3MN8A

Structure of drosophila melanogaster carboxypeptidase d isoform 1b short
Total Genus 121
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
121
sequence length
391
structure length
383
Chain Sequence
KEDESFLQQPHYASQEQLEDLFAGLEKAYPNQAKVHFLGRSLEGRNLLALQISRNTRSRNLLTPPVKYIANMHGDETVGRQLLVYMAQYLLGNHERISDLGQLVNSTDIYLVPTMNPDGYALSQEGNCESLPNYVGRGNAANIDLNRDFPDRLEAQSRQPETAALVNWIVSKPFVLSANFHGGAVVASYPYDNSLAHNECCEESLTPDDRVFKQLAHTYSDNHPIMRKGNNCNDSFSGGITNGAHWYELSGGMQDFNYAFSNCFELTIELSCCKYPAASTLPQEWQRNKASLLQLLRQAHIGIKGLVTDASGFPIADANVYVAGLEEKPMRTSKRGEYWRLLTPGLYSVHASAFGYQTSAPQQVRVTNDNQEALRLDFKLAPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LP15968p
publication title Structure-Function Analysis of the Short Splicing Variant Carboxypeptidase Encoded by Drosophila melanogaster silver.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Hydrolase
total genus 121
structure length 383
sequence length 391
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2010-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00246 Peptidase_M14 Zinc carboxypeptidase
A PF13620 CarboxypepD_reg Carboxypeptidase regulatory-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1120 Mainly Beta Sandwich Immunoglobulin-like Carboxypeptidase-like, regulatory domain 3mn8A02
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 3mn8A01
4PXDA 3NFZA 1LFWA 2PJCA 4ZY1A 2QJ8A 1VIXA 1F2PA 1LOKA 2ZEGA 4ZY0A 4NGSA 4K3NA 2PJ5A 3CDXA 1RTQA 3NH8A 1XBUA 1R3NA 5AQ0A 3PB9X 5HVFA 5JM6A 4EIUA 4WI0B 1Y0RA 4R76A 4MXUA 5DS0A 2V8GA 4EMEA 1TKHA 3KASA 3IEHA 4OC2A 8CPAA 1XJOA 4NGMA 1FT7A 2EWBA 2ZOGA 2OR4A 2PIYA 2PJ8A 4H2KA 3NH4A 3G3LA 1R43A 3IC1A 2AFZA 4IHMA 4X8IA 2PE3A 3D7DA 3NJVA 3SJFA 3NJXA 2ZEMA 1IGBA 4F8ZA 4LQGA 4X2TA 5I4MA 4WJBA 3L2NA 4Z65A 2GREA 4B6ZA 2O4HA 2AFWA 3N5FA 4OC5A 3FVLA 5LRKA 3B2YA 3FEDA 5LYDA 2XHNA 2EK9A 3KZWA 2ZEPA 3BI0A 5CPAA 3KL9A 1Z8LA 1H8LA 4IK2A 4ZX8A 1ARMA 3LMSA 2ZEDA 3TC8A 2JEWA 4PXCA 3ISXA 4YOKA 3V38A 2HB6A 4ZX9A 1Z2LA 5K8MA 2BO9A 1TXRA 2CIJA 2ZEHA 3FF3A 4FUUA 4FBEA 5K8PA 2PVWA 4U3SB 4MCSA 2Q43A 1HEEA 2Q4ZA 4NGRA 1CP7A 2C6GA 2ABZA 3B3TA 3IIBA 3NH5A 4OC4A 2AFMA 2IQ6A 4UF4A 1BAVA 4ZI6A 3SI0A 3KCPA 4R8FA 4P4IA 3PFEA 4OC0A 1TF9A 1CP6A 4MHYA 4UEEA 5K8OA 3T8WA 4PXBA 4TNUA 4YU9A 4R6TA 2PJ7A 4NGNA 2VL1A 2F8HA 5IB9A 2DEAA 1BPNA 4OIDA 2POKA 4P44A 3WC6A 3H8GA 2PJ3A 2PRQA 3S9NA 5J1QA 4WWVA 3B35A 2C1CA 2QYVA 2ZELA 4NJQA 1CBXA 4P4EA 2XEIA 2ANPA 1YSJA 4NGTA 4MMOA 3IFEA 4ZYQA 2BOAA 4OC1A 4GM5A 2B59B 2PJ4A 3HLPA 1PCAA 2G9DA 4P4BA 4FL4C 2PJ1A 2V8HA 2WYRA 3K2KA 4F9VA 3KI9A 2WZNA 1YMEA 3PB6X 4ZY2A 2AFXA 2GLFA 3PRTA 2JBJA 3FECA 6CPAA 2PJ2A 3D67A 2O53A 4P6YA 3VARA 2PJAA 2ZEFA 1LAMA 1LCPA 3D7FA 2ZENA 4P4FA 2CF4A 3SJGA 2ZEEA 4A38A 3HN5A 1CX8A 2AFOA 3TX8A 3KR5A 4TWEA 1YW6A 4UEZA 4F9UA 1JQGA 2BCOA 2JBKA 4FAIA 1TKJA 1DE4C 5JH9A 1F2OA 1YLOA 5ELYA 3SI2A 1ZG8A 1Q7LA 1ELLP 3B3SA 5G5DB 4P10A 1CG2A 3WT4A 4EWTA 3PBEA 4EFDA 3NA6A 4JZ0A 3I1UA 3IO1A 3FX6A 1YW4A 3BHXA 4R7MA 7CPAA 4A39A 1ZG9A 1UWYA 3D66A 3S9LA 2PJ6A 3WABA 1XRYA 2I3CA 1QMUA 1XFOA 2ZEOA 4Q7AA 4PXEA 4A37A 2IMOA 1PYTB 3PB7X 4O23A 4P4DA 4P4JA 3FMCA 3D68A 3CPXA 3HUVA 1IY7A 3D7GA 4DYOA 4FWUA 3QNVA 1FNOA 3KHXA 4NJRA 1LANA 1ZG7A 3KQXA 4UEFA 2PVVA 3KR4A 3JRUA 5HVHA 4OC3A 3PFOA 1AYEA 4MHPA 1DTDA 3DGVA 3KQZA 1ARLA 1NKGA 4OP4A 1CPXA 2FVGA 2IJZA 3PEIA 5LRGA 4FXTA 1LAPA 3S9MA 4OKOA 5THWA 4NFRA 3WC5A 1TKFA 2CTCA 3PBBA 4A94A 1ZLIA 3CT9A 2EK8A 1BPMA 1GYTA 1QQ9A 4OIWA 4NGPA 4UIBA 2AFSA 1ELMP 4ONWA 5LYLA 1VHOA 3BXMA 4UIAA 3WC7A 4MRIA 4RUHA 2C6PA 3VH9A 3BI1A 1VHEA 2CTBA 5CBMA 4MCPA 3D7HA 2V77A 4CPAA 4DUKA 5LRJA 1BLLE 3VATA 3GLJA 4MHNA 4KSIA 3GB0A 1AMPA 1EE3P 1TF8A 3MRUA 3FJUA 2PIZA 2V8DA 3LWUA 2NSMA 2PJ0A 2ZOFA 1Y0YA 1NSAA 3K9TA 2PJ9A 1F57A 2NYQA 2J9AA 4MHZA 1Z5RA 3GUXA 3B3WA 2GU2A 4PQAA 2C6CA 4W9YA 3H8FA 2RFHA 4X3RA 5HXDA 5LYFA 2AFUA 3KGQA 2RB7A 5HVGA 3D4UA 3IJ3A 2XEGA 4PPZA 3ISZA 2PJBA 1OBRA 3V7ZA 4BD9A 1Y7EA 5LYIA 4JYWA 1XMBA 3RAMA 3MN8A 2OOTA 4G1PA 3RZAA 3KHZA 3RBUA 3SJEA 3B3CA 5JGFA 5K8NA 4IYKA 2HC9A 4MCRA 1HDQA 3SJXA 5F09A 2GLJA 3CPAA 2XEJA 3PB8X 5K39B 3IWWA 2PCUA 4OMEA 3B7IA 2XEFA 3FEEA 4NGQA 1CPSA 2V8VA 4P45A 4YWYA 3H8EA 1ZLHA 2F7VA 3DLJA 2Q51A 5D8NA 4IAVA 4MCQA 3E8VA 4AXVA 3B3VA 3FH4A 3PB4X 1HDUA 3SI1A 4DJLA 1M4LA 2QVPA 1KWMA 1VGYA 5D29A
chains in the Genus database with same CATH superfamily
4Y5VA 3VD7A 3C8KA 2X09A 2OK0L 3BDYL 3B6SA 4ZBJA 4GAYB 4PWJA 4M4RB 3VFWB 4KMTH 3P3UA 1AQKL 1BVNP 1J86A 5E6SB 1Q9LB 3PP3H 5J12B 3NDZE 2ZWSA 3CZLA 1U30A 3D0LB 3FFCD 2PXYD 4QRQA 2WNXA 1G6RL 2E9JA 4NGHL 2WSPA 2FLMA 3CPUA 3HC0B 4NZRH 4XWOD 3VFUA 4JDEB 5AVUB 3PAUA 4HWBH 1GGUA 2NTFA 1PY4A 4P2CG 5LBSL 4AMKL 5F6HI 1Q0EA 3EJZC 2QECA 1ZRUA 4FFZH 2Q4YA 3ERXA 5JDSA 4MX7B 2DL9A 1U0QA 2BOCB 3QRLA 3L3GB 3ZIMA 4TOYH 3NIFE 1CGTA 2EDXA 3DR8A 4UQ3A 4U1KB 1DUZA 1YPZE 2ZTBA 1GSKA 4KOYA 2YOCA 3HAEG 4BQBA 4HJ0C 1JZ6A 4CVZB 3KWVA 4JY5H 4I4WB 4S0TD 3GJFH 3B2VH 2YARA 4LSVL 4X4XB 3WEBA 2YS4A 4N3TA 4O5LL 2FYYA 5DS8A 2YGPA 4HW6A 5E2VH 3VXTB 4U1LA 1WIPA 1CG9A 5GIRB 5BNXD 1BBDH 3SPJA 3EH2A 3V52L 5JR1H 4JO2L 3QIWA 2NY3C 4NP4L 1BQKA 2GUOA 5A2KH 3PDDA 3BKJH 1TOXA 4XBMA 4NKMB 4X2TA 4RAUA 5CJOL 1BF5A 4U7KA 3CZSA 5IQLA 4DZBA 4MAYB 4UIMB 3ALWA 2N7AA 1A7PL 2EDFA 3HB3C 1YN7B 1DVFD 1JNLH 3S36L 5J6GB 1WH0A 3MHZA 4J27A 4MS8D 4A7SA 4OV5B 4MHDA 2HRPH 4KI5C 5T5FA 5ID0B 5LQBH 4S1RH 3IF1B 1GOGA 5JPMA 5CWSB 4ZXBD 3ZZLA 3CLFL 1BXUA 4KROD 3VYNA 1C12B 4RRPA 1KJVB 2P42B 3AMLA 4XGZA 5GGSA 3U9UA 3X11B 1G1OA 2QHRH 4G9FD 4Y4KC 1IEBA 2Y7NA 4JQXC 3K91A 5D1ZB 1ARMA 2A9MH 4XRCB 3VFGH 2Y6TE 2ZX8A 3ARSA 2Y9RT 4YDZA 3F5WB 1PX8A 4ZO9A 1P7HL 1S7TA 4R2GC 1L9OA 2IDFA 3UBXI 4XPGH 1DQQB 5ICXA 1FAKT 2H26B 3J7HA 4OIBA 2P5EE 1TQWA 1BBJA 3MZTA 4N1HB 3PU7A 3MRKA 4G9DA 2WMPA 5EOQH 3E6HA 2Z34A 1RIUH 2B2XL 4ANUA 4NN7B 2E7LC 5D5ME 1UKQA 1S5IL 1H3TA 5F88B 3SD2A 1GIGH 1HEEA 5K69A 1VHSA 2CR6A 3FQUA 4JFOB 3RX9A 1R4XA 1QBAA 3H9SA 4JPVL 3B3TA 4E0RA 3R95A 4OCSL 4S1DC 2YLHA 4LPUA 1TKWB 4JM2A 3C75A 3ZK0A 3EJTA 4WTWA 3ES6B 4HD5A 4A66A 4ZI6A 1G5AA 1FZMA 5E96A 2E0PA 3AC0A 3BZ4B 2E6PA 3CSBA 1MJ8L 4YSUA 2V5YA 1H15B 4FNQA 4CAFA 2YD9A 3SDAA 2WLIB 3T90A 4E9SA 4PXBA 4TNUA 4TVPE 3VD2A 3D25B 4HKXA 4XO5A 3QI9D 3P9LA 3X12B 3T2QA 2A3TA 2YEZB 3NQKA 4HMCA 5C1MB 1Q38A 5D7IE 4HHAA 4FKKA 2WP3O 1D5XB 2R56L 4PRNA 1ZWIA 2FEEI 3CZKA 5LNGA 3NCBB 5F70A 3NEEA 1DE4A 4JNXA 1OCOB 5BUAA 4TVPL 4DAGL 2WVVB 2I9LA 2Y5TA 5EBGA 4CW1A 1GGTA 1Q9WB 4HS6B 3KWUA 5KBPA 3KPLA 1RFDL 1UZ6F 4HCFA 1JNHA 2OYPA 2EDTA 5I1GL 4RGND 1V10A 3N41F 1Z9OA 5FA4B 3WJLA 4AZ8B 4P8QA 3D3SA 5DZPA 5FYLE 1AXSB 2CGRL 4OD3L 3WLWD 2M2DA 2CO7B 1BVLB 2NY4B 1KXVC 3SDXE 1YGHA 1BFVL 1DN0A 4QGYA 4D0BB 4D7BA 2CAKA 1YECL 2ZJSL 3HBGA 2QJDA 2P8MA 2EDLA 3JYBA 5JQ6H 1ADQL 2EKSB 4FFYA 2V8HA 3VXMB 3VJ6B 4Y5XA 2YD4A 5D2LF 4JQVA 4N1EA 3HAEB 5FYLL 1G7PA 3BZFB 1BLNB 4TNVF 4IGBD 4BFBD 3WNJA 1ZVHA 5HI4D 2K3HA 5ISVA 1OE1A 4QNPE 1MN4A 1MW2A 4ABQA 1NDTA 4JRYB 3TNNB 1S7UA 4X9GA 2NZ1A 5JLZA 3U4AA 1Z1WA 4E41A 3PS6A 3G8WA 2XN9D 3F7LA 1KV3A 2AI0H 2J88L 3B9KC 3KLLA 5I76A 1CFTB 1A7RL 4E9RA 4L8CA 3BIKB 1LCPA 2ZEFA 1UACH 2VH5L 4MYWB 4HU8A 4AB7A 3ZE2B 1MCCA 4OIAA 2QVKA 4ZS7L 5C0RL 1IC4H 4O02B 3ROOB 2IBZX 3FHQA 1A3QA 4HIIB 1NC2B 4QRRA 1CDJA 4G1MB 4FHKA 2P5WD 2ICWJ 4BH7B 3IGFA 3HBPA 3TIEB 2X2HA 3TOAA 5CWSA 3TOPA 2UZIH 4BDVB 1RZJL 5A16A 3GXMA 5CINL 3K2UH 2MRYA 1QATA 4RWYH 3C5JB 2CGYA 4GUPA 4M00A 4PS7A 1RIHH 4IMKC 4DKFH 3H2PA 5D1ZA 2IH9A 1SYVA 1BZ9B 4ODWB 4XRCA 5EO0B 3FMGH 4HD9A 4N26A 3VXUB 2J4WL 3BMVA 4V2BA 3F5WA 4NUGL 1BJ1J 1YC7A 1TZGH 5F8QC 4P10A 3QQXA 1HSBB 1CG2A 1JDAA 2H26A 3PBEA 1IAIH 4EFDA 1L4IA 1KBKA 4ALAL 2AEOA 3EYFA 5ALCL 2A77H 1I3UA 1O6TA 4HT1H 3VXRB 2VC2B 5CIPB 3VFSA 4G82A 4GB9A 3V5DA 1L7TH 1RZQA 4BZYA 2GJJA 2CY2A 4Z76B 2B8OT 3GSXA 5MEQA 2XCMC 1KTJA 2EINB 2MEJB 2OTUB 1ZA3B 3FU0A 2OR9H 2C1PA 2KZKA 3DX1A 1IQWH 1RUKL 2UZXB 4MXQC 1IM9A 3V0AC 3QORB 2X53A 1JPST 4OI9A 4KKCC 3DGDA 4O23A 4WHTA 1U3NA 2VSMB 5DMIL 4WWID 3T3PE 2L7JA 4FA8A 3BXNB 5EOCJ 1E4WH 4DP0X 3VI3E 5AB2A 1D7DA 1RUMH 1HQ4A 2H6UA 1NCWL 3CLWA 1C7SA 4YHIB 1QNZL 1YN6A 4FZ8H 4X5RA 2VN5A 1IQDA 2YGOA 2ORBL 4GI9A 1MREH 4OFDA 5E6ID 1FNOA 4M3JA 5HVHA 1M9WA 2EBJA 5FB8A 1N5YL 3ELQA 1AYEA 4HMDA 3KWXA 1HHKB 2QADD 4DP5X 4M1DH 2Q9OA 5FDWA 1M7XA 1AC0A 1AO7E 1RJYA 3B5TA 3VM7A 1RK1B 4R7XA 1KDJA 2H2PC 5LCVA 3OD3A 5KW9H 3OJDA 1FA4A 2IJZA 2UVFA 5DVNA 1OGAA 4ZUWB 2HLAB 3LB6D 1E90A 4HFUH 3ZYIA 3WS6C 3NJHA 5THWA 1EEZB 4NO3A 3WC5A 1S7RB 3FUJA 1RULH 4TUOB 2XOTA 4R96A 3UY5A 3CXFA 1X7QA 1SOQA 4KXBA 4QXGL 3TO2A 4JL1A 2ATPA 3MA9L 1GYTA 4M6HA 2O30A 3LZFH 4GW1B 3RUGE 1IFHL 1I1DA 2BS9A 2PWDA 4L1HA 5HDQL 3EDJA 2Q0YA 1MELA 3HZKA 2JCCF 3CG8A 2ROYA 4MQ7A 4FXLA 4NJAL 4OI7A 1MQ8A 4H6ZA 5A6MA 4RUHA 4MRIA 1AP2B 3C2AH 1YEDA 1KIQA 2Z93A 2B3VA 1N4XL 3FTWA 4PLJD 5I1AB 1QLEL 3VGFA 1AGFA 1W0VA 2EIZB 3FOMA 3G5YA 4G80A 4MCPA 1IAMA 5H4YA 4HCRA 1AVAA 2QBWA 4QYOA 1HQRA 2OMWB 4KNUA 3ARXA 1E6JH 3FT2B 2K78A 3E3QC 3QIUD 4IU3A 5T1JA 2JKWA 3WO4B 3TBYB 1J48A 1NC2A 3GLJA 4GO9A 1XF3A 4C59B 2B08A 1FVEA 4L8SB 3STZA 2PWEA 1I82A 1AD9B 12E8H 4YZFE 3RWGA 4WKZA 3GI8H 4UNVA 4NERA 2NSMA 1AR2A 2VUOA 2P5ED 2VYRE 3CVIH 3DIDA 5C0JA 2WCSA 5FIEA 3ARFA 1NSAA 4NQCB 1L9PA 4G7RB 4RMUA 4LPXA 4FULA 2NUPA 2QSCH 5D70H 3BKML 5DMKA 1MCFA 2NCEA 5I75C 1F57A 3ILQD 3ARZA 4KKNA 1T04B 5T5FL 1UUNA 1U9KA 2AJYL 2WXOA 3MBEA 2FWLB 4OFYD 2PUQT 3RL2A 3ZGIA 3IJEB 4G8AC 2Z3LA 2OP4L 2WQXA 3MOBH 1IM3B 3D4UA 5EU6A 5LXGL 2EICA 1BG9A 1AI1H 3OAUL 3SKJH 2H1XA 1A6UL 2PJBA 4GG8B 3QVAA 5B7MA 1L9NA 1BAGA 5CJQL 2A73B 3T0AA 5F72S 5KSAD 3KLQA 3H9SE 3KHZA 1CXHA 4TVPD 4FXKC 3FULA 1UWXH 1MWAH 1GKOA 1OM3L 5I6XC 2WXJA 4P4RB 4JO3H 3P30L 1QBML 1EX0A 2H1PL 4KRPC 4WI8A 4DEWA 4EXPX 1RZ8A 4F6AA 3RIFF 5KOMC 2OR7A 1DBKL 4NWUL 3RTQB 1QI4A 4FFVD 4P5TD 1ZD6A 5IK3B 4DESA 3NPSC 3DOSA 4AH2A 4DKEL 1IRAY 1PG7W 2PCUA 3C8HA 4OMEA 4HIQA 4MMZC 2H32H 3KW8A 4NENA 2VDMH 4TQHA 4ZFGH 4NGQA 5MEPB 1D9KC 2VR5A 3F7YB 3QC6X 4TQEL 3NCJH 2YPVA 4EPSA 4X80L 3MV01 3GTVA 3BE1L 4IRZA 5BO1L 2B16A 3W6SA 1L3NA 1ZHNB 5I8KL 5HYFA 4IAVA 1N10A 2DQUL 1NMBH 5FYLD 2ISDA 4JJXA 4MQSB 3PB4X 3K9UA 2I27N 4LBEA 2MQCA 2KI6A 5D2LA 5A27A 3L7EA 4ES9A 1QI5A 2R1YA 3I84A 4GS4A 4PJ9D 4G8EB 1XR9B 3DVGA 1E8XA 1XCQA 3L9RB 4MS6A 3C6EA 2I5YL 4A95A 3HHSA 4B9FA 1QSFD 4PJ8A 1JG9A 3LSOB 2C3GA 2P9RA 2FE7A 2W9DH 2X4QA 1G9NC 1F97A 3FYEB 1ML0A 1RTQA 3ZHLA 5FYJU 2H0JA 5IEKB 3RBSA 1U33A 2BW5A 2HT4D 1T7WA 1ZT4B 2E7HA 1P69B 4BH8A 2A6DA 2FJHA 3X1BA 4F93B 4WI0A 4NNXA 4UTBH 5J6HB 5C0DA 3VCLB 4CDHA 2MJWA 4ZQKB 4UYPA 5JMOC 1G84A 4E2AA 3GSQA 4DGYH 1CICC 4KOVA 2F7OA 1E4KA 2DEYX 2V8GA 2DTMH 3NSCA 2FQFA 1A6AB 3QC5X 3QYMA 5IB5A 4E41E 5L7XL 1ELLP 5T1KB 5DQ9A 4FFYL 1XGYL 1E4HA 2DQCL 4GRLB 5JNYA 4CGLA 2NX5B 4EDXB 3D85D 3RWIB 5KTEL 3SDYH 1Y0LB 4H2KA 1DBBL 3OMAB 3QR0A 3NH4A 3BAWA 4AYSA 4CMHC 1R43A 1NGYB 1CE6B 1ASQA 2Y7OA 3ZSSA 1JFQH 4QRRE 2IH1B 1JMZA 3NCFB 4OLUH 1AD9A 5F7EL 1BQHG 3V6BR 4BELD 5DWNA 2DD8H 5FK9A 5C88A 3BT2H 5EH1A 3VFRA 3S6HA 4QMEA 3NJVA 5IR1A 4NCC2 3C60A 1BVKB 3JBG7 3MZGB 4OLXL 5TK4A 3VXOB 3V8CA 1DJYA 1QI3A 1H9VA 1H19A 1O6SA 1U4EA 1RPQA 1ZOXA 3JTKA 1F3JA 1HIML 5B1JA 2Q8AH 1ACYH 4U6XB 4JFFB 4MQXD 5FYKH 1P2CB 4GLRI 3GO1H 3R9GA 3OC8A 3IETA 4I3GA 5FEBA 4LFHG 1ZTXE 3KXFB 1J1XH 3U9PH 2NW2A 1UFGA 2AXWA 2XQYK 3U0PB 3WY1A 1BPVA 5EC4A 3G3SA 1S3KL 1GZQB 4ZMYA 2W91A 3DETC 5F9JA 1Q2DA 2Y1AA 2WK2A 4GG8A 4UNIA 2IGLA 1B90A 4OF7A 3MJ8A 3I02A 1S2EA 4OUOA 1QG3A 1XD0A 3CFJB 3GMLA 4XNQB 5L0QC 2YZ8A 4YDIL 1ERNA 35C8H 3D08A 1QZ1A 5CZXC 2QQQA 3EO0B 3CXSA 1T2XA 1I1FB 1ZTXL 2CRZA 3TC8A 2V2WB 5FCUH 5BRZB 2E27L 2GT9A 1KN2H 4WY7H 1NGZA 4UDTB 4X98B 2HB6A 3L9YA 4PAZA 3CHOA 2XPGA 5IK3A 4IIQA 4F27A 1SJXA 2CIIB 1KLUB 3M17A 4U3SA 3TO6A 3SBQA 5L4JA 1YA5A 4R7DA 1R3LB 4S0HA 1MG2C 4K3JH 1TJGL 3S96A 2IPUG 1SZNA 1IC5H 1WWZA 1EJOL 1QKZL 4OKVA 2JMRA 4BINA 1F3DH 4HSCX 4OGQC 4R3SB 4OC4A 1AYRA 4F33B 3F3HA 2JH2A 2XVBA 1G7IA 1U6AH 1XR8B 2NRDA 5J1TC 1TZ8A 3FU3A 1VGEH 3VFMB 3CPLB 3CBJB 1A0QL 4HXBL 5DHVB 3P2HA 4P2QA 4YHLL 5HHQB 1HE7A 4FS0A 3BAIA 3RP1A 3V95A 3ZE1F 2BSRB 4J23A 3L4CA 2A4ZA 2D03H 2JCCA 1HK6A 4QWWC 3SY0B 2Z4TA 1I8LC 1PW3A 1UEMA 2R98A 1Z9SB 2Q3ZA 1MI5A 4X7SH 4ZPVB 5DFVC 5F0JB 4LVOB 4N2IA 1E40A 1IGCL 5CBAB 5HYQA 3TCVA 5TQ0H 1I3RA 4OLWL 4PJAF 4J3OD 3FUFA 3QXTA 3QIWD 1ZK5A 4XP4H 2CKNA 1LLAA 5LCVL 5SWSB 2XNAB 3HCVA 4G6FD 1MUJA 5ENWB 1DSYA 1LO0H 1NMAL 1ONQA 3T4AA 4UZUA 4DW2L 5BZWB 1JVLA 3VW3H 1NCNA 3MXVH 5E1HB 2MPAL 2OSLB 3LDBC 3FTGB 4LLYA 2VTFA 2ZELA 1MHCA 2REEA 3MRQB 5JXEC 4KK9D 3ECQA 4X6CB 5HHOE 2C7UA 3LD8B 5B38A 5LN8A 4JKLA 3QUZD 4P99A 4KY1L 1SXBA 4X5XA 3L48A 3ULVF 5GHWL 4R7NB 2K0RA 5DHYA 3QJSB 3TYGL 3CTTA 3KEDA 4Q74A 4BJLA 1SVCP 4A7QA 5EBVA 2DQHH 1J8HA 3CVHA 1UD6A 2GBVA 2NXYC 2B59A 3SE3C 1W15A 2K1MA 5FF6B 4ZUSB 1N3NA 2HVBA 2P8PA 3SD5A 3WXVH 2PJ1A 3IRZA 4GW5A 1N64L 4Q89A 1PG7L 5I2IB 3L5WA 3FSOA 5DEFA 5DEGB 2UYLB 3UTQB 3PRTA 1MQKH 3OF6A 4UBDC 2K7QA 3HC3H 3QI9B 2J5LC 4C56B 4TVSa 3VX0A 3S8FB 2EEFA 3ZKXC 2WN3A 3HI5L 3M8OH 2G3NA 1NCIA 2NW3B 3VWKC 2O53A 2EDKA 1BQHB 2PJAA 1PCXA 4U6XA 1TVHA 1XIWB 2JNZA 1MSPA 4JZJA 4IBTA 3U46A 1TVBB 3H9SD 3KJ4B 3KXFA 5E2TL 2EH8H 5G2NA 3DWTA 4JM2D 4KO6A 3SQOH 4EI6A 4WK2B 4AQEB 1WC7A 4GBXB 1G7LA 2XTJC 4YQXH 5EU6E 3SGJC 2WNGA 5CBEB 4OZIA 5FA3B 4RNRB 4ZMLA 3UO1L 3MRJA 3EJPA 2QGDA 4JJ5B 4KO5A 4P9HL 5F7MC 3U7YH 5AB9A 1XB8A 1HZLA 3W1ZA 1GZPB 5EIQA 3UGUA 3OLDA 4JFVA 5CCGE 2F74B 3UEQA 1DJSA 4Q56A 5GISL 4YHZL 1F2OA 5ELYA 4UT7H 1NPUA 1R3HA 3K4AA 5G4NA 2IMMA 4F7MB 5D2NB 1KN4L 5G5DA 1DLHB 1N6QH 4Z18A 4QXTB 3MLVL 3MO1A 3RY4A 3VG0L 1IBBA 3C09C 1NCHA 4BFEA 5HY9A 2E86A 4R84A 2JK5A 2A0LC 4ZD3L 3SO5A 1J9SA 5HDBF 1GGBH 4FP8L 4UWQB 3T3ME 4HOWA 5JYLA 1HHGB 1BF8A 1C5CL 5I1DA 1BO4A 4UWIA 1A4AA 1Y18B 4JFDB 3DVNA 4XNBA 2EDOA 4ZO6A 5KSUA 1OAXL 3B2DC 3HS0A 3ARPA 3T9WA 1KFAH 4S0SD 5D1ZI 4R3SA 2CO1A 1ZSHA 4AT6A 3MJ9H 5TPWL 2VN3A 2XTSA 2ZWLT 2ZP0T 1IB5A 1I7TA 4MCYB 4OLYH 4KNQA 2CUMA 3NFNB 4QRFA 4M7JH 3E8UL 5GZOC 1U2YA 3APMA 3GZQA 3QDGA 5D2LE 4I87A 1YMHA 3D7GA 4G7VH 3CN2A 3IAQA 4GXVH 1BGXH 4IRZL 1WLHA 4N6QA 3BVXA 3MSPA 5CNHA 1FE8L 4QXUL 4P2RB 2FZ3B 1NCAL 2WD0A 2Q76B 2PYEB 4CGPA 4WJ5B 5K33A 3QCTH 3HRPA 4MFKA 3FRMA 1H8OA 4ATTA 2VGLM 2ZX6A 4HG4K 2WXNA 4ZW3A 3PDOB 2ZCHH 3HC4L 3IDYC 4WTZA 4E41D 3KQZA 3OGCB 1G9NH 3US9A 4RI1A 3SE4C 4FZEH 2B5GA 1A2YB 4BZ2A 3AQYA 3RZCA 1KB9J 1U3HB 1AHWA 1MF2H 1SQMA 4M93B 3MRQA 2ADIA 4NQXB 2EECA 3SO3B 1UHVA 4A2MA 4DKDC 2V0AA 3U2IA 4X6DF 1IGFH 2XQBH 3RPKA 3GEWB 2FGWH 2H45A 4QRRD 4ZK8A 2C5DC 2WN2A 1UWFA 2J7LA 1QSEB 3DSFL 5GGTL 3MV8A 5JHLA 1KUVA 3H1ZA 1YLEA 1NINA 4QTHA 2ZP8A 5MERB 3WIAA 5KSBE 2EKJA 2AJUH 5FM5O 5DEJA 3VTTA 4NXKA 3QW9A 4DK3A 5H37H 2UVEA 3KGSA 1SQ2N 1DDHA 3VGGA 2ZSWB 5DD1H 4G6KL 4U1SA 3G08B 5FFGA 3R06B 3QWRA 4H25B 4JN1H 4C47A 4BWUA 4RFEB 5E6IB 3WC7A 2PW2B 4F8LA 1Q1JL 3FKUS 4L1LA 1AZUA 1AZRA 4GAGH 1P84J 3LXCA 4OM0L 1QRNB 3WIIL 3RDJA 4R5VA 1M4IA 3UTSB 1FBIH 2R7EA 2A6JA 5FWQA 2VQ4A 2CDGB 4NHUA 1CVSC 4BKLB 3NIFB 3MRHA 3OSKA 5C09E 4JKPL 5I18H 1Q9OA 1YPZB 3EYSH 3Q1EA 4LCWB 1ACZA 4XMLL 2KH2B 2DB8A 4BQ9A 4MLSA 2VNCA 4LSRL 4MFZA 3CC5B 1VFMA 3X3GH 3GB0A 3QNZB 1IM9D 2DLFL 2EE0A 2HJKB 1ZT1A 1HVXA 3QFJA 4F58L 2L8AA 4U1JB 3OBAA 3G5XB 3ZTNL 5AD0B 1UA6L 1KPUA 2D9CA 3S34L 2CDFA 4ZOAA 2P28B 1WZ1L 3F7VB 5KYWA 4PJFB 2OPCA 4AL8C 1D7CA 3CSTA 1JWSB 2QVTA 1EZLA 3QXDB 5DUBA 3GI9H 2YK1H 4OGYH 4W6WB 5HJ3B 4HPHA 4UUJA 3I3DA 3P1VA 4F7MA 3JVGA 3KBPA 5D2NA 1DLHA 5IVXF 1OP5K 2NNFA 3VRJB 3Q6GH 5ABDE 2GU2A 2NY3D 1LWRA 2NDGA 4K94C 1MH5B 4IHOB 4Y4HA 1J18A 5F6IB 4DEPC 4PPZA 1IVTA 2DF5A 1KJ3L 1HHGA 1HSAA 3FBKA 5DJYA 5TGBA 4N6RB 2WO2B 3TCLA 4D9QE 4MD4B 2DXQA 3A4AA 4IHBA 5I30L 4GIAA 2X9XA 1TDQA 1OGAD 4DOHE 4X42A 4HKBB 1F56A 4PJAA 5HDWA 5GGRA 4G72B 4FQ2H 1LO5A 4IRSB 3C6LC 2UY7A 1W72H 5TE7H 4MCYA 4OFPA 4TUJA 5CHNB 5IF0B 4AUJA 4X8XA 5I1HL 3HFFA 2DBLH 3PWPA 2JJSA 3Q44A 2ZW5A 4XOAA 4HEMA 1BJ8A 4HK0A 1FL5B 3DNKA 3CK0H 4YH6A 5K39A 1M53A 4CA4A 1JK8A 5ANMA 2NY0C 3IWWA 4KXZH 1MI5E 1UM6L 3BKYH 3B7IA 3GLEA 3AB0B 5FC9A 2HB0A 4PJBF 4P2RA 2FZ3A 4X6DB 4J3TA 3OB8A 5FDYA 5D5MB 4EUPA 4UCPA 2AXHA 1KG0B 5E6RB 2R29H 2VAJA 3G7TA 5HHOD 4JW3A 1C8PA 1U92A 4M6NH 5DK2A 2Q10A 3T0EE 5IREA 4C4KT 2IGFH 3C08L 5AEAA 1U8QB 4DN3L 4L5FL 4M7LT 1FV1A 2MNUA 1ZS2A 2IG2H 4URKA 1U8HA 4W9CC 2K3TA 3VWJB 4AKPA 4UT9H 4LEOB 1UVQB 4MB3A 2A4NA 1FGVH 1FO0B 1D3CA 4NNPH 2KZ1B 3PQYB 5F7BA 4LSUH 3POHA 1EJFA 3MLWH 4Q6KA 3UBFA 1UJ3C 2BHZA 2QV2A 3MBWA 3GZKA 1MFBL 2H2SD 4M3KB 2Z31B 4APQB 1J8HE 3ARQA 2P7TA 3FONA 1RUPL 2IDCA 3BUTA 4JO4L 3KYOB 5HI5D 1ZLSL 1ORQB 2WNWA 3ARFD 4OGZA 3MRCB 4HZ1A 1AMYA 1ASPA 1M2OA 2VISA 4X0KA 4K2UH 4EXKA 5BVJB 5L8KB 2CWRA 3ULUC 4JFQB 1T5XB 4QOKA 4M62H 5JMRA 2BVEA 1E27A 5LGJA 1AFVH 1QFWM 2D2CC 3KE0A 4H26A 3D4GA 1J8RA 5BJTB 1FIEA 3BH8A 4XVSH 3MBED 1CDIA 3RA7H 4KZ0A 2BSEA 4PREB 4MXUA 1QRNA 3BAYA 3LVTA 4L2LA 1JVOA 2ZUQC 3E38A 3LIZL 5K1NA 4ONFL 1A3LL 5EU6D 5GGVH 4OC2A 5LDSA 3NIDF 4P5KA 4TN9A 2GW5A 2X4TB 5FM8A 3ZUNC 5BZDB 5HPMA 3NOIA 1SBSL 2Y4SA 2PIYA 2H5MA 2GAZA 4LPTA 3PWVB 1OV8A 3CQFA 1JHKL 4N8VA 4ZYKB 3AM8A 3B2XA 4FG6C 5EZLA 1DEDA 2QKIC 4U6HB 1T2QH 3RKDD 1PLBA 3KL5A 3VFPB 4OZIE 3WFHB 4LB8A 3EFOB 4QRSA 1UCBL 1P5UA 3VXQB 1T1XA 1I9IH 1HXMA 2A83A 2LAGB 4WW1B 4XNXH 4BQ8A 3PG2A 2A9DA 3BUYA 2E7CA 5A2BA 4LLAA 3IU1A 3GMMA 4ZZFA 4A32A 1OM9A 2HJFB 3HLAB 3KYKH 3GSNH 4E36A 4FQQB 2PR1A 3QEHA 1PZ5B 2IWKA 1RJZA 3G5VA 4W4OA 1B9ZA 4BKTC 1RP8A 3QQ9C 3FN9A 4E42B 4IK6A 1J0KA 3QXUA 4H0HB 4PFEA 3TLRA 2ITDB 3VG9B 2WO3B 2KPWA 2B7DT 2QQKL 3WIFA 2JQZA 2O61A 2A74C 4GJTB 3UABA 2BWQA 2Q0ZX 2ZKYA 1J0HA 1HFUA 1JV5A 1QNIA 2ARJQ 4HH8A 2CIKB 4XNYL 4CJ1A 4JLYA 2VXSH 3T71A 5HP5A 2PF6A 5GRZA 4X8CA 4YVNA 5I1LB 1AZNA 5I6NA 2Z3PA 1DQLH 3LEYL 1DQDL 4NZTL 1KELL 5JOEA 3FQ2A 4YHNB 4TNEA 4LCIH 1QBLL 1JRHH 2MTPA 1U8PB 3N2JA 3TZVB 1KEMH 2HG0A 4PJ8D 3ISXA 3QJXA 4UQ2B 4R7LA 2Q7YA 1VADB 4U1NB 3QDGE 4UQEA 4D0DA 2ARJA 3UJJH 4DQOL 2NNRA 4PD4J 5GS1C 4FUUA 1WFJA 3UOAB 3TT3L 2PVWA 3LKSB 5DJ6B 5GGQL 3SKNA 3WS3A 4L3CB 2BY0A 1O5DT 4L05A 3WKYA 2WLLB 5ITBH 1SGKA 2Z0BA 1U8KA 1ETB1 1UM4L 4I8DA 4XNHB 1QQDA 3QAYA 3JTTA 5DC2A 1TJHH 3TA3B 1JZEA 2WXFA 2IV8A 1OB1A 3EFDL 4XCCL 2HG5B 5J57B 5DRNA 3EJYD 5FHBL 3ILPB 1AZZC 4P0DA 3WU1A 5EU7C 4RFOL 4AIZA 2ARWA 1FN4A 3F7KA 32C2A 4WGKA 1BVZA 3T6WA 4FQ1L 4NIYE 5C8JB 1F42A 1V55B 1X5YA 2PR4H 4RGOL 4KXDA 5LGHH 4MHYA 2UXVA 3FT3B 3S6GA 3H2QA 1YAZA 5HHPB 3UCQA 2GANA 5KJ4A 4JG0L 1OF2B 1XE4A 3QWOB 5I0CA 3IGRA 1KIRA 5E8DL 1E9QB 2Z31A 1K4DB 4EJ1C 3EH5B 2K9UA 5FECB 1BPNA 3CZFA 2YD5A 5KTDA 3KYOA 1FFPA 2YQ3A 2POKA 3NIDB 3C60D 1LEKA 4XH2A 4JD6A 2WTOA 3KL0A 5EWIL 1KMGA 1XDTT 2C4XA 1NPNA 2Y6SC 3VGAB 1A4BA 1YY8B 2GITB 3EHBB 1WBZA 2FWOB 3JYCA 1XL6A 3F7RA 3BQVA 1AO7B 2WSDA 3PGDA 1OCWL 3P9MB 4FQLL 4UOQA 2BY2A 5IG7B 5EFIB 1CVRA 3RY6C 2QMJA 1IAOB 2HH0H 3DV6A 1L0PA 4S1QH 5IJKC 1FRGH 1OK8A 1T89A 4U4IA 1LP9F 3LNIA 3L9EA 4A6YL 2R1XB 2XG5A 5CKGA 4KKZA 1JNNL 2H2PD 2X28A 3KW7A 4PV8B 2PCXA 2Q3AA 4W6XB 4NCC1 4Y1SA 2I9TB 5IVXA 4K0OA 4O2FA 4MJ5A 1TQTA 3EGDB 4JX0A 3SGEI 3QFJE 3ZTCC 1XMTA 5H35A 1CL7H 2YBGA 3RUGB 4UMSA 3T6ZA 3BRFA 5EORL 1QHQA 1DO6A 4ZFOA 1HYSD 1JPEA 1JPFA 4Z3GA 2HJFA 3LACA 1MJUL 1T22A 3NTCL 5E00B 3TN0A 3K46A 4G6FB 5AL8A 3FXTA 2V5TA 2YBRB 2P4AB 4HUNB 4JAMA 4PRIE 2GJZA 1OW0A 5HYJA 4PJEA 4AL8H 2E75C 1SVZA 3WEMA 4ANXA 2ZENA 1TZIB 1PVHA 4H8UA 4JY6A 1XTMA 5HGDB 4R6UA 3S6CA 1SJHB 1K6QL 1AAJA 4LP5A 3GT6A 1XGRA 2KL6A 2AFOA 4RISL 5D55A 1NAKH 3MGAA 3BDXA 3QUZB 4NZ8A 2VR9A 4K94H 4J7RA 1N5AB 2ZUWA 5ESQA 4P2QD 2EQDA 3L5XH 3HE7A 2J8HA 4GQQA 3PNWA 4PJBA 5JA8B 2VXKA 3TV3H 3I3BA 1CGSL 5JUEL 2NY5C 4K5LA 5L6YL 3RVWD 1MI5D 5E9NA 3WY2A 2IJ0C 2R2EB 2EVGA 3C5ZC 4C58B 3TOBA 2WVTA 3OKMB 3NZ8A 4JFPA 1TJMA 1N0XL 3UH8A 3D05A 3MRMB 2XVGA 5B3JE 4Y9GA 5DJAA 4CC4C 2ODIA 4HEME 5EOTB 2BIHA 5C2UB 4GPVA 1UFUA 2PMZA 4G8FA 4BCXA 4K3DH 2H41A 1NBVL 3LXUX 4DP1X 5MENE 3T0ED 4KITB 3Q05A 2YAEA 4HWBA 1X4YA 4P23A 1P0SE 1PSKH 3KG5A 4L23A 4I18A 4IRJB 4PJXF 2D7QA 5TDOB 4FFZA 1FJ1B 4BXVA 3ARDC 4LT7A 3MBXH 4XVTH 4XXDA 4RQQB 1AXTL 4MVBD 3TO4C 4UCFA 4X7TB 4AGQA 1I4FA 2OJEB 4HC1A 3S5LG 5HYIA 4Q9BA 4PB9H 4AYMC 1GHFL 1TZHA 2VJ8A 1OP5H 1CGVA 1FIGH 1J8HD 3ZMRA 1OAKH 3BEVA 4I88A 4YE4L 1OANA 4JRWA 4HQQH 3W39B 3WLBB 1MY7A 3GJFA 1HAWA 4IOSA 2OSXA 4PCTA 3BGMB 4RMRA 3MNDA 3DXAA 2X6MA 2AV1B 3FB7B 4RMWA 4NQDE 5CUSH 4L9DA 2ZKHL 5F47A 4KZEL 3ZJ0A 2K4AA 3IDXL 5DRZB 4GKZB 3OF6D 4MNGB 2FBJL 3IDMB 4UINH 5F1SA 2X1XR 1SXNA 4FQCL 1HJCA 1NGPL 5G21A 4HWUA 5CD3A 1ET7A 1RSFA 4XVJH 3JT2A 5D7LA 1YY8A 4A31A 1IZKA 4QOKE 1JSYA 2V17L 3QCVL 1MJJB 3DROB 3WFEH 3D6GA 3FYIB 3DJRA 3QHZH 4U1IB 1EO8L 4PW9A 3ULUH 4HNXB 3WE6A 1VACA 3NCWA 4G7YH 1BHGA 15C8L 3B2MA 3OG4B 1R34A 1TETH 5AVVB 2WLKA 1Z9MA 2Z1PA 3NIGF 4OU3A 4WZ9A 4F5CE 4G3YH 2R1XA 4HUWA 1QEWB 3L3KB 4H13C 3H42H 3V9CA 5I1KL 4LEEA 1YQEA 4Y49C 3JSSA 3U83A 5AENA 1EIBA 4LLWB 5DD6A 3U9WA 1MFAH 1RUAL 1TTFA 1N59B 5BW7C 2Z0ZA 5LHDA 1BQSA 2W9EL 1L9SA 4OIWA 3X14B 2ZUYA 3QQNA 3QPKA 4NQTA 4ZDHB 1NOAA 1BOGB 1BOBA 1TTGA 1EHKB 4OCXH 4KK6D 4DCQB 3E1ZA 3QIBB 5IHBA 3BWSA 4L8DB 3GHBL 3VGHA 2RQEA 4PJHF 5FCSH 3V7AG 4FG4A 3DX6A 3HI1B 2JE8A 3V5KB 2LTQB 4OQ1A 5F46A 1VHPA 4G6MH 2EXYC 1BP3B 1BIIB 4PJ5E 4JG5A 4N0RA 2I25N 3G6AA 1PX4A 4YAQB 1E5CA 2GI0A 4PSWA 4U3CA 3BN9C 1CICD 2DEXX 4N0YL 1LQSR 5FW8A 3U2SA 6PCYA 5EOCL 3HZYA 1AHKA 1NANH 2WWMD 3QR1A 2FUQA 2AKRB 1QPPA 1INQA 2IAMC 4AQ1C 1Y9KA 1E9OB 5JYMA 1KPVB 4JHUA 2KKQA 2WBKA 3QDGD 3QJZA 4PJXB 4Y2OA 4ODHL 4TSBH 2OJZH 1JPSH 1C1EH 2N7BA 3UP1A 2CA4A 4PU2A 3ZT7A 2OMYA 2JJVA 2DKSA 4D9LL 1K4CA 4OCWH 3CFTA 2VE6B 1XZ0A 1NIAA 4M3HA 2J9AA 1V3MA 5JW5B 2HTKD 2XBDA 3O3BA 4K8RL 4N24A 4HIEB 3Q0HA 3THML 2C6CA 3BZDA 3CXDH 3H8FA 5C0BA 5LYFA 1JUFA 2AZUA 4M8UA 4GQZA 4CS0B 2Y2YA 5JHDE 1J5DA 1ZS8B 2GIYA 4FKHA 1VEMA 3CQQA 1FI8C 2R0WH 1N2RA 1ICTA 3PV7A 4XCFH 1BFOB 3OXSB 2AJSL 3BPOC 1EBAA 3I2CL 3RZAA 4CSTA 3QRFM 3UCRA 4Q9RH 5BVPH 1PF3A 3D33A 1Y1DA 1X5GA 3PHSA 4JZNB 4Z7NB 3B3CA 4FQIH 2I32A 2GTZB 3WJMB 3BEWB 2VLLA 3B3BA 1QX1A 3QWNA 3P73A 4ZFFA 5F09A 1JYXA 1GZHA 2ZSVA 3S5LB 1CLYL 3MOAH 2GHWB 3NGBC 2ZPKL 1PNCA 1E9PA 2EJ1A 4OVUA 3TYFB 3C9NB 2AV1A 3LV3B 4H1LH 2Q7BA 3EO9L 3H54A 2XEFA 1SN5A 3ESMA 5EIIA 3QWRD 4GRWE 4MNGA 3RWFA 3L1OL 4TF4A 1IBFA 1WUNT 1OQXA 4AV5A 1F1DA 1R0AL 1LP9A 2F7VA 2AQNA 1Q94A 3L3IA 4ZOEA 4AXWA 3PWJB 2NY3B 1F58H 3E8VA 1CWVA 4KJQC 4P3CH 1LDPL 3UC0H 5HPOA 1U93A 3N50A 3BJ91 3BX7C 3CHXA 4YC2C 1ZLUK 1XH0A 1CFNB 2G2RA 1UXLA 1DBJH 1TQUA 2VR7A 4YGVA 5EUKA 1T4KB 1KWMA 3BPCA 3PXHA 5FOBA 1L5GB 1LEGB 2VDLL 3AXLB 3IJ7A 3QZWG 3HB3B 3D4CA 1KGCE 3HUJB 5FGRA 4YNYA 3QFJD 4O4YL 5CGYD 1AGCB 3SKMB 1A7QH 1T4WA 5F0LB 3LAFA 3RE0A 3TBSA 3IAGC 2EIJB 3BRDA 3OKKA 1Z3GL 3LZNA 2NZIA 4YJZL 3GRWH 4P04A 5KANG 2ADJB 3KJ6L 1U8JB 3EYUL 2ZOKA 3HFML 1CU4H 4QWWD 4NO5A 4AQAB 5DD5H 2FO8A 3EH3B 3BAEL 4Y4KB 3C5SB 3PB9X 2O6CA 2C9XA 4A7VA 1SEBA 4FG2A 4ELME 3S8GB 1Z9LA 5HVFB 2Q5BA 1GC1H 2MQ0A 1Y9WA 2F0CA 1GJUA 3HG1A 4R2GB 4ZX4A 2N1TE 3V4PL 5MI0C 5IMMB 3EYQD 4Y4HD 2BLFA 4MFLA 5HHOB 5DU7A 4DH2A 3AU0A 3UYPB 4ZMNA 3LKOB 3FPXA 4ZMWA 5HYJE 3DURB 4PJEE 5TE6H 3HMWH 5T33L 5IQ9B 3EW3B 1FNGB 3ABLB 4JFYB 4YAQA 5FLVA 3G3LA 4JDTH 2JELL 1ZT7B 5IB3A 2BNUA 4LAQH 5C82A 4QI3A 4PSXA 1TR7A 5AZEH 4IBUA 3O3EB 4ODBD 4N8CH 3IE9A 4FD4A 4X8IA 5CKAA 5HXMA 3VSTA 3C26A 3QUMA 3PWPD 4WWPA 4NOFA 2EDDA 5B8CA 2VL4A 3BDBA 1W0WA 3CX2A 5E2UH 1D2OA 3BSZL 1PD6A 1JGUH 1S9YA 2RGSA 4XMWA 5DGQA 4I0PA 5C0FA 3K4DA 3H56A 2VDMB 2O5ZL 2OMVB 5KN5A 4A63A 3LZRA 2NY5H 4FXGC 1CB4A 5HYSA 1P1ZB 2DYPA 1MJ9A 3CZEA 4CADB 4D8OA 1WAAF 3UACA 2F8OA 3FB6A 1AACA 4LCCA 3LNFA 5AYUH 3CFDA 1EJ8A 4FLQA 1XF8A 2DQEH 5IB2A 2OZGA 1FVDA 1T5KA 4OZGE 3NJMA 4PR5A 4N2KA 5G1ZA 4YEEA 3SBWA 3GMPB 2OI9C 3WGVB 4DP2X 3MJ7A 2REFA 2VITB 4UIKH 3CFCL 5IB4B 4YUEH 5DTFB 2WXRA 3D30A 2FHBA 4KHXH 5F7YC 2EK9A 1RZ7L 1CCZA 3BI0A 4I85A 3WTSA 1NUGA 1URLA 3L4XA 4LESA 4HJ1A 3GBEA 4NM8H 4ZX8A 2R2BA 3QJFA 3D69B 4NQDD 3QHTC 5T5NG 1XFPA 2GTZA 4NRZA 4WO4C 4OW6A 2V4LA 5KTAA 1M4GA 4M1CD 4JLRB 3QQ3B 4KO7A 5GGUB 3N1PC 2Y1ZA 3MV11 3ZYZA 1KTRL 2OTPA 4FFZL 2XZCH 3ARGA 3BAKA 3DXAE 5DWUH 2H3NA 3KLKA 3QUXC 2ED8A 4QOKD 1KFGA 1IT9L 2X4RB 5TF1L 4HC1L 1BEXA 4N8PA 3FCGA 2IANB 1R24B 3T3MB 1YEGH 2Q4ZA 4A30A 1O75A 4Q0XH 4WCYH 1XCXA 2LU7A 3EOAB 4PRPA 5IW1A 2X0VA 5HYEA 1LNUB 2BSED 3GIVA 5FR3A 5IP4A 1JYNA 5I0XA 3V4VH 4IKIA 3HVDA 4RA3A 5ISZA 4AITA 1M1DA 1BAVA 1JVKA 1KGIA 4PCSA 5T5NF 3INUH 5AWNH 5DFTA 4HIHA 4OC0A 5A40E 4WUKL 1J1PL 1NA8A 1BBDL 4YHOH 3B9KB 3UX9B 2W92A 2W8CA 2EC9T 1WP6A 4ZMQA 5DK3A 3V2AR 4HXAL 4UT6L 1AQ8A 1N8ZA 1MCQA 1T6BX 3OX8B 4QF1A 4WI5A 1NJ9B 3SKMA 5E24E 2VL1A 2GG1A 1U58B 3E6FA 5C0IB 2VM3A 3ZOAA 4PJHA 1E4XL 1S7NA 4BFJA 5E0FA 4JO1H 4XBEL 5GZOD 5HMNA 4ZQTA 5GS2D 3NN8B 6FABH 4LMQI 3QZWB 4LHUG 4WWKA 3DTXA 1MLBB 1YEEH 1UTDA 1JNLL 5J1QA 1R5VB 4HHGA 3PCYA 2HRPL 4ZMAT 5LQBL 4S1RL 5DGRA 1INDH 5ICUA 4PJ5D 2Q6WB 3CHPA 3P0YH 2VWEC 3K2IA 4MTMA 4J3XA 5HBBA 1NL0H 4NC1C 2DQTL 4HV8A 4PTUA 4B5OA 2YR3A 1FNEA 1X9LA 3CDZA 4ZFZA 2BMKA 2VZZA 3UYPA 4XNAA 2V7NB 4K8RD 3U25A 5EDXA 5JQHC 1H5BA 3QO0B 5L88H 3IFEA 2E7LA 1DJGA 3JT0A 3BLNA 2AJ3A 2NR6A 1I3GH 4GEJA 5FVJA 5IQ9A 1KOAA 3U4EB 2KT6A 4HUKB 4QUOA 5KSBB 1GXEA 4XWGH 3B1UA 1MWAA 5E2WH 4AQOA 1FPTL 1HHHB 1CXKA 4XPBL 3FQ1A 1CFSA 3HMXH 1D6VL 1BXXA 4CAGA 3PREA 4K7PX 1MAKA 2WAQA 4BUQA 5HD8C 1OGSA 3SCMD 4MZRA 4JY4A 3L5HA 2H32A 5GGSY 1T0PB 5JHDD 2CO6A 1MXGA 2VUYA 4X4MA 2ENQA 2CHZA 4QC6A 1LAMA 3ZSTA 3D7FA 1TFPA 1ZTMA 1P1ZA 3UTZA 4FMKA 1FGNL 5CLTA 4CADA 2X89A 2FLBT 3GIZL 4POUB 2OM5A 5C09B 1LK3H 3P4NB 3GRGA 3DPDA 3N40P 3F12B 5C0BE 3RWCB 2EIMB 2VL5B 3FU7A 3N5AA 3NVQA 4XPAH 3WEOA 1CX8A 3FOLB 4HUVA 4D0CB 1FG9C 2ESVA 4XPLA 1MCLA 5F1IB 1YW6A 1VERA 4JG1L 3FRUA 3PYCA 1TKJA 3T04D 2B58A 3FAWA 1RHHA 2GJPA 3QH3A 1S8DA 3N85L 2HKFH 5D1QC 5IROA 1J7VR 3H3KA 2GSIA 3N6YA 3T2NH 3TVMA 4LEXH 5CMAA 1AQHA 5ES4B 4I77H 2X9YA 3PJSA 3WIHH 4EWTA 2HKAA 1XGPB 3KZ8A 4CGTA 4FQXA 5A1AA 4DP4X 5I6KA 3HHMA 5E94A 1J5CA 2X4RA 5J13C 2FJGA 2XXGA 4CNIA 2ATKA 1YCSA 4L9LA 4XX1E 3MX0A 4XNDA 2H6PB 1VESA 4LNRB 5ESVA 3GPEA 4AW4A 3Q3GB 1XRYA 4AMWA 1A9BB 5AOJA 4A68A 4G1EB 5JQ6L 2RA1A 1KGCD 1OSYA 4L4VE 4BSVA 1YUHA 4BYHA 1BMZA 1K2DA 4PIRF 3AQXA 4YDLC 5DXWA 5CM1A 1DVTA 4HUMB 4KK8D 1RPKA 4G43B 7CGTA 4GO6B 5DEZA 4MKMA 3BLKA 2YXFA 4OJFH 4AYFB 2PRBA 4JVWA 4N0CC 3TIDA 3F01A 1IKNC 1BAFH 1XHHA 4MCZB 1IVLA 1VCBC 1RVFH 4UEFA 1GMEA 1KXTA 5DMGC 3S4SB 2UWEE 2VXUL 3QUYC 4MA8H 5CD5D 4GQ9H 2Z3OA 3TBTA 1X5MA 4HJSA 2J8RA 1OTSC 1UACL 3VFTB 4YHKH 5I6MA 3CXHJ 3TN0D 1MLBA 5J0BA 3DGVA 2WO4A 2VM4A 2YPLE 3KPQA 3FO1B 5HYJD 2EYRB 3LN4B 5IGXH 3HRZA 3BP4A 4IDJH 4IOFD 4LHUB 1T0NA 1HDMB 5I75B 5LRGA 2A5UA 3V0WL 3HE6A 5I66B 1LAPA 4ORGA 4NS0A 4GSDH 4Z8FH 3QEGH 1KGYE 4QBJA 5I8EA 1HWHB 2R0ZH 1RIHL 1SVBA 3H0TA 1E67A 3OHXA 4GG6F 2AFNA 3MMEA 4AVAA 4NSKB 4CVUA 2OL3H 3NAAH 3JV0A 2W59A 4QHNA 5SX4H 3HE7D 2XWCA 1S7VB 1XF5B 3FU8A 4ZODA 1PJ9A 5TDPB 3S3PA 3OPZL 1IBHA 1TT6A 1JWMA 3ZDXB 3K1KC 2HT2C 4NGPA 1WAAA 3PL6A 1ZLUH 4P2OC 4DETA 4FXKB 4LIQE 1AQDA 3CVCA 1E2ZA 3V8OA 3UTTE 3ARVA 5JIIA 5I6XB 3U48A 3BVNA 3VGBA 4B9YA 3R4RA 3US1A 3CXQA 3BAJA 2W0FB 2J8UA 4KRPB 2ZG2A 3CSFA 3B5GA 4JS7A 5IJBC 1Z5LA 1R3KA 1BMGA 4GKOA 4P23D 3AT0A 5DUMH 4KDTC 4CPAA 3NPSB 1C5BH 1OWRM 2DQGH 3GS4A 4MMZB 4LIQL 1D9KB 1R33A 5CSBA 5C0EA 2YN3A 3QUML 3WFBH 3H7BA 3SZKC 2XQYG 4LASL 4FD7A 4FLHA 3D12B 2WUBL 3S3SA 1S78D 3FO2B 1AMPA 3Q2NA 1OB0A 1TF8A 2ED7A 5GS0H 1ZGLA 2I60H 3DDDA 5DVOA 3VD3A 4Z7QF 1F8TH 1THCA 3FTYA 2K4WA 4H8WC 1Y0YA 1FYHB 3FTVA 2TSBA 4BM7A 3DGGB 3DXAD 1JV2A 4O9HL 1NIDA 3QO1B 3VE0B 4FG6D 1VFAA 4LLVA 3ISRA 3T4YA 4UZGA 5JHAA 3QULB 3B3WA 4F2FA 1SDAB 3BIBX 4U0RC 1XGPA 4KAQH 3BJ8A 2ATRA 2YMXL 3SDCC 4PGEB 3MLUL 1JK9A 3KPTA 4Q52A 3RWEB 2RFHA 4U6YB 1EXUA 1KCUH 5D7LD 1FG2B 2DICA 5D93C 4CKVX 1J5IA 4C7HA 2MWCA 3V7ZA 1YAIA 1MHEB 2VMJA 5D7JC 4AENA 1WFNA 3ESNA 4QHUA 3NIGE 1L7IH 1S9WB 2VEZA 1FL6B 1G0DA 1M2VB 2R0LL 3GSUB 5ISZE 2E7BA 5JGFA 1CICB 1M7DB 5BZZA 5A7EA 3V0VA 4Z7WB 4MCRA 2WIIA 2CCVA 2IBZY 3FU6A 3I9GL 3EOBB 2Y69B 3SPIA 1EHXA 5DJDA 1NDGB 1SOXA 2ALAA 4Z7OF 4QRUA 4AYFA 3WTTA 2VZUA 1WTLA 1FYTA 4CMHB 4HJGB 4R0LA 4HS3A 4X6FB 3TBWA 3DPBA 2VLJA 4PW4A 4PJHE 5L2KA 3U6RB 4KK5C 2X4PA 3S2CA 3NSDA 1QPXA 1E6JL 3QQDA 1HCZA 3MRLB 4PS4H 3SN6N 4AXVA 3DBSA 4YDKH 3IGAB 3SPGA 2WCPA 4I0KA 5J1AB 4M5TA 4OZFB 3P3YA 1HAUA 1AGEB 2Y07H 3FO1A 4MNHB 3DHJA 3AS1A 5AAWC 2VMEA 4LHUA 4A04A 3GSOA 2FIAA 3U7WH 2Z3MA 4PK3A 1MIEH 5AZ2L 1LFWA 2FX8H 4P57A 3GB7A 1T0OA 4NZDA 3U1SH 3TEYA 1ETZB 1GHEA 1VIXA 2R1IA 5AL0A 2WHVA 4F7CA 2VAAB 1LO3H 4B96A 1A7BA 1S7VA 5J3HC 2PJ5A 3S3BB 1SF5A 2VKXA 4NPJA 1R3NA 3SPCA 2IFGA 2ZZUT 3JXAA 4KV5F 2GB2A 4A6YB 5L0QB 4ODUB 3W0WB 3Q2LA 2F53E 3BZEA 3KPSB 2ZCKH 4L0YA 5C07E 1H3PH 2HVJB 3MUGB 3K1DA 1YHPA 5C70A 3QCUL 5C0BD 1BOYA 4Z7QB 2NNXA 4AYBA 4QO1B 3IJYA 3IJ8A 1F4YL 2Y6SD 3UZVB 3KLDA 3Q8BA 2QQLL 2YC1A 4B9CA 4M3SA 1MWAL 3BHBB 4K7FA 1RZGB 3W3BA 1Q72L 1JWQA 5C97A 1PZAA 2ZXAA 3GXNA 3DMMA 5F9OH 1AZVA 4NWTH 4POYA 4UM8B 3C12A 3MJ9A 4X6EB 5D7SH 3VB9A 3CMGA 2NNAA 2O5NA 1CF8L 3ZGHA 5FFLA 1U42A 3EO1A 1IAII 2AQQA 2W9LA 2ESVE 1I8MB 2EEXA 3ESVF 1I7ZB 5GRXG 1ZE3H 2DJMA 5KYNA 2N1KA 4XXCA 5HHME 2V7HA 5KZCD 3RB7A 4KQ3L 2X4OB 3AREC 4XB8A 1WCBB 1JPGA 4D8PB 1M1XA 4KLVA 3OLIA 1K8IA 5F6HJ 2HMIC 3D51A 1QSVA 4PRIB 2GREA 4KLWA 3OLGA 5EEVA 1XGQA 4U0QB 3VFVA 3VD0A 4B53A 5IY5B 3G5ZB 3KPNB 5EC1A 5B1BB 4BGLA 3MNZA 2VRAA 2ICCA 2X4UB 4L4VD 1MRDH 3SE9L 4AUUA 5AVZB 5HHVH 3NJLA 5GZNA 4YWGL 5A2AA 2OKMA 5J6SA 3TJEH 2D0HA 3CE1A 3OKOA 4PRBB 3W5MA 3EO4A 3P69A 2E7MA 3GMQA 2CJTA 3LDBB 2KQMA 4M7LH 1Z8LA 3KPMB 1TVDA 1EAPB 4B5EA 1I1CA 3S88H 3LMSA 2D7MA 5IESH 4LK4A 2HT3C 4YOKA 1HXKA 3EG9A 1DVUA 5IJDC 2P26A 2QPDB 4OJYA 4ZMPA 2AXGA 3LXAA 4KZCA 5H37A 1TXRA 4NCDA 2OTWA 3ARBC 2Q86A 1I1AC 5AG8A 2NXYB 3VQ2C 2BNRA 4DGYL 1NAMH 5MENB 4KJPC 1G5GA 1FFNA 3GXPA 1M3IA 3ZTEA 4QJ4B 4IM8A 1KWKA 3HG1D 4GG6A 4Y1TA 3FUKA 4K7PL 3LH2L 1DVSA 2J5LB 3QJHB 3NA4A 4HPOL 3DX9A 4YIQB 5JPNA 2OZ4A 3CSYB 1UXSB 3ZKXB 1P4IH 3E1F1 2C3VB 3SGKC 1QTSA 2VXTL 3KS0J 1LE5B 3QUHA 2Y23A 4L1SA 4IKKA 1WBYB 2QPSA 3VWKB 5BS0A 1MNUL 4CRYB 1QYGL 2DD8L 2WQWA 1ZLVK 4AJVA 2H0PA 2A4EA 5BXFA 3D87B 5M94B 1SDYA 1DQML 3P54A 4NQDB 5IM7B 1R5WB 2XTJB 1A9EA 1B4JL 3CZJA 4GQRA 3NCXA 4AJWA 2ICWB 4PRAB 2FQGA 2EH7H 3GO1L 1JGDB 2J6EL 2X4NA 3MROA 4XPFH 1T83C 3B7UX 3CWGA 4I0PD 4CSPA 4PRDA 1ZJAA 3RIAK 5IHLB 5M7QA 4ODUA 2P43B 3L08A 1OD7A 3L1FA 4EN3A 3PHAA 3F65A 1FHGA 2DTSA 2ZUXA 3KPSA 3D09A 5ALBH 1M7IA 3AXHA 3KBFA 2HVJA 3A6CH 3GS7A 5DK0B 3SKUD 2VDOL 3O4OC 3U0TA 2WXGA 3UIZA 4C2ZA 2J8UE 3T6QC 2F7QA 3C09B 1OGPA 1SYSB 4QGTA 3NRQA 1ITBB 1BEYL 5IT2L 1EHLL 1KSRA 4F8PA 1E42A 4MMYB 1I1RA 3IU2A 5FCUL 1JYWA 1CJYA 2X2JA 5FHAH 2WPXA 2E9WA 1KN2L 3JWDC 5EF1A 3GHPA 4JKMA 1OZUA 1F6FB 2PJ4A 4OLVH 3D9AL 2R4SH 4U4BA 5AZUA 4FL4C 4JG9A 4ODSH 5EZJB 2VQ1B 3VFOA 4P4BA 1W72A 2K7PA 5B22A 1QBBA 2J1WA 1WFMA 2R2HB 5EPMB 4EI5C 4KOWA 1WHPA 2PJ2A 2IIJA 3MGTB 4OGAD 3CFBA 1I7ZA 4JR9H 4DGUA 4ZUTB 2DKMA 3ARGD 3ZHNA 3RRQA 1NLDL 2IOOA 2EVJA 1WCBA 3QNFA 1UWGH 3CVDA 4FFWC 5E0QA 1VIWA 5HI3C 4I48A 3UTPE 1OPOA 2QL1A 1U6AL 5FKPB 2Y72A 4LLQB 4ODXB 3DX7A 2YWYA 3NCEB 3I6LE 4A38A 4PJ5B 1MEXH 5ISZD 2A9AA 2H8PA 4AY0A 2CLVB 3DI2B 3TX8A 3P4MA 3ALPA 1G9MH 2QR0A 2Z1KA 3QA3B 4LARL 1EFXB 4OCRL 1N0LB 5L9DH 1MFVA 2FEDD 3IDYB 4UT9A 2ZCLH 3LZPA 1FNAA 2FECI 3ECBA 4D9RD 3EGXB 4HCIA 4WGWB 1QW8A 1CLVA 3DLQR 4EQ2A 2B1OA 2P6GA 4NC1E 3KBHE 1E28A 3T1FA 4UM9B 1LO0L 1QO3A 3B1TA 1HC1A 3P3RA 3MRFA 2BERA 5BQDA 1V8HA 3H6JA 5JO5A 1B6DA 1SOSA 3ETBF 5TH2A 3OKEB 3MNMA 3OLEA 4WWKD 1Z4RA 1P6WA 4IS6A 3UPAA 5FUOH 2FR4A 1WE5A 3PP9A 1LDSA 4GSUA 4HH9B 2CBOA 1F1GA 2EXWD 1U8MB 2VLJE 2E47A 3H2WA 5L2KE 1PJWA 4JUSA 1I85C 3S9LA 4Z5RA 1KNOB 4UI2A 3QJHA 4RX4D 2XN2A 2BL1A 2AGJH 4HJUA 1YMMB 4NKOA 1RK0B 2LU3A 4HKZA 3VFNA 3NA9L 3UAFA 5AB0A 3QSKB 3PB7X 2VB5A 1TG8A 5A43C 2NR6D 2CH8A 5D6DA 4NQQA 1NBZB 4Q9CA 2Z7WA 3V5HA 3ULUF 2IPKB 2YKLL 2PO6A 4BCYA 5DJCA 1ZHLB 3U82B 1AJ7H 1CGYA 2F53D 3MYZA 3GXTA 1NICA 4QT5B 5TK2A 3T8XA 4K3EL 3S6FA 1RMFL 5EUOB 4DGIH 1TEFA 4GRWB 4RN7A 2BINA 3RPIB 3GSNA 5IWLA 3ZDYF 3F6LA 5JIKA 1BYNA 5IHUL 4OAEA 3DX8A 1E50A 2HLFC 1YEFL 4J4PC 4NO2A 2OZHA 1QWNA 3SQOL 4RBPK 4WJKB 2Q7SA 2O4EA 5I1CH 3RX7A 1XF2A 1CPXA 2X89D 1BZ7B 5DMJB 3U7YL 2WYTA 1TITA 3BT0A 4P46C 3CN1A 1DLFH 4J1UB 2P8LA 2WTRA 3GUTB 1A14H 2O5XL 1A1OA 3TT2A 5D9SB 2LU5A 2ESVD 4WVRA 4X5LA 3WSQH 3DOIA 2FATL 3OJMB 1YYML 4DEPB 5ILTH 2CTCA 4XP5L 3NSYA 1WD8A 1GS7A 2X9WA 5ID1A 2AQRA 5HHMD 4JFXB 3CT9A 2UX6A 3V4PB 3P9WB 1IO4C 2WKOA 4FLOA 3SEPA 1WWCA 1OF0A 4F57L 4UIBA 4M6OH 2WKGA 2OFQA 3NEXA 5C0CB 5IROD 4TQIA 4LHJB 5KANI 1XF1A 4U3XA 5GRUH 3TVMD 4ONWA 3QUKB 2VW4A 1VHOA 5GQBA 4HUXB 3C6LB 3GPSA 3L5IA 4ELMB 1TMCB 4FQXD 4Y4FC 4P4KA 5JW4Q 1OSPH 4GEIA 4MMXC 2HRGA 3HPLA 3V0HA 5I1IH 2FX9H 2NY0B 4X2UA 2F54A 2PABA 4I13B 4NPKA 5IZ7A 1YREA 4YBHA 2ROXA 2OZNA 4YXHL 3DO3A 5E8NA 3JWNC 2NY6D 4GXVL 4KXAA 3AQDA 1CM0A 2I7SA 3OMIB 4ODTL 1EFXA 3IXTB 4HWZB 3CUPB 1T66D 2EZ0C 5LAXB 1A7NH 4E0AA 4JFEA 2NNCA 3EGXA 5I8CB 2GPZA 3OKLB 3QDME 1HN1A 1AOHA 3HBQA 5MP6L 2BS71 3Q8CA 5IKCA 3IMRA 4ODVH 4UM9A 3GMNA 1KLGA 1C9SA 4RIRB 3RVVD 5K59F 4YZWA 3HZVB 3B37A 3HHRB 2NYQA 1KIPB 4BGDA 3M7OA 2FSDA 4MNQA 4N2MA 4HPYL 3JVFC 1SF3A 3GK8H 1UJ3B 3V9FA 1GYWA 1AMXA 3OKNA 2AFUA 5F89A 2BNRE 2XVLA 1IGFL 4MA1C 4MZIA 5JHBA 1JN6A 3IJ3A 3GLDA 4BD9A 4OZGB 2Q7NA 3S3JA 3O6FA 5DMYA 2UY6B 1KTDA 2NMSA 4DT2A 3RVTC 4TL5A 4AOFA 5MHSE 4GI8A 1RJCA 1BD2E 3HE6D 1KBVA 3IRPX 3PRZA 1UATA 1WEJL 2DOCA 1E6OH 4N20A 5DJ0A 2J8NA 4E9QA 2ZAIA 1QUNB 5FO2A 4OAWA 3P2FA 4MAZA 3ZDYB 2NXZD 4HIJB 2JTYA 2ZUQB 4UTAH 1HEZB 4PCKA 5KVFH 2PCYA 4RMTA 4C8XA 3LKNB 4YDMA 3PB8X 5C7XL 3VH8G 2FJSA 1KENL 2CUAA 1YYLL 2IQ9H 1FBIL 1LE9A 5C9JA 3LRKA 3UEZA 1PPIA 3OMZA 4YWYA 2QKIB 2OZ4L 2BFVH 3CFKA 3ZRFC 3H8EA 3GBDA 3A3YB 2ZIDA 3RPIA 3MODL 4M43H 4P5MA 1HYRC 4O02H 4OF0A 3SBPA 1MY5A 1CFMA 2CJUL 4KQ4H 2B4DB 4DTGH 2J25A 1CBJA 1MLCA 3FQWA 1I9RH 2VSDA 1NMCC 4F7TA 3QEQB 2PXYC 3SI1A 2DPSA 1TENA 4NQEE 1YDPB 2YAQA 2MCPH 1AS8A 4P48A 3ME0A 1ZA6B 2MQ3A 3RWDA 3IE4A 4XWOC 3SDDA 1NFIB 1CD1A 2J2ZA 4W4NA 4JHWL 2C9PA 3D39A 5DRWB 3D34A 2V2TB 2XJKA 2QLVB 4KOTA 4U7SA 3EZ8A 1Z0MA 4R9MA 4ABUA 3RFZC 2A74B 2F8IA 2VLRB 4BA0A 1JWUB 4E5XG 1SN0A 4TNWK 3W2DH 1KLFA 3BWAB 5LDUA 4N25A 5I5IA 3CDXA 3MCLL 1WYJA 3LN5A 5A2JH 5CIPH 5C0CA 2P48B 3ORJA 1JHLH 2Z92A 1QSNA 4YDVA 4ZMOA 3NCYS 3VRIB 1NGQH 1G0XA 2ITCB 3K72A 2X4SA 5E8PA 4PY7B 4FQHB 5EA0L 2ZAGA 1JHTB 2R27A 2UX7A 3CVBA 1ZLVH 4F8TA 1PBYA 3I6LD 3IFOB 2AJZA 1UD2A 1MFEL 1R3IH 2R0KL 3I9IA 4WV1C 5DS0A 2DQ6A 4HWEH 1PLGH 4P3WA 2BS8A 2DWDA 3QNYB 1H0DB 4RSYA 5AYQA 5KYXB 3DO4A 3CSGA 3W9DA 4ABVA 3BKCL 5GS1B 3IBOA 4W6YB 2HFTA 2PPDA 2YPKB 3OPUA 1ZCRA 3N0PB 1R3JB 3IJSB 3TS8A 2PQ8A 3O45B 5D4QA 4XCYA 4NKDB 1UM5L 4PSRA 5EF3A 1NBYA 3F85A 5E03A 4Q9QL 4U33A 4N9GA 2OB0A 1ZHBA 4Z7OE 1ILUA 3NESA 4AW7A 1DVFC 4HIPA 4U6VH 1Y1UA 2A2QT 1PDKB 1O9ZA 2C34A 1MAMH 3ATBA 3K6DA 3TT1H 3N9GL 4F8ZA 2WQUA 1NIFA 2R69A 4N3UA 4Y7MA 5EBLB 5E70A 4ZXBC 4B14A 1HINL 1FYTD 2IGFL 4KROC 5IHHA 2FLRT 1YR0A 1F6AA 3TTSA 2VLJD 2VZOA 5L2KD 1E2VA 5E99H 4IBLT 3BP5A 3FQNA 5ESAA 1UJ3A 5IB1B 1TO4A 4UT9L 2Q04A 1NEPA 3I6KA 2A1WL 3LKQB 4JUTA 1FGVL 1RD6A 3O2WL 4MJIB 1FNLA 5KVGE 2Y0MA 1JGEB 4GP5B 4LSUL 1Q2YA 1JCKA 2YQBA 4GRMA 2XHNA 3CN4A 4BFFA 1CFQB 5B7FA 2R8SL 4KOUA 2OULB 4KTEH 2Q4VA 1DJHA 3C6SA 3SQBA 5CJ5A 1NCCH 3JZYA 1NKOA 1P6AB 2HX8A 1OXYA 2HKHL 1H8LA 3CHSA 1LO2L 1A5FL 3O3DB 3TBVA 4C4BA 2EO9A 4K2UL 3AZUA 4NT6B 4S2SA 5GSVA 3ZT6A 3ZBMA 1OCZB 1DBML 2AC0A 4CYOA 5KVGL 3V38A 1AFVL 1U95B 4MJ6A 1KJMB 2E5EA 3FZUC 5C7ZA 4KHTH 4NJ9H 3WHE0 2ZEHA 3IDNA 4XVSL 4N0UB 5E5MA 4KUZH 1A6VL 1BG1A 4AM0A 2X0WA 4MCSA 4QIRA 1TIUA 2MCAA 4Q6IC 4BE6A 1YEIH 3TH4T 2D73A 1D5BB 3VH8B 1SMOA 2W07B 3ASOB 3VD4A 3RU8H 1B87A 1BZDA 5I15H 5EMIA 1I8KB 3VI4B 3NFSL 1E8YA 1OL0A 1QPKA 2FGZA 2VOTA 4L4VB 5DQJA 3MRIB 3NCCB 4P4IA 1HX0A 2AQ3A 1JZFA 1YDPA 3LXBA 1CD9B 1F4XL 4UEEA 1LM8V 3DMMD 1KEGH 4GKNB 4ONUA 4X8JA 1S5HA 1UD3A 3ZQXA 3QG6A 2JLLA 3BVUA 1UEYA 3ENEA 2D31A 4AWJC 1KB5L 2CM6A 3PWUA 3WEAA 2V2XA 3D8PA 4J6RH 4RGNC 4BZ1H 4OIDA 3DA0A 1JXJA 2NZ9C 3APCA 2ZOTA 3OKYA 4TS6A 4CVWA 2O5YL 4P44A 1T2JA 3BWAA 1NC4B 3G6JB 2UWEB 2KERA 1KCKA 4JDZA 3BSHA 3ZDZF 2ADGA 3FQXB 4MA3A 2BP3A 2HVKB 5TF0A 1L6ZA 5FO7A 1XSOA 4A2DA 1QLRA 4MDJA 3B35A 5AVXB 4E5XB 1S5KA 1CT8B 1HJBC 4YHMH 1D5ZA 1U8IB 2BNQA 4LKCA 3RGVA 5CP3H 2YPLB 1NUDA 4UCNA 3ZL1A 1OSZA 4NQVB 4EO5A 4NC0B 1OTSD 1EEUA 4FG0A 4BUGA 2JKXA 1RZFL 4R5TA 5T1MB 2VDPL 2WW8A 3C8DA 3V0IA 3N42B 2MHAB 3DTUB 3ZZIA 2XV6B 4IGBC 5GZND 4LSSH 2F54E 2BOAA 5DR5H 5EU5A 1KIUA 3DX3A 3CFEB 3FCSB 4GSXA 4F7PA 5L2JB 2RFXB 4HPSA 3TFBA 3BP7B 5GJSL 2QLYA 1AANA 4C55A 5BV7C 3ARDB 2AF2A 5JIQA 3UJJL 3K2KA 2ICEC 1VFOA 4RBPH 3VXSA 3TEWA 3KH4A 4ZY2A 3E2HC 3GSVB 3O81A 4PB0L 3TO4B 1NCDH 1NCBL 2FJUB 5DD3L 1T3FB 3L3HB 5CCHE 3UPRA 6CPAA 4ERSH 4YXLL 4TSAH 1QEXA 5ITBL 1W80A 5B1AB 4C2XA 1XMEB 1Q0XL 4JFEE 1IYLA 1Q9KB 1UOLA 3UTTB 1QSTA 1J8SA 1DFBH 2G3MA 3QRGH 4H1LA 1DSFH 2G60H 2BNRD 4FJZA 2O6DA 4N5UA 5CN1A 1WWBX 5D8JL 4POZD 3QXVA 2NYYD 3LQAC 4XBPB 5F7WC 5IMKA 4MXWH 5E08L 1RJLB 2GK0B 1DEEB 5TFSL 1JXGA 2XWDA 5I1JH 3LMJH 5C71A 1BD2D 1HNGA 2B4CL 3BUQA 1G1KA 4GQPH 3PJLA 3NUKA 3NABH 3TWCL 3UAEA 1AD0A 4EKJA 4Z6AT 1YEHH 2NY1D 4BBWA 1X4XA 5BS0D 2MNWA 2FQEA 4M9OA 1QVOA 3O6LH 3O3AB 3P11H 2VZ1A 4LF3B 5IFHL 5H94B 3DBXB 4Y16D 1DUYA 2CE6A 2GJ6B 3TFYA 3LD2A 2Q8BL 1U8NB 2G9HA 4HAFA 4FTVB 1BM3H 1F11A 3OM3B 2JI3A 1YY9D 2OXHA 3OV6A 1B0GA 1LILA 1J1OL 1BV8A 1XO8A 2JB6B 3KPOB 3GRWA 5IHZB 2OW6A 1IGTB 2CMRH 3DYMA 2Y7LA 1K8DB 3KDMB 2V5RA 1ZIBA 3MRRB 2EIKB 3OXRB 4GAJL 1Z9UA 4A2HA 4Y49B 2OW7A 4K5OA 1CLOL 3D50A 2HH0L 4W9JC 4EN3D 2AK4B 3P4OB 3BUBA 1B0WA 4KPHL 3MV9A 2Z3FA 5KJRL 4PG9A 1J5OL 5E23A 2AK1L 43CAB 3D66A 1QD0A 4YBLC 4XAWL 1A7OL 2CPUA 4B10A 2C9AA 4NRYB 1K5WA 4ZUVB 4Z7AA 5E6IC 5MEOA 3X1EA 1LTXA 3G5WA 4LDCA 3TJPA 4I2XA 1KZQA 5T3ZE 1ZHKB 3O0RH 4P4DA 3UJIH 5AVTB 2B77A 2DMHA 2QADC 2YUVA 4K5MA 4AYID 2WCGA 2Y3NA 1X7TA 5FYKU 1FZJB 4MCNA 4Y2DA 3ABMB 4I1RA 4EIGB 4JHZA 1ILSA 3D39E 1MCNA 5FAAA 3CBKB 3VB8A 5BOJA 5D1XA 4ZOBA 2BDNH 3L3OA 3WN6A 3L5JA 4LRNL 3GMOA 3A6BL 5T3ZL 3LB6C 4HA1A 1WBXB 3V6FA 2IAMB 3H3PH 4LLMA 4AQ1B 3HNVL 2G2NA 1OLLA 4A2EA 3LNGA 3QPQD 2WZPD 3RB5A 3IFNL 7FABH 2X12A 4E5XA 1SJVA 2DM3A 1NKGA 2YOAA 5FKAA 4AEEA 5J06A 1NAKL 4OP4A 1RO5A 3C5ZA 2E59A 2EUXA 1G0YR 1Y7RA 4FXTA 4XN1A 2IGTA 1FHNA 4AGLA 1DHKA 5AAMA 1OAUH 1QFWH 4BA8A 3IGUA 1PNDA 4NQSB 3PFUA 5D96C 4V1DA 4ZS6D 1IKFL 3REWB 2WB1A 3CFEA 1PZDA 2J20A 5L2JA 3ZLQC 4PLJC 1BX2B 4CVXA 2ZYIA 1PFCA 5I1EL 4WSGA 2X6AA 1HL4A 2XKNB 3BPOB 3NCMA 5AALA 4AIOA 5IJVB 1BQ5A 4HZLB 1E4JA 1OAQL 5LNDA 5E4IA 1A1NA 2FS5A 3FO0L 1KYAA 2BSWA 2VR8A 8FABA 3QIUC 3F6IA 4NKIH 3LEXB 4XZUB 4L4TE 3QEUB 2ATAA 2F53B 2IXQA 4FERA 4Q38A 3SQRA 2NPLX 1I9JH 5LN4A 5C07B 1VHEA 4KX9A 4JFWA 4NM4L 3NGBB 1EDQA 1P7QA 2ZXQA 5DHVH 1VLXA 4HSQA 1J0ZA 2QHLA 3WY3A 1KPRA 3L3DA 1YEKL 4IBSA 3QFDA 3V4VA 3TC9A 1C5DA 4IOIB 4NKQB 3ZZQA 4MHNA 4LKXA 1QTYT 1S9XA 3ZMNA 4HETA 3REVA 2X7BA 3ILQC 2X6CA 5CZVL 4CKQA 1ZANL 4X0NA 1A4JB 5DZ9A 2R69L 1XSKA 5CR8A 3OR7A 4UILL 2IH3B 3JZ7A 5JIMA 3U0WL 2W60B 4YC2B 4X7DC 4UINL 2NQ3A 5DRXB 2HFFB 1Z6JT 4LF3A 4PJCF 2JKIS 3RX8A 4DJMA 2C4FU 2PO6D 4FAAB 3TURA 3K9TA 1KBGH 1MCOL 1IKOP 2XA8L 4ZAKA 3S9DB 2PTTB 2C3WA 1CD0A 3DHMA 4FTVA 4GMTH 1SLUA 1TCRA 3GJEA 3QT2A 1F90H 3EF4A 4MHZA 4M1GH 5KSAC 4OQTL 2AVFA 1OARH 2G3ZA 3QHZL 2JB6A 4PQAA 3ML8A 3UBXA 4F3FB 1HXYA 4YX2H 3SBRA 3KPPA 4YFLI 3GY9A 4XBGB 1NKRA 3M1BB 3GFUA 1CIUA 2AQTA 1TETL 2DWEA 2IC2A 1S46A 1TCMA 3LJ3A 1QLFB 2AK4A 2BIMA 4IK7A 4ADIA 5C3LD 1L0CA 3QB8A 2XWJB 4G3YL 5F71A 1KCSL 4FFVC 2IFFH 4JJOA 4P5TC 2OOTA 4OJDH 1MPAH 5HGAA 1QUPA 4JRLA 3HPJB 4WFGE 4JM4H 2K5TA 4GT7A 3WOVA 4GXUM 4JPWL 3MREB 4LP8A 2BRRH 2CRYA 5INCB 2BP0A 1NMTA 4Y2LA 5MI0B 3AVEA 4YHPB 2ZOLB 1I8AA 4J3BA 3SJXA 1N12A 5DYOA 4Y19A 2I07B 1AY1L 3EFFA 5GRJH 5CEYA 1PYWB 4G6JH 4FOMA 3WN5C 2A6IA 3JWNE 4MQTB 3WD5H 2GSGA 3WUZA 2CKBH 5K9QG 4JK0D 4XXWA 3HMXA 3FFDA 3BWUF 3FBUA 4JN2B 4PJ9C 2HXAA 3DRQA 1XD1A 1R46A 4J39A 3DLJA 3QXAA 4TXVB 4P4KD 3ARBD 3ZYJA 5SWZA 1HI6B 1TEGA 2XWZA 2DMKA 2F54D 1LK2B 4MD5B 1I8IB 2SEBB 1VPOL 5IVZA 2J56A 2BSSA 1IC0A 4IMLB 2HWZH 3UBGA 4FXGB 4NUJA 3FYNA 3FQTA 2GABA 4YE0A 4ZSOE 2EDWA 1CL7I 3NZHH 2HT4C 2K6YA 2DJ4A 4PY8I 1AUGA 4PJDF 1NPJA 3GBNH 2AXFA 3BFQG 3PPEA 3PV6B 4OCWL 3UDWC 2X1QA 5DVMA 1LOKA 2ZEGA 1F5WA 4JFED 2OI9B 3W9EB 3X1GA 1KTLB 4HVBA 2JF1A 1YNTF 5K59E 1JZ8A 5IEHA 4NSQA 4BFKA 2WBJA 2C1OA 4G8GE 3OSVA 4PG2C 3VXSE 3UG4A 2HFGL 2WLMA 4ALAC 4OCNC 3F00A 5BV7H 4DVBB 3FUHA 4O51B 3FB5B 4Q97A 2VLKB 4WO4B 3MRGB 3WIHA 2OQJA 3VQMA 2WXIA 2R0WL 3KYMA 4YPGA 4ONHA 4RLDA 4Q9RL 5B7EA 4JB9H 4ONGH 5PAZA 1TZAA 3OZ9H 3IEHA 3GTNA 4FE9A 1FNSH 3QUXB 3O6FD 5ABAA 3BQUC 3N7ZA 5F7NC 2QMKA 2YAPA 1A6WL 5F1KC 1LMIA 4Z77A 1P4BL 3QPXH 4J28A 4ELKB 2DQFB 2W65A 1T5WA 4MQXC 1VFBB 1KCRL 2R23B 1PQZA 3MRNB 1S7SB 5CP7B 3W11D 1UH2A 4M4PA 2BUEA 5KG9A 3VXNA 3NJXA 4KVNL 2OK0H 2ZNWA 3BDYH 4LNVA 1GTFA 2WJ5A 2Y06L 3B2UD 3JV6A 4Z7UE 1AQKH 3R19A 4P3CL 4XT1C 5C0AE 4HDIB 3GLAA 5H2BB 3QGVA 5EEZA 4Y5VC 3CX5K 5EU4B 4K07A 4NGHH 3U7AA 1DBJL 1MZZA 2A9BA 4F2MA 2UZYB 1OSEA 5K1VA 2XFXA 2YRLA 2RCSL 4X5KA 4B97A 1I7UA 1QLFA 4FFWD 4G42A 4AMKH 1GOFA 3MV9E 4LO9A 2XWBA 3N43F 4HJJL 2CDEB 3D39D 3GRWL 2Y1YA 2B1HL 2VW6A 2JEWA 3R0MA 4N2FA 4I2XE 3UMNA 3ECUA 3CU7A 2OL3A 3SJVE 4WW2F 4NI3A 3ARUA 3TTHA 3VXPB 2ZXEB 3L4ZA 1Z2LA 4QHMA 1UZ8B 3EDFA 4XC3H 4YBQD 3KLAA 4MFJA 4IBZA 3BI9X 4MD0B 5INDA 2H3XC 4LGSB 4A67A 4AVCA 4O5LH 4XCEA 1G7HB 4B11A 1T20A 1QA9A 5KBLA 2Z35A 1HWWA 3GNML 4Z7VE 2EAEA 3S5ZA 2C7FA 1EZUA 2G5BA 1RY7B 1IEAB 4M5SA 2AQ1A 2FIKB 2Y7SA 4J8RA 4JO2H 4S11A 4ZW6A 4F20A 4NP4H 1AOZA 4HKFA 3GSWA 5TE6L 4UOW0 2ABZA 4IEFB 4PJDB 4FI6A 3H85A 3RL1A 5A3ID 3ZY7A