2B4DA

Ssat+coa+sp- sp disordered
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
170
structure length
170
Chain Sequence
AKFVIRPATAADCSDILRLIKELAKYEYMEEQVILTEKDLLEDGFGEHPFYHCLVAEVPKEHWTPEGHSIVGFAMYYFTYDPWIGKLLYLEDFFVMSDYRGFGIGSEILKNLSQVAMRCRCSSMHFLVAEWNEPSINFYKRRGASDLSSEEGWRLFKIDKEYLLKMATEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Diamine acetyltransferase 1
publication title Structures of wild-type and mutant human spermidine/spermine N1-acetyltransferase, a potential therapeutic drug target
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 35
structure length 170
sequence length 170
ec nomenclature ec 2.3.1.57: Diamine N-acetyltransferase.
pdb deposition date 2005-09-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 2b4dA00
1Z4RA 4FD4A 2ZXVA 2VBQA 2R7HA 2OH1A 4ORFA 2GE3A 1L0CA 3BLNA 3EO4A 2OZGA 2JDCA 4H6UA 4KOUA 4UA3A 3V8IA 3ZZIA 4YFJA 2B4DA 2B3VA 4M85A 3D2PA 2P6GA 2I79A 2PR8A 3S6HA 4CS0B 2K5TA 5ISVA 1YK3A 2KCWA 5F46A 1KUXA 3FRMA 2WPWA 4YRHA 2OU2A 3P2HA 4IF5A 3R9EA 1NSLA 4FD5A 3TO7A 4F6AA 1MJBA 2OB0A 4JD6A 2FXFA 2CNMA 3D2MA 2JLMA 3SHPA 3OWCA 3EXNA 1NE9A 2GANA 2QIRA 4QC6A 1VHSA 4NCZA 1B6BA 5E96A 4KORA 4HNXB 2JEVA 5IB0A 3SXOA 1XMTA 1S7LA 3IWGA 4KOTA 5J8FA 2PC1A 4MI4A 4JXQA 1BO4A 4MY0A 2B5GB 3PZJA 3BJ7A 1QSNA 4XPKA 2D4PA 4CRYB 2PDOA 4PK2A 3TFYA 2FE7A 3P2FA 2B4BA 2VXKA 1M4IA 1P0HA 4KUBA 4U9ZA 4MY3A 2ZW5A 3FB3A 1WWZA 3F8KA 4AG7A 1ON0A 1VKCA 2B3UA 4H89A 1XEBA 3S6FA 2I00A 1IB1E 4AVAA 2QMLA 1U6MA 3TO9A 2J8RA 3JVNA 1MJAA 4CAVA 5H84A 4DNCA 1TIQA 1S5KA 2JDDA 1J4JA 2B4DB 2CNSA 3PGPA 2EUIA 5C88A 4QBJA 2ATRA 4CRZB 3VWDA 4R3KA 1FY7A 1M44A 2C27A 5IX3A 3I9SA 2P0WA 4JXRA 1YVOA 3QAHA 4AVCA 1S7KA 2VZZA 1YREA 4B5PA 4IUSA 3WR7A 4MHDA 3UY5A 1NMTA 1S7NA 2BL1A 1LRZA 2Q44A 3GYAA 2O28A 5HH1A 4KOYA 3N7ZA 1P4NA 4KOSA 5EC4A 2G3TA 4EVYA 1S7FA 4LUAA 1Q2YA 2BEIA 4HNWB 3T9YA 2WPXA 2PSWA 2F5IA 4NEXA 3TOBA 3JUWA 4XNHC 3T90A 5JPHA 4L8AA 2IL4A 1N71A 2EVNA 2R1IA 3R95A 3W6SA 2J8NA 4KVXA 1Z9UA 3H4QA 2J8MA 1V0CA 2HQYA 4XPDC 1IYKA 1YVKA 4OLLA 2FIWA 4I49A 2P6EA 4Y49C 3TOAA 5JQ4A 2OZHA 4RI1A 4RS2A 2ZW4A 4F0YA 1IIDA 3VWEA 5KTCA 2BSWA 5F49A 2HUZA 5IV0A 1YX0A 4ZBGA 3EY5A 1S60A 4AB7A 2OZUA 1BOBA 1IYLA 5EBVA 3W91A 2PR1A 4FD7A 3RYOA 3F0AA 3ZJ0A 3CXPA 2HV2A 4XNHB 1YGHA 2Y0MA 4J3GA 3CXQA 1XF8A 2FL4A 1K4JA 4X5KA 4QUSA 1KUVA 4QVTA 4UWJA 4NXYA 3DNSA 2PQ8A 4XPDB 2B58A 1YR0A 3EC4A 5F48A 4JJXA 2ARHA 4Y49B 2VEZA 2FCKA 1QSTA 4KUAA 1PU9A 4PSXA 5J8CA 4BMHA 2QECA 1Y9WA 1CJWA 2AJ6A 4E8OA 4PSWA 5HMNA 4QB9A 5KTAA 1XIXA 2Q0YA 2A4NA 4ONUA 1QSOA 1XE4A 1Z4EA 4B5OA 4B5PB 1Q2CA 3D3SA 5DWNA 3D8PA 2R98A 2NMTA 3TCVA 3B8GA 1B87A 4H6ZA 1QSRA 1Y9KA 4KZTA 4L89A 1UFHA 3DR8A 4KVOE 3GKRA 4R3LA 1Y7RA 2ZPAA 3FIXA 2VQYA 3E0KA 4II9A 2Z10A 4AVBA 2FS5A 4OADA 4MJ8A 4E2AA 3LODA 4R57A 2Q7BA 3S6GA 1SQHA 3SXNA 1R57A 2VI7A 4XPLA 1M4GA 1OZPA 3FNCA 4K30A 2Z11A 1IICA 3G3SA 4KLWA 4U9YA 1I12A 3LD2A 2PRBA 4R87A 5F47A 4AG9A 3IGRA 2Q4VA 4FD6A 3C26A 2VZYA 1M4DA 2FT0A 1PUAA 3DSBA 3PP9A 2H5MA 4NSQA 2Q4YA 3GY9A 1RO5A 1GHEA 3R96A 1YLEA 3DDDA 3R9GA 2X7BA 1M1DA 2G0BA 4OAEA 2CY2A 3FYNA 4R9MA 3QB8A 4PK3A 4KLVA 4M3SA 2ZW7A 3W6XA 4HKFA 1KUYA 3R9FA 1I21A 4KOWA 1KZFA 1CM0A 1MK4A 5C82A 5DWMA 4YGOA 2AE6A 3G8WA 3DR6A 2R8VA 4U5YA 5I0CA 1Q2DA 2Q04A 2BUEA 3FXTA 3TT2A 4UWIA 3S6KA 5KTDA 3K9UA 4UBRA 2FIAA 2REFA 2GIVA 4E0AA 4MBUA 3I3GA 4JWPA 3TE4A 4JLYA 2D4OA 4GS4A 5FVJA 2B5GA 3MGDA 2REEA 3CXSA 1MJ9A 2FSRA 2P6FA 5CNPA 2CNTA 3TTHA 3NE7A 4CAXA 4LX9A 2RC4A 2Z0ZA 4HNYB 3EFAA 3KKWA 2G3AA 2DXQA 4KOXA 1WK4A 3F5BA 4PV6A 1RXTA 2ZW6A 1S3ZA 1QSMA 5GCNA 3TO6A 3R1KA 5H86A 4CAWA 3BJ8A 4KVME 4KOVA 1I1DA 3FBUA 4NF1A
chains in the Genus database with same CATH superfamily
1Z4RA 4FD4A 1YW4A 2ZXVA 3B3SA 2VBQA 2R7HA 2ZEGA 4DYOA 4C2YA 2OH1A 1TKFA 4ORFA 2GE3A 1Y7EA 2GLFA 1L0CA 3BLNA 3KI9A 4PXEA 5JGFA 5K8OA 3EO4A 3SI2A 2OZGA 4PXBA 4UCNA 4MFQA 1GYTA 2JDCA 4H6UA 4KOUA 2O53A 1VHOA 4UA3A 4K3NA 3V8IA 5LRGA 3ZZIA 4F8ZA 2Q4ZA 4YFJA 1JQGA 4MFKA 4C68A 2B4DA 4BD9A 1LAPA 2B3VA 4JYWA 3NH5A 4M85A 3D2PA 2P6GA 2Z3OA 3CZXA 2I79A 2PR8A 4MCQA 5AG6A 3S6HA 4CS0B 2K5TA 5G1ZA 5ISVA 2AFOA 3KGQA 1YK3A 2KCWA 5F46A 1KUXA 3FRMA 2WPWA 2GFQA 2GU2A 3A9LA 4YRHA 2ZOFA 2OU2A 3KQXA 4OMEA 2Z3KA 3NH8A 2O4HA 3P2HA 1R43A 4IF5A 3BI1A 1ZLHA 3GLJA 2ZOGA 1NSLA 3R9EA 3FVLA 4FD5A 1F2OA 2YNCA 5D8NA 3TO7A 4F6AA 4ZY2A 1MJBA 2ZEMA 4P4DA 2ZEPA 3S9LA 2OB0A 3KQZA 3PEIA 2FXFA 4JD6A 2CNMA 1HEEA 3D2MA 2JLMA 3SHPA 4KSIA 3B3CA 3PBEA 4MCPA 2VL1A 3OWCA 2Q51A 3D7FA 3EXNA 4O23A 4CGNA 1NE9A 4LQGA 2GANA 2QIRA 4DUKA 4QC6A 3NH4A 1VHSA 4NCZA 3SJXA 1B6BA 3SI0A 3LACA 5E96A 4KORA 4HNXB 2JEVA 4P4FA 3B2YA 3ISXA 3SXOA 5IB0A 4OC1A 1XMTA 1S7LA 2JEWA 3IWGA 2QVPA 4KOTA 4MFZA 4FAIA 2Z3PA 5J8FA 2PC1A 4MI4A 4JXQA 5K8NA 4B13A 4R76A 1BO4A 5ELYA 4MY0A 3CPAA 4ZX9A 2B5GB 1ELLP 3PZJA 1TXRA 3BJ7A 1QSNA 2C6GA 2ZENA 2D4PA 4XPKA 4CRYB 2ZEOA 1IOFA 2PDOA 4F9UA 3T8WA 2Q43A 5HVHA 4PK2A 1Y0RA 1UWYA 4NGNA 5AGEA 3TFYA 2FE7A 4P44A 3P2FA 2RB7A 4ZI6A 2B4BA 2QYVA 2VXKA 1M4IA 1JWQA 2EO8A 1P0HA 4KUBA 4U9ZA 1XMBA 4MY3A 2ZW5A 1YQEA 4R8FA 2PJ2A 3FB3A 1WWZA 3D68A 3D66A 3F8KA 4MXUA 4B12A 4AG7A 3VARA 5AG5A 2CF4A 3FF3A 1ON0A 1VKCA 2B3UA 3H5ZA 4H89A 1XEBA 4IHMA 1PYTB 3S6FA 2I00A 1IB1E 5AG4A 4AVAA 3D7HA 2PJAA 4UIBA 4PPZA 4NJRA 4PXCA 5G22A 4YWYA 2Z3LA 2QMLA 1U6MA 3TO9A 3B3TA 2J8RA 3JVNA 1MJAA 4C2XA 4B10A 4CAVA 5H84A 3B3VA 4NGTA 4UFVA 4DNCA 1TIQA 4ZY1A 1S5KA 1CP6A 4OIDA 2JDDA 1J4JA 2B4DB 2CNSA 3B35A 3PGPA 3V7ZA 3NA6A 2EUIA 5THWA 5C88A 4FWUA 4QBJA 1XRYA 2ATRA 4P4BA 4CRZB 3VWDA 4R3KA 1FY7A 1BAVA 1M44A 2CIJA 1ZG8A 4UFWA 1PCAA 3RAMA 2C27A 3PFOA 4BBHA 3B3WA 4M6HA 5IX3A 3I9SA 2DPTA 8CPAA 1IOIA 2EBJA 4Q38A 2P0WA 4JXRA 3DGVA 1YVOA 3QAHA 4AVCA 1LOKA 3JTKA 1S7KA 2VZZA 1YREA 5LRJA 4NGRA 1CPXA 4IUSA 4MHPA 4NGMA 4B5PA 5DS0A 4MHDA 4ONWA 3UY5A 4MHYA 3WR7A 3FECA 4BINA 1F57A 1NMTA 1S7NA 1VHEA 2BL1A 1LRZA 4UEFA 2OOTA 4R6TA 3WABA 1BLLE 4EMEA 3SJGA 5IB9A 3GUXA 2YNEA 2Q44A 3BI0A 2FVGA 4CYNA 1IY7A 3GYAA 4HPSA 2O28A 2V8HA 2ZEFA 5HH1A 4KOYA 3TC8A 3N7ZA 1P4NA 3B7IA 3PRTA 4KOSA 3WC7A 5BWAB 5D29A 2BCOA 4X2TA 5EC4A 4EWTA 2G3TA 4EVYA 1S7FA 1X12A 5EMIA 3SJEA 4LUAA 4PQAA 2F7VA 1Q2YA 2BEIA 4FUUA 4NGPA 4HNWB 4TWEA 3T9YA 2WPXA 4RUHA 2PSWA 2F5IA 4GXHA 4NEXA 3TOBA 3JUWA 4IK2A 2IQ6A 1DTDA 4UCPA 4XNHC 1AUGA 3T90A 5JPHA 4L8AA 2IL4A 1N71A 1LANA 4YU9A 5G20A 3L2NA 3S9NA 5JM6A 2EVNA 2R1IA 1IU8A 3R95A 3W6SA 1A2ZA 2J8NA 3IJ3A 1Z9UA 4KVXA 3H4QA 3D7GA 4A39A 4FBEA 4CYQA 2J8MA 1V0CA 4P45A 2HQYA 4XPDC 1IYKA 1YVKA 2QJ8A 2AFMA 4OLLA 3PFEA 2FIWA 4P4JA 1AYEA 2G9DA 3NE8A 4C2ZA 3IU1A 4I49A 2P6EA 2ZEHA 4Y49C 3TOAA 2OZHA 4RI1A 3WC5A 4RS2A 2ZW4A 4F0YA 1IIDA 3VWEA 5KTCA 1YLOA 2BSWA 2Q7SA 3H8EA 5F49A 2HUZA 2PJ5A 3RNZA 4F0XA 5IV0A 1YX0A 2XEJA 3FX6A 4ZBGA 3QAYA 4WWVA 1M4LA 1S60A 3EY5A 4CAFA 4AB7A 3TX8A 3S9MA 2OZUA 1BOBA 1IYLA 5EBVA 3W91A 2PR1A 3D4UA 4FD7A 4ZY0A 5JH9A 3RYOA 1ZLIA 4OC3A 5LYLA 3F0AA 3ZJ0A 3CXPA 4PXDA 2HV2A 1YW6A 4Q36A 4XNHB 2PIYA 1YGHA 2Y0MA 2CTCA 3KASA 4J3GA 3CXQA 4OC0A 2Z3NA 3IU2A 3FEDA 1XF8A 2FL4A 1K4JA 4X5KA 4CGLA 4MCRA 5K8MA 5K8PA 4QUSA 4Z65A 5JQ4A 2ZEEA 1KUVA 4QVTA 2YGWA 4B6ZA 1Z5RA 4NGQA 4UWJA 2V77A 4CYPA 4NXYA 3DNSA 2PQ8A 4M6IA 4XPDB 2B58A 1YR0A 2PJ1A 3EC4A 5F48A 1CX8A 4JJXA 2CTBA 2ARHA 4Y49B 4ZGYB 2VEZA 1TKJA 2FCKA 3JRUA 4P10A 4JZ0A 1QSTA 4KUAA 1PU9A 2BO9A 2DEAA 4PSXA 5J8CA 2PCUA 4BMHA 3GIUA 4A38A 4R7MA 1Q7LA 2ABZA 3KL9A 1Z8LA 2C1CA 1RTQA 2DF5A 2QECA 3CPXA 3N5FA 4MHNA 4MRIA 1Y9WA 1CJWA 1ARMA 2AJ6A 4E8OA 2I3CA 4G1PA 2YNCC 4PSWA 3PB6X 4CPAA 5HMNA 4QB9A 5KTAA 3MRUA 1XIXA 1X10A 2Q0YA 3FH4A 1CBXA 4MFLA 4UCMA 4C7HA 5A28A 4KS9A 4UIAA 2C6PA 2A4NA 3LWUA 4ONUA 2IMOA 1QSOA 1R3NA 1XE4A 2PE3A 1Z4EA 4B5OA 4A30A 1NSAA 4B5PB 1Q2CA 2Z3MA 2XEIA 1FNOA 3D3SA 4P6YA 1TKHA 4X3RA 5DWNA 5A27A 1Y0YA 1EE3P 2R98A 3D8PA 5LYDA 2NMTA 3FMCA 3TCVA 3B8GA 3CDXA 4B11A 3RO0A 2PJCA 2WZNA 3ISZA 4IAVA 4GM5A 1B87A 4H6ZA 4MFPA 1Z2LA 5LRKA 2DPSA 1ZO0A 1QSRA 1Y9KA 2IJZA 2EWBA 1TF9A 2EK8A 2PRQA 4KZTA 4OC5A 4RN7A 2PJBA 3H8GA 4L89A 1UFHA 3DR8A 1DE4C 2CXAA 1QQ9A 4KVOE 3QNVA 5HVGA 4DJLA 1XFOA 3GKRA 3WC6A 4MMOA 1Z8TA 2YNDA 3IWEA 1Y7RA 2ZPAA 3FIXA 4R3LA 2VQYA 3E0KA 2AFZA 1QMUA 2J9AA 5G21A 4KSFA 5AG7A 4II9A 2HB6A 2Z10A 4A95A 4LQ6A 5HVFA 4OP4A 3BHXA 2NYQA 1ZG9A 2FS5A 4OADA 4AVBA 2F8HA 3LMSA 4MJ8A 1FT7A 4OC2A 4E2AA 3BXMA 3LODA 2AFUA 4R57A 2Q7BA 3IIBA 3S6GA 1XOVA 4C7IA 3IO1A 4A32A 1SQHA 3SXNA 1R57A 2VI7A 4XPLA 1M4GA 1OZPA 3FNCA 3GB0A 4K30A 2PJ8A 2Z11A 1IICA 3G3SA 3NFZA 1XBUA 4KLWA 4NFRA 4U9YA 4ZX8A 4AXVA 1I12A 4UEZA 3LD2A 2PRBA 4R87A 3H8FA 5F47A 4AG9A 3IGRA 2Q4VA 3PBBA 2OR4A 1IGBA 4FD6A 4CAEA 4CGPA 3C26A 2VZYA 1M4DA 4UF4A 2FT0A 4H2KA 2GLJA 5J1QA 1PUAA 1BPNA 4X8IA 6CPAA 2XEGA 3DSBA 3PP9A 2H5MA 4NSQA 3WT4A 3RBUA 2ODFA 2Q4YA 3GY9A 3IC1A 4A37A 2GREA 1RO5A 2EK9A 1GHEA 3R96A 2XEFA 1YLEA 3KR4A 3VATA 3K9TA 4CGMA 2AFXA 4B14A 3IEHA 2RFHA 3DDDA 1VIXA 1Z8XA 2PJ4A 4Q7AA 3R9GA 1VGYA 2X7BA 3SJFA 2WUUA 4A31A 3D67A 1HDQA 2POKA 3K2KA 2ANPA 1M1DA 3CT9A 2G0BA 4UFXA 4OAEA 4OIWA 2CY2A 3FYNA 2V8DA 3PB7X 1ELMP 5HXDA 4R9MA 3QB8A 4PK3A 3DLJA 4KLVA 2ZEDA 4M3SA 2ZW7A 3W6XA 3KHZA 4HKFA 4CYOA 2PJ0A 1KUYA 4WJBA 3R9FA 3VH9A 3I1UA 1I21A 4KOWA 1KZFA 1CM0A 1MK4A 4M6GA 3MN8A 4OKOA 1HDUA 5C82A 5DWMA 4F9VA 3KR5A 4A94A 3KHXA 1CP7A 4YGOA 3RZAA 2AE6A 2JBJA 2PIZA 1CG2A 3G8WA 3DR6A 2R8VA 2WYRA 4KSAA 5CPAA 2PVWA 2ZELA 4U5YA 1AMPA 1LAMA 2JBKA 3FEEA 5I0CA 1Q2DA 2Q04A 2PJ6A 2V8VA 2V8GA 3PB9X 2BUEA 3FXTA 3IFEA 3TT2A 4UWIA 2PVVA 3S6KA 1BPMA 5KTDA 1H8LA 3K9UA 4UBRA 5F09A 4OC4A 2FIAA 2C6CA 2PJ3A 2REFA 1F2PA 4P4IA 2GIVA 4E0AA 3IWWA 4MBUA 3I3GA 4JWPA 4NGSA 3TE4A 4TNUA 4JLYA 5LYIA 2D4OA 4GS4A 5FVJA 1YMEA 4A2ZA 2B5GA 4MHZA 7CPAA 3MGDA 2REEA 3HUVA 4UEEA 3CXSA 1MJ9A 1YSJA 2FSRA 2P6FA 5CNPA 2CNTA 2HC9A 4MFJA 4A33A 4P4EA 3KZWA 3TTHA 5I4MA 3NE7A 4CAXA 4LX9A 3V38A 5LYFA 2RC4A 3PB8X 3PB4X 4W9YA 2Z0ZA 4HNYB 1CPSA 4ZYQA 3EFAA 1ZG7A 3KKWA 2G3AA 2DXQA 4KOXA 1WK4A 3F5BA 4CGOA 1LCPA 4PV6A 2PJ9A 2PJ7A 1KWMA 1RXTA 3D7DA 2ZW6A 4MCSA 1S3ZA 1QSMA 1TF8A 1ARLA 2AFWA 2WSAA 1OBRA 5GCNA 3TO6A 3R1KA 2AFSA 4NJQA 5H86A 4CAWA 2BOAA 3BJ8A 3FJUA 4KVME 3SI1A 1LFWA 4KOVA 2NSMA 5CBMA 4EFDA 1I1DA 1XJOA 3FBUA 1Z8WA 4NF1A 3HLPA
chains in the Genus database with same CATH topology
1Z4RA 4FD4A 2ZXVA 2VBQA 2R7HA 4C2YA 2OH1A 4ORFA 2GE3A 1L0CA 3BLNA 3EO4A 2OZGA 4UCNA 4MFQA 2JDCA 4H6UA 4KOUA 4UA3A 3V8IA 3ZZIA 4YFJA 4MFKA 4C68A 2B4DA 2B3VA 5AG6A 4M85A 3D2PA 2P6GA 2Z3OA 2I79A 2PR8A 3S6HA 4CS0B 2K5TA 5G1ZA 5ISVA 1YK3A 2KCWA 5F46A 1KUXA 3FRMA 2WPWA 3A9LA 4YRHA 2OU2A 2Z3KA 3P2HA 4IF5A 3R9EA 1NSLA 4FD5A 2YNCA 3TO7A 4F6AA 1MJBA 2OB0A 4JD6A 2FXFA 2CNMA 3D2MA 2JLMA 3SHPA 3OWCA 3EXNA 4CGNA 1NE9A 2GANA 2QIRA 4QC6A 1VHSA 4NCZA 1B6BA 5E96A 4KORA 4HNXB 2JEVA 5IB0A 3SXOA 1XMTA 1S7LA 3IWGA 4KOTA 4MFZA 2Z3PA 5J8FA 2PC1A 4MI4A 4JXQA 4B13A 1BO4A 4MY0A 2B5GB 3PZJA 3BJ7A 1QSNA 4XPKA 2D4PA 4CRYB 2PDOA 4PK2A 5AGEA 3TFYA 2FE7A 3P2FA 2B4BA 2VXKA 1M4IA 1P0HA 4KUBA 4U9ZA 4MY3A 2ZW5A 3FB3A 1WWZA 3F8KA 4B12A 4AG7A 5AG5A 1ON0A 1VKCA 2B3UA 3H5ZA 4H89A 1XEBA 3S6FA 2I00A 1IB1E 5AG4A 4AVAA 5G22A 2Z3LA 2QMLA 1U6MA 3TO9A 2J8RA 3JVNA 1MJAA 4C2XA 4B10A 4CAVA 5H84A 4UFVA 4DNCA 1TIQA 1S5KA 2JDDA 1J4JA 2B4DB 2CNSA 3PGPA 2EUIA 5C88A 4QBJA 2ATRA 4CRZB 3VWDA 4R3KA 1FY7A 1M44A 4UFWA 2C27A 4BBHA 5IX3A 3I9SA 2DPTA 4Q38A 2P0WA 4JXRA 1YVOA 3QAHA 4AVCA 3JTKA 1S7KA 2VZZA 1YREA 4B5PA 4IUSA 3WR7A 4MHDA 3UY5A 1NMTA 1S7NA 2BL1A 1LRZA 2YNEA 2Q44A 4CYNA 3GYAA 2O28A 5HH1A 4KOYA 3N7ZA 1P4NA 5BWAB 4KOSA 5EC4A 2G3TA 4EVYA 1S7FA 4LUAA 1Q2YA 2BEIA 4HNWB 3T9YA 2WPXA 2PSWA 2F5IA 4NEXA 3TOBA 3JUWA 4UCPA 4XNHC 3T90A 5JPHA 4L8AA 2IL4A 1N71A 5G20A 2EVNA 2R1IA 3R95A 3W6SA 2J8NA 4KVXA 1Z9UA 3H4QA 4CYQA 2J8MA 1V0CA 2HQYA 4XPDC 1IYKA 1YVKA 4OLLA 2FIWA 4C2ZA 3IU1A 4I49A 2P6EA 4Y49C 3TOAA 5JQ4A 2OZHA 4RI1A 4RS2A 2ZW4A 4F0YA 1IIDA 3VWEA 5KTCA 2BSWA 4F0XA 5F49A 2HUZA 5IV0A 1YX0A 4ZBGA 3EY5A 1S60A 4CAFA 4AB7A 2OZUA 1BOBA 1IYLA 5EBVA 3W91A 2PR1A 4FD7A 3RYOA 3F0AA 3ZJ0A 3CXPA 2HV2A 4Q36A 4XNHB 1YGHA 2Y0MA 4J3GA 3CXQA 2Z3NA 3IU2A 1XF8A 2FL4A 1K4JA 4X5KA 4CGLA 4QUSA 1KUVA 4QVTA 2YGWA 4UWJA 4CYPA 4NXYA 3DNSA 2PQ8A 4XPDB 2B58A 1YR0A 3EC4A 5F48A 4JJXA 2ARHA 4Y49B 4ZGYB 2VEZA 2FCKA 1QSTA 4KUAA 1PU9A 4PSXA 5J8CA 4BMHA 2QECA 1Y9WA 1CJWA 2AJ6A 4E8OA 4PSWA 2YNCC 5HMNA 4QB9A 5KTAA 1XIXA 2Q0YA 4MFLA 4UCMA 4C7HA 5A28A 4KS9A 2A4NA 4ONUA 1QSOA 1XE4A 1Z4EA 4B5OA 4A30A 4B5PB 1Q2CA 2Z3MA 3D3SA 5DWNA 5A27A 3D8PA 2R98A 2NMTA 3TCVA 3B8GA 4B11A 1B87A 4H6ZA 4MFPA 2DPSA 1ZO0A 1QSRA 1Y9KA 4KZTA 4L89A 1UFHA 3DR8A 2CXAA 4KVOE 3GKRA 3IWEA 2YNDA 4R3LA 1Y7RA 2ZPAA 3FIXA 2VQYA 3E0KA 5G21A 4KSFA 5AG7A 4II9A 4A95A 2Z10A 4AVBA 2FS5A 4OADA 4MJ8A 4E2AA 3LODA 4R57A 2Q7BA 3S6GA 4C7IA 4A32A 1SQHA 3SXNA 1R57A 2VI7A 4XPLA 1M4GA 1OZPA 3FNCA 4K30A 2Z11A 1IICA 3G3SA 4KLWA 4U9YA 1I12A 3LD2A 2PRBA 4R87A 5F47A 4AG9A 3IGRA 2Q4VA 4FD6A 4CAEA 4CGPA 3C26A 2VZYA 1M4DA 2FT0A 1PUAA 3DSBA 3PP9A 2H5MA 4NSQA 2Q4YA 3GY9A 1RO5A 4CGMA 1GHEA 3R96A 1YLEA 4B14A 3DDDA 3R9GA 2X7BA 2WUUA 4A31A 1M1DA 2G0BA 4UFXA 4OAEA 2CY2A 3FYNA 4R9MA 3QB8A 4PK3A 4KLVA 4M3SA 2ZW7A 3W6XA 4HKFA 4CYOA 1KUYA 3R9FA 1I21A 4KOWA 1KZFA 1CM0A 1MK4A 5C82A 5DWMA 4YGOA 2AE6A 3G8WA 3DR6A 2R8VA 4KSAA 4U5YA 5I0CA 1Q2DA 2Q04A 2BUEA 3FXTA 3TT2A 4UWIA 3S6KA 5KTDA 3K9UA 4UBRA 2FIAA 2REFA 2GIVA 4E0AA 4MBUA 3I3GA 4JWPA 3TE4A 4JLYA 2D4OA 4GS4A 5FVJA 4A2ZA 2B5GA 3MGDA 2REEA 3CXSA 1MJ9A 2FSRA 2P6FA 5CNPA 2CNTA 4MFJA 4A33A 3TTHA 3NE7A 4CAXA 4LX9A 2RC4A 2Z0ZA 4HNYB 3EFAA 3KKWA 2G3AA 2DXQA 4KOXA 1WK4A 3F5BA 4CGOA 4PV6A 1RXTA 2ZW6A 1S3ZA 1QSMA 2WSAA 5GCNA 3TO6A 3R1KA 5H86A 4CAWA 3BJ8A 4KVME 4KOVA 1I1DA 3FBUA 4NF1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Z4R A;  4FD4 A;  2ZXV A;  2VBQ A;  2R7H A;  2OH1 A;  4ORF A;  2GE3 A;  1L0C A;  3BLN A;  3EO4 A;  2OZG A;  2JDC A;  4H6U A;  4KOU A;  4UA3 A;  3V8I A;  3ZZI A;  4YFJ A;  2B4D A;  2B3V A;  4M85 A;  3D2P A;  2P6G A;  2I79 A;  2PR8 A;  3S6H A;  4CS0 B;  2K5T A;  5ISV A;  1YK3 A;  2KCW A;  5F46 A;  1KUX A;  3FRM A;  2WPW A;  4YRH A;  2OU2 A;  3P2H A;  4IF5 A;  3R9E A;  1NSL A;  4FD5 A;  3TO7 A;  4F6A A;  1MJB A;  2OB0 A;  4JD6 A;  2FXF A;  2CNM A;  3D2M A;  2JLM A;  3SHP A;  3OWC A;  3EXN A;  1NE9 A;  2GAN A;  2QIR A;  4QC6 A;  1VHS A;  4NCZ A;  1B6B A;  5E96 A;  4KOR A;  4HNX B;  2JEV A;  5IB0 A;  3SXO A;  1XMT A;  1S7L A;  3IWG A;  4KOT A;  5J8F A;  2PC1 A;  4MI4 A;  4JXQ A;  1BO4 A;  4MY0 A;  2B5G B;  3PZJ A;  3BJ7 A;  1QSN A;  4XPK A;  2D4P A;  4CRY B;  2PDO A;  4PK2 A;  3TFY A;  2FE7 A;  3P2F A;  2B4B A;  2VXK A;  1M4I A;  1P0H A;  4KUB A;  4U9Z A;  4MY3 A;  2ZW5 A;  3FB3 A;  1WWZ A;  3F8K A;  4AG7 A;  1ON0 A;  1VKC A;  2B3U A;  4H89 A;  1XEB A;  3S6F A;  2I00 A;  1IB1 E;  4AVA A;  2QML A;  1U6M A;  3TO9 A;  2J8R A;  3JVN A;  1MJA A;  4CAV A;  5H84 A;  4DNC A;  1TIQ A;  1S5K A;  2JDD A;  1J4J A;  2B4D B;  2CNS A;  3PGP A;  2EUI A;  5C88 A;  4QBJ A;  2ATR A;  4CRZ B;  3VWD A;  4R3K A;  1FY7 A;  1M44 A;  2C27 A;  5IX3 A;  3I9S A;  2P0W A;  4JXR A;  1YVO A;  3QAH A;  4AVC A;  1S7K A;  2VZZ A;  1YRE A;  4B5P A;  4IUS A;  3WR7 A;  4MHD A;  3UY5 A;  1NMT A;  1S7N A;  2BL1 A;  1LRZ A;  2Q44 A;  3GYA A;  2O28 A;  5HH1 A;  4KOY A;  3N7Z A;  1P4N A;  4KOS A;  5EC4 A;  2G3T A;  4EVY A;  1S7F A;  4LUA A;  1Q2Y A;  2BEI A;  4HNW B;  3T9Y A;  2WPX A;  2PSW A;  2F5I A;  4NEX A;  3TOB A;  3JUW A;  4XNH C;  3T90 A;  5JPH A;  4L8A A;  2IL4 A;  1N71 A;  2EVN A;  2R1I A;  3R95 A;  3W6S A;  2J8N A;  4KVX A;  1Z9U A;  3H4Q A;  2J8M A;  1V0C A;  2HQY A;  4XPD C;  1IYK A;  1YVK A;  4OLL A;  2FIW A;  4I49 A;  2P6E A;  4Y49 C;  3TOA A;  5JQ4 A;  2OZH A;  4RI1 A;  4RS2 A;  2ZW4 A;  4F0Y A;  1IID A;  3VWE A;  5KTC A;  2BSW A;  5F49 A;  2HUZ A;  5IV0 A;  1YX0 A;  4ZBG A;  3EY5 A;  1S60 A;  4AB7 A;  2OZU A;  1BOB A;  1IYL A;  5EBV A;  3W91 A;  2PR1 A;  4FD7 A;  3RYO A;  3F0A A;  3ZJ0 A;  3CXP A;  2HV2 A;  4XNH B;  1YGH A;  2Y0M A;  4J3G A;  3CXQ A;  1XF8 A;  2FL4 A;  1K4J A;  4X5K A;  4QUS A;  1KUV A;  4QVT A;  4UWJ A;  4NXY A;  3DNS A;  2PQ8 A;  4XPD B;  2B58 A;  1YR0 A;  3EC4 A;  5F48 A;  4JJX A;  2ARH A;  4Y49 B;  2VEZ A;  2FCK A;  1QST A;  4KUA A;  1PU9 A;  4PSX A;  5J8C A;  4BMH A;  2QEC A;  1Y9W A;  1CJW A;  2AJ6 A;  4E8O A;  4PSW A;  5HMN A;  4QB9 A;  5KTA A;  1XIX A;  2Q0Y A;  2A4N A;  4ONU A;  1QSO A;  1XE4 A;  1Z4E A;  4B5O A;  4B5P B;  1Q2C A;  3D3S A;  5DWN A;  3D8P A;  2R98 A;  2NMT A;  3TCV A;  3B8G A;  1B87 A;  4H6Z A;  1QSR A;  1Y9K A;  4KZT A;  4L89 A;  1UFH A;  3DR8 A;  4KVO E;  3GKR A;  4R3L A;  1Y7R A;  2ZPA A;  3FIX A;  2VQY A;  3E0K A;  4II9 A;  2Z10 A;  4AVB A;  2FS5 A;  4OAD A;  4MJ8 A;  4E2A A;  3LOD A;  4R57 A;  2Q7B A;  3S6G A;  1SQH A;  3SXN A;  1R57 A;  2VI7 A;  4XPL A;  1M4G A;  1OZP A;  3FNC A;  4K30 A;  2Z11 A;  1IIC A;  3G3S A;  4KLW A;  4U9Y A;  1I12 A;  3LD2 A;  2PRB A;  4R87 A;  5F47 A;  4AG9 A;  3IGR A;  2Q4V A;  4FD6 A;  3C26 A;  2VZY A;  1M4D A;  2FT0 A;  1PUA A;  3DSB A;  3PP9 A;  2H5M A;  4NSQ A;  2Q4Y A;  3GY9 A;  1RO5 A;  1GHE A;  3R96 A;  1YLE A;  3DDD A;  3R9G A;  2X7B A;  1M1D A;  2G0B A;  4OAE A;  2CY2 A;  3FYN A;  4R9M A;  3QB8 A;  4PK3 A;  4KLV A;  4M3S A;  2ZW7 A;  3W6X A;  4HKF A;  1KUY A;  3R9F A;  1I21 A;  4KOW A;  1KZF A;  1CM0 A;  1MK4 A;  5C82 A;  5DWM A;  4YGO A;  2AE6 A;  3G8W A;  3DR6 A;  2R8V A;  4U5Y A;  5I0C A;  1Q2D A;  2Q04 A;  2BUE A;  3FXT A;  3TT2 A;  4UWI A;  3S6K A;  5KTD A;  3K9U A;  4UBR A;  2FIA A;  2REF A;  2GIV A;  4E0A A;  4MBU A;  3I3G A;  4JWP A;  3TE4 A;  4JLY A;  2D4O A;  4GS4 A;  5FVJ A;  2B5G A;  3MGD A;  2REE A;  3CXS A;  1MJ9 A;  2FSR A;  2P6F A;  5CNP A;  2CNT A;  3TTH A;  3NE7 A;  4CAX A;  4LX9 A;  2RC4 A;  2Z0Z A;  4HNY B;  3EFA A;  3KKW A;  2G3A A;  2DXQ A;  4KOX A;  1WK4 A;  3F5B A;  4PV6 A;  1RXT A;  2ZW6 A;  1S3Z A;  1QSM A;  5GCN A;  3TO6 A;  3R1K A;  5H86 A;  4CAW A;  3BJ8 A;  4KVM E;  4KOV A;  1I1D A;  3FBU A;  4NF1 A; 
#chains in the Genus database with same CATH topology
 1Z4R A;  4FD4 A;  1YW4 A;  2ZXV A;  3B3S A;  2VBQ A;  2R7H A;  2ZEG A;  4DYO A;  4C2Y A;  2OH1 A;  1TKF A;  4ORF A;  2GE3 A;  1Y7E A;  2GLF A;  1L0C A;  3BLN A;  3KI9 A;  4PXE A;  5JGF A;  5K8O A;  3EO4 A;  3SI2 A;  2OZG A;  4PXB A;  4UCN A;  4MFQ A;  1GYT A;  2JDC A;  4H6U A;  4KOU A;  2O53 A;  1VHO A;  4UA3 A;  4K3N A;  3V8I A;  5LRG A;  3ZZI A;  4F8Z A;  2Q4Z A;  4YFJ A;  1JQG A;  4MFK A;  4C68 A;  2B4D A;  4BD9 A;  1LAP A;  2B3V A;  4JYW A;  3NH5 A;  4M85 A;  3D2P A;  2P6G A;  2Z3O A;  3CZX A;  2I79 A;  2PR8 A;  4MCQ A;  5AG6 A;  3S6H A;  4CS0 B;  2K5T A;  5G1Z A;  5ISV A;  2AFO A;  3KGQ A;  1YK3 A;  2KCW A;  5F46 A;  1KUX A;  3FRM A;  2WPW A;  2GFQ A;  2GU2 A;  3A9L A;  4YRH A;  2ZOF A;  2OU2 A;  3KQX A;  4OME A;  2Z3K A;  3NH8 A;  2O4H A;  3P2H A;  1R43 A;  4IF5 A;  3BI1 A;  1ZLH A;  3GLJ A;  2ZOG A;  1NSL A;  3R9E A;  3FVL A;  4FD5 A;  1F2O A;  2YNC A;  5D8N A;  3TO7 A;  4F6A A;  4ZY2 A;  1MJB A;  2ZEM A;  4P4D A;  2ZEP A;  3S9L A;  2OB0 A;  3KQZ A;  3PEI A;  2FXF A;  4JD6 A;  2CNM A;  1HEE A;  3D2M A;  2JLM A;  3SHP A;  4KSI A;  3B3C A;  3PBE A;  4MCP A;  2VL1 A;  3OWC A;  2Q51 A;  3D7F A;  3EXN A;  4O23 A;  4CGN A;  1NE9 A;  4LQG A;  2GAN A;  2QIR A;  4DUK A;  4QC6 A;  3NH4 A;  1VHS A;  4NCZ A;  3SJX A;  1B6B A;  3SI0 A;  3LAC A;  5E96 A;  4KOR A;  4HNX B;  2JEV A;  4P4F A;  3B2Y A;  3ISX A;  3SXO A;  5IB0 A;  4OC1 A;  1XMT A;  1S7L A;  2JEW A;  3IWG A;  2QVP A;  4KOT A;  4MFZ A;  4FAI A;  2Z3P A;  5J8F A;  2PC1 A;  4MI4 A;  4JXQ A;  5K8N A;  4B13 A;  4R76 A;  1BO4 A;  5ELY A;  4MY0 A;  3CPA A;  4ZX9 A;  2B5G B;  1ELL P;  3PZJ A;  1TXR A;  3BJ7 A;  1QSN A;  2C6G A;  2ZEN A;  2D4P A;  4XPK A;  4CRY B;  2ZEO A;  1IOF A;  2PDO A;  4F9U A;  3T8W A;  2Q43 A;  5HVH A;  4PK2 A;  1Y0R A;  1UWY A;  4NGN A;  5AGE A;  3TFY A;  2FE7 A;  4P44 A;  3P2F A;  2RB7 A;  4ZI6 A;  2B4B A;  2QYV A;  2VXK A;  1M4I A;  1JWQ A;  2EO8 A;  1P0H A;  4KUB A;  4U9Z A;  1XMB A;  4MY3 A;  2ZW5 A;  1YQE A;  4R8F A;  2PJ2 A;  3FB3 A;  1WWZ A;  3D68 A;  3D66 A;  3F8K A;  4MXU A;  4B12 A;  4AG7 A;  3VAR A;  5AG5 A;  2CF4 A;  3FF3 A;  1ON0 A;  1VKC A;  2B3U A;  3H5Z A;  4H89 A;  1XEB A;  4IHM A;  1PYT B;  3S6F A;  2I00 A;  1IB1 E;  5AG4 A;  4AVA A;  3D7H A;  2PJA A;  4UIB A;  4PPZ A;  4NJR A;  4PXC A;  5G22 A;  4YWY A;  2Z3L A;  2QML A;  1U6M A;  3TO9 A;  3B3T A;  2J8R A;  3JVN A;  1MJA A;  4C2X A;  4B10 A;  4CAV A;  5H84 A;  3B3V A;  4NGT A;  4UFV A;  4DNC A;  1TIQ A;  4ZY1 A;  1S5K A;  1CP6 A;  4OID A;  2JDD A;  1J4J A;  2B4D B;  2CNS A;  3B35 A;  3PGP A;  3V7Z A;  3NA6 A;  2EUI A;  5THW A;  5C88 A;  4FWU A;  4QBJ A;  1XRY A;  2ATR A;  4P4B A;  4CRZ B;  3VWD A;  4R3K A;  1FY7 A;  1BAV A;  1M44 A;  2CIJ A;  1ZG8 A;  4UFW A;  1PCA A;  3RAM A;  2C27 A;  3PFO A;  4BBH A;  3B3W A;  4M6H A;  5IX3 A;  3I9S A;  2DPT A;  8CPA A;  1IOI A;  2EBJ A;  4Q38 A;  2P0W A;  4JXR A;  3DGV A;  1YVO A;  3QAH A;  4AVC A;  1LOK A;  3JTK A;  1S7K A;  2VZZ A;  1YRE A;  5LRJ A;  4NGR A;  1CPX A;  4IUS A;  4MHP A;  4NGM A;  4B5P A;  5DS0 A;  4MHD A;  4ONW A;  3UY5 A;  4MHY A;  3WR7 A;  3FEC A;  4BIN A;  1F57 A;  1NMT A;  1S7N A;  1VHE A;  2BL1 A;  1LRZ A;  4UEF A;  2OOT A;  4R6T A;  3WAB A;  1BLL E;  4EME A;  3SJG A;  5IB9 A;  3GUX A;  2YNE A;  2Q44 A;  3BI0 A;  2FVG A;  4CYN A;  1IY7 A;  3GYA A;  4HPS A;  2O28 A;  2V8H A;  2ZEF A;  5HH1 A;  4KOY A;  3TC8 A;  3N7Z A;  1P4N A;  3B7I A;  3PRT A;  4KOS A;  3WC7 A;  5BWA B;  5D29 A;  2BCO A;  4X2T A;  5EC4 A;  4EWT A;  2G3T A;  4EVY A;  1S7F A;  1X12 A;  5EMI A;  3SJE A;  4LUA A;  4PQA A;  2F7V A;  1Q2Y A;  2BEI A;  4FUU A;  4NGP A;  4HNW B;  4TWE A;  3T9Y A;  2WPX A;  4RUH A;  2PSW A;  2F5I A;  4GXH A;  4NEX A;  3TOB A;  3JUW A;  4IK2 A;  2IQ6 A;  1DTD A;  4UCP A;  4XNH C;  1AUG A;  3T90 A;  5JPH A;  4L8A A;  2IL4 A;  1N71 A;  1LAN A;  4YU9 A;  5G20 A;  3L2N A;  3S9N A;  5JM6 A;  2EVN A;  2R1I A;  1IU8 A;  3R95 A;  3W6S A;  1A2Z A;  2J8N A;  3IJ3 A;  1Z9U A;  4KVX A;  3H4Q A;  3D7G A;  4A39 A;  4FBE A;  4CYQ A;  2J8M A;  1V0C A;  4P45 A;  2HQY A;  4XPD C;  1IYK A;  1YVK A;  2QJ8 A;  2AFM A;  4OLL A;  3PFE A;  2FIW A;  4P4J A;  1AYE A;  2G9D A;  3NE8 A;  4C2Z A;  3IU1 A;  4I49 A;  2P6E A;  2ZEH A;  4Y49 C;  3TOA A;  2OZH A;  4RI1 A;  3WC5 A;  4RS2 A;  2ZW4 A;  4F0Y A;  1IID A;  3VWE A;  5KTC A;  1YLO A;  2BSW A;  2Q7S A;  3H8E A;  5F49 A;  2HUZ A;  2PJ5 A;  3RNZ A;  4F0X A;  5IV0 A;  1YX0 A;  2XEJ A;  3FX6 A;  4ZBG A;  3QAY A;  4WWV A;  1M4L A;  1S60 A;  3EY5 A;  4CAF A;  4AB7 A;  3TX8 A;  3S9M A;  2OZU A;  1BOB A;  1IYL A;  5EBV A;  3W91 A;  2PR1 A;  3D4U A;  4FD7 A;  4ZY0 A;  5JH9 A;  3RYO A;  1ZLI A;  4OC3 A;  5LYL A;  3F0A A;  3ZJ0 A;  3CXP A;  4PXD A;  2HV2 A;  1YW6 A;  4Q36 A;  4XNH B;  2PIY A;  1YGH A;  2Y0M A;  2CTC A;  3KAS A;  4J3G A;  3CXQ A;  4OC0 A;  2Z3N A;  3IU2 A;  3FED A;  1XF8 A;  2FL4 A;  1K4J A;  4X5K A;  4CGL A;  4MCR A;  5K8M A;  5K8P A;  4QUS A;  4Z65 A;  5JQ4 A;  2ZEE A;  1KUV A;  4QVT A;  2YGW A;  4B6Z A;  1Z5R A;  4NGQ A;  4UWJ A;  2V77 A;  4CYP A;  4NXY A;  3DNS A;  2PQ8 A;  4M6I A;  4XPD B;  2B58 A;  1YR0 A;  2PJ1 A;  3EC4 A;  5F48 A;  1CX8 A;  4JJX A;  2CTB A;  2ARH A;  4Y49 B;  4ZGY B;  2VEZ A;  1TKJ A;  2FCK A;  3JRU A;  4P10 A;  4JZ0 A;  1QST A;  4KUA A;  1PU9 A;  2BO9 A;  2DEA A;  4PSX A;  5J8C A;  2PCU A;  4BMH A;  3GIU A;  4A38 A;  4R7M A;  1Q7L A;  2ABZ A;  3KL9 A;  1Z8L A;  2C1C A;  1RTQ A;  2DF5 A;  2QEC A;  3CPX A;  3N5F A;  4MHN A;  4MRI A;  1Y9W A;  1CJW A;  1ARM A;  2AJ6 A;  4E8O A;  2I3C A;  4G1P A;  2YNC C;  4PSW A;  3PB6 X;  4CPA A;  5HMN A;  4QB9 A;  5KTA A;  3MRU A;  1XIX A;  1X10 A;  2Q0Y A;  3FH4 A;  1CBX A;  4MFL A;  4UCM A;  4C7H A;  5A28 A;  4KS9 A;  4UIA A;  2C6P A;  2A4N A;  3LWU A;  4ONU A;  2IMO A;  1QSO A;  1R3N A;  1XE4 A;  2PE3 A;  1Z4E A;  4B5O A;  4A30 A;  1NSA A;  4B5P B;  1Q2C A;  2Z3M A;  2XEI A;  1FNO A;  3D3S A;  4P6Y A;  1TKH A;  4X3R A;  5DWN A;  5A27 A;  1Y0Y A;  1EE3 P;  2R98 A;  3D8P A;  5LYD A;  2NMT A;  3FMC A;  3TCV A;  3B8G A;  3CDX A;  4B11 A;  3RO0 A;  2PJC A;  2WZN A;  3ISZ A;  4IAV A;  4GM5 A;  1B87 A;  4H6Z A;  4MFP A;  1Z2L A;  5LRK A;  2DPS A;  1ZO0 A;  1QSR A;  1Y9K A;  2IJZ A;  2EWB A;  1TF9 A;  2EK8 A;  2PRQ A;  4KZT A;  4OC5 A;  4RN7 A;  2PJB A;  3H8G A;  4L89 A;  1UFH A;  3DR8 A;  1DE4 C;  2CXA A;  1QQ9 A;  4KVO E;  3QNV A;  5HVG A;  4DJL A;  1XFO A;  3GKR A;  3WC6 A;  4MMO A;  1Z8T A;  2YND A;  3IWE A;  1Y7R A;  2ZPA A;  3FIX A;  4R3L A;  2VQY A;  3E0K A;  2AFZ A;  1QMU A;  2J9A A;  5G21 A;  4KSF A;  5AG7 A;  4II9 A;  2HB6 A;  2Z10 A;  4A95 A;  4LQ6 A;  5HVF A;  4OP4 A;  3BHX A;  2NYQ A;  1ZG9 A;  2FS5 A;  4OAD A;  4AVB A;  2F8H A;  3LMS A;  4MJ8 A;  1FT7 A;  4OC2 A;  4E2A A;  3BXM A;  3LOD A;  2AFU A;  4R57 A;  2Q7B A;  3IIB A;  3S6G A;  1XOV A;  4C7I A;  3IO1 A;  4A32 A;  1SQH A;  3SXN A;  1R57 A;  2VI7 A;  4XPL A;  1M4G A;  1OZP A;  3FNC A;  3GB0 A;  4K30 A;  2PJ8 A;  2Z11 A;  1IIC A;  3G3S A;  3NFZ A;  1XBU A;  4KLW A;  4NFR A;  4U9Y A;  4ZX8 A;  4AXV A;  1I12 A;  4UEZ A;  3LD2 A;  2PRB A;  4R87 A;  3H8F A;  5F47 A;  4AG9 A;  3IGR A;  2Q4V A;  3PBB A;  2OR4 A;  1IGB A;  4FD6 A;  4CAE A;  4CGP A;  3C26 A;  2VZY A;  1M4D A;  4UF4 A;  2FT0 A;  4H2K A;  2GLJ A;  5J1Q A;  1PUA A;  1BPN A;  4X8I A;  6CPA A;  2XEG A;  3DSB A;  3PP9 A;  2H5M A;  4NSQ A;  3WT4 A;  3RBU A;  2ODF A;  2Q4Y A;  3GY9 A;  3IC1 A;  4A37 A;  2GRE A;  1RO5 A;  2EK9 A;  1GHE A;  3R96 A;  2XEF A;  1YLE A;  3KR4 A;  3VAT A;  3K9T A;  4CGM A;  2AFX A;  4B14 A;  3IEH A;  2RFH A;  3DDD A;  1VIX A;  1Z8X A;  2PJ4 A;  4Q7A A;  3R9G A;  1VGY A;  2X7B A;  3SJF A;  2WUU A;  4A31 A;  3D67 A;  1HDQ A;  2POK A;  3K2K A;  2ANP A;  1M1D A;  3CT9 A;  2G0B A;  4UFX A;  4OAE A;  4OIW A;  2CY2 A;  3FYN A;  2V8D A;  3PB7 X;  1ELM P;  5HXD A;  4R9M A;  3QB8 A;  4PK3 A;  3DLJ A;  4KLV A;  2ZED A;  4M3S A;  2ZW7 A;  3W6X A;  3KHZ A;  4HKF A;  4CYO A;  2PJ0 A;  1KUY A;  4WJB A;  3R9F A;  3VH9 A;  3I1U A;  1I21 A;  4KOW A;  1KZF A;  1CM0 A;  1MK4 A;  4M6G A;  3MN8 A;  4OKO A;  1HDU A;  5C82 A;  5DWM A;  4F9V A;  3KR5 A;  4A94 A;  3KHX A;  1CP7 A;  4YGO A;  3RZA A;  2AE6 A;  2JBJ A;  2PIZ A;  1CG2 A;  3G8W A;  3DR6 A;  2R8V A;  2WYR A;  4KSA A;  5CPA A;  2PVW A;  2ZEL A;  4U5Y A;  1AMP A;  1LAM A;  2JBK A;  3FEE A;  5I0C A;  1Q2D A;  2Q04 A;  2PJ6 A;  2V8V A;  2V8G A;  3PB9 X;  2BUE A;  3FXT A;  3IFE A;  3TT2 A;  4UWI A;  2PVV A;  3S6K A;  1BPM A;  5KTD A;  1H8L A;  3K9U A;  4UBR A;  5F09 A;  4OC4 A;  2FIA A;  2C6C A;  2PJ3 A;  2REF A;  1F2P A;  4P4I A;  2GIV A;  4E0A A;  3IWW A;  4MBU A;  3I3G A;  4JWP A;  4NGS A;  3TE4 A;  4TNU A;  4JLY A;  5LYI A;  2D4O A;  4GS4 A;  5FVJ A;  1YME A;  4A2Z A;  2B5G A;  4MHZ A;  7CPA A;  3MGD A;  2REE A;  3HUV A;  4UEE A;  3CXS A;  1MJ9 A;  1YSJ A;  2FSR A;  2P6F A;  5CNP A;  2CNT A;  2HC9 A;  4MFJ A;  4A33 A;  4P4E A;  3KZW A;  3TTH A;  5I4M A;  3NE7 A;  4CAX A;  4LX9 A;  3V38 A;  5LYF A;  2RC4 A;  3PB8 X;  3PB4 X;  4W9Y A;  2Z0Z A;  4HNY B;  1CPS A;  4ZYQ A;  3EFA A;  1ZG7 A;  3KKW A;  2G3A A;  2DXQ A;  4KOX A;  1WK4 A;  3F5B A;  4CGO A;  1LCP A;  4PV6 A;  2PJ9 A;  2PJ7 A;  1KWM A;  1RXT A;  3D7D A;  2ZW6 A;  4MCS A;  1S3Z A;  1QSM A;  1TF8 A;  1ARL A;  2AFW A;  2WSA A;  1OBR A;  5GCN A;  3TO6 A;  3R1K A;  2AFS A;  4NJQ A;  5H86 A;  4CAW A;  2BOA A;  3BJ8 A;  3FJU A;  4KVM E;  3SI1 A;  1LFW A;  4KOV A;  2NSM A;  5CBM A;  4EFD A;  1I1D A;  1XJO A;  3FBU A;  1Z8W A;  4NF1 A;  3HLP A; 
#chains in the Genus database with same CATH homology
 1Z4R A;  4FD4 A;  2ZXV A;  2VBQ A;  2R7H A;  4C2Y A;  2OH1 A;  4ORF A;  2GE3 A;  1L0C A;  3BLN A;  3EO4 A;  2OZG A;  4UCN A;  4MFQ A;  2JDC A;  4H6U A;  4KOU A;  4UA3 A;  3V8I A;  3ZZI A;  4YFJ A;  4MFK A;  4C68 A;  2B4D A;  2B3V A;  5AG6 A;  4M85 A;  3D2P A;  2P6G A;  2Z3O A;  2I79 A;  2PR8 A;  3S6H A;  4CS0 B;  2K5T A;  5G1Z A;  5ISV A;  1YK3 A;  2KCW A;  5F46 A;  1KUX A;  3FRM A;  2WPW A;  3A9L A;  4YRH A;  2OU2 A;  2Z3K A;  3P2H A;  4IF5 A;  3R9E A;  1NSL A;  4FD5 A;  2YNC A;  3TO7 A;  4F6A A;  1MJB A;  2OB0 A;  4JD6 A;  2FXF A;  2CNM A;  3D2M A;  2JLM A;  3SHP A;  3OWC A;  3EXN A;  4CGN A;  1NE9 A;  2GAN A;  2QIR A;  4QC6 A;  1VHS A;  4NCZ A;  1B6B A;  5E96 A;  4KOR A;  4HNX B;  2JEV A;  5IB0 A;  3SXO A;  1XMT A;  1S7L A;  3IWG A;  4KOT A;  4MFZ A;  2Z3P A;  5J8F A;  2PC1 A;  4MI4 A;  4JXQ A;  4B13 A;  1BO4 A;  4MY0 A;  2B5G B;  3PZJ A;  3BJ7 A;  1QSN A;  4XPK A;  2D4P A;  4CRY B;  2PDO A;  4PK2 A;  5AGE A;  3TFY A;  2FE7 A;  3P2F A;  2B4B A;  2VXK A;  1M4I A;  1P0H A;  4KUB A;  4U9Z A;  4MY3 A;  2ZW5 A;  3FB3 A;  1WWZ A;  3F8K A;  4B12 A;  4AG7 A;  5AG5 A;  1ON0 A;  1VKC A;  2B3U A;  3H5Z A;  4H89 A;  1XEB A;  3S6F A;  2I00 A;  1IB1 E;  5AG4 A;  4AVA A;  5G22 A;  2Z3L A;  2QML A;  1U6M A;  3TO9 A;  2J8R A;  3JVN A;  1MJA A;  4C2X A;  4B10 A;  4CAV A;  5H84 A;  4UFV A;  4DNC A;  1TIQ A;  1S5K A;  2JDD A;  1J4J A;  2B4D B;  2CNS A;  3PGP A;  2EUI A;  5C88 A;  4QBJ A;  2ATR A;  4CRZ B;  3VWD A;  4R3K A;  1FY7 A;  1M44 A;  4UFW A;  2C27 A;  4BBH A;  5IX3 A;  3I9S A;  2DPT A;  4Q38 A;  2P0W A;  4JXR A;  1YVO A;  3QAH A;  4AVC A;  3JTK A;  1S7K A;  2VZZ A;  1YRE A;  4B5P A;  4IUS A;  3WR7 A;  4MHD A;  3UY5 A;  1NMT A;  1S7N A;  2BL1 A;  1LRZ A;  2YNE A;  2Q44 A;  4CYN A;  3GYA A;  2O28 A;  5HH1 A;  4KOY A;  3N7Z A;  1P4N A;  5BWA B;  4KOS A;  5EC4 A;  2G3T A;  4EVY A;  1S7F A;  4LUA A;  1Q2Y A;  2BEI A;  4HNW B;  3T9Y A;  2WPX A;  2PSW A;  2F5I A;  4NEX A;  3TOB A;  3JUW A;  4UCP A;  4XNH C;  3T90 A;  5JPH A;  4L8A A;  2IL4 A;  1N71 A;  5G20 A;  2EVN A;  2R1I A;  3R95 A;  3W6S A;  2J8N A;  4KVX A;  1Z9U A;  3H4Q A;  4CYQ A;  2J8M A;  1V0C A;  2HQY A;  4XPD C;  1IYK A;  1YVK A;  4OLL A;  2FIW A;  4C2Z A;  3IU1 A;  4I49 A;  2P6E A;  4Y49 C;  3TOA A;  5JQ4 A;  2OZH A;  4RI1 A;  4RS2 A;  2ZW4 A;  4F0Y A;  1IID A;  3VWE A;  5KTC A;  2BSW A;  4F0X A;  5F49 A;  2HUZ A;  5IV0 A;  1YX0 A;  4ZBG A;  3EY5 A;  1S60 A;  4CAF A;  4AB7 A;  2OZU A;  1BOB A;  1IYL A;  5EBV A;  3W91 A;  2PR1 A;  4FD7 A;  3RYO A;  3F0A A;  3ZJ0 A;  3CXP A;  2HV2 A;  4Q36 A;  4XNH B;  1YGH A;  2Y0M A;  4J3G A;  3CXQ A;  2Z3N A;  3IU2 A;  1XF8 A;  2FL4 A;  1K4J A;  4X5K A;  4CGL A;  4QUS A;  1KUV A;  4QVT A;  2YGW A;  4UWJ A;  4CYP A;  4NXY A;  3DNS A;  2PQ8 A;  4XPD B;  2B58 A;  1YR0 A;  3EC4 A;  5F48 A;  4JJX A;  2ARH A;  4Y49 B;  4ZGY B;  2VEZ A;  2FCK A;  1QST A;  4KUA A;  1PU9 A;  4PSX A;  5J8C A;  4BMH A;  2QEC A;  1Y9W A;  1CJW A;  2AJ6 A;  4E8O A;  4PSW A;  2YNC C;  5HMN A;  4QB9 A;  5KTA A;  1XIX A;  2Q0Y A;  4MFL A;  4UCM A;  4C7H A;  5A28 A;  4KS9 A;  2A4N A;  4ONU A;  1QSO A;  1XE4 A;  1Z4E A;  4B5O A;  4A30 A;  4B5P B;  1Q2C A;  2Z3M A;  3D3S A;  5DWN A;  5A27 A;  3D8P A;  2R98 A;  2NMT A;  3TCV A;  3B8G A;  4B11 A;  1B87 A;  4H6Z A;  4MFP A;  2DPS A;  1ZO0 A;  1QSR A;  1Y9K A;  4KZT A;  4L89 A;  1UFH A;  3DR8 A;  2CXA A;  4KVO E;  3GKR A;  3IWE A;  2YND A;  4R3L A;  1Y7R A;  2ZPA A;  3FIX A;  2VQY A;  3E0K A;  5G21 A;  4KSF A;  5AG7 A;  4II9 A;  4A95 A;  2Z10 A;  4AVB A;  2FS5 A;  4OAD A;  4MJ8 A;  4E2A A;  3LOD A;  4R57 A;  2Q7B A;  3S6G A;  4C7I A;  4A32 A;  1SQH A;  3SXN A;  1R57 A;  2VI7 A;  4XPL A;  1M4G A;  1OZP A;  3FNC A;  4K30 A;  2Z11 A;  1IIC A;  3G3S A;  4KLW A;  4U9Y A;  1I12 A;  3LD2 A;  2PRB A;  4R87 A;  5F47 A;  4AG9 A;  3IGR A;  2Q4V A;  4FD6 A;  4CAE A;  4CGP A;  3C26 A;  2VZY A;  1M4D A;  2FT0 A;  1PUA A;  3DSB A;  3PP9 A;  2H5M A;  4NSQ A;  2Q4Y A;  3GY9 A;  1RO5 A;  4CGM A;  1GHE A;  3R96 A;  1YLE A;  4B14 A;  3DDD A;  3R9G A;  2X7B A;  2WUU A;  4A31 A;  1M1D A;  2G0B A;  4UFX A;  4OAE A;  2CY2 A;  3FYN A;  4R9M A;  3QB8 A;  4PK3 A;  4KLV A;  4M3S A;  2ZW7 A;  3W6X A;  4HKF A;  4CYO A;  1KUY A;  3R9F A;  1I21 A;  4KOW A;  1KZF A;  1CM0 A;  1MK4 A;  5C82 A;  5DWM A;  4YGO A;  2AE6 A;  3G8W A;  3DR6 A;  2R8V A;  4KSA A;  4U5Y A;  5I0C A;  1Q2D A;  2Q04 A;  2BUE A;  3FXT A;  3TT2 A;  4UWI A;  3S6K A;  5KTD A;  3K9U A;  4UBR A;  2FIA A;  2REF A;  2GIV A;  4E0A A;  4MBU A;  3I3G A;  4JWP A;  3TE4 A;  4JLY A;  2D4O A;  4GS4 A;  5FVJ A;  4A2Z A;  2B5G A;  3MGD A;  2REE A;  3CXS A;  1MJ9 A;  2FSR A;  2P6F A;  5CNP A;  2CNT A;  4MFJ A;  4A33 A;  3TTH A;  3NE7 A;  4CAX A;  4LX9 A;  2RC4 A;  2Z0Z A;  4HNY B;  3EFA A;  3KKW A;  2G3A A;  2DXQ A;  4KOX A;  1WK4 A;  3F5B A;  4CGO A;  4PV6 A;  1RXT A;  2ZW6 A;  1S3Z A;  1QSM A;  2WSA A;  5GCN A;  3TO6 A;  3R1K A;  5H86 A;  4CAW A;  3BJ8 A;  4KVM E;  4KOV A;  1I1D A;  3FBU A;  4NF1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...