2B4DA

Ssat+coa+sp- sp disordered
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
170
structure length
170
Chain Sequence
b'AKFVIRPATAADCSDILRLIKELAKYEYMEEQVILTEKDLLEDGFGEHPFYHCLVAEVPKEHWTPEGHSIVGFAMYYFTYDPWIGKLLYLEDFFVMSDYRGFGIGSEILKNLSQVAMRCRCSSMHFLVAEWNEPSINFYKRRGASDLSSEEGWRLFKIDKEYLLKMATEE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Diamine acetyltransferase 1
publication title Structures of wild-type and mutant human spermidine/spermine N1-acetyltransferase, a potential therapeutic drug target
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 35
structure length 170
sequence length 170
ec nomenclature ec 2.3.1.57: Diamine N-acetyltransferase.
pdb deposition date 2005-09-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 2b4dA00
1Q2CA 4HNWB 1Y9WA 4R87A 2O28A 2QIRA 1ON0A 3GYAA 3SHPA 2VQYA 1M4GA 4JJXA 1CM0A 1Z4RA 1P0HA 5E96A 3BLNA 3FBUA 5KTDA 1S7NA 3P2HA 2JLMA 4E0AA 2Q4VA 2Q04A 1B87A 3BJ7A 2ATRA 3QB8A 4QB9A 2B4BA 3BJ8A 2WPXA 1S60A 4RS2A 4XPDC 1KUXA 1I21A 3EFAA 2REEA 1N71A 4AVCA 3G8WA 2FIAA 4HKFA 4KOSA 1YVOA 2I79A 3LODA 4FD6A 3TO6A 4JXQA 4J3GA 4KOVA 5FVJA 2A4NA 5F47A 2PQ8A 2Q0YA 1YX0A 4B5PB 2EVNA 3QAHA 4MI4A 4IF5A 3EC4A 4II9A 3VWEA 1WK4A 1S3ZA 2VXKA 4CAXA 1I12A 2ZPAA 1M1DA 1Y7RA 5J8FA 4B5PA 4YGOA 2BEIA 2PR1A 1VHSA 1QSOA 3JVNA 3SXNA 2PRBA 2FE7A 4YRHA 2J8MA 1IYKA 4GS4A 1LRZA 2FS5A 4RI1A 3EY5A 4KOXA 1XMTA 1RO5A 4EVYA 1QSRA 2ZW7A 4NSQA 2C27A 3PGPA 4JLYA 5DWNA 4PK2A 2HV2A 5HMNA 3FNCA 3SXOA 5F48A 4KOWA 3DR8A 1NMTA 3DNSA 1XIXA 4U5YA 2G3TA 1QSNA 2CY2A 4KVXA 5IV0A 2IL4A 3OWCA 2HUZA 1XF8A 1YGHA 4QBJA 3GY9A 5HH1A 5IB0A 4FD7A 2R7HA 2FT0A 3PZJA 2R8VA 4JWPA 2VZYA 3FRMA 3I9SA 1YVKA 4KUAA 3E0KA 4BMHA 2B3UA 1IICA 2QMLA 4UWJA 4AG7A 3R9FA 5GCNA 4B5OA 3TFYA 4E2AA 2G3AA 3CXPA 3TO9A 2R1IA 4R3LA 5F46A 3I3GA 2Z0ZA 2GANA 2P6EA 1CJWA 5JPHA 2OZHA 2BL1A 2OU2A 3DR6A 2OH1A 1Z4EA 4OAEA 1XE4A 2FSRA 4KVME 4HNYB 4JXRA 1XEBA 3H4QA 3R9GA 1B6BA 4MJ8A 3TE4A 1M4IA 3FXTA 5C88A 1NE9A 5EBVA 1MJAA 2BUEA 4CS0B 4F6AA 4KOTA 3R9EA 3UY5A 3V8IA 2OZGA 4F0YA 3CXQA 4HNXB 2ZXVA 4AG9A 3D3SA 3TO7A 1Z9UA 1S7LA 2P6GA 4M85A 3DDDA 4PV6A 2HQYA 3D2MA 1BOBA 3ZJ0A 4L89A 4OLLA 4CRYB 4H89A 3S6FA 2B5GB 2Y0MA 3TOAA 1MJ9A 5KTCA 4LUAA 1IYLA 1M44A 2AJ6A 1OZPA 1U6MA 1Y9KA 1KUVA 2ARHA 2G0BA 2GIVA 2PSWA 1YR0A 5EC4A 2B5GA 2VBQA 3FIXA 5IX3A 2J8NA 2K5TA 4NEXA 2Q7BA 1KZFA 2H5MA 1P4NA 4R9MA 1RXTA 3F8KA 3FYNA 4R57A 1Q2DA 4UWIA 3EXNA 4KOUA 1GHEA 1I1DA 1SQHA 3F0AA 2CNTA 3T90A 5ISVA 3NE7A 2FIWA 2B4DB 4MY0A 2JEVA 4UBRA 3W6XA 3W6SA 3PP9A 2D4OA 4MY3A 2GE3A 2ZW5A 1YREA 1Q2YA 2Z11A 4PK3A 4Y49B 4KOYA 4NF1A 2REFA 4ONUA 1FY7A 4YFJA 3IWGA 3S6KA 4KZTA 4CAWA 4Y49C 4KORA 1S5KA 4CRZB 2DXQA 4PSWA 4U9ZA 4ZBGA 5KTAA 1WWZA 5H84A 4AVAA 3JUWA 5I0CA 5J8CA 1KUYA 2EUIA 2J8RA 3S6GA 2ZW6A 4E8OA 1S7FA 2JDCA 2X7BA 3R1KA 4AVBA 1UFHA 2BSWA 1IIDA 1QSTA 4M3SA 4X5KA 4KUBA 4MBUA 2F5IA 2FCKA 2Z10A 5C82A 2FL4A 3MGDA 3RYOA 3S6HA 3T9YA 4XPDB 4KLVA 2B3VA 4QVTA 1PUAA 3TCVA 4JD6A 2OZUA 3TTHA 4XPKA 5JQ4A 3FB3A 3LD2A 2Q4YA 4U9YA 3D8PA 5H86A 3G3SA 4KLWA 2R98A 3IGRA 4K30A 5CNPA 2NMTA 1R57A 4QUSA 3N7ZA 1L0CA 1IB1E 2RC4A 1YK3A 4CAVA 3GKRA 4XNHB 1BO4A 4LX9A 2VEZA 1TIQA 4XPLA 1K4JA 4FD4A 1S7KA 2B58A 4ORFA 1NSLA 4H6ZA 4XNHC 2AE6A 3C26A 2PR8A 3WR7A 2P0WA 3TOBA 4R3KA 1M4DA 2PDOA 4UA3A 4QC6A 4H6UA 2QECA 1MK4A 3R95A 4NCZA 2VI7A 1PU9A 2Q44A 5F49A 2WPWA 4PSXA 2D4PA 1V0CA 3EO4A 4NXYA 2VZZA 1MJBA 4L8AA 4IUSA 2I00A 2CNMA 3VWDA 2FXFA 5DWMA 3TT2A 4DNCA 4I49A 2P6FA 3CXSA 3W91A 2OB0A 4MHDA 3B8GA 1QSMA 1VKCA 2KCWA 3D2PA 3KKWA 1YLEA 2CNSA 3R96A 2B4DA 3ZZIA 2ZW4A 3K9UA 4AB7A 4FD5A 3P2FA 1J4JA 2JDDA 3F5BA 4KVOE 3DSBA 4OADA 2PC1A
chains in the Genus database with same CATH superfamily
2PJ3A 1UWYA 3PFOA 1Q2CA 4HNWB 1IOIA 1Y9WA 4R87A 1TKFA 2EWBA 4NGQA 5HVFA 2O28A 2QIRA 3NA6A 4MHPA 1ON0A 3DLJA 3GYAA 3SHPA 3SI1A 3FJUA 3CZXA 5LYIA 3SI2A 1YSJA 1M4GA 2VQYA 5A28A 1CPXA 2YNEA 4JJXA 3PB6X 5AGEA 3TC8A 3VARA 4C2YA 2PE3A 4YWYA 4MHYA 1CM0A 1JQGA 1P0HA 1Z4RA 5E96A 3HLPA 3BLNA 1Y0YA 3NH5A 3FBUA 4K3NA 5KTDA 2QJ8A 4FWUA 4MFJA 1HDUA 1S7NA 4P44A 4UEFA 2DPSA 3P2HA 2JLMA 4E0AA 2Q4VA 2Q04A 4CAEA 1B87A 4MHZA 3BJ7A 3FVLA 3NH8A 2ATRA 4O23A 3QB8A 4QB9A 2B4BA 4ZYQA 3BJ8A 3SJEA 2WPXA 3IWEA 4F9VA 2V8HA 1S60A 2AFOA 4LQ6A 4RS2A 1LAPA 2FVGA 2PJ0A 3SJXA 3S9LA 4XPDC 1I21A 1KUXA 1BAVA 2AFXA 3KQZA 3EFAA 2REEA 5D8NA 1N71A 2ABZA 4AVCA 2EBJA 5LRJA 3G8WA 2FIAA 4HKFA 4KOSA 1YVOA 1Z2LA 2I79A 3LODA 4CYPA 4OC3A 4R8FA 4FD6A 2WUUA 3H8FA 3NFZA 3VH9A 3TO6A 4JXQA 4J3GA 4GM5A 4KOVA 1JWQA 5FVJA 1FNOA 2A4NA 2PJ7A 1KWMA 5F47A 2PQ8A 2Q0YA 1YX0A 4UIBA 1EE3P 4BINA 1M4LA 2PVVA 4B5PB 1IY7A 2EVNA 4P4IA 4MHNA 3QAHA 1Z5RA 4A38A 4DUKA 4MI4A 3BI1A 3RBUA 4G1PA 4IF5A 3EC4A 4BBHA 4NJQA 4II9A 3VWEA 2ZEDA 4P45A 1WK4A 1Z8LA 1S3ZA 2VXKA 4CAXA 3B35A 3DGVA 2PJ8A 5G20A 1I12A 4CGNA 2ZPAA 2PJ1A 1DE4C 3JRUA 3GIUA 4A31A 1M1DA 1Y7RA 2EK8A 4ZX8A 5J8FA 3L2NA 2Q51A 1R43A 2XEJA 4B5PA 5LYLA 4C7HA 4YGOA 3SJGA 2BEIA 2PR1A 1VHSA 2PJAA 7CPAA 1QSOA 2O53A 2ODFA 3JVNA 4R7MA 3SXNA 2PRBA 2FE7A 3D7DA 4KS9A 4YRHA 2J8MA 4NFRA 3D4UA 1IYKA 4GS4A 1LRZA 3I1UA 2ZENA 5K8OA 4NGPA 2FS5A 5F09A 3FEEA 3T8WA 1ELLP 4RI1A 3CPAA 3EY5A 1GYTA 3QNVA 4KOXA 1XMTA 1ZLHA 2Q43A 1LCPA 1RO5A 2ZEGA 4EVYA 1QSRA 3TX8A 4OC0A 1LANA 1AUGA 4CGPA 4LQGA 1LAMA 2ZW7A 1ARMA 3IU1A 4NSQA 2C27A 3PGPA 4JLYA 5AG4A 5DWNA 5IB9A 4PK2A 1HDQA 2HV2A 1CPSA 4PXCA 4UCNA 3V7ZA 5HMNA 3FNCA 1RTQA 5F48A 3SXOA 4KOWA 3DR8A 1NMTA 3DNSA 1XIXA 4U5YA 2GREA 5LYDA 2G3TA 1QSNA 2CY2A 4OIDA 5LRKA 4KVXA 2DEAA 3RNZA 3GB0A 4ONWA 3RAMA 5IV0A 4R6TA 2IL4A 1H8LA 3CDXA 2C6GA 4P4EA 3OWCA 2F7VA 2HUZA 4JZ0A 4CGLA 1XF8A 4F9UA 1YGHA 4QBJA 3GY9A 5HH1A 5IB0A 4FD7A 4PXBA 2R7HA 3PB8X 1AYEA 2YNCC 4UEZA 4GXHA 2FT0A 3PZJA 2R8VA 2GFQA 3HUVA 2PVWA 3PBEA 2YNCA 4JWPA 4KSFA 2VZYA 3FRMA 3I9SA 4OP4A 1YVKA 1ARLA 4C68A 4KUAA 3E0KA 1BPMA 4BMHA 1LOKA 4M6HA 4EFDA 2IJZA 3A9LA 2B3UA 3MN8A 2PRQA 1IICA 2QMLA 4UWJA 2CTBA 4AG7A 2WZNA 3R9FA 1YQEA 2WSAA 4IK2A 5GCNA 4B5OA 3TFYA 1XBUA 2G3AA 1ZG9A 3CXPA 3TO9A 3IWWA 2R1IA 1XOVA 2OOTA 4R3LA 2AFSA 3LWUA 4UIAA 1AMPA 5F46A 3GUXA 3KHXA 2AFWA 3I3GA 2Z0ZA 2GANA 2P6EA 1CJWA 5JPHA 3LACA 2OZHA 5HVGA 2BL1A 5EMIA 3IO1A 2OU2A 3DR6A 4B6ZA 2OH1A 1Z4EA 2PJCA 1XE4A 4OAEA 2FSRA 4BD9A 4UCPA 4ZGYB 4P10A 2PJ5A 3B3CA 1Z8WA 1QQ9A 4KVME 1R3NA 4HNYB 2C6CA 4JXRA 2ZEHA 3S9MA 1XEBA 3H4QA 3KGQA 4HPSA 1B6BA 4MJ8A 3R9GA 4KSAA 1QMUA 3TE4A 1M4IA 1Z8TA 2ZOFA 4OC1A 3FXTA 2RFHA 4MXUA 4Q36A 5C88A 1NE9A 4M6IA 5EBVA 3KASA 2IQ6A 3K2KA 3IC1A 3VATA 4X8IA 1MJAA 2BUEA 4CS0B 1VGYA 2GU2A 4F6AA 1BLLE 2EK9A 1DTDA 2V8VA 4KOTA 4ZY0A 1Y7EA 3R9EA 3QAYA 4Q38A 3UY5A 3V8IA 1IGBA 2OZGA 4F0YA 5I4MA 2HC9A 3IIBA 3S9NA 5BWAB 1ZG8A 3CXQA 5D29A 4HNXB 2ZXVA 5THWA 2G9DA 4JYWA 2PIYA 4AG9A 2Q4ZA 2Z3PA 4MCQA 4B12A 3D3SA 3D7HA 1Z9UA 3TO7A 1S7LA 2P6GA 4CYQA 3PB4X 4M85A 4P4DA 3DDDA 4DJLA 4PV6A 2HQYA 3D2MA 1BOBA 3CT9A 2Z3KA 5AG6A 3ZJ0A 3KR5A 4L89A 4OLLA 2J9AA 1TXRA 4H89A 4CRYB 3PB9X 3WC6A 2ZEFA 3S6FA 4UCMA 4A94A 2CIJA 2GLFA 2B5GB 2Y0MA 3B3TA 4Q7AA 3TOAA 4H2KA 3PBBA 1MJ9A 4MFKA 2XEGA 4F8ZA 5KTCA 2O4HA 2NYQA 1VIXA 4LUAA 1IYLA 1M44A 3K9TA 4OMEA 2ANPA 3D7FA 1YW6A 3D66A 4CAFA 2AJ6A 1FT7A 1OZPA 1U6MA 1KUVA 1Y9KA 2ARHA 2G0BA 2GIVA 2PSWA 2IMOA 4OC2A 5LYFA 4PXDA 2Z3OA 4P4BA 3FECA 5DS0A 1YR0A 4FBEA 5EC4A 1IU8A 3BHXA 3FX6A 2BO9A 2POKA 2B5GA 2VBQA 3FIXA 3PB7X 4UFVA 4TWEA 5IX3A 2J8NA 2ZOGA 2K5TA 4NEXA 4W9YA 2Q7BA 1KZFA 2H5MA 1P4NA 4R9MA 1HEEA 4NGNA 4ZI6A 1RXTA 3F8KA 4IHMA 3FYNA 4R57A 4MCSA 4NGMA 5CPAA 5AG7A 1Q2DA 5LRGA 3RZAA 2CF4A 4C2ZA 2V8DA 2RB7A 4UWIA 3EXNA 4TNUA 5K8NA 4KOUA 1GHEA 1I1DA 1SQHA 3F0AA 2CNTA 3T90A 5ISVA 3NE7A 2FIWA 2B4DB 2JBKA 4MY0A 4NGTA 5G21A 4RN7A 2F8HA 2JEVA 3ISZA 4UBRA 3W6XA 3W6SA 4A30A 3PP9A 2D4OA 2Z3LA 2ZEPA 2GE3A 2ZW5A 4MY3A 6CPAA 3JTKA 4Z65A 1YREA 1ELMP 1Q2YA 2Z11A 4PK3A 4PXEA 4Y49B 4KOYA 4NF1A 3H8EA 2AFUA 4NJRA 2REFA 4ONUA 2PJBA 1ZO0A 1FY7A 2OR4A 3IFEA 3SJFA 3KI9A 1TF8A 4A2ZA 4YFJA 1Q7LA 2PJ2A 3LMSA 3PEIA 3IWGA 3S6KA 4ZY2A 4UEEA 4A37A 3KL9A 4KZTA 4CAWA 4Y49C 2NSMA 4KORA 4WJBA 4B13A 1S5KA 2DPTA 2DXQA 4CRZB 8CPAA 4MCRA 4PSWA 2ZEEA 1XFOA 4U9ZA 4ZBGA 2XEFA 3N5FA 5KTAA 4M6GA 3D68A 2V77A 1WWZA 5H84A 4AVAA 3JUWA 2JBJA 1ZLIA 5K8MA 5I0CA 5CBMA 5J8CA 1KUYA 3WC7A 2EUIA 2J8RA 3S6GA 3D67A 2ZW6A 2C6PA 3B3SA 4E8OA 1YLOA 1S7FA 2JDCA 2X7BA 3R1KA 4AVBA 4B11A 1UFHA 3GLJA 2BSWA 4B14A 1IIDA 4A95A 5HXDA 4CYNA 1QSTA 4M3SA 2YNDA 4UF4A 4X5KA 1F57A 2EO8A 4MFQA 4KUBA 4MBUA 1CG2A 1IOFA 2F5IA 4DNCA 2FCKA 2Z10A 3WT4A 3PFEA 5C82A 2FL4A 3H8GA 3MGDA 1OBRA 3RYOA 3S6HA 1NSAA 2HB6A 1Y0RA 3PRTA 1TKJA 2I3CA 4KSIA 3B7IA 3T9YA 5JM6A 4XPDB 2Z3NA 3B3VA 4P6YA 4KLVA 2B3VA 4QVTA 4ZX9A 1PUAA 4YU9A 1X10A 3TCVA 3KQXA 4JD6A 2OZUA 3TTHA 3MRUA 2QVPA 3NH4A 4MRIA 4XPKA 5JQ4A 3FB3A 2DF5A 1A2ZA 1F2OA 3LD2A 2Z3MA 3WABA 4EWTA 2Q4YA 1CBXA 2Q7SA 4U9YA 4B10A 2CXAA 3D8PA 2PJ4A 5H86A 1CP7A 3G3SA 4UFWA 4E2AA 4KLWA 3BI0A 3IJ3A 2R98A 3IGRA 4K30A 4FUUA 5CNPA 2NMTA 1XJOA 1CP6A 1R57A 3KR4A 3N7ZA 4QUSA 3SI0A 1L0CA 1IB1E 2RC4A 1YK3A 2ZEOA 2PCUA 1BPNA 5G1ZA 3FEDA 4CAVA 3GKRA 4XNHB 1BO4A 3D7GA 2VEZA 4LX9A 1TIQA 4MFZA 4P4JA 4X3RA 4XPLA 4NGSA 1K4JA 4AXVA 4FD4A 4MFPA 1S7KA 2B58A 2VL1A 2YGWA 1F2PA 4CGMA 1LFWA 3V38A 4ORFA 2JEWA 1NSLA 4H6ZA 2XEIA 3IU2A 1XRYA 4XNHC 2AE6A 3VWDA 4DYOA 5AG5A 3WC5A 5A27A 1YW4A 4CPAA 3C26A 2PR8A 4PPZA 3WR7A 2P0WA 3TOBA 5JGFA 2GLJA 4R3KA 4A33A 3FH4A 4A32A 1M4DA 2PDOA 2ZEMA 2BCOA 4QC6A 4UA3A 2WYRA 4OC5A 4RUHA 3NE8A 2AFMA 3H5ZA 4H6UA 2QECA 4MCPA 3B3WA 1MK4A 3R95A 4NCZA 4X2TA 4F0XA 2VI7A 2QYVA 1PU9A 5JH9A 2Q44A 5F49A 5G22A 2WPWA 1YMEA 4PSXA 4CYOA 3CPXA 4A39A 2D4PA 2V8GA 5J1QA 1V0CA 4EMEA 1ZG7A 4CGOA 3EO4A 4NXYA 2VZZA 4OIWA 1PCAA 1MJBA 4L8AA 4MMOA 4IUSA 2I00A 2PJ9A 4C7IA 5K8PA 2CNMA 1Z8XA 2FXFA 5DWMA 2CTCA 4IAVA 3RO0A 3TT2A 4OKOA 4I49A 2P6FA 3CXSA 3W91A 4UFXA 4ZY1A 4C2XA 2OB0A 4MFLA 5HVHA 4MHDA 3B8GA 2PIZA 1QSMA 1VKCA 2KCWA 3D2PA 3ISXA 1TKHA 3KKWA 3KZWA 4PQAA 3KHZA 3IEHA 5ELYA 4FAIA 1X12A 3B2YA 3FF3A 1XMBA 2PJ6A 4OC4A 1YLEA 2CNSA 1TF9A 2B4DA 4NGRA 3FMCA 2AFZA 3R96A 2C1CA 4P4FA 2ZW4A 3ZZIA 4R76A 4WWVA 1PYTB 3K9UA 4AB7A 4FD5A 3P2FA 1VHOA 1J4JA 1CX8A 2BOAA 2JDDA 3F5BA 4KVOE 1VHEA 3DSBA 3BXMA 2ZELA 4OADA 2PC1A
chains in the Genus database with same CATH topology
1Q2CA 4HNWB 1Y9WA 4R87A 2O28A 2QIRA 1ON0A 3GYAA 3SHPA 2VQYA 1M4GA 5A28A 2YNEA 4JJXA 5AGEA 4C2YA 1CM0A 1Z4RA 1P0HA 5E96A 3BLNA 3FBUA 5KTDA 4MFJA 1S7NA 2DPSA 3P2HA 2JLMA 4E0AA 2Q4VA 2Q04A 4CAEA 1B87A 3BJ7A 2ATRA 3QB8A 4QB9A 2B4BA 3BJ8A 2WPXA 3IWEA 1S60A 4RS2A 4XPDC 1KUXA 1I21A 3EFAA 2REEA 1N71A 4AVCA 3G8WA 2FIAA 4HKFA 4KOSA 1YVOA 2I79A 3LODA 4CYPA 4FD6A 2WUUA 3TO6A 4JXQA 4J3GA 4KOVA 5FVJA 2A4NA 5F47A 2PQ8A 2Q0YA 1YX0A 4B5PB 2EVNA 3QAHA 4MI4A 4IF5A 3EC4A 4BBHA 4II9A 3VWEA 1WK4A 1S3ZA 2VXKA 4CAXA 5G20A 1I12A 4CGNA 2ZPAA 4A31A 1M1DA 1Y7RA 5J8FA 4B5PA 4C7HA 4YGOA 2BEIA 2PR1A 1VHSA 1QSOA 3JVNA 3SXNA 2PRBA 2FE7A 4KS9A 4YRHA 2J8MA 1IYKA 4GS4A 1LRZA 2FS5A 4RI1A 3EY5A 4KOXA 1XMTA 1RO5A 4EVYA 1QSRA 4CGPA 2ZW7A 3IU1A 4NSQA 2C27A 3PGPA 4JLYA 5DWNA 4PK2A 2HV2A 4UCNA 5HMNA 3FNCA 3SXOA 5F48A 4KOWA 3DR8A 1NMTA 3DNSA 1XIXA 4U5YA 2G3TA 1QSNA 2CY2A 4KVXA 5IV0A 2IL4A 3OWCA 2HUZA 4CGLA 1XF8A 1YGHA 4QBJA 3GY9A 5HH1A 5IB0A 4FD7A 2R7HA 2YNCC 2FT0A 3PZJA 2R8VA 2YNCA 4JWPA 4KSFA 2VZYA 3FRMA 3I9SA 4C68A 1YVKA 4KUAA 3E0KA 4BMHA 3A9LA 2B3UA 1IICA 2QMLA 4UWJA 4AG7A 3R9FA 2WSAA 5GCNA 4B5OA 3TFYA 4E2AA 2G3AA 3CXPA 3TO9A 2R1IA 4R3LA 5F46A 3I3GA 2Z0ZA 2GANA 2P6EA 1CJWA 5JPHA 2OZHA 2BL1A 2OU2A 3DR6A 2OH1A 1Z4EA 4OAEA 1XE4A 2FSRA 4UCPA 4ZGYB 4KVME 4HNYB 4JXRA 1XEBA 3H4QA 3R9GA 1B6BA 4MJ8A 4KSAA 3TE4A 1M4IA 3FXTA 4Q36A 5C88A 1NE9A 5EBVA 1MJAA 2BUEA 4CS0B 4F6AA 4KOTA 3R9EA 4Q38A 3UY5A 3V8IA 2OZGA 4F0YA 5BWAB 3CXQA 4HNXB 2ZXVA 4AG9A 2Z3PA 4B12A 3D3SA 3TO7A 1Z9UA 4CYQA 1S7LA 2P6GA 4M85A 3DDDA 4PV6A 2HQYA 3D2MA 1BOBA 2Z3KA 5AG6A 3ZJ0A 4L89A 4OLLA 4CRYB 4H89A 3S6FA 4UCMA 5AG4A 2B5GB 2Y0MA 3TOAA 1MJ9A 5KTCA 4LUAA 1IYLA 1M44A 4CAFA 2AJ6A 1OZPA 1U6MA 1Y9KA 1KUVA 2ARHA 2G0BA 2GIVA 2PSWA 2Z3OA 1YR0A 5EC4A 2B5GA 2VBQA 3FIXA 4UFVA 5IX3A 2J8NA 2K5TA 4NEXA 2Q7BA 1KZFA 2H5MA 1P4NA 4R9MA 1RXTA 3F8KA 3FYNA 4R57A 5AG7A 1Q2DA 4C2ZA 4UWIA 3EXNA 4KOUA 1GHEA 1I1DA 1SQHA 3F0AA 2CNTA 3T90A 5ISVA 3NE7A 2FIWA 2B4DB 4MY0A 5G21A 2JEVA 4UBRA 3W6XA 3W6SA 4A30A 3PP9A 2D4OA 2Z3LA 4MY3A 2GE3A 2ZW5A 3JTKA 1YREA 1Q2YA 2Z11A 4PK3A 4Y49B 4KOYA 4NF1A 2REFA 4ONUA 1ZO0A 1FY7A 4A2ZA 4YFJA 3IWGA 3S6KA 4KZTA 4CAWA 4Y49C 4KORA 4B13A 1S5KA 2DPTA 2DXQA 4CRZB 4PSWA 4U9ZA 4ZBGA 5KTAA 1WWZA 5H84A 4AVAA 3JUWA 5I0CA 5J8CA 1KUYA 2EUIA 2J8RA 3S6GA 2ZW6A 4E8OA 1S7FA 2JDCA 2X7BA 3R1KA 4AVBA 4B11A 1UFHA 2BSWA 4B14A 1IIDA 4A95A 4CYNA 1QSTA 4M3SA 2YNDA 4X5KA 4MFQA 4KUBA 4MBUA 2F5IA 2FCKA 2Z10A 5C82A 2FL4A 3MGDA 3RYOA 3S6HA 3T9YA 4XPDB 2Z3NA 4KLVA 2B3VA 4QVTA 1PUAA 3TCVA 4JD6A 2OZUA 3TTHA 4XPKA 5JQ4A 3FB3A 3LD2A 2Z3MA 2Q4YA 4U9YA 4B10A 2CXAA 3D8PA 5H86A 3G3SA 4UFWA 4KLWA 2R98A 3IGRA 4K30A 5CNPA 2NMTA 1R57A 4QUSA 3N7ZA 1L0CA 1IB1E 2RC4A 1YK3A 5G1ZA 4CAVA 3GKRA 4XNHB 1BO4A 4LX9A 2VEZA 4MFZA 1TIQA 4XPLA 1K4JA 4FD4A 4MFPA 1S7KA 2B58A 2YGWA 4CGMA 4ORFA 1NSLA 4H6ZA 3IU2A 4XNHC 2AE6A 5A27A 5AG5A 3C26A 2PR8A 3WR7A 2P0WA 3TOBA 4R3KA 4A33A 4A32A 1M4DA 2PDOA 4UA3A 4QC6A 3H5ZA 4H6UA 2QECA 1MK4A 3R95A 4NCZA 4F0XA 2VI7A 1PU9A 2Q44A 5F49A 5G22A 2WPWA 4PSXA 4CYOA 2D4PA 1V0CA 4CGOA 3EO4A 4NXYA 2VZZA 1MJBA 4L8AA 4IUSA 2I00A 4C7IA 2CNMA 3VWDA 2FXFA 5DWMA 3TT2A 4DNCA 4I49A 2P6FA 3CXSA 3W91A 4UFXA 4C2XA 2OB0A 4MFLA 4MHDA 3B8GA 1QSMA 1VKCA 2KCWA 3D2PA 3KKWA 1YLEA 2CNSA 3R96A 2B4DA 3ZZIA 2ZW4A 3K9UA 4AB7A 4FD5A 3P2FA 1J4JA 2JDDA 3F5BA 4KVOE 3DSBA 4MFKA 4OADA 2PC1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Q2C A;  4HNW B;  1Y9W A;  4R87 A;  2O28 A;  2QIR A;  1ON0 A;  3GYA A;  3SHP A;  2VQY A;  1M4G A;  4JJX A;  1CM0 A;  1Z4R A;  1P0H A;  5E96 A;  3BLN A;  3FBU A;  5KTD A;  1S7N A;  3P2H A;  2JLM A;  4E0A A;  2Q4V A;  2Q04 A;  1B87 A;  3BJ7 A;  2ATR A;  3QB8 A;  4QB9 A;  2B4B A;  3BJ8 A;  2WPX A;  1S60 A;  4RS2 A;  4XPD C;  1KUX A;  1I21 A;  3EFA A;  2REE A;  1N71 A;  4AVC A;  3G8W A;  2FIA A;  4HKF A;  4KOS A;  1YVO A;  2I79 A;  3LOD A;  4FD6 A;  3TO6 A;  4JXQ A;  4J3G A;  4KOV A;  5FVJ A;  2A4N A;  5F47 A;  2PQ8 A;  2Q0Y A;  1YX0 A;  4B5P B;  2EVN A;  3QAH A;  4MI4 A;  4IF5 A;  3EC4 A;  4II9 A;  3VWE A;  1WK4 A;  1S3Z A;  2VXK A;  4CAX A;  1I12 A;  2ZPA A;  1M1D A;  1Y7R A;  5J8F A;  4B5P A;  4YGO A;  2BEI A;  2PR1 A;  1VHS A;  1QSO A;  3JVN A;  3SXN A;  2PRB A;  2FE7 A;  4YRH A;  2J8M A;  1IYK A;  4GS4 A;  1LRZ A;  2FS5 A;  4RI1 A;  3EY5 A;  4KOX A;  1XMT A;  1RO5 A;  4EVY A;  1QSR A;  2ZW7 A;  4NSQ A;  2C27 A;  3PGP A;  4JLY A;  5DWN A;  4PK2 A;  2HV2 A;  5HMN A;  3FNC A;  3SXO A;  5F48 A;  4KOW A;  3DR8 A;  1NMT A;  3DNS A;  1XIX A;  4U5Y A;  2G3T A;  1QSN A;  2CY2 A;  4KVX A;  5IV0 A;  2IL4 A;  3OWC A;  2HUZ A;  1XF8 A;  1YGH A;  4QBJ A;  3GY9 A;  5HH1 A;  5IB0 A;  4FD7 A;  2R7H A;  2FT0 A;  3PZJ A;  2R8V A;  4JWP A;  2VZY A;  3FRM A;  3I9S A;  1YVK A;  4KUA A;  3E0K A;  4BMH A;  2B3U A;  1IIC A;  2QML A;  4UWJ A;  4AG7 A;  3R9F A;  5GCN A;  4B5O A;  3TFY A;  4E2A A;  2G3A A;  3CXP A;  3TO9 A;  2R1I A;  4R3L A;  5F46 A;  3I3G A;  2Z0Z A;  2GAN A;  2P6E A;  1CJW A;  5JPH A;  2OZH A;  2BL1 A;  2OU2 A;  3DR6 A;  2OH1 A;  1Z4E A;  4OAE A;  1XE4 A;  2FSR A;  4KVM E;  4HNY B;  4JXR A;  1XEB A;  3H4Q A;  3R9G A;  1B6B A;  4MJ8 A;  3TE4 A;  1M4I A;  3FXT A;  5C88 A;  1NE9 A;  5EBV A;  1MJA A;  2BUE A;  4CS0 B;  4F6A A;  4KOT A;  3R9E A;  3UY5 A;  3V8I A;  2OZG A;  4F0Y A;  3CXQ A;  4HNX B;  2ZXV A;  4AG9 A;  3D3S A;  3TO7 A;  1Z9U A;  1S7L A;  2P6G A;  4M85 A;  3DDD A;  4PV6 A;  2HQY A;  3D2M A;  1BOB A;  3ZJ0 A;  4L89 A;  4OLL A;  4CRY B;  4H89 A;  3S6F A;  2B5G B;  2Y0M A;  3TOA A;  1MJ9 A;  5KTC A;  4LUA A;  1IYL A;  1M44 A;  2AJ6 A;  1OZP A;  1U6M A;  1Y9K A;  1KUV A;  2ARH A;  2G0B A;  2GIV A;  2PSW A;  1YR0 A;  5EC4 A;  2B5G A;  2VBQ A;  3FIX A;  5IX3 A;  2J8N A;  2K5T A;  4NEX A;  2Q7B A;  1KZF A;  2H5M A;  1P4N A;  4R9M A;  1RXT A;  3F8K A;  3FYN A;  4R57 A;  1Q2D A;  4UWI A;  3EXN A;  4KOU A;  1GHE A;  1I1D A;  1SQH A;  3F0A A;  2CNT A;  3T90 A;  5ISV A;  3NE7 A;  2FIW A;  2B4D B;  4MY0 A;  2JEV A;  4UBR A;  3W6X A;  3W6S A;  3PP9 A;  2D4O A;  4MY3 A;  2GE3 A;  2ZW5 A;  1YRE A;  1Q2Y A;  2Z11 A;  4PK3 A;  4Y49 B;  4KOY A;  4NF1 A;  2REF A;  4ONU A;  1FY7 A;  4YFJ A;  3IWG A;  3S6K A;  4KZT A;  4CAW A;  4Y49 C;  4KOR A;  1S5K A;  4CRZ B;  2DXQ A;  4PSW A;  4U9Z A;  4ZBG A;  5KTA A;  1WWZ A;  5H84 A;  4AVA A;  3JUW A;  5I0C A;  5J8C A;  1KUY A;  2EUI A;  2J8R A;  3S6G A;  2ZW6 A;  4E8O A;  1S7F A;  2JDC A;  2X7B A;  3R1K A;  4AVB A;  1UFH A;  2BSW A;  1IID A;  1QST A;  4M3S A;  4X5K A;  4KUB A;  4MBU A;  2F5I A;  2FCK A;  2Z10 A;  5C82 A;  2FL4 A;  3MGD A;  3RYO A;  3S6H A;  3T9Y A;  4XPD B;  4KLV A;  2B3V A;  4QVT A;  1PUA A;  3TCV A;  4JD6 A;  2OZU A;  3TTH A;  4XPK A;  5JQ4 A;  3FB3 A;  3LD2 A;  2Q4Y A;  4U9Y A;  3D8P A;  5H86 A;  3G3S A;  4KLW A;  2R98 A;  3IGR A;  4K30 A;  5CNP A;  2NMT A;  1R57 A;  4QUS A;  3N7Z A;  1L0C A;  1IB1 E;  2RC4 A;  1YK3 A;  4CAV A;  3GKR A;  4XNH B;  1BO4 A;  4LX9 A;  2VEZ A;  1TIQ A;  4XPL A;  1K4J A;  4FD4 A;  1S7K A;  2B58 A;  4ORF A;  1NSL A;  4H6Z A;  4XNH C;  2AE6 A;  3C26 A;  2PR8 A;  3WR7 A;  2P0W A;  3TOB A;  4R3K A;  1M4D A;  2PDO A;  4UA3 A;  4QC6 A;  4H6U A;  2QEC A;  1MK4 A;  3R95 A;  4NCZ A;  2VI7 A;  1PU9 A;  2Q44 A;  5F49 A;  2WPW A;  4PSX A;  2D4P A;  1V0C A;  3EO4 A;  4NXY A;  2VZZ A;  1MJB A;  4L8A A;  4IUS A;  2I00 A;  2CNM A;  3VWD A;  2FXF A;  5DWM A;  3TT2 A;  4DNC A;  4I49 A;  2P6F A;  3CXS A;  3W91 A;  2OB0 A;  4MHD A;  3B8G A;  1QSM A;  1VKC A;  2KCW A;  3D2P A;  3KKW A;  1YLE A;  2CNS A;  3R96 A;  2B4D A;  3ZZI A;  2ZW4 A;  3K9U A;  4AB7 A;  4FD5 A;  3P2F A;  1J4J A;  2JDD A;  3F5B A;  4KVO E;  3DSB A;  4OAD A;  2PC1 A; 
#chains in the Genus database with same CATH topology
 2PJ3 A;  1UWY A;  3PFO A;  1Q2C A;  4HNW B;  1IOI A;  1Y9W A;  4R87 A;  1TKF A;  2EWB A;  4NGQ A;  5HVF A;  2O28 A;  2QIR A;  3NA6 A;  4MHP A;  1ON0 A;  3DLJ A;  3GYA A;  3SHP A;  3SI1 A;  3FJU A;  3CZX A;  5LYI A;  3SI2 A;  1YSJ A;  1M4G A;  2VQY A;  5A28 A;  1CPX A;  2YNE A;  4JJX A;  3PB6 X;  5AGE A;  3TC8 A;  3VAR A;  4C2Y A;  2PE3 A;  4YWY A;  4MHY A;  1CM0 A;  1JQG A;  1P0H A;  1Z4R A;  5E96 A;  3HLP A;  3BLN A;  1Y0Y A;  3NH5 A;  3FBU A;  4K3N A;  5KTD A;  2QJ8 A;  4FWU A;  4MFJ A;  1HDU A;  1S7N A;  4P44 A;  4UEF A;  2DPS A;  3P2H A;  2JLM A;  4E0A A;  2Q4V A;  2Q04 A;  4CAE A;  1B87 A;  4MHZ A;  3BJ7 A;  3FVL A;  3NH8 A;  2ATR A;  4O23 A;  3QB8 A;  4QB9 A;  2B4B A;  4ZYQ A;  3BJ8 A;  3SJE A;  2WPX A;  3IWE A;  4F9V A;  2V8H A;  1S60 A;  2AFO A;  4LQ6 A;  4RS2 A;  1LAP A;  2FVG A;  2PJ0 A;  3SJX A;  3S9L A;  4XPD C;  1I21 A;  1KUX A;  1BAV A;  2AFX A;  3KQZ A;  3EFA A;  2REE A;  5D8N A;  1N71 A;  2ABZ A;  4AVC A;  2EBJ A;  5LRJ A;  3G8W A;  2FIA A;  4HKF A;  4KOS A;  1YVO A;  1Z2L A;  2I79 A;  3LOD A;  4CYP A;  4OC3 A;  4R8F A;  4FD6 A;  2WUU A;  3H8F A;  3NFZ A;  3VH9 A;  3TO6 A;  4JXQ A;  4J3G A;  4GM5 A;  4KOV A;  1JWQ A;  5FVJ A;  1FNO A;  2A4N A;  2PJ7 A;  1KWM A;  5F47 A;  2PQ8 A;  2Q0Y A;  1YX0 A;  4UIB A;  1EE3 P;  4BIN A;  1M4L A;  2PVV A;  4B5P B;  1IY7 A;  2EVN A;  4P4I A;  4MHN A;  3QAH A;  1Z5R A;  4A38 A;  4DUK A;  4MI4 A;  3BI1 A;  3RBU A;  4G1P A;  4IF5 A;  3EC4 A;  4BBH A;  4NJQ A;  4II9 A;  3VWE A;  2ZED A;  4P45 A;  1WK4 A;  1Z8L A;  1S3Z A;  2VXK A;  4CAX A;  3B35 A;  3DGV A;  2PJ8 A;  5G20 A;  1I12 A;  4CGN A;  2ZPA A;  2PJ1 A;  1DE4 C;  3JRU A;  3GIU A;  4A31 A;  1M1D A;  1Y7R A;  2EK8 A;  4ZX8 A;  5J8F A;  3L2N A;  2Q51 A;  1R43 A;  2XEJ A;  4B5P A;  5LYL A;  4C7H A;  4YGO A;  3SJG A;  2BEI A;  2PR1 A;  1VHS A;  2PJA A;  7CPA A;  1QSO A;  2O53 A;  2ODF A;  3JVN A;  4R7M A;  3SXN A;  2PRB A;  2FE7 A;  3D7D A;  4KS9 A;  4YRH A;  2J8M A;  4NFR A;  3D4U A;  1IYK A;  4GS4 A;  1LRZ A;  3I1U A;  2ZEN A;  5K8O A;  4NGP A;  2FS5 A;  5F09 A;  3FEE A;  3T8W A;  1ELL P;  4RI1 A;  3CPA A;  3EY5 A;  1GYT A;  3QNV A;  4KOX A;  1XMT A;  1ZLH A;  2Q43 A;  1LCP A;  1RO5 A;  2ZEG A;  4EVY A;  1QSR A;  3TX8 A;  4OC0 A;  1LAN A;  1AUG A;  4CGP A;  4LQG A;  1LAM A;  2ZW7 A;  1ARM A;  3IU1 A;  4NSQ A;  2C27 A;  3PGP A;  4JLY A;  5AG4 A;  5DWN A;  5IB9 A;  4PK2 A;  1HDQ A;  2HV2 A;  1CPS A;  4PXC A;  4UCN A;  3V7Z A;  5HMN A;  3FNC A;  1RTQ A;  5F48 A;  3SXO A;  4KOW A;  3DR8 A;  1NMT A;  3DNS A;  1XIX A;  4U5Y A;  2GRE A;  5LYD A;  2G3T A;  1QSN A;  2CY2 A;  4OID A;  5LRK A;  4KVX A;  2DEA A;  3RNZ A;  3GB0 A;  4ONW A;  3RAM A;  5IV0 A;  4R6T A;  2IL4 A;  1H8L A;  3CDX A;  2C6G A;  4P4E A;  3OWC A;  2F7V A;  2HUZ A;  4JZ0 A;  4CGL A;  1XF8 A;  4F9U A;  1YGH A;  4QBJ A;  3GY9 A;  5HH1 A;  5IB0 A;  4FD7 A;  4PXB A;  2R7H A;  3PB8 X;  1AYE A;  2YNC C;  4UEZ A;  4GXH A;  2FT0 A;  3PZJ A;  2R8V A;  2GFQ A;  3HUV A;  2PVW A;  3PBE A;  2YNC A;  4JWP A;  4KSF A;  2VZY A;  3FRM A;  3I9S A;  4OP4 A;  1YVK A;  1ARL A;  4C68 A;  4KUA A;  3E0K A;  1BPM A;  4BMH A;  1LOK A;  4M6H A;  4EFD A;  2IJZ A;  3A9L A;  2B3U A;  3MN8 A;  2PRQ A;  1IIC A;  2QML A;  4UWJ A;  2CTB A;  4AG7 A;  2WZN A;  3R9F A;  1YQE A;  2WSA A;  4IK2 A;  5GCN A;  4B5O A;  3TFY A;  1XBU A;  2G3A A;  1ZG9 A;  3CXP A;  3TO9 A;  3IWW A;  2R1I A;  1XOV A;  2OOT A;  4R3L A;  2AFS A;  3LWU A;  4UIA A;  1AMP A;  5F46 A;  3GUX A;  3KHX A;  2AFW A;  3I3G A;  2Z0Z A;  2GAN A;  2P6E A;  1CJW A;  5JPH A;  3LAC A;  2OZH A;  5HVG A;  2BL1 A;  5EMI A;  3IO1 A;  2OU2 A;  3DR6 A;  4B6Z A;  2OH1 A;  1Z4E A;  2PJC A;  1XE4 A;  4OAE A;  2FSR A;  4BD9 A;  4UCP A;  4ZGY B;  4P10 A;  2PJ5 A;  3B3C A;  1Z8W A;  1QQ9 A;  4KVM E;  1R3N A;  4HNY B;  2C6C A;  4JXR A;  2ZEH A;  3S9M A;  1XEB A;  3H4Q A;  3KGQ A;  4HPS A;  1B6B A;  4MJ8 A;  3R9G A;  4KSA A;  1QMU A;  3TE4 A;  1M4I A;  1Z8T A;  2ZOF A;  4OC1 A;  3FXT A;  2RFH A;  4MXU A;  4Q36 A;  5C88 A;  1NE9 A;  4M6I A;  5EBV A;  3KAS A;  2IQ6 A;  3K2K A;  3IC1 A;  3VAT A;  4X8I A;  1MJA A;  2BUE A;  4CS0 B;  1VGY A;  2GU2 A;  4F6A A;  1BLL E;  2EK9 A;  1DTD A;  2V8V A;  4KOT A;  4ZY0 A;  1Y7E A;  3R9E A;  3QAY A;  4Q38 A;  3UY5 A;  3V8I A;  1IGB A;  2OZG A;  4F0Y A;  5I4M A;  2HC9 A;  3IIB A;  3S9N A;  5BWA B;  1ZG8 A;  3CXQ A;  5D29 A;  4HNX B;  2ZXV A;  5THW A;  2G9D A;  4JYW A;  2PIY A;  4AG9 A;  2Q4Z A;  2Z3P A;  4MCQ A;  4B12 A;  3D3S A;  3D7H A;  1Z9U A;  3TO7 A;  1S7L A;  2P6G A;  4CYQ A;  3PB4 X;  4M85 A;  4P4D A;  3DDD A;  4DJL A;  4PV6 A;  2HQY A;  3D2M A;  1BOB A;  3CT9 A;  2Z3K A;  5AG6 A;  3ZJ0 A;  3KR5 A;  4L89 A;  4OLL A;  2J9A A;  1TXR A;  4H89 A;  4CRY B;  3PB9 X;  3WC6 A;  2ZEF A;  3S6F A;  4UCM A;  4A94 A;  2CIJ A;  2GLF A;  2B5G B;  2Y0M A;  3B3T A;  4Q7A A;  3TOA A;  4H2K A;  3PBB A;  1MJ9 A;  4MFK A;  2XEG A;  4F8Z A;  5KTC A;  2O4H A;  2NYQ A;  1VIX A;  4LUA A;  1IYL A;  1M44 A;  3K9T A;  4OME A;  2ANP A;  3D7F A;  1YW6 A;  3D66 A;  4CAF A;  2AJ6 A;  1FT7 A;  1OZP A;  1U6M A;  1KUV A;  1Y9K A;  2ARH A;  2G0B A;  2GIV A;  2PSW A;  2IMO A;  4OC2 A;  5LYF A;  4PXD A;  2Z3O A;  4P4B A;  3FEC A;  5DS0 A;  1YR0 A;  4FBE A;  5EC4 A;  1IU8 A;  3BHX A;  3FX6 A;  2BO9 A;  2POK A;  2B5G A;  2VBQ A;  3FIX A;  3PB7 X;  4UFV A;  4TWE A;  5IX3 A;  2J8N A;  2ZOG A;  2K5T A;  4NEX A;  4W9Y A;  2Q7B A;  1KZF A;  2H5M A;  1P4N A;  4R9M A;  1HEE A;  4NGN A;  4ZI6 A;  1RXT A;  3F8K A;  4IHM A;  3FYN A;  4R57 A;  4MCS A;  4NGM A;  5CPA A;  5AG7 A;  1Q2D A;  5LRG A;  3RZA A;  2CF4 A;  4C2Z A;  2V8D A;  2RB7 A;  4UWI A;  3EXN A;  4TNU A;  5K8N A;  4KOU A;  1GHE A;  1I1D A;  1SQH A;  3F0A A;  2CNT A;  3T90 A;  5ISV A;  3NE7 A;  2FIW A;  2B4D B;  2JBK A;  4MY0 A;  4NGT A;  5G21 A;  4RN7 A;  2F8H A;  2JEV A;  3ISZ A;  4UBR A;  3W6X A;  3W6S A;  4A30 A;  3PP9 A;  2D4O A;  2Z3L A;  2ZEP A;  2GE3 A;  2ZW5 A;  4MY3 A;  6CPA A;  3JTK A;  4Z65 A;  1YRE A;  1ELM P;  1Q2Y A;  2Z11 A;  4PK3 A;  4PXE A;  4Y49 B;  4KOY A;  4NF1 A;  3H8E A;  2AFU A;  4NJR A;  2REF A;  4ONU A;  2PJB A;  1ZO0 A;  1FY7 A;  2OR4 A;  3IFE A;  3SJF A;  3KI9 A;  1TF8 A;  4A2Z A;  4YFJ A;  1Q7L A;  2PJ2 A;  3LMS A;  3PEI A;  3IWG A;  3S6K A;  4ZY2 A;  4UEE A;  4A37 A;  3KL9 A;  4KZT A;  4CAW A;  4Y49 C;  2NSM A;  4KOR A;  4WJB A;  4B13 A;  1S5K A;  2DPT A;  2DXQ A;  4CRZ B;  8CPA A;  4MCR A;  4PSW A;  2ZEE A;  1XFO A;  4U9Z A;  4ZBG A;  2XEF A;  3N5F A;  5KTA A;  4M6G A;  3D68 A;  2V77 A;  1WWZ A;  5H84 A;  4AVA A;  3JUW A;  2JBJ A;  1ZLI A;  5K8M A;  5I0C A;  5CBM A;  5J8C A;  1KUY A;  3WC7 A;  2EUI A;  2J8R A;  3S6G A;  3D67 A;  2ZW6 A;  2C6P A;  3B3S A;  4E8O A;  1YLO A;  1S7F A;  2JDC A;  2X7B A;  3R1K A;  4AVB A;  4B11 A;  1UFH A;  3GLJ A;  2BSW A;  4B14 A;  1IID A;  4A95 A;  5HXD A;  4CYN A;  1QST A;  4M3S A;  2YND A;  4UF4 A;  4X5K A;  1F57 A;  2EO8 A;  4MFQ A;  4KUB A;  4MBU A;  1CG2 A;  1IOF A;  2F5I A;  4DNC A;  2FCK A;  2Z10 A;  3WT4 A;  3PFE A;  5C82 A;  2FL4 A;  3H8G A;  3MGD A;  1OBR A;  3RYO A;  3S6H A;  1NSA A;  2HB6 A;  1Y0R A;  3PRT A;  1TKJ A;  2I3C A;  4KSI A;  3B7I A;  3T9Y A;  5JM6 A;  4XPD B;  2Z3N A;  3B3V A;  4P6Y A;  4KLV A;  2B3V A;  4QVT A;  4ZX9 A;  1PUA A;  4YU9 A;  1X10 A;  3TCV A;  3KQX A;  4JD6 A;  2OZU A;  3TTH A;  3MRU A;  2QVP A;  3NH4 A;  4MRI A;  4XPK A;  5JQ4 A;  3FB3 A;  2DF5 A;  1A2Z A;  1F2O A;  3LD2 A;  2Z3M A;  3WAB A;  4EWT A;  2Q4Y A;  1CBX A;  2Q7S A;  4U9Y A;  4B10 A;  2CXA A;  3D8P A;  2PJ4 A;  5H86 A;  1CP7 A;  3G3S A;  4UFW A;  4E2A A;  4KLW A;  3BI0 A;  3IJ3 A;  2R98 A;  3IGR A;  4K30 A;  4FUU A;  5CNP A;  2NMT A;  1XJO A;  1CP6 A;  1R57 A;  3KR4 A;  3N7Z A;  4QUS A;  3SI0 A;  1L0C A;  1IB1 E;  2RC4 A;  1YK3 A;  2ZEO A;  2PCU A;  1BPN A;  5G1Z A;  3FED A;  4CAV A;  3GKR A;  4XNH B;  1BO4 A;  3D7G A;  2VEZ A;  4LX9 A;  1TIQ A;  4MFZ A;  4P4J A;  4X3R A;  4XPL A;  4NGS A;  1K4J A;  4AXV A;  4FD4 A;  4MFP A;  1S7K A;  2B58 A;  2VL1 A;  2YGW A;  1F2P A;  4CGM A;  1LFW A;  3V38 A;  4ORF A;  2JEW A;  1NSL A;  4H6Z A;  2XEI A;  3IU2 A;  1XRY A;  4XNH C;  2AE6 A;  3VWD A;  4DYO A;  5AG5 A;  3WC5 A;  5A27 A;  1YW4 A;  4CPA A;  3C26 A;  2PR8 A;  4PPZ A;  3WR7 A;  2P0W A;  3TOB A;  5JGF A;  2GLJ A;  4R3K A;  4A33 A;  3FH4 A;  4A32 A;  1M4D A;  2PDO A;  2ZEM A;  2BCO A;  4QC6 A;  4UA3 A;  2WYR A;  4OC5 A;  4RUH A;  3NE8 A;  2AFM A;  3H5Z A;  4H6U A;  2QEC A;  4MCP A;  3B3W A;  1MK4 A;  3R95 A;  4NCZ A;  4X2T A;  4F0X A;  2VI7 A;  2QYV A;  1PU9 A;  5JH9 A;  2Q44 A;  5F49 A;  5G22 A;  2WPW A;  1YME A;  4PSX A;  4CYO A;  3CPX A;  4A39 A;  2D4P A;  2V8G A;  5J1Q A;  1V0C A;  4EME A;  1ZG7 A;  4CGO A;  3EO4 A;  4NXY A;  2VZZ A;  4OIW A;  1PCA A;  1MJB A;  4L8A A;  4MMO A;  4IUS A;  2I00 A;  2PJ9 A;  4C7I A;  5K8P A;  2CNM A;  1Z8X A;  2FXF A;  5DWM A;  2CTC A;  4IAV A;  3RO0 A;  3TT2 A;  4OKO A;  4I49 A;  2P6F A;  3CXS A;  3W91 A;  4UFX A;  4ZY1 A;  4C2X A;  2OB0 A;  4MFL A;  5HVH A;  4MHD A;  3B8G A;  2PIZ A;  1QSM A;  1VKC A;  2KCW A;  3D2P A;  3ISX A;  1TKH A;  3KKW A;  3KZW A;  4PQA A;  3KHZ A;  3IEH A;  5ELY A;  4FAI A;  1X12 A;  3B2Y A;  3FF3 A;  1XMB A;  2PJ6 A;  4OC4 A;  1YLE A;  2CNS A;  1TF9 A;  2B4D A;  4NGR A;  3FMC A;  2AFZ A;  3R96 A;  2C1C A;  4P4F A;  2ZW4 A;  3ZZI A;  4R76 A;  4WWV A;  1PYT B;  3K9U A;  4AB7 A;  4FD5 A;  3P2F A;  1VHO A;  1J4J A;  1CX8 A;  2BOA A;  2JDD A;  3F5B A;  4KVO E;  1VHE A;  3DSB A;  3BXM A;  2ZEL A;  4OAD A;  2PC1 A; 
#chains in the Genus database with same CATH homology
 1Q2C A;  4HNW B;  1Y9W A;  4R87 A;  2O28 A;  2QIR A;  1ON0 A;  3GYA A;  3SHP A;  2VQY A;  1M4G A;  5A28 A;  2YNE A;  4JJX A;  5AGE A;  4C2Y A;  1CM0 A;  1Z4R A;  1P0H A;  5E96 A;  3BLN A;  3FBU A;  5KTD A;  4MFJ A;  1S7N A;  2DPS A;  3P2H A;  2JLM A;  4E0A A;  2Q4V A;  2Q04 A;  4CAE A;  1B87 A;  3BJ7 A;  2ATR A;  3QB8 A;  4QB9 A;  2B4B A;  3BJ8 A;  2WPX A;  3IWE A;  1S60 A;  4RS2 A;  4XPD C;  1KUX A;  1I21 A;  3EFA A;  2REE A;  1N71 A;  4AVC A;  3G8W A;  2FIA A;  4HKF A;  4KOS A;  1YVO A;  2I79 A;  3LOD A;  4CYP A;  4FD6 A;  2WUU A;  3TO6 A;  4JXQ A;  4J3G A;  4KOV A;  5FVJ A;  2A4N A;  5F47 A;  2PQ8 A;  2Q0Y A;  1YX0 A;  4B5P B;  2EVN A;  3QAH A;  4MI4 A;  4IF5 A;  3EC4 A;  4BBH A;  4II9 A;  3VWE A;  1WK4 A;  1S3Z A;  2VXK A;  4CAX A;  5G20 A;  1I12 A;  4CGN A;  2ZPA A;  4A31 A;  1M1D A;  1Y7R A;  5J8F A;  4B5P A;  4C7H A;  4YGO A;  2BEI A;  2PR1 A;  1VHS A;  1QSO A;  3JVN A;  3SXN A;  2PRB A;  2FE7 A;  4KS9 A;  4YRH A;  2J8M A;  1IYK A;  4GS4 A;  1LRZ A;  2FS5 A;  4RI1 A;  3EY5 A;  4KOX A;  1XMT A;  1RO5 A;  4EVY A;  1QSR A;  4CGP A;  2ZW7 A;  3IU1 A;  4NSQ A;  2C27 A;  3PGP A;  4JLY A;  5DWN A;  4PK2 A;  2HV2 A;  4UCN A;  5HMN A;  3FNC A;  3SXO A;  5F48 A;  4KOW A;  3DR8 A;  1NMT A;  3DNS A;  1XIX A;  4U5Y A;  2G3T A;  1QSN A;  2CY2 A;  4KVX A;  5IV0 A;  2IL4 A;  3OWC A;  2HUZ A;  4CGL A;  1XF8 A;  1YGH A;  4QBJ A;  3GY9 A;  5HH1 A;  5IB0 A;  4FD7 A;  2R7H A;  2YNC C;  2FT0 A;  3PZJ A;  2R8V A;  2YNC A;  4JWP A;  4KSF A;  2VZY A;  3FRM A;  3I9S A;  4C68 A;  1YVK A;  4KUA A;  3E0K A;  4BMH A;  3A9L A;  2B3U A;  1IIC A;  2QML A;  4UWJ A;  4AG7 A;  3R9F A;  2WSA A;  5GCN A;  4B5O A;  3TFY A;  4E2A A;  2G3A A;  3CXP A;  3TO9 A;  2R1I A;  4R3L A;  5F46 A;  3I3G A;  2Z0Z A;  2GAN A;  2P6E A;  1CJW A;  5JPH A;  2OZH A;  2BL1 A;  2OU2 A;  3DR6 A;  2OH1 A;  1Z4E A;  4OAE A;  1XE4 A;  2FSR A;  4UCP A;  4ZGY B;  4KVM E;  4HNY B;  4JXR A;  1XEB A;  3H4Q A;  3R9G A;  1B6B A;  4MJ8 A;  4KSA A;  3TE4 A;  1M4I A;  3FXT A;  4Q36 A;  5C88 A;  1NE9 A;  5EBV A;  1MJA A;  2BUE A;  4CS0 B;  4F6A A;  4KOT A;  3R9E A;  4Q38 A;  3UY5 A;  3V8I A;  2OZG A;  4F0Y A;  5BWA B;  3CXQ A;  4HNX B;  2ZXV A;  4AG9 A;  2Z3P A;  4B12 A;  3D3S A;  3TO7 A;  1Z9U A;  4CYQ A;  1S7L A;  2P6G A;  4M85 A;  3DDD A;  4PV6 A;  2HQY A;  3D2M A;  1BOB A;  2Z3K A;  5AG6 A;  3ZJ0 A;  4L89 A;  4OLL A;  4CRY B;  4H89 A;  3S6F A;  4UCM A;  5AG4 A;  2B5G B;  2Y0M A;  3TOA A;  1MJ9 A;  5KTC A;  4LUA A;  1IYL A;  1M44 A;  4CAF A;  2AJ6 A;  1OZP A;  1U6M A;  1Y9K A;  1KUV A;  2ARH A;  2G0B A;  2GIV A;  2PSW A;  2Z3O A;  1YR0 A;  5EC4 A;  2B5G A;  2VBQ A;  3FIX A;  4UFV A;  5IX3 A;  2J8N A;  2K5T A;  4NEX A;  2Q7B A;  1KZF A;  2H5M A;  1P4N A;  4R9M A;  1RXT A;  3F8K A;  3FYN A;  4R57 A;  5AG7 A;  1Q2D A;  4C2Z A;  4UWI A;  3EXN A;  4KOU A;  1GHE A;  1I1D A;  1SQH A;  3F0A A;  2CNT A;  3T90 A;  5ISV A;  3NE7 A;  2FIW A;  2B4D B;  4MY0 A;  5G21 A;  2JEV A;  4UBR A;  3W6X A;  3W6S A;  4A30 A;  3PP9 A;  2D4O A;  2Z3L A;  4MY3 A;  2GE3 A;  2ZW5 A;  3JTK A;  1YRE A;  1Q2Y A;  2Z11 A;  4PK3 A;  4Y49 B;  4KOY A;  4NF1 A;  2REF A;  4ONU A;  1ZO0 A;  1FY7 A;  4A2Z A;  4YFJ A;  3IWG A;  3S6K A;  4KZT A;  4CAW A;  4Y49 C;  4KOR A;  4B13 A;  1S5K A;  2DPT A;  2DXQ A;  4CRZ B;  4PSW A;  4U9Z A;  4ZBG A;  5KTA A;  1WWZ A;  5H84 A;  4AVA A;  3JUW A;  5I0C A;  5J8C A;  1KUY A;  2EUI A;  2J8R A;  3S6G A;  2ZW6 A;  4E8O A;  1S7F A;  2JDC A;  2X7B A;  3R1K A;  4AVB A;  4B11 A;  1UFH A;  2BSW A;  4B14 A;  1IID A;  4A95 A;  4CYN A;  1QST A;  4M3S A;  2YND A;  4X5K A;  4MFQ A;  4KUB A;  4MBU A;  2F5I A;  2FCK A;  2Z10 A;  5C82 A;  2FL4 A;  3MGD A;  3RYO A;  3S6H A;  3T9Y A;  4XPD B;  2Z3N A;  4KLV A;  2B3V A;  4QVT A;  1PUA A;  3TCV A;  4JD6 A;  2OZU A;  3TTH A;  4XPK A;  5JQ4 A;  3FB3 A;  3LD2 A;  2Z3M A;  2Q4Y A;  4U9Y A;  4B10 A;  2CXA A;  3D8P A;  5H86 A;  3G3S A;  4UFW A;  4KLW A;  2R98 A;  3IGR A;  4K30 A;  5CNP A;  2NMT A;  1R57 A;  4QUS A;  3N7Z A;  1L0C A;  1IB1 E;  2RC4 A;  1YK3 A;  5G1Z A;  4CAV A;  3GKR A;  4XNH B;  1BO4 A;  4LX9 A;  2VEZ A;  4MFZ A;  1TIQ A;  4XPL A;  1K4J A;  4FD4 A;  4MFP A;  1S7K A;  2B58 A;  2YGW A;  4CGM A;  4ORF A;  1NSL A;  4H6Z A;  3IU2 A;  4XNH C;  2AE6 A;  5A27 A;  5AG5 A;  3C26 A;  2PR8 A;  3WR7 A;  2P0W A;  3TOB A;  4R3K A;  4A33 A;  4A32 A;  1M4D A;  2PDO A;  4UA3 A;  4QC6 A;  3H5Z A;  4H6U A;  2QEC A;  1MK4 A;  3R95 A;  4NCZ A;  4F0X A;  2VI7 A;  1PU9 A;  2Q44 A;  5F49 A;  5G22 A;  2WPW A;  4PSX A;  4CYO A;  2D4P A;  1V0C A;  4CGO A;  3EO4 A;  4NXY A;  2VZZ A;  1MJB A;  4L8A A;  4IUS A;  2I00 A;  4C7I A;  2CNM A;  3VWD A;  2FXF A;  5DWM A;  3TT2 A;  4DNC A;  4I49 A;  2P6F A;  3CXS A;  3W91 A;  4UFX A;  4C2X A;  2OB0 A;  4MFL A;  4MHD A;  3B8G A;  1QSM A;  1VKC A;  2KCW A;  3D2P A;  3KKW A;  1YLE A;  2CNS A;  3R96 A;  2B4D A;  3ZZI A;  2ZW4 A;  3K9U A;  4AB7 A;  4FD5 A;  3P2F A;  1J4J A;  2JDD A;  3F5B A;  4KVO E;  3DSB A;  4MFK A;  4OAD A;  2PC1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...