 1UXMA 2OS7A 3PWLA 4FD6A 1E90A 2AABL 4ABQA 1N10A 1LAMA 5HHVH 2EDRA 4BM7A 4G8EA 1TCRA 1MCEA 5JQ6L 3B3WA 3NZ8B 5K9QI 4IU3B 5CP7A 4FFTA 5JMOC 4W81A 3QFDA 3GKWL 4NNPL 3H7BA 3GIZL 4NZTL 4GS4A 5KTCA 3OF6A 3CE1A 3OHXC 2UUDK 1FVCA 2KHAA 5I71C 4I5BA 1PY0A 1NTDA 2EO1A 2NNRA 3MPCA 3JV6A 5DJ2A 2YPKB 3NFNA 4YHPA 1X9LA 2VWEC 2HSIA 2O5XL 3UYPB 3ZHLA 4UV7H 4KKAD 3T6XA 3ZSTA 4P3WA 1UB6B 4I48A 4ZTOL 3PB8X 1CGYA 3OGCB 4YHMH 5EMIA 5FHAL 2LTQC 1WFUA 3K6DA 5C0BA 1IE5A 1V3LA 1ZVHA 3P3TA 4IRZA 1DE4C 4K71C 4TWEA 3TC9A 3TP4A 4G43B 3ZDZF 2AS5M 5L4MA 5KSAD 4H8HA 1CFMA 1IGMH 3ATDA 3VFPA 3QUKA 2WCPA 3BPCA 1D5BA 1PDKB 4W9IC 3TXAA 3LWUA 1JPSH 1RUPL 4N1CA 3BGMB 3VWKA 1OO2A 4DWHA 1A7OH 4JJXA 1JGVL 3QJXA 3F65A 4FNQA 1WBXA 3CSPA 2F6AA 3SKMA 3HB3C 5BXFB 3LD2A 2NXYD 3BVWA 3VDAA 3WDJA 4JG1L 3NG5A 5ALCH 2Q76B 4L8CA 1F41A 8PAZA 4PRPB 1SQMA 5D7JA 3QORA 4MAYB 2E6QA 3OC8A 4XVOA 3AAZA 3FU3A 3MYJA 1RJLA 5CHNB 4NJ9H 4PRBA 1NMCB 2EJ1A 2YMXL 4XXCA 2FT6A 3AS2A 5FO8B 4UMSA 3BN9D 4BWWA 3V52L 2QMJA 3V7ZA 1CXEA 3D30A 2V17H 2A6KB 4UINL 1QFWI 1YMMB 3FPYA 3I9GL 2Q4YA 4NGNA 1WICA 1RERA 3IJ8A 5EZJB 5SWSD 2FZ3B 1ZEAH 3FB7A 3MRJA 3H54A 1J11A 4ZMQA 2DEAA 1NBZB 1AKPA 3FSWA 1K5NA 4APQA 1IO4C 1DCEA 3QHZL 1F2OA 4KJWC 2P46B 4HCGA 3L08A 4MI4A 3FFDA 3ILPA 4K3DH 5KVEH 3QHFH 3IU3B 3LHAA 4TF4A 1JPFB 1MSPA 1QPPA 3BKYL 3F5WB 3ULUL 1HK6A 2X42A 3B7UX 5IJBC 4FL4C 1HL4A 4BKTC 3RO0A 3MXVH 2GK0B 3MBWA 5D72H 2DDQH 2R7EB 1S7RA 3O6LH 1AQDA 1GIGL 4G9FD 2FYYB 2QDWA 1FH2A 3IDIB 3ZUCA 1DTDA 1E8WA 3LIUA 3QFJE 5TH2B 2OKMA 3KBFA 1TIQA 1JRHH 4LCWA 4ZAKD 4QRUB 3LYRA 2CMRH 2ALAA 3FTVA 2NQCA 5C0EA 2ZW4A 4EI5A 4CMHC 3CU1A 3UO8B 3V0EA 3OAUL 5IMLA 1NLBL 5EN2A 4E5XB 3DOSB 2C7FA 4G1PA 3K7UA 4U1MB 2EVGA 4E2OA 2PR1A 3MR9A 3T2NL 1DO6A 2EXYD 1YNTF 1PL3A 2IAAC 1OIOA 1NC4A 1VGEL 4BINA 1R3IL 4LSTL 1N5YL 1ZK5A 2I07A 2OCJA 1HL5A 5AG4A 2CKBB 2QSCL 4OSUH 5DMJB 2Q3AA 2WLIB 1AMXA 4ZW3A 1CF8L 4MB4A 4BD4A 4OJAA 1KG0A 4PJXF 3G9AB 1GH7A 1I7ZA 1MI5E 2BSDA 1MUJB 2D4FA 3OPUA 3LQAC 4RFOL 4R83A 5EOCL 4PS4H 4N1EA 2QVPA 2VDOH 2XA8H 4ANWA 2P7TA 4WJG3 9PCYA 6CGTA 1U8KB 1ACXA 1U8JA 4GSQA 3CZEA 4HV8B 5LDSA 4BWUA 4Q97A 5AW2B 1KPRA 4TQEL 4Z0XA 5JPNA 1AXSB 2W60B 3RTQA 4JDZA 3VQMA 2CDEA 4YLCA 4AEHH 3IWVA 5J6GB 4IOFD 1F6AA 4UTBA 3EJZC 4MQTB 1IILE 4FG4A 3VRLF 4X7FC 4N22A 4DESA 2IBGA 4PJ8C 1MCLA 3IJHA 3CVHH 3MGTB 4X6CB 1MFDH 4XPTH 4YHKH 4GUQA 1J86A 2HG0A 3KPOA 1X5HA 1XEDA 4ONGH 4UQEA 3K91A 5EO0A 4B10A 3CDZB 1T2QL 1CXIA 1HEZB 4IRJC 5SWQA 4LL1A 1T83C 3VCLA 4R0LA 3KPMA 1PYWB 1WQVT 1N0XH 2DQFB 4KJYB 3RUGB 2EUWA 4IRSD 1HAWA 1WPCA 5E9DD 2P6FA 3D39E 2CK0H 4TNWF 4IK7A 5L2KD 4G71B 2ZE0A 1XOVA 3P0VH 3IJ9A 4N90E 5JIPA 1NMBL 3F2LA 3PJSA 1F2PA 4YMPA 1P5UA 5DHVH 5TGBA 2FQEA 2N7AA 3KR3H 3RDTA 5IFAL 4XVJH 3FQXB 5EEZA 4J8QA 5CZVL 4NC1E 4P2OD 4PJ5D 2B9BA 3CFBA 3DURA 3HZYA 4NIYE 1M71A 2MNUA 4IGBA 4OC0A 2ZUQB 1PD6A 2Y5TB 4JNXA 2Q7YA 3SHPA 3QRGL 5AVQB 2PP8A 3CLFL 4CC0A 2NRDA 4N85A 8FABB 2B39A 1I7UA 4O2EA 1RZJL 1QZ1A 2RJMA 3MACL 4B14A 4AQ1C 2OTUB 1WD8A 4GQQA 2L04A 1GYVA 1E40A 5HJGA 1C5DA 1JPGB 5DLMH 2P9RA 2X40A 3C6LD 4PV8B 2FJUB 3FB5A 4KK6C 4HNWB 3GHBH 4HIQA 2K4AA 2MOGA 3DC0A 1BVKA 2FYVA 4FLQA 4S1RL 4L1BA 5KG9B 1BAVA 5D8NA 4HUKB 1XIWD 1RK1B 2X9WA 4EEEA 5D7EA 4TSBH 4XHJC 2XFXB 3N04A 5DI8A 1RURH 1FRGL 3J8F7 2H26A 4QRSA 3QQ3B 3WY1A 4FYTA 2P47B 3NK4A 4NQCA 1KZFA 3T6WA 3DX9A 2DBLL 1TKWA 3LKQB 4KZDL 2X4QA 3HHMA 5C0RH 5E2JA 4DW2H 1HQ4B 2OZHA 1B4JH 3CBJB 4MYPA 4JFOB 4IBLT 3GUTA 3OAWA 5DWPA 1UH3A 1LMKA 2IQ9H 5T1KB 3X2QB 4Z18A 4PFEA 5J1AB 1E9OB 1B2WH 2UZXB 3DTXA 4ONFH 2ZWZA 4ZX3A 1FO0L 1T0MB 2GBTA 3DVGA 3ARFC 1LRZA 1NKRA 5L6YH 3O11B 4UOJA 4F3FA 3QUXD 5CEYA 4FN0A 1DVFB 1OPOA 4RMWA 2AGJH 4Y16D 5J5EA 4XN2A 1QBMH 5J13C 3QXTA 3BWZA 1G1CA 4Z76A 4LASL 2IANB 3IFOA 2FEDC 3VXQB 4M7ZB 1W16A 2V2WA 5J6SA 2XWJB 2BIHA 3LY6A 1SXAA 4MA7H 4KRPC 5D7IF 3P77A 1DFBL 3TIDB 4LLQB 1PG7W 1NCAL 2LU3A 1D9KD 4A30A 1F1DA 3P73B 3W2DL 3KS0H 3SDCA 2QHLA 2EDLA 3DMMB 3UBXB 3FIXA 5FFLA 4HKZB 1KB5B 2FJFB 4Z0BH 4H6UA 4Y4FB 2XTLA 3S5LB 2VLJA 3QNFA 1P7KB 1OB1A 2FBJH 3DYPA 2D7PA 4JJHA 3RB5A 1EXGA 2X05A 5IB4B 3PWPB 4QO1A 3TZVC 4YBLC 1IGCH 3C6SB 1KFAH 2XC8A 5DD0H 3GKRA 5FM8A 1IEHA 1O9ZA 3VRJA 1WTGT 4UDUB 4J3BA 2XZAH 1R47A 5CP3A 3IMSA 3J2PA 1AQKH 1ZTXL 2X2IA 3D18B 3DX7B 1WAAF 3CSYA 4CDHA 4E41D 3BIBX 3GXDA 1JGDB 4BKLA 4X4ZA 1KYUA 1NCCH 1I3GL 2H9GA 2Z64C 5K8PA 2BNUB 2HFEB 3FC8A 2YWYA 4B95C 3D67A 4X99B 4NQED 4Z7UB 4WUUD 3G04B 1YG9A 3H9SE 3J27A 3NCJH 4FNUA 3FQRA 3B8SA 4LLYA 1IMHC 4IF5A 5JXEA 3UTSA 3HE6B 3BUYA 3KG5A 4F33B 2OX5B 1B6DA 1S5HA 2ENYA 5IBUG 3VW3L 3B34A 2X4UB 1JZ3A 4OF0A 1LYQA 4PP2A 4J1UB 4R57A 5LXGL 1L9SA 3RWGA 1QATA 2Z34A 4QRPB 4QXGH 5CF3A 4YHLH 3KAAA 3MA9H 3AG1B 3NSXA 4U7SA 5J9PA 1OTUC 1A22B 1QFOA 3D33A 4FTVB 2WBXA 1XH2A 1PJ9A 2ENJA 4A7QA 5I0DA 3OD3A 3SYAA 5I8KH 1A4CA 4NN5C 4LSPL 1OF0A 3ES6A 4EVNA 2FR4A 4FYSA 2GHZA 2Y1AA 3L3KA 2VLKA 5HDBB 5TE4L 1G7HA 5TDOA 2EE3A 1M7IB 3FFCE 1T03H 1QWHA 4GJTB 3DVFA 4G83A 1S9VA 3IMVA 2AQPA 2VW7A 3AWEA 1UCTA 2LFEA 4GAGH 1FLRL 4ODBD 1ZV2A 5C0AD 1X9QA 3TBTB 3EY5A 1WSST 3A6CH 4N8PA 4KAQL 5LJYH 2JB6A 3QG7H 5A2LH 1T1ZA 2HJLA 4X7SL 5LGJA 5ABZA 1O7SA 1YEIH 2QGEA 2Y7LA 4WF7A 3ZYOA 1KLUA 3N43F 4NUPA 5GS3A 2G75A 4FCHA 1L6PA 5D8JH 2RR3A 4DP6X 1IOFA 2GUYA 3HG1E 3T08A 1LHZA 1IKFL 1Q9KB 3C8KB 1AGBB 3ZDWA 5F1SA 3C12A 4IOIA 4L8BB 5I2IA 4N0CD 3GO1H 2OMZB 3GB7A 3HPJB 4NPJA 3M17B 3UAJA 3WO4C 4AEFA 3W9DA 3D3VE 4X5RA 4XMKL 4Y2DC 1HILA 1FZKA 1G7QA 5FLUA 3UMNA 1F2QA 2PYFA 4GKSB 3RLSA 5TF1L 2XQYG 3L3JB 1UATA 4OFYD 2BOCA 4JX0A 4UT9H 3G6JF 5J3HC 3U4AA 5D7LB 1RD6A 1NGZB 2ZUXA 1B6BA 1HSAB 3LS5L 1TT6A 3TN0A 1Q1JH 4MHHI 1GS8A 3MJWA 4CSZA 4KOWA 1UB5B 2Y72A 3VFMB 4X5QA 3V4PB 4NRXA 1NFDB 5AAPA 3GLDA 1WZAA 5ESVA 1ZWIB 2YEVB 4DOHB 1ZLHA 1TMQA 2Y06H 1IAOB 1XGPA 2AKRB 3V0JA 3UO1H 3LD8B 2NTFA 1D2PA 4WWOA 2QDVA 4W93A 1N18A 5I82A 1XCTB 3QDGA 4M3SA 1QSEA 2GSMB 2JKRM 5JIQA 1PS3A 1G7IB 1AC0A 2CGRH 1Y18A 4AKOA 4Z7UF 4GSDH 4TYUA 4XCEA 2KMWA 4UEZA 2C3GA 1DANU 3LXCA 1L0CA 3EJYC 2HQYA 3PNRB 1W0VB 2A77H 1HVXA 4CAFA 3H8EA 4NFBA 3QYNA 3SDXB 4U6TA 3PGDA 4XPAH 4KK5C 1WAEA 2X4PB 4QHMA 1KCVH 4GRLD 3T5WA 2WWKO 1KCUH 2M8XA 3FYEB 4NGSA 2BCOA 1FPTL 5I19H 2D4PA 1HH9A 4ZXBD 1YUHA 2BVUA 4JFHD 1CXLA 1SM3L 4YXLH 1ZHKB 2LT9A 1SZNA 2H2SC 3KE0A 2XBDA 2FIAA 3VXUB 3VI3A 1KENL 1JERA 1DANT 3BT2L 2JCCA 2PTTA 2WYZA 1Q0YH 2BSRB 1OSEA 1X4YA 3S88H 3GRWL 3HG2A 2NY4B 4YHIB 2AXGA 4ZS7L 3ALXA 3BAYA 1CI3M 4M6AA 3RKPA 3D0AA 2M26A 3QXDB 5IVXF 1BYNA 5KVDH 5CXPA 4I3RL 1S8DA 1UFUA 4B60A 1A47A 3I02A 4LVNB 4WHCA 5K39B 1QO3A 1QP1A 1UM5L 3GSWB 3KR5A 1YLOA 1NUFA 4M7JL 4KKLC 2TRYA 2F19H 1K6QL 5AWNL 5EO1B 1DEEA 4HSAC 3OM3B 2X44D 2VDNB 4R26L 1MJUH 4F93B 1B0GA 4ZSOE 1TVHB 1DN0B 1IB1E 4CUCA 1MOEA 2FATL 3R7RA 3VGBA 3T65A 2YNCA 5B1AB 3K46A 4KKAC 4U1NB 2V9QA 1DQQA 2I69A 2VC2B 4OLWL 1MCWW 2FTAA 3RWEB 3U46A 1PKQB 5AZEL 2AE6A 1B0IA 1MAKA 2HT4D 2R4RH 4U1GB 4D9QE 2DMHA 4LX9A 2BJMH 3OHXB 5EOCJ 1DCLA 1YAZA 2Z93A 1LFWA 3PP4L 5KSAC 4ZQKB 1OW0A 4ZX6A 3CFNA 4DZ8B 1V05A 2WPWA 1Z2KA 1FA4A 1Q9OB 5KS9A 1AFVH 1GZHA 1M4LA 4Z3IA 3PPSA 1NE9A 2BUEA 3V4UL 1UWFA 2YPLE 4H8QA 2W9EL 3TBWA 4K71B 3EGXA 2BZ7A 3SGDI 5IUSA 1IGJA 3SGKA 3FF7A 4B5OA 1RFDL 3EYOA 3LKPB 3GMLA 4LLMB 4NM8H 1A3RL 4ZNCD 4PJBF 3HZVA 1WZKA 2Q43A 4XNYH 4FABL 3ARVA 5E9NA 4IDJH 3GM8A 4FXKA 1INEL 3O3EB 2HB6A 1NL0H 1RJCA 3OJDA 5TQ0L 3T90A 3HB3B 3KD4A 4RRPA 4WDIB 1CJWA 4K8RC 1BQHA 3BVNB 2HFGH 4JO1L 4LLDB 3KL3A 1ED3B 3WGUB 3RL1B 1PSKH 2ARJQ 5CCKH 3L2LA 3MRRA 3DJRA 5IESL 2A74A 5AVRB 4OZIF 1E9QB 3ZJAA 2X0WA 1F11B 5MEPB 4NRZA 4ESKA 3K8LA 1JYNA 1HNGA 1ND0A 2BSSA 5ITFB 1KOAA 2CLVA 3ME0B 2ICCA 4ONUA 4OZHF 1SMDA 1M4KA 1V8HA 1X10A 5BVPH 4HJGB 1FYTD 5E51A 1DSFH 3B9AA 2XQBL 4M93B 2B2XH 4JDTL 3RZCD 2DKUA 1I9IL 1TYJA 1E5UI 2CLRA 2E5EA 3RWJA 2F61A 1UA3A 1HHHB 5A6IA 1TYRA 5ESQB 2DQIH 5I1CL 4H20H 4WW2A 4NFCA 4MX7B 1ACZA 1P0HA 1A4JB 4YSEA 5B3JE 4I18C 1YAIA 1KYFA 3RAMA 3FCSB 3A0OA 4UQBA 2OAAA 3QZWA 3E2HC 4UNTA 5DEGA 4XOEA 3TJEL 3KXFD 3UAEA 1WS7A 3GTTA 2IH1A 4HUMB 4BHUA 1IC4L 4L9LB 3O6FA 3VXRB 5DQJB 3FAWA 3O81A 4NT6A 1F4HA 2GSGA 3LV3B 4ZAKC 1CLVA 3GBML 3MOQA 4YFLI 1J8SA 4AUJA 1A1OB 5DO8A 1URLA 4DPAX 4PRDB 5IHZA 5IV2A 5DJXB 4AV0A 3S4SA 3DX6B 3GC3A 2C3VA 4PJEE 4OFDA 2E7CA 3HR6A 5H4YA 1XGRB 3VG9C 4DKAA 2EVFA 1Z4EA 4HZLA 2EXYC 5IW1B 3L3IB 4UTCA 3ILQD 4H7VA 2GJ6D 3MUZ1 5CLXA 3TEUA 4OJYA 4ZOAA 4DGWC 3BISA 2ID5A 4MA8H 1AOHA 2EC8A 1KB3A 1C08A 4YZFF 4DQOL 5F9JA 1A7NL 1JZDC 2R9HD 2WWOA 3AWGA 1SEBB 4CMHB 3LKNB 4B7IA 2Y2YA 5FW8A 3ZY7A 5F6IC 4MHNA 3OX8A 1FVDB 1NCDL 3SJVA 1KJMA 3BDYH 4M1GL 4K94C 4G8IB 4R8FA 1H0DB 5I5IA 2FT7A 5HGHB 1E4WL 1A6TB 4LBEA 2CBOA 4R3SA 1ZSDA 4OM0L 5D7SL 5HGGS 1VCBC 2VDOB 3MLVH 1PG7L 4PB0L 1OP5H 4EN3D 5GSRB 3KWXA 4NBYB 4L3EB 1JWSB 3RHWK 4Q6IC 5MERA 1TG8A 3K71B 1BJ8A 2E46A 1DE4A 1KTBA 2I7OA 5E8OA 5J8OA 4UM8B 2H3NB 5IB2A 4MNGB 4HWEL 5GGSA 3V5KA 4PLJD 3Q06A 1JFHA 3IDXH 2PDOA 3N42B 4BSWB 3ARBB 5BVJB 4LVEA 4CMMB 3IWWA 3D2MA 3NOIA 4H40A 5DDHB 4LPYA 2AV7A 3QJHB 4F7PB 4NM4L 5EU5B 4JFPB 1E5ZA 4PTTB 3CVHB 5HDLA 3H8GA 2Q5BA 1NCUA 4JL1A 1FNEB 1QMUA 3R9EA 3VYPA 2V7NB 4M02A 3WNOA 2PVVA 4HUNB 2NNFA 5DJ8A 1LK3H 3GSVA 2J25A 3ESUF 2OMTB 1XGTA 3T0EB 1UZ8A 2Z8SA 4XP9L 3UZQA 2TRHA 2N7BA 1XR9B 4GI9A 3PB6X 4JFDA 1TZ8A 3FT2A 1BM3H 5AD0B 3IO1A 1OCZB 1RV6X 4XPDB 2YD5A 3CFEB 4MWFA 5CKAA 3U7YL 1BXVA 4YE4L 1INDH 4WO4B 5LVEA 6FABL 3P54A 4ATWA 1PBYA 5DHVB 2WXFA 4ZTPL 2BW4A 5HDQH 1TJXA 4FTDA 3V9EA 3W9EB 3DETD 3QH3B 3E8UL 5LB1A 1U8LB 3M1BB 3CFJB 3TBYA 2NDFA 2V5SA 1TZHA 4PBXA 3HBZA 2ZX8A 2K8QA 3L4WA 4TUOA 4OVVA 4Y19E 4B6ZA 5JTWA 2XTJD 4AYGA 4WI4A 4WFFD 4GAJH 1JMZA 3BZ4B 2EXTA 3S37L 2ZCLL 1PMYA 3P1VA 2VMJA 4JQIL 5BJTA 1AR1C 3GMPB 3LRSA 4U6YA 3M07A 1KJ2H 1ODUA 4YSPA 4AZ8B 5DRNA 3STBA 1F4XH 3WXWL 3EYFB 1P2CA 4G3YL 4G8FA 2GUOA 4N2CA 5EIIA 1X5JA 4JM4H 4H8WH 4KX9A 1QSNA 1GGIH 1K9TA 2R23B 4UFWA 4M7KH 3KPLA 2QQNL 2ZEHA 1S7QA 1URZA 4IDLA 2OMVA 3ESPA 1RU9H 3PUUA 4GRMB 4V2CB 1FN4A 1G5AA 1Q2YA 1IAII 5DO2D 1CGUA 1BQKA 1IEBB 5C2BH 3TURA 5J6HB 4AG7A 3TEZA 2OFQA 4F7CB 1QKZL 5FYLL 4FF9A 2M1KA 1W8NA 3QNXB 3M6DA 2YPVA 1U30A 1JK9B 3D34A 5EWIL