2B4DA

Ssat+coa+sp- sp disordered
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
170
structure length
170
Chain Sequence
AKFVIRPATAADCSDILRLIKELAKYEYMEEQVILTEKDLLEDGFGEHPFYHCLVAEVPKEHWTPEGHSIVGFAMYYFTYDPWIGKLLYLEDFFVMSDYRGFGIGSEILKNLSQVAMRCRCSSMHFLVAEWNEPSINFYKRRGASDLSSEEGWRLFKIDKEYLLKMATEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Diamine acetyltransferase 1
publication title Structures of wild-type and mutant human spermidine/spermine N1-acetyltransferase, a potential therapeutic drug target
pubmed doi rcsb
source organism Homo sapiens
total genus 35
structure length 170
sequence length 170
ec nomenclature ec 2.3.1.57: Diamine N-acetyltransferase.
pdb deposition date 2005-09-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 2b4dA00
1KZFA 2PR8A 1LRZA 3CXPA 1M1DA 3FRMA 4IUSA 3G3SA 4KVXA 1SQHA 4KORA 3DDDA 3R95A 3B8GA 4NEXA 5KTAA 5H84A 3BLNA 3R9FA 4FD4A 3W6SA 4B5OA 2HV2A 1IYLA 4EVYA 1S7LA 5E96A 4PSXA 3SXNA 1CJWA 4CAWA 1GHEA 3FIXA 4QBJA 2AE6A 4R3LA 2X7BA 1PUAA 1Y9KA 4PSWA 4XPDC 5J8FA 1WK4A 1RO5A 3FYNA 4RS2A 1PU9A 3IWGA 4YGOA 3ZJ0A 1TIQA 2ZPAA 2QECA 2R7HA 1M4IA 3D2PA 1S7NA 4HNXB 3DNSA 1B87A 5ISVA 3D2MA 1KUVA 2P6FA 3V8IA 4MY0A 2OH1A 4XPDB 4F0YA 3MGDA 2C27A 3F0AA 2B3UA 3I9SA 2VQYA 4FD5A 1M4GA 1QSTA 2BUEA 3H4QA 4E2AA 4GS4A 1S3ZA 3P2HA 4JLYA 4HKFA 3R9EA 3TTHA 4MBUA 1MJBA 1VKCA 5EC4A 2GANA 5DWNA 2ZW4A 1R57A 3VWDA 1IICA 2VZYA 2FXFA 2BL1A 1I21A 2Q4VA 1FY7A 4R9MA 1KUYA 4FD7A 2G3TA 3FBUA 3G8WA 2WPWA 1NMTA 1YLEA 1Z9UA 2ZW7A 1QSOA 3TOAA 3T90A 1BO4A 1Z4RA 1VHSA 4KUAA 1S60A 4I49A 2OZGA 2VBQA 4KLWA 3R9GA 2BEIA 2QIRA 4AB7A 2ZXVA 4KOWA 2KCWA 3BJ8A 3W6XA 1OZPA 1M44A 3DR8A 1S5KA 1QSMA 1S7KA 1XE4A 2CNMA 2PR1A 4K30A 3OWCA 4LX9A 4KVME 1B6BA 1Q2YA 1UFHA 3EY5A 1YR0A 3KKWA 4KOUA 2F5IA 3LD2A 3QB8A 2VZZA 3CXSA 2RC4A 1QSRA 3S6KA 3S6GA 4MHDA 3N7ZA 2ZW5A 3UY5A 3FB3A 3IGRA 1Z4EA 2PC1A 4XPLA 4U5YA 2NMTA 4JJXA 2O28A 2Q04A 3JVNA 5JPHA 3S6HA 2G3AA 4ONUA 4UA3A 4UWJA 1KUXA 4NXYA 3FNCA 1XF8A 2B4DA 5IV0A 1YGHA 2PDOA 4HNWB 4CRZB 5HH1A 5F47A 2JEVA 2I00A 2GIVA 1MJAA 4AG9A 5HMNA 2Q0YA 4KLVA 3BJ7A 2DXQA 4OLLA 2FIWA 2PRBA 2OZUA 2Y0MA 2JDDA 4E8OA 2QMLA 3D3SA 2CNTA 1S7FA 4KVOE 3F5BA 5I0CA 1M4DA 5GCNA 4XNHC 4X5KA 4YRHA 1K4JA 1YX0A 3P2FA 4U9YA 1Q2DA 2JDCA 2PQ8A 4CAVA 1BOBA 5J8CA 1L0CA 2R98A 3CXQA 4U9ZA 2P0WA 4LUAA 4KOSA 4MY3A 4XNHB 4DNCA 2A4NA 4JXQA 5IB0A 3EXNA 4NSQA 2CNSA 3PP9A 2D4PA 4QVTA 2IL4A 3RYOA 4UWIA 2Z10A 4JWPA 2WPXA 1P0HA 4ZBGA 2B5GA 3TO6A 3TO7A 2PSWA 2REEA 3VWEA 2JLMA 1V0CA 2R1IA 3S6FA 3FXTA 1P4NA 3T9YA 2HUZA 2VXKA 2FCKA 4B5PB 5FVJA 4IF5A 2Z11A 3NE7A 5JQ4A 4PK2A 3LODA 2D4OA 4FD6A 2FS5A 3K9UA 4CS0B 1I1DA 3EFAA 3E0KA 3QAHA 3PGPA 1Y7RA 2Q7BA 1Q2CA 4CRYB 4M85A 4H6ZA 5C88A 3F8KA 4L8AA 4HNYB 3TCVA 2J8RA 4MJ8A 4R87A 2B4BA 4H6UA 2OU2A 3GYAA 5IX3A 4R57A 2P6GA 4AG7A 1YREA 3PZJA 1NSLA 3JUWA 4L89A 4NCZA 1IB1E 2GE3A 2J8NA 4M3SA 5H86A 1Y9WA 3GY9A 4AVBA 2Q44A 2B4DB 3GKRA 1YK3A 1MK4A 3ZZIA 2B58A 4QC6A 4UBRA 2P6EA 2VEZA 3D8PA 2ARHA 5DWMA 3SXOA 2J8MA 1I12A 4ORFA 2REFA 3R1KA 2FL4A 2VI7A 1XEBA 3TO9A 4AVCA 4RI1A 4KOYA 4E0AA 4OAEA 3EC4A 4MI4A 4JXRA 1J4JA 1ON0A 1XMTA 1NE9A 4CAXA 2FE7A 3TE4A 2EUIA 3DSBA 2R8VA 4R3KA 2ZW6A 5CNPA 4H89A 2B3VA 3TOBA 2K5TA 4Y49C 1IIDA 2OB0A 5F46A 3WR7A 2I79A 4OADA 1QSNA 2FSRA 4II9A 4F6AA 1WWZA 3I3GA 2G0BA 4J3GA 1U6MA 2CY2A 4JD6A 2OZHA 3EO4A 4AVAA 4NF1A 5KTCA 4Y49B 2FIAA 2EVNA 3TFYA 1MJ9A 2Z0ZA 4KUBA 5EBVA 1XIXA 2B5GB 2FT0A 2ATRA 5KTDA 4XPKA 3SHPA 4YFJA 4KOTA 1N71A 5F49A 4KZTA 4PV6A 5F48A 2HQYA 4PK3A 4BMHA 1YVKA 2H5MA 2BSWA 5C82A 3W91A 1RXTA 3C26A 4KOVA 2AJ6A 2Q4YA 3TT2A 4KOXA 3R96A 1CM0A 1IYKA 4QUSA 3DR6A 1YVOA 4B5PA 4QB9A
chains in the Genus database with same CATH superfamily
1KZFA 2AFSA 2HC9A 2EWBA 1LRZA 1ZLHA 2PR8A 3CXPA 4FWUA 4LQGA 1M1DA 3FRMA 4G1PA 2I3CA 2PJBA 5G22A 1Y0YA 4IUSA 3G3SA 3PB7X 4KVXA 3BI0A 3RAMA 4FAIA 3V38A 5JH9A 3FEEA 1YSJA 1SQHA 4KORA 3DDDA 3R95A 4M6HA 4YWYA 3B8GA 2ZEHA 3BHXA 3PFOA 4P4JA 2XEGA 3LMSA 4NEXA 5KTAA 5LYDA 4NGQA 5H84A 3BLNA 2RFHA 2ZEEA 1YW4A 4OP4A 3R9FA 4FD4A 3W6SA 4A38A 4B5OA 4ZGYB 2HV2A 1IYLA 4PPZA 2JEWA 4EVYA 1S7LA 5E96A 1IGBA 1ZLIA 2XEJA 4PSXA 3SXNA 1CJWA 4CAWA 1GHEA 4ZYQA 3FIXA 4YU9A 1LAPA 3CPXA 4QBJA 2AE6A 2FVGA 2X7BA 4R3LA 4UCMA 1PUAA 1Y9KA 3SI2A 4PSWA 4XPDC 4P4FA 5AG5A 5J8FA 4UCPA 1WK4A 1RO5A 3FYNA 4RS2A 1PU9A 3IWGA 2Q51A 5DS0A 3KASA 4YGOA 3PRTA 1M4LA 1TIQA 3HUVA 4ZX9A 3RNZA 2ZPAA 2QECA 3ZJ0A 5K8NA 2R7HA 4C2YA 3QAYA 1M4IA 1CG2A 3D2PA 3V7ZA 4CGLA 1S7NA 1QQ9A 4HNXB 3DNSA 4P10A 1B87A 3FEDA 5ISVA 4MFPA 1ARLA 3D2MA 1KUVA 1R43A 3H8EA 2P6FA 1TF9A 3V8IA 3KQXA 2OH1A 4MY0A 4XPDB 4F0YA 3MGDA 3NE8A 2C27A 4OMEA 2Z3KA 1ARMA 3F0AA 4O23A 4BD9A 4MXUA 2B3UA 3I9SA 2VQYA 4FD5A 4R76A 1M4GA 5AG7A 3SJFA 4B12A 2CIJA 1QSTA 1LCPA 2BUEA 2GLJA 1X12A 3H4QA 3NFZA 4NGSA 4RN7A 4E2AA 3FMCA 4GS4A 1S3ZA 3P2HA 2GU2A 4JLYA 2ZENA 4HKFA 3R9EA 1VGYA 3FJUA 3WT4A 2POKA 2C6CA 4MBUA 1MJBA 3TTHA 4FUUA 4F9VA 1IOIA 1VKCA 2WUUA 4A30A 5JGFA 3IFEA 2CXAA 2GANA 2ZW4A 1R57A 5DWNA 5EC4A 3VWDA 1KWMA 1IICA 2VZYA 2NYQA 2FXFA 3FVLA 3PBBA 2BL1A 4X2TA 5HVFA 1I21A 2EO8A 2Q4VA 2ZEPA 2ZOGA 4M6GA 1FY7A 3L2NA 4NGMA 4R9MA 4C68A 1KUYA 2QYVA 4FD7A 2G3TA 1YQEA 3B35A 1YLOA 3FBUA 4MFZA 1AYEA 4NJQA 3G8WA 2WPWA 1NMTA 1YLEA 2PVWA 1Z9UA 2ZW7A 2VL1A 1QSOA 3TOAA 3T90A 1BO4A 1Z4RA 2JBJA 1VHSA 4KUAA 4A31A 4RUHA 2HB6A 1S60A 4IHMA 1Y7EA 4B11A 3IU1A 1AUGA 4I49A 5LYIA 1LANA 4C7IA 4ZI6A 2PJ9A 2PIYA 2V77A 3RO0A 2OZGA 2VBQA 1TKHA 3CPAA 4OC3A 1EE3P 4P4IA 4KLWA 4A39A 3R9GA 1F2PA 2BEIA 2QIRA 4AB7A 1TKJA 3LACA 4F9UA 4ONWA 2ZXVA 4KOWA 3IWEA 4KS9A 2KCWA 3BJ8A 3W6XA 4P6YA 3MN8A 3TX8A 2ODFA 4OC2A 2AFMA 2PJ2A 1OZPA 1M44A 1ZG9A 3DR8A 2IJZA 1Z8LA 4IAVA 1S5KA 4K3NA 1QSMA 4TNUA 1S7KA 1XE4A 4OIDA 4KSIA 2CNMA 2PR1A 2YNDA 4K30A 1NSAA 3OWCA 4OIWA 4LX9A 4KVME 1B6BA 1Q2YA 1UFHA 1Z8XA 3EY5A 5LRJA 4CGOA 2Z3MA 4F8ZA 3NH5A 1YR0A 3KKWA 4KOUA 2F5IA 2QJ8A 3LD2A 4GM5A 4PXEA 3QB8A 4NGNA 2VZZA 3CXSA 7CPAA 1BPNA 2RC4A 1CP6A 1QSRA 3D4UA 1ZO0A 3S9LA 4R6TA 3S6KA 3S6GA 3FH4A 4MHDA 3N7ZA 2ANPA 2ZW5A 3UY5A 1XJOA 3CZXA 3FB3A 3IGRA 3B3VA 4MFLA 1Z4EA 4R8FA 2Z3PA 4CYPA 2PC1A 3KQZA 1Z8TA 4MHYA 4XPLA 2PCUA 4U5YA 2NMTA 3A9LA 3QNVA 4JJXA 2O28A 4MHNA 2Q04A 3JVNA 4P4DA 5JPHA 1VIXA 2ABZA 1Q7LA 4AXVA 2EK9A 4PQAA 3S6HA 1XRYA 2F7VA 2YNEA 3PBEA 2G3AA 4ONUA 4UA3A 3IJ3A 4UWJA 1KUXA 4NXYA 3CDXA 5AG6A 2PJ6A 3FNCA 1IOFA 1XF8A 2B4DA 5G21A 5IV0A 2Z3LA 2C6PA 5AGEA 1GYTA 3JRUA 5JM6A 1YGHA 2PDOA 4HNWB 2JBKA 1F2OA 4CRZB 5HH1A 4CYOA 5F47A 2XEFA 3TC8A 2JEVA 2I00A 1CPSA 2GIVA 1MJAA 4AG9A 5AG4A 1Y0RA 2ZELA 5HMNA 2Q7SA 2V8HA 2XEIA 2Q0YA 4KLVA 1Z5RA 2Q4ZA 3BJ7A 2DXQA 3KR4A 2EK8A 4OLLA 3ISZA 1FNOA 4CAFA 2FIWA 2PRBA 2OZUA 2IQ6A 2Y0MA 4MHZA 4CPAA 4C7HA 1LFWA 2JDDA 3K9TA 4E8OA 2PJ0A 2QMLA 3D3SA 2CNTA 1S7FA 3PFEA 1PYTB 5HXDA 2Z3NA 4P4BA 1PCAA 3RZAA 4EFDA 1X10A 2DEAA 4CGNA 3F5BA 1Z2LA 4KVOE 4B13A 5I0CA 1M4DA 4OC0A 5GCNA 3KGQA 4XNHC 4X5KA 4YRHA 1K4JA 1YX0A 5G20A 2YGWA 3P2FA 4UFWA 4U9YA 4ZY0A 1Q2DA 2JDCA 2PQ8A 1ELLP 1HDQA 4FBEA 1TXRA 2CF4A 4CAVA 1BOBA 5J8CA 3D7HA 1L0CA 2WSAA 2R98A 3IO1A 4MRIA 1TKFA 4CYQA 2PJ1A 3CXQA 4U9ZA 5CPAA 3GIUA 1BAVA 2PIZA 4UIBA 2GLFA 2P0WA 4LUAA 4KOSA 4H2KA 4MY3A 4XNHB 4A33A 5K8MA 5CBMA 4OC5A 4DNCA 2A4NA 4A32A 4MMOA 4JXQA 5IB0A 2ZEGA 4DJLA 4C2XA 2BCOA 3DLJA 3PEIA 2YNCC 1QMUA 3EXNA 4NSQA 1Z8WA 2CNSA 3PP9A 3D7DA 2QVPA 1CBXA 2D4PA 4QVTA 2IL4A 1FT7A 3B3CA 3RYOA 2BO9A 4UWIA 1JQGA 3VH9A 1HEEA 4BBHA 2Z10A 4NFRA 4JWPA 2WPXA 1P0HA 3CT9A 3D68A 5THWA 4ZBGA 2B5GA 2PJ7A 3TO7A 2PSWA 2REEA 3IWWA 3TO6A 3FF3A 3VWEA 3KI9A 3WC5A 8CPAA 2JLMA 2Z3OA 1V0CA 5D8NA 4WJBA 2R1IA 3GB0A 3KHZA 3S6FA 3FXTA 4Q38A 1P4NA 2PJCA 4MCRA 2V8GA 2J9AA 3T9YA 1ZG7A 2PE3A 2HUZA 2VXKA 2FCKA 3VATA 4B5PB 5FVJA 4IF5A 2AFOA 3S9NA 5EMIA 1XMBA 4BINA 3ISXA 2Z11A 3NE7A 3HLPA 4ZY2A 3FECA 5JQ4A 4PK2A 3LODA 4JYWA 2D4OA 4FD6A 5LRGA 2FS5A 1XFOA 2PRQA 3IIBA 3B7IA 3K9UA 2OOTA 4CS0B 1I1DA 1F57A 3KZWA 3WABA 3D67A 1OBRA 3EFAA 5ELYA 4DYOA 2AFWA 3E0KA 1TF8A 3QAHA 3PGPA 1Y7RA 4P4EA 2ZEDA 1Q2CA 2Q7BA 4CRYB 4M85A 1LAMA 2ZEFA 4H6ZA 2ZEMA 4UEZA 5C88A 3SJEA 3F8KA 3GLJA 2NSMA 4KSAA 4L8AA 4M6IA 4R7MA 3NA6A 4HNYB 3TCVA 3B3TA 3H8GA 1VHOA 2J8RA 2PJ3A 2PJ4A 2B4BA 4H6UA 4MJ8A 4R87A 4CAEA 2OU2A 3GYAA 5IX3A 4R57A 2P6GA 4AG7A 1YREA 3PB4X 3PZJA 4MCPA 4A37A 1NSLA 4X8IA 3JUWA 4L89A 4NCZA 1IB1E 2GE3A 2J8NA 2OR4A 4M3SA 5H86A 4NGTA 2C6GA 4NGPA 1Y9WA 5HVHA 3IU2A 2O53A 2V8VA 3B2YA 3GY9A 3MRUA 4AVBA 3H5ZA 4EWTA 3S9MA 6CPAA 2Q44A 2B4DB 3GKRA 4OC1A 1YK3A 4TWEA 3KHXA 1DE4C 2ZOFA 3RBUA 1MK4A 3ZZIA 4UCNA 2PJ5A 2B58A 3SJXA 4MFJA 2AFZA 4PXDA 4QC6A 4UBRA 1HDUA 2P6EA 4MFQA 4PXBA 1AMPA 2CTBA 2V8DA 2VEZA 1RTQA 3D66A 3D8PA 1IY7A 2ARHA 5D29A 5DWMA 3NH8A 3SXOA 2GFQA 2J8MA 4P45A 1I12A 5A27A 4B6ZA 4ORFA 2REFA 3R1KA 2FL4A 2VI7A 1XEBA 3KL9A 1JWQA 3TO9A 3LWUA 5K8OA 3BI1A 4AVCA 4Z65A 4ZX8A 4RI1A 3PB8X 4HPSA 4KOYA 1CP7A 3NH4A 3GUXA 4OAEA 4E0AA 2WYRA 3IC1A 3EC4A 4MI4A 1LOKA 1J4JA 1ON0A 1XMTA 4JXRA 4P44A 5LRKA 3KR5A 2ZEOA 4ZY1A 2AFXA 4A2ZA 1IU8A 4GXHA 1NE9A 4CAXA 2FE7A 4NJRA 5A28A 2F8HA 2DPTA 2CTCA 2EUIA 3TE4A 3DSBA 5G1ZA 2R8VA 4A95A 4UEFA 2RB7A 4R3KA 2ZW6A 5CNPA 3I1UA 5BWAB 1XBUA 2PJAA 4H89A 2B3VA 3SI1A 3D7FA 3TOBA 2K5TA 3WC6A 4KSFA 4UFVA 4Y49C 4QB9A 1YMEA 4MFKA 4W9YA 1IIDA 5IB9A 4EMEA 2OB0A 2IMOA 3H8FA 2WZNA 3N5FA 2I79A 3WR7A 2AFUA 4A94A 4CYNA 5F46A 4OADA 1QSNA 2FSRA 3K2KA 3DGVA 3FX6A 4II9A 4F6AA 3IEHA 4DUKA 1WWZA 3I3GA 2O4HA 2BOAA 2G0BA 4JZ0A 4UFXA 4J3GA 1U6MA 2CY2A 4JD6A 1R3NA 2OZHA 3EO4A 4AVAA 4NF1A 4CGPA 5LYFA 1CPXA 4LQ6A 4MCQA 4B14A 5KTCA 4NGRA 2FIAA 4Y49B 2EVNA 1H8LA 1VHEA 4WWVA 5F09A 5I4MA 4PXCA 3TFYA 1MJ9A 2Z0ZA 1UWYA 3D7GA 3BXMA 5K8PA 4MCSA 4KUBA 3PB6X 5EBVA 1XIXA 3WC7A 1DTDA 1YW6A 4UF4A 4UIAA 2B5GB 4F0XA 2FT0A 2ATRA 4Q36A 4CGMA 5KTDA 4XPKA 3T8WA 3VARA 4UEEA 3SHPA 4YFJA 2G9DA 4KOTA 1N71A 3B3WA 4Q7AA 5F49A 4KZTA 1BLLE 2PJ8A 4PV6A 5F48A 2PVVA 2HQYA 4PK3A 4BMHA 1YVKA 1ZG8A 2EBJA 2H5MA 2BSWA 4IK2A 3SI0A 3PB9X 1RXTA 3W91A 1CX8A 5C82A 2C1CA 3B3SA 3C26A 4X3RA 2DF5A 4MHPA 2YNCA 2GREA 4C2ZA 1ELMP 2Q43A 4KOVA 3SJGA 2AJ6A 2Q4YA 5LYLA 1A2ZA 4OC4A 3TT2A 4B10A 4KOXA 3R96A 3JTKA 1CM0A 5HVGA 1IYKA 4OKOA 1BPMA 3DR6A 4QUSA 5J1QA 1YVOA 4B5PA 1XOVA 2DPSA
chains in the Genus database with same CATH topology
1KZFA 2PR8A 1LRZA 3CXPA 1M1DA 3FRMA 5G22A 4IUSA 3G3SA 4KVXA 1SQHA 4KORA 3DDDA 3R95A 3B8GA 4NEXA 5KTAA 5H84A 3BLNA 3R9FA 4FD4A 3W6SA 4B5OA 4ZGYB 2HV2A 1IYLA 4EVYA 1S7LA 5E96A 4PSXA 3SXNA 1CJWA 4CAWA 1GHEA 3FIXA 4QBJA 2AE6A 4R3LA 2X7BA 4UCMA 1PUAA 1Y9KA 4PSWA 4XPDC 5AG5A 5J8FA 4UCPA 1WK4A 1RO5A 3FYNA 4RS2A 1PU9A 3IWGA 4YGOA 3ZJ0A 1TIQA 2ZPAA 2QECA 2R7HA 4C2YA 4CGLA 1M4IA 3D2PA 1S7NA 4HNXB 3DNSA 1B87A 5ISVA 4MFPA 3D2MA 1KUVA 2P6FA 3V8IA 4MY0A 2OH1A 4XPDB 4F0YA 3MGDA 2C27A 2Z3KA 3F0AA 2B3UA 3I9SA 2VQYA 4FD5A 4B12A 1M4GA 5AG7A 1QSTA 2BUEA 3H4QA 4E2AA 4GS4A 1S3ZA 3P2HA 4JLYA 4HKFA 3R9EA 3TTHA 4MBUA 1MJBA 1VKCA 2WUUA 4A30A 5EC4A 2CXAA 2GANA 2ZW4A 1R57A 5DWNA 5BWAB 3VWDA 1IICA 2VZYA 2FXFA 2BL1A 1I21A 2Q4VA 1FY7A 4R9MA 4C68A 1KUYA 4FD7A 2G3TA 3FBUA 4MFZA 3G8WA 2WPWA 1NMTA 1YLEA 1Z9UA 2ZW7A 1QSOA 3TOAA 3T90A 1BO4A 1Z4RA 1VHSA 4KUAA 4A31A 1S60A 4B11A 3IU1A 4I49A 4C7IA 2OZGA 2VBQA 4KLWA 3R9GA 2BEIA 2QIRA 4AB7A 2ZXVA 4KOWA 3IWEA 4KS9A 2KCWA 3BJ8A 3W6XA 1OZPA 1M44A 3DR8A 1S5KA 1QSMA 1S7KA 1XE4A 2CNMA 2PR1A 2YNDA 4K30A 3OWCA 4LX9A 4KVME 1B6BA 1Q2YA 1UFHA 3EY5A 4CGOA 2Z3MA 1YR0A 3KKWA 4KOUA 2F5IA 3LD2A 3QB8A 2VZZA 3CXSA 2RC4A 1QSRA 1ZO0A 3S6KA 3S6GA 4MHDA 3N7ZA 2ZW5A 3UY5A 3FB3A 3IGRA 4MFLA 1Z4EA 4CYPA 2Z3PA 2PC1A 4XPLA 4U5YA 2NMTA 3A9LA 4JJXA 2O28A 2Q04A 3JVNA 5JPHA 3S6HA 2YNEA 2G3AA 4ONUA 4UA3A 4UWJA 1KUXA 4NXYA 5AG6A 3FNCA 1XF8A 2B4DA 5G21A 5IV0A 2Z3LA 5AGEA 1YGHA 2PDOA 4HNWB 4CRZB 5HH1A 4CYOA 5F47A 2JEVA 2I00A 2GIVA 1MJAA 4AG9A 5AG4A 5HMNA 2Q0YA 4KLVA 3BJ7A 2DXQA 4OLLA 4CAFA 2FIWA 2PRBA 2OZUA 2Y0MA 4C7HA 2JDDA 4E8OA 2QMLA 3D3SA 2CNTA 1S7FA 2Z3NA 4CGNA 3F5BA 4KVOE 4B13A 5I0CA 1M4DA 5GCNA 4XNHC 4X5KA 4YRHA 1K4JA 1YX0A 5G20A 2YGWA 3P2FA 4UFWA 4U9YA 1Q2DA 2JDCA 2PQ8A 4CAVA 1BOBA 5J8CA 1L0CA 2WSAA 2R98A 4CYQA 3CXQA 4U9ZA 2P0WA 4LUAA 4KOSA 4MY3A 4XNHB 4A33A 4DNCA 2A4NA 4A32A 4JXQA 5IB0A 4C2XA 2YNCC 3EXNA 4NSQA 2CNSA 3PP9A 2D4PA 4QVTA 2IL4A 3RYOA 4UWIA 4BBHA 2Z10A 4JWPA 2WPXA 1P0HA 4ZBGA 2B5GA 3TO6A 3TO7A 2PSWA 2REEA 3VWEA 2JLMA 2Z3OA 1V0CA 2R1IA 3S6FA 3FXTA 4Q38A 1P4NA 3T9YA 2HUZA 2VXKA 2FCKA 4B5PB 5FVJA 4IF5A 2Z11A 3NE7A 5JQ4A 4PK2A 3LODA 2D4OA 4FD6A 2FS5A 3K9UA 4CS0B 1I1DA 3EFAA 3E0KA 3QAHA 3PGPA 1Y7RA 2Q7BA 1Q2CA 4CRYB 4M85A 4H6ZA 5C88A 3F8KA 4L8AA 4KSAA 4HNYB 3TCVA 2J8RA 4MJ8A 4R87A 2B4BA 4H6UA 4CAEA 2OU2A 3GYAA 5IX3A 4R57A 2P6GA 4AG7A 1YREA 3PZJA 1NSLA 3JUWA 4L89A 4NCZA 1IB1E 2GE3A 2J8NA 4M3SA 5H86A 1Y9WA 3IU2A 3GY9A 4AVBA 3H5ZA 2Q44A 2B4DB 3GKRA 1YK3A 1MK4A 3ZZIA 4UCNA 2B58A 4MFJA 4QC6A 4UBRA 2P6EA 4MFQA 2VEZA 3D8PA 2ARHA 5DWMA 3SXOA 2J8MA 5A27A 1I12A 4ORFA 2REFA 3R1KA 2FL4A 2VI7A 1XEBA 3TO9A 4AVCA 4RI1A 4KOYA 4E0AA 4OAEA 3EC4A 4MI4A 4JXRA 1J4JA 1ON0A 1XMTA 4A2ZA 1NE9A 4CAXA 2FE7A 3TE4A 5A28A 2DPTA 2EUIA 3DSBA 5G1ZA 2R8VA 4A95A 4R3KA 2ZW6A 5CNPA 4H89A 2B3VA 3TOBA 2K5TA 4KSFA 4UFVA 4Y49C 4QB9A 4MFKA 1IIDA 2OB0A 5F46A 3WR7A 2I79A 4CYNA 4OADA 1QSNA 2FSRA 4II9A 4F6AA 1WWZA 3I3GA 2G0BA 4UFXA 4J3GA 1U6MA 2CY2A 4JD6A 2OZHA 3EO4A 4AVAA 4NF1A 4CGPA 4B14A 5KTCA 4Y49B 2FIAA 2EVNA 3TFYA 1MJ9A 2Z0ZA 4KUBA 5EBVA 1XIXA 2B5GB 4F0XA 2FT0A 2ATRA 4Q36A 4CGMA 5KTDA 4XPKA 3SHPA 4YFJA 4KOTA 1N71A 5F49A 4KZTA 4PV6A 5F48A 2HQYA 4PK3A 4BMHA 1YVKA 2H5MA 2BSWA 5C82A 3W91A 1RXTA 3C26A 2YNCA 4C2ZA 4KOVA 2AJ6A 2Q4YA 4B10A 3TT2A 4KOXA 3R96A 3JTKA 1CM0A 1IYKA 4QUSA 3DR6A 1YVOA 4B5PA 2DPSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KZF A;  2PR8 A;  1LRZ A;  3CXP A;  1M1D A;  3FRM A;  4IUS A;  3G3S A;  4KVX A;  1SQH A;  4KOR A;  3DDD A;  3R95 A;  3B8G A;  4NEX A;  5KTA A;  5H84 A;  3BLN A;  3R9F A;  4FD4 A;  3W6S A;  4B5O A;  2HV2 A;  1IYL A;  4EVY A;  1S7L A;  5E96 A;  4PSX A;  3SXN A;  1CJW A;  4CAW A;  1GHE A;  3FIX A;  4QBJ A;  2AE6 A;  4R3L A;  2X7B A;  1PUA A;  1Y9K A;  4PSW A;  4XPD C;  5J8F A;  1WK4 A;  1RO5 A;  3FYN A;  4RS2 A;  1PU9 A;  3IWG A;  4YGO A;  3ZJ0 A;  1TIQ A;  2ZPA A;  2QEC A;  2R7H A;  1M4I A;  3D2P A;  1S7N A;  4HNX B;  3DNS A;  1B87 A;  5ISV A;  3D2M A;  1KUV A;  2P6F A;  3V8I A;  4MY0 A;  2OH1 A;  4XPD B;  4F0Y A;  3MGD A;  2C27 A;  3F0A A;  2B3U A;  3I9S A;  2VQY A;  4FD5 A;  1M4G A;  1QST A;  2BUE A;  3H4Q A;  4E2A A;  4GS4 A;  1S3Z A;  3P2H A;  4JLY A;  4HKF A;  3R9E A;  3TTH A;  4MBU A;  1MJB A;  1VKC A;  5EC4 A;  2GAN A;  5DWN A;  2ZW4 A;  1R57 A;  3VWD A;  1IIC A;  2VZY A;  2FXF A;  2BL1 A;  1I21 A;  2Q4V A;  1FY7 A;  4R9M A;  1KUY A;  4FD7 A;  2G3T A;  3FBU A;  3G8W A;  2WPW A;  1NMT A;  1YLE A;  1Z9U A;  2ZW7 A;  1QSO A;  3TOA A;  3T90 A;  1BO4 A;  1Z4R A;  1VHS A;  4KUA A;  1S60 A;  4I49 A;  2OZG A;  2VBQ A;  4KLW A;  3R9G A;  2BEI A;  2QIR A;  4AB7 A;  2ZXV A;  4KOW A;  2KCW A;  3BJ8 A;  3W6X A;  1OZP A;  1M44 A;  3DR8 A;  1S5K A;  1QSM A;  1S7K A;  1XE4 A;  2CNM A;  2PR1 A;  4K30 A;  3OWC A;  4LX9 A;  4KVM E;  1B6B A;  1Q2Y A;  1UFH A;  3EY5 A;  1YR0 A;  3KKW A;  4KOU A;  2F5I A;  3LD2 A;  3QB8 A;  2VZZ A;  3CXS A;  2RC4 A;  1QSR A;  3S6K A;  3S6G A;  4MHD A;  3N7Z A;  2ZW5 A;  3UY5 A;  3FB3 A;  3IGR A;  1Z4E A;  2PC1 A;  4XPL A;  4U5Y A;  2NMT A;  4JJX A;  2O28 A;  2Q04 A;  3JVN A;  5JPH A;  3S6H A;  2G3A A;  4ONU A;  4UA3 A;  4UWJ A;  1KUX A;  4NXY A;  3FNC A;  1XF8 A;  2B4D A;  5IV0 A;  1YGH A;  2PDO A;  4HNW B;  4CRZ B;  5HH1 A;  5F47 A;  2JEV A;  2I00 A;  2GIV A;  1MJA A;  4AG9 A;  5HMN A;  2Q0Y A;  4KLV A;  3BJ7 A;  2DXQ A;  4OLL A;  2FIW A;  2PRB A;  2OZU A;  2Y0M A;  2JDD A;  4E8O A;  2QML A;  3D3S A;  2CNT A;  1S7F A;  4KVO E;  3F5B A;  5I0C A;  1M4D A;  5GCN A;  4XNH C;  4X5K A;  4YRH A;  1K4J A;  1YX0 A;  3P2F A;  4U9Y A;  1Q2D A;  2JDC A;  2PQ8 A;  4CAV A;  1BOB A;  5J8C A;  1L0C A;  2R98 A;  3CXQ A;  4U9Z A;  2P0W A;  4LUA A;  4KOS A;  4MY3 A;  4XNH B;  4DNC A;  2A4N A;  4JXQ A;  5IB0 A;  3EXN A;  4NSQ A;  2CNS A;  3PP9 A;  2D4P A;  4QVT A;  2IL4 A;  3RYO A;  4UWI A;  2Z10 A;  4JWP A;  2WPX A;  1P0H A;  4ZBG A;  2B5G A;  3TO6 A;  3TO7 A;  2PSW A;  2REE A;  3VWE A;  2JLM A;  1V0C A;  2R1I A;  3S6F A;  3FXT A;  1P4N A;  3T9Y A;  2HUZ A;  2VXK A;  2FCK A;  4B5P B;  5FVJ A;  4IF5 A;  2Z11 A;  3NE7 A;  5JQ4 A;  4PK2 A;  3LOD A;  2D4O A;  4FD6 A;  2FS5 A;  3K9U A;  4CS0 B;  1I1D A;  3EFA A;  3E0K A;  3QAH A;  3PGP A;  1Y7R A;  2Q7B A;  1Q2C A;  4CRY B;  4M85 A;  4H6Z A;  5C88 A;  3F8K A;  4L8A A;  4HNY B;  3TCV A;  2J8R A;  4MJ8 A;  4R87 A;  2B4B A;  4H6U A;  2OU2 A;  3GYA A;  5IX3 A;  4R57 A;  2P6G A;  4AG7 A;  1YRE A;  3PZJ A;  1NSL A;  3JUW A;  4L89 A;  4NCZ A;  1IB1 E;  2GE3 A;  2J8N A;  4M3S A;  5H86 A;  1Y9W A;  3GY9 A;  4AVB A;  2Q44 A;  2B4D B;  3GKR A;  1YK3 A;  1MK4 A;  3ZZI A;  2B58 A;  4QC6 A;  4UBR A;  2P6E A;  2VEZ A;  3D8P A;  2ARH A;  5DWM A;  3SXO A;  2J8M A;  1I12 A;  4ORF A;  2REF A;  3R1K A;  2FL4 A;  2VI7 A;  1XEB A;  3TO9 A;  4AVC A;  4RI1 A;  4KOY A;  4E0A A;  4OAE A;  3EC4 A;  4MI4 A;  4JXR A;  1J4J A;  1ON0 A;  1XMT A;  1NE9 A;  4CAX A;  2FE7 A;  3TE4 A;  2EUI A;  3DSB A;  2R8V A;  4R3K A;  2ZW6 A;  5CNP A;  4H89 A;  2B3V A;  3TOB A;  2K5T A;  4Y49 C;  1IID A;  2OB0 A;  5F46 A;  3WR7 A;  2I79 A;  4OAD A;  1QSN A;  2FSR A;  4II9 A;  4F6A A;  1WWZ A;  3I3G A;  2G0B A;  4J3G A;  1U6M A;  2CY2 A;  4JD6 A;  2OZH A;  3EO4 A;  4AVA A;  4NF1 A;  5KTC A;  4Y49 B;  2FIA A;  2EVN A;  3TFY A;  1MJ9 A;  2Z0Z A;  4KUB A;  5EBV A;  1XIX A;  2B5G B;  2FT0 A;  2ATR A;  5KTD A;  4XPK A;  3SHP A;  4YFJ A;  4KOT A;  1N71 A;  5F49 A;  4KZT A;  4PV6 A;  5F48 A;  2HQY A;  4PK3 A;  4BMH A;  1YVK A;  2H5M A;  2BSW A;  5C82 A;  3W91 A;  1RXT A;  3C26 A;  4KOV A;  2AJ6 A;  2Q4Y A;  3TT2 A;  4KOX A;  3R96 A;  1CM0 A;  1IYK A;  4QUS A;  3DR6 A;  1YVO A;  4B5P A;  4QB9 A; 
#chains in the Genus database with same CATH topology
 1KZF A;  2AFS A;  2HC9 A;  2EWB A;  1LRZ A;  1ZLH A;  2PR8 A;  3CXP A;  4FWU A;  4LQG A;  1M1D A;  3FRM A;  4G1P A;  2I3C A;  2PJB A;  5G22 A;  1Y0Y A;  4IUS A;  3G3S A;  3PB7 X;  4KVX A;  3BI0 A;  3RAM A;  4FAI A;  3V38 A;  5JH9 A;  3FEE A;  1YSJ A;  1SQH A;  4KOR A;  3DDD A;  3R95 A;  4M6H A;  4YWY A;  3B8G A;  2ZEH A;  3BHX A;  3PFO A;  4P4J A;  2XEG A;  3LMS A;  4NEX A;  5KTA A;  5LYD A;  4NGQ A;  5H84 A;  3BLN A;  2RFH A;  2ZEE A;  1YW4 A;  4OP4 A;  3R9F A;  4FD4 A;  3W6S A;  4A38 A;  4B5O A;  4ZGY B;  2HV2 A;  1IYL A;  4PPZ A;  2JEW A;  4EVY A;  1S7L A;  5E96 A;  1IGB A;  1ZLI A;  2XEJ A;  4PSX A;  3SXN A;  1CJW A;  4CAW A;  1GHE A;  4ZYQ A;  3FIX A;  4YU9 A;  1LAP A;  3CPX A;  4QBJ A;  2AE6 A;  2FVG A;  2X7B A;  4R3L A;  4UCM A;  1PUA A;  1Y9K A;  3SI2 A;  4PSW A;  4XPD C;  4P4F A;  5AG5 A;  5J8F A;  4UCP A;  1WK4 A;  1RO5 A;  3FYN A;  4RS2 A;  1PU9 A;  3IWG A;  2Q51 A;  5DS0 A;  3KAS A;  4YGO A;  3PRT A;  1M4L A;  1TIQ A;  3HUV A;  4ZX9 A;  3RNZ A;  2ZPA A;  2QEC A;  3ZJ0 A;  5K8N A;  2R7H A;  4C2Y A;  3QAY A;  1M4I A;  1CG2 A;  3D2P A;  3V7Z A;  4CGL A;  1S7N A;  1QQ9 A;  4HNX B;  3DNS A;  4P10 A;  1B87 A;  3FED A;  5ISV A;  4MFP A;  1ARL A;  3D2M A;  1KUV A;  1R43 A;  3H8E A;  2P6F A;  1TF9 A;  3V8I A;  3KQX A;  2OH1 A;  4MY0 A;  4XPD B;  4F0Y A;  3MGD A;  3NE8 A;  2C27 A;  4OME A;  2Z3K A;  1ARM A;  3F0A A;  4O23 A;  4BD9 A;  4MXU A;  2B3U A;  3I9S A;  2VQY A;  4FD5 A;  4R76 A;  1M4G A;  5AG7 A;  3SJF A;  4B12 A;  2CIJ A;  1QST A;  1LCP A;  2BUE A;  2GLJ A;  1X12 A;  3H4Q A;  3NFZ A;  4NGS A;  4RN7 A;  4E2A A;  3FMC A;  4GS4 A;  1S3Z A;  3P2H A;  2GU2 A;  4JLY A;  2ZEN A;  4HKF A;  3R9E A;  1VGY A;  3FJU A;  3WT4 A;  2POK A;  2C6C A;  4MBU A;  1MJB A;  3TTH A;  4FUU A;  4F9V A;  1IOI A;  1VKC A;  2WUU A;  4A30 A;  5JGF A;  3IFE A;  2CXA A;  2GAN A;  2ZW4 A;  1R57 A;  5DWN A;  5EC4 A;  3VWD A;  1KWM A;  1IIC A;  2VZY A;  2NYQ A;  2FXF A;  3FVL A;  3PBB A;  2BL1 A;  4X2T A;  5HVF A;  1I21 A;  2EO8 A;  2Q4V A;  2ZEP A;  2ZOG A;  4M6G A;  1FY7 A;  3L2N A;  4NGM A;  4R9M A;  4C68 A;  1KUY A;  2QYV A;  4FD7 A;  2G3T A;  1YQE A;  3B35 A;  1YLO A;  3FBU A;  4MFZ A;  1AYE A;  4NJQ A;  3G8W A;  2WPW A;  1NMT A;  1YLE A;  2PVW A;  1Z9U A;  2ZW7 A;  2VL1 A;  1QSO A;  3TOA A;  3T90 A;  1BO4 A;  1Z4R A;  2JBJ A;  1VHS A;  4KUA A;  4A31 A;  4RUH A;  2HB6 A;  1S60 A;  4IHM A;  1Y7E A;  4B11 A;  3IU1 A;  1AUG A;  4I49 A;  5LYI A;  1LAN A;  4C7I A;  4ZI6 A;  2PJ9 A;  2PIY A;  2V77 A;  3RO0 A;  2OZG A;  2VBQ A;  1TKH A;  3CPA A;  4OC3 A;  1EE3 P;  4P4I A;  4KLW A;  4A39 A;  3R9G A;  1F2P A;  2BEI A;  2QIR A;  4AB7 A;  1TKJ A;  3LAC A;  4F9U A;  4ONW A;  2ZXV A;  4KOW A;  3IWE A;  4KS9 A;  2KCW A;  3BJ8 A;  3W6X A;  4P6Y A;  3MN8 A;  3TX8 A;  2ODF A;  4OC2 A;  2AFM A;  2PJ2 A;  1OZP A;  1M44 A;  1ZG9 A;  3DR8 A;  2IJZ A;  1Z8L A;  4IAV A;  1S5K A;  4K3N A;  1QSM A;  4TNU A;  1S7K A;  1XE4 A;  4OID A;  4KSI A;  2CNM A;  2PR1 A;  2YND A;  4K30 A;  1NSA A;  3OWC A;  4OIW A;  4LX9 A;  4KVM E;  1B6B A;  1Q2Y A;  1UFH A;  1Z8X A;  3EY5 A;  5LRJ A;  4CGO A;  2Z3M A;  4F8Z A;  3NH5 A;  1YR0 A;  3KKW A;  4KOU A;  2F5I A;  2QJ8 A;  3LD2 A;  4GM5 A;  4PXE A;  3QB8 A;  4NGN A;  2VZZ A;  3CXS A;  7CPA A;  1BPN A;  2RC4 A;  1CP6 A;  1QSR A;  3D4U A;  1ZO0 A;  3S9L A;  4R6T A;  3S6K A;  3S6G A;  3FH4 A;  4MHD A;  3N7Z A;  2ANP A;  2ZW5 A;  3UY5 A;  1XJO A;  3CZX A;  3FB3 A;  3IGR A;  3B3V A;  4MFL A;  1Z4E A;  4R8F A;  2Z3P A;  4CYP A;  2PC1 A;  3KQZ A;  1Z8T A;  4MHY A;  4XPL A;  2PCU A;  4U5Y A;  2NMT A;  3A9L A;  3QNV A;  4JJX A;  2O28 A;  4MHN A;  2Q04 A;  3JVN A;  4P4D A;  5JPH A;  1VIX A;  2ABZ A;  1Q7L A;  4AXV A;  2EK9 A;  4PQA A;  3S6H A;  1XRY A;  2F7V A;  2YNE A;  3PBE A;  2G3A A;  4ONU A;  4UA3 A;  3IJ3 A;  4UWJ A;  1KUX A;  4NXY A;  3CDX A;  5AG6 A;  2PJ6 A;  3FNC A;  1IOF A;  1XF8 A;  2B4D A;  5G21 A;  5IV0 A;  2Z3L A;  2C6P A;  5AGE A;  1GYT A;  3JRU A;  5JM6 A;  1YGH A;  2PDO A;  4HNW B;  2JBK A;  1F2O A;  4CRZ B;  5HH1 A;  4CYO A;  5F47 A;  2XEF A;  3TC8 A;  2JEV A;  2I00 A;  1CPS A;  2GIV A;  1MJA A;  4AG9 A;  5AG4 A;  1Y0R A;  2ZEL A;  5HMN A;  2Q7S A;  2V8H A;  2XEI A;  2Q0Y A;  4KLV A;  1Z5R A;  2Q4Z A;  3BJ7 A;  2DXQ A;  3KR4 A;  2EK8 A;  4OLL A;  3ISZ A;  1FNO A;  4CAF A;  2FIW A;  2PRB A;  2OZU A;  2IQ6 A;  2Y0M A;  4MHZ A;  4CPA A;  4C7H A;  1LFW A;  2JDD A;  3K9T A;  4E8O A;  2PJ0 A;  2QML A;  3D3S A;  2CNT A;  1S7F A;  3PFE A;  1PYT B;  5HXD A;  2Z3N A;  4P4B A;  1PCA A;  3RZA A;  4EFD A;  1X10 A;  2DEA A;  4CGN A;  3F5B A;  1Z2L A;  4KVO E;  4B13 A;  5I0C A;  1M4D A;  4OC0 A;  5GCN A;  3KGQ A;  4XNH C;  4X5K A;  4YRH A;  1K4J A;  1YX0 A;  5G20 A;  2YGW A;  3P2F A;  4UFW A;  4U9Y A;  4ZY0 A;  1Q2D A;  2JDC A;  2PQ8 A;  1ELL P;  1HDQ A;  4FBE A;  1TXR A;  2CF4 A;  4CAV A;  1BOB A;  5J8C A;  3D7H A;  1L0C A;  2WSA A;  2R98 A;  3IO1 A;  4MRI A;  1TKF A;  4CYQ A;  2PJ1 A;  3CXQ A;  4U9Z A;  5CPA A;  3GIU A;  1BAV A;  2PIZ A;  4UIB A;  2GLF A;  2P0W A;  4LUA A;  4KOS A;  4H2K A;  4MY3 A;  4XNH B;  4A33 A;  5K8M A;  5CBM A;  4OC5 A;  4DNC A;  2A4N A;  4A32 A;  4MMO A;  4JXQ A;  5IB0 A;  2ZEG A;  4DJL A;  4C2X A;  2BCO A;  3DLJ A;  3PEI A;  2YNC C;  1QMU A;  3EXN A;  4NSQ A;  1Z8W A;  2CNS A;  3PP9 A;  3D7D A;  2QVP A;  1CBX A;  2D4P A;  4QVT A;  2IL4 A;  1FT7 A;  3B3C A;  3RYO A;  2BO9 A;  4UWI A;  1JQG A;  3VH9 A;  1HEE A;  4BBH A;  2Z10 A;  4NFR A;  4JWP A;  2WPX A;  1P0H A;  3CT9 A;  3D68 A;  5THW A;  4ZBG A;  2B5G A;  2PJ7 A;  3TO7 A;  2PSW A;  2REE A;  3IWW A;  3TO6 A;  3FF3 A;  3VWE A;  3KI9 A;  3WC5 A;  8CPA A;  2JLM A;  2Z3O A;  1V0C A;  5D8N A;  4WJB A;  2R1I A;  3GB0 A;  3KHZ A;  3S6F A;  3FXT A;  4Q38 A;  1P4N A;  2PJC A;  4MCR A;  2V8G A;  2J9A A;  3T9Y A;  1ZG7 A;  2PE3 A;  2HUZ A;  2VXK A;  2FCK A;  3VAT A;  4B5P B;  5FVJ A;  4IF5 A;  2AFO A;  3S9N A;  5EMI A;  1XMB A;  4BIN A;  3ISX A;  2Z11 A;  3NE7 A;  3HLP A;  4ZY2 A;  3FEC A;  5JQ4 A;  4PK2 A;  3LOD A;  4JYW A;  2D4O A;  4FD6 A;  5LRG A;  2FS5 A;  1XFO A;  2PRQ A;  3IIB A;  3B7I A;  3K9U A;  2OOT A;  4CS0 B;  1I1D A;  1F57 A;  3KZW A;  3WAB A;  3D67 A;  1OBR A;  3EFA A;  5ELY A;  4DYO A;  2AFW A;  3E0K A;  1TF8 A;  3QAH A;  3PGP A;  1Y7R A;  4P4E A;  2ZED A;  1Q2C A;  2Q7B A;  4CRY B;  4M85 A;  1LAM A;  2ZEF A;  4H6Z A;  2ZEM A;  4UEZ A;  5C88 A;  3SJE A;  3F8K A;  3GLJ A;  2NSM A;  4KSA A;  4L8A A;  4M6I A;  4R7M A;  3NA6 A;  4HNY B;  3TCV A;  3B3T A;  3H8G A;  1VHO A;  2J8R A;  2PJ3 A;  2PJ4 A;  2B4B A;  4H6U A;  4MJ8 A;  4R87 A;  4CAE A;  2OU2 A;  3GYA A;  5IX3 A;  4R57 A;  2P6G A;  4AG7 A;  1YRE A;  3PB4 X;  3PZJ A;  4MCP A;  4A37 A;  1NSL A;  4X8I A;  3JUW A;  4L89 A;  4NCZ A;  1IB1 E;  2GE3 A;  2J8N A;  2OR4 A;  4M3S A;  5H86 A;  4NGT A;  2C6G A;  4NGP A;  1Y9W A;  5HVH A;  3IU2 A;  2O53 A;  2V8V A;  3B2Y A;  3GY9 A;  3MRU A;  4AVB A;  3H5Z A;  4EWT A;  3S9M A;  6CPA A;  2Q44 A;  2B4D B;  3GKR A;  4OC1 A;  1YK3 A;  4TWE A;  3KHX A;  1DE4 C;  2ZOF A;  3RBU A;  1MK4 A;  3ZZI A;  4UCN A;  2PJ5 A;  2B58 A;  3SJX A;  4MFJ A;  2AFZ A;  4PXD A;  4QC6 A;  4UBR A;  1HDU A;  2P6E A;  4MFQ A;  4PXB A;  1AMP A;  2CTB A;  2V8D A;  2VEZ A;  1RTQ A;  3D66 A;  3D8P A;  1IY7 A;  2ARH A;  5D29 A;  5DWM A;  3NH8 A;  3SXO A;  2GFQ A;  2J8M A;  4P45 A;  1I12 A;  5A27 A;  4B6Z A;  4ORF A;  2REF A;  3R1K A;  2FL4 A;  2VI7 A;  1XEB A;  3KL9 A;  1JWQ A;  3TO9 A;  3LWU A;  5K8O A;  3BI1 A;  4AVC A;  4Z65 A;  4ZX8 A;  4RI1 A;  3PB8 X;  4HPS A;  4KOY A;  1CP7 A;  3NH4 A;  3GUX A;  4OAE A;  4E0A A;  2WYR A;  3IC1 A;  3EC4 A;  4MI4 A;  1LOK A;  1J4J A;  1ON0 A;  1XMT A;  4JXR A;  4P44 A;  5LRK A;  3KR5 A;  2ZEO A;  4ZY1 A;  2AFX A;  4A2Z A;  1IU8 A;  4GXH A;  1NE9 A;  4CAX A;  2FE7 A;  4NJR A;  5A28 A;  2F8H A;  2DPT A;  2CTC A;  2EUI A;  3TE4 A;  3DSB A;  5G1Z A;  2R8V A;  4A95 A;  4UEF A;  2RB7 A;  4R3K A;  2ZW6 A;  5CNP A;  3I1U A;  5BWA B;  1XBU A;  2PJA A;  4H89 A;  2B3V A;  3SI1 A;  3D7F A;  3TOB A;  2K5T A;  3WC6 A;  4KSF A;  4UFV A;  4Y49 C;  4QB9 A;  1YME A;  4MFK A;  4W9Y A;  1IID A;  5IB9 A;  4EME A;  2OB0 A;  2IMO A;  3H8F A;  2WZN A;  3N5F A;  2I79 A;  3WR7 A;  2AFU A;  4A94 A;  4CYN A;  5F46 A;  4OAD A;  1QSN A;  2FSR A;  3K2K A;  3DGV A;  3FX6 A;  4II9 A;  4F6A A;  3IEH A;  4DUK A;  1WWZ A;  3I3G A;  2O4H A;  2BOA A;  2G0B A;  4JZ0 A;  4UFX A;  4J3G A;  1U6M A;  2CY2 A;  4JD6 A;  1R3N A;  2OZH A;  3EO4 A;  4AVA A;  4NF1 A;  4CGP A;  5LYF A;  1CPX A;  4LQ6 A;  4MCQ A;  4B14 A;  5KTC A;  4NGR A;  2FIA A;  4Y49 B;  2EVN A;  1H8L A;  1VHE A;  4WWV A;  5F09 A;  5I4M A;  4PXC A;  3TFY A;  1MJ9 A;  2Z0Z A;  1UWY A;  3D7G A;  3BXM A;  5K8P A;  4MCS A;  4KUB A;  3PB6 X;  5EBV A;  1XIX A;  3WC7 A;  1DTD A;  1YW6 A;  4UF4 A;  4UIA A;  2B5G B;  4F0X A;  2FT0 A;  2ATR A;  4Q36 A;  4CGM A;  5KTD A;  4XPK A;  3T8W A;  3VAR A;  4UEE A;  3SHP A;  4YFJ A;  2G9D A;  4KOT A;  1N71 A;  3B3W A;  4Q7A A;  5F49 A;  4KZT A;  1BLL E;  2PJ8 A;  4PV6 A;  5F48 A;  2PVV A;  2HQY A;  4PK3 A;  4BMH A;  1YVK A;  1ZG8 A;  2EBJ A;  2H5M A;  2BSW A;  4IK2 A;  3SI0 A;  3PB9 X;  1RXT A;  3W91 A;  1CX8 A;  5C82 A;  2C1C A;  3B3S A;  3C26 A;  4X3R A;  2DF5 A;  4MHP A;  2YNC A;  2GRE A;  4C2Z A;  1ELM P;  2Q43 A;  4KOV A;  3SJG A;  2AJ6 A;  2Q4Y A;  5LYL A;  1A2Z A;  4OC4 A;  3TT2 A;  4B10 A;  4KOX A;  3R96 A;  3JTK A;  1CM0 A;  5HVG A;  1IYK A;  4OKO A;  1BPM A;  3DR6 A;  4QUS A;  5J1Q A;  1YVO A;  4B5P A;  1XOV A;  2DPS A; 
#chains in the Genus database with same CATH homology
 1KZF A;  2PR8 A;  1LRZ A;  3CXP A;  1M1D A;  3FRM A;  5G22 A;  4IUS A;  3G3S A;  4KVX A;  1SQH A;  4KOR A;  3DDD A;  3R95 A;  3B8G A;  4NEX A;  5KTA A;  5H84 A;  3BLN A;  3R9F A;  4FD4 A;  3W6S A;  4B5O A;  4ZGY B;  2HV2 A;  1IYL A;  4EVY A;  1S7L A;  5E96 A;  4PSX A;  3SXN A;  1CJW A;  4CAW A;  1GHE A;  3FIX A;  4QBJ A;  2AE6 A;  4R3L A;  2X7B A;  4UCM A;  1PUA A;  1Y9K A;  4PSW A;  4XPD C;  5AG5 A;  5J8F A;  4UCP A;  1WK4 A;  1RO5 A;  3FYN A;  4RS2 A;  1PU9 A;  3IWG A;  4YGO A;  3ZJ0 A;  1TIQ A;  2ZPA A;  2QEC A;  2R7H A;  4C2Y A;  4CGL A;  1M4I A;  3D2P A;  1S7N A;  4HNX B;  3DNS A;  1B87 A;  5ISV A;  4MFP A;  3D2M A;  1KUV A;  2P6F A;  3V8I A;  4MY0 A;  2OH1 A;  4XPD B;  4F0Y A;  3MGD A;  2C27 A;  2Z3K A;  3F0A A;  2B3U A;  3I9S A;  2VQY A;  4FD5 A;  4B12 A;  1M4G A;  5AG7 A;  1QST A;  2BUE A;  3H4Q A;  4E2A A;  4GS4 A;  1S3Z A;  3P2H A;  4JLY A;  4HKF A;  3R9E A;  3TTH A;  4MBU A;  1MJB A;  1VKC A;  2WUU A;  4A30 A;  5EC4 A;  2CXA A;  2GAN A;  2ZW4 A;  1R57 A;  5DWN A;  5BWA B;  3VWD A;  1IIC A;  2VZY A;  2FXF A;  2BL1 A;  1I21 A;  2Q4V A;  1FY7 A;  4R9M A;  4C68 A;  1KUY A;  4FD7 A;  2G3T A;  3FBU A;  4MFZ A;  3G8W A;  2WPW A;  1NMT A;  1YLE A;  1Z9U A;  2ZW7 A;  1QSO A;  3TOA A;  3T90 A;  1BO4 A;  1Z4R A;  1VHS A;  4KUA A;  4A31 A;  1S60 A;  4B11 A;  3IU1 A;  4I49 A;  4C7I A;  2OZG A;  2VBQ A;  4KLW A;  3R9G A;  2BEI A;  2QIR A;  4AB7 A;  2ZXV A;  4KOW A;  3IWE A;  4KS9 A;  2KCW A;  3BJ8 A;  3W6X A;  1OZP A;  1M44 A;  3DR8 A;  1S5K A;  1QSM A;  1S7K A;  1XE4 A;  2CNM A;  2PR1 A;  2YND A;  4K30 A;  3OWC A;  4LX9 A;  4KVM E;  1B6B A;  1Q2Y A;  1UFH A;  3EY5 A;  4CGO A;  2Z3M A;  1YR0 A;  3KKW A;  4KOU A;  2F5I A;  3LD2 A;  3QB8 A;  2VZZ A;  3CXS A;  2RC4 A;  1QSR A;  1ZO0 A;  3S6K A;  3S6G A;  4MHD A;  3N7Z A;  2ZW5 A;  3UY5 A;  3FB3 A;  3IGR A;  4MFL A;  1Z4E A;  4CYP A;  2Z3P A;  2PC1 A;  4XPL A;  4U5Y A;  2NMT A;  3A9L A;  4JJX A;  2O28 A;  2Q04 A;  3JVN A;  5JPH A;  3S6H A;  2YNE A;  2G3A A;  4ONU A;  4UA3 A;  4UWJ A;  1KUX A;  4NXY A;  5AG6 A;  3FNC A;  1XF8 A;  2B4D A;  5G21 A;  5IV0 A;  2Z3L A;  5AGE A;  1YGH A;  2PDO A;  4HNW B;  4CRZ B;  5HH1 A;  4CYO A;  5F47 A;  2JEV A;  2I00 A;  2GIV A;  1MJA A;  4AG9 A;  5AG4 A;  5HMN A;  2Q0Y A;  4KLV A;  3BJ7 A;  2DXQ A;  4OLL A;  4CAF A;  2FIW A;  2PRB A;  2OZU A;  2Y0M A;  4C7H A;  2JDD A;  4E8O A;  2QML A;  3D3S A;  2CNT A;  1S7F A;  2Z3N A;  4CGN A;  3F5B A;  4KVO E;  4B13 A;  5I0C A;  1M4D A;  5GCN A;  4XNH C;  4X5K A;  4YRH A;  1K4J A;  1YX0 A;  5G20 A;  2YGW A;  3P2F A;  4UFW A;  4U9Y A;  1Q2D A;  2JDC A;  2PQ8 A;  4CAV A;  1BOB A;  5J8C A;  1L0C A;  2WSA A;  2R98 A;  4CYQ A;  3CXQ A;  4U9Z A;  2P0W A;  4LUA A;  4KOS A;  4MY3 A;  4XNH B;  4A33 A;  4DNC A;  2A4N A;  4A32 A;  4JXQ A;  5IB0 A;  4C2X A;  2YNC C;  3EXN A;  4NSQ A;  2CNS A;  3PP9 A;  2D4P A;  4QVT A;  2IL4 A;  3RYO A;  4UWI A;  4BBH A;  2Z10 A;  4JWP A;  2WPX A;  1P0H A;  4ZBG A;  2B5G A;  3TO6 A;  3TO7 A;  2PSW A;  2REE A;  3VWE A;  2JLM A;  2Z3O A;  1V0C A;  2R1I A;  3S6F A;  3FXT A;  4Q38 A;  1P4N A;  3T9Y A;  2HUZ A;  2VXK A;  2FCK A;  4B5P B;  5FVJ A;  4IF5 A;  2Z11 A;  3NE7 A;  5JQ4 A;  4PK2 A;  3LOD A;  2D4O A;  4FD6 A;  2FS5 A;  3K9U A;  4CS0 B;  1I1D A;  3EFA A;  3E0K A;  3QAH A;  3PGP A;  1Y7R A;  2Q7B A;  1Q2C A;  4CRY B;  4M85 A;  4H6Z A;  5C88 A;  3F8K A;  4L8A A;  4KSA A;  4HNY B;  3TCV A;  2J8R A;  4MJ8 A;  4R87 A;  2B4B A;  4H6U A;  4CAE A;  2OU2 A;  3GYA A;  5IX3 A;  4R57 A;  2P6G A;  4AG7 A;  1YRE A;  3PZJ A;  1NSL A;  3JUW A;  4L89 A;  4NCZ A;  1IB1 E;  2GE3 A;  2J8N A;  4M3S A;  5H86 A;  1Y9W A;  3IU2 A;  3GY9 A;  4AVB A;  3H5Z A;  2Q44 A;  2B4D B;  3GKR A;  1YK3 A;  1MK4 A;  3ZZI A;  4UCN A;  2B58 A;  4MFJ A;  4QC6 A;  4UBR A;  2P6E A;  4MFQ A;  2VEZ A;  3D8P A;  2ARH A;  5DWM A;  3SXO A;  2J8M A;  5A27 A;  1I12 A;  4ORF A;  2REF A;  3R1K A;  2FL4 A;  2VI7 A;  1XEB A;  3TO9 A;  4AVC A;  4RI1 A;  4KOY A;  4E0A A;  4OAE A;  3EC4 A;  4MI4 A;  4JXR A;  1J4J A;  1ON0 A;  1XMT A;  4A2Z A;  1NE9 A;  4CAX A;  2FE7 A;  3TE4 A;  5A28 A;  2DPT A;  2EUI A;  3DSB A;  5G1Z A;  2R8V A;  4A95 A;  4R3K A;  2ZW6 A;  5CNP A;  4H89 A;  2B3V A;  3TOB A;  2K5T A;  4KSF A;  4UFV A;  4Y49 C;  4QB9 A;  4MFK A;  1IID A;  2OB0 A;  5F46 A;  3WR7 A;  2I79 A;  4CYN A;  4OAD A;  1QSN A;  2FSR A;  4II9 A;  4F6A A;  1WWZ A;  3I3G A;  2G0B A;  4UFX A;  4J3G A;  1U6M A;  2CY2 A;  4JD6 A;  2OZH A;  3EO4 A;  4AVA A;  4NF1 A;  4CGP A;  4B14 A;  5KTC A;  4Y49 B;  2FIA A;  2EVN A;  3TFY A;  1MJ9 A;  2Z0Z A;  4KUB A;  5EBV A;  1XIX A;  2B5G B;  4F0X A;  2FT0 A;  2ATR A;  4Q36 A;  4CGM A;  5KTD A;  4XPK A;  3SHP A;  4YFJ A;  4KOT A;  1N71 A;  5F49 A;  4KZT A;  4PV6 A;  5F48 A;  2HQY A;  4PK3 A;  4BMH A;  1YVK A;  2H5M A;  2BSW A;  5C82 A;  3W91 A;  1RXT A;  3C26 A;  2YNC A;  4C2Z A;  4KOV A;  2AJ6 A;  2Q4Y A;  4B10 A;  3TT2 A;  4KOX A;  3R96 A;  3JTK A;  1CM0 A;  1IYK A;  4QUS A;  3DR6 A;  1YVO A;  4B5P A;  2DPS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...