3MN8A

Structure of drosophila melanogaster carboxypeptidase d isoform 1b short
Total Genus 121
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
121
sequence length
391
structure length
383
Chain Sequence
b'KEDESFLQQPHYASQEQLEDLFAGLEKAYPNQAKVHFLGRSLEGRNLLALQISRNTRSRNLLTPPVKYIANMHGDETVGRQLLVYMAQYLLGNHERISDLGQLVNSTDIYLVPTMNPDGYALSQEGNCESLPNYVGRGNAANIDLNRDFPDRLEAQSRQPETAALVNWIVSKPFVLSANFHGGAVVASYPYDNSLAHNECCEESLTPDDRVFKQLAHTYSDNHPIMRKGNNCNDSFSGGITNGAHWYELSGGMQDFNYAFSNCFELTIELSCCKYPAASTLPQEWQRNKASLLQLLRQAHIGIKGLVTDASGFPIADANVYVAGLEEKPMRTSKRGEYWRLLTPGLYSVHASAFGYQTSAPQQVRVTNDNQEALRLDFKLAPV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LP15968p
molecule tags Hydrolase
source organism Drosophila melanogaster
publication title Structure-Function Analysis of the Short Splicing Variant Carboxypeptidase Encoded by Drosophila melanogaster silver.
pubmed doi rcsb
total genus 121
structure length 383
sequence length 391
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2010-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00246 Peptidase_M14 Zinc carboxypeptidase
A PF13620 CarboxypepD_reg Carboxypeptidase regulatory-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1120 Mainly Beta Sandwich Immunoglobulin-like Carboxypeptidase-like, regulatory domain 3mn8A02
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 3mn8A01
2PJAA 4X3RA 4PXCA 3VH9A 4PXEA 1Z8LA 2B59B 4Z65A 5I4MA 4PPZA 4ZY0A 2CTBA 3CT9A 3DLJA 3WC6A 2PJ4A 3SJEA 3BXMA 4FL4C 1ARLA 2PRQA 3N5FA 1ELMP 3D68A 3VARA 4NGTA 2PJ9A 2AFWA 1HDUA 4EIUA 2PJ3A 3H8GA 3HN5A 4ZI6A 2RB7A 1F57A 5THWA 2F8HA 3D4UA 4UEZA 4OIDA 2CTCA 3TC8A 4W9YA 5K8PA 3PFEA 4P6YA 3KI9A 2HB6A 1HDQA 4JZ0A 4FBEA 4R6TA 4MRIA 2PJ0A 5G5DB 5AQ0A 2PJ2A 2C6PA 3FVLA 4FAIA 3B3TA 1RTQA 3KR5A 4P4DA 3B35A 3D7GA 3KZWA 3ISXA 3B3WA 1XFOA 3D7HA 1YSJA 3FMCA 2QYVA 4MCRA 2Q51A 1LAMA 8CPAA 4A37A 1AYEA 1TF9A 4OMEA 3IIBA 3KR4A 2O4HA 4UIAA 2ZEGA 2ZELA 3V7ZA 4U3SB 4NGRA 4TWEA 1CBXA 2GU2A 4TNUA 4ONWA 4OC1A 1CG2A 2XHNA 2JBKA 3WC7A 1ZG7A 3MN8A 5JM6A 4ZYQA 5K39B 2ZOFA 4JYWA 3CDXA 4MXUA 1EE3P 5LYDA 4OC5A 3HUVA 4DYOA 4RUHA 1IGBA 5D29A 1XRYA 3NA6A 4DJLA 2GREA 5JH9A 1R43A 2JBJA 4MCPA 3FECA 5D8NA 4PQAA 2ZENA 4OC0A 1FNOA 3B3CA 5IB9A 3FJUA 3IJ3A 3D7DA 2O53A 1LCPA 3KQXA 2ZEEA 1UWYA 1R3NA 3FEEA 1YMEA 3IO1A 4WI0B 4ZX9A 1YLOA 3JRUA 1YW4A 3PEIA 4UF4A 3QNVA 3D67A 1QQ9A 4IK2A 3PB9X 2DEAA 2PVWA 5ELYA 4G1PA 2V8DA 4K3NA 2WZNA 1LAPA 3MRUA 3WABA 4ZY2A 2ABZA 4R8FA 4MMOA 3TX8A 1BPNA 3PFOA 3DGVA 1TKFA 5LYIA 3RBUA 4MHYA 4MHZA 3IFEA 2ZEFA 1VIXA 1ZLHA 3FEDA 5LRJA 4OC4A 1Z2LA 2IJZA 4WJBA 1JQGA 5LYFA 4OKOA 2PJ5A 4P4BA 2XEJA 5LRKA 4MCQA 2CIJA 3NFZA 1Z5RA 4FWUA 3B7IA 3D7FA 4IAVA 3G3LA 3NH4A 2PVVA 2PJ8A 2PJ6A 2G9DA 2AFZA 2OR4A 4KSIA 5K8NA 2PIZA 2ZEMA 2EK9A 2C6GA 1DE4C 5LRGA 2Q4ZA 2AFSA 4YWYA 4A38A 3BI0A 1OBRA 5LYLA 4YOKA 4FUUA 3SJFA 3T8WA 4F9VA 4OIWA 4WWVA 2BOAA 4R7MA 6CPAA 4CPAA 3WC5A 3L2NA 4NGMA 1CX8A 2ZEPA 2NSMA 2AFUA 3LWUA 3S9NA 5CBMA 4UEFA 3K9TA 3V38A 2Q43A 2PCUA 1NSAA 3ISZA 1QMUA 2XEIA 1XMBA 3KHZA 1ZG8A 1IY7A 4O23A 2EWBA 2JEWA 2RFHA 3H8FA 2V77A 2VL1A 4P4EA 5HVGA 2PJBA 4PXDA 4A94A 2CF4A 3H8EA 3FX6A 3GLJA 3IWWA 3RZAA 1VHOA 4F8ZA 3KL9A 4MHNA 4P10A 4GM5A 4YU9A 1M4LA 4UEEA 4UIBA 1CP7A 2I3CA 1Y0YA 1BAVA 1PCAA 2PJCA 5CPAA 1Y7EA 4ZY1A 2ZOGA 1YW6A 2V8VA 4X2TA 3KCPA 1XJOA 3PB7X 1ARMA 2PJ7A 1Q7LA 2OOTA 1FT7A 4X8IA 5JGFA 4OP4A 3HLPA 3KGQA 1VHEA 3GUXA 3PB4X 4A39A 2J9AA 1CPSA 1F2PA 1ZG9A 3KHXA 3S9MA 1NKGA 2FVGA 2XEGA 1PYTB 4ZX8A 1BPMA 4EFDA 3CPXA 3BHXA 5HXDA 4BD9A 3LMSA 2XEFA 1LANA 4NGNA 2PIYA 2ZEHA 4P4FA 4DUKA 3WT4A 4NGQA 3VATA 1AMPA 3CPAA 2AFOA 2V8HA 3I1UA 3NJXA 2GLFA 5K8MA 1CPXA 3SI2A 2HC9A 1ZLIA 2AFMA 1LOKA 2BCOA 4MHPA 2PJ1A 4Q7AA 4AXVA 5HVHA 3E8VA 1HEEA 2QVPA 5J1QA 1DTDA 2NYQA 3RAMA 1TF8A 3PB8X 4P45A 3SJXA 4IHMA 1Y0RA 1BLLE 1TKHA 1TKJA 4PXBA 3B3SA 3SI0A 3KASA 1F2OA 2POKA 3S9LA 2F7VA 3NH8A 2GLJA 1VGYA 3IEHA 3BI1A 3B2YA 3PRTA 4FXTA 3PBBA 2ZEDA 4MCSA 5K8OA 5F09A 3FF3A 2ANPA 4B6ZA 3SJGA 4EWTA 5DS0A 3KQZA 4P4IA 4P4JA 2AFXA 4NJRA 3D66A 4R76A 3GB0A 3NJVA 3K2KA 2QJ8A 1KWMA 1ELLP 3B3VA 4OC2A 4IYKA 5HVFA 4OC3A 1XBUA 3SI1A 4H2KA 2C1CA 4NFRA 4NGPA 2ZEOA 4LQGA 3FH4A 2IMOA 3NH5A 7CPAA 4NJQA 2EK8A 1TXRA 2WYRA 2BO9A 4P44A 2PE3A 2C6CA 1CP6A 2IQ6A 4F9UA 3PB6X 4NGSA 4EMEA 1LFWA 2V8GA 1GYTA 1H8LA 3IC1A 3PBEA
chains in the Genus database with same CATH superfamily
2P43B 1NAMH 3ESPA 4CUCA 3HG5A 3S97C 2Y23A 5GGVH 3N1MC 3BN9D 1G7JB 3FU6A 4DVBA 2ATAA 5I6LA 3DOSA 4LCUB 1HH9A 1XVSA 1YLEA 3DR6A 2XV2A 3VXUE 2K6ZA 1YEDB 3OKKA 1XGQA 3I50L 3LSOB 1CQYA 4F93B 2M26A 2XX0A 3P2TA 2AEPH 3QCUH 4WW1B 1GAFL 2HFTA 3NSYA 4X5XA 4IBUA 2AKRA 5HYIA 4PJAB 5GGQH 3QJUB 4HJUA 1AXSA 5E4AA 3TCVA 3GGWA 4P5SA 2AJZA 1IAOA 2DBJA 3C60B 3MV01 3QAZB 2JLMA 3IU1A 5DWUH 2YEVB 3D68A 3D2UA 4AXWB 3US0A 1S7XA 4DN3L 3BH4A 1H5BA 4W9ZA 3LKSB 4EIUA 1BVZA 2H2SD 3MA7A 3GPSA 4RAHA 4UQ2B 5CZKA 1LK2B 2X41A 3MODH 1RPUA 3G5XB 5HYEA 1CXIA 2DLHA 1OOWA 4NUJB 5THWA 1QW8A 2EQDA 4PD4K 1EXGA 4DP8X 2IH8A 4CRZB 3B7SA 1QRNB 5AG5A 4XVJH 1BAFL 3N04A 5FHAL 3LEYH 3TC8A 1P5UB 2BHZA 2ZE0A 4MBOA 5K8PA 1FO0A 5CILL 4Z7VF 2HB6A 3E8UL 4JM4H 3LZPA 1MCOH 3GMOA 1KCVL 3ZU8A 4FG0A 3DGCR 3DETD 5ICYA 2AXGB 3ECVA 2VB5A 4QUSA 3I9GL 4MJ5B 4IJ3B 1CD9B 4R2GD 4ZNEA 3O6FA 3WIIH 3P02A 1SVZA 2DL9A 3SYAA 3IDMB 3TO9A 1ZT4A 4LPVA 3G8WA 1EEUA 2CDFA 4G7QB 1HE7A 4Q89A 3W0WA 4PJ7F 5CBAB 2I9TB 3L3KA 4U1SA 5L2JB 2J5LB 4OCXL 1LTXA 2IMNA 4OD3H 1UXLA 3ULVE 1A3QA 1FFRA 2IADA 3MRBA 3L5XL 3GI9L 4MD4B 3IJSB 32C2A 3LN5A 4FC3E 5F9OL 3CDGA 3AG1B 3FOMA 4JFEE 3TV8A 1JGIA 5ACZA 1QSEE 2EVJA 2XT1B 5IQ9B 5DHDA 2N0MA 4LCVA 2J43A 1ZLSH 3LV3B 3O2WL 3ROOA 3WV0A 1GIGH 5BJTA 4TNVK 2UX6A 1KXTB 1VGKB 3B3BA 1W9XA 4O9HL 5FHBH 3Q48A 1OWWA 3BXNB 3R1KA 3ES6B 3TEZA 3D48R 1N0LA 5F1OB 4P2RE 4QCIA 2XN9E 1I8UA 2PWGA 1JZFA 2YMOA 1F1GA 4CVZA 5CM1A 2OSYA 2RBLA 1EDYA 3DX7A 1IT9L 4S2SA 1ROWA 5FV1L 4GS7B 4JG9A 5TDNA 3K0WA 3VAEA 4DUVA 1FG9C 1TITA 4G9DA 5K33A 1YNTB 3CFCH 1X7QB 2B1HL 4H2AA 1CFTB 4RFOH 4JAMB 4HUVB 3FBQA 3KL0A 4LF3A 4I18A 3B56A 4PJ7A 3OQ3B 3GKRA 5IB5B 1B2WL 3LZRA 3R8BB 2WBJB 3DTDA 1A9BA 4ZTOL 3IAQA 3RVXC 2DIJA 2JK5B 1NGYB 1E4HA 4OFQA 4YC2B 2G75B 3AAZA 2E7BA 4AEFA 4PRPB 2E7LC 3PL6C 1WC7B 1IC4L 2MCG1 2J44A 3P69A 4JRYD 4NC2B 5IHUH 1T0NA 2HVJA 3TNMA 3W81A 4XPGH 2AJZB 3WJMA 4Y9GA 5FECA 4JJ5A 2Z3OA 4GKZB 5IW6A 5BQDA 4J3UA 1NANI 2IWGA 2J25A 3PXJA 4TYUA 4Z7NF 2R23B 1G1CA 2AK4D 1HWWA 2R29A 4HLEA 4Q36A 2AXWA 1N10A 2FO4A 2ZAGA 2ZXCA 3EO9H 5EWIL 2AF2A 1N12A 4UOW1 1OGTB 4LP8A 2O5ZH 2VAJA 2FHCA 1Q1PA 2YGPA 4CMHB 4EBQL 4Y4FD 1FG2B 1XSJA 4L9LC 3S96B 4FL4B 3NCFB 1E2WA 3FQWB 1TYEB 4U3CA 1U92A 2BX5A 4NCDA 3GSWA 3PDOB 4B3VA 4IJ3C 5TE4H 1IBHA 3GSQB 3H9SE 4NQQA 4ODTH 2VLJA 4MGXA 1MVFA 1C08A 5C0DA 3TNNB 1AR1C 4P46C 1T04A 3CH8A 3V6FB 3UAEA 4PLNC 2E4TA 5B8CB 5CZXC 1U95B 1BZ9A 5TD4A 3O6FB 3QUXD 3SE4C 1QHPA 2E74C 3K71A 4OKOA 5C82A 4HUUB 1UWEH 2VDNH 5A2KH 1A66A 3N1QC 2F5BL 1FCGA 5EDXA 5IJDC 1KBWA 3H1ZA 5KBDA 5TK2A 4TULH 1SJXA 1UCBL 1IAIL 2VR5A 2JELH 4MD5A 5D6CA 3B5HA 3VMPA 1LO4L 5IMLA 4I0PC 1SY6L 1FO0B 3RTQD 1QVOB 4NRYB 1T5WB 3HZVB 1AR2A 2BSTA 1KCVH 4N20A 1MCOL 2ZSVB 2Z31C 4JFHD 3Q8AA 1T21A 2XV3A 2X28A 3FRUA 4HCRL 5EO9A 5D7LD 1N8ZB 4WU5A 1NDMB 4QGTA 5DJCA 4ZMYA 1ADWA 5C0BE 1UM6L 3H85A 1HNYA 4LCIL 5T3XH 1EQWA 2J8UF 3MYZA 3MLVL 2WZPA 4U1HB 3DOSB 1FVDA 5IQ7L 5FPIA 1B2WH 3RFZA 4R0LA 3VWKA 1UWGH 4FGMA 1NIAA 2XZZA 4P4RA 3WO4B 1XGZA 3SJVD 4BQ6A 3FH8A 2DPTA 4LO9A 4BWTA 1R3HB 3U30B 3MUY1 5T1LB 3H9ZA 2I9LA 3FB7B 3MRFA 2DQIH 4WI8A 2BOAA 3V10A 3ZO0A 2FEDC 1VERA 3EOTH 3TASA 4K3GA 2MNJB 1L6PA 3IRCA 2FATL 1X5JA 4NO3B 3TO6A 4MXQD 5L8KB 2VE6B 4G42A 4HMDA 4P4KC 4F2MB 2D2CC 3U1QA 5BZDA 2A4NA 5JOEA 2Y36L 1M2OA 3S88H 4PRHA 3MLXH 2VI7A 3O2WH 1NINA 3MLZL 1QMUA 3DO4A 4NO2B 4I18B 2R0LH 1UB5B 4PW9A 1CYWA 2PWFA 2GITB 2OR7A 2YSTA 4GG6E 2E7DA 3CMGA 4JQIL 4CC1A 4FP8H 4NS0A 4P4EA 5TH2A 5INCA 3TF4A 3LXUX 4FQXD 2VXQA 3S6HA 1UEMA 1EGJH 4QRPD 5KVGL 4HPYH 4Y9EA 5C0NC 2IFGA 4Z7NB 1ANUA 2FEEL 5T1MA 5E8EB 4OCXH 4OW6A 1NBYA 4YE0A 1ZLWK 1LE9A 2GANA 4RGMB 3LD8C 3QIUB 1NEPA 1S7KA 4P10A 5FUCE 1I4FA 2MQGA 4ZT1A 4IUSA 2AEIT 4UIBA 4G8FA 3MV9E 3B3IB 2MKWA 2OL3B 1ASOA 5HGHB 2BOCB 2ZCHH 1C1EH 4MXWL 1NEZB 5DUJA 2UY6A 3MLWL 2F54B 5FOBB 3HZYB 3QH3A 2EACA 1A2YB 3GHBL 2XIDA 3BP6A 1R46A 4M02A 3H54A 3KW8A 2L7JA 1WHPA 2YXWA 5SWSA 4GFXA 1LDPL 3BJLA 3DVIA 4GRMB 5AUMB 3ZKND 2BNQA 3QEGL 5GIRB 4OZHF 3S35X 1Q0YL 5JGFA 4A7UA 2E56A 1ZV9A 4FNTA 4LCCB 1DQTA 4P5KA 1RU9H 1IKNA 5C6PB 4X7TA 4M61B 1IKNC 2KS0A 3QWOB 3ZTJH 1QABA 2FBJL 1OP9A 1ZTXL 1AO7E 1M7DB 3FFCE 3REVA 4BZ1A 4RFEA 1A6UH 3N43F 4FKHA 1TVDA 4LBAA 3UPRA 2GK2A 4OKDA 1UOVA 3V2AR 3AY2A 3GHEL 2A6DB 4GKLA 5BPPA 2R4RL 1FNSL 5F0MB 3P3TA 4O58H 4YK4B 1LANA 2WVUA 1UADC 2NPLX 2UZXA 3KJ6H 3MVSA 4CSPA 1RZPA 1ES0B 2W60B 2P5WB 4AVJA 2ZEHA 1TVHA 3EW3B 3OC5A 4M8VA 4ZS6D 4XPDB 3UBXG 5B8CA 4IOFD 1IQDA 3I1UA 3NJXA 4U1MB 5AZEH 1EZLA 2JJUA 1NDGA 4L4TA 5JQ6L 2YNDA 3UJIH 1U8IA 4CVXB 4R0LB 2IV9A 2JFCA 1X44A 1FFQA 2UWEF 3C6EA 4PJXE 4MNHA 3EDKA 4TUOA 2DKMA 2D3LA 2EILB 3PHAA 1A7OH 1FYTB 2G9HA 3WTTA 2ADFH 3FQ1A 4JB9H 2I9LB 1ZDSA 1MIMH 2Z3FA 4AIOA 3FB7A 3MR9A 2BSTB 4PWEA 4X80H 4JFDD 4MSWB 5G21A 3B6SA 4F8LA 1LNUB 2W07B 4JMXA 1P6AB 2IAMC 3LEVL 1D9KD 5DHXB 5CS7A 1XF5A 2B0SH 1SJMA 2XETA 2QADC 3QIBD 3SI0A 3CZGA 3G7TA 1ERNA 4PJIA 3S9LA 2X7BA 3NH8A 2ICEC 4F9PC 3I9SA 2GK0B 2AANA 3DXAA 3LRSA 4NPYB 4F1SA 5ESQA 1A8JH 3QCVL 4P05A 2IWFA 2YA1A 3PIQA 3QJRB 1E4XI 3GSUB 4FLRA 4KQ3L 2Y0SA 2WBXA 4JDTH 4OZHB 5BS0A 5ID0A 2VWEC 1KJ2A 1TXKA 2WVTA 3L9BA 2JKXA 1MCWM 2EADA 1BFOA 2IG2L 4P4IA 1BZEA 1HXMB 2BC4B 4H1LH 3KVDD 4KTYA 1F4HA 1MF2L 1KPRA 2YMTA 1I9IL 2YPLA 2VRQA 4NM8L 3K71B 4PRHB 1MRFL 2REFA 1JGLH 4GW4A 4L3AA 2FH8A 1NC4A 4NQED 1RK0A 3V4PH 5JR1H 2HVKB 2EKSB 2UUDK 4O2FA 4YWGL 5JTWA 1VHSA 3I74A 4ALAL 4MQXD 1EBAA 1XF3A 2JH2A 1KBGH 4FYQA 2Z31A 4NQTA 4MHDA 3ARDC 5I18H 2PXYD 2XZAL 1Y6MR 3ATDA 3ZO9A 2ZPAA 5AAWA 8FABB 3MBEA 5AAWC 1QA9A 5ITBL 2XWBB 2YZ1A 3P30L 4NBXB 1IOIA 1BCIA 5T3ZD 3B2VH 3GZPA 2CBOA 5B1BB 4ZMTA 4OJAA 4JFEB 4N8CL 3NBNA 2FIWA 2CH8A 3GBNL 1J1OH 5DEJA 3VRJA 3IDMA 3MACH 5EBLB 2J6EH 1DEDA 1IC0A 2IBZY 2K8MA 4A2EA 5E08H 4F9UA 3B3IA 1LO3L 4CGPA 4YSSA 1ZKAA 2BIMA 1UGKA 5I5RA 4QRUA 3V8CA 1WS7A 3NH7L 4RA0C 5ILTH 5FKAA 4H0GA 2AQ1A 3BP5A 1HINL 5DS8A 5DD1L 5TPWH 3UTQA 3I9PA 4POYA 4YX2H 1AZBA 2J1ZA 1BWMA 1FGNL 3DTUB 3HI6H 3CLFH 5CSZA 5BUAA 3T4YA 3IDXL 1AZVA 5DSCA 3CXDL 1XR9A 3EJPA 4LSUH 5L4JA 1KCUL 5D2LF 1MJBA 4YHZL 3MA9H 4X9BA 2VZ1A 2HB0A 1MHEB 1RU9L 4ZW8A 3WDHA 4LESA 1O6SA 5JHMA 3OMAB 2C26A 3B83A 5JQHC 5T3ZE 4HOZA 3QQ3A 3P9MA 1D6EB 3ETTA 1GMIA 1CCZA 4MJHA 5EEUA 3W82A 3DX7B 2Y6SC 4BH7B 1G6RL 1OF2A 2DD8L 2YAOA 5DK2A 1BD2B 4Q7DA 4L8AA 1IGCL 3R9EA 2G3ZA 3L6FA 2VAAB 5DO2C 1V7NL 3KHOA 5E99L 2EEXA 3TH4T 3ZE1F 3BKYL 3OXRB 1RV6X 4NO0A 5DI8A 1M05B 4QXUL 1PYWB 5L9DL 1MSPA 4Z7WA 3HI6L 4TSAL 4JZ0A 3LS4H 3MROA 4JO4H 4PRNA 1JRHI 3MJ7A 2A74A 1OE2A 4HWEL 2A9MH 4F1ZA 4CS0B 2WWMD 2V3EA 4L4VB 4DESA 5I1JH 2X70B 4MJIA 2PJ0A 3NCJL 4W6XB 4Z95H 4MB1A 3ENEA 4MYPA 5IJCC 1IAKB 4L4VE 2VITA 2NOYA 5F0PB 3OF6D 3BEWB 2Q76B 2IQAA 3ARFD 2Y7QB 1B4JL 1PZBA 5CUSL 4M6HA 4MFPA 4WCYL 3E9UA 4X8JB 4WI6A 2WLMA 2EO1A 4JFED 2OK0H 3P0VH 4YGVA 2XBZA 5G20A 5DMYA 2DBLL 1XCXA 4P49A 5F96H 3MRMA 2BMKA 2QL1A 4L48A 1JGDA 2N0KA 3HG0A 3LJ3A 1BHGA 3GBEA 4HT1L 3PUUA 3SPIA 2FSRA 1E4XL 2A6DA 5JPMA 4JFDB 5HDQH 5F47A 3GSUA 1MRCL 3H9YA 3SGJC 4NQUA 5ISVA 2QADB 4OMEA 2WJ5A 4TSCH 2O4HA 4M6AA 2ITCB 1XF2A 2ZEGA 1DN2A 4Z18A 2VOTA 5F1IA 2CBPA 1DUYA 4PQXA 3SEPA 3IU2A 2ZCLH 3U1SL 1R9FA 5C0BB 2ZP9A 5HHNB 4Y2DC 3VYNA 3TVMB 4ZFFB 2HT3D 5KSAD 4PJBF 3SYPA 4FFYA 2VQ1A 5IHZA 2DPSA 1XGUB 4OGXL 5GJSH 3DHMA 5J8OA 2DWYA 4QY8B 1DJZA 2WW8A 1MJAA 2OSLA 1UYWH 3QZLA 4NQXA 5JNYB 2P24A 2X44D 2XWJB 1HILA 2D31B 1DBBH 4WUUA 3Q3GB 5EUOB 4F9LA 2D8KA 1H3XA 2UVFA 3GHPA 2X4QB 5A3IC 1LYQA 4JYWA 2ZXDA 2R83A 2ZSVA 5D7JC 1BMWA 5JHDE 1UT9A 1F02I 3FCUB 2J8UE 1G7QB 2VW4A 5EN2A 1DQVA 5D93B 4BKSC 2P48B 2F5BH 3MRDB 4JZOB 1RZKC 4QAMB 4MX7A 1FVDB 5EV7A 4ZPTB 2HLAB 3RFZB 1XL6A 5D5MF 5AG7A 1V8HA 4BH8B 5JHBA 3LEVH 3SDCD 2VN4A 4OBRA 4AUJA 2CGRH 3OL2A 4TLUA 4WEBH 3QYNA 1BZOA 3MRGA 4AVBA 4HFWB 2ADYA 1KIPB 5ADOL 3HE6A 1L9NA 5HVHC 1UWYA 1R3NA 1XSOA 5F3FA 3TESA 4OR1A 1LMIA 2MPAL 5FKPB 3MV8B 2YRZA 4UIKL 3FRMA 3DPBB 5DD3H 4YHNB 1R17A 4N4YB 5CNPA 5LG6A 1HEJC 3B8GA 1GZHC 2MJWA 2BSCA 4WTXA 5EG6C 1Z0NA 1R24B 4Y7OC 1OQXA 3KWXA 5C0CD 1L3WA 2NTFA 3L7EB 4IU3A 5AZEL 4K73A 4L1DA 4IK2A 2W9DH 5GGSY 4F2EA 1U8LB 3QDMB 3X17A 2BS8A 1IAMA 2HPTA 1Y6KR 2BRRH 2BVOA 4OU3A 4K3NA 1ZK5A 2EJ1A 3IU3B 4MQ7B 4AGPA 2IAMD 1ETB1 2YK1H 2CK0L 1BPNA 3KGUA 1ETA1 2X2YA 2WUCH 4DGVL 2V5SA 5EULV 5IBUB 1S7WB 2HLEB 4M6MH 5HGBA 2GSGB 3WEMA 1T1WA 4GKOA 5E1QA 3UADA 4CNIB 2DKSA 3FFDB 3BC9A 4X4XB 5DVKA 4W9IC 5I75B 1Y18A 5EBLA 1QO3B 2V3DA 2X6BA 1RZJL 1KTKE 1NGQL 4TRPH 1E28B 5JO5A 3D2PA 1PYWA 3B9KB 4TVPE 5T5NG 3MSPA 2AI0H 1RIUH 1P4LB 5I2IB 2R2HA 2FEEI 3S7GA 1PJWA 2L7QA 1TCRB 3CHRA 4N2FA 4WAFA 2XG4A 1R5VB 4X5LA 5E6ZA 5HMNA 5GS2H 1T4KB 4U6YB 1IKFH 4R90H 4C56E 1XE4A 3MLWH 4MS6A 2GI7A 2X6UA 3Q44A 2W38A 4W9DC 1WT5C 4Y1AB 1I82A 1OGPA 5KVGH 2QHRH 5CP7B 3LHPL 4TXVB 3QFJE 4Y5YB 2Z10A 1UH3A 2GYSA 3IYLW 2ZEMA 5SV4A 1X5YA 3VXQA 3G6AA 4FFYH 1UM4L 1E8XA 2YIHA 3GK8L 4IRSC 2KQMA 5E9NA 2BSBA 1B0RB 1C7TA 2C3HA 2CRMA 3FUNA 3L3GA 4OGYH 4YXHL 2Q44A 3GLAA 4KITB 3SJFA 2DQCH 3T8WA 1CBVH 1K6QH 1TTAA 3QDGA 3LQAL 2AC0A 4N2OA 3T3MB 4Y2DD 4LUAA 1TO5A 5F7EL 3QNZA 4XHJC 4BKLB 3H56A 4HPYL 4DZ8B 3UPRB 4DGYL 3QDJB 5GRUH 4U1LB 1FZKB 5HD8D 2FX9L 4K8RC 2NSMA 4I0KA 3LKPB 3CJJA 4WEMB 3S2AA 3U0PB 2BY3A 5L7XL 1NGWB 2EEFA 2V7NA 4HH9B 1PNDA 3THMH 2ISDA 3EYOB 5I5JA 2W0PA 2PPDA 5L2KD 4K0OA 1YN6B 2H1LM 2HT3C 3GXPA 4AVAA 2PYEE 3LXCA 3KLAB 3PWPD 4D8PB 5I19L 2PABA 2BS71 4QRRD 1TUPA 1I1RA 4RQQA 1UACL 4GKNB 5CCGE 3JUZA 3S48A 4Z7WB 1NDGB 4LQ1A 2V77A 4DVBB 2DMHA 3SY0A 1LK3L 3EJTA 3A6CL 1D6VL 5IB1B 1UATA 4A94A 4UV7L 3HMXH 2CALA 5F48A 3PWNB 4HP5A 4Y19D 1AS8A 1UXSA 2DWEB 5EMIA 4LCIH 5T3XL 5EU5A 2IL4A 2FZ3A 5D7IB 1ED3A 4ZW5A 1QHOA 1H5BC 4F2FA 4P8QA 4MHNA 2VDML 3I3EA 4IIQA 3O6ML 5JIQA 4KOSA 2R8SH 4Y19A 4Q56A 3QUZB 1UCBH 2JELL 2WWKO 5JDJA 2IWEA 1XGYH 5IQ7H 4ODXB 3DSBA 1UD4A 4YGVB 3MLVH 4OM1H 3CSGA 1PKOA 2H2SC 2ADJB 3G5XA 1IEHA 4I88A 2N01B 3MPCA 2PR8A 1RFDH 4KVNL 1H8OA 5BJTB 4L4JA 3N6YA 2OLDA 4YH6A 1A8ZA 1Z5YD 3EG9A 1RERA 1WICA 3VXSD 2FHFA 3FB5B 5C0FA 4M6NH 3UMTA 4X8IA 1SY6H 1MOEA 2O6FA 2R27A 3FOLA 1PSKL 5B4MD 4OLVH 3SDXB 3DIFB 4R7XA 4PJGA 2W0FA 3FTYA 4HJJL 1MCKA 4L37A 1VHEA 1MIEL 3KD4A 4QC6A 2JJWA 3BHBB 3IPBA 1BGXH 3QXDB 4U1KB 4E41E 3TJHC 3EJSA 1ZG9A 1UACH 4DP6X 3ZQ9A 5J89A 3DURB 3T0DA 5K9KA 1XGUA 5D6DC 5JW4N 1P84K 5AOMA 3UZQB 3DECA 1PEZA 1EHKB 1P2CA 2DYPB 2EDNA 4WFHD 4HOXA 2EICA 1NFDF 2FWLB 4ZPVB 2WGXA 4XPHH 2X4QA 4IRZA 3ZDYB 1FPTL 2FX9H 4PP2B 4Z3FA 1SXZA 2YPKB 3GINA 2YGWA 4LIQH 2I25N 3RWCA 2DICA 3LN4B 3IXAB 1YMHB 3UJJL 4KVPA 2HWZH 3PV6B 3R18A 3POHA 4AG4H 1BJMA 4X9FA 4XB3A 1VADA 3V5HB 1T6BX 4LCUA 1RZ7L 1CLCA 1QKZH 4DTGH 4MHPA 3MRRB 1ZHLB 4ZUVB 3EH1A 5HDWA 1NFKA 3AMKA 3UTPD 4Q7AA 2A77L 3P3RA 1QSFA 3TZVD 4J3BA 2G3MA 3H4QA 3SKOA 3O11A 1HL9A 4IBQA 4YDVB 3ZKXB 2NY2D 3UTTE 2ZSWB 3L1OH 3AWEA 5AW6B 3MV7B 3DPBA 2XPGA 1OSYA 4QYAA 4U6YA 4Y4KB 3BP5B 4IHMA 4NKQB 4NFBA 1YMMD 1TVBA 4IOIA 3ARTA 3C5XA 4XVUD 3WXVL 5IBLD 5CF3A 5SWZD 2BNQE 2ENYA 1DEEA 5IESL 5L88H 2BCMA 2ICWI 5C07E 1CBJA 2HFEB 2CPCA 2JDDA 1V55B 3QULA 1ZVSB 4BUQA 1X5KA 1NCUA 5EFIB 3MX0A 4NUJA 2PTUA 3WL9B 2OTWB 1CB4A 3TNNA 4XC1L 3MRCB 4QWWD 1G0YR 1EA9C 4IBLT 5EEVA 1YNTF 3I2CH 3PAVA 1IAIM 1RLWA 3QORD 4ELME 4I87A 1UUNA 2MNWA 3X12B 3HI5H 4ERSL 3ISRA 5DJDB 4EIZC 4IF5A 5BRZA 4HPSA 4ZODA 3ZLQC 2R4SL 4QHLB 1KTRL 3GI8H 4GMTH 3BMVA 5F93C 1QI3A 4NRYA 2B14A 4LGSB 2G0KA 3DIDA 4AVKA 2B5GB 1AY1L 3UGEA 2IAAC 5AWNH 4AQ1C 2W9DL 3VMOA 3CZNA 1A4KB 1M05A 2NZ9D 4FJ6A 2R23A 4MB4A 4FD6A 5IBTH 3KDMB 4KWUA 3O8XA 4LPCA 2DQJH 2G3NA 3SI1A 1YN7A 2IPTH 5K39A 3WG7B 4MYWB 2ADGA 2FJFB 1KFGA 1CD0A 4LOUC 5LLIC 2GSIA 2NY0C 2EECA 3WMSA 2X4OB 5CN2A 4MJJA 3T2LA 1TFHA 4B60A 1IM9D 4H25B 4OJYA 3DX4A 2IMOA 2WZ0A 1KGYE 4FOMA 1U92B 1U58A 1TXRA 2JIXA 4F9LC 1MQKL 2YQBA 1R6VA 2O26U 3DUUA 3GB7A 4PV6A 2IQ9L 2DMBA 2Q87A 3CZFA 1AGDA 4MVBD 2ARJB 4UINH 1ADQL 2J2ZB 3QHFH 1NLBH 3OB8A 2F7QA 2X10A 4XVJL 1ZSHA 4P2YA 5IJVA 1GYTA 4BFIB 3QJSB 2QEJA 5AB2A 1GRWA 1OGTA 2CAKA 3NFSH 4K5LA 4EI6A 5D4QA 1JDAA 2YD6A 3MDJA 4JQVA 4ODWA 3MLPA 1J05B 2QQNH 4RAUA 4ZXBC 5IHBA 2D0GA 4L3EA 2PP9A 4QXWA 5ICUA 2P49B 4U1NB 1JK8A 2AVGA 4QOKA 1OP5K 2DWSA 5CEYA 5T3ZH 5AG8A 2K3TA 4BJLA 3H0TB 4PP2A 2JKIS 2F19H 3S3PA 4M7LH 1WWZA 3BAYA 4L8DB 2XKUA 1AIFA 1T6WA 2CTBA 5IQMA 5GJSL 1HSAA 2D0FA 3ILPB 4YDNA 2XVLA 3ZTJG 4ZYKA 4K5PA 2VLME 4XOCA 1A3LH 4GKNA 2WJ7A 3L4CA 1U9KA 2BK8A 2NXYC 3KPLB 4U1HA 3DURA 5E1GA 1GSKA 1UASA 3VWKB 1FORH 4WTZA 2V2TA 1ITBB 4LKXB 3P0VL 2QSCL 5IROD 1TQCC 1M7IB 1JF6A 2YS4A 5CWSA 3X14A 4HU8A 5AVVB 2W1NA 2P6FA 2BSDA 4KRMB 3ZT6A 4R87A 3VGEA 2WOBA 4W4OA 5E5MA 1C5DB 5KS9F 4WW2A 3RB7A 3L08A 5HYSA 4Z23A 4M62H 2H6PB 2H0EA 3FQXB 3HS8A 3NSFA 4M9OA 1CE1L 2KPNA 4UA3A 4CC0A 5LBSH 3S8WA 1TZHB 3CN0A 3L3HA 2P44B 4GBXC 1TKWB 3A9LA 4PWGA 4XHJD 4OGYL 2X4RB 2Z93B 5FM8A 1TETL 4RSYA 2ADJA 3G6JE 4KQ0A 3LRMA 4GO6B 4GG6B 2EDRA 2YQGA 2GSMB 2G2PA 5CJOL 4Y16C 3FDWA 4PJCF 1EAJA 5I76B 1NC2A 3TOAA 1DVFC 2Q7NA 2LTQC 3GSWB 1JDCA 1GOGA 4NENB 4AE1A 2I79A 1NBQA 2QHLA 4M7ZC 5DJ6A 1EHAA 3TA3A 4NPJA 3O6LL 1IGCH 2VC2B 4LOFA 3BLPX 5SX4H 5BRZB 2OTUB 4WO4B 1A7BA 4QHLA 1DE4B 1X4XA 1BXVA 1NCAH 2X4UB 4IRSD 2CHWA 3FMCA 3NPSC 3WNLA 3DUSA 3BUYA 2AJSH 2ITDB 2MQ0A 5DFVC 5GRVL 5BMFH 1JZEA 2FB4H 4KKAD 5F9JB 4XBEL 4LU5L 5IZ7A 5D96B 4LCYA 2BWIA 4IHOA 3B9KC 2ZG2A 1B4RA 1S78D 1CE6A 1OHZA 2B5IC 3JQOB 1S7FA 3VSTA 1CFQB 5CCKH 3MJ9A 5E2VH 5LWYH 3BP7A 5JA9A 4P4KD 2WINB 1GVIA 1ZV5A 2V9UA 1YR0A 4QXGH 2VDKB 5C0AD 1CGYA 2VL5B 4W9HC 5HYJB 3MRKB 1O75A 2AV1B 4LBEA 4HOWA 5F88B 4B14A 5D5MB 4ONWA 2R1XB 4ZX4A 1NCIA 2G5UA 1XCTB 3G08B 3O41A 1KN4H 3V0DA 2VZTA 5JXAH 1B88A 2W80C 1VIWA 2B2XH 1VZGA 5FWQA 3QWOA 3CNKA 1AYRA 5K39B 1NMAL 4AEEA 1PLCA 5L0QC 5B39A 4UNVA 4NQDD 5GS0D 3PWLA 4X4YB 3IDYC 5FYJL 3SZKC 4RVBA 1T4KA 4K9JA 3ZE2B 3ZYJA 5E4IA 3U83A 5C2BH 3D4GA 4L2LA 2XV0A 2GREA 4XMLH 4LGPB 5CZVL 3L5HA 3CXPA 1HXKA 2VDOH 2V5TA 2PRBA 2H4EA 2BSED 5C09E 5FA4A 3QCTH 4EVNA 1DQML 4PQAA 5AW5B 2DLGA 4PJ5B 3BRDA 3VQ2C 3KQXA 1DQQB 1E6OH 3JWNC 4Q0XH 3N91A 2CXGA 4JDZB 1U8IB 5DJYB 3AMLA 5KS9E 3UIYA 1IEAB 1MJ7L 3DRTB 3VD4A 2Y24A 3GMMA 2LQRA 4HOMA 2F61A 3JVNA 5I8CB 2CUAA 2A6JB 3VXPB 4OF6A 5AZ2H 3TZVA 1NBYB 2J8HA 2J3SA 3ARDB 3II3A 3SQBA 3HRZB 2ALWA 5BWAB 4XPAH 1MI5D 4WQOA 2YEZA 1WH0A 5CCKL 1SOKA 1UYWL 1U8MA 2Q7AA 4JGUA 4MHHI 3E2HB 2VKXA 2Y07H 5KYUA 3ZUNC 3D2UD 2VZYA 4KXBA 5E9DE 2OP4L 3NP3A 3ZMNA 5BMFL 3CK0H 4DN4H 4OM0L 3KPRD 4PK3A 1HK6A 1YYLL 3PJNA 1BFTA 1EPFA 2XDHA 2DM3A 4ONFH 1DDHA 3KYNA 4XBPA 3MCKB 4YSDA 2EDTA 4AGOA 1FO0H 4JFYB 4XPDC 5JORB 2V7HB 3W11D 1HXYA 1KB5H 4WJBA 4QF1A 4OZHA 4Y4FC 2ESVE 5HDQL 5AUMA 2XBTA 3CBRA 1CXFA 4WJKB 4X80L 1KJ2B 1KIUB 2PJ5A 2X9ZA 1S5HA 4ZW6A 4GOSA 1A5FL 4HKJA 3IJHB 3MRNA 5FDWA 1FNHA 3S3DB 5L6YH 4ICXA 2QVMA 1NBZB 2JQMA 4JVPA 1INDL 4Y16D 3BQUA 3O45B 3OJ2C 4HCRA 2I24N 4PJIB 1AR1D 1U8HB 2DQTH 3IETA 1HS6A 1ZGLA 3AABA 3KHQA 3IF1A 3VXSA 1BZQK 1MFCH 4AMKL 3WFCH 4KOWA 1CE1H 1ZGLM 2UWEE 4QXVA 4QOKB 1WD9A 1WLHA 3KPMB 3R4RA 2CCWA 4EOWL 5B22A 4RWYH 1S7RA 4E5XG 3HI1A 1UURA 5AB1A 3NA9L 5I28A 1JFHA 3D0AA 4G6ML 4CGUB 1CS6A 4GI8A 5D2LB 2P5WD 3SKMB 4KVME 4N26A 4U1JB 1OE1A 2VLLA 2WXKA 5FYKL 1KUVA 1A6UL 1OP3K 2D0HA 2ITDA 3FU9A 5DZVA 4CMMA 1ACZA 1KCLA 1VFBB 2DH3A 3CVCA 3GZKA 1J11A 2XC8A 4UT6H 1A3LL 3WC5A 1CX8A 1KGCD 2ZEPA 1T7XA 4J3XA 4NQCE 2BNQD 1FNSH 3EBGA 4JPSA 4XGZA 3UP6A 4P2OC 1IV8A 5SWSD 3TN0D 1QATA 2RFXA 3ISZA 4BK4A 2PPEA 4UZUA 2XWCA 4WTQA 4IK6A 1ZVYA 5DQDH 2X1OA 3MRKA 4W68A 5E8DH 3LPWA 2EWBA 4M7KH 1NBCA 2E4FA 3ABMB 4IGBB 2F74A 1T66D 2GKIA 4G8IB 3UZVB 1FI8C 4YHPB 4AC4A 2EYTA 3O3EB 4I8DA 1XR9B 1FHGA 1QSFB 2OJ1A 3IDJA 43CAA 3Q5OA 1WGVA 2WXQA 1LP9A 2J55A 2G2RB 3FW6A 1HJBC 4L8SB 2OV0A 2VDQB 2OMZA 4J3VA 4N2BA 4XVTL 3GNML 3QYCA 5DDHB 3EDFA 3JTBA 4XVUC 2BNUB 3LQZB 3MNVA 3QXUA 3PWUB 1J12A 5AL0A 5E94B 1I3GL 3OWRA 1IARB 1M2VA 2VUKA 3L2MA 4FQXC 3BDYL 4KVCH 5B1JC 2J20A 4LLQB 1EFXD 3JYCA 3WNPA 4WKXA 3L5WA 4Y5XB 5DHYB 2XNAA 5DR5L 3U7YH 3PP9A 1DBKL 1HVXA 3FF8A 4PV8B 4FG6C 1L0CA 5FW7A 4HUKB 4AGQA 4TOYH 2EKSA 1ESOA 4YK4C 4LRIC 1MCCA 3ZDZB 1DSWA 4N8CH 4IS6B 1CLOL 1CVSC 3VD1A 2C34A 1B4TA 1TJIH 4ZQTA 4O2EB 5T8IA 1Y1UA 3H3PH 3UO8B 4X0KA 3V0JA 3X13A 4OZIB 2J7LA 4Z3EA 3CBJB 3BUPA 1UJ3C 2OMWB 4HV8A 4E5XA 2XZCH 1WK0A 4I5BB 5GSVA 5DK2B 3GM8A 3KGQA 4CU6A 3PB4X 4GQRA 5IFJB 3QEUB 4HUXA 2BUEA 3D39E 1DQIA 1JPGA 2PUQT 2PPFA 1YEJL 4GLRI 1KDIA 1PEWA 1PY4A 1WG3A 1Z9MA 2YLHA 1PYTB 5ICXB 1YX0A 5JR1L 4KJQC 2PR1A 4KORA 4JVWA 3ILQC 4X6FA 1YY8A 4CVUA 4J28A 1YN7B 1J0ZA 3CQPA 3CFJB 2HLAA 1XH3A 2X4TB 2OZGA 5I1IL 1A7PH 1O7DE 4P5TC 3U4KA 4WNQA 3T1WA 1JD9A 4UBDD 3R19A 4MDIB 5HJDA 4GEJA 5B8CC 4MMXB 4OZFH 3FUFA 3MTXA 2V8HA 3GXTA 3J2PA 1ID2A 2JIXD 2WV3A 3JWDL 1UB6A 4PCYA 3RB5A 4EI5B 4NERA 5EEZA 3KVPA 5HYQA 4YFDB 1S9VA 4X6DB 1JMZA 4K2UH 2CKNA 4F15C 3QJXA 1BAWA 3PRZA 1HE8A 5E9DD 2M83A 3K6DA 5LBGA 4F7KA 1XCQA 3OPZL 4G43B 5IVOA 3G04B 1DQQA 1NGZA 1YGHA 5EZJA 5HI5D 3DIVA 3TVMA 3OKMA 4ZFFA 5C0GA 3AXLA 5IHZB 4P45A 3L3DA 3D30A 3HE6D 4D0BB 4UIMB 2CM5A 1P1ZA 1X5XA 3O2VH 4YQXL 1YO4A 1GS8A 2NX5B 3SYQA 2VLJD 3R06A 5GRZA 4NKOA 4PXBA 1NAMA 1G9MC 3FQ4A 3KPMA 4EI0A 5EDSA 2OL3L 1GGIL 1SJEA 3GXNA 3X1NA 3JV6A 4RMBA 2BFVH 3KASA 5EC2B 2OI9C 1FVEB 4JGJA 2BVEA 4JY5H 3MZTA 5J56B 3BZ4A 3HG4A 1MDAA 4OIAA 3TN0A 2Q0ZX 2EVIA 3EOAB 4MB5A 3F7VB 3S34L 4KSFA 4Y2NA 4A2ZA 5T5FL 1KB5A 1CLZH 1WBZA 4OLYL 4XNAA 1T66C 3ALXA 5EF2A 1MZZA 3DX8A 3N42F 2ESVA 3ULUF 1MIEH 3FCGA 3IE9A 3KJ6L 5ECGA 1SJHB 4XVOA 2EUZA 3I3BA 3MRQA 3D66A 5E6YA 5J13C 3GHEH 3MV8A 4Z7UE 2GJ6A 2KDGA 3RKDD 3LN5B 5IK3A 4FFVC 4HSCX 1AD0A 1KB9J 3QUZC 4Q2ZB 4XNXL 5KVFH 4M6IA 1JN6B 4NGPA 4NKDA 3QG7H 1E9QA 2NW2B 4PJXA 3RL2B 3VI3F 1G7LA 4BH8A 4CN1A 3LV3A 4PRIA 5J11C 2ZYHA 3AY4C 1OP4A 3I3GA 4WFFD 4UM9B 5C0CE 3C8KB 5E95B 1MCJA 2A7BA 5E2UH 4F37F 2VR4A 2MCMA 5A43C 2DDQH 2VSMB 2EEBA 5J9PA 4CYOA 2WYRA 3IGLA 3LX9A 3LN9A 3GKZA 5B21A 3UG3A 2B1HH 4ZUTA 4WIQA 2Z8VC 5AOJA 3P2FA 1L6ZA 5AVXB 3PWUA 1U91B 2FECI 1X5AA 5B7MA 3MV7E 1LFWA 2BHUA 3CDZA 1J8HB 1QRNE 1P53A 1ZA6B 3FTXA 3GF8A 4QGYA 1LK3H 1VZHA 3BVDB 1GC1L 3DX9A 1U8LA 3QDMA 1WZKA 4MMYA 4J23A 2RB7A 2XY2A 3HLKA 3UAJA 3VD5A 2PQ8A 4FI6A 5HDRA 1A6TB 3FQUA 1S9XA 2O5XH 2CJSA 1OVZA 2B16A 5E6ID 3B9VA 3LPFA 1A14H 5CHNA 5C08D 2R29H 1PPIA 5F49A 1NGPH 2ORBL 2YXVA 4JFFA 4D3CH 4UYPA 4ZD3H 3SKNB 2AQTA 2L7UA 2XZCL 4XNBA 5IG7B 4AV5A 4KKZA 3P9LB 4N6RB 4KJPD 3CQFA 4DIXA 1FV1A 1RJZB 1LQSR 5AW4B 5IF0A 5I30L 3HLAA 3O2DH 1GIGL 4UNUA 2KCWA 1A4CA 1H3PL 4LOEA 3MLXL 5I74C 2AFWA 5FDYA 4ZBGA 4U0RC 5E6IB 2MMXA 2GT9A 2BP8A 2WN3A 1A6PA 2RACA 1VEOA 3ORJA 1SHMA 3H6JA 2O5NA 3VG0L 2NY3B 3L5XH 3TPUB 3HC4L 1INQA 3CDGB 5IX3A 1F8TH 1QFWH 1IM3A 3LKPA 3LIZL 2ZKHH 5E5UB 1UB6B 2F1EA 3OXSA 3WIHH 1QEWB 2VCOA 3D4CA 4TQHA 1SHSA 1I9EA 4OZFB 1GHEA 2HFFB 4H5SB 3ZZLA 3FT2A 4G9FB 4OFIA 4QYOB 5IVXA 3CXSA 1O6TA 2CIKB 2X9XA 4DOHE 1MAKA 3L3GB 4OB5H 1J18A 1MWAH 5LKNA 1GJIA 4PJ9B 1NCHA 4WWPA 3KLSA 4JJXA 1F4XL 2FTAA 2YKLL 4RIRB 1K2DB 4Z7VE 1FNGB 4YE4L 4W93A 1KCRL 2WQ8A 1YEIH 4U6XB 3KR5A 1EHLL 3N5AA 4X7FC 3LHAA 4TSBH 5H84A 3JVGC 4PB9H 1D7BA 4FQ1L 1MN4A 4PRDB 1CVRA 3DVFA 3QXVA 3STZA 4Y5XC 4ENZA 4URKA 2CK0H 2YPVH 4OJDH 5ETUB 1YVLA 2NW3A 5ECJE 3WS3B 4FXGC 1H0DB 3MRJB 4L23A 3C5ZA 4NFDA 3MBED 5E6SB 3RAJH 1KTJA 5FXCH 5GISL 4KTDH 5T5FH 3G5WA 3EJUA 4H40A 4ZUVA 1XBDA 1PG7W 1I7ZA 3RGBA 3WEAA 4ZO6A 3RVVD 2FBOJ 3PXLA 4NGRA 2DI8A 3QUML 4TWEA 1YY9C 4NQEA 3STLA 4XP1L 2A6KA 1ED3B 3G5YB 4JY5L 4P2AA 5I75C 3DVNB 1T03L 2H0PA 5EU6A 4FNPA 3GMRA 3TONA 4R3SA 3W9DB 3X1GA 1E7UA 4O51B 1HCFX 4PN6A 3OX8B 3WC7A 1CLZL 1ZHBB 4KC3B 2FO4B 3T3ME 1WK4A 3SY6A 3RNZA 1BYOA 3DX0A 1AS7A 2MSPA 4KKLC 4YNYA 5EZJB 1OLLA 4RMRA 2WO2B 3AJ7A 1UM4H 3WL9A 5JW5A 3M1OA 2YD0A 4KO7A 1XF4A 3CN1A 2WWNA 4PY7B 3RTLA 2W65A 1K3IA 3VI3B 3HW7A 4NT6A 5J9PB 5HHQB 1RI8A 1M4DA 3FOLB 4HJEA 4AL8C 3DIFA 4ZAKB 5K9QI 4CSTA 3I75A 5GCNA 1GJUA 1KFAL 5F9WB 4PAZA 3TIDA 2WMPB 2I07A 3TT1H 5C07B 1JYWA 2Y72A 4WV1B 5MENE 3MV9B 1D5MA 1SRDA 1ZT1A 4HPOH 1DHKA 4DCQB 3TTHA 2VZ3A 3VJ6B 3D25A 1ZHLA 2CNMA 3HZ3A 4E9QA 3EHBD 1XF8A 2COQA 2XIBA 3O8XB 3UTTB 3LKNB 3IMVA 1SMAA 3TZVC 1P6WA 2H1PH 4Z7UA 1XMEB 1Q72H 2NUPA 3MRQB 1NANH 5D96C 1YW4A 3T9YA 4P9MH 3PEIA 1C5CH 1UXWA 3BAKA 2OSXA 4G2AA 2B5IB 5CHNB 3BN3B 3RA7H 1KDJA 3IPFA 5D4HA 3EYQC 2NZIA 4ONGL 2DRUA 1WTLA 3U0WL 3C5JB 4PGBA 1QYGL 4S1RL 5IBLC 5TF0A 4PS3A 4EJ1C 1S2EA 1YEEH 3TL5A 2CM6A 2UUDH 3WFBH 3BSHA 2GW5A 4M8QB 4GAJL 5KG9A 1A7QH 4G9FA 4ZS7L 4G3YL 1D5BB 5IVXB 1G6VK 1G94A 1OD7A 3DVGB 3PJSA 1NQBA 5PCYA 1A6ZA 3SYOA 2VDOL 1YEGH 3ZTCC 4CAWA 3T8XB 2HTLD 4ECNA 5F9OH 2JCWA 3BPNC 3M46A 3K6SA 4ZUTB 1VLXA 1R57A 3KS0J 4P2RD 1X12A 1G43A 1INQB 3F2LA 3TS8A 4XN5A 4IOIB 1CR9L 2EC8A 2D31A 4WUUB 1TNMA 2CIJA 5B7FA 4YHKH 4FWUA 2W94A 4RMWA 1FFOB 1QBBA 2WWKT 5EO0A 3FHAA 3IFNH 5C3LD 3G3LA 5J11B 5C7XL 4CAFA 5D55A 2VSCA 4A33A 5GRXG 2EVFA 4X7SL 3WIHA 3WN5B 2FQEA 4ZSOA 2Q86B 4MMZC 4JMNA 1AOZA 4KO6A 5KS9A 4MAYD 1I8MB 1WIPA 2DJ4A 1W8OA 3TO4B 4G11A 5ES4B 3LNFA 5DLLA 2YRLA 4JFFB 4Q9QH 3PHQA 5E8DL 4QKTA 5IFJA 4OH2A 3WY2A 3HBQA 4TPRL 5E8NA 3W5MA 5E5MB 1GCFA 1Z5LA 1GYAA 2AK4E 1OSPH 4KS9A 1RHFA 5EUOE 1SDAB 1BBJA 1M1XA 4BQ9A 3BPCB 3FO9B 2DM2A 4NDMA 2A0LD 2DQUH 4LVHB 2HP4A 3BIKB 2QQKL 3BUIA 5FFOA 5EO1A 2FX8H 3B5TA 3OMNB 5JW4R 1IGIL 4UEFA 1YPZB 2IALA 3K9TA 4XCFH 3I6LD 3O0LA 5FA3A 1YEFH 3HZKA 4BZYA 3CFEB 3OR6A 5I1HH 3ZJ0A 2H5UA 3X3GL 4TLSA 5F7MC 2WXLA 1D5RA 2X4NA 2G30A 4JLYA 3SE3C 3RWFA 3EBAA 2VDOB 1YQVH 3HNTL 2LE9A 3QJVB 3G5YA 4Y4FA 3TO2B 1JK8B 1XFPA 3NA9H 2VUYA 4IOSA 3D51A 4NENA 4YUEH 4L9LB 4MQ7A 5CLYA 2R2CA 4NUGH 3ETBJ 3T3PF 5JW4Q 3C6LB 4WJG3 1U42A 2CF4A 1SZNA 4K8RL 1KJVA 3FCBA 1CGSH 2BY1A 1NUNB 4EKJA 1WWBX 4N2CA 3BZ5A 3TC9A 3O8XC 1WZ1L 2CRIA 4M03A 4H8WL 4H6UA 2PYED 3EC4A 1N5YL 3FO1A 4KAQH 4G6MH 2I3CA 1B4JH 1H3VA 1HNFA 1QSEB 2J88H 4QIRA 5HHVL 3VXUB 3WJLA 3K6IA 3C08H 3NIFF 1EHNA 4ELMA 1FWXA 5TE6H 1L4IA 1AC0A 4KHXL 2SODB 2ZOKA 2OMYB 2K8QA 3CIQA 3PL6D 3OBAA 3QUKB 3TBWB 1DLFL 3SXOA 4WW2B 3SN6N 1G4MA 4OCRH 2E7CA 2K45A 2XG4B 4H2CA 2HKFL 1D9KB 1BIIB 2P8PA 3IWGA 2HKAA 1A7NL 2H32H 2EYRA 1K4DA 4C8XA 1T2QL 3O0RL 4J6RH 1PX3A 5SX4I 1HL4A 2A3TA 4CDGC 1AGFB 5GJTL 1AG6A 4OF5A 1I9IH 2MKLC 5CD3A 3D4YA 4HNWB 3L95B 4OD2A 3AFLA 3IN2A 1A64A 2O6DA 3GUTB 4U3HA 5EOCH 5T1KD 5LCVA 1NKGA 5J1AB 3TBSB 1HHJB 1BD2E 5AVTB 2XN9B 4FG2A 4RETB 4EFDA 3LZFH 1G0DA 4XR8C 5HI3C 4YGOA 2XJLA 3BAJA 5AZ2L 2DQEL 2JKNA 4AM0A 1BQRA 4BYHA 2WUBL 2X88A 3F7YB 2QQKH 4EI6B 4Y4KC 1G7LB 3BUYB 4GXFA 3L81A 1WO2A 5BRPA 1HHIB 4Z3HA 4EVNB 4NGQA 1NLBL 3V0HA 3KEHA 2P80A 1AMPA 3GRWA 5GS1B 4K5NA 3L4VA 3U9WA 1I7UB 5A6IA 5CEYB 4URTB 5TPWL 4X6EA 1P7QD 2P6EA 1P6FA 1D9KC 5J6GB 4PJ5D 2H9GB 4XMLL 4LIQE 1RSYA 4BWUA 4XT1C 2K6YA 3ML9A 4F3FB 1URLA 2X0WA 5DYOA 1CL7L 4B27A 4KSAA 3CHXA 3Q8CA 1FGVL 5BZWB 2Y0MA 5GS2D 5A2CA 3MJWA 3RVVC 2C5DC 3JTTB 2YNEA 3D25B 3IDIB 5C7XH 3SJXA 1WD8A 1MNNA 5CJ5A 4Q9RL 2OBGA 4LEEA 1KCSL 2FIKA 4F2MA 4UQBA 4GAJH 2EH7H 1SQMA 2MQCA 4B5OA 3KXFD 4KH2A 1U0QA 1UQSA 2P52A 1LRZA 2F7VA 3KPSA 3U46B 3MGOA 4FLSA 4D9RD 5D1XD 2CDEB 3SPHA 3BI1A 1R3IL 4MJIB 4DPBX 5H4ZA 5I1LB 2EIBA 3RWFB 4BD4A 5DRXA 4EXKA 1K4CA 2VDLB 2VLJE 4XXCA 1F5WA 4Y4FB 5D93C 1J5DA 3HUJF 4OUUB 4P57A 3IVKB 2VBQA 3PABB 2J8UB 4X4ME 4A7GA 4G8GE 3VVWA 3QARA 5F2FA 4YDLC 3PNWA 1KGXA 1IB1E 2XXMB 3RRQA 4G59C 3LZQA 5E6IA 3B37A 1M6UA 4YVUA 4PMEA 3FCSA 3F85A 4AZ8A 2QSTA 1KF9B 2ARWA 3BWSA 5LUMA 4MKMA 2F8XC 2W59A 3D52A 5C0BD 3EO4A 4CGMA 5TQ2H 4MJ4A 4AE0A 1E6JL 1LDPH 2NY5L 2UXTA 2SEBA 1A02N 3HCVB 3IWVA 4F92B 5HVFA 1ZHKB 4JFDA 5D4JA 4DQOH 4XN2A 1MEXL 1AG0A 3FCTB 1LO5B 4MJ2A 5F97E 2OXHB 4TM9A 1JYNA 2Q04A 3CX2A 4ZSOE 2CGYA 3NAAL 3BO8A 4LHQB 3AWGA 5DHVA 5FUOL 4OF8A 1QWUA 1Z6JT 4GRWE 5CLXA 1JWSA 2XKNA 2V5YA 2ZNWA 4G6AD 3US9A 2G3AA 4IRSB 3EDDA 4MNGE 1NMBH 3AM8C 4P5RA 3RNQA 4JFQA 2EK8A 4OV5B 1UWXK 3ETBF 4E41B 5DEFB 1CLVA 1JTTA 3CFTA 3MRRA 4EDXB 5A2IH 3W0WD 4H89A 1U6AL 4MD0A 2R69H 1DN0A 4O02A 3SDCC 3UMNA 2AQ2A 4F58L 4S0HA 4OCNC 4JCMA 4ELKB 2PXYA 1TIQA 2OMYA 2BIPA 3BWUF 5DFWH 1A7OL 2WNKA 1T03H 1Z9OA 4IKNA 3LNHA 4ZXBA 2JQAA 1U3JA 1YQ2A 3C12A 5EZOL 1UG9A 1PY0A 1DBJL 1M71B 3P54A 2Q4YA 4BFEA 4N2NA 1NCOA 2YXMA 3F58L 4XX1E 2RGSA 2BSRB 2ZG1A 1AGEA 3PGCA 3QQDA 2WBJC 1NUFA 4NEHB 1JFQL 3FK3A 2HJKB 1IM9B 2WXHA 2Z11A 4RGOH 1ARLA 3N5FA 2R4RH 1I8KB 4J8QA 2GJ6E 1HHJA 1IE4A 2AQPA 1DUZB 1KXQE 1S5HB 1Q1JL 1HKLL 1IC1A 1ZA3A 3WMQA 5E23A 5I0CA 2QSCH 4JQXA 4ELDA 1I3RB 1KLGB 3NP4A 4KTDL 1ACYL 3CBKB 2DQ6A 4JL2A 1UD8A 2FJGB 5IB3B 4P23B 4Y5VC 1YYCA 2VXQL 1IGIH 4J8RA 1FNLA 1V0CA 1EERB 1E8WA 1MI5A 3KCPB 3RGVC 5C09A 1SN2A 3AUWB 1F57A 1I9RH 8PAZA 3LZNA 3FH5A 4UQIM 3BYTA 3WY3A 3IBEA 2FQDA 4YSUA 4FXKA 4AVIA 3DI2B 4XWOC 3KI9A 2ZOKB 3QR2A 3AREC 2AGJL 5AG4A 3V9FA 2H9GA 3GHBH 4A04A 2FT7A 2HRPH 2OMWA 4E5XB 3CZJA 5AW0B 5FYKD 2B3IA 1GH7A 1KC5L 1LO4H 1UGNA 4QBJA 4JBSA 3H7BB 1B6UA 3H2PA 4N68A 3UTSD 3JUWA 2OJZH 3OKEB 4ADJA 1ZTXE 1OAJA 2ZX9A 3OKYA 4B0MM 1D5MB 2AJYH 4QTFA 4G80B 4BIKA 3IWEA 2OR9H 1AKPA 4WUUD 1HSBA 4GW5B 5ICXA 4XI5D 2MQ3A 2EYSA 5MEND 5J1TC 3CPLA 2UWEB 2DH2A 2P5WE 4PJ9C 2KHAA 4YLCA 2B77A 4APQA 3C8DA 3RUGB 3VFRB 5I30H 3OJDA 1YUKB 2NY7L 4QHKJ 5DK0B 5IB4A 4CBZA 2NR6D 3T2QA 2B3VA 3MNVB 2BLFA 3E6HA 2XRAL 4M5YL 1ZHNB 4Y9BA 2Z31B 1ZE3C 1YAIA 5SWQA 3U9PL 5I15L 1VKXA 1TF9A 1NPNA 2EDXA 1K6QL 3MI6A 1CBVL 1H3PH 2QMKA 5DO8A 5FM5O 3N44F 3PNWB 2HH0L 3I2CL 4DNLA 4AKQA 4AEHH 1S7LA 4JKMA 1OAYH 1RLBA 1BREA 2VXTH 1IQDB 3EF4A 4FFYL 3ULVF 1G9HA 1U3NA 4ZZKA 3OKOA 4NAQA 3IB4A 1CIUA 3U0WH 1U8PB 2LLNA 2R4SH 4LHUD 1KYAA 5DJAA 1F1AA 2Y1AA 1KPUB 1KYOK 4HIJA 4PB0L 1N68A 2GIXA 4ZYQA 3OF6A 5I1AB 2VABA 4AK2A 4R4ND 2NMSA 1SJEB 4GAYB 1BQHA 1JF1A 4GUPA 4MASA 4PJFA 4QRUB 3HHMA 4O4YL 4F2ME 1I8AA 4Y49C 1XGTB 2YKKA 1WJ3A 1X5IA 4WI2A 2IBGA 4HSAC 3WN5A 4YEEA 5J12B 4IS6A 1IGBA 1XRYA 4Z7OF 2A9NL 2KLTA 5L88L 2D4OA 3KYKH 1DQKA 3T4YB 1UM6H 2VM4A 3MUHL 5IQ9A 2JBJA 4JRXE 4MNQE 5LO7A 4H20L 2VZSA 1DFBH 1FNEA 4BZ1L 4DP5X 1TJXA 2E47A 2A83A 3G5VB 4K9EH 4WJ5A 4Q9CA 5F7LB 3RPBA 3FJUA 4WFED 5ESQB 1NGXB 4PGCB 2XVKA 1NCTA 1K4CB 1ZANL 1MFEL 1F6AA 4PJ8D 5DVMA 1LCPA 4H0HB 2K78A 1OAZH 4F7EA 5CGTA 2KUTA 3K2IA 5I6MA 4YR6A 5DJ6B 3GMNA 3BEVA 1Q2CA 3FEEA 3DGGB 4D2NA 4HX1B 4AG7A 3RDJA 4O9HH 3MC0A 4XPFH 4ZX9A 1MFUA 4R4BB 1LP9B 3RY4A 4AEHL 3RUGF 4S0TD 3OJVC 4OLXH 3P4OA 1ZMYA 4XNXH 5KVFL 5AW8B 5HVWA 4KGLA 2AMUA 4CU7A 3ZDYF 2QPEB 5I1GH 4NJAL 4JRFA 4HMEA 3UY5A 2DEAA 4ZOBA 3COOA 1WBXA 2AABL 4XNQB 3H9SB 1I21A 4XXWC 2O61A 3U30C 4UIKH 4DO5A 3U36B 5HHPB 4NGMA 4PRPA 1KEGL 4LNVA 1KTDA 4FULA 2XTJC 3SBWC 4XRCA 5LYIA 4U6TA 3VTTA 4MHYA 3NSXA 5F7KC 3EJJX 2ZEFA 3V55A 1LVEA 1PCSA 4PVMA 4X7DC 4GB9A 2V17L 3N85L 4J8RB 1JQGA 1P4BL 3SDXF 3NJGA 3F8KA 3K2UL 1D3CA 3SZ6A 3DX9B 3L3OC 3E6FB 4FTVA 3WKPA 1NUGA 3RWIA 1E43A 1SEBB 2XWTA 3POCA 2HG0A 1ND0A 1YUHB 4XPGL 3K4DA 3O9WA 4E9XA 4IMLA 5CLWA 3QS3A 1EZVX 3V6OC 4MAYA 2FNWA 3WSQH 4J3TA 3CC5B 4O02L 3NH4A 3QUMB 5IB4B 2CZNA 4YHOH 1FG2A 4H20H 2VLRB 4WW1A 1IX2A 2I7OA 5I1KH 1W6WA 4L3CB 5DF0A 4ZAKC 2FUQA 4IEFA 5H37G 2FE7A 4M5TA 5D1QD 3RBSA 5SX5K 3V5HA 4OGXH 4KROD 3SY0B 1ZXQA 3IDNA 3SDAC 1D6VH 4JRXD 1XH1A 4WWKC 4X9IA 4PRIB 5EIQA 1GYCA 1QRND 2ODHA 5FA4B 3RI5F 2BNRA 5DLML 4B0MB 5LRGA 5EUKA 3BI0A 5DC0A 5I19H 4WFGE 3LPOA 3KPRA 1WV7T 2H26A 3LIZH 4EI5A 1ML0A 5J1AA 3MCYA 1VESA 4HIHA 3MXWH 4PY8I 4JPVL 5DHEA 2ZWZA 5T1DH 4M7JL 1AZZC 1OF2B 2WBWB 4RGOL 3VG0H 4HIJB 3SO3B 5JPMB 2CPUA 3KWVA 5C0ND 4WFGD 1C7SA 2G5RA 1JGUH 3PP3K 5CCJA 1RZGB 4N2EA 4IBZA 1KEML 1SEQL 4JPIB 1CYXA 1OCCB 3MLRH 1BDYA 3MLUL 4MY3A 2APTA 2YPVA 2XEIA 1DUYB 3Q5YA 1XMBA 2PR4L 3KHZA 3JWOC 1IY7A 4RA3A 5ABZA 5FF6A 4RCAA 3JV4A 2ZUTA 4G1MB 2WZAA 1CXLA 2CLRA 5JXEA 2Y5EA 3K1DA 4AC2A 4ZTPL 2C7UB 2XXGA 1FVEA 3ZJAA 3H8EA 1U91A 1WAEA 4KVCL 4MCYB 4LARL 5FGCE 1QSVA 2UXFA 3DBXB 1PLGL 4KK5D 4HZAA 4F8ZA 3S6KA 3AS2A 4MA8H 1M4LA 4LP4A 1OZTG 3KPNB 2X05A 5C6TL 2WY3B 1MW2A 5FCSH 1W91A 1Y0YA 2XA3A 3WFDH 2G0BA 2DYPA 2PJCA 2BP3A 4KX9A 2UWEA 3ULVC 4ZY1A 1OEZW 3LKSA 4NQDA 4PRHE 3OTTA 4R4BA 4JZOA 2NSXA 3RHWK 2EC9T 2V8VA 1G7MB 2FWOB 3RIAF 2JTDA 2IH1B 1F42A 2Z91B 3I9GH 3UL4A 3CPUA 1FZJB 1GZHA 1W0WB 4ZMXA 4YDJB 2HRPL 1OIOA 4HHAA 4P2QA 1GGUA 1YG9A 5FYJD 1ARMA 1SF3A 3SIKA 2N4IA 2XZQH 5CKAA 1QBLH 5CILH 2WLLB 3EYFA 3VX1A 2XXFA 1DBML 2JVUA 5A2BA 5KSUB 3H9HB 3DARA 4O2CB 3GMOB 4UNIA 1NGQH 1EJOH 2AEQL 2KYIA 3WXWL 4DOHB 4F33B 4JY6A 4P4KA 1DANU 1NMCC 1GC1C 15C8L 1JJUA 3QG7L 3RX8A 5IJVB 4XZUA 1GGTA 4QT5A 3SBWA 3U82B 2APWA 4ETQB 1MCRA 1F58L 1O9VA 1QAWA 1L0XA 3FUJA 5B4MC 2DWDA 3WNJA 4GNKB 3GYAA 2OXGA 1T22B 2OJEA 2HFGL 3E1F1 5EC1A 1U8NB 2GB2A 3CSTA 1UH2A 3INOA 1WFOA 1L9RA 1TCRA 1I8IB 2TAAA 1NEUA 2A4CA 4MMYB 5GSRB 4KQ4L 3MBWA 1P4IL 5K9JL 2KT6A 3D85B 3MNMA 2ROYA 1NPUA 5KBLA 4YDZA 3SI2A 4X4KA 4ZPTA 4Z7QF 3VI4B 4AL8L 3T6QC 3SPCA 2BCOA 3WD5H 1BQSA 1KPVB 1VFUA 4TNVF 3HPJA 4LE8A 5JZ7D 1DBAL 2KERA 4UUJB 4Q38A 3RX5A 4UF7C 2NY4B 4PGCA 4PG2A 3GGWB 4M48L 1F6AB 5L4IA 2GFBA 3BPOC 5ADPL 4JHBA 5ESVA 3UFIA 5C0RL 5I9QC 1PG7X 1UZ6F 2G60L 4KROC 1MCBA 2LLLA 4WEBL 1KYUA 1V5JA 2ZT9C 3F62A 4Q6KA 3QDJA 3PAZA 3QORC 4OVUA 5CIPB 4PRPD 5B3JF 1YAZA 2DEWX 3VM7A 1TKHA 2GT9B 1KWKA 1MXDA 1XB6A 3WTSA 3A4DA 1TMQA 3GSNL 1OGAE 2NQDA 4M8QA 5FUOH 2B4DB 1K5NA 4POZD 2F7PA 4JAMA 4KFMA 1LEKA 4HUVA 3Q2NA 4PJCE 4XN9A 4LF3B 4OLUL 4P5MA 4WO0A 2Y07L 1MEXH 3WHXA 4XC3L 2ZCZA 4WWID 4CN4A 1E0OB 3UAJC 5IFHL 2E0PA 2JIXB 2EP6A 1SHXA 2HV2A 3CZEA 3EH5B 5HHPA 4EWTA 2BH0A 3ARDD 1M9SA 1JZIA 3ZE0E 5CJXA 3ABGA 3A67L 1QNZH 4YSTA 3C09C 4GRLB 2AFXA 1A7PL 4BFFA 3ZR6A 4Z5RB 4JRXB 4QOKD 1JXGA 4XP4L 3ZZ1A 4J6RL 4L3ED 1T2QH 2BXZA 3O0RH 4AJ0A 1KWMA 2NZ1A 2BZ7A 4FJZA 2JF1A 1NAKL 3DDDA 2WBKA 4OC2A 1J48A 3LTVA 3QUZA 1CU4H 3GIVB 3ARBA 1HYRC 1RUKH 1MRCH 4PRDA 2F58H 3ARBC 3JWNG 3S4SA 2HYMA 1NIBA 4ZO7A 1R3IH 2DJUA 1TQBB 3VGDA 4ZAKA 4NUMA 3L1FA 5IVXF 3FBUA 1BX2B 4MDJB 4MD4A 4UQAA 3JVFC 3LRSB 3RIKA 5BS0E 5ESAA 5JIIA 2FZ3B 1DBAH 2I32A 4N85A 2ZUYA 4L18A 4XMPH 4KZTA 3ET9F 2HMID 3T77B 3KE0A 1JPSL 2OK0L 1CD8A 5D1ZC 3L3OB 1CP6A 2YA0A 4XCYB 3PB6X 2EYSB 3D85D 4K94C 4LSRH 3BIKA 4PEEA 4PTUB 2BSWA 1EZUA 1CL7H 3I84A 3FRPA 1RAMA 4TS6A 3AC0A 4N0FA 2YD9A 4P2OB 4NQSA 1OALA 5TF1L 2Q8AH 4HIQA 1S46A 4AITA 2PJAA 1FZKA 4MD5B 4HXAH 5D6CB 5EC1B 5IMLB 3OLEA 4MHHG 1XF3B 2VQTA 3NCBB 4OCSH 4BELD 4BBWA 4E0AA 5DT1L 2OSWA 4GG6A 4ZY0A 2VZZA 2KMWA 4R0LC 1JHTA 4DETA 4BUGA 1LXMA 2JI1A 1JGVH 3SJEA 3DJ9A 1L9OA 3TBCA 2D7MA 4TVPD 3QIBB 4JM0A 4Q4EA 1BQ5A 2VLRE 3P77A 3PUCA 2ZUQB 4WW2F 3EADA 5TGBB 2OMXA 4FQHB 3EYSH 3TIDB 4DEPB 1RHHA 4FFWC 4QHKI 3AVEA 4R4NC 5HVHB 4KVXA 3BE1L 3FN0L 4CGNA 3ESOA 2APFA 1OT2A 4RGNE 3ARDA 2MTAA 4DF9A 4Y19E 5SWZA 2F54A 5FOBA 5TDOB 4GXUM 2F8HA 1C1EL 4FFZH 5DC4B 4MWFA 4OIDA 1S7SB 4JFPB 4K94H 4EUPB 2HG5B 1XH2A 3SGKA 4LK4A 2A0LC 4C54A 5EO1B 2J12B 4F8OA 2AEWA 4GRMA 5MP6H 2KKQA 1D5ZA 4Z8FH 2NW2A 2QADD 3F6LA 4PJXB 3MX0B 3RL2A 5KVDE 3R96A 3QUYA 1UM5H 1M44A 3WTVA 4P2QB 4X6CF 3QXAA 4OCRL 5GGTA 4LARH 2IDFA 4MB3A 1NGXA 3VWDA 4JLRA 5E8NB 1J86A 4DKAA 5G5DB 1EXHA 4JR9H 1QEXA 1BG1A 3HC2A 3IKCA 5CJOH 2XZAH 4IRJB 4NWUL 3DX6B 4HUNB 3UX9B 1RTQA 4YDLB 3GSRB 3V4VL 1TF4A 1MH5B 1SOQA 4QRRB 2JKTM 4YSEA 1AR1B 1XFOA 4PD4J 4BQ8A 3BHBA 4MKTA 1J5OL 3T04D 1OZPA 4ICWA 4QAWA 3KKWA 2HFEA 4WI4A 1N59A 2VUOA 4MCRA 4YPGB 1YC7A 1ZIAA 1EZSA 2CUHA 4QUOA 4QRAA 4K07A 4ZFGL 4IKJA 1NIDA 2A1WL 3RWDA 2ENQA 1JZ4A 1IICA 5I8KH 1NE9A 3N41F 4WNJA 3PHOA 2FATH 4Z9KB 2C9QA 3FAXA 1ZLDA 4GBXB 1YQVL 2NY6B 3HNTH 3ARXA 2IOOA 4LRIA 3U36A 1J8RA 43C9B 3KR4A 4FD4A 3BCFA 3V4PB 1FO0L 3SD2A 3ARBD 3WY1A 4FEMA 4G83A 3BLNA 5EU7C 5I1DB 2CO6B 1A2YA 5KVEL 2NCMA 3N44B 4L4VA 2F1BA 2PF6A 3LZLA 1RIVH 4PHXA 2Q86A 4ZSOB 1WWWX 3NZHL 4M6GA 5FGSA 2VLLB 4XXWA 4IBYA 2XA8L 4UOW0 5E5LA 5FEBA 4NQCB 3SQOH 2B4BA 1UEYA 3C5ZD 3DMMB 5ACMA 4JPWH 3QHFL 3IDYB 2AMGA 3ISYA 4XN7A 6PAZA 3SQBB 4YL9A 1OT1A 5DVLA 3RVTC 4UT7L 4XH2B 4Y2OB 2YO3A 5GZNA 3UDWA 3CC5A 3OAZH 2WPWA 3PE9A 1E2VA 1ZTMA 4P3WA 1E4WH 1Y07A 3HNSL 4GS4A 4DYOA 3PGDA 4UQ9A 2IV8A 2WCSA 5D2NE 4NN6B 4OJEH 4M3KB 3OKDA 2HN7B 2NY3D 4KXZI 5G55A 4XNHC 2IALB 3NFPA 4H13C 3RVUC 5CD5C 5AL8A 3FECA 3LPGA 1Q2YA 3UJTH 4PJDA 3VRIA 2BWQA 4NCC1 5IVZB 4H1LG 5E2JA 1JHTB 3Q2LA 2HT2C 2DQFB 3PAYA 1EHXA 4M48H 4QF1B 3TEYA 4NNXA 4R4FL 4QRTB 2JV6A 1VSCA 5C0EB 4PG2C 5K93A 3SOTA 2FYYB 4R7VA 5LGHH 4WWKA 2P42B 2IWKA 1S7QB 3HCVA 2OZNA 5HVFB 1RUML 3L7FA 4I4WA 4KXAA 1YLOA 4WHYH 1KJ2L 4YIQA 4Z7IA 3QXWA 4F7MB 2Y3AA 2M8XA 4ERSH 3HI5L 4FHBD 3DROA 2QPDB 2OFQA 1AJ7L 3F6JA 2GBAA 2FO1A 3PAUA 1WBYB 2PVWA 3A21A 4XC1H 1W15A 4P3DB 3SCMC 4XCNB 2V8DA 1QYGH 2LTQB 2XI9A 3MRDA 4S1RH 1PVHA 3D8MA 1RXLA 3P4NA 5CR8A 5ACZB 2CA3A 3HR5B 2ABZA 4R8FA 4MMOA 1CGWA 4JFHE 3W39A 3HZYA 3QH3B 2ZF8A 8CGTA 4PIRF 3WGUB 4DPAX 4MHZA 5D1XC 5E2TH 2J4WH 2YAQA 4NQEB 2GC4C 3STLB 3QAQA 1KGJA 3MV9D 5FWRA 3HTLX 2J73A 1ZDQA 4LAQH 2B4CC 2VSDA 5E9AA 2BIQA 5JPNA 3HA0A 4MFKA 3O3AB 4EUPA 1YEKH 3EUUA 1OW0C 4HQQH 1GGBL 3SDAD 3VVVA 5J8CA 3ZY7A 4PYGA 1R24A 3UZEC 4Z0XA 3NFZA 4U05A 3LKRA 3TT1L 3V6OA 1QTYT 5BOZG 3D87B 2X4PB 3PGFL 5GS0L 1UA7A 2DI9A 2ZKHL 3JVGA 4A6YH 4MMXA 1N2RA 1TYJA 4MLIA 4KK9C 1FL5A 2G9DA 4GAFB 5I76A 1L6XA 2HTLC 3UYPB 4FS0A 5HD8C 1PZAA 4EQ2A 2WIIB 1D6EA 3LODA 4CVZB 4OIIH 4CGOA 4XXDA 3O9WD 1FL3A 2P8MA 5F89A 3AW5A 1T6VN 1TVHB 5BQ7A 4KU1A 4Q6YA 4A38A 1EEYB 2DYPD 3HRPA 3S5YA 4MA8L 1EEZB 4HG4J 2ENJA 4RS2A 4WV1A 4B9KC 4YHLL 1MI5B 2E9JA 4H8WC 3EYVA 4NXKA 5LBSL 2LFEA 4YZFE 2HLFC 3VRJB 2V37A 2IH3A 1TJMA 4ONOA 4F3FA 4MA7H 2E6PA 4HZLB 4HS6B 4NKOB 4Q8BA 3GXMA 1RUAH 3W1ZA 5CBMA 2R2HB 1IIKA 2NY7H 4MFQA 4Q4IA 3MBEB 2PCUA 2YPLD 1NSAA 3DX2A 4YSQA 1YECL 3RVTD 3MLZH 5D1XA 2D7TH 2WVVA 2CO1A 4JCLA 3H2QA 5EF3A 2Z6FA 1XL4A 3VI4A 1JV2A 1PJ9A 1UZGA 3BGFC 4G80A 2YLKA 4PSPA 1CXEA 3CLEL 4A7QA 3MJGX 3LMJH 1NBVL 1SBBA 5H37H 3V6ZB 5HPMA 1ZT7B 1P4NA 3FMGH 4YSCA 2F7IA 2R8SL 5I1LA 3K9UA 2EIKB 3AZUA 1NL0L 1PZ2A 3CFIC 4M6NL 3US1A 4IW4C 4NRZB 4DKEH 2R69A 4O02H 3AQXA 1DJXA 1GR7A 4EI5D 3WSQL 3P9MB 1Y9KA 1U4EA 1X6LA 3H5ZA 1OM9A 3K72B 4PCSA 5C0JB 4XO5A 1YYML 1JWQA 5EA0L 4IRZL 4AQOA 1P7QA 2LU5A 1JN6A 5EF1A 4NQCD 4DJMA 1TT6A 4IBVA 4PJHB 4UTBH 1SVBA 2VDNL 3DJSA 2I5YH 3KCPA 4HJTA 1X5FA 1LO2L 3BESR 3B2DC 1K5NB 5C86A 2BNRE 4UINL 1C08B 1T7ZA 4N8VB 4YHOL 4JRYB 2NNRA 4OIBA 3CZUB 1U3ZA 3QPXL 2EH8L 3G6DL 1Q7LA 5KSAA 4OAWA 4U33A 1CN4A 4NNXB 3ULUL 5BXFB 1CF1A 5AVWB 5H4YA 1DSFL 3LMJL 4R96B 4X6BA 3KYNB 2AJ3B 2WQSA 4BA0A 2P8LA 3FQNB 3TZVB 4A7GF 3GUXA 4MCZA 3R7RA 4M29A 3DUHA 1MCPH 2BIIA 2IPTL 4OLYH 5TDPB 5LN4A 4ZX8A 3TU6A 3ZGIA 3N7ZA 2PWHA 3WNNA 4N5ED 1MW1A 1OTUD 4NO3A 3X1EA 3ZDYE 1OTSD 3QT2A 5DYFA 1CFMA 3CVDA 4K5OA 1IRAY 5DD6A 1R33A 5TE4L 5CN3A 2X3CA 2R0WL 1J9RA 2VN5A 2YFOA 2V2WA 2DXQA 1I7TA 5JZ7C 4X5WB 1OAZL 1KUXA 1PZ3A 1X5GA 4C68A 2ENSA 4NJAH 1UT2A 5I1GL 1ZCRA 3EHBB 5F7EH 1IMHC 4N6QA 1CFVH 4WJ5B 2WO3B 3IAPA 3U6XA 2F9BT 1HXYB 3LDBB 5C0FB 2CJUH 3PL6A 2Q3ZA 3WCYA 3WAJA 3IKKA 2JWYA 4Y9CA 4HCGA 3GK8H 1G84A 1E5UI 1CXKA 1IOFA 3A4FA 5HJBA 4JXRA 2ZNXA 5J1QA 3TF7C 5IOPA 3GY9A 4KKPA 5JW3L 1BWWA 1CQKA 3V4LA 5H2BB 2JKWA 3QB7C 4TUJA 3PGFH 5GS0H 1D5IL 1G9NL 5D1QE 1BO4A 4PTTB 1FL5B 1TJHL 4NIKB 1JG9A 2N1TE 2WUCL 4DGVH 1BXXA 1RIUL 1Y9WA 4PYHA 3UTZA 4WFHE 5AW7B 1YEKL 3D2MA 4MTMA 2F6AA 4NNYB 5FM4A 3ZE2F 5ELIA 3QO1B 1N19A 1PFCA 5KYWB 4QYOA 4RNRA 1XB3A 2DM7A 1PBYA 3BH9A 4OZIE 1OGSA 2NDGA 3BKJL 3SKMA 4PBWD 3HS9A 2CJUL 2YNCC 3LH2H 4JFSA 2RIKA 3HJEA 3KCWA 9CGTA 4UZGA 5GIRA 4UMSA 2OR8A 4N8UA 4PHZA 1MCQA 2YJQA 4FD0A 2X70A 4HS6A 4PBDA 2D4DA 5JDSB 4XPHL 4NXYA 1NEZA 4L8SA 5BO1L 2MPAH 4MAYB 5HHXL 1OAYL 2VXTL 3AITA 5F7AA 2A73B 3UC0L 2O1AA 1H3GA 2NQ3A 2VR9A 3GM0A 4LMQE 3LIUA 4QJ4B 3AS1A 4HX1A 3S34H 1G7JA 4OTXL 4QRRE 1IE5A 2G4GA 3JZYA 5LB1A 2QFPA 4YHPA 1OCWL 3QFGA 3U7YL 4N2KA 3WJLC 3HG3A 4DK5A 3BT0A 1RURH 4NWTH 4RMSA 2P5WA 5DD3L 1GHFH 4PJDF 2ALAA 5HTSA 3KH3A 4AGNA 4DO4A 5I6NA 5EOQH 2Q9OA 5K9QG 5IG7A 2ZX7A 4X5QA 2IC2A 4KY1H 5GS1C 3NK3A 5ADOH 1U30A 5INCB 2VC2L 4XMWA 4G6JL 4KI5F 1XV8A 4YDIL 5J6GA 4G6KH 5KSBE 4QMEA 4NGSA 4BV1A 4EPSA 1OAXH 2XACC 1P7QB 2V8GA 1H9VA 3P4OB 4C56B 3RU8L 3FO2B 4S0SD 4K3DH 1BVNP 5CZXD 4D7BA 3PWPE 4UOQA 2VDLH 1S5IL 3OQRA 1M6OA 4NBYB 2ZCLL 4D8PA 5IR1A 1N71A 3RZWA 5JIKA 3U4BL 3TT3L 4HK3N 2WXFA 1IM3B 5KVEH 4PXCA 4NT6B 5AVRB 1MLCB 1RSFA 2FL5B 2FSEB 3W5NA 2FWSA 1HKLH 2E9GA 1I7TB 3ARQA 1URZA 3NCMA 7TAAA 2K5TA 5I4MA 4J6IA 3TWCL 1UD3A 1JPFA 2CDEA 3EJZD 4TUOB 4CKQA 3DLJA 2HCZX 2PJ4A 2CIKA 3LD8B 3QIUC 3TYGH 3DRQB 2MRYA 4HT1H 4M4RA 4XB7A 4Z7VB 5AAPA 3HC0A 1NM4A 4WO4C 4X4ZA 3O3DB 5AVYB 3SCMD 1EEQA 3OAUL 2FIAA 3P4MB 3AG2B 3GSOB 3HZMB 4JZNA 4LQGA 3QWRA 1BQLH 1HDUA 4N90D 4LRNL 4PWFA 2J2ZA 4ODSL 4XBGA 4XAKD 5BRZD 5JMRA 5EZOH 5L2KB 3EFOB 4G8GB 3LNEA 2D7NA 4C2YA 4PWKA 5AENA 3H8GA 2R39A 3DSNA 3VW3L 4GI6A 4PP1C 5DDHA 3MFGB 5HPOA 1IQWH 1GAFH 4XTRD 4U3XA 2YQ2A 4YHNA 4HLZG 1A3ZA 2HX8A 4OGZA 1NCCH 1N64L 4PREB 3EG9B 5I71B 4PSXA 1J1XH 1SXAA 2E75C 1J5IA 1HCYA 2C3VB 2VW6A 3KPSD 1KLFB 2OMVA 2EDMA 3EH3B 4YXHH 4WTZG 5I73B 4HC1H 2Z4QA 3GXFA 4UOZA 4ZMOA 2D3JA 2K70A 2O28A 4PJFE 3V5KB 2NXZB 3V6FA 1QFWI 2D9QB 1YREA 4B13A 4PS7A 2AZUA 2PYEB 4GQ9L 3RY5A 4QXUH 4HIIA 3QEQE 5HY9A 3LEXB 4PGEB 5KVDL 2ZOWA 2Q20A 3P2BA 1SLVA 1LO0H 2DL2A 2D7QA 1HNGA 3D39A 3BAEH 4MAYC 1ZRUA 3B3TA 1XXDC 4LCWE 1H15B 4I5BA 2J6WA 5EU5B 3ISXA 1W8NA 4ZPVA 1NMBL 1SUHA 3HR6A 4E9YA 1P5UC 1IGML 3KZ8A 4M93C 5ANMB 1YYLH 4XNZC 3KLAA 3NGBC 4NI3A 2P80D 3VU1A 4CN6A 1INEL 2NZ9C 5CKGA 4XMVA 4F7TB 4ZJ9A 1JXJA 2CDGB 3U4AA 1FY7A 1N3NA 4F8QA 3ARWA