2B4DA

Ssat+coa+sp- sp disordered
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
170
structure length
170
Chain Sequence
AKFVIRPATAADCSDILRLIKELAKYEYMEEQVILTEKDLLEDGFGEHPFYHCLVAEVPKEHWTPEGHSIVGFAMYYFTYDPWIGKLLYLEDFFVMSDYRGFGIGSEILKNLSQVAMRCRCSSMHFLVAEWNEPSINFYKRRGASDLSSEEGWRLFKIDKEYLLKMATEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of wild-type and mutant human spermidine/spermine N1-acetyltransferase, a potential therapeutic drug target
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Diamine acetyltransferase 1
total genus 35
structure length 170
sequence length 170
ec nomenclature ec 2.3.1.57: Diamine N-acetyltransferase.
pdb deposition date 2005-09-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 2b4dA00
2FIWA 2WPWA 3GKRA 4CAXA 3QB8A 1P0HA 4NXYA 1Y7RA 1XE4A 1OZPA 2FL4A 2P0WA 3S6KA 3TE4A 1GHEA 5F46A 4ZBGA 2Z0ZA 3R9EA 2GIVA 3LODA 4KOTA 3ZZIA 3JVNA 2BL1A 3PP9A 3JUWA 3EC4A 1QSTA 1NE9A 4UWJA 1BO4A 4HKFA 2Q4YA 4IF5A 5CNPA 3FB3A 3WR7A 3S6HA 4RI1A 4R9MA 2ZXVA 2PQ8A 2P6EA 3D3SA 2HV2A 2PSWA 2Y0MA 4AVAA 2Q0YA 1IYKA 4QVTA 1BOBA 1XEBA 3CXPA 2EVNA 3PGPA 4IUSA 2IL4A 2OZGA 1QSNA 2DXQA 4CAWA 4BMHA 1I12A 4FD7A 1RO5A 1RXTA 4OAEA 4KOUA 1YVOA 3SHPA 1VKCA 3VWEA 1YLEA 4QC6A 1MJ9A 4AVBA 5F48A 2CNSA 3F5BA 4MI4A 2Q04A 3FYNA 4HNXB 4MJ8A 3E0KA 3EXNA 3W6SA 4AB7A 3F0AA 4KOSA 4NEXA 2OU2A 4H6ZA 1Z4EA 1YGHA 4L8AA 2C27A 1UFHA 1S5KA 2B4DA 3T9YA 2A4NA 2B5GB 2R1IA 3TO9A 3SXOA 3R9GA 4UWIA 3CXQA 2Z11A 3EO4A 5J8CA 3G8WA 1FY7A 3DSBA 4KOYA 4YGOA 4II9A 3H4QA 2P6GA 5JPHA 4KORA 3TOAA 3OWCA 1XIXA 4KVOE 4MHDA 2CY2A 4UA3A 3ZJ0A 3P2HA 2H5MA 4FD5A 2JDDA 4M85A 4R3LA 1M4GA 2FXFA 2VXKA 3P2FA 3T90A 2G3AA 2QIRA 1YK3A 2REEA 2FCKA 1NMTA 1Q2YA 1KUYA 2PR8A 3W91A 2FS5A 2JLMA 2EUIA 4KUAA 2JDCA 2VZZA 1YREA 5KTCA 1QSMA 2B4BA 3N7ZA 4MBUA 5E96A 3VWDA 2ATRA 4YRHA 4GS4A 4H6UA 2D4OA 3PZJA 4U9ZA 2HUZA 5DWMA 1KUVA 1MK4A 4XPLA 2OB0A 2K5TA 1ON0A 3GYAA 2ZW4A 1KUXA 2QMLA 4B5OA 1V0CA 2P6FA 1B6BA 5IX3A 2PR1A 2OZHA 4CAVA 4U9YA 3IWGA 4NCZA 4DNCA 2OZUA 1WK4A 4KOXA 3TOBA 2PC1A 1YVKA 4FD4A 5EBVA 2ZW7A 1N71A 5KTDA 4K30A 2D4PA 4KOWA 2ARHA 1S7LA 1M1DA 4HNYB 5J8FA 4LX9A 5IB0A 5H84A 2BUEA 4FD6A 4EVYA 3R95A 3LD2A 5FVJA 2PRBA 5F49A 2R98A 4OLLA 3BLNA 2FT0A 3KKWA 1YX0A 2JEVA 4XPKA 4B5PA 5IV0A 2B3VA 2FE7A 1U6MA 3IGRA 3TFYA 5HMNA 4KUBA 3BJ8A 3R9FA 1J4JA 3K9UA 2AE6A 1M44A 4ONUA 3FNCA 1K4JA 1Q2CA 2BEIA 3S6GA 5DWNA 1YR0A 1Q2DA 3TO7A 2J8NA 2WPXA 4F0YA 2B58A 1S60A 1S7NA 2OH1A 5C88A 1QSRA 4XNHC 4XPDC 3DNSA 3EY5A 3TCVA 2Z10A 2J8MA 1IYLA 1TIQA 3FXTA 1I1DA 4PSWA 1P4NA 2VBQA 1WWZA 4MY0A 3R96A 3TO6A 2B3UA 1SQHA 1IIDA 4OADA 2GANA 1Y9KA 3SXNA 2CNTA 3FBUA 3I9SA 4KVXA 3V8IA 3FIXA 5H86A 4ORFA 4CRZB 4JLYA 1MJBA 4HNWB 3B8GA 3EFAA 4I49A 5C82A 1S3ZA 1KZFA 3S6FA 2Q4VA 1Z4RA 1VHSA 2HQYA 3D2MA 3D2PA 4XNHB 4XPDB 1XMTA 1PUAA 4L89A 3TTHA 2REFA 3TT2A 2GE3A 1Z9UA 4PK2A 4CRYB 4X5KA 3FRMA 4QUSA 4QB9A 2R7HA 4NF1A 4LUAA 4QBJA 4E0AA 1S7FA 4R87A 5ISVA 2R8VA 2QECA 5KTAA 2RC4A 3F8KA 5HH1A 1IB1E 2ZW5A 2X7BA 4PV6A 2PDOA 4Y49B 2G3TA 4JXQA 3NE7A 1XF8A 2CNMA 3W6XA 1L0CA 1I21A 2F5IA 2Q44A 4PSXA 2FIAA 4KZTA 1R57A 2ZPAA 5F47A 2I79A 3CXSA 1M4DA 3I3GA 5JQ4A 4KOVA 4U5YA 4Y49C 1MJAA 2KCWA 3UY5A 4M3SA 2BSWA 3QAHA 4JJXA 1LRZA 4JXRA 2ZW6A 1S7KA 4MY3A 1PU9A 4KVME 2VI7A 3GY9A 4RS2A 4YFJA 4CS0B 1M4IA 2VEZA 4JD6A 3DR6A 1NSLA 2AJ6A 4PK3A 2O28A 4KLVA 2B5GA 2B4DB 4B5PB 2VZYA 2J8RA 4NSQA 2I00A 4F6AA 4E2AA 5GCNA 1CJWA 1B87A 3DR8A 3BJ7A 2G0BA 4KLWA 4R3KA 4JWPA 4R57A 3R1KA 2FSRA 3RYOA 1Y9WA 4E8OA 3DDDA 3C26A 4AG9A 3D8PA 4H89A 2Q7BA 4AVCA 2VQYA 3MGDA 5I0CA 1IICA 5EC4A 1CM0A 1QSOA 4UBRA 4J3GA 2NMTA 4AG7A 3G3SA
chains in the Genus database with same CATH superfamily
3ISZA 4B11A 3NA6A 1VGYA 2PJ8A 3QNVA 2FIWA 3FJUA 2WPWA 4Q36A 4K3NA 4UEEA 3GKRA 3RAMA 4CAXA 3QB8A 2PJ0A 1P0HA 1DTDA 4G1PA 1Y7RA 4NXYA 1XE4A 4JYWA 4P4EA 1UWYA 1OZPA 2FL4A 2P0WA 5CPAA 3S6KA 1GHEA 5F46A 4NGSA 2Z0ZA 4ZBGA 4BD9A 4UIAA 4P4BA 3IC1A 4UCNA 3R9EA 2GIVA 3LODA 4KOTA 4X2TA 4ZX8A 4A39A 2PIYA 3ZZIA 2BCOA 4NGQA 4TWEA 3JVNA 4WJBA 4CPAA 2Z3NA 2BL1A 3KHXA 3PP9A 4MFZA 3JUWA 3EC4A 5K8MA 5LYLA 2C6CA 2WYRA 1QSTA 4KSAA 2PJ2A 1NE9A 4UWJA 1BO4A 3B3SA 2ODFA 2Q4YA 4HKFA 4A38A 2O53A 2RFHA 4IF5A 4ZY2A 2V77A 5AG7A 2ZEPA 4P4IA 5CNPA 2NSMA 3FB3A 4A30A 3WR7A 3S6HA 4EFDA 2I3CA 4RI1A 2PJCA 4R9MA 2ZXVA 2PQ8A 2EK9A 2P6EA 4OC5A 3D3SA 4R76A 2HV2A 3SJXA 3WT4A 2PSWA 2Y0MA 3LMSA 4AVAA 4OC1A 1HEEA 2Q0YA 3S9MA 1IYKA 2PJAA 4Q38A 4QVTA 1XRYA 4MHZA 4OC3A 1BOBA 4NGRA 1XEBA 5LYIA 3CXPA 2EVNA 2Q43A 2AFXA 2WZNA 4W9YA 3PGPA 4IHMA 4IUSA 5J1QA 3PBBA 4HPSA 1F2PA 3DLJA 2IL4A 3KR4A 2OZGA 1QSNA 2DXQA 4PXBA 4BMHA 1I12A 4CAEA 4FD7A 4CAWA 2XEIA 1RO5A 3GUXA 1RXTA 1BPMA 5HXDA 4OAEA 4KOUA 1OBRA 1R43A 1YVOA 2PVWA 4H2KA 4MCPA 3SHPA 1VKCA 1JQGA 3IIBA 2IQ6A 4JZ0A 2PJBA 4RN7A 3B3TA 3VWEA 4C68A 3PB4X 1YLEA 1YW6A 2C6PA 4QC6A 1MJ9A 5A28A 2PJ5A 3GB0A 3N5FA 1ELMP 4AVBA 4A33A 4OP4A 2CNSA 5F48A 3F5BA 2F8HA 4MI4A 1IY7A 2Q04A 3FYNA 4B10A 4DJLA 2PJ7A 3KHZA 4HNXB 4MJ8A 3E0KA 2ANPA 3EXNA 3VATA 3W6SA 4NFRA 2PJ3A 5AG5A 4A94A 4AB7A 3F0AA 4KOSA 4R8FA 4RUHA 3JTKA 2ABZA 2Z3OA 4NEXA 2OU2A 3PBEA 4H6ZA 1Z4EA 1YGHA 3KASA 4L8AA 3CDXA 4ONWA 4EMEA 1BPNA 4WWVA 2C27A 4AXVA 1UFHA 2O4HA 4UIBA 1S5KA 2B4DA 3T9YA 2A4NA 2PVVA 2B5GB 3CT9A 2R1IA 4MHNA 3TO9A 1XMBA 3SXOA 1F57A 5AGEA 3R9GA 3CZXA 3IWEA 3CXQA 4UWIA 4ZGYB 5A27A 2Z11A 4B14A 2AFUA 3EO4A 5J8CA 3G8WA 1YLOA 1FY7A 1CP6A 3DSBA 4KOYA 4PXEA 1Y7EA 4YGOA 1IOFA 3KGQA 4II9A 3H4QA 2P6GA 1TF8A 5JPHA 1Z8XA 4KORA 1YQEA 4Q7AA 3TOAA 2YGWA 4C2ZA 3OWCA 1XIXA 4KVOE 4MHDA 4C2YA 4UFXA 3SI1A 2CY2A 4UA3A 3ZJ0A 1TF9A 4O23A 3P2HA 3PB6X 2H5MA 4FD5A 4FBEA 3PFEA 3TE4A 2JDDA 5JH9A 4M85A 4R3LA 4DUKA 3I1UA 1M4GA 4C7HA 1CPXA 1LFWA 2FXFA 2VXKA 3P2FA 3IEHA 3T90A 2G3AA 2QIRA 4IK2A 4BBHA 3SI0A 1YK3A 1LAPA 2REEA 4OIWA 1JWQA 4F8ZA 2FCKA 1KWMA 1NMTA 1Q2YA 1XFOA 3CPXA 1TKFA 4PQAA 1KUYA 3FX6A 2PR8A 1PYTB 1FT7A 3W91A 2FS5A 2JLMA 2EUIA 4KUAA 3VARA 4FAIA 2Z3MA 2JDCA 1CG2A 3NH4A 2VZZA 1YREA 3B7IA 4FUUA 1QSMA 2B4BA 3N7ZA 4MBUA 4OC2A 5E96A 3VWDA 5KTCA 2ATRA 1XBUA 3MRUA 4YRHA 3RO0A 5F09A 1AYEA 5K8OA 3FEEA 4GS4A 2D4OA 3PZJA 4H6UA 4U9ZA 2HUZA 2ZEHA 5DWMA 4NJQA 3CPAA 2RB7A 2Q4ZA 5K8NA 1KUVA 1MK4A 4LQGA 2AFOA 6CPAA 4XPLA 2YNCA 2OB0A 2ZEGA 4UCMA 2NYQA 2K5TA 1ON0A 3D66A 3GYAA 3IWWA 2ZW4A 3S9LA 1KUXA 5HVFA 2QMLA 2GU2A 4B5OA 1V0CA 4FWUA 2P6FA 1B6BA 3RNZA 1Z2LA 5IX3A 2PR1A 3A9LA 5EMIA 2OZHA 2BO9A 1H8LA 4CYQA 3B3WA 2XEFA 3D7DA 3TC8A 4CAVA 8CPAA 5AG4A 3B3VA 4U9YA 3IWGA 4NCZA 5LYDA 4DNCA 5ELYA 4TNUA 5CBMA 3BHXA 1R3NA 3D7FA 2OZUA 3V38A 1WK4A 4KOXA 2BOAA 3TOBA 1AUGA 1VIXA 1Z8LA 1YVKA 2PC1A 4M6GA 4NGTA 1IU8A 4FD4A 4NJRA 5EBVA 2ZW7A 1N71A 4UCPA 1LAMA 5KTDA 4K30A 2CTCA 1A2ZA 2D4PA 4KOWA 3PB8X 4PXCA 4CAFA 2V8GA 2ARHA 3HUVA 4MCRA 1TXRA 2PJ1A 1S7LA 1ZG8A 1M1DA 1YMEA 1CPSA 4P44A 4HNYB 5J8FA 5DS0A 4LX9A 5THWA 3V7ZA 1XJOA 5IB0A 5H84A 4YU9A 4NGPA 4MFJA 3IU1A 2BUEA 4FD6A 4EVYA 1ARLA 3H8EA 3R95A 3LD2A 2ZELA 2Z3PA 3KL9A 4MCQA 5FVJA 4C7IA 2PRBA 5BWAB 4LQ6A 5F49A 1X10A 3WC5A 2R98A 4OLLA 2CXAA 3BLNA 2FT0A 3KR5A 3KKWA 1TKJA 1YX0A 3PEIA 2GREA 2JBJA 3PRTA 2JEVA 3FVLA 3GLJA 4MMOA 4XPKA 5K8PA 4B5PA 1ZO0A 4OC0A 3SJGA 5IV0A 4GM5A 2B3VA 4B6ZA 2FE7A 5G20A 1U6MA 4C2XA 3IGRA 3TFYA 5HMNA 3FH4A 4ZY1A 2AFSA 4KUBA 3T8WA 3BJ8A 3R9FA 3MN8A 2EK8A 4KSIA 2DPSA 4MFPA 4YWYA 1J4JA 3K9UA 3BXMA 4MXUA 2C6GA 4X3RA 1QQ9A 1RTQA 1M44A 2AE6A 2PJ4A 3FNCA 4ONUA 1K4JA 1Q2CA 2XEJA 2BEIA 3S6GA 2F7VA 5DWNA 1Q2DA 1YR0A 2PJ6A 3KI9A 2J8NA 3TO7A 4CGNA 2WPXA 3PFOA 4F0YA 2B58A 1S60A 3FEDA 1S7NA 1XOVA 2OH1A 3B35A 1ELLP 3B3CA 3DGVA 3QAYA 4MFLA 1Q7LA 5G1ZA 5C88A 1QSRA 4XNHC 4XPDC 1Z8WA 3DNSA 1F2OA 2DPTA 3EY5A 3TCVA 2Z10A 1TKHA 1DE4C 2V8HA 2J8MA 2DEAA 1IYLA 2ZEEA 3K9TA 1TIQA 3NFZA 3FXTA 1I1DA 4PSWA 2OR4A 1P4NA 2VBQA 1WWZA 4MY0A 4UEFA 2QVPA 3R96A 3IJ3A 3TO6A 2B3UA 4UEZA 1SQHA 1IIDA 2AFZA 4OADA 2V8VA 2GANA 5LRKA 1Y9KA 2ZOGA 3IU2A 3SXNA 2CNTA 2CF4A 2ZEDA 3FBUA 4MFKA 3I9SA 4ZI6A 4F0XA 4KVXA 3V8IA 1IGBA 3FIXA 2ZEFA 4NGNA 2PRQA 2ZEOA 5H86A 4ORFA 3RZAA 3L2NA 3BI1A 4X8IA 4CRZB 2WSAA 4KSFA 1IOIA 1YSJA 2J9AA 2AFMA 1MJBA 2VL1A 3LWUA 2YNCC 4JLYA 4MRIA 3FMCA 3H8GA 5D8NA 2POKA 4HNWB 1VHEA 3B8GA 3EFAA 4I49A 5G21A 5C82A 4NGMA 1S3ZA 1KZFA 3D68A 2V8DA 4CGOA 2EWBA 2G9DA 1CX8A 1LANA 2CIJA 1QMUA 4OMEA 2WUUA 3S6FA 2PE3A 2Q4VA 1Z4RA 4Z65A 2GFQA 4ZX9A 1VHSA 2GLFA 2HQYA 2ZEMA 4A95A 4F9VA 3D2MA 3NH5A 3D2PA 4XNHB 4XPDB 1XMTA 3IO1A 1PUAA 1Y0YA 2QJ8A 3K2KA 2YNDA 4L89A 3TTHA 2REFA 3TT2A 3PB7X 2GE3A 4IAVA 1AMPA 3H8FA 1CP7A 1X12A 1Z9UA 4PK2A 4P4DA 4X5KA 4CRYB 3FRMA 4QUSA 4QB9A 2QYVA 2FVGA 1Z8TA 2R7HA 4NF1A 4LUAA 4PXDA 4QBJA 3S9NA 3D67A 2IMOA 4E0AA 4CGMA 2GLJA 1S7FA 2JEWA 4R87A 4A37A 1LOKA 5ISVA 1ARMA 2Q7SA 4UF4A 2R8VA 2C1CA 5I4MA 2QECA 4M6HA 3KQXA 5KTAA 3IFEA 3PB9X 2RC4A 3F8KA 5HH1A 1IB1E 2ZW5A 2X7BA 1YW4A 1ZLIA 4F9UA 2HC9A 4PV6A 7CPAA 2PDOA 4Y49B 1BAVA 2G3TA 4JXQA 2ZENA 3NE7A 1XF8A 3D7HA 2CNMA 5JM6A 3W6XA 1L0CA 3GIUA 1I21A 4ZYQA 2F5IA 1VHOA 2Q44A 3H5ZA 4OKOA 4PSXA 4OIDA 1HDUA 2FIAA 3B2YA 3FECA 4KZTA 3VH9A 3SI2A 1R57A 2ZPAA 5F47A 2I79A 3CXSA 3D7GA 1M4DA 4MHPA 3I3GA 2EO8A 4MCSA 1GYTA 1M4LA 4GXHA 5JQ4A 4KOVA 4U5YA 4R7MA 4Y49C 2OOTA 4CGLA 2Q51A 1MJAA 3SJFA 1CBXA 2KCWA 3UY5A 4M3SA 4MFQA 5HVGA 2BSWA 3QAHA 1ZLHA 1BLLE 4JJXA 4CYOA 1LRZA 4MHYA 4JXRA 2ZW6A 3BI0A 4B13A 1S7KA 4BINA 4MY3A 1PU9A 3KQZA 4KVME 3RBUA 5JGFA 2VI7A 3GY9A 4P4JA 4RS2A 4YFJA 4CS0B 5IB9A 1M4IA 2IJZA 1FNOA 2VEZA 2Z3KA 2EBJA 2PCUA 3WC6A 4JD6A 3DR6A 4CYPA 3WC7A 1NSLA 4A2ZA 4KS9A 5LRJA 2AJ6A 4PK3A 2O28A 4P10A 1LCPA 4KLVA 4P4FA 2B5GA 2PIZA 3WABA 2B4DB 5LYFA 4B5PB 4UFVA 1HDQA 1Y0RA 2J8RA 2VZYA 4UFWA 5D29A 3JRUA 4OC4A 4NSQA 2XEGA 2I00A 3LACA 4F6AA 4M6IA 4P6YA 5GCNA 4CGPA 1ZG7A 1CJWA 4E2AA 5HVHA 1B87A 1NSAA 2DF5A 4A31A 2Z3LA 3BJ7A 3DR8A 3FF3A 2G0BA 4KLWA 3KZWA 2PJ9A 4R3KA 5AG6A 2YNEA 4JWPA 4R57A 4ZY0A 3R1KA 1Z5RA 2FSRA 3RYOA 4CYNA 1Y9WA 4A32A 5LRGA 4E8OA 3SJEA 1PCAA 3DDDA 3C26A 2AFWA 2ZOFA 4AG9A 2HB6A 3D8PA 2JBKA 4H89A 2Q7BA 4AVCA 1ZG9A 2VQYA 3MGDA 5G22A 4PPZA 1EE3P 4R6TA 5I0CA 1IICA 5EC4A 4EWTA 1CM0A 3HLPA 4B12A 1QSOA 3NH8A 4UBRA 3TX8A 3ISXA 4DYOA 4P45A 4J3GA 3D4UA 2NMTA 2CTBA 4AG7A 3G3SA 3NE8A
chains in the Genus database with same CATH topology
4B11A 2FIWA 2WPWA 4Q36A 3GKRA 4CAXA 3QB8A 1P0HA 4NXYA 1Y7RA 1XE4A 1OZPA 2FL4A 2P0WA 3S6KA 3TE4A 1GHEA 5F46A 4ZBGA 2Z0ZA 4UCNA 3R9EA 2GIVA 3LODA 4KOTA 3ZZIA 3JVNA 2Z3NA 2BL1A 3PP9A 4MFZA 3JUWA 3EC4A 1QSTA 4KSAA 1NE9A 4UWJA 1BO4A 4HKFA 2Q4YA 4IF5A 5AG7A 5CNPA 3FB3A 4A30A 3WR7A 3S6HA 4RI1A 4R9MA 2ZXVA 2PQ8A 2P6EA 3D3SA 2HV2A 2PSWA 2Y0MA 4AVAA 2Q0YA 1IYKA 4Q38A 4QVTA 1BOBA 1XEBA 3CXPA 2EVNA 3PGPA 4IUSA 2IL4A 4CAEA 2OZGA 1QSNA 2DXQA 4CAWA 4BMHA 1I12A 4FD7A 1RO5A 1RXTA 4OAEA 4KOUA 1YVOA 3SHPA 1VKCA 3VWEA 4C68A 1YLEA 4QC6A 1MJ9A 5A28A 4AVBA 4A33A 5F48A 2CNSA 3F5BA 4MI4A 2Q04A 3FYNA 4B10A 4HNXB 4MJ8A 3E0KA 3EXNA 3W6SA 5AG5A 4AB7A 3F0AA 4KOSA 3JTKA 2Z3OA 4NEXA 2OU2A 4H6ZA 1Z4EA 1YGHA 4L8AA 2C27A 1UFHA 1S5KA 2B4DA 3T9YA 2A4NA 2B5GB 2R1IA 3TO9A 3SXOA 5AGEA 3R9GA 3IWEA 4UWIA 3CXQA 4ZGYB 5A27A 2Z11A 4B14A 3EO4A 5J8CA 3G8WA 1FY7A 3DSBA 4KOYA 4YGOA 4II9A 3H4QA 2P6GA 5JPHA 4KORA 3TOAA 2YGWA 4C2ZA 3OWCA 1XIXA 4KVOE 4MHDA 4C2YA 4UFXA 2CY2A 4UA3A 3ZJ0A 3P2HA 2H5MA 4FD5A 2JDDA 4M85A 4R3LA 1M4GA 4C7HA 2FXFA 2VXKA 3P2FA 3T90A 2G3AA 2QIRA 4BBHA 1YK3A 2REEA 2FCKA 1NMTA 1Q2YA 1KUYA 2PR8A 3W91A 2FS5A 2JLMA 2EUIA 4KUAA 2Z3MA 2JDCA 2VZZA 1YREA 5KTCA 1QSMA 2B4BA 3N7ZA 4MBUA 5E96A 3VWDA 2ATRA 4YRHA 4GS4A 4H6UA 2D4OA 3PZJA 4U9ZA 2HUZA 5DWMA 1KUVA 1MK4A 4XPLA 2YNCA 2OB0A 4UCMA 2K5TA 1ON0A 3GYAA 2ZW4A 1KUXA 2QMLA 4B5OA 1V0CA 2P6FA 1B6BA 5IX3A 2PR1A 3A9LA 2OZHA 4CYQA 4CAVA 5AG4A 4U9YA 3IWGA 4NCZA 4DNCA 2OZUA 1WK4A 4KOXA 3TOBA 2PC1A 1YVKA 4FD4A 5EBVA 2ZW7A 1N71A 4UCPA 5KTDA 4K30A 2D4PA 4KOWA 4CAFA 2ARHA 1S7LA 1M1DA 4HNYB 5J8FA 4LX9A 5IB0A 5H84A 4MFJA 3IU1A 2BUEA 4FD6A 4EVYA 3R95A 3LD2A 4C7IA 2Z3PA 5FVJA 5BWAB 2PRBA 5F49A 2R98A 4OLLA 2CXAA 3BLNA 2FT0A 3KKWA 1YX0A 2JEVA 4XPKA 4B5PA 1ZO0A 5IV0A 2B3VA 2FE7A 5G20A 1U6MA 4C2XA 3IGRA 3TFYA 5HMNA 4KUBA 3BJ8A 3R9FA 4MFPA 2DPSA 1J4JA 3K9UA 2AE6A 1M44A 4ONUA 3FNCA 1K4JA 1Q2CA 2BEIA 3S6GA 5DWNA 1YR0A 1Q2DA 3TO7A 2J8NA 4CGNA 2WPXA 4F0YA 2B58A 1S60A 1S7NA 2OH1A 4MFLA 5G1ZA 5C88A 1QSRA 4XNHC 4XPDC 3DNSA 2DPTA 3EY5A 3TCVA 2Z10A 2J8MA 1IYLA 1TIQA 3FXTA 1I1DA 4PSWA 1P4NA 2VBQA 1WWZA 4MY0A 3R96A 3TO6A 2B3UA 1SQHA 1IIDA 4OADA 2GANA 1Y9KA 3IU2A 3SXNA 2CNTA 3FBUA 4MFKA 3I9SA 4F0XA 4KVXA 3V8IA 3FIXA 5H86A 4ORFA 4CRZB 2WSAA 4KSFA 4JLYA 1MJBA 2YNCC 4HNWB 3B8GA 3EFAA 4I49A 5G21A 5C82A 1S3ZA 1KZFA 4CGOA 2WUUA 3S6FA 2Q4VA 1Z4RA 1VHSA 2HQYA 4A95A 3D2MA 3D2PA 4XNHB 4XPDB 1XMTA 1PUAA 2YNDA 4L89A 3TTHA 2REFA 3TT2A 2GE3A 1Z9UA 4PK2A 4CRYB 4X5KA 3FRMA 4QUSA 4QB9A 2R7HA 4NF1A 4LUAA 4QBJA 4E0AA 4CGMA 1S7FA 4R87A 5ISVA 2R8VA 2QECA 5KTAA 2RC4A 3F8KA 5HH1A 1IB1E 2ZW5A 2X7BA 4PV6A 2PDOA 4Y49B 2G3TA 4JXQA 3NE7A 1XF8A 2CNMA 3W6XA 1L0CA 1I21A 2F5IA 2Q44A 3H5ZA 4PSXA 2FIAA 4KZTA 1R57A 2ZPAA 5F47A 2I79A 3CXSA 1M4DA 3I3GA 5JQ4A 4KOVA 4U5YA 4Y49C 4CGLA 1MJAA 2KCWA 3UY5A 4M3SA 4MFQA 2BSWA 3QAHA 4JJXA 4CYOA 1LRZA 4JXRA 2ZW6A 4B13A 1S7KA 4MY3A 1PU9A 4KVME 2VI7A 3GY9A 4RS2A 4YFJA 4CS0B 1M4IA 2VEZA 2Z3KA 4JD6A 3DR6A 4CYPA 1NSLA 4A2ZA 4KS9A 2AJ6A 4PK3A 2O28A 4KLVA 2B5GA 2B4DB 4B5PB 4UFVA 2VZYA 2J8RA 4UFWA 4NSQA 2I00A 4F6AA 4E2AA 5GCNA 4CGPA 1CJWA 1B87A 4A31A 2Z3LA 3BJ7A 3DR8A 2G0BA 4KLWA 4R3KA 5AG6A 2YNEA 4JWPA 4R57A 3R1KA 2FSRA 3RYOA 4CYNA 1Y9WA 4A32A 4E8OA 3DDDA 3C26A 4AG9A 3D8PA 4H89A 2Q7BA 4AVCA 2VQYA 3MGDA 5G22A 5I0CA 1IICA 5EC4A 1CM0A 4B12A 1QSOA 4UBRA 4J3GA 2NMTA 4AG7A 3G3SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FIW A;  2WPW A;  3GKR A;  4CAX A;  3QB8 A;  1P0H A;  4NXY A;  1Y7R A;  1XE4 A;  1OZP A;  2FL4 A;  2P0W A;  3S6K A;  3TE4 A;  1GHE A;  5F46 A;  4ZBG A;  2Z0Z A;  3R9E A;  2GIV A;  3LOD A;  4KOT A;  3ZZI A;  3JVN A;  2BL1 A;  3PP9 A;  3JUW A;  3EC4 A;  1QST A;  1NE9 A;  4UWJ A;  1BO4 A;  4HKF A;  2Q4Y A;  4IF5 A;  5CNP A;  3FB3 A;  3WR7 A;  3S6H A;  4RI1 A;  4R9M A;  2ZXV A;  2PQ8 A;  2P6E A;  3D3S A;  2HV2 A;  2PSW A;  2Y0M A;  4AVA A;  2Q0Y A;  1IYK A;  4QVT A;  1BOB A;  1XEB A;  3CXP A;  2EVN A;  3PGP A;  4IUS A;  2IL4 A;  2OZG A;  1QSN A;  2DXQ A;  4CAW A;  4BMH A;  1I12 A;  4FD7 A;  1RO5 A;  1RXT A;  4OAE A;  4KOU A;  1YVO A;  3SHP A;  1VKC A;  3VWE A;  1YLE A;  4QC6 A;  1MJ9 A;  4AVB A;  5F48 A;  2CNS A;  3F5B A;  4MI4 A;  2Q04 A;  3FYN A;  4HNX B;  4MJ8 A;  3E0K A;  3EXN A;  3W6S A;  4AB7 A;  3F0A A;  4KOS A;  4NEX A;  2OU2 A;  4H6Z A;  1Z4E A;  1YGH A;  4L8A A;  2C27 A;  1UFH A;  1S5K A;  2B4D A;  3T9Y A;  2A4N A;  2B5G B;  2R1I A;  3TO9 A;  3SXO A;  3R9G A;  4UWI A;  3CXQ A;  2Z11 A;  3EO4 A;  5J8C A;  3G8W A;  1FY7 A;  3DSB A;  4KOY A;  4YGO A;  4II9 A;  3H4Q A;  2P6G A;  5JPH A;  4KOR A;  3TOA A;  3OWC A;  1XIX A;  4KVO E;  4MHD A;  2CY2 A;  4UA3 A;  3ZJ0 A;  3P2H A;  2H5M A;  4FD5 A;  2JDD A;  4M85 A;  4R3L A;  1M4G A;  2FXF A;  2VXK A;  3P2F A;  3T90 A;  2G3A A;  2QIR A;  1YK3 A;  2REE A;  2FCK A;  1NMT A;  1Q2Y A;  1KUY A;  2PR8 A;  3W91 A;  2FS5 A;  2JLM A;  2EUI A;  4KUA A;  2JDC A;  2VZZ A;  1YRE A;  5KTC A;  1QSM A;  2B4B A;  3N7Z A;  4MBU A;  5E96 A;  3VWD A;  2ATR A;  4YRH A;  4GS4 A;  4H6U A;  2D4O A;  3PZJ A;  4U9Z A;  2HUZ A;  5DWM A;  1KUV A;  1MK4 A;  4XPL A;  2OB0 A;  2K5T A;  1ON0 A;  3GYA A;  2ZW4 A;  1KUX A;  2QML A;  4B5O A;  1V0C A;  2P6F A;  1B6B A;  5IX3 A;  2PR1 A;  2OZH A;  4CAV A;  4U9Y A;  3IWG A;  4NCZ A;  4DNC A;  2OZU A;  1WK4 A;  4KOX A;  3TOB A;  2PC1 A;  1YVK A;  4FD4 A;  5EBV A;  2ZW7 A;  1N71 A;  5KTD A;  4K30 A;  2D4P A;  4KOW A;  2ARH A;  1S7L A;  1M1D A;  4HNY B;  5J8F A;  4LX9 A;  5IB0 A;  5H84 A;  2BUE A;  4FD6 A;  4EVY A;  3R95 A;  3LD2 A;  5FVJ A;  2PRB A;  5F49 A;  2R98 A;  4OLL A;  3BLN A;  2FT0 A;  3KKW A;  1YX0 A;  2JEV A;  4XPK A;  4B5P A;  5IV0 A;  2B3V A;  2FE7 A;  1U6M A;  3IGR A;  3TFY A;  5HMN A;  4KUB A;  3BJ8 A;  3R9F A;  1J4J A;  3K9U A;  2AE6 A;  1M44 A;  4ONU A;  3FNC A;  1K4J A;  1Q2C A;  2BEI A;  3S6G A;  5DWN A;  1YR0 A;  1Q2D A;  3TO7 A;  2J8N A;  2WPX A;  4F0Y A;  2B58 A;  1S60 A;  1S7N A;  2OH1 A;  5C88 A;  1QSR A;  4XNH C;  4XPD C;  3DNS A;  3EY5 A;  3TCV A;  2Z10 A;  2J8M A;  1IYL A;  1TIQ A;  3FXT A;  1I1D A;  4PSW A;  1P4N A;  2VBQ A;  1WWZ A;  4MY0 A;  3R96 A;  3TO6 A;  2B3U A;  1SQH A;  1IID A;  4OAD A;  2GAN A;  1Y9K A;  3SXN A;  2CNT A;  3FBU A;  3I9S A;  4KVX A;  3V8I A;  3FIX A;  5H86 A;  4ORF A;  4CRZ B;  4JLY A;  1MJB A;  4HNW B;  3B8G A;  3EFA A;  4I49 A;  5C82 A;  1S3Z A;  1KZF A;  3S6F A;  2Q4V A;  1Z4R A;  1VHS A;  2HQY A;  3D2M A;  3D2P A;  4XNH B;  4XPD B;  1XMT A;  1PUA A;  4L89 A;  3TTH A;  2REF A;  3TT2 A;  2GE3 A;  1Z9U A;  4PK2 A;  4CRY B;  4X5K A;  3FRM A;  4QUS A;  4QB9 A;  2R7H A;  4NF1 A;  4LUA A;  4QBJ A;  4E0A A;  1S7F A;  4R87 A;  5ISV A;  2R8V A;  2QEC A;  5KTA A;  2RC4 A;  3F8K A;  5HH1 A;  1IB1 E;  2ZW5 A;  2X7B A;  4PV6 A;  2PDO A;  4Y49 B;  2G3T A;  4JXQ A;  3NE7 A;  1XF8 A;  2CNM A;  3W6X A;  1L0C A;  1I21 A;  2F5I A;  2Q44 A;  4PSX A;  2FIA A;  4KZT A;  1R57 A;  2ZPA A;  5F47 A;  2I79 A;  3CXS A;  1M4D A;  3I3G A;  5JQ4 A;  4KOV A;  4U5Y A;  4Y49 C;  1MJA A;  2KCW A;  3UY5 A;  4M3S A;  2BSW A;  3QAH A;  4JJX A;  1LRZ A;  4JXR A;  2ZW6 A;  1S7K A;  4MY3 A;  1PU9 A;  4KVM E;  2VI7 A;  3GY9 A;  4RS2 A;  4YFJ A;  4CS0 B;  1M4I A;  2VEZ A;  4JD6 A;  3DR6 A;  1NSL A;  2AJ6 A;  4PK3 A;  2O28 A;  4KLV A;  2B5G A;  2B4D B;  4B5P B;  2VZY A;  2J8R A;  4NSQ A;  2I00 A;  4F6A A;  4E2A A;  5GCN A;  1CJW A;  1B87 A;  3DR8 A;  3BJ7 A;  2G0B A;  4KLW A;  4R3K A;  4JWP A;  4R57 A;  3R1K A;  2FSR A;  3RYO A;  1Y9W A;  4E8O A;  3DDD A;  3C26 A;  4AG9 A;  3D8P A;  4H89 A;  2Q7B A;  4AVC A;  2VQY A;  3MGD A;  5I0C A;  1IIC A;  5EC4 A;  1CM0 A;  1QSO A;  4UBR A;  4J3G A;  2NMT A;  4AG7 A;  3G3S A; 
#chains in the Genus database with same CATH topology
 3ISZ A;  4B11 A;  3NA6 A;  1VGY A;  2PJ8 A;  3QNV A;  2FIW A;  3FJU A;  2WPW A;  4Q36 A;  4K3N A;  4UEE A;  3GKR A;  3RAM A;  4CAX A;  3QB8 A;  2PJ0 A;  1P0H A;  1DTD A;  4G1P A;  1Y7R A;  4NXY A;  1XE4 A;  4JYW A;  4P4E A;  1UWY A;  1OZP A;  2FL4 A;  2P0W A;  5CPA A;  3S6K A;  1GHE A;  5F46 A;  4NGS A;  2Z0Z A;  4ZBG A;  4BD9 A;  4UIA A;  4P4B A;  3IC1 A;  4UCN A;  3R9E A;  2GIV A;  3LOD A;  4KOT A;  4X2T A;  4ZX8 A;  4A39 A;  2PIY A;  3ZZI A;  2BCO A;  4NGQ A;  4TWE A;  3JVN A;  4WJB A;  4CPA A;  2Z3N A;  2BL1 A;  3KHX A;  3PP9 A;  4MFZ A;  3JUW A;  3EC4 A;  5K8M A;  5LYL A;  2C6C A;  2WYR A;  1QST A;  4KSA A;  2PJ2 A;  1NE9 A;  4UWJ A;  1BO4 A;  3B3S A;  2ODF A;  2Q4Y A;  4HKF A;  4A38 A;  2O53 A;  2RFH A;  4IF5 A;  4ZY2 A;  2V77 A;  5AG7 A;  2ZEP A;  4P4I A;  5CNP A;  2NSM A;  3FB3 A;  4A30 A;  3WR7 A;  3S6H A;  4EFD A;  2I3C A;  4RI1 A;  2PJC A;  4R9M A;  2ZXV A;  2PQ8 A;  2EK9 A;  2P6E A;  4OC5 A;  3D3S A;  4R76 A;  2HV2 A;  3SJX A;  3WT4 A;  2PSW A;  2Y0M A;  3LMS A;  4AVA A;  4OC1 A;  1HEE A;  2Q0Y A;  3S9M A;  1IYK A;  2PJA A;  4Q38 A;  4QVT A;  1XRY A;  4MHZ A;  4OC3 A;  1BOB A;  4NGR A;  1XEB A;  5LYI A;  3CXP A;  2EVN A;  2Q43 A;  2AFX A;  2WZN A;  4W9Y A;  3PGP A;  4IHM A;  4IUS A;  5J1Q A;  3PBB A;  4HPS A;  1F2P A;  3DLJ A;  2IL4 A;  3KR4 A;  2OZG A;  1QSN A;  2DXQ A;  4PXB A;  4BMH A;  1I12 A;  4CAE A;  4FD7 A;  4CAW A;  2XEI A;  1RO5 A;  3GUX A;  1RXT A;  1BPM A;  5HXD A;  4OAE A;  4KOU A;  1OBR A;  1R43 A;  1YVO A;  2PVW A;  4H2K A;  4MCP A;  3SHP A;  1VKC A;  1JQG A;  3IIB A;  2IQ6 A;  4JZ0 A;  2PJB A;  4RN7 A;  3B3T A;  3VWE A;  4C68 A;  3PB4 X;  1YLE A;  1YW6 A;  2C6P A;  4QC6 A;  1MJ9 A;  5A28 A;  2PJ5 A;  3GB0 A;  3N5F A;  1ELM P;  4AVB A;  4A33 A;  4OP4 A;  2CNS A;  5F48 A;  3F5B A;  2F8H A;  4MI4 A;  1IY7 A;  2Q04 A;  3FYN A;  4B10 A;  4DJL A;  2PJ7 A;  3KHZ A;  4HNX B;  4MJ8 A;  3E0K A;  2ANP A;  3EXN A;  3VAT A;  3W6S A;  4NFR A;  2PJ3 A;  5AG5 A;  4A94 A;  4AB7 A;  3F0A A;  4KOS A;  4R8F A;  4RUH A;  3JTK A;  2ABZ A;  2Z3O A;  4NEX A;  2OU2 A;  3PBE A;  4H6Z A;  1Z4E A;  1YGH A;  3KAS A;  4L8A A;  3CDX A;  4ONW A;  4EME A;  1BPN A;  4WWV A;  2C27 A;  4AXV A;  1UFH A;  2O4H A;  4UIB A;  1S5K A;  2B4D A;  3T9Y A;  2A4N A;  2PVV A;  2B5G B;  3CT9 A;  2R1I A;  4MHN A;  3TO9 A;  1XMB A;  3SXO A;  1F57 A;  5AGE A;  3R9G A;  3CZX A;  3IWE A;  3CXQ A;  4UWI A;  4ZGY B;  5A27 A;  2Z11 A;  4B14 A;  2AFU A;  3EO4 A;  5J8C A;  3G8W A;  1YLO A;  1FY7 A;  1CP6 A;  3DSB A;  4KOY A;  4PXE A;  1Y7E A;  4YGO A;  1IOF A;  3KGQ A;  4II9 A;  3H4Q A;  2P6G A;  1TF8 A;  5JPH A;  1Z8X A;  4KOR A;  1YQE A;  4Q7A A;  3TOA A;  2YGW A;  4C2Z A;  3OWC A;  1XIX A;  4KVO E;  4MHD A;  4C2Y A;  4UFX A;  3SI1 A;  2CY2 A;  4UA3 A;  3ZJ0 A;  1TF9 A;  4O23 A;  3P2H A;  3PB6 X;  2H5M A;  4FD5 A;  4FBE A;  3PFE A;  3TE4 A;  2JDD A;  5JH9 A;  4M85 A;  4R3L A;  4DUK A;  3I1U A;  1M4G A;  4C7H A;  1CPX A;  1LFW A;  2FXF A;  2VXK A;  3P2F A;  3IEH A;  3T90 A;  2G3A A;  2QIR A;  4IK2 A;  4BBH A;  3SI0 A;  1YK3 A;  1LAP A;  2REE A;  4OIW A;  1JWQ A;  4F8Z A;  2FCK A;  1KWM A;  1NMT A;  1Q2Y A;  1XFO A;  3CPX A;  1TKF A;  4PQA A;  1KUY A;  3FX6 A;  2PR8 A;  1PYT B;  1FT7 A;  3W91 A;  2FS5 A;  2JLM A;  2EUI A;  4KUA A;  3VAR A;  4FAI A;  2Z3M A;  2JDC A;  1CG2 A;  3NH4 A;  2VZZ A;  1YRE A;  3B7I A;  4FUU A;  1QSM A;  2B4B A;  3N7Z A;  4MBU A;  4OC2 A;  5E96 A;  3VWD A;  5KTC A;  2ATR A;  1XBU A;  3MRU A;  4YRH A;  3RO0 A;  5F09 A;  1AYE A;  5K8O A;  3FEE A;  4GS4 A;  2D4O A;  3PZJ A;  4H6U A;  4U9Z A;  2HUZ A;  2ZEH A;  5DWM A;  4NJQ A;  3CPA A;  2RB7 A;  2Q4Z A;  5K8N A;  1KUV A;  1MK4 A;  4LQG A;  2AFO A;  6CPA A;  4XPL A;  2YNC A;  2OB0 A;  2ZEG A;  4UCM A;  2NYQ A;  2K5T A;  1ON0 A;  3D66 A;  3GYA A;  3IWW A;  2ZW4 A;  3S9L A;  1KUX A;  5HVF A;  2QML A;  2GU2 A;  4B5O A;  1V0C A;  4FWU A;  2P6F A;  1B6B A;  3RNZ A;  1Z2L A;  5IX3 A;  2PR1 A;  3A9L A;  5EMI A;  2OZH A;  2BO9 A;  1H8L A;  4CYQ A;  3B3W A;  2XEF A;  3D7D A;  3TC8 A;  4CAV A;  8CPA A;  5AG4 A;  3B3V A;  4U9Y A;  3IWG A;  4NCZ A;  5LYD A;  4DNC A;  5ELY A;  4TNU A;  5CBM A;  3BHX A;  1R3N A;  3D7F A;  2OZU A;  3V38 A;  1WK4 A;  4KOX A;  2BOA A;  3TOB A;  1AUG A;  1VIX A;  1Z8L A;  1YVK A;  2PC1 A;  4M6G A;  4NGT A;  1IU8 A;  4FD4 A;  4NJR A;  5EBV A;  2ZW7 A;  1N71 A;  4UCP A;  1LAM A;  5KTD A;  4K30 A;  2CTC A;  1A2Z A;  2D4P A;  4KOW A;  3PB8 X;  4PXC A;  4CAF A;  2V8G A;  2ARH A;  3HUV A;  4MCR A;  1TXR A;  2PJ1 A;  1S7L A;  1ZG8 A;  1M1D A;  1YME A;  1CPS A;  4P44 A;  4HNY B;  5J8F A;  5DS0 A;  4LX9 A;  5THW A;  3V7Z A;  1XJO A;  5IB0 A;  5H84 A;  4YU9 A;  4NGP A;  4MFJ A;  3IU1 A;  2BUE A;  4FD6 A;  4EVY A;  1ARL A;  3H8E A;  3R95 A;  3LD2 A;  2ZEL A;  2Z3P A;  3KL9 A;  4MCQ A;  5FVJ A;  4C7I A;  2PRB A;  5BWA B;  4LQ6 A;  5F49 A;  1X10 A;  3WC5 A;  2R98 A;  4OLL A;  2CXA A;  3BLN A;  2FT0 A;  3KR5 A;  3KKW A;  1TKJ A;  1YX0 A;  3PEI A;  2GRE A;  2JBJ A;  3PRT A;  2JEV A;  3FVL A;  3GLJ A;  4MMO A;  4XPK A;  5K8P A;  4B5P A;  1ZO0 A;  4OC0 A;  3SJG A;  5IV0 A;  4GM5 A;  2B3V A;  4B6Z A;  2FE7 A;  5G20 A;  1U6M A;  4C2X A;  3IGR A;  3TFY A;  5HMN A;  3FH4 A;  4ZY1 A;  2AFS A;  4KUB A;  3T8W A;  3BJ8 A;  3R9F A;  3MN8 A;  2EK8 A;  4KSI A;  2DPS A;  4MFP A;  4YWY A;  1J4J A;  3K9U A;  3BXM A;  4MXU A;  2C6G A;  4X3R A;  1QQ9 A;  1RTQ A;  1M44 A;  2AE6 A;  2PJ4 A;  3FNC A;  4ONU A;  1K4J A;  1Q2C A;  2XEJ A;  2BEI A;  3S6G A;  2F7V A;  5DWN A;  1Q2D A;  1YR0 A;  2PJ6 A;  3KI9 A;  2J8N A;  3TO7 A;  4CGN A;  2WPX A;  3PFO A;  4F0Y A;  2B58 A;  1S60 A;  3FED A;  1S7N A;  1XOV A;  2OH1 A;  3B35 A;  1ELL P;  3B3C A;  3DGV A;  3QAY A;  4MFL A;  1Q7L A;  5G1Z A;  5C88 A;  1QSR A;  4XNH C;  4XPD C;  1Z8W A;  3DNS A;  1F2O A;  2DPT A;  3EY5 A;  3TCV A;  2Z10 A;  1TKH A;  1DE4 C;  2V8H A;  2J8M A;  2DEA A;  1IYL A;  2ZEE A;  3K9T A;  1TIQ A;  3NFZ A;  3FXT A;  1I1D A;  4PSW A;  2OR4 A;  1P4N A;  2VBQ A;  1WWZ A;  4MY0 A;  4UEF A;  2QVP A;  3R96 A;  3IJ3 A;  3TO6 A;  2B3U A;  4UEZ A;  1SQH A;  1IID A;  2AFZ A;  4OAD A;  2V8V A;  2GAN A;  5LRK A;  1Y9K A;  2ZOG A;  3IU2 A;  3SXN A;  2CNT A;  2CF4 A;  2ZED A;  3FBU A;  4MFK A;  3I9S A;  4ZI6 A;  4F0X A;  4KVX A;  3V8I A;  1IGB A;  3FIX A;  2ZEF A;  4NGN A;  2PRQ A;  2ZEO A;  5H86 A;  4ORF A;  3RZA A;  3L2N A;  3BI1 A;  4X8I A;  4CRZ B;  2WSA A;  4KSF A;  1IOI A;  1YSJ A;  2J9A A;  2AFM A;  1MJB A;  2VL1 A;  3LWU A;  2YNC C;  4JLY A;  4MRI A;  3FMC A;  3H8G A;  5D8N A;  2POK A;  4HNW B;  1VHE A;  3B8G A;  3EFA A;  4I49 A;  5G21 A;  5C82 A;  4NGM A;  1S3Z A;  1KZF A;  3D68 A;  2V8D A;  4CGO A;  2EWB A;  2G9D A;  1CX8 A;  1LAN A;  2CIJ A;  1QMU A;  4OME A;  2WUU A;  3S6F A;  2PE3 A;  2Q4V A;  1Z4R A;  4Z65 A;  2GFQ A;  4ZX9 A;  1VHS A;  2GLF A;  2HQY A;  2ZEM A;  4A95 A;  4F9V A;  3D2M A;  3NH5 A;  3D2P A;  4XNH B;  4XPD B;  1XMT A;  3IO1 A;  1PUA A;  1Y0Y A;  2QJ8 A;  3K2K A;  2YND A;  4L89 A;  3TTH A;  2REF A;  3TT2 A;  3PB7 X;  2GE3 A;  4IAV A;  1AMP A;  3H8F A;  1CP7 A;  1X12 A;  1Z9U A;  4PK2 A;  4P4D A;  4X5K A;  4CRY B;  3FRM A;  4QUS A;  4QB9 A;  2QYV A;  2FVG A;  1Z8T A;  2R7H A;  4NF1 A;  4LUA A;  4PXD A;  4QBJ A;  3S9N A;  3D67 A;  2IMO A;  4E0A A;  4CGM A;  2GLJ A;  1S7F A;  2JEW A;  4R87 A;  4A37 A;  1LOK A;  5ISV A;  1ARM A;  2Q7S A;  4UF4 A;  2R8V A;  2C1C A;  5I4M A;  2QEC A;  4M6H A;  3KQX A;  5KTA A;  3IFE A;  3PB9 X;  2RC4 A;  3F8K A;  5HH1 A;  1IB1 E;  2ZW5 A;  2X7B A;  1YW4 A;  1ZLI A;  4F9U A;  2HC9 A;  4PV6 A;  7CPA A;  2PDO A;  4Y49 B;  1BAV A;  2G3T A;  4JXQ A;  2ZEN A;  3NE7 A;  1XF8 A;  3D7H A;  2CNM A;  5JM6 A;  3W6X A;  1L0C A;  3GIU A;  1I21 A;  4ZYQ A;  2F5I A;  1VHO A;  2Q44 A;  3H5Z A;  4OKO A;  4PSX A;  4OID A;  1HDU A;  2FIA A;  3B2Y A;  3FEC A;  4KZT A;  3VH9 A;  3SI2 A;  1R57 A;  2ZPA A;  5F47 A;  2I79 A;  3CXS A;  3D7G A;  1M4D A;  4MHP A;  3I3G A;  2EO8 A;  4MCS A;  1GYT A;  1M4L A;  4GXH A;  5JQ4 A;  4KOV A;  4U5Y A;  4R7M A;  4Y49 C;  2OOT A;  4CGL A;  2Q51 A;  1MJA A;  3SJF A;  1CBX A;  2KCW A;  3UY5 A;  4M3S A;  4MFQ A;  5HVG A;  2BSW A;  3QAH A;  1ZLH A;  1BLL E;  4JJX A;  4CYO A;  1LRZ A;  4MHY A;  4JXR A;  2ZW6 A;  3BI0 A;  4B13 A;  1S7K A;  4BIN A;  4MY3 A;  1PU9 A;  3KQZ A;  4KVM E;  3RBU A;  5JGF A;  2VI7 A;  3GY9 A;  4P4J A;  4RS2 A;  4YFJ A;  4CS0 B;  5IB9 A;  1M4I A;  2IJZ A;  1FNO A;  2VEZ A;  2Z3K A;  2EBJ A;  2PCU A;  3WC6 A;  4JD6 A;  3DR6 A;  4CYP A;  3WC7 A;  1NSL A;  4A2Z A;  4KS9 A;  5LRJ A;  2AJ6 A;  4PK3 A;  2O28 A;  4P10 A;  1LCP A;  4KLV A;  4P4F A;  2B5G A;  2PIZ A;  3WAB A;  2B4D B;  5LYF A;  4B5P B;  4UFV A;  1HDQ A;  1Y0R A;  2J8R A;  2VZY A;  4UFW A;  5D29 A;  3JRU A;  4OC4 A;  4NSQ A;  2XEG A;  2I00 A;  3LAC A;  4F6A A;  4M6I A;  4P6Y A;  5GCN A;  4CGP A;  1ZG7 A;  1CJW A;  4E2A A;  5HVH A;  1B87 A;  1NSA A;  2DF5 A;  4A31 A;  2Z3L A;  3BJ7 A;  3DR8 A;  3FF3 A;  2G0B A;  4KLW A;  3KZW A;  2PJ9 A;  4R3K A;  5AG6 A;  2YNE A;  4JWP A;  4R57 A;  4ZY0 A;  3R1K A;  1Z5R A;  2FSR A;  3RYO A;  4CYN A;  1Y9W A;  4A32 A;  5LRG A;  4E8O A;  3SJE A;  1PCA A;  3DDD A;  3C26 A;  2AFW A;  2ZOF A;  4AG9 A;  2HB6 A;  3D8P A;  2JBK A;  4H89 A;  2Q7B A;  4AVC A;  1ZG9 A;  2VQY A;  3MGD A;  5G22 A;  4PPZ A;  1EE3 P;  4R6T A;  5I0C A;  1IIC A;  5EC4 A;  4EWT A;  1CM0 A;  3HLP A;  4B12 A;  1QSO A;  3NH8 A;  4UBR A;  3TX8 A;  3ISX A;  4DYO A;  4P45 A;  4J3G A;  3D4U A;  2NMT A;  2CTB A;  4AG7 A;  3G3S A;  3NE8 A; 
#chains in the Genus database with same CATH homology
 4B11 A;  2FIW A;  2WPW A;  4Q36 A;  3GKR A;  4CAX A;  3QB8 A;  1P0H A;  4NXY A;  1Y7R A;  1XE4 A;  1OZP A;  2FL4 A;  2P0W A;  3S6K A;  3TE4 A;  1GHE A;  5F46 A;  4ZBG A;  2Z0Z A;  4UCN A;  3R9E A;  2GIV A;  3LOD A;  4KOT A;  3ZZI A;  3JVN A;  2Z3N A;  2BL1 A;  3PP9 A;  4MFZ A;  3JUW A;  3EC4 A;  1QST A;  4KSA A;  1NE9 A;  4UWJ A;  1BO4 A;  4HKF A;  2Q4Y A;  4IF5 A;  5AG7 A;  5CNP A;  3FB3 A;  4A30 A;  3WR7 A;  3S6H A;  4RI1 A;  4R9M A;  2ZXV A;  2PQ8 A;  2P6E A;  3D3S A;  2HV2 A;  2PSW A;  2Y0M A;  4AVA A;  2Q0Y A;  1IYK A;  4Q38 A;  4QVT A;  1BOB A;  1XEB A;  3CXP A;  2EVN A;  3PGP A;  4IUS A;  2IL4 A;  4CAE A;  2OZG A;  1QSN A;  2DXQ A;  4CAW A;  4BMH A;  1I12 A;  4FD7 A;  1RO5 A;  1RXT A;  4OAE A;  4KOU A;  1YVO A;  3SHP A;  1VKC A;  3VWE A;  4C68 A;  1YLE A;  4QC6 A;  1MJ9 A;  5A28 A;  4AVB A;  4A33 A;  5F48 A;  2CNS A;  3F5B A;  4MI4 A;  2Q04 A;  3FYN A;  4B10 A;  4HNX B;  4MJ8 A;  3E0K A;  3EXN A;  3W6S A;  5AG5 A;  4AB7 A;  3F0A A;  4KOS A;  3JTK A;  2Z3O A;  4NEX A;  2OU2 A;  4H6Z A;  1Z4E A;  1YGH A;  4L8A A;  2C27 A;  1UFH A;  1S5K A;  2B4D A;  3T9Y A;  2A4N A;  2B5G B;  2R1I A;  3TO9 A;  3SXO A;  5AGE A;  3R9G A;  3IWE A;  4UWI A;  3CXQ A;  4ZGY B;  5A27 A;  2Z11 A;  4B14 A;  3EO4 A;  5J8C A;  3G8W A;  1FY7 A;  3DSB A;  4KOY A;  4YGO A;  4II9 A;  3H4Q A;  2P6G A;  5JPH A;  4KOR A;  3TOA A;  2YGW A;  4C2Z A;  3OWC A;  1XIX A;  4KVO E;  4MHD A;  4C2Y A;  4UFX A;  2CY2 A;  4UA3 A;  3ZJ0 A;  3P2H A;  2H5M A;  4FD5 A;  2JDD A;  4M85 A;  4R3L A;  1M4G A;  4C7H A;  2FXF A;  2VXK A;  3P2F A;  3T90 A;  2G3A A;  2QIR A;  4BBH A;  1YK3 A;  2REE A;  2FCK A;  1NMT A;  1Q2Y A;  1KUY A;  2PR8 A;  3W91 A;  2FS5 A;  2JLM A;  2EUI A;  4KUA A;  2Z3M A;  2JDC A;  2VZZ A;  1YRE A;  5KTC A;  1QSM A;  2B4B A;  3N7Z A;  4MBU A;  5E96 A;  3VWD A;  2ATR A;  4YRH A;  4GS4 A;  4H6U A;  2D4O A;  3PZJ A;  4U9Z A;  2HUZ A;  5DWM A;  1KUV A;  1MK4 A;  4XPL A;  2YNC A;  2OB0 A;  4UCM A;  2K5T A;  1ON0 A;  3GYA A;  2ZW4 A;  1KUX A;  2QML A;  4B5O A;  1V0C A;  2P6F A;  1B6B A;  5IX3 A;  2PR1 A;  3A9L A;  2OZH A;  4CYQ A;  4CAV A;  5AG4 A;  4U9Y A;  3IWG A;  4NCZ A;  4DNC A;  2OZU A;  1WK4 A;  4KOX A;  3TOB A;  2PC1 A;  1YVK A;  4FD4 A;  5EBV A;  2ZW7 A;  1N71 A;  4UCP A;  5KTD A;  4K30 A;  2D4P A;  4KOW A;  4CAF A;  2ARH A;  1S7L A;  1M1D A;  4HNY B;  5J8F A;  4LX9 A;  5IB0 A;  5H84 A;  4MFJ A;  3IU1 A;  2BUE A;  4FD6 A;  4EVY A;  3R95 A;  3LD2 A;  4C7I A;  2Z3P A;  5FVJ A;  5BWA B;  2PRB A;  5F49 A;  2R98 A;  4OLL A;  2CXA A;  3BLN A;  2FT0 A;  3KKW A;  1YX0 A;  2JEV A;  4XPK A;  4B5P A;  1ZO0 A;  5IV0 A;  2B3V A;  2FE7 A;  5G20 A;  1U6M A;  4C2X A;  3IGR A;  3TFY A;  5HMN A;  4KUB A;  3BJ8 A;  3R9F A;  4MFP A;  2DPS A;  1J4J A;  3K9U A;  2AE6 A;  1M44 A;  4ONU A;  3FNC A;  1K4J A;  1Q2C A;  2BEI A;  3S6G A;  5DWN A;  1YR0 A;  1Q2D A;  3TO7 A;  2J8N A;  4CGN A;  2WPX A;  4F0Y A;  2B58 A;  1S60 A;  1S7N A;  2OH1 A;  4MFL A;  5G1Z A;  5C88 A;  1QSR A;  4XNH C;  4XPD C;  3DNS A;  2DPT A;  3EY5 A;  3TCV A;  2Z10 A;  2J8M A;  1IYL A;  1TIQ A;  3FXT A;  1I1D A;  4PSW A;  1P4N A;  2VBQ A;  1WWZ A;  4MY0 A;  3R96 A;  3TO6 A;  2B3U A;  1SQH A;  1IID A;  4OAD A;  2GAN A;  1Y9K A;  3IU2 A;  3SXN A;  2CNT A;  3FBU A;  4MFK A;  3I9S A;  4F0X A;  4KVX A;  3V8I A;  3FIX A;  5H86 A;  4ORF A;  4CRZ B;  2WSA A;  4KSF A;  4JLY A;  1MJB A;  2YNC C;  4HNW B;  3B8G A;  3EFA A;  4I49 A;  5G21 A;  5C82 A;  1S3Z A;  1KZF A;  4CGO A;  2WUU A;  3S6F A;  2Q4V A;  1Z4R A;  1VHS A;  2HQY A;  4A95 A;  3D2M A;  3D2P A;  4XNH B;  4XPD B;  1XMT A;  1PUA A;  2YND A;  4L89 A;  3TTH A;  2REF A;  3TT2 A;  2GE3 A;  1Z9U A;  4PK2 A;  4CRY B;  4X5K A;  3FRM A;  4QUS A;  4QB9 A;  2R7H A;  4NF1 A;  4LUA A;  4QBJ A;  4E0A A;  4CGM A;  1S7F A;  4R87 A;  5ISV A;  2R8V A;  2QEC A;  5KTA A;  2RC4 A;  3F8K A;  5HH1 A;  1IB1 E;  2ZW5 A;  2X7B A;  4PV6 A;  2PDO A;  4Y49 B;  2G3T A;  4JXQ A;  3NE7 A;  1XF8 A;  2CNM A;  3W6X A;  1L0C A;  1I21 A;  2F5I A;  2Q44 A;  3H5Z A;  4PSX A;  2FIA A;  4KZT A;  1R57 A;  2ZPA A;  5F47 A;  2I79 A;  3CXS A;  1M4D A;  3I3G A;  5JQ4 A;  4KOV A;  4U5Y A;  4Y49 C;  4CGL A;  1MJA A;  2KCW A;  3UY5 A;  4M3S A;  4MFQ A;  2BSW A;  3QAH A;  4JJX A;  4CYO A;  1LRZ A;  4JXR A;  2ZW6 A;  4B13 A;  1S7K A;  4MY3 A;  1PU9 A;  4KVM E;  2VI7 A;  3GY9 A;  4RS2 A;  4YFJ A;  4CS0 B;  1M4I A;  2VEZ A;  2Z3K A;  4JD6 A;  3DR6 A;  4CYP A;  1NSL A;  4A2Z A;  4KS9 A;  2AJ6 A;  4PK3 A;  2O28 A;  4KLV A;  2B5G A;  2B4D B;  4B5P B;  4UFV A;  2VZY A;  2J8R A;  4UFW A;  4NSQ A;  2I00 A;  4F6A A;  4E2A A;  5GCN A;  4CGP A;  1CJW A;  1B87 A;  4A31 A;  2Z3L A;  3BJ7 A;  3DR8 A;  2G0B A;  4KLW A;  4R3K A;  5AG6 A;  2YNE A;  4JWP A;  4R57 A;  3R1K A;  2FSR A;  3RYO A;  4CYN A;  1Y9W A;  4A32 A;  4E8O A;  3DDD A;  3C26 A;  4AG9 A;  3D8P A;  4H89 A;  2Q7B A;  4AVC A;  2VQY A;  3MGD A;  5G22 A;  5I0C A;  1IIC A;  5EC4 A;  1CM0 A;  4B12 A;  1QSO A;  4UBR A;  4J3G A;  2NMT A;  4AG7 A;  3G3S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...