3MN8A

Structure of drosophila melanogaster carboxypeptidase d isoform 1b short
Total Genus 121
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
121
sequence length
391
structure length
383
Chain Sequence
KEDESFLQQPHYASQEQLEDLFAGLEKAYPNQAKVHFLGRSLEGRNLLALQISRNTRSRNLLTPPVKYIANMHGDETVGRQLLVYMAQYLLGNHERISDLGQLVNSTDIYLVPTMNPDGYALSQEGNCESLPNYVGRGNAANIDLNRDFPDRLEAQSRQPETAALVNWIVSKPFVLSANFHGGAVVASYPYDNSLAHNECCEESLTPDDRVFKQLAHTYSDNHPIMRKGNNCNDSFSGGITNGAHWYELSGGMQDFNYAFSNCFELTIELSCCKYPAASTLPQEWQRNKASLLQLLRQAHIGIKGLVTDASGFPIADANVYVAGLEEKPMRTSKRGEYWRLLTPGLYSVHASAFGYQTSAPQQVRVTNDNQEALRLDFKLAPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure-Function Analysis of the Short Splicing Variant Carboxypeptidase Encoded by Drosophila melanogaster silver.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Hydrolase
molecule keywords LP15968p
total genus 121
structure length 383
sequence length 391
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2010-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00246 Peptidase_M14 Zinc carboxypeptidase
A PF13620 CarboxypepD_reg Carboxypeptidase regulatory-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1120 Mainly Beta Sandwich Immunoglobulin-like Carboxypeptidase-like, regulatory domain 3mn8A02
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 3mn8A01
5ELYA 4MHYA 2ZEGA 2RB7A 4MRIA 3TC8A 2WYRA 3D7GA 2HB6A 3S9LA 2POKA 3D68A 1Y0RA 4NGSA 1EE3P 2ZENA 5JM6A 3B2YA 3FECA 2O4HA 4MHNA 2NSMA 2ZELA 1QMUA 4MCQA 3IWWA 4JYWA 4NGTA 3NJXA 2AFUA 3KR4A 1LCPA 2GLFA 1YSJA 3L2NA 5K8MA 4R6TA 3B3VA 3D7HA 1TKFA 4OP4A 2C6PA 2PCUA 4P44A 1JQGA 1TXRA 1PYTB 5HVFA 1H8LA 4OIWA 3NJVA 1TKJA 1F2PA 3JRUA 2BO9A 1TF9A 2Q4ZA 2V77A 1LFWA 4NGPA 3NH8A 2O53A 4G1PA 4IHMA 2ZEMA 1ARMA 2RFHA 2PJ0A 3H8EA 5CPAA 3GUXA 3T8WA 3PRTA 3KASA 5F09A 4DJLA 1AYEA 1R43A 1FT7A 5DS0A 4YU9A 2V8GA 2VL1A 4NGRA 1XRYA 2CIJA 3GLJA 3D7DA 2PE3A 3GB0A 2ANPA 1CBXA 3WC5A 2V8DA 5LRGA 3FMCA 4MCPA 3I1UA 2PRQA 3DGVA 3PB6X 2JEWA 3WC7A 4IAVA 2AFSA 5LYLA 4OC3A 4OC4A 1ARLA 4NGNA 3V38A 4X8IA 5LRKA 3HUVA 4A94A 3KR5A 2PJBA 3NFZA 4PXBA 2PJAA 4EWTA 1TKHA 4WJBA 1Z2LA 2PJ8A 1AMPA 5JGFA 3G3LA 3KI9A 3NA6A 3IIBA 1F57A 2IMOA 2NYQA 4ZY1A 1NSAA 2ZEEA 4X3RA 1YLOA 3S9MA 2IJZA 4PPZA 3KZWA 1BPNA 1QQ9A 4IK2A 1CPXA 3CPXA 4OC1A 2GREA 4P4FA 3IFEA 4OC2A 2XEGA 3KQZA 3D7FA 4P10A 5I4MA 4NGQA 5K8NA 3CDXA 2PJ7A 2QJ8A 4BD9A 3SJXA 1CPSA 2ZEDA 2ABZA 2Q51A 3FJUA 5D8NA 4FL4C 1ZG9A 2PIYA 3HN5A 3D66A 4MHZA 1LAPA 3LMSA 4UEEA 3K9TA 1CP6A 1VHEA 1UWYA 4DYOA 3VH9A 1BLLE 3SJGA 4NJQA 2PJ5A 3H8FA 2WZNA 2XEFA 2PVWA 2F7VA 4Z65A 3NH4A 4GM5A 1Y0YA 5CBMA 3SJEA 1VIXA 4X2TA 5G5DB 3PBBA 2CF4A 5HVHA 1XFOA 5LRJA 4MMOA 4F8ZA 3BI0A 2C6CA 4O23A 4F9VA 4EMEA 4F9UA 5K8OA 1DE4C 2AFMA 3H8GA 5D29A 3B7IA 3CPAA 4WWVA 2OR4A 4KSIA 4OMEA 2F8HA 3KHZA 2JBJA 4JZ0A 2FVGA 3SI0A 4P4EA 2Q43A 3SJFA 3RAMA 1LANA 2EK8A 1CG2A 4UIAA 7CPAA 4MXUA 4B6ZA 3KGQA 4ZY0A 4ZX9A 2C6GA 2QYVA 1HDUA 1Z8LA 2PJ9A 1BAVA 2ZOFA 4MHPA 3WT4A 2G9DA 3WABA 4A38A 1RTQA 3KHXA 4LQGA 2BCOA 1R3NA 1ELMP 2C1CA 4R8FA 2GLJA 2J9AA 2EWBA 1M4LA 5HXDA 5LYFA 4UEZA 4YOKA 4YWYA 3PFOA 3FF3A 3DLJA 1ZG8A 2JBKA 2PJ2A 4MCSA 3PB9X 2PJ6A 1CX8A 2PVVA 4MCRA 3PB4X 1FNOA 1YMEA 1IGBA 8CPAA 4OIDA 4P4BA 2V8HA 3SI1A 2AFWA 3MN8A 1ZG7A 4A39A 3HLPA 1LOKA 3PEIA 3B3SA 3WC6A 4UEFA 3PB8X 3QNVA 1KWMA 4TWEA 1PCAA 1BPMA 4H2KA 2ZEPA 4DUKA 4IYKA 3VATA 1NKGA 2OOTA 6CPAA 3BXMA 2PJCA 1ELLP 1CP7A 2BOAA 3N5FA 3TX8A 4AXVA 4FBEA 4P45A 2DEAA 3D4UA 4OC5A 2PJ1A 2AFXA 4RUHA 3D67A 1DTDA 3FVLA 2XEJA 4PXEA 1OBRA 2ZOGA 4UF4A 3PB7X 2XEIA 4W9YA 2ZEOA 4EIUA 3B3CA 4ONWA 2IQ6A 4ZX8A 1XMBA 4A37A 3B3TA 4P4IA 3SI2A 2CTBA 5IB9A 2CTCA 1VHOA 4FWUA 3IO1A 2AFZA 5J1QA 4PXCA 3S9NA 2AFOA 3ISXA 4NJRA 1XBUA 2ZEHA 2HC9A 3ISZA 4FAIA 3IJ3A 1HDQA 4ZI6A 3FX6A 2V8VA 4NFRA 2PJ3A 1XJOA 3K2KA 4OC0A 3FEDA 1VGYA 2PIZA 1YW4A 1ZLHA 1TF8A 3PFEA 4R76A 1IY7A 2XHNA 3IEHA 4U3SB 5JH9A 4UIBA 4NGMA 5K8PA 1YW6A 3MRUA 2B59B 1F2OA 1Q7LA 2PJ4A 3NH5A 5HVGA 3PBEA 3BHXA 4P6YA 3V7ZA 2GU2A 4Q7AA 3KQXA 4P4DA 1HEEA 3FH4A 1GYTA 5LYDA 2EK9A 2QVPA 4FXTA 3B3WA 5K39B 3B35A 3KL9A 3KCPA 4P4JA 4K3NA 3BI1A 5THWA 3VARA 3FEEA 4FUUA 3E8VA 3LWUA 3RZAA 4OKOA 3IC1A 4PXDA 3RBUA 4CPAA 4PQAA 4TNUA 4EFDA 4R7MA 3CT9A 1LAMA 4ZY2A 1Z5RA 1ZLIA 5LYIA 1Y7EA 2I3CA 5AQ0A 4WI0B 2ZEFA 4ZYQA
chains in the Genus database with same CATH superfamily
2B3VA 5L6YL 2ZEGA 2VM3A 3D33A 5D2LB 2WV3A 5D93C 4HUWB 1GGTA 2IDSA 3U6XS 3HFFA 3SPJA 2G4GA 4PD4K 5ETUA 5JXEC 3WYRA 3M1CA 5DA4A 3D1MC 2XI9A 4BHUI 5I2IA 2J44A 2NZ9D 1F58H 4KK5C 5EU7C 1JYNA 5HJGA 2AJVH 3HJ0A 2UZIL 5K93A 4F1SA 5ISZA 5KSAB 3U4BL 1OSZA 1BAFL 2V5MA 3ZZ1A 1UADC 2VSKB 5HYJD 1GKEA 3I75B 1PU9A 3MROA 1AGEA 3IU4L 2IH1B 1J9QA 4N87A 4DFIA 1YNKL 3T9WA 3MJ8A 1UM4L 2ZXVA 4CYNA 2GLFA 1I31A 3CV5A 3VX1A 4JHWH 1DVTA 4KH2A 4U9YA 1M3JA 1ZGLA 4BQ9A 7PCYA 4X5WB 5AUMB 3KE0A 3MOBH 1GGBL 4YE0A 2ZT9C 4MNHB 4PJAE 2R69A 3MUUA 3VWEA 5EA0L 5AL8A 5CIPA 4UOJA 3MVSA 4LDOB 4WCYH 2F74B 4NZJA 3ZDZF 3QQ3A 4EI6A 2XFXA 1DO6A 3ISRA 5CGYD 1ROCA 3RKDD 1AGFA 4HEME 4MJ6B 4U7SA 3X3FL 4BSJA 2CQVA 4IBWA 4FD6A 3AG2B 4IHMA 1HKLL 3FO2B 1PSKH 3FO2A 1A4KA 2NSXA 2JLPA 3MRCA 5DT1H 4BQBA 2CCVA 3JT0A 3ZKNC 1DEEB 3K7UA 5A27A 3D2MA 5ADPL 3P0YH 5D1XB 4FFYA 1JGUH 3KEDA 3CC1A 4LLYB 1KJVA 5F7KC 1PAMA 1JTPA 1KUXA 4PJXA 2EYTA 4HZLA 2IWGA 2WSPA 1N8OE 2VW4A 3E6FB 5B38A 4RGMC 4ZD3H 5LAXA 3G6JA 3GMPB 1U8OB 3MRKA 1BEYH 1F6AA 4ZT1A 1KFGA 5DEFA 2FYYA 3CHSA 1FUNA 2H47C 1MWAL 4CGOA 2E6PA 3CVHA 5HI4C 1J1PL 2AABH 3X13B 4QHNB 4QXUH 1EFXD 4NZUH 3U4EB 3S88L 4IU3A 4LSUH 1MCQA 2QSTA 2VXQH 3KPPA 4L8AA 4Y4HC 1LO2H 1PF3A 1G7HA 2L0DA 5DQDL 1OGSA 4ZMQA 5C3IA 4NN5C 2AQ3A 4Z7OB 4O2CB 4AQ1A 1NCWL 1QSEA 2CXGA 5EUOF 3OKDB 2Q7NA 1VPOL 2WJ5A 1TQBB 4HJTA 4BWWA 2D3JA 3S96B 1FA4A 1ZLVH 2WLLB 1QHQA 3R19A 5D1QB 3TYFB 5FB8A 3ARDB 3CLWA 3K3QA 5I30L 4QWWC 2Z0ZA 5IY5B 3B2VH 4GIAA 3PDOB 4IRJC 4UQ3B 3QCUL 1II4E 2YC1B 2P24A 2PW2B 3INOA 4HT1L 4JREC 1AG0A 2H9GB 4E41E 3BXNA 2DYPD 1OTSC 5IOPB 1JAEA 3P30H 2DPTA 3R7QA 3JV5A 4APQB 5GGSY 3NA6A 1XCQB 3BVNA 4Y4KA 1S9XB 5C0AA 4KO7A 5DRZB 4P0DA 2D4PA 4ZQKA 4KOYA 5KG9B 2J8UB 2Z3FA 2ZEEA 2DYRB 2VMEA 1YLOA 4HFWA 2Q76A 3FQNA 1LE5B 3LD2A 3L3KB 1B6BA 4O58H 4ZPTB 3S5YA 1KJ3L 3DLQR 1HOCB 1UASA 3RX9A 2GTWA 1U6MA 2X89D 4F24A 1CYXA 5B4MD 2BOCB 3LKNA 3TIEB 5KVEE 1UTDA 1A4BA 2EO9A 2IH9A 3H9SD 4NN7B 2WCPA 2YBGA 3VXTB 1QQ9A 3IK2A 1NFAA 4KXAA 5C70A 1FZKB 4WFFE 4UZSA 2R56L 4TTDC 2E27L 4U6HB 5FHAL 4WEEA 3UBXA 4FMKA 1YMMA 3KKWA 3AQXA 1BECA 2J7LA 1IJ9A 1X44A 1N3NB 5HD8D 1O6SA 3SGEH 3MRQA 3LN5A 4FL4B 4ZOEA 5EU6B 4RMQA 4G6AD 4HLZG 4KKRA 3FQRB 3GMQA 1FO0L 3B5GA 4K55A 1TYJA 2Y3AA 4NUJA 3KAAA 3SKOB 4HIHA 3T5WA 3SJXA 1PVHA 1INQB 4HWZA 5DXWA 4KJQD 3DJ9A 4PUBL 3AFLA 4OLUH 1MWAH 3K6IA 3GTVA 1Y0LA 3MA7B 1YMHB 4P57B 2CLVB 3L9YA 1W72H 1OARL 3N06B 2KI6A 1FE8H 4UEEA 1B4LA 5F7LB 5I76B 1CZ8H 3N9GL 3OX8B 3SD5A 2NT0A 4CVZB 2XWTB 1T2JA 4LB8A 2NMTA 3ME0B 5DLMH 4UIMB 1F4AA 4QTIH 1XGZA 3FFDA 2VW6A 5FO9B 5GRJH 1DDTA 4ELME 5DT1L 1K5WA 5HSFA 4L8BB 2X9WA 1OT4A 1QSFD 1WGOA 4KVNL 2R2HA 3W0WA 4NFCA 2FJGB 1YPZB 2K5TA 5AAPA 4NPYB 3OB8A 3P9MA 2EDBA 4KZTA 3AU1B 2AFNA 1X7SA 3GBNL 3RP1A 1I8MB 3GC3A 5EOTA 4F7TA 1S7QB 1GGBH 2VR9A 4UI2A 2IOIA 1UUNA 3VXUE 5ABZA 3HE7D 1GS8A 3HR5A 4KUCD 3K8MA 2K7PA 3SGKA 3WFCL 2NLJA 1AH1A 2GKIA 4KRMB 4WI3A 3MRNA 2ZUTA 2OL3H 3SKNB 3MLPA 3OWRA 1UM4H 3N41B 5CP3A 5TF1H 5IFJA 3QFDB 4RMSA 1AJ7L 1VFBB 2CWRA 3CH1A 4LOVA 1CE6A 3P3YA 4RH4A 4LSVL 2WYZA 4I2XE 3U4BH 2C3HA 3JTBA 4G6MH 1IGJA 4JPWH 1BW8A 4Y16C 1UT1A 3X1EA 4Z7UB 1U8MB 4HF5L 2K9FB 3GSWA 1MI5D 2B3IA 3BEWB 4TSCH 4JFYA 2KT6A 1RMFH 3QI9D 2EO8A 1KTDB 2NNAA 4DH2A 2RALA 2H1PL 5IT2L 2VDQH 3CK0L 2XQYG 1SXCA 4Z0XB 2GIMA 3OMIB 2I00A 3R1KA 3RZCB 2IANE 2ISDA 4WW2C 4AQEB 2FQFA 4B95C 2IBZX 5DD6A 4HWNA 5F97E 4OJDH 2VXVL 3HMWH 4HKXB 2W65A 4PR5A 1SN0A 4M1DL 4XO5A 5AB2A 2C9XA 1M6UA 2BRRL 2GTZB 1NM9A 5EOCJ 1UZ8A 1SJXA 3GHBL 5DUMH 4EXKA 1MRDH 5I8CB 4UT6L 5CJQL 1U8NA 2O6CA 4IKLA 3TA3C 5I15L 5M95B 1AIFA 5F0PB 5L2JA 3KPOB 4HMCA 5HHQB 4HEPA 4OTXL 4G6KL 1D9KC 1R46A 2JWYA 1I9RH 1MCFA 4QR7A 4BK5C 4KZDH 3LZOA 4N8CL 4D0DB 4F9PC 3FH5A 1MG2C 1YN6A 4J3VA 2AK4B 4A55A 1CX8A 4MCRA 4B13A 5HHOE 5BXFA 4TVPD 3PB4X 1CD1A 3W39B 1SYVA 4ZAKA 4LXFA 4G43A 1RMFL 2VR5A 4FYRA 5GZND 3CSTA 4WFED 1E50A 3FUMA 4F3FB 4LCWA 4KO6A 2HJFA 1MFAH 4U1HA 4XNMB 4BQ6A 5KYYA 1BVKA 1CXHA 4JPWL 2JJTA 3VFPA 4KFMA 2XTLA 1HQRA 3IDUA 5DU7A 5EORL 4OGXH 4EI0A 1SJVA 4TWEA 4JFFA 3DO7B 2HZHA 3TWCL 1F4XH 5HVHB 2CO7B 3EHBD 1IAII 1AQ8A 1T1XA 2DW5A 3WFDH 2D3NA 4AYEC 3L5IA 4DUKA 5DJ2B 1DN2A 5EOQH 5IFAL 3GINA 5AAWA 1EAJA 4E5XG 5KG9A 3QISA 4Y2OA 3ZJAA 4OIBA 2OU2A 1MELA 3W9DB 1WD9A 2GSIB 2IC2A 5FYLE 4WDIA 3BD4A 1QNZH 2XDHA 2GUYA 4EXPX 4I4WA 4ZXBC 4B7LA 4RUHA 3TX4A 1DZBA 1DTDA 4PRNB 1B0IA 4UB0H 3PWJB 3FVLA 1IE4A 2ZUQC 1OZPA 4PU2A 2NRDA 1OK0A 4OFQA 1E9OB 2FLRT 3KHOA 3QHFL 3ZE2B 1JNNH 4TOYL 5KJ7E 3FQTA 1LK3L 1A7OH 4XPAH 1JHTA 2X40A 3HLAB 3VXQB 2OMVB 3P30L 4F7MB 5FLVA 3SO5A 1P84K 2Y24A 4LMQE 2NXYD 5I8KL 2G3MA 1A1MB 4EIUA 3LYRA 3RWFA 3MI6A 1GYAA 1YEHH 1MOEA 1O7DC 4PSXA 2Q7YA 1OPGH 4FQQB 1MHPL 4NWTH 4ZTPH 2O6PA 4JG5A 1BGXH 1INEH 3FU9A 2ADGB 4OCSL 1ML0A 1UENA 2R0WH 3G5YB 3UROR 2OXGB 1T21B 4PXCA 3ZW3A 1FH5L 5ICXB 2QR0B 5ID0A 1USZA 5I1LB 4P23A 2WB7A 2KPNA 1O9ZA 4RDBA 1M7DB 4XP1H 3TN0A 3L08A 5IWLA 2CJUH 4WKZA 5DVKA 4LLQA 1RAMA 1J10A 5C86A 1CE1L 4X6BB 4YHIB 3ECUA 2IBBA 1ZXQA 4QRPA 3QDGE 4OD1L 1R1CA 3NCBB 2WUCL 3O6FC 3QEHA 5DFVC 3B3IB 2HLFD 3QZNA 4N0YL 5FFLA 3IGLA 4QUOA 1JGVH 1G7MB 2ADIB 3NT0A 4Q0XH 2X3BA 1MHPH 5DMGD 1EAQA 5IVXF 3T0BA 1FBIH 3LJ3A 1CFBA 2E9JA 2EXWD 3SDXA 2FBOJ 4EZLA 2DIAA 3MRUA 3EBAA 3KBFA 4EZMA 5TE7L 1SXSA 3QQXA 2E9IA 1J05B 3SE8H 4KNTA 4PWEA 3V9EA 1DL7H 1QEWA 3NCYS 4KH9A 5F1IA 5C92A 3X17A 5EOTB 1KELL 4F7TB 2IL4A 1BSIA 1UYWL 3TNNB 3KQXA 1UKTA 3KMDA 2VSMB 3DV4A 1WLHA 4FF9A 1MF2H 3PU7A 4XT1C 4NI3A 1ZLVK 3VW3L 2KZKA 3L3DA 3S4SB 5E1HB 1SQ2N 4LARL 5DF0A 2QVPA 5CHNA 2WHVA 5INDA 2EUZA 3VWDA 3CSPA 1TO5A 2D2OA 1UH3A 4N2CA 5GZOA 2X2IA 4JN1L 1XEDA 5FLUA 4FXKC 2CLZB 4JM2F 3L8QA 2BSEA 3E8VA 3HB3C 4KI1A 4K94H 3BH9A 4G8EA 4DNCA 2ZW7A 4IRSD 3OMNB 3KDMB 2P24B 2PW2A 3D69A 3GMOB 3QW9A 2OBGA 4ZTOL 5EORH 4YXHH 5JW3H 5LYIA 5HGDA 3VFSA 2FSEA 1YECH 3DRTB 4L3FA 2XQYK 4ZYQA 5AUMA 5AEAA 3QO1B 2MTPA 3IWVA 3D7GA 2ATKB 2LABA 1XF2B 1KB9K 2VE6B 1ZV5A 1W15A 1TJXA 3F5WB 5CILL 1WFMA 1GMIA 2A9ML 2JQMA 1S5IL 1ZD6A 3RGVA 3VFMB 5HD8C 1JYWA 1FC1A 2CNTA 2Z93A 1GA2A 2C26A 3RWGB 1CE1H 3FDWA 5DJ8A 3MNWB 2DH3A 3TA3D 1NGQH 4FNUA 2F1EA 4AW7A 1YA5A 1OAKL 4NZRL 4PJGA 1G7PB 4EF3A 4QKTA 1F11B 1KIQB 3PGPA 2ZUVA 2VC2B 4OM0H 5MI0C 3VU1A 4JPKH 4L5FL 3I9GL 4UT7L 2WO2B 5FUCE 3HS9A 1F02I 3B7TA 4LKCB 5KBMA 4IMKA 1I8KA 4M48L 2YKLH 4ZPTA 3DVNB 4PV9A 1X7QB 3BDYL 2K6WA 3KYOA 1YYMH 2IV8A 4PV9B 4EI5D 1F6LL 4ALAC 5I73B 3IVKA 1CK0H 2YPLD 1RU9H 1NBZB 4NWTL 3C6LA 1BMGA 4JQXC 5EA0H 3PAZA 3ENEA 4X98B 1HYSD 3KYNA 4EAEA 5I26A 4C54A 3HIZA 4DUWA 1T22A 3DDFA 6PAZA 3WU1A 3U7AA 3TBVA 3WN5B 1XR8A 1C5DA 3K72A 4FNQA 3HG1E 7FABH 3I02B 1JMXA 5C6WH 4X8JA 2WCSA 1FJ1B 5DJ0A 4C55A 4ZAKD 4DQAA 3VFOA 3OWCA 4MNQA 3ULUL 5DJ0B 1G4MA 1VFAB 1JZIA 4TN9A 3ECBB 4OH2A 2W60B 2CO2A 4Z7UE 4ICWA 1J9TA 5KSBF 5TH2B 2Z3LA 1PQZB 3KVPA 5FFOA 2XWEA 4FKEA 2K9UA 4R96B 5EIVA 1OO2A 5GS1A 4WJKB 4RETB 5FYLL 4EI5A 3GI9L 3TTSA 4PLKD 3NFNA 4LSQL 5I1LA 3DURA 4DGUA 5CEZD 2CIJA 4Z3IA 2ZTBA 3AM8A 2X2UA 4GIPD 4H1LH 1T0OA 1H6EA 4D9QD 2X12A 3VQLA 3NH7H 5C0DB 3BUYA 2AXFA 2AAVA 4LMQI 2FB4L 3A6CH 3BAWA 1JV5A 2CNZA 1RXTA 2JI1A 3GIVA 4K73A 5DHVA 5IQNA 3WC5A 1JS4A 1UH2A 2A73B 1UM6H 3TA3B 2WBJB 3FNKA 3G9VA 1I8LC 3IDMA 5CNPA 3TA3A 3EYUL 4V1DA 2OL3B 5CFAA 1SOXA 4PBXA 4NZFA 1KPVB 2WZAA 4GAJL 2AXWA 3MREA 3RGVD 4HIXL 3EJUA 2FZ3A 1RXLA 1M71A 1J0ZA 4J12A 3SDYH 3A5VA 3V4VH 1RPQA 3AAZA 5JZ7C 4A33A 3JBG7 3VFRB 1EVTC 4BK5A 2EH7H 2VLJD 3UTSD 1VKCA 5I6MA 4HS6A 1S3KH 2D8KA 3T3PF 2OZ4L 1VGEL 5CLTA 3X1FA 2VXQA 2B9AA 2PO6C 1CICB 3BEWA 2FL5B 4HBCL 5ITBL 2VDKH 1NAMH 5LLIC 1CZ8L 1JZJA 3WY4A 5LGHL 1XR9A 3NDYE 3NOIA 1IGYB 3GWJA 3RKDC 1QFWM 3FU7B 3SKOA 4B12A 3GKRA 1MFEH 1KGYE 1GKOA 4R0LC 7TAAA 5SWZB 4UT6H 5I15H 1M9WA 2WXLA 3RNQB 1I9IH 4QKXB 2R8SH 4JZJA 4FE9A 1AI1H 2XXGA 3PUCA 2V7NB 1RUAL 2FE7A 3NZUA 4PN6A 4M1DH 3RJDA 2IFGA 3KPNB 3BQUD 4FXGC 3LEYL 2I24N 2IF7A 1MPAL 1BPNA 5BVJA 2DBLL 3D5OF 3DVNA 2I60H 3PGCA 1AY1L 3PWVB 3V0JA 1C5CH 4J4PA 1T5WB 1U3JA 2NZ1A 2V2WA 1GYWA 3BN3B 3PWPB 4N5EC 4GS7B 1XGRB 5FYKH 5E1AA 4Z7WA 1N5YL 5MEQA 2J8NA 2GY7B 4IJ3C 3KCWA 4LGRB 4QGTA 4U1JB 5ANMB 2QSVA 2J8UA 5BXFB 4AYSA 2BUEA 4G80B 3CDXA 3O6KL 4KAQL 3QWQB 1OZTG 1VFUA 3P2BA 3VXMB 5B7MA 4L18A 1JD7A 4CN4A 4APXA 3VI4B 4XNUH 4LNRB 1BD2E 2P26A 4E42B 1F4WH 5HVFB 1Z4EA 2CCWA 2DQFA 4NQDE 2PIYA 2XTJE 5KVFE 3S96A 4IKIA 4RDQF 1X4YA 1P1ZA 2OSXA 2DMBA 4QRPD 4YPGB 1LAPA 1EA9C 3UERA 3L45A 1PCSA 3KLAA 3NAAH 3QZOA 4MB3A 5DJAA 5JHDE 3BVDB 1JK8B 1OCWL 2X87A 5I1IH 2GTZA 4WNJA 4QXVA 5DK0B 2YGOA 4PRIB 3U2IA 4QRTA 1TKWB 1OF2B 4QPEA 1GZQA 4UT9L 1D7FA 5E7BA 2I07B 1AIFB 1GS6X 2JDCA 5CEYB 2PW1A 1YQ2A 4WGKA 4LF3B 1AZNA 2IDFA 4OB5H 3TWYA 2DDQL 4FNTA 5LNGA 4G8GE 1UGNA 2P6EA 4IBQA 1QACA 4LLWB 4G8EB 4Z7NB 4KHXH 4WHCA 3ARBD 4AGMA 3UJIL 3FOMB 3LXAA 4LE8A 2HT4C 2XC8A 3LKRB 3HG4A 4OW6A 1S9VA 2BOLA 2YGQA 3BKCL 5E5MA 5LG1A 3WKYA 2J25A 4DAGH 1F56A 2X4TA 4HJ0C 2QQNH 1DTUA 3ARFC 2JJSC 5IF0B 4PGBA 3APMA 4KNSA 3JUYA 4M85A 4KHXL 5HVHA 4KTDL 2BOCA 3LKNB 1MVUA 4K5MA 1KFAH 4AYBA 3FRPB 4UILL 3H7BB 4Z77B 3QAYA 3KBPA 4FTVE 5TH2A 3MRJA 4MQXD 3ZKXB 4KY1H 1IKFL 1G0DA 4UT9H 4J27A 3QIWA 3UAFA 2DM7A 3L7FB 2F9BT 3LQAC 3KLKA 3TFKC 4IGBC 3VRLE 5AVXB 3RWGA 1XAUA 4YDJB 3VMNA 2F8HA 4OZIB 3KHZA 4W6YB 4V11A 5E00A 1W91A 4TKWA 1FO0H 4Y5YB 1BZ9B 5HXMA 3HZVA 2FD6H 1B4RA 3ZTNL 1LP9A 4JZJC 1BVLB 1GSMA 4FQXC 4A31A 3RPIA 4RA3A 2EDEA 3DBXA 1PZUB 4E2AA 4NNPH 5D7LD 2H3NB 1X7QA 1MKFA 5EU3A 5PCYA 1T7WA 2QVIA 1QSFA 1WFTA 1SXNA 1IBYA 2OTWA 1MJ8L 5IROD 3MRRA 2P4AB 4HWBA 5FM5O 5HDRA 5FYKU 1RTQA 3OB0K 4TSBL 5D96C 1HH6A 3UZVB 4HPYL 3T6XA 3WN5A 3PNWA 3MJ7B 1TITA 4X0KA 4MYPA 4YSRA 2VDLH 4Y2NA 5D5ME 3Q2CA 4I0KA 4KUCF 5LYFA 3LDBB 3CD4A 1EGJL 1DBBL 1NDMB 2CKNA 3QUXB 3BSZH 2EACA 3IFOB 4FQQA 4I18A 2AK4D 2Z35B 2R1YA 5ES4B 3EKCA 4PJIE 1IBBA 3L3HA 4PP1D 4ONGH 5ANME 3CFTA 3SIKA 3EJZC 4HIHB 5HI3C 3K0WA 1HZHL 4IJTA 2PJ6A 3UTPE 3ZHDA 3FT2B 1SJMA 3H0TB 4LHJB 5KTEL 2QPDB 4PJ8A 4ZDHB 2CGZA 3IDGA 5DZAA 2LLGA 4TUKL 3TVMC 3MRBB 5KVDE 1G7PA 4KSAA 2CGRH 3LZNA 4NO0B 1G7JB 5DZVA 3TVMB 1FIEA 3AM8C 4KDWA 3GTTA 3RIFF 4AUJA 1A7BA 1AMXA 4IKKA 3RVXD 2VYRE 5LNDA 2VN6A 4Z7VE 2CDGB 1GHEA 3K4AA 4PJBF 4NOBA 1RURL 4JCMA 1CI3M 1RCYA 4V2BA 3BIKB 5EPMB 1NBZA 5L2KE 4OIIL 2IG2H 1GHFL 5HY9B 4LFHG 3K2MC 3E9UA 2JJSA 1NIBA 4L1TA 2A4CA 5J56B 3IMWA 1VERA 3OPZL 2J71A 3EYUH 3L3DB 4PJEE 3VFSB 3AU1A 4HU8A 3C6LC 4JQXA 1FGVH 3WIFB 3RWDA 1XO8A 5BOPA 3JV0A 4JFOA 1EJ6A 1AD9B 3OLEA 4KDVA 3SKJH 4AXVA 2CUIA 3QJFA 2QR0A 1AD0A 5ID0B 3U4KA 12E8H 3L95A 4L8DA 4QRUB 3GS0A 2CA4A 1B90A 3ILEA 1KCBA 5KYXA 5HP5A 4YXLH 4POUB 4AIEA 2Y9RT 9CGTA 1MCEA 3FULA 1EJFA 5E70A 3NFNB 3PQYB 3DSFH 2XJLA 4MASA 5CLWA 2DMHA 1GGCL 4WW2B 1ACYL 2DQJH 4KROD 4Y1SA 4Z5RA 5HTSA 4PGZA 1LO4L 1NLBH 4ZX8A 3L4XA 5TTRA 5A7EA 3UYPB 1HI6A 2HN7B 4B9JA 3EJYD 4HH9B 1I75A 1CFSB 4QT5A 4QIRA 4HUNB 3H9SE 3HE6A 4N5UA 5I0XA 4GB9A 4Z76A 3HZMB 5JDSA 4OF0A 2MH4A 4XMKH 1CGXA 4ZX3A 3B9VA 4LDLB 2XTSA 3DDGA 3VX0A 4FQLL 4UWJA 2X0UA 4JKNA 4M4PA 2QLVB 3QFJE 3VFRA 3V0GA 3SGDH 5I23A 1GY1A 1A2YA 4LP8A 4RAVA 2R23A 3O8XC 4RISL 4EN3B 3CXQA 1PZDA 2R23B 4IOFC 5D7LB 3RWFB 1H5BB 3IWGA 3BPLB 4JM2A 4ONFH 5DEGA 1BIIA 4ZTEA 4TTGA 4IKJA 1ES0B 2XHNA 4FA6A 1QRKA 1N67A 2QHLA 2P42B 5L4IA 4POYA 2ZUUA 1CLVA 3CC5A 5E8EB 2IAMA 5F7UA 3IDIA 1MW0A 1Y18A 3MKKA 4XPBL 1RIHL 2P43B 3O6LL 5JMOC 3BLBA 2EYRA 1OAUH 2LAAA 1XX9C 3QCTL 1DBKH 5HVGA 4NM8H 4PCTA 4NRXB 3OZ9L 1ZVHA 3T8VA 4KZ0A 4RZKA 3ZHFA 3R1GH 4DQOL 4HWBL 4LEOB 5I0VA 4XGZA 4X5LA 3GJFK 1PQZA 3O41A 3ULVH 2VUYA 4X9FA 3NE7A 3S8GB 1QLEB 4QVTA 5ACZB 2H26A 2XN9B 3QARA 4FXTA 3G04A 1QPPA 3PIQB 2XVGA 3NEEA 4J3WA 3BJ7A 1NCOA 3SEPA 1P5UB 1TZGL 4GOSA 3G08A 1PY4A 4WU7A 1QD0A 3VB8A 3MX0B 3WKQA 5FHBL 1I8LA 4HIIA 5GJTL 3D3VD 4BIKA 4XPDB 4ODUA 4XBEL 2Z3KA 3SE4A 5LXGH 4FLRA 3G5YA 5EBWB 2X3CA 5DHVB 4ODTL 4R2GC 1LEKB 1S8DA 2CJTA 4R7MA 4JB9L 43CAB 4QRUA 1T7VA 3CPUA 4PRBB 1Z5RA 1QQDA 1XGTA 2F5BL 1KBBA 2VJXA 4ALAL 3WIHL 5FA3B 5DYOB 4YAQA 2MCAA 3S4SA 1ET7A 3A6OA 3CFEA 1LO0H 2CO1A 1I1AD 4MRIA 4HZLB 2FWOB 4CMMA 1NBQA 3D06A 4M93C 1IGCH 4NQTA 3SQOH 2CDGA 3P4NA 3EOAB 1MHCB 2X89A 2GBTA 2X4SB 2XU9A 1ZKAA 5FV1L 3RGBA 3VTAA 2IANB 1ZA3B 3VXPA 1FVCA 5C6PB 1BZDA 4D0BB 4M8QA 1N8ZB 2V5YA 1IKFH 2XZAH 4GBXC 5TFSL 4X9GA 2Y6SC 1XCWA 4FOMA 3M7FB 2JCCF 2WQVA 1D7CA 2WUCH 5CCKL 4EQ3A 1JPSH 2MQ0A 3GSQB 4F58H 8FABB 1L9OA 3NFPB 3DARA 5HYJE 3IS0X 2B08A 4PBVC 3IMRA 3I6LE 2J57A 2AZUA 4L8SB 5CIPB 2EDOA 5C0CA 2Z10A 2OJEA 1C08B 2G75B 4PRPA 3TZVB 5ECGA 3OJDA 5J8FA 2YS4A 5DI8B 3B3VA 3BQUB 5C1MB 3WMPA 4OP4A 5DJYB 2PCUA 2IDQA 3WG7B 1XCTA 2HCZX 2FQGA 5ESVA 5L2JB 3AG4B 1RI8A 1YEGL 1DFXA 3ML8A 2JLLA 2XBZA 3L3IA 3QWRD 1YJDL 4MA3B 4MJ5B 5I1CL 1JE6A 4P2YA 2IO5A 2VIRA 1MSPA 3D3VA 3FUKA 4EUPB 1B0RB 4U2YA 2HT4D 5J89A 5I8KH 5C09B 2CM5A 1XSIA 3MRDA 3QUXD 5D70L 4J6IA 4XZUB 5KUMA 4XPDC 2HFTA 2VITA 2Z31D 1XGYL 4K94C 5TFSH 1QSFB 2QVKA 2VLJB 3ZJ0A 3IKCA 2JKRM 2OMBA 5CZRA 4UV4L 1R43A 4AKOA 6TAAA 3MJGX 1P7QD 4AX3A 1B0GA 3EFFA 4JZOB 3SHSA 1J7VR 1G0YR 1MW1A 1ZSDA 3O6KH 4KRPC 4P5KA 4PRDB 4RGMB 2OM5A 4LLMA 2W0FA 4R9MA 4JO5A 4I0PC 2AQPA 5FW8A 1DUYA 1OAXH 4A6YA 3I02A 1R5VA 1ZHLA 2FWSA 3ECBA 4C68A 5AG4A 1UEMA 2VLKE 4LIQL 5FGRA 4AVHA 1OANA 5F48A 4FZEL 4HFUL 3PL6D 4OKVB 3WENA 4ODHH 1JZ7A 2HYMA 3FO9A 2IAMB 2WP3O 1S7QA 3RA7H 1HHJB 3MRHA 2DJUA 4X7SL 4M8UA 1CU4H 3EJCA 3MNVB 1LD9B 2EUWA 4H1LA 1MJ7H 5FK9B 4BFEA 3U0WH 1I8KB 2UWEA 2FT0A 3N85H 2HVKB 1MK4A 3DIFB 3VA6A 4KX8A 1HFUA 4H5SB 4CW1A 4XTRD 4JY6A 1IBFA 3OHXA 4EIBA 2BP0B 5IG7B 5I28A 3Q5YA 4MQ7A 1H3PL 2C7FA 1Y1DA 4MBRA 4HCFA 4O51B 4YWGH 4BH8A 3V9CA 3ZLQC 1Z9LA 2R0LL 3MV7D 4ZG1A 3QB8A 2JJTC 2RGSA 3MRQB 1CXLA 2UXGA 3E8UL 3EH4B 1N6QL 1HYSC 1C8PA 4OZHA 5JQ4A 2G3AA 1UWGL 3SI1A 5HYSA 4LEXH 1WDAA 5FM5M 4EUPG 3FHEA 4AMKL 1NCJA 2P8MA 2PTUA 4PGCB 4KTEL 5MEOA 1RIHH 5I1JH 2WANA 4L3EB 3CHQA 1EBPA 1JK8A 3U9UB 3H54A 1NAMA 1QFWI 3VI3A 3FT2A 5BMFH 3S3DB 3WD5L 1KGCD 4M7LT 4BXVA 4O4YH 1OSYA 4PI2A 3KLDA 3V8IA 1T6VN 5JOFB 1EPFA 4LQ6A 4YGOA 4L5FE 3CLEH 3W2DL 4JWPA 3FFCA 1UZ6E 1GVIA 3CFQA 3B7RL 3REVA 3A6CL 5F89A 1TZIA 1XZ0A 1N59A 1FZJB 3IBEA 2VIRB 4XNZB 2FJUB 3OKYA 1V7NH 3MBEB 3HI1A 4PJ5E 3MFGB 5IHZB 3LZFL 5D1QE 4OI9A 4BA8A 1E2WA 1A4CA 1N5AB 3ARXA 3EYOA 4QO1A 5T5NF 3M8OH 5AVWB 4K8RL 2I32A 5DRWA 2ZD0A 4WWPA 4BHUA 4CYPA 2L7UA 3TOAA 4CBZA 4HKJA 4YK4C 5BVJB 5AW8B 4XO4A 1CGTA 5JR1L 1T0NA 4JFQB 2ZJSH 2GJZB 2C3VA 2WIIB 4LSVH 3K6SB 1MCWM 4XCYA 4ZBJA 3B2DC 4NUGH 1CP6A 3OAYK 3QIUB 4U9ZA 2HG5B 3VA2C 3CVBA 4TMPA 3QNXA 2DKMA 4BCXA 2AF2A 1OOAA 2DQIL 4B9GA 1PLAA 1U92B 2Z3NA 3QPXL 2VDKB 4DN3L 4Z8FH 4YHKH 3SGJC 4NEXA 2O72A 4A6YB 4P5TA 8PAZA 1JFQH 4JJXA 2HRLA 4D8PA 2HTLC 5AAMA 1OT2A 5EEWA 1P9MC 3C87A 2IWKA 4PMFA 3H4HA 1T7ZA 4X0NA 1ES0A 4CA4A 4KK8C 1MEXH 2XY1A 4ZJ9A 4YSTA 5D1ZA 4JFEA 2BWDA 3SGKC 1LXMA 1G7IA 3F6JA 1RHFA 2WKOA 1KJVB 4ERSL 1SBSL 4OJYA 3VXSE 5CEZL 1NPJA 4W9DC 2W94A 3CLEL 3QIUD 4ZO7A 1VIWA 1QBML 4HS3B 1IBGL 1BVNP 1RZ8B 4NC2B 3BUTA 5I1GH 4JN2B 5C2BL 5DRZA 4FFWC 4M6NH 3SQBA 1KTKE 4QEGA 2QIRA 3X12A 1Z3RA 4GT7A 4LLUA 1J8HD 5IB5B 3UC0L 3D0AA 4KSIA 3NJLA 5BRQA 2A77H 1CFVL 4FABH 3AREB 3TBTA 4FHKA 1AGFB 4U4BA 4LLAA 3QBTB 2AQ2A 1YQVL 2Q43A 1XCTB 5HHMB 4OF3A 4NDMB 5L9DL 3W5NA 3ZQXA 3X1NA 4AGPA 4XXWC 4EDXA 3FUFA 3ZYOA 1NC2A 2HT3D 2RD0A 3P9LA 2QGCA 2PTTB 4UIAA 4N8PA 3GPSA 1C08A 2G75A 1NJ9A 1FF5A 3P0VL 5DVPA 3KJ6H 3MCG1 2W0KA 1U95B 1XB3A 3NZSA 4OLZH 1MCSA 2ZXBA 2X53A 4Q6KA 4MXVE 5I8CA 1KPUB 1JPGB 5EU6A 1J4JA 4HIJA 1TJIH 4ZUUA 4W9LC 3K4ZA 3II3A 3N85L 1AQHA 3U2JA 5E51A 3IKKA 3RBSA 2KLSA 4OZIA 1ELMP 5B3JF 4AMWA 2J8HA 1A6WL 4R8FA 3D3VB 3GK8L 2EVFA 3MV8D 1IBZA 4MQ7B 5I2IB 2ZQKA 3B5TA 4RX4A 3RX8A 5I66B 1BO4A 3PFOA 4BELD 4TSBH 4ZUTB 1JZ6A 3MV7B 2XN9D 4AG9A 3TO4A 4WJ5B 4JFFB 3ARBC 1DLHB 4IQHA 4MCSA 2YSSA 1Q0EA 3ZTDC 3NSXA 1AYRA 5SWSD 2Y2TA 3I75A 4XE0A 3WCYA 5HYEA 2Y7MA 3B7SA 3K1DA 3QDME 4N0CD 1M9SA 1ZAGA 1U8PB 5EBWA 1IV8A 3OJMB 4XC3H 4AENA 3IAGC 4G7YH 3REWA 1ERNA 4LSSL 4AM0Q 1NIAA 2H9GA 1DDHA 3FSZA 2VSDA 1QHPA 4MMZB 4XVUC 5LBSL 3X1GA 4AKQA 1FL6B 3ETTA 2IAMD 1LJMA 3MYJB 4UYQA 2PXYC 4X6BA 1EV2E 1K5NB 3S0PA 4YHZL 1YC7A 1J8HE 1PCAA 1B88A 2EC9T 3S34H 4AIXA 4ANXA 3EHBB 2EABA 1WAEA 4NO2B 5BO0D 3QDJA 5DQDH 5IQ9B 1S7UB 4KLWA 2EILB 3QJZA 3GT6A 2E7HA 5KTAA 4OZGB 4HUCA 4YAQB 5DYOA 2RCSH 1RZQA 3I50L 4GMSH 1YPZA 4MZ3A 3AAZB 1N12A 1A3RL 2Q7AA 3NIDF 2Q2LA 2ROXA 5LDUA 5L0QB 4PG2C 2KDGA 4P4KD 3NEXA 5FV2A 2WXKA 3VRJB 3O6MH 2FYYB 5FIEA 1T80A 1UXMA 1WHOA 5DMYA 1YEHL 5I19L 3AS3A 3KPLA 5F21B 1P0HA 4CKVX 3ZL1A 4G59C 5ECJE 5C09D 1LK3H 2NNAB 4K71C 5T1LB 5DJYA 4XWOD 2YN5A 5JIHA 3VD0A 3D39A 4X7CC 4Z23A 3EO4A 1QSMA 4M00A 4ONWA 2H0JA 1FAIH 3QIBC 1OHZA 3JTKA 3RPIB 1UA6L 5E99H 2DQEL 1ZLWH 3S5LB 2X4UA 5M94B 2YNEA 1QBLH 4WWKA 2VZSA 3BKJH 4FULA 5CS7A 3UACA 1BVNT 4YZFE 4WHTB 2GC7C 5D4IA 4A6YL 1CG9A 2BNRA 2MIZA 3QDGB 3VGEA 3L1EA 4XBGA 2Q0ZX 3S34L 5J1QA 5HHPB 4U3XA 1N8ZA 4LPCA 1UA3A 2ODHA 1KLFB 3MHZA 1X5KA 4M9OA 4NAMA 5EOQL 4P3CL 1IQDB 5IFAH 3ISXA 3RWEB 2HC9A 3Q2VA 3EJJX 3N42F 5AKVA 4W68A 3F6IA 5CSBA 2FT7A 3WFEH 1F4XL 3C8HA 3TWCH 2FJSA 5I1KH 3KPSD 3K2KA 2BS71 3A9LA 4G7YL 1NIEA 3LEVH 3MNMA 3VJ6B 1LEIB 3QH3B 5E8OA 4Z7QB 1Q9LA 4MMXC 2V17L 3AREA 5E23A 3WTUA 2Z4QA 3FOLA 4JO8A 3U25A 2FO1A 4E42A 4N6RA 3KLSA 4YS4A 3O6FB 1KIRA 4IS6A 4PLJD 5E08L 1FZOA 3CVHL 1N26A 2E74C 3B2XA 3GUFA 1ZHLB 1D5XA 3IXAA 5B7FA 5J6HB 1HNGA 1AD0B 3CXDL 2PJ4A 1HXYB 1J48A 4PLKC 5I71B 2WAQA 4QYOA 2IALB 4N6QA 1TTRA 1S9WA 2YN3A 1A47A 4RVBA 3DSFL 3OZ9H 1BD2D 1YN6B 2C5DC 2VZ3A 3GDCA 4G6AC 3E1ZA 1TLMA 4NKDA 5ALBH 4XODA 5DUPL 1R33A 3HE7B 4UZGA 1AP2B 4TQ8A 3FH4A 1MZZA 3AWGA 2BINA 3GSOB 2VAJA 4HOMA 1MUJA 3C8KB 4ZRGA 3WS6C 3PXJA 4PHXA 5G1ZA 1NANI 2NW2B 3BIKA 1M6OA 3VSVA 1CXIA 1QI3A 1S3KL 4AQ1C 4LVNC 4F9LA 4FFWD 1FGVL 4P4JA 5JXAH 4BKLB 2Y2YA 1ED3A 2F53E 4XI5D 3VARA 2R4RH 5D2NA 3DRTA 2VXVH 3HMWL 4S0HA 2OV0A 3KWUA 2X4QA 5D2LE 4XOEA 1JK9B 4M03A 3VFOB 4QHKI 3BGMA 1XF5A 3TV8A 4Z9KB 1LWHA 3RL2A 3IF1A 3KS0J 3UBXI 3EO1B 1SYSA 3DUUB 2ZCLL 3SE3C 2N59A 4ISVB 1IJNA 2E6QA 5DUJA 4CNIB 4G5ZH 1FV1A 3GLEA 2XZCH 5TE4L 5EZOH 2OMYB 2G9HB 2X7LA 2X2HA 4G6ML 3UTTA 4FG0A 4GW5B 1QBMH 2YSTA 1EO5A 2QBWA 1BBDL 4KRNA 2YQ2A 3RY6C 4E41B 5C9JA 4OCNC 3MV9A 3C08H 4UA3A 1P6FA 1I4FB 4MYWB 2J88L 3AXLB 3SGJA 4OV5B 1QI4A 2YD4A 3BH4A 4KK9C 5TF1L 4JFXB 4N8VA 1BF2A 1JPGA 4ZMWA 4JRLA 4X6EB 4C83B 3QXTA 4S2SA 3J27A 3FF7A 3T6QC 4G43B 4JFHE 1TOXA 1URZA 3AROA 4NXYA 3SCMB 1QR4A 1EGJH 1IYKA 2F08A 3NJXA 4K15A 3GBNH 4B60A 1WWBX 3MBXH 3NP3A 5HHVL 5B39A 3HFMH 2PYEB 3DMMA 12E8L 1I1DA 4P44A 5EO9A 4IMKC 1FSKC 4WAFA 4OZFA 1RU9L 1NGXB 3IETA 3R95A 1A02N 4HVBA 2B58A 1F2PA 1E28B 3NMEA 3JRUA 4PK3A 5HDWA 3N43F 4NGPA 4C56D 1U3HD 5DWPA 1BM3L 3O6FA 5EU5B 2ICEA 4YBLC 4ENEC 3H55A 1E90A 4PVNA 3HUJA 1W0WA 1P4LA 3CC5B 5F2FA 1W0WB 3CH8A 5HYFA 3QUML 1TZHB 3M8OL 2QKIC 1IICA 4LCCC 1I3VA 4KOVA 2BNQA 2C8NA 2HT3C 3LSOB 2GABA 4GUOA 3HNSL 2UXTA 2Q8AL 1F8TH 2CXKA 4UWQB 1XOVA 3CFJB 1JWMB 4IHOB 4XWGL 1IQDA 5DS0A 2LU7A 4HGMA 1R3IH 4MNQD 5DZPA 4KY1L 3V6FB 5CBAA 3VXQA 1U8QB 1DBJL 1NINA 3QQDA 3L1OH 5DD3H 1KSRA 2ANPA 3IB4A 2IMNA 4KUBA 2X44D 2V8DA 4N0UE 4ZMAT 1EHLL 2DJSA 4GG8A 5KEZA 1KB5A 3IGAB 1ADQA 4HK3N 4P05A 3D09A 3VSQA 5D2NB 3PXLA 3TBSA 5INCA 1MHEB 4F92B 4P5TB 2FJFA 2PRQA 2F7PA 1E4WH 3VD1A 1IAIL 3T0ED 2XZQH 3MAWA 4H7VA 2F7RA 2XIBA 1VEPA 2BHZA 5F8QC 4G6JL 2ATKA 3NCXA 4PCYA 4HPYH 2RAMA 4MFPA 5LRKA 2D4DA 2LTQB 4JDEA 1WGVA 3PRZA 1EVUA 4PXBA 2ITCB 4CVUA 5KN5A 4NKDB 4FFYH 1Q90A 5FA4B 1YEWA 2JI3A 3QEQE 3SGEI 1FZJA 1XB8A 4PRAB 1XCQA 4HU2A 1XL4A 1OALA 2BSWA 2OQJB 1ZTXL 4Z7WB 2IJ0C 2BVEA 3SGDI 3D7PA 1XF4A 4DFHA 3ABZA 4KRLB 3X12B 3O0RH 3ES6B 3HCVA 3S9MA 1GYCA 2ENPA 5KSUA 4R0LB 2Y1VA 3UO8B 2VR6A 5GSRB 3F5WA 3U1QA 2X05A 4B96A 3SPHA 4ANVA 1MH5A 3QHZL 3MYZA 4JFWA 3F85A 2O5XL 1QVOA 25C8H 4LCIL 3S6HA 3Q13A 2NX5A 1R5WB 3NGBB 1VLXA 4HSAC 1S7FA 5DJDA 3DROA 3P11L 5DRNB 1LLAA 1AHWC 2Y6SD 1V3MA 1C5CL 2LU3A 4F8TA 1CI5A 1M4GA 2VAAB 1SN2A 5K9JH 4WEBH 4NQDD 2X9YA 1FJ1A 1J1PH 2AABL 3WNOA 1U6AL 2IOMA 1U8NB 1X5FA 3B2MA 1NWOA 2AJZB 3HJEA 1FVEB 5MERB 1CPSA 5DD0H 5C0IB 4F1ZA 5D70H 4DERA 1I9IL 1T89A 2E4TA 4IF5A 3VXRB 1FG9C 1MFCL 1ZG9A 1KIPA 1M1SA 3O3AB 1Z6JT 2IAMC 4JANA 2KERA 3RDTA 4UU9A 1KZYA 3PV6A 2DQCH 4LBEA 3WEXA 3AWFA 4GMTH 5D1QC 4PWGA 1AZRA 4QWWD 1GJUA 3DIFA 3U0TA 3TN0B 2XG4B 3BESR 2GY5A 1ZT4B 4HBCH 5GGUB 4L4TA 1MFCH 3FOMA 3HI6H 2BXYA 2V2XB 4IRZH 5IZ7A 4JY5H 1SYSB 1FFTB 3LS4L 1OTSD 3MV8A 4DPRA 1IAIM 3WTWA 4HJSA 3CQPA 4UDUB 1B2WH 3ISYA 4QY8A 4JKWA 5E2UH 2Y07H 3WMQA 1AGDB 4GKNB 1CBVH 2HG0A 2MEJB 4Z3EA 2BERA 4J5VA 4N90D 1HSBB 2BHYA 4UIKL 1JXDA 3ARBB 4IU2B 3MBXL 1XGQB 3CZGA 3DOIA 4UCMA 1KNOA 4KRPD 2HVBA 4HS8H 2VMCA 4I7ZC 3RPBA 1NLDL 3MGOA 3VI3B 1E0OB 3DNKA 1D2PA 2PCYA 2Y7NA 1GZPA 2L8AA 3NCMA 4R4ND 4AEIH 4CMHC 2DMGA 2ZPAA 4O23A 1UXSB 3ULUC 1DVFA 4JFZH 3QO0A 4YDNA 4KKCC 4YE4H 1OTUD 3F58L 4YFEA 5K8OA 3BAEH 3QIWD 1F58L 3QNZB 4B53A 2FHFA 4WWVA 3BWZA 4Z0BH 1HK6A 4OAWA 2NT1A 4AQOA 4ZXBA 1U33A 3FN0H 3G6JB 1E9QA 3V6FA 1TVBB 2A4EA 5FCUL 3BWAA 4U49A 2F5BH 5KANG 1UB5B 4ALAH 3OR6B 3AVEA 3DVIA 2VN7A 1FFOB 2X1OA 4G5ZL 3LIZH 4MX7B 4HULB 4URKA 4TSAH 4NYLA 2YUWA 4NCZA 3FXIC 2BPBA 1UOLA 3V0FA 1COBA 2C6GA 1FLRH 4MA8H 4Z95H 2VLLA 2XIIA 3HN3A 5D1ZD 3O4LA 4I77L 5DJXB 1SLXA 3AY4A 4PLOB 1VGEH 4MHPA 3GSUA 2G9DA 1OM3H 2XZQL 1PG7W 1Y6MR 4O9HH 4P4RA 4X83A 1HHKA 5ESAB 4YDLC 4YBQC 3UTQA 3SPCA 4D94A 1QZ1A 1YYML 4X9IA 3ULVL 1VB9A 1PKQE 4UCPA 4NJAH 2YNCA 1OSPH 2WWNA 2Z64C 5EO1B 3GD1C 1FRGH 4PJDF 3TCLA 3I9GH 3O45A 3PUUA 4PV6A 3L1OL 5DD3L 4HISA 4YUEL 3KWTA 4ANUA 2Y36L 4YPGA 3PP4H 3DLJA 4GKSB 1W72B 2NW2A 2QGEA 1TEFA 5IMLB 1H3TA 2VISA 1TQBC 1ET8A 3L48A 4NQCD 4WU5B 3B5HA 3JT2A 4QO1B 3A67H 1KGJA 3FB8B 5D72L 3V5KA 2ZYSA 3V8CA 1HE8A 5IQOA 3PWLB 1LMIA 5J12B 2A9MH 3JZ7A 4HK0B 4PJAB 2CCLA 5GS2H 1JV2B 5I73C 2P5WD 3F05A 3E0KA 3F7QA 4F7PA 1HOCA 5E6SB 1W9XA 5D4QA 2GJPA 5EO0B 4HHWA 2GW5A 4IEFA 3ZDWA 2HJFB 5E1AB 4GG6A 2V8HA 2YMTA 1KG0A 3VI4E 3WDIA 3LNDA 1WC7A 4YDVA 4N24A 1Q9OB 1S7KA 5KOMC 2J5LC 2YJQA 3HLPA 5IKCA 2YRZA 2PQ8A 2WW8A 3PB8X 2Q10A 1M2VA 3QNVA 4I9WD 4MJ4A 4PP2A 5AW2B 4Y5XA 3BT2H 5FYJU 5ACMA 5A3IC 5CR1A 1P4BH 3EGDA 3ALXA 3RG1C 1NC4B 4OZFG 4R3KA 2QV2A 3GXIA 1EHAA 1GOGA 2H6OA 3US9A 3V0WH 4JZJB 1IC0A 4UQDA 4GT0A 4CRYB 1ZVNA 4U05A 2AQNA 2IPUG 4P2QB 4HH8A 1I7UB 1XZWA 3VGFA 2UVEA 2J6WA 4ZPVB 4ZUVB 3DPBB 5DGQA 2BLFA 4B5PB 5DRXA 3DX3A 5E9AA 1NCAH 3WN6A 4F37F 4KKLC 4Y16B 3DX7A 3D69B 2BFVL 3EYSH 4JRXD 4C2ZA 3ESNA 5J11C 5KVFH 1WF5A 1RZGA 3HRPA 3EGSB 1UA6H 5E99L 1A22B 2FEDD 1FAIL 2FWLB 4M7JH 4UBDD 5GGUA 3RVTD 3MSPA 4U1KB 3S35H 2EIMB 1BHGA 1JWUA 1UYWH 4PVLA 3STZB 5ACLA 3S6GA 2CALA 1KLGB 1YHPA 3OQ3B 4XMVA 4G8GD 3ELAT 2NXYB 4GKOA 5BUGA 4W9YA 1G1CA 2HKHH 3EZJB 4Y19A 3WS6A 3D4YA 2E47A 4XN9A 5JOPD 3UFIA 1PD6A 2CTBA 3I2CL 5F7WC 1JWSA 5CGTA 4S0SD 1IIDA 1S7NA 3POHA 5IHLB 2EZ0C 2VNCA 2HFGH 2CTCA 4J39A 1Q9KB 2BDNL 2YPLB 4PJGB 2OXGA 5F7EL 5IQ7L 3DYPA 4L48A 2AVFA 2E75C 2YO3A 3DHJA 2C1PA 1LEKA 4KK6D 3ISWA 1NAKH 2XRAL 1O6TA 3R4RA 4KHTH 1TKWA 3VD7A 3MLTA 4AYID 4KITB 4NJRA 2AGJL 2YRBA 5D4HA 2HRPH 2KKQA 2Z1KA 3C26A 3BSHA 4OR1A 4PREA 2AQTA 4HIJB 2EDQA 1THAA 5IFJB 1X5ZA 1A21A 3QQ9C 1WK4A 4GH7B 3B8GA 4J3XA 4FQXD 3WNPA 2VH5H 1Z7JA 5CNHA 3ARYA 1I1CA 5LKNA 1YMHA 2BXZA 4DP0X 1KJMA 1FHGA 4MMYB 2X9ZA 3D8PA 3QS2A 3BAKA 3KPTA 1FL5A 2HLAA 2IGFL 3DRQA 2FQEA 3Q1SH 1XBRA 1F00I 5DLLA 3OKKA 2J1KA 5L8JB 3VNZA 1KXQE 2OP4H 2WYHA 2Z31A 3D4GA 4UQBA 1ET5A 2KPWA 1WISA 4UBDC 3C6SA 4L4TD 2I9TA 2QMLA 5JHLH 3R8BB 1T5WA 4IGBA 3CZEA 4M5YL 4YSCA 3MCKA 5I82A 4P6YA 4H2CA 1HINL 1F2QA 3V7MA 5F3BB 3EY5A 5D6DA 1QFWL 4YBLB 1YX0A 3FB7B 3WUWB 4LAJH 4PRPB 3TZVA 1GAFL 4M02A 1M1XB 2FNBA 1GYTA 2FE0A 4K94L 3OV6A 1GPOL 3G6DH 1VCAA 1QNZL 1NBYA 5EUKB 5T1LA 4UOW1 1VHSA 1TQUA 3B3WA 2GBUA 4N0RA 2ZG2A 1ZPUA 2Z3MA 2AJ6A 1SXZA 3HC4L 1PYWA 4J3OC 4FXGA 4Q2ZB 3ZE2F 3R9EA 3Q1SL 4OF8A 1AGBB 3ZKMD 1NUNB 3BP4B 3OKLA 1QABA 3BLKA 3GIZH 3Q2NA 4ZFZB 3FEEA 4R6UA 4KX9A 2J3SA 3IMTA 3MTRA 4E0AA 1G7JA 1IC1A 2AEWA 4PG2A 1FAKT 1RUMH 3X3GL 4L0PB 3RILA 3TPKA 2YD5A 4KY2A 3WIIH 4H88H 3P73A 3MV7E 1JI1A 4Z7IA 4A30A 2OMUA 1JGEB 1RZKC 2XFGB 2PYEA 1YK3A 2H8PA 5BWAB 3S48A 5AQ0A 5CKGA 4ZS7H 2WUBL 5I1HH 3KZ8A 4OCRH 4MHYA 1UD3A 4IRJA 3O3BB 2WYTA 3QI9B 2HB6A 4LL1A 1Z3GL 2IQ9H 1P7KB 1HCFX 2PWEA 5IMKB 1YY9C 1OW0A 4ORGA 1I1AA 3H6JA 3MRGB 1T83C 4NDMA 4N0YH 2K70A 2C9AA 3HUJF 2WBJC 1P4LB 4GQZA 1LDSA 2H2SC 2UZPA 4XXCC 3BP6A 4E5XB 5J6HA 3KPQB 2VDML 4UQIM 3MFFA 3D51A 2GUOB 3WL9A 1OF0A 1DQMH 3BVNB 3RWCA 2NSMA 3BUPA 5E8NB 3QUGA 1SBSH 4R83A 1ETB1 3MGOB 2MOVA 4MMZC 3MRPA 1WBYA 3I50H 4GMSL 3KR4A 1CLZH 1ZLEA 5BQ7A 2EQDA 5FA4A 2APSA 2FECI 3AMKA 5BS0B 3C2SA 4L8SC 2DPSA 3PJNA 2GJ6D 1FYTD 3L6FA 3PAVA 3WUWG 4HG4J 1BZ9A 3GMRA 3ABLB 3VD5A 4LPWA 4JZNA 2EDRA 2M83A 1BXXA 4RMTA 5ICZB 2ARHA 1TKJA 1ZK9A 2XWDA 2YD1A 4HJJL 4OF5A 4PJCE 2Q4VA 5HDOA 2V3EA 3PS6A 5DURB 4EZKA 3GQFA 1JNNL 4N2DA 4MDIA 2V5SA 3ROLB 4LU5H 3C12A 2BO0A 3VFWB 3EDKA 3KCPB 4K30A 5E5LA 2RBLA 5AW7B 3MGTA 1Q9KA 3K6SA 2AJVL 3O4LB 5C0EB 4AUUA 1KEGH 5D7IE 5B1CA 4JY4B 5AVUB 4S1SL 3TBCA 3WEMA 4C56B 2DD8H 1O5DT 2LVEA 4YU9A 2UWEB 4BE5A 3T4AB 5AAMC 3UMTA 1CWVA 3IFOA 4MNGE 1NFDE 2BWQA 4IKNA 5L88H 4N2BA 2CKBL 2ICEB 4NWUH 3STZA 1LK2B 3ELQA 5L6YH 1V7ML 2JTYA 4W4OA 3PJSB 1A3QA 1JYXA 2ODIA 1U8CA 1ORSB 4CC0A 4OZGA 5DQJB 2ADIA 1OGPA 2YQGA 5AG8A 1I53A 4KK5D 4JRYB 5E6IB 3C60D 3WGUB 2OXHA 2AFSA 4FFVD 2D0FA 1WK0A 3H9SB 3SJVE 2WD0A 2BP8A 2EJ1A 1WS8A 5GRJL 2X4SA 1EIBA 4XGZB 5DQ9B 2WTOA 2C4FT 2W9EL 2XETA 1KNOB 4YJZL 1CBJA 1WA2X 2X7BA 1UOKA 3HAEG 4JAMA 4Y2DA 4FTVB 4YO0A 2E8ZA 4YFDB 4OBRA 1Z2LA 1KC5H 5JGFA 2MJWA 2D3VA 5DZOA 2EKSA 4D9LL 2Q3XA 1I9RL 5IKCB 1ZHKB 3FO1A 5KW9L 1F57A 5DYFA 2ZYHA 4WWNA 2DD8L 1W72L 3ATDA 3I9PA 3O11B 3RWIA 1KF9B 1HDMB 4IOSA 1BOYA 4E5XA 1WWWX 4H0LC 2LLNA 3BFWA 1HHHA 1TZAA 2PYFB 3BP4A 3T0WA 3UXFA 4MDJB 3GUTA 5GIRB 2CBTA 4CC1A 1DSYA 1A4JB 2NY3D 3NCJH 1H3GA 2UZXA 3T8MA 3U0TB 3BDBA 4DN4L 4G1MB 4GIOA 3KZWA 4G9DB 4AXWB 5AKRA 2N01B 2GK0B 4JVUA 4NN7C 5SX5H 2H8PB 3MBEA 4PB0H 1W72A 2I7SA 2J73A 3GXDA 5C0RL 3KQZA 3BYTA 4DN4H 4P10A 1E6OH 1VZGA 4H8WC 1PNCA 1DZ0A 3F7VB 3PE9A 1I21A 2QJ8A 2ICCA 2ZX9A 3FAXA 3RX5A 3FJUA 1TCMA 3FU0A 3L3HB 2EVJA 1KTRL 1YDPB 4XCYB 3UH8A 1SQHA 2CDFA 4Y4HB 4Q2ZA 3ARRA 4X2UA 4TUUA 3ZPDA 1AS6A 3GSUB 4KORA 3STBA 3JV4B 5EG6C 4QTIL 4AZ8A 5DJAB 4PJ7F 3SDCA 1UWXK 1OCZB 4PHZA 5IHWA 2QADD 5EBMA 3KL5A 2QKSA 2X4PB 4NGHL 4P07A 4CVWA 3REWB 3VWKC 2NQDA 2AITA 3SQRA 2XXFA 2WNGA 3MRDB 1NCDL 4UTAL 5KBKA 2UX7A 1F3JA 5HGBB 4F20A 3QPKA 1NQBA 2IIJA 1BYPA 3ASOB 4HV8A 5LBGA 3ILPA 3L54A 4HV8B 4B97A 3O3DA 3FU8A 4IEFB 4U3SA 1ZTXE 2D3LA 1NDTA 4UM9D 4MD4A 1J0IA 1IKNC 4BCZA 4JFHD 4R5XA 4Z65A 2GT9A 3OKOA 4HIPA 5CBMA 3OF6D 5BO1L 4PRDA 5CGYC 1JD9A 4MJJA 4N0FB 3FZUD 4PSRA 5F7DA 4JG0H 1BG1A 5G5DB 3U36A 1KCVH 1NSLA 4P2OA 1A14H 5LRJA 4F2ME 4CL7A 3NJHA 2YAFA 4KO5A 4CADA 4IOSD 4M7LH 4UM8B 4PJBB 4GRLC 4AMKH 4FYTA 5C08E 2D4FA 1AYOA 2KZ1B 1UC6A 3ETBJ 5KSAD 5IVNA 1KPUA 5ISZD 1GJIA 2FGZA 1AGDA 1A1OB 2B14A 4GKNA 3DX7B 3CMOL 7PAZA 2OR4A 4MSWA 3O2DA 3QG7L 2VQYA 2D9CA 1S7RB 2OCJA 3CN3A 1GAFH 2UVFA 3GMRB 1FG2B 3FCUB 4MA1B 4PJ9C 5JW3L 3D39D 3JTSA 4P4KB 2PCPB 2DWDA 3BAXA 3WY3A 3WO4B 3CN2A 4PD4J 1WD8A 3UC2A 2H5MA 3S5LA 1ZTXH 2N1TE 4OSUH 1DJHA 3NYKA 1LD9A 1L0QA 2JKJA 4HPOL 1A4JA 3MACL 2O4EA 2EUVA 2O28A 4N3TA 2HLEB 3WT4A 4QTHA 3T1FA 3CFMA 4XBEH 3QQ4B 2VRKA 2FJHB 3SOBH 4ETQA 4Q6IA 2Z7YA 3OMAB 3PNWB 3Q5TA 4PJFE 2AKRA 4P23C 2GB2A 2KUTA 4IK7A 5IW1B 4Z7WF 1RZJH 1JGDA 4NRZB 2GLJA 4L1DA 3IJYA 1MJJB 3RZWA 1NCWH 4TL5A 1X5JA 1E28A 1S7VA 1KLUA 2VO8A 2NYKA 5C2UB 4S1RH 4J6RL 5L2KD 1E5CA 5C82A 5FOBB 1QZNA 1U91A 3POCA 1OE2A 3SDDD 5LNEA 1D5IH 2HT2C 3ZY7A 4KVPA 2B4DB 2KL6A 1XXDC 2C3XA 1I7TB 4FD5A 3CGTA 2XBDA 4KQ4H 1ACZA 1NIDA 3TO2A 2JF1A 4KVME 1J8RA 1U92A 1XGYH 1XV8A 3QR0A 1YMEA 4FGMA 5GGTL 1IGBA 4L1HA 5HVGB 3VCLB 5K9OB 4WV1B 1LK2A 3S2AA 3QUKA 5D1QD 2GK2A 2FUTA 2XWTA 4GAAA 4ONFL 3H4FA 4IBZA 3AGWA 5IVXE 1D3CA 1N19A 5FDWB 3PWPA 3VXMD 4HCRH 2BNUA 4G82A 5KTDA 2G0LA 3TNMB 4CGPA 3ATEA 4MA7L 4Y19B 1YEIH 3A3YB 4NPJA 3HBZA 3MJ9L 1P7KA 2F0CA 2GIYA 4QXUL 5KZCB 5BS0D 4QYAA 3LNGA 4I85A 2NZIA 4XAKD 2QQLL 3NABH 4XE5B 4AG4H 1NGZA 2OW6A 2OOTA 2GFBA 4MD5A 5AOMA 1MDTA 1OGTA 4A67A 4IGBB 2XUWA 1DVXA 3CX2A 2GSGB 2V9QA 3RNQA 1SY6H 1SZNA 3GXPA 3LMJH 4FBEA 3EO1A 1PFCA 5DVNA 4RRPA 3UCRA 3Q9PA 2E9BA 4UAHA 3EGXB 3AADB 2X6MA 3RDJA 4YSOA 1RUPL 4J3TA 4LLMB 2YC1A 1QFWH 4TVPL 2KC0A 1OF2A 1NM4A 1J0HA 4Q9RH 4Q58C 1OB0A 2VZVA 3O2VH 4HLJA 4QDGA 4BYHA 3GSOA 4OLVL 4FXGB 2EDNA 4P06A 2CUMA 2PUQT 1NEZB 2ZX5A 3QRGL 3FTWA 3L6FB 4KMTH 4WJG3 4UBRA 4JJHA 5E6YA 1KCRH 1IGFH 4PW3A 5JHBA 3SODB 3M45A 3ZK0A 1IC5H 4G3YH 5AW9B 3VE0B 3D2UD 3HHRB 2VKXA 3VYPA 3IFLL 5T1KD 4FC3E 3FB3A 1BFVL 1A6ZA 4OCWH 1FWXA 5T1KB 3ML9A 2FIAA 4XI5C 1TTFA 1L9MA 4UT9A 4HEPG 3D2UB 1PGRB 2Z8VC 3HHSA 4ONHB 1NMTA 2LGNA 3UTSB 4FWUA 2VH5L 5FYJE 2VN4A 4QTHB 3ULUE 3HE6C 4ZSOA 5JOPE 4HGWB 2X38A 4K3DL 4N5ED 2JJUA 1ONQA 1PDKA 5DFAA 1TQTA 3WTVA 4BSVA 2NCMA 4QRSA 4ORGB 3CHOA 2VMJA 4N6RB 1R4XA 1NICA 4FFVC 1H5BA 3FSOA 5AOLA 1VADB 4QHUB 3A23A 2YUVA 5D1ZI 1MHHA 4Y9CA 1S7RA 1T0MA 3BGFC 2VT0A 3J8F7 3MLSL 5F93C 4MMXB 1RZJC 1EEYA 4HWBH 1B9KA 4OLXL 4WFFD 1RZKH 2OMXB 3EHBC 2G2RA 1UZGA 1AMYA 1PZ5A 3JZYA 3TT3H 1NOLA 4P3WA 5C6TL 5IGXH 1ASPA 2OJZL 1X5IA 4Y16A 4HWEH 1ZGLM 3W0WD 1A7NH 2L3BA 3ZHNA 4XNYL 1IIKA 3FBQA 3CX5J 3SN6N 1H9DA 3ROOB 3E38A 4JHAH 3BDXA 4QRPE 4YLQT 3T0EE 4G8IA 2Y1AA 4ODXB 2V2XA 5FYJH 1EXUA 2EDJA 3MBED 1CFQB 3KGQA 3GTNA 5FCUH 3C8DA 1MREH 2MFNA 2BRRH 3A6BL 4C7IA 4ONUA 2FJGA 4PGBB 1N64H 3IJ8A 4NKIH 2WWKO 4QLRA 5SWQA 2HP4A 3QXDA 3BCFA 2CNMA 2QLYA 1S4IA 3KCPA 4Z6AT 3L13A 4K3NA 5I9QB 3WL9B 4YMPA 2WVVB 3FFCD 1YJDC 3HMXL 3T0EC 3QFGA 4WW1A 1B6DA 4L3ED 1DYZA 1JNLH 4X4YB 1TZOA 3JUWA 4S1SH 4ANKA 4WFHD 4TQIA 5EB9A 3K2IA 1F3RB 4OVUA 4NQCE 5C3LD 4NO2A 4JFSA 1D6VL 3PWNB 4EJ1C 2XXMB 5K1NA 1L6PA 2PPCA 3QORA 3QR1A 4ABQA 1VJSA 5CINH 3QORB 4XP5L 4KOSA 3MYJA 5HYIA 1DN0B 2CR0A 4DKEL 3CQFA 4G7VH 5IJDC 1OVZA 2LE9A 2VR3A 3BAYA 4J3OG 2DQJL 3DMMB 3WNMA 4D7PA 4IRJD 3P3UA 5H35B 3O9WA 3LRSA 5IW1A 1ORSA 4AEIL 3HI6L 4H40A 2V3DA 3QEQB 1DQIA 1MVFA 1NCCH 3WDJA 1A6UH 4K3EH 3HCVB 3MXWL 2NY0C 4JUTA 2H1LM 3ZE1E 5IEKB 4B41A 4NGSA 4GAYA 5IBTL 4JRXB 1QWUA 3HPLA 4A68A 2DQCL 4IRSA 4ETYA 3O2DL 3VXRD 3ZDZE 5DJXA 2K8MA 1RZPA 5EOCH 5J13B 1S7WA 1BFTA 1QMUA 1XCXA 1YAZA 3NK3A 3PL6B 4XXDB 4HKXA 5DD0L 2XOTA 5AOKA 4PB9L 5KSAC 3L2NA 1IILE 3PABB 1S46A 3GSNH 4I0PD 4I18B 3PABA 4MJIA 2AJSL 5MP6H 3CZSA 2O93L 2GE3A 1PD0A 1J5OL 1FIGH 1SHSA 3TOBA 1JQGA 1OP5K 1RULH 2F53B 5I5IA 4I18C 1TXRA 3CFBB 5C88A 1DO5A 3ARFD 3MRFA 1QA9B 1H6UA 2WVSA 3N9GH 5AW0B 5E9DD 1TZHA 4B9FA 1TQSA 1TF9A 5FDWA 1KWGA 1OTTD 1A7PH 3QEUA 1FG2A 1EEYB 2ERJC 4NJ9H 2FR4A 1YCSA 2GI0A 5DVLA 2ESVA 3TVMA 3V4PA 4HD9A 4R7DA 4J3OD 2LAGB 2F74A 4RBPH 5IESH 1MIEH 1YYCA 4I3RL 3IJEB 4X8XA 3RIAF 3QZLA 5D5MB 1I1AC 4ZS7L 5I1HL 4QJ4B 5KSBA 5CBAB 4I2XB 1ODUA 3IKCB 3OZKA 1PLCA 2BJMH 5TPWL 4DW2H 5J6SA 3DR8A 2VRQA 5EMYA 1D5IL 2CK2A 3ESPA 1NUFA 3GLJA 1NBVL 1IM9A 1JHKH 1LO3L 4TVPE 1NOAA 2WINA 4MAYD 1UXWA 5HI4D 1TJHL 2I7OA 3THMH 4AIZA 1M7IA 1G84A 25C8L 1RZJL 4I89A 1H3XA 1CM0A 2DJMA 5E5RB 3EJRA 4RAHA 3MRJB 1CT8B 1V5JA 1EZLA 4GQPH 1BVOA 3A24A 3V2AR 2CRMA 1KBPA 3MLYH 5D1ZB 1I85A 4OC3A 4I87A 1A6ZB 1M7XA 3VTMA 1RUAH 1P4IH 3H42H 2Y06H 4QRRD 2EC8A 2G9HA 4U1GC 5AW1B 4YN3A 1K4CB 5C0FA 4FD4A 3ZDXB 2XBTA 4KJYB 4X5RA 1TTCA 5A2CA 3T8XB 4HPOH 2X4OB 4L9LA 2XWRA 2OFQA 2BSRB 3F7YA 3VQ1C 2NNRA 4P4KA 2R2BB 4JG1L 4ZMOA 1GGYA 1FNGB 1AE6L 2P8LB 3QIWC 4ES9A 5KSVA 3VQMA 5FKPB 3BFOA 4XWGH 4F8OA 4R3SB 3QIWB 1JSYA 5IUCA 2Q7BA 2WP3T 3T3ME 4TUJA 2ITEA 4RQQA 1MIEL 1VFOA 2VL5A 3GJFB 2WXGA 4KPHH 4QRFA 2BVTA 4RWYH 2IJZA 4G8FB 3A4EA 1MLBB 3HC3L 2BCMA 4AWJC 4M7LL 1Q4NX 1OGTB 4LZKA 4NO5B 4XX5A 4XXCA 5SWZE 1G9NH 4D9RD 4JRXE 2Y5TA 2P6GA 4AUYA 5EIQA 4KHTL 2ZXGA 3BUBA 5LBVA 4ZFOA 1FV1B 2BZDA 1KCVL 2HLFC 3FU5A 1ZT1A 4I3SL 4KDTC 1AP2A 1DVQA 3I6GB 5CN2A 1M7DA 4IIZA 4MAUH 3C5JB 4C4KT 2DQMA 4PRIE 4P4FA 5D1XE 2OR9L 3GMNB 1MAMH 4LLWA 4Q4EA 3SYAA 3ASNB 3B56A 3HUJB 4LCIH 4QOKB 1KN4H 2WQUA 5FVJA 2AEPH 4NGQA 1I7TA 1TUPA 1AOHA 2LT9A 3JWOH 5AZ2L 3C60B 3AT9A 3O2DH 1SM3L 3SCMD 1NGYA 2ABZA 4GP5B 5GGVY 1IB5A 4FI7A 5C0BD 4ELMF 5IREA 4WU7B 1CQYA 3MLUL 1KXTB 4AYMC 4HXBH 1XGQA 1H0DA 3HOGA 3GI8H 3UTPD 5DQ9A 3K9TA 5GHWL 1HIML 3TV3H 1UWYA 1D5BA 4PJIF 3D30A 3V4VB 2PJ5A 1BD2A 4AV5A 5F9JB 4MFKA 5F7AA 5JDJA 1G5GA 4NQDA 3F7VA 4G6JH 2YAMA 4JHWL 5I1AB 4H25B 2W9LA 2NR6D 1A25A 3K6FA 4E9TA 1NKRA 4XMLH 8CGTA 2KYIA 4FFZH 3G5WA 1FZOB 2CLZA 4Y9FA 1N5YH 1CFTA 3L3JA 4I1RA 2EUIA 5FYKL 4CGUB 4FADA 3IXTA 5CEXA 1ETZA 3EFOB 2WGXA 1VIXA 3V5KB 1KY6A 1R3LA 4AI7A 1FC2D 1OQXA 1RIVL 4IBTA 2BNQB 3LSOA 2NY7H 4KI5D 2ED6A 5HHXH 5HY9A 5IHUL 5C9KA 4NKIL 4G8GA 2D7TH 2DWXA 4APQC 4EQ2A 5B38B 2HVJA 4DGYL 3GXTA 1QFPA 1BZ8A 4YSDA 3I3GA 1YVLA 3OBAA 1J8SA 1YEKH 5J7CC 1DE4C 3H8GA 2CDEA 4LGPB 2F1AA 4HUXB 2WO4A 3NSDA 4LVEA 4D0BA 3B7IA 1BQLL 2H45A 4OD2B 4ZXBD 3LZPA 2P0WA 3UYPA 2D03L 1N0XH 3EGXA 4LSRL 1Z9SB 5BZDA 1EMTL 2ZCLH 2V8LA 1UWGH 2A6IA 4ODBD 1DCLA 1DUYB 1G94A 1MJUL 1VHPA 2A0LC 1QPXA 5E03A 1LP9F 4EOWL 3ULVF 3MRFB 3DXAD 4PM1A 3EGDB 1V54B 1TF4A 3IE9A 2FTAA 2FLBT 3NACH 2HJKA 5JXED 4ZS6C 1XEUA 1YEEL 3DX6A 5BRZB 4W70A 1QKZL 3DXAB 3RTQB 1Z1WA 2QYVA 3ARDA 4W6XB 4GSUA 1OLZA 3BGAA 4J2QA 4NHUA 1AR1B 4KK6C 4A7SA 4H26B 3U7WL 1Z0MA 2VR7A 2E86A 3BWSA 1UB6A 4LQGA 3PQYA 1T1WA 3HFML 3T2NH 1MJ7L 4ZUSA 2CHXA 3GZQA 4N2MA 1CFMA 2Z34A 3S5ZA 4F5CA 1E4KC 1A6PA 1ACCA 2JELL 1S9YA 1BFSA 2TSAA 3LN9A 3ZO0A 1KPRB 1M4LA 1HHIB 2RB8A 1QTYT 4KK8D 4H89A 1KXVA 1CR9L 4ES8A 4XPLA 2DWEA 2FB4H 4ELMB 4S1QH 3V79C 3WEXB 4DO6A 1GMEA 2ZPKH 5C97A 2IVFC 2B3RA 1LRZA 1BQHB 4LSQH 1U8LA 3D0VB 3O2WL 4HHAA 5E9DB 4URTB 5I6PA 2FEEL 5TQ2L 1CURA 5DS2A 1BMWA 4PAZA 3ARFB 1KDJA 4H8PA 1R9FA 3CVCA 2AJXH 2FO4A 2F53D 3NN8B 4JFZL 2DMCA 3RFZA 1BLNA 2R7EB 1FCGA 2YJLA 4YFJA 2ZUYA 1D5BB 3MLZH 3T1WA 4DKFL 1JGDB 4NRZA 3ULUH 1J0JA 3R06A 4WDIB 4HS8L 2DQ6A 4AY0A 4GBXA 2NYZA 5F88A 4OFPA 3GSXA 3QFJD 4L9LB 4EVYA 2A1WH 5GS0H 4X9YA 2A74A 4PY7A 1AGBA 2VDOH 1G43A 5DFTA 3LRHA 4YSAA 4JANB 3EFOA 4II9A 1CF8H 1NIFA 4IYKA 1A9VA 4HGKC 1FPTL 5IBUB 1WTLA 3SYCA 2HVKA 1BOGB 3QWNA 1Z9OA 2ZKHL 3QUZC 3N5FA 4G8IB 3TF4A 1ONQB 1IGIH 3HPLB 4LAQL 1UCTA 3D4UA 3NUKA 1J86A 5CJ8A 4QOKD 3GM8A 3MLWL 5IQLA 3KNBA 1GC1L 2ZCHH 5DUPH 2H6PB 3PHAA 4Y0GA 1KT2A 4B11A 2OB0A 1ADQH 4LCUB 5I0ZA 2WBWB 4OLWL 2FEJA 3X2QB 3NVQA 1IGTA 4B9YA 1MRFH 4TOYH 4ELKA 2AMGA 1P7HL 3Q48A 4JFDA 3CUPB 4UAOB 1GZHA 3RDTC 1CVSC 1DUZA 4YHIA 2BSTA 2NXYC 4JRFA 2JIXD 4MFJA 3FQUB 4X5QA 3GMMB 3UTSE 3TEZA 3GM0A 4KUZL 3RUGF 2AJXL 2YD0A 1M56B 4BZYA 1OP5H 2B0SH 4K7PY 5TJWK 4ZFGL 5IOKA 5IB9A 3NFSH 2QMJA 2AI0L 3LEVL 5EV7A 1XIWC 1RJZA 1CFNB 1JVKA 4QOKA 4UFVA 3P2DA 4J8RB 1BBJA 1U8KA 4FQCH 5LVEA 4TQEH 4J3OH 1JL8A 5I8EA 1JDAA 1IAMA 4ETQB 4WGVB 5IVZB 4UIMA 4ZI6A 3Q8AA 3GSVA 1WT5C 4P2OC 4LL9A 2WNXA 2PJ3A 3TGXA 3LXUX 5T5FA 4DZBA 5C3TA 1KEMH 2GJ6B 3RAJL 4OC0A 3OAZK 1WE5A 4TTDD 2VDLB 4QHMB 4YNYB 3WHXA 3EYFA 3LQZB 3PFEA 2XLLA 3PGFL 3QJQB 2IH3B 3INUH 4BWTA 4H6ZA 4PRID 3TIDB 1MF2L 5GCNA 4XPTL 4UCNA 1KB3A 4ZSOB 1C16B 1JTOA 2B59B 3U1SH 1QKZH 2NR6A 1GZPB 3CU1A 2AQQA 4U1IB 4IJ3B 2ZX6A 5DK0A 2PP9A 3TH4T 5DFVD 2ZYIA 1BQKA 3N44B 1E3ZA 4YHPA 3UZQB 1JZGA 1MJUH 3OGOE 3HI5L 5BQ7B 1YQVH 3A47A 3ZSTA 1NC4A 4HJ0D 4IHOA 4UINH 5LYDA 4ZNEE 4UQCA 5TDNA 2MNWA 2DIBA 2ORBL 3CSYA 3TTYA 3UBHA 3WY1A 4XBPA 3QSKB 1EK3A 1K4DB 3P40A 4OLLA 1HHIA 1DHKA 2P5WB 1GGUA 3V52L 4A7TA 4N25A 1T20A 2O26U 1DBJH 3CDGB 2DLIA 3V95A 2EDXA 1VSCA 3K72B 4XZUA 4FEMA 3ZMEA 4FUUA 1GOFA 1G7HB 4YGAB 2G0KA 3O81A 5ENWA 3PNRB 4W9EC 1DQJB 1UKSA 3UBFA 3QWOB 4Y9BA 3I3BA 2ED8A 3SQBB 2WSDA 4WWKD 4CJ0A 3DNSA 4F15C 4DP7X 1NCGA 1FH5H 5DD6B 4ZY2A 3ZL4H 4HA1A 1R3KB 1SHWA 5DJ2A 1INEL 2DEXX 5CAYB 4WI0B 2G60H 5E8PA 2AXGA 4JM2C 3ZGIA 1XVSA 3EJQA 4XC3L 4AYFA 2WYRA 4NO3B 3N7ZA 2AV1B 5KJRL 5FK9A 1AGCB 5EC2A 3NK4A 2PR4L 4MD0A 3KH4A 2POKA 2QKIA 4ENED 3QI9C 4ADJA 5GGQH 2VR4A 4P46D 1TVDA 4BK8A 1U42A 2ZOLA 3UJTL 2CR3A 2YEQA 4TLUA 3RWJB 2FRGP 2W92A 4R7DB 2Z91B 4RGND 4X6EA 4M7KH 1BJMA 3D9AH 3LRKA 1EE3P 3NCFB 4PJ6A 4ZFFA 3AB0C 1AUGA 2GSIA 4JKKA 2Z3OA 4Y1AA 4ZFFB 1FNSH 2CLRB 3W39A 3VDAA 4B0MM 2W95A 4HJGA 4KTGA 4BD4A 3ARDC 5AGEA 1WIUA 2ZOTA 1A9EB 4P9HC 5JPMC 1QVOB 3FXTA 3A4FA 4JY6B 5IB4A 1U93B 1JCKA 2PNDA 4CU8A 4XP4H 4X5WA 4GXUN 1FNSL 2IEPA 3QORD 2W38A 3V0VA 4U1LB 1ILUA 2XQ0A 3KHQA 3V0WL 1FYHB 2BS9A 4KU1A 1OGAA 3WNKA 1MJJA 4BZ2H 4RESB 4WUKL 1G0XA 3P02A 3ZVVA 4M6OH 4OIWA 2K8QA 1VESA 3NCJL 2DQTL 1XGPB 3U9PH 3N43B 2VO5A 5BZWB 3WSQH 1JV5B 3ZDXE 4Z7NF 2VXUH 1R3JA 2CKBB 4FX5A 3WD5H 2PJ0A 3SDCC 1CJYA 3T2QA 4YSPA 4MHDA 5EULV 2B4CL 3IDMB 1I1YA 2HJKB 5F3HB 2DWSA 1JTTA 1U4FA 1L5GA 1U8HA 2YGVA 4BUHA 2X4PA 5BUPA 4Y49C 3T0VA 2Q8BL 4CSTA 3PRTA 4HP5A 4KMQA 4TLKA 1MRCL 3CIQA 4LQFH 3SO3B 4M6NL 3IDJA 4B50A 4DJLA 5E96A 3MQIA 1DLFH 1Z0NA 1WWAX 1ZEAH 4YH6A 2GFQA 4ZFOL 5D72H 2AC0A 5TDNB 2N0KA 1TJMA 2K45A 4NZTL 5D7JA 2F7QA 1IC7L 3ABGA 4R96A 1FNAA 3MOAH 3H2PA 5LWYL 1K6QH 2V7HA 3GXMA 3DX0A 3QAZB 2LFGA 5IBLD 3MZGB 2WY3B 1MZYA 3FSVA 4RGNB 2CY2A 4JLRB 1X10A 2R51A 4XO3A 3T4YB 3FUJA 4G9FE 2V9TA 4JK0D 2YPLA 1FN4B 4BZ1L 5CD5D 4K0OA 1PNDA 1JZDC 3S36X 3C09B 3O0LA 3MCYA 3D6GA 3FO0H 3CSFA 4YHKL 5DHYA 2A99A 2XV6B 4LGSB 3X14A 2AJYL 3BE1L 3D52A 2OMTA 2PKDA 4F8QA 4L37A