3MN8A

Structure of drosophila melanogaster carboxypeptidase d isoform 1b short
Total Genus 121
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
121
sequence length
391
structure length
383
Chain Sequence
KEDESFLQQPHYASQEQLEDLFAGLEKAYPNQAKVHFLGRSLEGRNLLALQISRNTRSRNLLTPPVKYIANMHGDETVGRQLLVYMAQYLLGNHERISDLGQLVNSTDIYLVPTMNPDGYALSQEGNCESLPNYVGRGNAANIDLNRDFPDRLEAQSRQPETAALVNWIVSKPFVLSANFHGGAVVASYPYDNSLAHNECCEESLTPDDRVFKQLAHTYSDNHPIMRKGNNCNDSFSGGITNGAHWYELSGGMQDFNYAFSNCFELTIELSCCKYPAASTLPQEWQRNKASLLQLLRQAHIGIKGLVTDASGFPIADANVYVAGLEEKPMRTSKRGEYWRLLTPGLYSVHASAFGYQTSAPQQVRVTNDNQEALRLDFKLAPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords LP15968p
publication title Structure-Function Analysis of the Short Splicing Variant Carboxypeptidase Encoded by Drosophila melanogaster silver.
pubmed doi rcsb
source organism Drosophila melanogaster
total genus 121
structure length 383
sequence length 391
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2010-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00246 Peptidase_M14 Zinc carboxypeptidase
A PF13620 CarboxypepD_reg Carboxypeptidase regulatory-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1120 Mainly Beta Sandwich Immunoglobulin-like Carboxypeptidase-like, regulatory domain 3mn8A02
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 3mn8A01
2ZELA 1ELMP 4X8IA 1Z2LA 2AFMA 4OMEA 3V38A 1LOKA 3PB7X 4ZY1A 5DS0A 5D8NA 1ELLP 2HB6A 2C6CA 5I4MA 4B6ZA 1JQGA 3NJVA 3PB9X 2DEAA 2GLFA 3IWWA 4YU9A 3SI1A 4W9YA 4MCQA 2IMOA 4F9VA 1QMUA 5HVFA 2C6PA 4P4JA 4PXDA 4MHZA 4A38A 2Q43A 4P4IA 1LAMA 2CTCA 1Z5RA 4BD9A 3GB0A 4CPAA 4MRIA 5F09A 1AYEA 4MCSA 4P44A 4PQAA 1RTQA 5JM6A 2XEFA 3H8GA 1KWMA 4P4BA 1VHOA 3FEEA 3IFEA 3KR5A 1YW4A 4MHPA 3D67A 2IJZA 4TNUA 4UEEA 1VIXA 3B3CA 1HEEA 3B3TA 5THWA 4WI0B 2AFUA 4JYWA 4FAIA 3B3SA 5LYDA 4NGRA 3KASA 8CPAA 2PJ3A 1VGYA 3KQXA 1CP7A 3NH4A 2PIZA 2EWBA 1BPMA 4G1PA 5K39B 1XBUA 5CPAA 3NA6A 4OC4A 2XEIA 2ZEHA 4EWTA 1GYTA 3IO1A 2F7VA 3D7FA 1YLOA 3GLJA 4O23A 2PJAA 3QNVA 3RZAA 5K8OA 2ZEGA 2ZOFA 1XRYA 3BXMA 3E8VA 4F9UA 4IYKA 4NJRA 1ZLIA 3B3WA 3HLPA 1XMBA 2PJ0A 1TKJA 4LQGA 3L2NA 1H8LA 1TF9A 4NGSA 3PBEA 4P10A 1ZG8A 3MRUA 1FT7A 2PJ9A 2G9DA 3LWUA 4PXBA 3FEDA 3T8WA 5K8PA 1YMEA 4GM5A 2PJCA 3DGVA 3SJFA 4NFRA 3BHXA 1CPSA 3SI2A 2FVGA 2XEGA 5K8NA 4NGNA 3IIBA 3KR4A 3RBUA 1CX8A 1LAPA 3S9NA 4X3RA 3SJXA 3PFOA 3PRTA 5LYIA 4JZ0A 3CPAA 2F8HA 2AFZA 2I3CA 4UEFA 1TF8A 3WC5A 4P4FA 4UIBA 1ARMA 2RFHA 4R8FA 3H8EA 5LRJA 3D7DA 2PJ1A 3K2KA 4TWEA 4IAVA 1FNOA 4FBEA 2ZEOA 3PB4X 3D66A 2BO9A 4FXTA 3D7GA 5ELYA 1DE4C 1HDQA 4YOKA 2O4HA 1CG2A 4MCPA 1TKHA 4PXEA 4OC2A 3NH8A 2PCUA 2PRQA 2JBJA 5K8MA 4R6TA 1CP6A 3CT9A 3PB6X 4ONWA 2CF4A 4EFDA 3KHZA 3V7ZA 3FH4A 2PJBA 2PIYA 2ZOGA 4ZY2A 3PEIA 3PBBA 3K9TA 3DLJA 3FJUA 1F2PA 4OC3A 1F57A 3VATA 1VHEA 3H8FA 1ZG9A 1DTDA 4EMEA 3WC7A 4ZX8A 5HVGA 3IJ3A 1AMPA 2QYVA 2CTBA 3SI0A 2POKA 3PB8X 4A94A 2J9AA 2PJ2A 4IK2A 2WYRA 4X2TA 4OC1A 1IY7A 4UF4A 3I1UA 3KHXA 1PCAA 4FUUA 4ZYQA 4OIWA 3VH9A 4ZI6A 3D68A 2AFXA 3G3LA 1QQ9A 3IEHA 3ISZA 4EIUA 4R7MA 1Z8LA 2NYQA 3KQZA 2BOAA 3KL9A 2V77A 4RUHA 4A39A 2AFWA 3B7IA 1LCPA 1LFWA 4MCRA 1F2OA 4R76A 2BCOA 4ZY0A 2XEJA 2V8VA 2GU2A 2VL1A 2QVPA 1XFOA 3BI1A 3LMSA 4NJQA 3SJEA 2CIJA 2IQ6A 3FX6A 4IHMA 4OP4A 4NGMA 3TX8A 4OIDA 2V8GA 5J1QA 4WWVA 2PVWA 1XJOA 5G5DB 3GUXA 1YW6A 4P4DA 4NGTA 4AXVA 4PXCA 4U3SB 4K3NA 4OC5A 4UIAA 2QJ8A 4F8ZA 2C6GA 5CBMA 2Q4ZA 2JEWA 2Q51A 3B3VA 3HN5A 1LANA 1EE3P 3MN8A 3NH5A 5LRGA 3WABA 3B2YA 2EK8A 2AFOA 4P45A 1CBXA 2PJ5A 3CPXA 4WJBA 2HC9A 2WZNA 3KCPA 5HVHA 4ZX9A 4MHYA 5AQ0A 1Y7EA 1YSJA 1BAVA 1CPXA 1ZLHA 6CPAA 2ZEDA 4NGQA 3HUVA 1PYTB 1ARLA 1M4LA 2ZENA 3BI0A 3D7HA 2O53A 5JH9A 1NKGA 2GLJA 4DJLA 3FVLA 2ZEFA 3WC6A 7CPAA 3VARA 5HXDA 2PJ6A 3KZWA 4A37A 3KGQA 3FECA 1BPNA 5LRKA 3ISXA 4PPZA 5JGFA 2OR4A 2PE3A 1HDUA 2EK9A 4OC0A 4OKOA 3KI9A 5LYFA 1Y0YA 2ZEEA 3S9LA 1IGBA 2V8HA 2NSMA 4UEZA 3FMCA 3TC8A 1TXRA 4P4EA 2RB7A 4YWYA 2B59B 4DYOA 1UWYA 4MMOA 3S9MA 3RAMA 3D4UA 2JBKA 2C1CA 2PJ8A 4Q7AA 2ZEPA 3WT4A 3B35A 2ANPA 2GREA 3JRUA 3FF3A 1OBRA 4MHNA 5LYLA 1R43A 2PVVA 5D29A 2XHNA 2ZEMA 2OOTA 4DUKA 4KSIA 5IB9A 1Y0RA 3NFZA 1TKFA 2PJ7A 1ZG7A 3NJXA 2V8DA 4H2KA 4NGPA 2AFSA 1NSAA 3CDXA 2ABZA 1BLLE 1Q7LA 1R3NA 3N5FA 4MXUA 4FL4C 2PJ4A 3SJGA 3IC1A 4Z65A 4FWUA 3PFEA 4P6YA
chains in the Genus database with same CATH superfamily
5C88A 5TH2A 3IGRA 1YNTF 1VADA 2H7WA 1EDHA 5FA3B 1OB1B 5MEQA 5MHSD 3EO0A 1F3DH 2ISDA 1CWVA 3BIKA 3NFNA 2GSIA 3SXOA 1N0XH 3Q2VA 5J13C 5L9DL 3HC0B 4E5XG 2F9BT 2JVUA 2K1MA 3HFML 1XL6A 4DSYA 3DX2A 3FZUC 3F5WA 1H3UA 1BD2E 2B5GB 1VPOL 3IMVA 3KPRB 2VE6A 3KBHE 4BDVB 1X4YA 1RP8A 1AXTH 3UX9B 4PLOB 2YGWA 1NIDA 1DEDA 2NY6C 3GHEL 5HVGB 1ZY9A 3T4AB 5BV7C 2ZAIA 1KIQA 2ICEB 4PGBB 1J9RA 3GPSA 1YCSA 2CRZA 1KBGH 3IMWA 2AI0L 2MKWA 3ZTJG 3GGWA 3P73A 5IROD 1T1XB 4LCVA 5DS8B 1GJWA 1L0PA 3FCSB 5DR5H 3NJFA 2YFNA 1NUDA 2O5YL 4W93A 4P4IA 2R2BA 4YQXH 2EVFA 1F4WH 1M44A 3EH4B 2IBGA 4MA3B 4GAGH 3T2QA 5CIPB 3N7ZA 4KOBA 4J5VA 3L1OL 4MRIA 3AJ7A 3SSGA 3FO9B 4CSZA 1SMDA 2DQFA 3REWA 1DQLH 2IDCA 2TSBA 1R24B 4BKTC 5LKNA 2Y25A 5JZ7C 3H8GA 3RWJA 2VIRB 2WNKA 4U05A 4WU7A 4AIXA 3NESA 3KR5A 3UTQA 4C4UA 2XBZA 4XNUH 5HGDA 4AQ1B 2X4QB 1MCWW 4XXDB 1AZCA 3DVNA 4OF5A 5LGKA 4ELDA 2AAVA 1B4TA 2UZXB 2ROXA 4UEEA 3B3TA 1IAIM 1IC7H 4C7HA 2Z7WA 4N2NA 4LLMB 1Z4EA 2CUAA 3ZL4H 4ZTEA 4NZ8A 4BKSC 1J1PH 3OKMB 1DL7L 4MJ8A 3ZRSA 2Y7NA 2X2HA 3HG4A 4ES8A 4CYPA 1ORQA 3HLKA 3UIZA 2FRGP 1UUSA 3DRQA 3K2UL 3KYAA 4YSDA 4YHMH 1XGRB 5GRUH 4CUCA 3HIZA 1O0VA 4HBCL 2BNQA 3HJ0A 1A4KB 2C1PA 4DERA 1K85A 2G2RB 1O6SB 4IRSC 1KXQA 3RWGA 5CKAA 3AY2A 1XMTA 2C9XA 3ZE1F 4JDVA 4JFDE 4QIRA 3GWJA 1YLOA 4JO4H 3DHPA 5D5MF 4EVYA 5K8OA 4P46B 2A6KB 4LSSL 3NIGF 5AVZB 2EDDA 1U8NB 1ZLIA 5I5JA 3GINA 2GFBA 2Q4YA 2OPCA 2XXGA 1I1AB 3JTTB 4HXBH 3RL2A 5BRQA 3O3AB 3S0PA 3D85B 1FG2B 3UMTA 2Q6WA 3WHXA 5ISZA 4WV1B 4LNVA 1OM3L 2P5PA 2QMJA 3L2NA 5FOBB 4Z7NF 1HXYA 4FJ6A 3Q6GH 4K8RL 2P80D 4F7EA 1XAUA 4MNHB 1N6UA 1CI5A 1YZZA 2VM3A 1MJAA 5TDOA 1PNDA 1NFIB 2VN6A 1FBIL 3BYYA 5I6XB 4QPEA 4HIQA 4FQXB 3IU4H 2VLKB 4UM9B 1S7RB 4UYPA 4G6FD 3VFUA 5JPMC 2AHIA 2ZCHL 2V5YA 1TTGA 3KM2A 3GBMH 4XO4A 2BSTB 4XNYL 1Y6KR 4MMYB 2JV6A 2OI9C 3E1ZA 1PDKB 4AQZA 5E4IA 2FWLB 2ENJA 3O3EB 4DESA 4LEOA 5MEND 4L3CB 4Z7QE 3D6GA 5ETUA 2YMOA 4X4YB 3B5GA 4ORGA 5GRZA 5JW3H 4TQEH 4OGAD 1L3WA 4KNSA 1J0YA 2CIKB 3PFOA 3K2MC 1Z0NA 2V3EA 2ZWNA 1TETH 5ITFA 3M1CA 3U1QA 3H7LA 3WXWL 4QY8B 1KXQE 2QPEB 1PZ5B 4C7IA 1GKOA 1DDTA 1FHGA 3IYLW 1ERNA 2WQ8A 3PWPB 1XF2B 2AFZA 3P40A 5BW7A 5EU6B 5I1DA 3DTXA 4LSTH 3MOAL 1ZK5A 1EZSA 5C07A 1DE4A 1E7VA 3WLBB 1OF2B 5C1MB 2YRLA 4URKA 2VZZA 2YUWA 1N3NA 3GYRA 1P4IH 3MV8D 5BW7C 4LASL 3PB4X 3MUHL 3B43A 4IDJL 4PJEE 1DE4C 4P5KB 3OM3B 3ROLB 2BSED 5B38B 2VDNB 3G9VA 4NXKA 1XGUB 3WFEL 5BRPA 4OC2A 3EAKA 3FQYA 2VW6A 3INUH 4RA3A 1KEMH 3VI3F 3BKCL 5F96L 2PW2B 2PXYB 4K0OA 4X4KA 2FL5A 2AW2A 1I4FB 1OW0A 3GNML 3MXVL 1FPTL 5H94B 5L4IA 3TIEA 3FTSA 3VAEA 1OANA 5EOQL 1T7YA 3HC3H 5GGRB 3P0GB 2KHAA 5K93A 5IBTL 4PCKA 2AKRA 4K3GA 1BM3L 4WHYG 3SQOL 1S9YB 1OW0C 2AJ3A 2RTTA 4CDGC 5BS0A 2PIYA 2BHFA 2PWDA 5DYOA 4XMUA 5DUBB 3VRLF 5MHSE 4ZY2A 3LV3B 3VFSB 1BD2B 3PBBA 4XNHC 4FNSA 4QR7A 2KL6A 3P3YA 2EP6A 2MCPL 3NJNA 3ZKND 1ZLEA 3V4VA 3B56A 4HFUH 2VQ1B 5IP4A 1C08B 1GYCA 1UZ6F 1WP6A 2DKUA 3ARWA 1U8JA 1LK2B 2JK5A 3B8YA 6FABL 3WJLA 2VLJD 1UGNA 1PY0A 4LL4A 5G4OA 3OC5A 3N55A 2I32A 1LO0H 1MFBH 3AB0C 3MRDB 1IM9A 3FQUA 3WJLC 3BT0A 1T1WB 3MJ7B 4ZMLA 4KZ0A 5CCKH 3UBXB 4RN7A 2OX5A 3L5WA 3PWUA 2EDMA 4UF4A 2G2PA 3S8WA 1P7BA 1KTBA 5CSBA 2E5EA 4CMMB 5C07E 2FYYB 1XGQB 2XICA 3VDCA 2D73A 3CN2A 3KPOB 4O2CB 2ZYIA 3SOTA 1X5KA 5IHZA 2AXFB 4N8CH 2WXNA 1TVHA 3PPSA 4XPKA 1JYXA 5J1AB 4LAQL 4XP5H 2HSIA 4OZFH 1MCWM 4RSVA 2J71A 5FK9A 4EUPB 1E5ZA 1HH9B 2CGYA 5TH2B 4A7UA 5E2VL 3QIWD 5J13B 5FM5M 3HLAB 5MEQB 3EO0B 3CLEL 5D93C 3BIKB 4FG2A 4WI0A 1SYVA 3NFNB 4OB5H 2GSIB 1G9HA 1B0GA 4WTZA 4U4BA 2RB8A 4NCC1 1TJMA 4PTUA 2B8OT 3TJPA 3AW5A 5BS0E 2FEDC 4X6FA 4AYBA 12E8H 4XN4A 3DUSA 5KVDL 5T5FL 3OVUB 3F5WB 3PXLA 3O8XD 4X9HA 4UNUA 2NY6B 2YSSA 4BGDA 4ZYKB 4PWHA 3D3SA 5IVOA 3Q5YA 1GH7A 3ZGHA 5BV7B 2Y7MA 2KZ1B 3PGDB 3SJEA 1XDTT 5DJAA 1K8DA 4ZFZA 3T08A 1OWRM 3DBSA 3FQTA 4N2GA 4YL4A 4JFDB 4Q4IA 2UX6A 3P73B 4HPYL 3WFDL 2Z8WC 4GS7B 1JZ6A 1YEKL 3NZHL 1ML0A 1XJOA 4PS3A 4BZ2H 1ZSDA 4NHCL 5D7JA 3JUWA 2R2BB 4L1TA 1RVFH 1YW6A 2QSCH 1X5LA 1KZQA 2D3VA 1PL3A 2XU9A 3CDCA 1ZAGA 4JCLA 3X2QB 1OT4A 2X4TB 4F7TA 1OE1A 4UIAA 4ODTH 2XZAL 2DQFB 3REWB 2C3VA 1GMIA 1WTLA 4LSUL 4ZO7A 4MMZA 3IDGA 5E0QA 4C4KT 4S0HA 3IGKA 1KIUA 3HI5L 3AROA 3LCYA 3RWJB 1OQOA 2CCVA 4M1GH 5K1NA 4QVTA 2DXQA 4WU7B 4Y2DA 2JEWA 5EF2A 1LWRA 4MXVF 3BEWA 3UTQB 1J8SA 4ZNEE 5HGDB 2QELA 3ZDZF 2DLGA 2XOTA 3DVNB 4HKJA 4O51A 1HL4A 2PABA 3IPBA 5CF3A 1E9QB 1OCZB 2DQEH 2BY2A 5I26A 2VITB 3MX0A 4UMGA 1IICA 1ND0A 2FECL 1P53A 1XGYH 1MN4A 4M7ZB 3CGTA 2HPOA 1TEFA 2P44B 2HC9A 4ZX9A 3S37H 3ZTNL 5JYMA 4YFEA 4Z7QB 1DQMH 2ZOKA 1YAIA 2NLJA 4JQVC 1ORQB 1RULH 4IRSB 1DBBL 1WAAF 1UOVA 3DRQB 1AR1D 2ZEDA 1QZ1A 4K3JL 4EMZA 3DX6A 4X42A 4YHKL 2P6GA 3CHRA 5BPPA 2C1PB 1KTKE 4OD1L 3N85L 4KVNL 2JKTM 3RWGB 4PGDA 3CHXA 2ADGB 3ZKNC 2C9RA 2F7OA 4IU2A 5FYKH 1LO4L 4AQAA 4R3KA 2FQFA 4LCIL 5K9QG 2HV2A 3L4CA 3OAUH 2XUWA 2IOMA 4FNRA 5IBUG 3NE8A 4LHUA 3ARQA 1YDPB 1CGWA 1MWAL 1WT5A 4TVPL 3ULSA 4K8RC 3IU2A 3NJHA 3FECA 3OLIA 2ATPA 5LRKA 3BPLC 5ABDE 5HJ3A 2GSGB 1U3ZA 4PJEB 4JO3H 4TTDD 1W91A 2Q6WB 3DDFA 1I1YA 3SYCA 5IESH 2Z92A 3WHXB 1JHKH 4PUBH 5K69A 2C7FA 5EB9A 5KBPA 4DAGH 4KX7A 5KSAA 3V9EA 1E2WA 1T0PB 3EGXA 4F7EB 4NNYA 2FO4A 3PJLA 4Z7IA 2ZUXA 1E5CA 5JPMB 2BCKA 2APXA 4LU5H 4TN9A 4X9YA 4FXGA 1QWUA 1TXRA 1WZKA 2WYHA 1XD1A 1KZYA 1NANI 2OI9B 1KCSL 5L4FA 2WBKA 3VFUB 5D1QD 7PAZA 3MOQA 4FXGC 3KPMA 3H9SD 3SOBL 2E56A 3EGSB 1IX2A 1KYDA 3CZSA 4FJZA 1EHXA 4J27A 3ZUNC 4DP0X 2CHNA 4KPHH 4N8VB 1KLFA 1HILB 4F33A 4BZYA 3O8XA 4ORGB 3BVTA 4AGNA 1OBRA 4R90H 2I9TB 4HT1L 5FFOA 5LWYL 2MH4A 1DBAL 1JZHA 1W0VA 2QPSA 4IOIA 3UOAB 5FO8A 3O8XC 4IOSD 2VLJE 4X5PA 4N0CC 2WSKA 4RWYH 3WY1A 3LN4A 4PW4A 4D9QD 2CR6A 4K2UH 3WJMA 1Y0RA 2IC2A 3U0PA 1H6UA 5I1DB 3DTXB 3UYPA 4QHNA 3QO0A 3K0YA 3NP4A 2YWYA 1DE4B 5C07B 3RE0A 3N1QC 3GHPA 2BVQB 3CDXA 4JM4H 5C08A 1I7RA 1X9QA 2WBWB 35C8L 3S35L 3UROR 3NFSH 1UEMA 2IO5A 3GSRA 3V95A 1MQKH 3WENA 3WKNA 3UG4A 4HLJA 4B3EA 5AOLA 3S34H 2FZ3B 2CBPA 2VGLM 3A6OA 2XV6B 2VSKB 2W91A 4GRLA 2JLMA 4ODXA 2FL5B 1DBJH 5L6YH 3ARGD 3FC8A 2BJMH 2IH1A 1JNNL 3OMNB 2CIIA 4L4TA 1HKLL 4RRPG 4X8IA 2ZKXA 2CNZA 4FQCL 3PL6D 1BFSA 2C1OA 3FQWA 1A7BA 2CE6A 3ZO0A 4PRBB 4CRPA 2A6JB 4XNHB 3PB7X 4WUKL 2AKRB 4ZY1A 4XN2A 4R9MA 3P0YL 5BS0B 2R0KL 4TVPD 5DYOB 1E8WA 3UBGA 2F74A 3F65A 5FXCH 5DLMH 3GBNH 2AJZB 3NJVA 3TEZA 3AB0B 1LP9A 1IJNA 4U6XA 4IGBA 1W6WA 4WIQA 3LH2L 4F33B 3IWWA 3MV7D 1PCXA 1A7OL 2IOIA 2V9TA 5C0NC 5D72L 1A4CA 1F8TH 4AQ8A 2OZHA 3CCHA 1E43A 4JVUA 5F1NB 4IGBC 3OF6A 1JHLL 3UMNA 4Z76A 4KBPA 4AQ8C 1JNLH 4YEFA 4Z7OE 4FQ1L 2HLAA 3LKSA 3UTOA 3V6OA 4JGUA 3P3TA 4NFCA 2NTFA 1CXIA 3KR3H 1D5BB 3FUDA 5IB4B 1GZQA 1FL6A 2J6EA 2E27H 2O6DA 4FD4A 3V6OC 2PCXA 3EBIA 5JQ6L 1TU2B 3EOYG 3I6KA 4X9FA 3IFNL 2HT2D 5FIEA 4MXWH 1KCUL 1HCYA 4X6DA 3FTWA 1RTQA 4KRPD 1NSLA 4HSCX 5IHZB 5IBLD 4G1MA 2Z9TA 4RMSA 3ESMA 1TVHB 5T5FA 2Y5TB 4YL9A 1GGCH 5EEWA 1D6VH 5EG6C 3DURB 3HG3A 1VHOA 4IF5A 3O2VH 5D93B 1E8ZA 1MFEH 1H0DB 3HRZA 3KGTA 1KV3A 4TTDC 4S0TD 2UX7A 4JN1H 4X6DF 4A04A 2FX7L 1RIUL 2Y7LA 1SXSA 4FZ8H 1KELL 3GB7A 2VJ0A 1MFAL 4TUJA 5BRZA 4WF7A 1JXKA 2BHYA 4WI0B 1SYVB 3HRZC 2X6AA 1BJ1H 3QNYA 4FP8H 5DT1L 1AACA 4JG0H 3DX8A 1D3CA 3MJGX 3NZ8A 4LBEB 3X1FA 4PTUB 4WSGA 5E51A 3PUCA 3ZE2E 4X6FB 4MZ3A 4G6FB 3DUSB 4NGRA 3VXRA 4RAUA 1KC5H 5AL0A 2YSSB 4MNGA 4U3HA 3D4CA 3RLSA 3ZY7A 1IGIH 3RDTA 5GIRA 2B9BA 5D1QC 1JV2A 3S97C 2FYVA 5MENB 1XMWA 3U9PH 4P5TD 4JDTL 5TDPA 3ZSTA 1FE8H 3OAYK 3FQTB 4WW1A 3RDTC 2DYPA 4CDHA 5KTEL 3FT3A 3VO0A 5E5RB 5E5LA 2WKLA 2Q3AA 3LX9A 2O6EA 4WUUD 4K5MA 1J88A 1FNSL 2O5XL 3ULVD 3UZQA 4GAJH 4G6JL 3NSJA 3RZAA 3GMNA 3V0DA 4HCRH 3V6OE 5B7FA 3KYNA 4CC0A 3FXIC 1ZSDB 3I75B 3EYUL 4OCXH 4LSRH 1LEKA 3QXDA 4TV3A 5I1GH 1JG9A 4DUWA 3GRWH 4WWOA 4LCWD 4PAZA 5GRYA 5FM8A 1FIGL 1YSOA 2R1YA 5BWAB 3P3UA 1ZANL 4F7TB 3ZDWA 2BNUB 3K1DA 2Z91A 5CD3B 5F46A 1U92A 3IDGB 3QXTA 4I77H 3K6IA 1KIUB 4LGPB 4WI4A 2XN0A 4II9A 2JKJA 5KVDE 2WKGA 4P9HL 4MB5A 1KTJA 4P10A 1DVYA 4AVCA 2YMTA 4L29B 4POYA 3NJLA 4UANA 4DK6A 3FRUA 2YD1A 3T8WA 4G42A 2R0WL 4HKJB 4O51B 3PJNA 1NA8A 1JGUH 5I9QB 4G70B 2R2EA 3MX0B 5BRZE 5AG4A 4PMFA 3D33A 5IB1B 3SDYH 4MJIA 3WO4C 3QDMA 3IAQA 1Q9KA 3KVDD 3ARGC 2DOCA 3FULA 2EUIA 2ENQA 4CAXA 1EHKB 1N2RB 1XR9A 1AO7A 3UAJD 4H8WL 1NC2A 1MWAA 1O6VA 2NLJB 5D1QE 3VXRE 3IGLA 4WENB 1OAXH 5HHVL 4MNGE 4OGYL 3GXFA 4D0CA 3AT8A 5KVEL 5LYIA 1J11A 2VLJB 2F0CA 3V7MA 4PGDB 1C1EH 4IU2B 1ZPUA 4GQZA 1UD6A 4KGLA 1B9KA 2R69H 3I74A 5GGSY 3V4UL 4AQAB 3PNWA 2KPNA 1VERA 1T0MA 2QVMA 4NQQA 1I8LA 1I7ZA 3BPLB 2C9AA 2F18A 4NAJA 3LB6D 3K2KA 4JY5H 3CV5A 5FGSA 4M93C 4FQJL 4TXVB 1I8LC 4LLYA 2OZ4A 5I19L 5F3BA 2WZAA 4HGKC 3KL3A 1I1YB 5HDOA 2Z92B 3VJ6B 4D8PA 1UA6L 2DLTA 4UINL 3O6MH 1JYVA 1CDIA 4GW4A 3Q1SH 2V5SA 1RUPH 2NOYA 3QGVA 5C6WH 2HT2C 1BVLA 3EGXB 3HHSA 2BVTA 3EHBD 4NNYB 1BQUA 2FO4B 1N59B 1QZNA 2BCKB 3HS9A 4FXGB 4P99A 1R34A 1N0XL 2J8UE 1S7TA 3WNMA 3ESOA 3FH4A 2BS71 2CJ3A 4FNTA 1HZHL 5BXFA 5HP5A 2A2QT 4NDMA 1MCEA 3ILDA 1R75A 3L9EA 4MCYA 4MJIE 4Q6YA 3A0OA 2ZXDA 2JKWA 2DWYA 1XSJA 1M56B 3K6DA 3KGRA 1F57A 3JV4A 4PSRA 3ZVVA 4F20A 4NF1A 1AXTL 2AJYH 4TVPE 2DEWX 4GSQA 5MEPA 1VIWA 1DUYB 3QZMA 3O8XB 4EMEA 5AL8A 2XXCB 2CKBB 3KPQA 5EC2A 1T5KA 3BP7B 1L9NA 5CXPA 4QEGA 1OK0A 1KBGL 2C3XA 1UACH 1W0VB 4IOIB 4Z7OB 5FO8B 3MV7E 4QRFA 1FIEA 3I9IA 4C68A 3GXNA 1ID5I 5DR5L 4CAEA 4F57H 3EH5B 4GXUM 3ZRFC 3WJMB 1F4WL 4YQXL 3KHXA 4GAGL 4ZAKA 3U0PB 1IYKA 4P5TC 4W6YB 3UYPB 2EYRB 3T6QC 3PGPA 4QHNB 3QO0B 3CVCA 3D48R 3BRDA 1R3LA 4GUPA 4OCLC 5KYNA 3ZE0E 4ZD3H 4ZAKC 1DQLL 2VMDA 3TO4D 1JWUA 3JTBA 5DWUH 5D7LD 5HI4D 4KX9A 5H37H 1NFDA 3HVDA 1UKQA 4XNUL 4JKPH 4Z7WA 3H8NA 4ODXB 3PP3H 2EACA 1QRND 2VRQA 4JFWA 1EEQA 3QNXA 3CX5J 4GAAA 1I9RH 3IJYB 2AFWA 1E4XH 1IC7L 1SQ2N 3FQWB 1KUMA 5D7KD 1BZQK 4LXFA 5F44A 2WLIA 4Z7VA 1F2OA 2YRBA 4R7NA 1Z5HA 1NFDF 3O2DH 5GZND 1RJCA 3ZL4L 4BFKA 3ZE2B 5E1IA 1J1PL 4K9JA 2KZWA 3QPKA 4YWGH 3DO4A 5FKAA 3NCCB 3UABA 3ABMB 1JN6A 4YE4H 1BMGA 2Q76A 4UQCA 5GRUL 5C0JA 2EVIA 4LE8A 4U6XB 4IGBB 3RIFK 3ET9F 4QRPD 3SPHA 4LLVB 4A55A 3GMPA 5PAZA 3X1BA 3LKRA 3AGVA 25C8H 4HPSA 2H6PA 3M46A 4Q2ZB 3CCHB 1BVKA 5ITBH 3IE9A 2Z3LA 4M00A 4Z76B 3TX8A 4JO4L 2XVKA 1BJMA 5C7ZA 3T0WA 5AVSB 2VRAA 1HHIB 1QKZH 2NTFB 2ZXCA 1CM0A 5CJQH 5E1AB 4HU8A 1FL6B 3ZKSD 1IBGH 4HXBL 3I6KB 5F97E 4M3SA 4R4FH 4GRWF 2ALAA 2B4CH 1IB1E 3FPXA 3EF4A 2ZOLB 4G1MB 4TOYH 2B7DT 5I18H 1K4CA 3LB6C 3Q6GL 5TF1H 2CXGA 2ATAA 1QD0A 3L45A 3QUHA 3T04D 4KHXH 1JGDA 2H6OA 3HN5A 1B4RA 5IB5B 3HRZB 5J8FA 2YAMA 4O2FB 5DK0A 3ZDXE 1WYJA 5B39A 3IU4L 1ILSA 4Y2NA 5GRXG 4N2MA 3IJ8A 3GB7B 4TUJB 5BRZB 3MRCA 3QNZB 4J3SA 3QNYB 5EU4A 2OQJA 1T22A 4C56A 4Z7VE 3DX8B 3NZ8B 2DIEA 2BP5M 4KTGA 4GG8A 3EHBC 4JREC 2J5WA 3KCPA 4YSQA 2K3HA 4BMHA 5HVHA 3SDCD 1A5FH 2XV3A 3QFJD 5JNYA 4BKLA 5D1QB 5KUMA 4RAUB 1WH0A 4PJFB 3VXRB 4A7QA 5HYQA 2G4EA 3MODH 3H9SB 3L2MA 4RQQB 4E9TA 4MNGB 4TQEL 3U2IA 3WNOA 5HVHC 5AVTB 4XOCA 5JW3L 3ZT7A 4J4PD 3FB5B 4NOBA 3RDTB 5B3JF 4AGMA 1NLBH 4CILA 2KZKA 3HUVA 2PCFB 4Z7UA 5TDPB 4HIJA 3RY5A 2E47A 3ZYZA 1Y9WA 4WW1B 1RK0A 2Z8VC 4DKDC 3FT3B 3C5XA 3CX5K 4DJLA 2FS5A 5BZZA 3KDMA 4LF3B 3TBVB 3GMNB 1I8KA 2G9HA 4LSTL 1MFDH 4HCGA 2PUQT 4KK8D 2GBAA 2XPGA 1BXXA 4NENA 2LW3A 4P9HC 4H20H 1P4IL 1F90H 2HN7A 3APMA 2IL4A 1NQBA 3VRJA 4X80H 2DMHA 1WBZA 2R1YB 2VUKA 3VD3A 2ITFA 2WQAA 2BWDA 1XH0A 5B22A 2EYSA 3INUL 1KEML 4S10A 1EQWA 1YQ2A 3ZZQA 2ZEEA 1A4AA 4OBSA 1C7TA 3FB6A 4TNVK 4FYQA 3CDZB 1SM3H 5D7LA 2I5YH 4DH2A 2VXVH 4NI6A 3FRUB 4H8WC 4AGPA 4G42B 2YZ8A 4XCNA 3HC3L 1DDHA 1PLBA 4ZRGA 3WO4B 2J8UB 3TO4C 2ITEA 3G5ZA 5H8DA 2PDOA 4L4JA 3ARGB 3V6ZB 5HI4C 1IGCH 1CDJA 4JB9H 2R2EB 1FZJA 1M1XB 1BBJA 2K0RA 1IEHA 1LHZA 3MLSH 4MJIB 4JQXA 4C56E 2BERA 3Q5TA 3WKPA 3ZYIA 2YC1A 5D6DC 5GZNA 3KCWA 4MRCA 4HFUL 1NC2B 1MWAB 2NZ1A 1TVBA 2VDMH 4JQXC 2PRBA 3D8PA 4S1QH 1A6PA 1AQKH 1LO0L 1MFBL 4NRZA 5GZNC 1ZT7A 3GI8H 2HJFB 3NJIA 4QRPA 3MV7B 2IBZX 4JM2A 2MQCA 5BQ7A 5AAWA 4Z7UE 4P2AA 1MXGA 2WLYA 3FFCD 4JE4B 2WY3B 3DX3A 5CCKL 4ZT1A 3T9YA 1ITCA 3HBZA 2X9ZA 4ZMPA 4M93B 4JM2C 4YLBA 1EJ8A 1Z32X 4U2ZA 4YSTA 5AAWC 2DMCA 1I7ZB 5JW4M 2BLFA 4KI5D 2PJ7A 3R9GA 3NJXA 4MCZA 3PDOA 5FW8A 1H15B 4POZD 3ZE0B 3SY0B 4WCYH 4LLYB 4Q9CA 3IVKA 3T0AA 2EXYD 1OCRB 5F3BB 4N8CL 5KUKA 3WNLA 1IM3D 4K23H 3W56A 4XP5L 1CGSH 4D8PB 4Z65A 3ILPA 4B6ZA 3CC1A 4GW4B 5GGRY 1BVLB 3HEIB 3HHSB 4Z95H 3RB7A 5D7LE 3PAZA 2ZJSH 1CXFA 4OB5L 5IQ9A 5GZOA 2VQYA 2VDOB 2J57A 5KVEE 1F58H 1KXHA 4KOCA 1T7XA 2ZUVA 3LQMA 3FCBA 4L9LA 5BXFB 3FS9A 12E8L 3J27A 4NDMB 4X8JA 4MCYB 3BWZA 1G1YA 1JJUA 4JPIB 5AVUB 4G8GD 1ZHLA 4YX2H 3NFPA 4L9LC 2DEAA 3ZL2A 1B6BA 2B3VA 3MV11 3QORA 2GCYA 4E9LA 2HG0A 3S8FB 2DLHA 4U3XA 5EC2B 1X3DA 4NBYB 3BD5A 2I9LA 4PJIF 4FI6A 2QT6A 4GYBA 2ALWA 5JIDA 3QORC 1G0YR 3QWNA 1HL5A 1RZFL 4QRPE 1M2VA 4P4JA 4P5TB 1WIUA 3FKUS 3VDBA 4JFOA 3NRQA 3JTKA 4BZ2L 4J4PC 3WLWD 2XACC 1D2PA 4LKXB 3CXQA 3W5NA 1RVFL 5JIHA 5A16A 4ZAKB 3GBLA 2QSCL 1N4XH 4JHBA 4Q6IB 4BD9A 1KB3A 1FN4B 2VDRH 1WA1X 3WKQA 1UOKA 4GUPB 2LGNA 3ATEA 5IT2H 2NY2D 4ODTL 1BM7A 1ET5A 3AY4A 3L4TA 1M7IA 5BO1H 3T1FA 2HWZH 3ARPA 4KUZH 1JWUB 4M1GL 4KK8C 2G75A 3DJ9A 4GMTH 4KJWD 1EO8H 5FF6A 2B1OA 1FYTA 1IE4A 1NDTA 3AY4C 1ZLVK 1CYWA 1ETZB 3ZDXB 2VJ8A 2A9DA 5DQDH 2Q10A 2E8ZA 4X7SH 3NABH 3R06A 2DQEL 4U1IA 5EZIH 4HKZB 1XGYL 2BIOA 2ZUYA 5AOZA 4Z7VB 1L6PA 2WLIB 3MJ6A 4EKXA 5E8NA 1YPZA 4B11A 3S37L 3G5YB 1VRSA 1DQML 1EJFA 1H5BC 2KLTA 2VW7A 5FKAB 1RULL 8CPAA 1MCIA 1AZBA 1YMHA 1JN6B 3KQXA 1NSNH 1GMEA 1SDAB 3FQ1A 1F2XK 4YHOH 3GMPB 3QFJE 2W94A 3ZJAA 5AOKA 1TTAA 1WFOA 2C5DC 1UOLA 1BVKB 3BEVA 4IIQA 5FYKL 1RUQH 4FL4B 2F7VA 3OAUL 2Q7YA 3K91A 4D0DA 3QJQB 4ZFOL 4IIQC 2ZOFA 2QMKA 5JIMA 1S5KA 3GM0A 2R2HA 5J1TC 2BWIA 5E00A 2PJ0A 4ZS6D 4QYOA 1CMOA 3GHBH 5F7EH 3VTTA 1DJGA 4JO3L 5CGMA 1MOEA 3WY4A 4GNKB 4WFEE 4M5YH 5IESL 3MRFA 5DC9B 1ICTA 4PUBL 2CBMA 4KI5C 1K4CB 3G6JA 4DAGL 1KGWA 3RUGA 4GUCA 4POZC 1IM3A 4LVOC 2PJ9A 2DWEB 1FYTE 5INDB 4MA7H 4PXBA 1JGDB 4DCQB 6PCYA 2QQKH 1THCA 4LU5L 3LJ3A 4NFBA 3W37A 2E46A 2YSTA 5B39B 3TJHD 1YMEA 2AXGA 3EHBB 4JREB 1T4KA 3MRCB 3GXIA 1M05A 1JCKA 1QYGH 3SI2A 2OQJB 4C56B 2X2IA 2BVOB 3A4EA 4XB7A 4MD0A 4GG8B 3ZPDA 3P2BA 3KCPB 3VFVB 5HVHB 2V0AA 3KR4A 4M9PA 5JNYB 3F05A 3HTLX 4DEWA 4KPHL 5HYQB 4P4RA 4P4KA 4X0KA 1B2WH 2OCFD 2OULB 1JOIA 3CFJA 2VZSA 4R90L 2BP3A 1LMIA 3ECUA 1NL0H 4Z3IA 3NYKA 2OFQA 3L1EA 2IPUK 3PRTA 3LRGA 4Z7UB 4HIJB 2R29H 3C2AH 1J18A 1MAKA 3OKNB 2OK0H 4ADIA 4F1ZA 1ETB1 1EVUA 3ZBMA 4MD4B 3KDMB 4K2UL 1X5FA 4UIBA 1I8KB 4NX0A 5LRJA 1I7TB 4TUKH 4R6UA 3TJEH 4NENB 4TWEA 4U1HA 4JM4L 4GKLA 2OSYA 2AEQH 1NIFA 3SODB 3NFSL 1Z9OA 1MVUA 1A02N 3UO8B 1WBZB 3KPLA 4KI5E 4NZRH 1AG6A 3WLWC 3B3IB 5ECGA 4ZQTA 1RO5A 3NH8A 3S34L 3GI9H 1BFVH 1NCAH 4Y1TA 5EV7A 2XA8H 3MNZA 3FB6B 5DA0B 3G6JE 1DBJL 4JO5A 3TO4B 5L6YL 2BJML 4NQSA 5D7LB 4KJQC 2NY2C 3DV4B 5HHXH 5FYKD 2HUZA 4DGWC 4ZQKA 1DDHB 3EJRA 3VVWA 3G5ZB 1BAFH 1AZVA 4KJWC 5A6MA 3D52A 5SWSD 4BQ6A 3PYCA 1HNGA 3UC2A 3GMRA 4ZPVA 1R57A 3C6LD 3GBNL 5DLML 4BEIA 3K9TA 3VXOB 2BIPA 1DVFA 2QQLH 2M1KA 2C34A 3IKCA 2EE0A 4PWIA 3VB9A 3IAGC 1S2EA 1LWJA 4AZ8B 1F8TL 3BT2H 1GOHA 3V10A 1GYWA 4NRZB 1BQRA 2FK9A 1EFXA 1ZT7B 4KORA 5EBGA 4QRPB 5I8EA 4JM2B 1JWMB 3TONA 1JNLL 3O6FD 5BQ7B 4OZFA 3L9BA 4E41D 4DPRA 4HISA 1QLRB 1QPPA 3VD4A 1GTFA 3KR3L 1IC5H 3JVGC 4OC1A 1IY7A 3H7BA 2E27L 4YXKH 2OL3A 3E9UA 4MCZB 3CE1A 1PY4A 4N6QA 1ZHBB 4QCIB 4BE6A 5EN2A 4KSAA 4RIRA 4MXWL 4PV9A 5EO0A 4ZI6A 3G3LA 4PJ7A 5DVOA 2D31A 2IWEA 3KLDA 1Z9NA 4M6NH 2BY3A 1X7QA 2J72A 1CTNA 1IBYA 4JO1H 4XXCA 3THMH 2K9FB 4YMPA 1GGCL 2X3CA 5HDBF 1D6VL 3JWNG 3ESUF 1EK3A 3ILPB 1MFEL 5AW7B 3NSDA 4OI8A 4U1SA 1SJHA 4Q74A 4JN1L 1ZGLP 2V17H 4PJ7F 4FZ8L 3NJMA 3MNDA 4IJ3C 4FP8L 1LCPA 4JG0L 5GGUB 2ITCA 3W0WA 5KJ4A 3F04A 4P59H 4N2EA 4L9LB 2BCOA 4BZ2A 3OXSA 2YBRA 2A9MH 4X8JB 2NUTB 1ZOXA 1AHMA 3I6SA 1KC5L 5ACMA 4MZIA 2HUHA 1ZHLB 4H5SB 1FGNH 3NFPB 3E6HA 4OLXH 3U1PA 4CAWA 4NJ9H 1XF5A 1E27B 1J5DA 1IGIL 2ERJC 2C26A 3QFJB 4G9FD 4WGKA 3FX6A 4OIBA 5K39A 2H5MA 2EIZA 3D87B 3SDAD 1FE8L 4IHOB 2I9LB 4MS6A 5DJ8A 5JXAH 2IOOA 4TLTA 2OSXA 3UTPD 3BMWA 1A6TA 2ZKWA 1Q94B 4GAJL 4XCEA 4DGVH 4HCRL 1EMTH 1NGQH 5IVZA 2DWDA 2R59A 4OCXL 4LSRL 3BUIA 2V9RA 3GUXA 1QBLH 2CD0A 5A16B 4A6YH 2Z4TA 3MU3A 4ELKA 5I1GL 2WXKA 2GTZA 3GRWL 1IIKA 5KAQF 4MZ2A 4NGTA 4ANVA 3IK2A 3IF1A 1IVLA 1SZNA 3S6GA 3MROA 2KT6A 2F8IA 1YN6A 2R56H 1JE6A 1VSCA 1M7IB 4I77L 2GT9A 1SN2A 1GSKA 2G75B 4KKBC 4OLVH 5FF6B 1KOAA 4AH2A 1FYTB 5EO1A 4X7FC 4QTHA 5J89A 2LE9A 3CBRA 4AJ0A 3WMPA 3BWSA 4JRXD 4WLCA 2UXTA 1JGUL 3L95B 4KO7A 3R06B 1MEXH 2NY0C 5LDSA 4YDKH 2QGEA 1MKFA 2CO6A 2CCWA 3BKYH 1H5BB 3SDYL 1MCKA 3BGMA 3W0WE 1TTUA 1O6TA 2GJ6A 4QI3A 2H41A 4EN3D 4ZFOA 1BHGA 3F7PC 3T3MF 1JGVH 5E03A 5AVXB 5T3XH 5CCJA 3SY6A 2IBBA 2CBTA 1YMHB 3IWUA 3C6LA 4Y9BA 1OAXL 3S5ZA 3DO7B 2C9QA 4X98A 4A2DA 1S60A 1G1OA 2EINB 2MFNA 3NZUA 5BVPH 4GT7A 5CD5D 1ZHKB 3C6LC 5J6GA 5KSBF 1WLHA 2DJMA 3BEVB 1C1EL 2M26A 2IDFA 4IIQB 4KNTA 1NIAA 2R69L 1H6EA 2BINA 1ZT4A 4IKJA 4BINA 1JXFA 3F8KA 2Q8AH 5JIIA 1Z5LA 3Q05A 2ZEFA 4CRYB 3B2XA 1MZZA 1UWGH 2D03H 4LVHC 4S1DC 5EWIH 4D0DB 3GEWB 5DHDA 1JTTA 1VENA 3FFCB 1TITA 2R2HB 4JY5L 1JZ4A 1XEUA 5E00B 3G8WA 4CC4A 4JHZA 5DO2D 3TEYA 4JZOA 5L8KB 1MFCH 1NPUA 3O6FC 4QYOB 2BUEA 4PJ9A 3IU1A 4XVUD 3KXFD 2WZPD 4C2YA 5L4JA 4DN4H 3TFKC 3O6ML 3EF7A 3B6SB 2ZSWA 1RXTA 4PJ9C 3DA0A 3G6JB 3Q1SL 4TL5A 5HD8C 2BSDA 1RUPL 1IM3B 4B14A 2EEXA 2Q3ZA 1VDGA 2UZYA 4NUMA 3OPZH 1Z9LA 2E0PA 2ZG2A 3B37A 2W0PA 4WO4A 3PFUA 1JZGA 2AXGB 2RQ8A 4IW4C 1T4KB 3GIZH 3E7JA 2G3TA 4NQED 3IWEA 3OAYH 5FYKE 4GMSH 4PSPA 4F0XA 3Q06A 4WO4C 4MD0B 2X0WA 2AJUH 2JJTC 2YD3A 1V0CA 2A9AA 2X09A 2AF2A 5FYLH 4FC3E 3BD3A 3ZHKA 2AJYL 2IH9A 5E5MA 1VB9A 4X0KB 5SWSE 5L2JA 4JN2A 1GOGA 1I31A 3CFJB 4G8GB 2ESVD 2XWJA 3QUYD 2E9GA 4HNYB 1QBBA 1UACL 4K9EH 4G9FA 2BSRB 5C09A 4JAMA 3FBQA 1AY1H 5EFIA 3BPOC 3GJFK 3WV0A 1YX0A 2HYMA 1B4LA 1L9QA 2OOTA 1TYJA 1BGXH 4F57L 2D7OA 3AWFA 4NN6C 1GSMA 3L16A 5LN4A 1X12A 2VLRD 1BWWA 4P9MH 4TUOA 1UT9A 1XCXA 5EMIA 1XIWA 3AITA 3SDAC 4Y8AA 3W9DA 5F93C 4H2KA 5IM7B 4YNYA 3FCUB 5B1AB 1NSAA 2HT4D 5FR3A 4ZD3L 4W4OA 1BLLE 1S9XB 1XIWC 3CN1A 3OHXA 1A3ZA 5LBSA 3KPLB 5DWUL 5I6OA 1NDMA 4XPAH 2Y5QA 4W4OC 4YHIA 4I0KA 2R1WB 2NY2B 4A68A 1UFGA 4M3JA 3OHXC 4JKPL 4OUOA 3MV9A 2QVFB 4V1DD 4AV0A 2OBGA 5AENA 3MLTA 1ES0A 4ATWA 3D2TA 3Q7JA 1I9RL 1U8OA 1E4XL 3I3EA 3UO1H 3LSOA 1YREA 1RHFA 3QE5A 4TLUA 2GYSA 2VN3A 4QGYA 3ZTJH 3PHAA 4HS3B 4JRXA 3S96A 1D9KD 3DIFB 3O2DL 1A6WH 4J3OH 2WXJA 5FO2A 4GI8A 3V52H 4CGUB 4YWGL 5IZ7A 4LNRB 2YEVB 3WEMA 4FJYA 4ZPVB 5I4MA 1EDYA 1QLFA 1KCKA 2V2XA 4KNUA 4E9SA 4OZ4A 4YE4L 3PB9X 4GKZA 3FO2B 4WWKA 3ARBD 3RPKA 2J25A 4HUMB 4JMNA 2OMUA 2GK2A 4XR8C 4YDZA 2GUOB 3IETA 3SGKC 3WKMH 5HHQB 25C8L 1M57B 4A7VA 2IMOA 1A25A 2H0JA 2WWKO 1EFXB 4WWKC 5ITBL 4H89A 4F9VA 2X4UA 4Z3HA 2FSRA 3OKDA 2GPZA 5I8EB 5C09E 4G9FE 4OZFB 1ZVSB 1QKZL 2ZPAA 4B97A 4XN7A 2DS4A 5CJQL 3TTSA 2QMLA 3D0AA 3JV5A 4JCMA 4YFDB 3UTPE 1IBGL 4KK6D 4HETA 2APSA 1JFQH 2AEOA 4R4FL 2ITDA 2GY7B 5CWSA 2EXTA 4KDWA 3GMQB 4GP4B 5EN2B 3II1A 4RIRB 5FGBA 5GRVK 1N5AA 4GI6A 2B4CL 5EO0B 3B2UC 1FNFA 5AW3B 3ZZ1A 3AMKA 1X7QB 4TOYL 2XEFA 5I18L 3RGBA 3W39A 5TF1L 2JI2A 4H8PA 4R2GC 3QDJD 3VG9C 4KHXL 1EX0A 4Y19A 2OMYA 4IJ3B 4DO5A 4GLRH 1QLEH 4U1SB 1TQTA 5IMLB 2XYCA 3AG1B 1LLAA 1KGIA 2EDRA 4J3WA 4B9JA 3HRPA 3BIBX 1UHVA 1PKQE 2V3FA 1G5GA 5LGYA 3NEEA 1KJVB 3W0WB 3GM8A 2O5NA 3L3IB 4JRXE 1IAIH 4W9KC 2F1BA 4HCRA 2ERJB 4C8XA 2FJUB 1QWHA 2QKIA 2XIDA 1NCNA 4PBDA 3KASA 2DD8H 1GS8A 4C58B 1ZHNA 3MODL 1G0DA 5DZVA 1ASPA 3E6HB 3GRWA 1D5XB 4ZUVA 2H1XA 1NLBL 2PR4H 1U3HD 2EH8H 5FYJU 5A2IH 2EE9A 4G1PA 5K39B 1OVZA 5A2BA 4KDVA 3FOLA 4KGJA 2ZCKH 1K5NB 3QEQD 2ESVA 3QQ3B 5EIQA 3D7FA 1KYUA 1WIOA 4Q58C 4DK3A 1A2ZA 3IWGA 1A6TB 4Y7MA 4XBMA 2PJAA 2DAVA 5H4YA 1MFDL 2ZICA 2Y0MA 5HGGS 5IVZB 2FEEI 4F9UA 1TTFA 2X4RA 1BVNT 1DSYA 3BCFA 4IYKA 4BSJA 5HPMB 3KPPA 3CN3A 4H20L 4ELKB 2BVPB 2YPKB 4X6CA 2GTZB 3N43B 4WFGD 1PJWA 1F90L 2KPWA 2VLRA 4X7CC 1A1MA 4X80L 3IF1B 5EUOA 1QO3A 2FH6A 3MROB 1YN6B 3GSQB 2GT9B 1Y1UA 2PTUA 1HHJA 32C2A 3L4YA 3MCLH 3VXTA 4JPWH 1TENA 1SM3L 1TVDA 4J12A 4X6CF 2BHZA 5EO1B 3LWUA 2I5YL 2NY0B 2DQHH 4K5OA 4QTHB 2VXVL 3BZFA 4JR9H 4AEFA 2DBLH 1KB9K 2FJGB 4V1DA 4XHQA 2I79A 2F58H 4X5WB 4PY8I 1RZIA 3G6AA 1IGCL 1E3ZA 2DQJH 2ZP8A 2RFXA 4AQOA 2CO6B 2XEGA 1TLMA 3MLSL 1UT1A 2R69A 3U2SB 3BC9A 5IEHB 3BGMB 3P2TA 2F1EA 4J8RB 1WQVT 2NW3B 1Z9SA 4QRTB 1H3GA 3FU0A 4R83A 4ZFOB 4KVOE 4JXRA 5SWSB 2VDML 2EUZA 2NY5H 4S1QL 5J6HA 2CGRH 3C6LB 4LSVH 2ATRA 1AQKL 1J0JA 3DJRA 4WNJA 4X98B 2FD6H 3GI8L 4JWPA 3REVA 1IEBA 3S48A 3GTNA 3NCFB 4N68A 1E9OA 4ORFA 2QVKA 3EDKA 2DEXX 5JXED 3WEXA 2CK2A 2HJKA 3PWNA 2ESVE 2EC8A 1Z5LB 1RIHL 3MOBL 3O6FB 4OZHA 4PTTB 4XB8A 1TQCC 3LS4H 1P6WA 4WCYL 3FH8A 1K3IA 2AZAA 4HW6A 4W9FC 5DJ6A 4CADA 2VLRE 4PJ9B 4WQOA 5EUOE 2W92A 2X7LA 1Z4RA 4K23L 4FCAA 4CAVA 3E6FA 1CGSL 2PCUA 2NT0A 2BW5A 3A6CH 1SQMA 4N0FB 1SNRA 2ZSWB 1AD9B 3VFGH 4YO0A 3SKOA 3ETTA 4BCXA 4OZIF 2XG5B 2B58A 4Z95L 3CT9A 3ARED 3QDJA 4IMKC 5F3HA 2ZJSL 1CGXA 2HFEA 2UZYB 4HAFA 5EOCJ 5T1LA 4PN6A 4YPJA 5K9OB 1NBCA 4WO4B 5C9JA 4UV7H 4V1DE 5JMOC 3EKCA 1F58L 1KPUB 3VMPA 4PJBA 2AK1H 5DJDB 5EUKA 4H8HA 4PB0H 4YX2L 3EO9H 4FADA 3AM8A 1C16A 5L2KD 1UTDA 3BPOB 1DTDA 4JN2B 4JFZH 2XWJB 3FHAA 3V0IA 1YLBB 2XN1A 1L7IH 3KYKH 5E4AA 4NN6B 3PABA 1B87A 4G9FB 1O7DC 1I12A 4JAMB 4OTXH 5EFIB 4P3DA 3CZXA 5I8KH 4PP2A 3K6NA 5C0EA 2NYKA 1TPXC 1BW8A 3SDAB 3GSUA 1H19A 1QW8A 4BQ8A 1S9WA 2OXHA 3V8IA 2P5ED 5C0CD 1U3HC 5T1JA 1ZO0A 3FCGA 1CQKA 1N4XL 1UD5A 1XIWB 4OZHE 2YUXA 3AG2B 1ZJAA 1WD8A 3CIAA 5IT2L 3TTYA 3O2DA 3TNMA 1PX3A 2BZDA 3I9GH 3OHXB 4GAYB 5BO1L 2HWZL 1ZS8A 4KUZL 5FHBH 3V4LA 3V6BR 2XWTA 4GMTL 1EO8L 4YHIB 2X4PA 2NYQA 1M7XA 3MNWA 4YDMA 3HVNA 1GIGH 5DQDL 3MLTB 1UB6B 3NJJA 4X7SL 3NABL 1U8OB 3QDJE 5EZIL 1PKQB 3LSOB 3QP3A 3JYBA 3KBEA 2WQRA 4D0BA 4JRXB 3S96B 3P9LA 2XQYA 3UEZA 3C2SA 2E86A 1A9EA 5EIIA 1PLAA 3DXAD 4PJBE 3CFKA 3ULUL 4MQ7A 2EILB 2FBJH 3AACA 2V8VA 2DIJA 1S7FA 1QLFB 1D7FA 2V2XB 5D7IA 4OZ4B 4GW5A 1NSNL 3X3GH 4WWKB 3GZPA 4YHOL 1O7DE 1MW3A 3SD2A 3EUUA 5D9SB 3EYQD 1USZA 3DARA 4GY4A 4JO2H 5KVMC 1RUQL 2ICCA 4OVUA 2DYSB 1TZIB 1K72A 4JXQA 4O02H 3ZHDA 1J10A 2B4CC 2K8QA 4V11A 5HYJA 4FYSA 1F97A 3BVXA 4UCMA 3N06B 1I7UA 2CJUH 4R5XA 3QEQE 3HE7D 5DDHA 2V2WA 4RMUA 3C60D 3GHBL 3P3RA 5F7EL 3T65B 5JXEC 5I1AB 4U3SB 5CWSB 4HUVA 4K3NA 5EN3A 2VM4A 2P47B 4M5YL 4M62H 1N5AB 2NDFA 4R2GB 1TFHA 5KN5A 4QOKD 2LFEA 5K1VA 3HS8A 2AXHA 1KN4H 4WFGE 4AGOA 3KLHC 4H8UA 3W39B 1TMQA 4JFQA 2Q4ZA 1P2CA 1V8HA 3CFCH 4LPCA 4L0ZA 3IS1X 4MA7L 5AYTA 2CH8A 2OMYB 1ACYH 1M71B 2JQZA 2QQKL 3W9EB 1Q0YH 4S2SA 1BAGA 3H42H 3BP5A 4GBXD 3QQXA 4ETYA 4JFSA 1QYGL 2YOCA 4I9XA 2MQ3A 2AFOA 2HB0A 3VFPA 2DBJA 3CPXA 2Y2WA 3KYMA 4CKQA 3AREC 4RMWA 1YSJA 4Y49C 1VZGA 1SRDA 3H2WA 1B2WL 1E4WH 1ZHNB 4AIZA 1XGTA 2H2PD 5D7IE 3TF7C 4RFOH 3FDWA 1WRFA 4N2AA 1NL0L 1SHWA 4GSUA 4K7FA 3C5ZD 2J43A 3FTZA 4MJ5A 2R29L 2ZENA 2UXVA 2JQAA 3C2AL 3SZ6A 4QLRA 1KT2A 2OK0L 1WC7B 2ESVB 1FVEA 1JMZA 1NWPA 1S4IA 5DJYA 2MOVA 3WUWG 5L7XL 2Z6FA 2VQTA 3OAWA 5FW6A 1GGUA 3VARA 2WNXA 3MUJA 4NEHB 1J9TA 4TUKL 2Q0ZX 2X4RB 4FXLA 3TJEL 1JK9A 4LQFH 2AEQL 2P5EA 5C0CA 3BAKA 1NLDH 2VLRB 4MASA 2NYYC 1A1MB 5EUOB 4KU1A 1QO3B 4NZRL 1DJZA 1CICD 2XIBA 4OC0A 4XZ4A 3U36A 1IYLA 3GI9L 1BFVL 1NCAL 2WCPA 1CI3M 2ZSVA 2W65A 3NIFE 2XA8L 2H0EA 4HV8A 1HHJB 32C2B 3P4LA 4PJFF 5ENWA 3WAKA 2BMKA 3KYOB 5ICXA 1I9IH 4M8QA 5HHXL 1BZEA 3BZFB 5HGHA 4KUBA 4W6WB 3M07A 4V1DB 1BAFL 1RZIB 1UJTA 1QFUH 5C3IA 1Q2CA 4G3YH 2RCSH 3AG4B 1RFDH 1F11A 2L7EA 2JBKA 3ISYA 1D9KB 2QQLL 3B9KA 5DD3H 3GLEA 5F8RC 4YBHA 3BO8A 3SGDI 1KB5H 5IOPA 1OT1A 1QNIA 3BT2L 5J6HB 2EIDA 3WIIH 3JRUA 1Y7VA 4OIAA 2ZX9A 1T1YA 1IEBB 5J9PB 4JKKA 1HCZA 1E9OB 4KLVA 4UT7H 5C6TH 4ZSOA 2MEJB 1WFNA 3BJ8A 1JHTA 2HJKB 3LQAH 3PWNB 3T3PE 4CVWA 1DUZB 2IQ9H 1IC5L 5IR1B 5E6ID 4HS8H 1TQCB 4F37F 2CNSA 4YXKL 1TKFA 1KGCD 2BNRA 2VUOA 3LPWA 4OZHB 5PCYA 5SX5H 3EYQC 1YC8A 4UZUA 4XO5A 4BFJA 4NM4H 3SPJA 2J8UF 5C97A 3C08H 2J8OA 3M6DA 1MCRA 1I1FA 4ZBJA 3HE7A 5DJZB 2P5EE 5DJ6B 5C0CE 1R3NA 2X3AA 2CDFA 4M6NL 4NHUA 4JO1L 3THML 3CZFA 1NEZB 3GUTA 2X7LB 3GPEA 3V5DB 4OJFH 3STLA 1SOXA 1MNUH 3E6FB 3HE7C 3C9NA 4F7KA 2HQYA 3GBDA 5ADPH 3G9AB 4FA8A 3PFEA 1DJYA 1S7VA 2JELH 3RNQA 4GO8A 3SKOB 3LVEA 4HJGA 3OAZK 3A47A 1JV5B 3TLRA 1ELMP 2V17L 1HQRA 4H1LH 4NOFA 3QDJB 4W1TA 2HFEB 3ZYOA 4HJUA 2QECA 1I1CA 3EJUA 1WSST 5TE4H 3U6RA 1RURH 4PCSA 3V38A 5F6HJ 4FG6D 4P59L 1HESA 4PJBB 2CA3A 2K7PA 4YFLF 5F0LB 5F7FA 4H26B 1ZD6A 2A9ML 5EUKB 4JRLA 5DI8A 2B0SH 1JS4A 5C0IA 3PGFH 4OLXL 3LYRA 1ZEAH 5I74C 3DVFA 1HHGB 1QR4A 4NJ9L 5E6ZA 4PB9H 4APXB 2H1PH 1M6OA 3DXAE 2VXQH 2QGDA 3QWRD 4FNLH 3MKGA 4UI2A 1DEEA 3ME0B 5E23A 4G71B 1TPXB 3UTSA 5L0QB 1AQHA 4HK0A 4K3HA 5FA4A 5JXAL 5I6PA 1DANU 3VGGA 3D18B 1BVZA 3S6FA 1AR2A 3KPTA 4P3DB 1L5GA 1U3HB 3N91A 4E0RA 1TCMA 2W60A 1L6ZA 3QDGA 1X7TA 4U1MB 4AMKH 1ZT1A 3JSSA 4DGVL 1EMTL 3K46A 4ZSOE 3GSUB 4UDTA 1NGQL 1M42A 3QEQB 4FYRA 1DVZA 2OXHB 1QBLL 3B2MA 3C5ZC 4A6YL 2W1NA 4G8FA 2OYLA 5JO5A 5D1ZD 1NKRA 2XBTA 4LT7A 1IVTA 1FJ1A 4NPJA 5E2TH 2C9SA 4IU3A 4UQBA 4F8LA 3DSFH 3WFCL 2R56L 3T6ZA 5I15H 1MREH 5IHHA 5AG7A 4N0UA 1J0ZA 3S3DB 1ZS8B 2XWTB 4OLVL 5FEBA 5ID1A 2A4NA 1CLYH 4RDBA 2X4PB 3EDJA 2X88A 1P84K 2EEAA 3ULUD 3G6DH 3QRFM 5JMRA 3EYOB 1SVZA 2RACA 2IJZA 3HC4H 4UCFA 1FV1B 1Z3GH 2XZZA 1MEXL 1H9VA 3S4SA 1RKRA 5F7MC 3BKYL 2YAFA 4Z78A 1I3UA 1XD0A 3R8BB 3P9LB 1A6UH 1A9EB 3WS3A 1F41A 4M29A 1JGVL 5T3XL 3UZVA 5EO9B 3LKPA 4B13A 5D7IB 4NQVB 2C9VA 2Y7QA 1KWKA 4GW5B 1TLKA 5ICYA 3ULVF 4JNXA 2YNEA 3MKKA 2EWBA 4DP1X 4PS7A 1BPMA 5BVPL 5FYJD 5LNGA 1X5AA 1JNHA 3KMDA 4GJTB 2H8PB 5EF0A 1U58A 4R84A 5DVNA 3U7YH 5C0AA 1QBMH 1E67A 1KXVA 2F53D 3BAYA 4AEEA 3H53A 4HDIB 3H2PA 2Q8AL 4B96A 1JZIA 1UWGL 3WEAA 3O11B 4GI9A 4PJAF 3KEDA 1GZPB 1KXVC 1I7UB 1P4LB 4YSAA 1GA2A 3KWUA 5E6IA 5I1LB 4GH7B 3S5LA 5DDHB 3R19A 2V2WB 1MFCL 1RCYA 1Y07A 1GGIH 1WZMA 4JGJA 4KUCD 5K33A 2P24B 1TKJA 4HUVB 3UY5A 2ZW6A 1YC7A 1ZPLA 2NY3D 5B38G 5IMOA 2QQNH 5E6IC 5I71C 2QVTA 4DN4L 3EG9A 1IGMH 2OJZH 4I2XA 3NIFB 1PZ2A 1N9PA 4MQTB 4N0UE 3UJJH 4QKXB 4JFQB 4Z3JA 4B12A 1P2CB 1AI1H 2WZ6A 3QJOA 3JWDH 3FEDA 3L3JA 3OPZL 4OKVA 5I30H 2VZVA 3PE9A 3QCVH 5K8PA 2HT3D 4JL2A 4BQBA 1ECYA 1S6NA 2R29A 3GIZL 3FUFA 3AREB 1P1ZB 2FVGA 1XR8A 4GMSL 3RQ3A 2WPWA 5K8NA 1T7ZA 3ARDD 3KYMB 2AJUL 5DRWA 3H5ZA 4PJXA 4X8GA 5FYLL 2WNWA 1BJ8A 1V10A 5J3HD 1DJSA 1Q72H 3AWGA 2IH8A 4CSPA 4L2LA 1NANH 3PV6A 3LKQA 1XGTB 3IMBA 1BF2A 4FG6C 4GXFA 1DJXA 4K7FB 4K9EL 5AAMA 3IM1A 1AXSA 3QXUA 4MJ5B 1AY1L 3HAEH 3BDBA 4PJXF 3VACA 3VXUD 5L2KB 2K6YA 3AXLA 5F88A 1BCIA 1GYUA 1QACA 3UBXG 3BUBA 1BGXL 4OCRH 1FVEB 4GW1B 5AAMC 2J8MA 1HFUA 5DJYB 5IQLA 5ACZA 5AZ2H 3C8KB 1NCDH 4P9ML 1ZSHA 1E50A 1ZKAA 3ASNB 4L8DA 5DFAA 3ETBF 4EQ2A 3ZL1A 1F6AB 2P5EB 5C0CB 3CXSA 3X12B 2EXWD 1JUFB 1MJJA 4YSSA 5T3XD 2YPLA 3D7GA 1KGCE 1A3LH 2VEZA 2VRKA 3BZ5A 4XPAL 1BEYH 3U36B 4MCPA 2ZSVB 4BRJA 2W65B 4I2XE 3KW8A 1Y9KA 1Q1JH 2AJVH 4KH9A 4YR6B 4EUPG 3MLVH 2VDMB 5ENWB 3FFDA 2OTPA 4Y4FA 4IK6A 4KKCC 4OVVA 5ICXB 3M86A 2AQ1A 1J8KA 5HGHB 2H47C 2BOCA 3MGOA 1XFPA 1O5PA 2JCCE 4OLZH 3UO1L 4RI1A 3RG1C 4EFDA 5DHXB 1HZLA 2PYFA 3GYAA 4Y4FC 3VGFA 4KI1A 4DJMA 2F68X 3KHZA 1A6WL 1PG7X 3MZGB 2DIAA 1NJ9A 3V52L 3W3BA 3VWJD 4P2RD 1BLNA 3G7TA 3ARRA 1JIBA 2CHZA 2VXKA 1JF6A 3ZDYF 1YAZA 3V4PH 4AYDC 1URIA 2K45A 3DXAB 4TULH 3V9CA 4XVOA 2ROYA 4PJ5A 3QULB 3WKML 1LK3H 5IOPB 1XBDA 1FFOA 3IJ3A 4U31A 5EA0H 2IANA 4H7VA 1TKWA 5F9AC 3DV6B 3BVUA 4A7TA 1WZLA 5AKTA 3RB5A 3QQ4B 3MCG1 4L3ED 4ZSOB 2D2OA 1JHTB 2MRYA 1DVXA 2N7BA 5FV2A 2Y6TE 2JIXD 3HN3A 5AW1B 4ACPA 1NOLA 1RZJH 4U0QB 4UQ2B 1O75A 2W38A 3T8XB 1X7SA 1WVZA 1JFQL 3UJIH 4B53A 4ZYQA 5CILH 2WYTA 4XPTH 4K7PY 4QTIH 3EFOB 2M2DA 3HE7B 4JS7A 1JZ8A 3TA3D 1T5WB 2CDFB 3S6KA 2E8YA 4NHUB 3ARFD 3WHE0 1EWHA 2APFA 3STLB 2YAPA 2IAMA 3D8MA 1X5JA 1BBDH 1CLOH 3C9NB 4DP7X 3FL7A 4F0YA 1S7VB 3RNQB 5KYYA 1NIBA 3EIFA 4HJGB 1QLEL 3BVDB 3KL9A 2CDEA 2NY3C 3AT0A 3LPPA 2Z31D 3CK0H 4HJ0D 4MD5B 5DF0A 4FFYH 5DRXA 5EEXA 5E7BA 1FAIH 5D6CB 1AQ8A 3N0PB 2AV1A 3Q6FA 3HG1A 4WTQA 3U6RB 1ZJBA 1IAIL 1BVNP 5I74B 5K59E 3GJFH 4G11A 2R4SH 4Y9EA 3MRQA 5DI8B 2X4NB 1U8KA 1U3YA 2DD8L 3O0LA 4HJTA 5C0IB 2HT3C 2FEJA 4LL9A 4XCCH 4A6YA 1JYNA 3FYNA 5D8JH 1FVDA 4A63A 2FLMA 4JGNA 2VDRB 1M6OB 2C8NA 1YO4A 2PR4L 3NJGA 2EH8L 2Z1PA 1DEEB 3FQXA 1BQLH 3ARDC 3OSVA 4Y5YA 2ZCKL 4HK0B 4AYSA 2IANE 1GKEA 4CBPA 3BRFA 4HGWB 3R7RA 4L4VD 4NAMA 3F64A 3C5ZB 2BVYA 4E0RB 2W60B 1JTPA 2GK0A 1ZT1B 4MAYD 2O72A 5FM5O 1R3IH 4UDTB 3DX0A 5KSVA 2FQGA 4ZG1A 4J3OD 2X4OB 1H3VA 4G8FB 1E4HA 4KMLB 2OCCB 5JO5B 1KLUA 1KDJA 5FDWA 1BIIA 3GSOA 2CWRA 1FJ1B 4Y88A 4ANUA 3POCA 2ZNXA 3FJTA 4IU3B 4L23A 4BFIA 3U83A 4EKJA 2OR9H 3WYRA 4N0UB 4F8ZA 3LNHA 3MUGA 4HUUA 3MCLL 4N87A 4JPWL 5CBMA 1MI5A 2Q51A 2DQHL 4F9LC 4B0MB 4JR9L 2DBLL 2GIMA 1P0HA 3VGEA 3MA7A 2R0ZH 3GSVA 3H3PH 1T89C 1CFQA 2F58L 4N8UA 5AVQB 1CJWA 2X2JA 1NMCC 1PPIA 5EBMA 3MCKA 5FAAA 3S4SB 1CL7I 2R9HD 1IQWH 2GTQA 1QTPA 4HKXA 2Z35B 4Z78B 4BD4A 4WHTB 5TK2A 4Z0BH 4PRPA 1AP2A 1MVFA 4LOFA 3WS3B 3U82B 5GRWA 3U6XS 5AQ0A 1Y7EA 3UZVB 4P2RA 3R1GH 2G3AA 2NY5L 1CFBA 2DQCH 3WAJA 4K3EH 2CGRL 2ETWA 4LSVL 5ICYB 2FD6L 3VWJC 1OTUD 1U42A 2X0UA 1U58B 1OM9A 2WLZA 2YUVA 2ZOUA 1E5YA 2FLRT 2VABB 2GLJA 3K5SA 4OD2A 5SV4A 2ZOOA 2E59A 3RNKA 4FLHA 4W9LC 1OTSC 4Y2LA 1BQSA 5L88H 1ON0A 1F3JA 3LS4L 3MLWH 2JIXA 3KPNA 1HZKA 5E6IB 5I71B 1BZ9A 1QI4A 3CJJA 3FU6A 4JZJC 3RURA 3QVAA 1WWBX 3ZZLA 1BPNA 1CQYA 2GIVA 2PE3A 2B4DA 4PJCF 1YVOA 5IMOB 1QSVA 2YLHA 3IN0A 3EG9B 3G3SA 4L37B 1A65A 3A6CL 4FFTA 3KW7A 4I2XB 1OZTG 3VFGL 3APNA 1HH6B 2NPLX 5T3XE 3MPCA 1BXVA 2XBDA 4QRRA 4WEMB 5DVLA 2XWEA 3OSKA 2I25N 1EDQA 2JCCB 3BLBA 3L3DA 3TBSB 1HIMH 3ARFC 2RB7A 2GBUA 5F7NC 2RGSA 5F70A 2ICWA 2Z31A 4O9HH 5GISH 1X6NA 2AK1L 1XR8B 5LAXB 2CUHA 4I48A 4R26H 2VDLB 4WEUD 4I3GA 2DYRB 3PFQA 4PB0L 4UMSA 4MVBD 5DRWB 2VXSH 5LQBH 2Z31C 4HJ0C 3EO9L 2DPTA 3CXHJ 4PRPE 1QSZA 2X10A 3U1SH 4HULB 4ZZFA 5C3LD 2A6DB 3U6XA 1IOIA 1U6AH 4P2RE 5HJDA 2WTOA 3PV6B 4WW2A 3LKQB 2KCWA 4JFZL 1CCZA 2ZW5A 2V4LA 4JRWA 4MHNA 3ASWA 4E5XA 1L7IL 3KYKL 3QUGA 5DUPH 4ZFFB 1AXSB 2NCMA 4JDZB 4WW2C 1FL3B 3BFOA 5I8KL 4BBHA 4G9DA 3AXLB 5F88B 4WDIA 3WNIA 2QSTA 3DLQR 5IQMA 3VUAA 5ACZB 3OZKA 4L4VA 3TO6A 4XP4H 2BS8A 4PV6A 4U1KA 5F89A 1E4KC 5IV2A 1QSED 2AGJH 2AVGA 1R3KB 1UM5H 4RZCA 1KBBA 1MJJB 3TX4A 3I9GL 5FHBL 5HXMA 3QWOA 4GXUN 4XX1E 1E5UI 5G21A 3VI4F 3TF4A 4J3OC 1OB0A 1T6BX 43C9B 3BMVA 1PMYA 2QADD 4B10A 4H25B 4AENA 1GIGL 1OGSA 4Y4FB 3WE6B 4GEIA 3G5VB 1ODAA 2GEEA 2OMTA 3MGOB 4EI5D 3AMLA 4WTZG 4JKMA 4NPYA 3L4VA 1N6QH 4AK2A 4CGNA 5ANMA 1NJ9B 2HLFC 4DQAA 3DK2A 2Y0SA 3NSFA 4GO9A 2FBJL 3SBWC 3ZHLA 1KUVA 4PLKC 1XSOA 4LLDA 3ZR5A 2QR0A 3X3GL 3AU1B 3GZOA 2X0VA 4QHMA 1HYRC 2C3GA 4JKLA 3D25A 3CTTA 2WHVA 4L8SC 1FFOB 1EBPA 1TKWB 5A7BA 5IHBA 4FNQA 4JO2L 3SZKC 1AGDA 4O02L 4BQCA 2GAZB 4KOXA 5IQOA 5M94B 1NAMB 4PXDA 4G72B 3LZOA 5BZWA 3ARXA 2JSFA 1U41A 3F83A 4I3SH 2F53B 1OTUC 3V5HB 3JV6A 4L4VE 2BP8A 2MMXA 2AK4A 3T4YA 3X13A 5JORA 3GB0A 3DX9A 4JANA 4M62L 1N67A 2GITA 1TEGA 2LU7A 2P26A 2X5PA 3QHFH 4FULA 1CPUA 1KN4L 2WPXA 3QZWB 3QPQD 4FF9A 1JXJA 5IFHL 2FWOA 5TFSH 3RYOA 2NY3B 1U93B 3CFCL 4PRNA 2ZX7A 4EZJA 1A47A 4Q38A 5M95B 1ACYL 5KYYB 1SXZA 1E6OH 1Q0YL 1D5IH 4B41A 2CDEB 3H42L 4GKSA 4LP8A 4U7KA 1OY3B 3A67H 3BWUF 3BDYH 2AV1B 2J1XA 4RDQG 2AFUA 4JFHD 2P7TA 2EO7A 4L1LA 4MNQD 3VFMA 5AGEA 4M43H 4UU9A 3M7FB 5CCHE 3MRQB 1MY7A 4DOHE 3I9SA 1E4WL 2Y72A 4A6YB 3ARDB 1EAQA 2P28B 1KPRA 1CP7A 2VW4A 1FVDB 2JB5H 4RFOL 4LLWA 3DX7A 4OCSH 4YN3A 2F08A 2HTLC 2MNJB 3LXUX 3U9UA 1FHNA 4MVBC 3V4VH 3DWTA 1NCTA 5EEVA 2AERT 5ALBH 3GXUB 3LPGA 2JLLA 5FFLA 3TZVD 4LMQE 1CBVH 4XP9L 1QHQA 4M7KH 5KSVB 4LQFL 3IDNB 1RZ7L 5I6KA 1XMBA 4ZMQA 1WICA 4TM9A 2DQUH 2O1AA 1KLUB 3O4LA 1NLDL 3QK0A 1BIIB 3GSOB 1XF4A 4AVAA 4NC2B 1PD0A 4QC6A 1HCVA 5EPMA 4BFIB 1QSEA 2F5BH 4MY3A 3ASOB 3D3VD 4J6IA 4XMWA 4YFLI 4AQEA 3I9PA 3FAWA 3IFPB 1D2OA 3MUGB 4HUUB 5D2LA 4UAOC 1JGEA 1NMCB 3UGUA 2YXVA 2PO6D 3BPCB 2CLZB 4Q0XH 3MA7B 4M4RA 3GSVB 2NY5C 4R4ND 1CFQB 3JZ7A 3GIVA 2HG5A 4GG6F 1QFUL 3DGVA 5EBMB 4G3YL 5DK3A 2RCSL 3MTRA 1CPSA 3V9FA 3HS0C 1RFDL 1E30A 3EOTH 2QADC 4G7SB 2ZXEB 1Q9WA 4PG9A 1WBYA 4B3VA 2P46B 4DKFH 4PRPB 1AP2B 2BY0A 4X7TA 4YSEA 4EI5C 2NR6A 4X8CA 3BN3B 4MJHA 4CBZA 3VWJB 4P2RB 4NRXB 1KB5L 1CFSA 2MCAA 2Q1EA 3N43F 5EC1B 3WIIL 4E42A 1CLCA 3RVTD 5IVXA 1DLHA 3N42F 4M6OH 4UT7L 3MLYH 4HIHA 5C6TL 4O2EA 3HG2A 3LQAL 4MCNA 1T03H 2IQ9L 2GANA 4OM1H 4WU5B 2BP0A 4GT0A 4OD2B 1ZLWK 3ALXA 4NO0A 4KKNA 4JZJB 3RNKB 1XEBA 5JQ4A 4WAFA 5A6LA 5ESQA 4KKZA 4OV5B 3OJMB 5FO9A 1KCVH 1T4WA 4NM4L 3SPVA 2WV3A 1F3JB 1U8HA 2EYTB 2J7LA 2JIXB 3C08L 1BZ9B 3KS0J 3QT2A 4ATTA 1FNOA 4EZKA 4NO3A 1OV8A 5KYUB 3O4LE 2DI7A 4PLJD 5LAPA 4B50A 5ELYA 4J7RA 2HRGA 1HDQA 3T8VA 4OJFL 1YMMA 3QJTB 4KJYA 1MNUL 4M7LH 1QSEE 4XODA 4HKBA 2WZ0A 5JW4N 1CG2A 4U9ZA 5ADPL 1EHLH 4FD6A 2JELL 5D4IA 1B3IA 2N4IA 5DUMH 3F00A 3RWDA 3VYOA 5JOPD 3ARFB 4DPBX 1JDAA 1P4UA 1YY8A 2R1XA 5HHPB 4AJWA 4NKOA 1HL9A 5TE4L 2XT1B 3L3DB 1RURL 4NUGH 4QXTA 2X38A 2IF7A 4ODWA 3BZ4A 4F58H 2EDFA 2ICWB 2UV3A 2Z31B 1OARH 4HBCH 2NNFA 3P02A 1DVSA 3H6AA 2E6PA 4I48B 4YGVA 1DANT 1NCJA 2B0SL 3PGFL 1ZEAL 2WW8A 4MNQA 2J8RA 2NY4D 4PB9L 2YWZA 4NC1C 2H1PL 1VHEA 1YEIH 3GRGA 3UZEC 2HX9A 2RMNA 3N44F 5K9KA 1ZGLM 4FNLL 1BO4A 3VCLB 4WW2B 1TQUA 2DQIH 4MB3A 4X4XA 3NCWA 1AMPA 4IMLA 3JVNA 1UEYA 1B2YA 5FV1L 4JY4A 4G9DB 4WDIB 4AMKL 2D3NA 2ARJA 1TG8A 1QR1A 4BWTA 3F7KA 4NAQA 2CO7A 3Q9PA 4DF9A 4L4VB 2YR3A 2WN2A 3V0HA 2X9XA 5DVMA 4EI6A 4WI8A 3UDWA 2KC0A 2WAHA 3APDA 5IV2B 5CSZA 5E2TL 3C75A 3BUTA 3DSFL 3EOAA 4RZCB 1XF1A 1MREL 5I15L 1C5DB 4WNSA 3UDWC 3CFEA 3OXRA 4PJGA 3D0VA 3TZVC 4TVUA 1EXGA 1CLYL 2EDOA 2D4OA 1GC1H 1YMME 2F54A 5HI3C 2QSVA 5D7EA 3G6DL 2QV2A 4UZGA 3KQZA 3GLAA 3HC4L 4HF5L 3T0XA 5HHMD 3UBFA 3CVIH 4RUHA 5AG9A 4F92B 4ZX5A 4OZGA 2OMTB 1CB4A 4N85A 1L9RA 3N41B 3DUUB 4O02A 1HAWA 1XHHA 5LCVH 3EYFA 4YBLC 4YDVA 5A6IA 1A6UL 4Q7DA 3B5HA 3WDJA 3PRZA 4NLAA 1DFBH 1XH1A 4DOHB 4NC1E 1KWGA 1INEH 2GU2A 5FX3A 4KZTA 1PG7W 1KBVA 4L8SB 3K2IA 3FQ4A 4LLDB 4BUHA 2GTWB 4MNQE 1QNZH 3FQRB 4D8OA 2IQ6A 4UTCA 2DMGA 3QW9A 3W6XA 3IDMA 3CLFH 2QFRA 2NSXA 2UWEF 4ZMWA 1PAMA 4ZK8A 3U7YL 3HBQA 4PBVC 4WFHD 1QBML 3GKZA 1AGDB 3VSUA 5EBWA 1KBKA 3HR6A 5DHVH 2EDEA 4C83B 4F1SA 1NDGA 3D9AH 5J1QA 2R23A 2PVWA 4RAHA 5BZWB 1QQDA 3C6SA 1QLEB 4I8DA 4J2QA 4JFFD 4FYTA 3OAZH 1EAPA 1MHCA 4AZUA 1OEZW 3JV6B 4AYMC 1GGIL 4NQDA 1CR9H 5JORB 1CURA 4PXCA 3DX9B 4LDCA 5HDLA 4OC5A 2PWHA 2BPBA 5CHNB 2Q3XA 2GITB 5EBVA 4YHYC 3UXFA 2OJZL 1XZWA 3MRMA 2BRQA 3UJJL 1RUKH 2FWOB 4PJGE 1AG0A 1QHOA 1AI1L 3WN6A 3K8MA 4PRNB 3JWDL 4LHQB 1ADWA 2F54E 4QT5A 3NQKA 4QWWD 5E9AA 1MCBA 3T5WA 4PLJC 5I30L 3QCVL 1R47A 1UD3A 3CXFA 4OAWA 3KVPA 3KWXA 3OWRA 1U4FA 4IBTA 2WCGA 3NJKA 4PR5B 5IFJB 3B2YA 4OZGE 1Q0EA 5DSCB 3EBGA 4YEEA 5E1HB 3ZZSA 3BAXA 3D4GA 2VZ1A 1HXKA 3SYAA 2P7TB 3I6GA 4KKAC 3V0EA 1YQVL 1R0AH 4UU9B 4MHYA 1K4DA 1W9XA 1Q72L 4HJ1A 3OD3A 5C0BD 5IMKA 1EH9A 1CGVA 2EVHA 3FT2A 4GQQA 1ZLHA 2E9BA 4GRMA 1KPRB 2QHRL 4LLWB 5GSVA 3DX7B 3O41A 3KGUA 4ZUWA 1AIZA 4UTBH 2A6IA 1UZ8A 5E8EA 4JHUA 5HMNA 1SDYA 1J05A 3QEHA 3D1MC 2P52A 4OCRL 3GSXB 3NT0A 5AZ2L 5L4MA 4EDXB 1NCDL 4GP5B 2YQ2A 4Z23A 3TO9A 1DQJA 3MNVB 4WNQA 1UVQA 3BSZH 1ZWIA 3KZWA 3FUHA 1QOKA 3HNTH 2OTWA 1RPQA 3O4LB 1G7MA 1QSNA 2CZNA 1XF4B 4AV5A 1V7MH 1FFNA 3FF7A 3FB3A 1A3LL 3SHPA 3UYOD 4UAOB 5I24A 5EPMB 3EXLA 1BEYL 1QSEB 1D7CA 2J6EH 2W0KA 3SCMA 3DKHA 4AQEB 5JOFA 1YEFH 1T66D 4JCWA 2AJVL 4X5KA 1N5YH 3MLVL 1S3KH 1KB5A 3KPRD 3SCMC 4NZDA 2M83A 2WK2A 1Q2DA 1EZVX 5AZEH 4UEZA 4OLZL 1S7KA 3HS0B 2W9DH 4IEFA 2QADB 4M4RB 3GIVB 2HG5B 1Y18A 2GKIA 5LJYH 3DYMA 4BK4A 4EI5B 1MAJA 4KXDA 4A7GA 2EUVA 4MMOA 1WIPA 4X9BA 3TNNA 1F1GA 1WO2A 5F9JA 3DHUA 4PG9B 1WBYB 4MAUH 4NZFA 1NC4D 3SHSA 3V4PL 5HI5D 3LQAC 4TULL 2FGWH 4LCCA 3NA9H 4QRUB 3GKRA 2VL5A 1CFSB 1LK3L 3WMSA 5CLTA 3BZDA 4E42B 3FF3A 1D5RA 2FIWA 1JP5A 5EA0L 3O3DA 2XG4A 3DGGA 1DLHB 1FNGA 1K8IB 4LCCC 1ACXA 4E68A 4FERA 1SBBA 2XWBA 5I1CH 4J3XA 4OLUH 5FO7A 3AAZA 4EZMA 5J12C 1KGXA 2BP0B 1RZJL 3GSWA 3K6OA 4H1LA 4WHDA 1JYWA 1OSEA 1DSWA 3GXPA 5TDNA 3UJIL 4JO8A 3QIUD 5CILL 5FO9B 3QFGA 3D05A 4XPTL 3RVVD 2VSMB 1DSFH 1QG3A 1U8HB 4QTIL 5DHYA 4NO3B 3L3KA 4MZRA 5AKRA 2YRPA 1R5WA 1WTGT 4N24A 1CLVA 1J9CT 1YMMB 2ARJQ 3IAPA 4KJYB 4Y9CA 2PJ4A 4HKBB 1BBDL 1CLOL 1WZAA 4NN7B 1NUGA 1IJ9A 2HX8A 2OMZA 3RWDB 4H13C 3GZQA 1AZNA 2LU3A 3FO0H 3CK0L 4WJKB 5AOMA 4FFYL 1GJIA 1YY8B 3UIYA 1FAIL 1JPSH 4NKOB 4H6ZA 2OCJA 4QXTB 1LOKA 1EXUA 4ODWB 3QUMB 3E8UH 1Z7JA 2AJSH 3F6IA 2BM3A 1OGTA 3QJUB 3QZLA 2R4SL 4QWWC 4YGVB 1JCVA 3WIFA 4LRIA 1Z0MA 2YKLL 3E38A 1JWSA 4X50A 4XCCL 1VA9A 5D8JL 5FUZH 2BWQA 4MNQB 3DO3A 3MLXH 4JFEA 4U49A 3B8SA 5F8QC 2J1ZA 2V37A 2C3HA 4LRIC 5K9KB 4KXBA 5C0BA 4I0CC 1QVOA 1BQLL 4WEEA 4NO5A 3GT6A 4X4XB 5AG6A 3MO1A 2IQAA 3NAAH 1Q1PA 2JNZA 4CGMA 1SQHA 1SJMA 1JVLA 1DVTA 2XTLA 2F7IA 1IC0A 3UP1A 3SBPA 4YXLL 5HVFA 1TQSA 4LGRB 2CO2A 5D1XD 4PV8A 4XOEA 3L5IA 1R3IL 1A2YA 3CFBB 1CLZH 3V0VB 4EOWH 2ID5A 1QR1B 2CO7B 2RIKA 3U0TA 2CTCA 4Y2OA 2IGLA 1Z5RA 1RIVH 3ILQC 4UT9H 5J8OA 5CSZB 3TZVB 4P44A 2VR6A 1N68A 3OKLB 1CDCA 3EOAB 2OR9L 4ZMAT 1L9PA 2WXLA 3CFEB 3OXRB 4PJGB 3RJQB 2NMTA 4FA6A 1AHWA 2EQDA 3NCYP 1R3HA 2EUWA 2W0FB 4YHNB 2OZ4H 5KSUA 1YW4A 5B39G 4FLRA 1AHWC 2R0ZL 3H3PL 5KG9A 1GVIA 5EORH 4YBLB 3L7EA 4Y4KA 4ONUA 4OZGB 1IQWL 1T66C 2NXYD 4J23A 4O02B 3LOWA 1X6LA 1WBXB