2WSAA

Crystal structure of leishmania major n-myristoyltransferase (nmt) with bound myristoyl-coa and a pyrazole sulphonamide ligand (ddd85646)
Total Genus 124
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
124
sequence length
411
structure length
411
Chain Sequence
AHAFWSTQPVPQTEDEDEKIVFAGPMDEPKTVADIPEEPYPIASTFEWWTPNMEAADDIHAIYELLRDNYVEDDDSMFRFNYSEEFLQWALCPPNYIPDWHVAVRRKADKKLLAFIAGVPVTLRMGTPKYMKVKAQEKGEGEEAAKYDEPRHICEINFLCVHKQLREKRLAPILIKEATRRVNRTNVWQAVYTAGVLLPTPYASGQYFHRSLNPEKLVEIRFSGIPAQYQKFQNPMAMLKRNYQLPSAPKNSGLREMKPSDVPQVRRILMNYLDSFDVGPVFSDAEISHYLLPRDGVVFTYVVENDKKVTDFFSFYRIPSTVIGNSNYNLLNAAYVHYYAATSIPLHQLILDLLIVAHSRGFDVCNMVEILDNRSFVEQLKFGAGDGHLRYYFYNWAYPKIKPSQVALVML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title N-Myristoyltransferase Inhibitors as New Leads to Treat Sleeping Sickness.
pubmed doi rcsb
source organism Leishmania major
molecule tags Transferase
molecule keywords GLYCYLPEPTIDE N-TETRADECANOYLTRANSFERASE
total genus 124
structure length 411
sequence length 411
ec nomenclature ec 2.3.1.97: Glycylpeptide N-tetradecanoyltransferase.
pdb deposition date 2009-09-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01233 NMT Myristoyl-CoA:protein N-myristoyltransferase, N-terminal domain
A PF02799 NMT_C Myristoyl-CoA:protein N-myristoyltransferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.170 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 2wsaA00
4CGLA 4CGOA 3IU1A 4UCMA 5G21A 4B13A 4B10A 4CAFA 5G22A 3IWEA 5AG5A 4UFWA 4UCNA 5A27A 4CYNA 5AG4A 5G1ZA 4B12A 5AGEA 3JTKA 2WUUA 4A33A 4A30A 4CYOA 5A28A 2YNCA 4A95A 4CGNA 5AG6A 2WSAA 2YNCC 4A32A 4UFVA 4C7IA 4CYQA 2YNEA 4C2YA 4CYPA 4C68A 4CAEA 4A31A 3IU2A 4A2ZA 2YNDA 4C2ZA 4C2XA 4UCPA 4BBHA 5AG7A 4C7HA 4CGPA 4UFXA 4CGMA 5G20A 3H5ZA 4B14A 4B11A
chains in the Genus database with same CATH superfamily
5D29A 1M4LA 2QMLA 3P2FA 4OAEA 4YGOA 5LRGA 1YVOA 3TO7A 3NH5A 4FUUA 1AYEA 3D67A 4LQ6A 1MJAA 5H86A 4NJRA 1KUVA 3S9LA 4Q36A 4RS2A 2Z3LA 4JZ0A 5JM6A 3SXNA 4UF4A 5J8FA 5CPAA 4UEEA 3FEDA 4E2AA 2P6FA 1K4JA 1S3ZA 4PXEA 5BWAB 4CAEA 4QVTA 2ZXVA 4XPDB 5H84A 2BCOA 2POKA 2FCKA 2O53A 5DWMA 1U6MA 2B3UA 2Q0YA 3KQZA 2OZGA 4NGNA 3NA6A 1S7LA 4HPSA 5GCNA 4R87A 4UWIA 2ZEFA 5KTDA 4XPKA 1P4NA 3FRMA 2PJ8A 4F6AA 4NFRA 5FVJA 2JLMA 3DDDA 1ZG8A 2CF4A 2NSMA 2R1IA 4GM5A 4MY0A 4KLVA 1P0HA 4CYNA 4A33A 3T90A 4R8FA 4BMHA 2FIWA 3WABA 4ORFA 1Z8TA 2I00A 2QIRA 4UA3A 5C82A 4NXYA 1JQGA 4MHZA 1FNOA 1TF9A 4MCRA 3A9LA 2XEGA 1VHEA 3TCVA 4QB9A 4NJQA 1XF8A 4C2ZA 2F7VA 3SJFA 2CXAA 1CBXA 2PJAA 2X7BA 3D7HA 4QUSA 2WZNA 2BUEA 2DPSA 4OC5A 5K8NA 1LAMA 1PUAA 2FS5A 2XEIA 4FD7A 3KASA 4CRZB 4UBRA 1RTQA 1IB1E 4XNHB 2ZW6A 3DR8A 1TIQA 2B4BA 1ZLHA 5G1ZA 3DLJA 3D4UA 5AGEA 3MN8A 3K9TA 4KVME 2PDOA 2PE3A 4W9YA 3RAMA 1JWQA 1IIDA 2G9DA 1UFHA 4KOTA 2JDCA 4MFJA 4OC4A 5K8MA 4H89A 2Z3MA 3T9YA 2PJ1A 4C2YA 2G3TA 5F46A 3GUXA 2B3VA 2NYQA 1F57A 1V0CA 2B5GA 2WYRA 1GHEA 3V8IA 2PSWA 4MMOA 3B7IA 2FVGA 4P6YA 3FJUA 2Z10A 4EWTA 4NGMA 2O4HA 4PXCA 3IFEA 2OB0A 4MJ8A 1LCPA 1IY7A 4R7MA 1QSNA 1YLEA 2PJ6A 4PV6A 1Z2LA 2ZW5A 4AG9A 3LWUA 2B5GB 4CAFA 4QBJA 3TOBA 3QB8A 1KUXA 1Q2YA 3PRTA 3GKRA 1XMTA 3NE8A 2IQ6A 1R57A 4KOYA 5DS0A 1KUYA 1Y0YA 5IX3A 2GLFA 4MFQA 4IHMA 1XMBA 3SJXA 3VH9A 4CGNA 2FXFA 1XJOA 5D8NA 3FEEA 3QNVA 4ZX9A 1Z8XA 1KWMA 2GANA 3KR5A 4NGRA 4OIWA 4J3GA 4U9ZA 4XPLA 4L89A 3ZJ0A 4CGPA 2QJ8A 3CPAA 4UFXA 1Y9KA 2PC1A 3FF3A 5EBVA 3H4QA 3H5ZA 3LACA 2PJBA 5THWA 2FE7A 4M6GA 5F09A 2ZEDA 4LUAA 1PCAA 2CTCA 5LYIA 3SI2A 4NF1A 4NGPA 4LX9A 4UFWA 4A94A 4DJLA 4MFZA 4CS0B 1X12A 3B8GA 4PPZA 1PYTB 2V8HA 3B2YA 3EY5A 1ZG7A 4PSXA 3WR7A 3BI1A 4PSWA 2BO9A 3JVNA 1YGHA 3IJ3A 5ISVA 3F8KA 4MXUA 4C68A 5HVHA 1VHSA 4U5YA 4AVBA 2IL4A 4OP4A 4AXVA 3R9FA 2YNDA 4AVAA 4F9UA 1Z8WA 2G0BA 2PR1A 1L0CA 3HUVA 2J8NA 2ABZA 5K8PA 1ZG9A 3DR6A 4KORA 4BINA 2REEA 4FD4A 2FSRA 2PQ8A 4B13A 4AVCA 2C27A 5K8OA 4HNWB 1VKCA 2ZEHA 1Q2DA 2Z3KA 3I3GA 4KOXA 5AG5A 5G22A 2ZELA 6CPAA 1AMPA 3VWDA 2PR8A 1IGBA 3BHXA 3ZZIA 1XIXA 2WUUA 1XE4A 3IIBA 4X3RA 2B4DB 2V8GA 2OZHA 1YX0A 2AFUA 2ZEOA 5LYDA 4ZGYB 2V77A 3VARA 3FIXA 1CPXA 3DGVA 3RNZA 1RO5A 1NSAA 4CAVA 4YU9A 1XBUA 2IMOA 4WJBA 3TOAA 3EC4A 5F48A 5KTCA 1M4GA 2ZENA 4JLYA 4R3KA 4Y49C 4KVXA 1S5KA 3CZXA 3F5BA 3TC8A 4KOWA 4NSQA 4PK3A 2ZOFA 4MHNA 2JEWA 1NMTA 4CGLA 4Y49B 5HXDA 4M3SA 3R9EA 2Z11A 4B6ZA 2CY2A 2GE3A 5F47A 2D4OA 1QSRA 3S9NA 4KSFA 2VQYA 1KZFA 4TNUA 4YWYA 4UEFA 5A28A 1YVKA 5F49A 1Y0RA 3P2HA 7CPAA 4F0XA 1YW6A 2G3AA 3IO1A 1F2OA 4FBEA 4MFLA 4NEXA 4A39A 4JJXA 4AG7A 4MBUA 4K3NA 1CM0A 2H5MA 4KOSA 2BOAA 3C26A 4OC2A 4C7HA 4CPAA 4ZI6A 1LAPA 1YK3A 2Q04A 2V8VA 2VEZA 1XOVA 1Q7LA 4KVOE 5EMIA 4E8OA 2PJ0A 3CPXA 3TFYA 3FYNA 2WPWA 4ONWA 3N7ZA 2OR4A 3L2NA 3FX6A 2JDDA 2ZW4A 3BI0A 3LODA 1UWYA 1Z4RA 3PP9A 1BPMA 2RC4A 5LRJA 5A27A 2Q44A 2Y0MA 1ARLA 1VGYA 4OADA 3JTKA 4UIBA 2PVWA 5I4MA 4UWJA 2O28A 1Y9WA 3FB3A 4WWVA 2QVPA 2AFZA 2RFHA 3JUWA 2Z3NA 2EBJA 1J4JA 4F9VA 1CX8A 2DXQA 4P4IA 1IOIA 4FD5A 4X8IA 4OIDA 3WT4A 3FH4A 2IJZA 2Q7SA 4CAWA 5C88A 4RI1A 1Z5RA 4JXQA 4C2XA 5HMNA 1Z4EA 3EFAA 3SHPA 3RO0A 3KZWA 2GREA 2VI7A 3SJEA 3TX8A 5LYLA 3KGQA 3LMSA 3PBEA 2HB6A 3BJ7A 3LD2A 1YQEA 4X2TA 1ON0A 4OLLA 4HNXB 2Q4VA 1NSLA 4GS4A 5JH9A 2P0WA 4CRYB 1DTDA 5AG6A 4PXDA 3FMCA 4KSAA 2YNEA 4CYPA 3JRUA 2J9AA 4I49A 4KSIA 3CDXA 4L8AA 4NGTA 3D2PA 4OC1A 4P4EA 3WC6A 3IGRA 1ZO0A 4MHYA 2AFSA 1YSJA 4H6UA 1ARMA 3KR4A 4G1PA 2PCUA 4YFJA 4F0YA 1TF8A 2Q4YA 4KLWA 5ELYA 1CJWA 4P45A 1VIXA 3G3SA 4E0AA 1H8LA 5CNPA 2VXKA 1CP6A 3H8EA 2F5IA 3K9UA 3W6SA 1HDUA 2AFOA 4MY3A 2ZEEA 4B5PB 3S6GA 3WC7A 5IV0A 2QECA 4JWPA 4MCSA 1YR0A 3CT9A 2Z3OA 2ATRA 1TXRA 2EWBA 2RB7A 4A37A 3N5FA 4A95A 4OMEA 2OOTA 1BO4A 2PRQA 4B5OA 3IWGA 3D68A 2A4NA 4UIAA 1YW4A 4DNCA 3G8WA 2Q43A 4K30A 2BSWA 4M85A 1LANA 3DSBA 1ELMP 4QC6A 1VHOA 1Q2CA 1XRYA 3H8FA 3VWEA 4A2ZA 3GY9A 4RN7A 4XNHC 3VATA 2PRBA 3B3CA 4UCPA 4ONUA 2ANPA 2P6GA 4B14A 3PB6X 4KZTA 3PEIA 2Z0ZA 2GU2A 3FECA 2Q7BA 4P4BA 2PJ3A 3IU1A 4ZY2A 3S6KA 3D66A 3FBUA 5JPHA 1LFWA 8CPAA 1QQ9A 3IWEA 1I12A 2BEIA 1TKHA 4UCNA 4MHDA 3D8PA 4KS9A 1HDQA 3SJGA 1CG2A 2CIJA 4O23A 4R76A 1I21A 4OC0A 4CYOA 3ISZA 2KCWA 1Y7RA 2WSAA 3EO4A 3V7ZA 4ZYQA 1DE4C 3CXPA 3MGDA 4IF5A 1QSOA 3H8GA 3FVLA 4MFKA 2GIVA 3B3TA 2B4DA 4II9A 4IK2A 3V38A 3S9MA 2NMTA 1M1DA 4JYWA 5G20A 4UEZA 4JD6A 1B87A 3F0AA 2C6GA 3B3VA 3S6FA 1BOBA 4HKFA 1LRZA 3SI0A 3KL9A 3RBUA 4BD9A 3KQXA 5JQ4A 3KHXA 3IEHA 2OZUA 2DPTA 2R8VA 2HV2A 4IUSA 4ZBGA 4X5KA 5HVGA 1MJ9A 2D4PA 3BLNA 2PJ5A 4ZY1A 3PB4X 3QAHA 1QMUA 4EMEA 2CNSA 3D7GA 3I1UA 2Z3PA 4U9YA 4MFPA 4AB7A 2B58A 1M4IA 4TWEA 2PJ9A 3GYAA 1YREA 4MI4A 3IC1A 1OZPA 3D7DA 4CGMA 2ODFA 5CBMA 1ELLP 3TO6A 2C6CA 1TKFA 3R1KA 3R96A 1B6BA 2XEFA 4FD6A 1A2ZA 3DNSA 1S7NA 2R7HA 2EK8A 4H2KA 4LQGA 4PK2A 1QSTA 3GLJA 4Q38A 2XEJA 4R3LA 2JBKA 3IWWA 4R9MA 4B12A 1M44A 2JEVA 2WPXA 4KUBA 2J8MA 2I3CA 2ZEMA 1AUGA 3CXQA 2PIZA 2YNCC 4NCZA 2CTBA 4C7IA 3PZJA 1I1DA 2J8RA 3QAYA 4M6HA 4NGQA 4Q7AA 5J8CA 4MHPA 2JBJA 1Z9UA 1R43A 1WWZA 1YLOA 1BPNA 3D3SA 3KI9A 1LOKA 3SXOA 2GFQA 3UY5A 1N71A 2F8HA 3ISXA 4GXHA 2FIAA 1ZLIA 1WK4A 1IYKA 4A38A 3W91A 4KUAA 5KTAA 1IICA 4B10A 1XEBA 2HUZA 3GIUA 4OC3A 5J1QA 2AFMA 3PB8X 5DWNA 3FNCA 2PJ2A 3TTHA 4MCQA 4ZX8A 3NE7A 3WC5A 3NFZA 3D7FA 3FXTA 4A30A 1NE9A 2HQYA 3I9SA 4CAXA 2YNCA 3BXMA 3NH8A 3T8WA 2DEAA 2PIYA 2C6PA 4MRIA 4PXBA 4B5PA 1CP7A 1FT7A 2C1CA 3K2KA 2AE6A 3PBBA 4IAVA 4A31A 2PJ7A 3EXNA 5HVFA 3W6XA 2VZZA 2EO8A 1S60A 1S7FA 1FY7A 4Z65A 5AG4A 2DF5A 2K5TA 2GLJA 5IB9A 1TKJA 2AJ6A 4NGSA 1MK4A 4CGOA 2OU2A 4UCMA 5G21A 1HEEA 1IYLA 1GYTA 1IU8A 1YMEA 2Q51A 2ARHA 3GB0A 4JXRA 3B35A 4KOUA 2VBQA 2ZEPA 4P44A 2EK9A 4PQAA 1Z8LA 1EE3P 5E96A 3B3SA 4F8ZA 1M4DA 2V8DA 3RZAA 2FT0A 1S7KA 3E0KA 3KKWA 4P10A 3D2MA 3SI1A 1RXTA 2VL1A 2AFWA 2R98A 3S6HA 4FWUA 4UFVA 3R95A 4EVYA 1IOFA 4R6TA 2VZYA 4P4JA 4MCPA 5IB0A 3NH4A 3PFOA 4P4FA 3B3WA 3TO9A 4RUHA 2PJCA 2ZPAA 4BBHA 3BJ8A 3KHZA 5EC4A 2AFXA 1X10A 4DUKA 2BL1A 2EVNA 2Q4ZA 5LYFA 2HC9A 2EUIA 2YGWA 3PGPA 3R9GA 4B11A 1BAVA 1F2PA 1PU9A 2CNMA 2CNTA 2ZOGA 4KOVA 3RYOA 1CPSA 4OKOA 1OBRA 1SQHA 4XPDC 5JGFA 5I0CA 4R57A 1BLLE 1MJBA 3TT2A 2QYVA 4HNYB 2ZEGA 2ZW7A 2FL4A 2PVVA 3PB9X 4M6IA 4FAIA 4DYOA 4A32A 3PFEA 4CYQA 3TE4A 3PB7X 4YRHA 5LRKA 2I79A 2PJ4A 2OH1A 3IU2A 1R3NA 2P6EA 3CXSA 4EFDA 4H6ZA 1Y7EA 3HLPA 5AG7A 3OWCA 3MRUA 1XFOA 4P4DA 4ZY0A 2REFA 5HH1A 1QSMA
chains in the Genus database with same CATH topology
2QMLA 3P2FA 4OAEA 4YGOA 1YVOA 3TO7A 1MJAA 5H86A 1KUVA 4Q36A 4RS2A 2Z3LA 3SXNA 5J8FA 4E2AA 2P6FA 1K4JA 1S3ZA 5BWAB 4CAEA 2ZXVA 4XPDB 5H84A 2FCKA 5DWMA 1U6MA 2B3UA 2Q0YA 2OZGA 1S7LA 5GCNA 4R87A 4UWIA 5KTDA 4XPKA 1P4NA 3FRMA 4F6AA 5FVJA 2JLMA 3DDDA 2R1IA 4CYNA 4MY0A 4KLVA 1P0HA 5AG4A 4A33A 3T90A 4BMHA 2FIWA 4ORFA 2I00A 4UA3A 2QIRA 5C82A 4NXYA 3A9LA 3TCVA 4QB9A 1XF8A 4C2ZA 2CXAA 2X7BA 4QUSA 2BUEA 2DPSA 1PUAA 2FS5A 4FD7A 4CRZB 4UBRA 1IB1E 4XNHB 2ZW6A 3DR8A 1TIQA 2B4BA 5G1ZA 5AGEA 4KVME 2PDOA 1IIDA 1UFHA 4KOTA 2JDCA 4MFJA 4H89A 2Z3MA 3T9YA 4C2YA 2G3TA 5F46A 2B3VA 1V0CA 2B5GA 1GHEA 3V8IA 2PSWA 2Z10A 2OB0A 4MJ8A 1QSNA 1YLEA 4PV6A 2ZW5A 4AG9A 4CAFA 2B5GB 4QBJA 3TOBA 3QB8A 1KUXA 1Q2YA 3GKRA 1XMTA 1R57A 4KOYA 1KUYA 5IX3A 4MFQA 4CGNA 2FXFA 2GANA 4J3GA 4U9ZA 4XPLA 4L89A 3ZJ0A 4CGPA 4UFXA 1Y9KA 2PC1A 5EBVA 3H4QA 3H5ZA 2FE7A 4LUAA 4NF1A 4LX9A 4UFWA 4MFZA 4CS0B 3B8GA 3EY5A 4PSXA 3WR7A 4PSWA 3JVNA 1YGHA 3F8KA 4C68A 1VHSA 4U5YA 4AVBA 2IL4A 4AVAA 3R9FA 2YNDA 2G0BA 2PR1A 1L0CA 2J8NA 3DR6A 4KORA 2REEA 4FD4A 2FSRA 2PQ8A 4B13A 4AVCA 2C27A 4HNWB 1VKCA 4KOXA 1Q2DA 2Z3KA 3I3GA 5AG5A 5G22A 3VWDA 2PR8A 3ZZIA 1XIXA 2WUUA 1XE4A 2B4DB 2OZHA 1YX0A 4ZGYB 3FIXA 1RO5A 4CAVA 3TOAA 3EC4A 5F48A 5KTCA 1M4GA 4JLYA 4R3KA 4Y49C 4KVXA 1S5KA 3F5BA 4KOWA 4NSQA 4PK3A 1NMTA 4CGLA 4Y49B 4M3SA 3R9EA 2Z11A 2CY2A 2GE3A 5F47A 2D4OA 1QSRA 4KSFA 2VQYA 1KZFA 5A28A 1YVKA 5F49A 3P2HA 4F0XA 2G3AA 4MFLA 4NEXA 4JJXA 4AG7A 4MBUA 1CM0A 2H5MA 4KOSA 4C7HA 3C26A 1YK3A 2VEZA 2Q04A 4KVOE 4E8OA 3TFYA 3FYNA 2WPWA 3N7ZA 3LODA 2JDDA 2ZW4A 1Z4RA 3PP9A 2RC4A 5A27A 2Q44A 2Y0MA 4OADA 3JTKA 4UWJA 2O28A 1Y9WA 3FB3A 3JUWA 2Z3NA 1J4JA 2DXQA 4FD5A 4CAWA 5C88A 4RI1A 4JXQA 4C2XA 5HMNA 1Z4EA 3EFAA 3SHPA 2VI7A 3BJ7A 3LD2A 1ON0A 4OLLA 4HNXB 2Q4VA 1NSLA 4GS4A 2P0WA 4CRYB 5AG6A 4KSAA 2YNEA 4CYPA 4I49A 4L8AA 3D2PA 3IGRA 1ZO0A 4H6UA 4YFJA 4F0YA 4KLWA 2Q4YA 1CJWA 3G3SA 4E0AA 5CNPA 2VXKA 2F5IA 3K9UA 3W6SA 4MY3A 4B5PB 3S6GA 5IV0A 2QECA 4JWPA 1YR0A 2Z3OA 2ATRA 4A95A 1BO4A 4B5OA 3IWGA 2A4NA 4DNCA 3G8WA 4K30A 4M85A 2BSWA 4QC6A 3DSBA 4A2ZA 1Q2CA 3VWEA 3GY9A 4XNHC 2PRBA 4UCPA 4ONUA 2P6GA 4B14A 4KZTA 2Z0ZA 2Q7BA 3IU1A 3S6KA 3FBUA 5JPHA 3IWEA 1I12A 2BEIA 4UCNA 4MHDA 3D8PA 4KS9A 1I21A 4CYOA 2KCWA 1Y7RA 2WSAA 3EO4A 3MGDA 3CXPA 4IF5A 1QSOA 4MFKA 2GIVA 2B4DA 4II9A 2NMTA 1M1DA 5G20A 4JD6A 1B87A 3F0AA 3S6FA 1BOBA 4HKFA 1LRZA 5JQ4A 2OZUA 2DPTA 2R8VA 4IUSA 2HV2A 4ZBGA 4X5KA 1MJ9A 2D4PA 3BLNA 3QAHA 2CNSA 2Z3PA 4U9YA 4MFPA 4AB7A 2B58A 1M4IA 3GYAA 1YREA 4MI4A 1OZPA 4CGMA 3TO6A 3R1KA 3R96A 1B6BA 4FD6A 3DNSA 1S7NA 2R7HA 4PK2A 1QSTA 4Q38A 4R3LA 4B12A 4R9MA 1M44A 2JEVA 2WPXA 4KUBA 2J8MA 3CXQA 2YNCC 4NCZA 4C7IA 3PZJA 1I1DA 2J8RA 5J8CA 1Z9UA 1WWZA 3D3SA 3SXOA 3UY5A 1N71A 2FIAA 1WK4A 1IYKA 3W91A 4KUAA 5KTAA 1IICA 4B10A 1XEBA 2HUZA 5DWNA 3FNCA 3TTHA 3NE7A 3FXTA 4A30A 1NE9A 2HQYA 3I9SA 4CAXA 2YNCA 4B5PA 4A31A 2AE6A 3EXNA 3W6XA 2VZZA 1S60A 1S7FA 1FY7A 2K5TA 2AJ6A 1MK4A 4CGOA 2OU2A 4UCMA 5G21A 1IYLA 4KOUA 4QVTA 2ARHA 4JXRA 2VBQA 5E96A 1M4DA 2FT0A 1S7KA 3KKWA 3E0KA 3D2MA 1RXTA 2R98A 3S6HA 4UFVA 3R95A 4EVYA 2VZYA 5IB0A 3TO9A 2ZPAA 4BBHA 3BJ8A 5ISVA 5EC4A 2BL1A 2EVNA 2EUIA 2YGWA 3PGPA 3R9GA 4B11A 1PU9A 2CNMA 2CNTA 3RYOA 4KOVA 1SQHA 4XPDC 5I0CA 4R57A 1MJBA 3TT2A 4HNYB 2ZW7A 2FL4A 4A32A 4CYQA 3TE4A 4YRHA 2I79A 2OH1A 3IU2A 2P6EA 3CXSA 4H6ZA 5AG7A 3OWCA 2REFA 5HH1A 1QSMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CGL A;  4CGO A;  3IU1 A;  4UCM A;  5G21 A;  4B13 A;  4B10 A;  4CAF A;  5G22 A;  3IWE A;  5AG5 A;  4UFW A;  4UCN A;  5A27 A;  4CYN A;  5AG4 A;  5G1Z A;  4B12 A;  5AGE A;  3JTK A;  2WUU A;  4A33 A;  4A30 A;  4CYO A;  5A28 A;  2YNC A;  4A95 A;  4CGN A;  5AG6 A;  2WSA A;  2YNC C;  4A32 A;  4UFV A;  4C7I A;  4CYQ A;  2YNE A;  4C2Y A;  4CYP A;  4C68 A;  4CAE A;  4A31 A;  3IU2 A;  4A2Z A;  2YND A;  4C2Z A;  4C2X A;  4UCP A;  4BBH A;  5AG7 A;  4C7H A;  4CGP A;  4UFX A;  4CGM A;  5G20 A;  3H5Z A;  4B14 A;  4B11 A; 
#chains in the Genus database with same CATH topology
 5D29 A;  1M4L A;  2QML A;  3P2F A;  4OAE A;  4YGO A;  5LRG A;  1YVO A;  3TO7 A;  3NH5 A;  4FUU A;  1AYE A;  3D67 A;  4LQ6 A;  1MJA A;  5H86 A;  4NJR A;  1KUV A;  3S9L A;  4Q36 A;  4RS2 A;  2Z3L A;  4JZ0 A;  5JM6 A;  3SXN A;  4UF4 A;  5J8F A;  5CPA A;  4UEE A;  3FED A;  4E2A A;  2P6F A;  1K4J A;  1S3Z A;  4PXE A;  5BWA B;  4CAE A;  4QVT A;  2ZXV A;  4XPD B;  5H84 A;  2BCO A;  2POK A;  2FCK A;  2O53 A;  5DWM A;  1U6M A;  2B3U A;  2Q0Y A;  3KQZ A;  2OZG A;  4NGN A;  3NA6 A;  1S7L A;  4HPS A;  5GCN A;  4R87 A;  4UWI A;  2ZEF A;  5KTD A;  4XPK A;  1P4N A;  3FRM A;  2PJ8 A;  4F6A A;  4NFR A;  5FVJ A;  2JLM A;  3DDD A;  1ZG8 A;  2CF4 A;  2NSM A;  2R1I A;  4GM5 A;  4MY0 A;  4KLV A;  1P0H A;  4CYN A;  4A33 A;  3T90 A;  4R8F A;  4BMH A;  2FIW A;  3WAB A;  4ORF A;  1Z8T A;  2I00 A;  2QIR A;  4UA3 A;  5C82 A;  4NXY A;  1JQG A;  4MHZ A;  1FNO A;  1TF9 A;  4MCR A;  3A9L A;  2XEG A;  1VHE A;  3TCV A;  4QB9 A;  4NJQ A;  1XF8 A;  4C2Z A;  2F7V A;  3SJF A;  2CXA A;  1CBX A;  2PJA A;  2X7B A;  3D7H A;  4QUS A;  2WZN A;  2BUE A;  2DPS A;  4OC5 A;  5K8N A;  1LAM A;  1PUA A;  2FS5 A;  2XEI A;  4FD7 A;  3KAS A;  4CRZ B;  4UBR A;  1RTQ A;  1IB1 E;  4XNH B;  2ZW6 A;  3DR8 A;  1TIQ A;  2B4B A;  1ZLH A;  5G1Z A;  3DLJ A;  3D4U A;  5AGE A;  3MN8 A;  3K9T A;  4KVM E;  2PDO A;  2PE3 A;  4W9Y A;  3RAM A;  1JWQ A;  1IID A;  2G9D A;  1UFH A;  4KOT A;  2JDC A;  4MFJ A;  4OC4 A;  5K8M A;  4H89 A;  2Z3M A;  3T9Y A;  2PJ1 A;  4C2Y A;  2G3T A;  5F46 A;  3GUX A;  2B3V A;  2NYQ A;  1F57 A;  1V0C A;  2B5G A;  2WYR A;  1GHE A;  3V8I A;  2PSW A;  4MMO A;  3B7I A;  2FVG A;  4P6Y A;  3FJU A;  2Z10 A;  4EWT A;  4NGM A;  2O4H A;  4PXC A;  3IFE A;  2OB0 A;  4MJ8 A;  1LCP A;  1IY7 A;  4R7M A;  1QSN A;  1YLE A;  2PJ6 A;  4PV6 A;  1Z2L A;  2ZW5 A;  4AG9 A;  3LWU A;  2B5G B;  4CAF A;  4QBJ A;  3TOB A;  3QB8 A;  1KUX A;  1Q2Y A;  3PRT A;  3GKR A;  1XMT A;  3NE8 A;  2IQ6 A;  1R57 A;  4KOY A;  5DS0 A;  1KUY A;  1Y0Y A;  5IX3 A;  2GLF A;  4MFQ A;  4IHM A;  1XMB A;  3SJX A;  3VH9 A;  4CGN A;  2FXF A;  1XJO A;  5D8N A;  3FEE A;  3QNV A;  4ZX9 A;  1Z8X A;  1KWM A;  2GAN A;  3KR5 A;  4NGR A;  4OIW A;  4J3G A;  4U9Z A;  4XPL A;  4L89 A;  3ZJ0 A;  4CGP A;  2QJ8 A;  3CPA A;  4UFX A;  1Y9K A;  2PC1 A;  3FF3 A;  5EBV A;  3H4Q A;  3H5Z A;  3LAC A;  2PJB A;  5THW A;  2FE7 A;  4M6G A;  5F09 A;  2ZED A;  4LUA A;  1PCA A;  2CTC A;  5LYI A;  3SI2 A;  4NF1 A;  4NGP A;  4LX9 A;  4UFW A;  4A94 A;  4DJL A;  4MFZ A;  4CS0 B;  1X12 A;  3B8G A;  4PPZ A;  1PYT B;  2V8H A;  3B2Y A;  3EY5 A;  1ZG7 A;  4PSX A;  3WR7 A;  3BI1 A;  4PSW A;  2BO9 A;  3JVN A;  1YGH A;  3IJ3 A;  5ISV A;  3F8K A;  4MXU A;  4C68 A;  5HVH A;  1VHS A;  4U5Y A;  4AVB A;  2IL4 A;  4OP4 A;  4AXV A;  3R9F A;  2YND A;  4AVA A;  4F9U A;  1Z8W A;  2G0B A;  2PR1 A;  1L0C A;  3HUV A;  2J8N A;  2ABZ A;  5K8P A;  1ZG9 A;  3DR6 A;  4KOR A;  4BIN A;  2REE A;  4FD4 A;  2FSR A;  2PQ8 A;  4B13 A;  4AVC A;  2C27 A;  5K8O A;  4HNW B;  1VKC A;  2ZEH A;  1Q2D A;  2Z3K A;  3I3G A;  4KOX A;  5AG5 A;  5G22 A;  2ZEL A;  6CPA A;  1AMP A;  3VWD A;  2PR8 A;  1IGB A;  3BHX A;  3ZZI A;  1XIX A;  2WUU A;  1XE4 A;  3IIB A;  4X3R A;  2B4D B;  2V8G A;  2OZH A;  1YX0 A;  2AFU A;  2ZEO A;  5LYD A;  4ZGY B;  2V77 A;  3VAR A;  3FIX A;  1CPX A;  3DGV A;  3RNZ A;  1RO5 A;  1NSA A;  4CAV A;  4YU9 A;  1XBU A;  2IMO A;  4WJB A;  3TOA A;  3EC4 A;  5F48 A;  5KTC A;  1M4G A;  2ZEN A;  4JLY A;  4R3K A;  4Y49 C;  4KVX A;  1S5K A;  3CZX A;  3F5B A;  3TC8 A;  4KOW A;  4NSQ A;  4PK3 A;  2ZOF A;  4MHN A;  2JEW A;  1NMT A;  4CGL A;  4Y49 B;  5HXD A;  4M3S A;  3R9E A;  2Z11 A;  4B6Z A;  2CY2 A;  2GE3 A;  5F47 A;  2D4O A;  1QSR A;  3S9N A;  4KSF A;  2VQY A;  1KZF A;  4TNU A;  4YWY A;  4UEF A;  5A28 A;  1YVK A;  5F49 A;  1Y0R A;  3P2H A;  7CPA A;  4F0X A;  1YW6 A;  2G3A A;  3IO1 A;  1F2O A;  4FBE A;  4MFL A;  4NEX A;  4A39 A;  4JJX A;  4AG7 A;  4MBU A;  4K3N A;  1CM0 A;  2H5M A;  4KOS A;  2BOA A;  3C26 A;  4OC2 A;  4C7H A;  4CPA A;  4ZI6 A;  1LAP A;  1YK3 A;  2Q04 A;  2V8V A;  2VEZ A;  1XOV A;  1Q7L A;  4KVO E;  5EMI A;  4E8O A;  2PJ0 A;  3CPX A;  3TFY A;  3FYN A;  2WPW A;  4ONW A;  3N7Z A;  2OR4 A;  3L2N A;  3FX6 A;  2JDD A;  2ZW4 A;  3BI0 A;  3LOD A;  1UWY A;  1Z4R A;  3PP9 A;  1BPM A;  2RC4 A;  5LRJ A;  5A27 A;  2Q44 A;  2Y0M A;  1ARL A;  1VGY A;  4OAD A;  3JTK A;  4UIB A;  2PVW A;  5I4M A;  4UWJ A;  2O28 A;  1Y9W A;  3FB3 A;  4WWV A;  2QVP A;  2AFZ A;  2RFH A;  3JUW A;  2Z3N A;  2EBJ A;  1J4J A;  4F9V A;  1CX8 A;  2DXQ A;  4P4I A;  1IOI A;  4FD5 A;  4X8I A;  4OID A;  3WT4 A;  3FH4 A;  2IJZ A;  2Q7S A;  4CAW A;  5C88 A;  4RI1 A;  1Z5R A;  4JXQ A;  4C2X A;  5HMN A;  1Z4E A;  3EFA A;  3SHP A;  3RO0 A;  3KZW A;  2GRE A;  2VI7 A;  3SJE A;  3TX8 A;  5LYL A;  3KGQ A;  3LMS A;  3PBE A;  2HB6 A;  3BJ7 A;  3LD2 A;  1YQE A;  4X2T A;  1ON0 A;  4OLL A;  4HNX B;  2Q4V A;  1NSL A;  4GS4 A;  5JH9 A;  2P0W A;  4CRY B;  1DTD A;  5AG6 A;  4PXD A;  3FMC A;  4KSA A;  2YNE A;  4CYP A;  3JRU A;  2J9A A;  4I49 A;  4KSI A;  3CDX A;  4L8A A;  4NGT A;  3D2P A;  4OC1 A;  4P4E A;  3WC6 A;  3IGR A;  1ZO0 A;  4MHY A;  2AFS A;  1YSJ A;  4H6U A;  1ARM A;  3KR4 A;  4G1P A;  2PCU A;  4YFJ A;  4F0Y A;  1TF8 A;  2Q4Y A;  4KLW A;  5ELY A;  1CJW A;  4P45 A;  1VIX A;  3G3S A;  4E0A A;  1H8L A;  5CNP A;  2VXK A;  1CP6 A;  3H8E A;  2F5I A;  3K9U A;  3W6S A;  1HDU A;  2AFO A;  4MY3 A;  2ZEE A;  4B5P B;  3S6G A;  3WC7 A;  5IV0 A;  2QEC A;  4JWP A;  4MCS A;  1YR0 A;  3CT9 A;  2Z3O A;  2ATR A;  1TXR A;  2EWB A;  2RB7 A;  4A37 A;  3N5F A;  4A95 A;  4OME A;  2OOT A;  1BO4 A;  2PRQ A;  4B5O A;  3IWG A;  3D68 A;  2A4N A;  4UIA A;  1YW4 A;  4DNC A;  3G8W A;  2Q43 A;  4K30 A;  2BSW A;  4M85 A;  1LAN A;  3DSB A;  1ELM P;  4QC6 A;  1VHO A;  1Q2C A;  1XRY A;  3H8F A;  3VWE A;  4A2Z A;  3GY9 A;  4RN7 A;  4XNH C;  3VAT A;  2PRB A;  3B3C A;  4UCP A;  4ONU A;  2ANP A;  2P6G A;  4B14 A;  3PB6 X;  4KZT A;  3PEI A;  2Z0Z A;  2GU2 A;  3FEC A;  2Q7B A;  4P4B A;  2PJ3 A;  3IU1 A;  4ZY2 A;  3S6K A;  3D66 A;  3FBU A;  5JPH A;  1LFW A;  8CPA A;  1QQ9 A;  3IWE A;  1I12 A;  2BEI A;  1TKH A;  4UCN A;  4MHD A;  3D8P A;  4KS9 A;  1HDQ A;  3SJG A;  1CG2 A;  2CIJ A;  4O23 A;  4R76 A;  1I21 A;  4OC0 A;  4CYO A;  3ISZ A;  2KCW A;  1Y7R A;  2WSA A;  3EO4 A;  3V7Z A;  4ZYQ A;  1DE4 C;  3CXP A;  3MGD A;  4IF5 A;  1QSO A;  3H8G A;  3FVL A;  4MFK A;  2GIV A;  3B3T A;  2B4D A;  4II9 A;  4IK2 A;  3V38 A;  3S9M A;  2NMT A;  1M1D A;  4JYW A;  5G20 A;  4UEZ A;  4JD6 A;  1B87 A;  3F0A A;  2C6G A;  3B3V A;  3S6F A;  1BOB A;  4HKF A;  1LRZ A;  3SI0 A;  3KL9 A;  3RBU A;  4BD9 A;  3KQX A;  5JQ4 A;  3KHX A;  3IEH A;  2OZU A;  2DPT A;  2R8V A;  2HV2 A;  4IUS A;  4ZBG A;  4X5K A;  5HVG A;  1MJ9 A;  2D4P A;  3BLN A;  2PJ5 A;  4ZY1 A;  3PB4 X;  3QAH A;  1QMU A;  4EME A;  2CNS A;  3D7G A;  3I1U A;  2Z3P A;  4U9Y A;  4MFP A;  4AB7 A;  2B58 A;  1M4I A;  4TWE A;  2PJ9 A;  3GYA A;  1YRE A;  4MI4 A;  3IC1 A;  1OZP A;  3D7D A;  4CGM A;  2ODF A;  5CBM A;  1ELL P;  3TO6 A;  2C6C A;  1TKF A;  3R1K A;  3R96 A;  1B6B A;  2XEF A;  4FD6 A;  1A2Z A;  3DNS A;  1S7N A;  2R7H A;  2EK8 A;  4H2K A;  4LQG A;  4PK2 A;  1QST A;  3GLJ A;  4Q38 A;  2XEJ A;  4R3L A;  2JBK A;  3IWW A;  4R9M A;  4B12 A;  1M44 A;  2JEV A;  2WPX A;  4KUB A;  2J8M A;  2I3C A;  2ZEM A;  1AUG A;  3CXQ A;  2PIZ A;  2YNC C;  4NCZ A;  2CTB A;  4C7I A;  3PZJ A;  1I1D A;  2J8R A;  3QAY A;  4M6H A;  4NGQ A;  4Q7A A;  5J8C A;  4MHP A;  2JBJ A;  1Z9U A;  1R43 A;  1WWZ A;  1YLO A;  1BPN A;  3D3S A;  3KI9 A;  1LOK A;  3SXO A;  2GFQ A;  3UY5 A;  1N71 A;  2F8H A;  3ISX A;  4GXH A;  2FIA A;  1ZLI A;  1WK4 A;  1IYK A;  4A38 A;  3W91 A;  4KUA A;  5KTA A;  1IIC A;  4B10 A;  1XEB A;  2HUZ A;  3GIU A;  4OC3 A;  5J1Q A;  2AFM A;  3PB8 X;  5DWN A;  3FNC A;  2PJ2 A;  3TTH A;  4MCQ A;  4ZX8 A;  3NE7 A;  3WC5 A;  3NFZ A;  3D7F A;  3FXT A;  4A30 A;  1NE9 A;  2HQY A;  3I9S A;  4CAX A;  2YNC A;  3BXM A;  3NH8 A;  3T8W A;  2DEA A;  2PIY A;  2C6P A;  4MRI A;  4PXB A;  4B5P A;  1CP7 A;  1FT7 A;  2C1C A;  3K2K A;  2AE6 A;  3PBB A;  4IAV A;  4A31 A;  2PJ7 A;  3EXN A;  5HVF A;  3W6X A;  2VZZ A;  2EO8 A;  1S60 A;  1S7F A;  1FY7 A;  4Z65 A;  5AG4 A;  2DF5 A;  2K5T A;  2GLJ A;  5IB9 A;  1TKJ A;  2AJ6 A;  4NGS A;  1MK4 A;  4CGO A;  2OU2 A;  4UCM A;  5G21 A;  1HEE A;  1IYL A;  1GYT A;  1IU8 A;  1YME A;  2Q51 A;  2ARH A;  3GB0 A;  4JXR A;  3B35 A;  4KOU A;  2VBQ A;  2ZEP A;  4P44 A;  2EK9 A;  4PQA A;  1Z8L A;  1EE3 P;  5E96 A;  3B3S A;  4F8Z A;  1M4D A;  2V8D A;  3RZA A;  2FT0 A;  1S7K A;  3E0K A;  3KKW A;  4P10 A;  3D2M A;  3SI1 A;  1RXT A;  2VL1 A;  2AFW A;  2R98 A;  3S6H A;  4FWU A;  4UFV A;  3R95 A;  4EVY A;  1IOF A;  4R6T A;  2VZY A;  4P4J A;  4MCP A;  5IB0 A;  3NH4 A;  3PFO A;  4P4F A;  3B3W A;  3TO9 A;  4RUH A;  2PJC A;  2ZPA A;  4BBH A;  3BJ8 A;  3KHZ A;  5EC4 A;  2AFX A;  1X10 A;  4DUK A;  2BL1 A;  2EVN A;  2Q4Z A;  5LYF A;  2HC9 A;  2EUI A;  2YGW A;  3PGP A;  3R9G A;  4B11 A;  1BAV A;  1F2P A;  1PU9 A;  2CNM A;  2CNT A;  2ZOG A;  4KOV A;  3RYO A;  1CPS A;  4OKO A;  1OBR A;  1SQH A;  4XPD C;  5JGF A;  5I0C A;  4R57 A;  1BLL E;  1MJB A;  3TT2 A;  2QYV A;  4HNY B;  2ZEG A;  2ZW7 A;  2FL4 A;  2PVV A;  3PB9 X;  4M6I A;  4FAI A;  4DYO A;  4A32 A;  3PFE A;  4CYQ A;  3TE4 A;  3PB7 X;  4YRH A;  5LRK A;  2I79 A;  2PJ4 A;  2OH1 A;  3IU2 A;  1R3N A;  2P6E A;  3CXS A;  4EFD A;  4H6Z A;  1Y7E A;  3HLP A;  5AG7 A;  3OWC A;  3MRU A;  1XFO A;  4P4D A;  4ZY0 A;  2REF A;  5HH1 A;  1QSM A; 
#chains in the Genus database with same CATH homology
 2QML A;  3P2F A;  4OAE A;  4YGO A;  1YVO A;  3TO7 A;  1MJA A;  5H86 A;  1KUV A;  4Q36 A;  4RS2 A;  2Z3L A;  3SXN A;  5J8F A;  4E2A A;  2P6F A;  1K4J A;  1S3Z A;  5BWA B;  4CAE A;  2ZXV A;  4XPD B;  5H84 A;  2FCK A;  5DWM A;  1U6M A;  2B3U A;  2Q0Y A;  2OZG A;  1S7L A;  5GCN A;  4R87 A;  4UWI A;  5KTD A;  4XPK A;  1P4N A;  3FRM A;  4F6A A;  5FVJ A;  2JLM A;  3DDD A;  2R1I A;  4CYN A;  4MY0 A;  4KLV A;  1P0H A;  5AG4 A;  4A33 A;  3T90 A;  4BMH A;  2FIW A;  4ORF A;  2I00 A;  4UA3 A;  2QIR A;  5C82 A;  4NXY A;  3A9L A;  3TCV A;  4QB9 A;  1XF8 A;  4C2Z A;  2CXA A;  2X7B A;  4QUS A;  2BUE A;  2DPS A;  1PUA A;  2FS5 A;  4FD7 A;  4CRZ B;  4UBR A;  1IB1 E;  4XNH B;  2ZW6 A;  3DR8 A;  1TIQ A;  2B4B A;  5G1Z A;  5AGE A;  4KVM E;  2PDO A;  1IID A;  1UFH A;  4KOT A;  2JDC A;  4MFJ A;  4H89 A;  2Z3M A;  3T9Y A;  4C2Y A;  2G3T A;  5F46 A;  2B3V A;  1V0C A;  2B5G A;  1GHE A;  3V8I A;  2PSW A;  2Z10 A;  2OB0 A;  4MJ8 A;  1QSN A;  1YLE A;  4PV6 A;  2ZW5 A;  4AG9 A;  4CAF A;  2B5G B;  4QBJ A;  3TOB A;  3QB8 A;  1KUX A;  1Q2Y A;  3GKR A;  1XMT A;  1R57 A;  4KOY A;  1KUY A;  5IX3 A;  4MFQ A;  4CGN A;  2FXF A;  2GAN A;  4J3G A;  4U9Z A;  4XPL A;  4L89 A;  3ZJ0 A;  4CGP A;  4UFX A;  1Y9K A;  2PC1 A;  5EBV A;  3H4Q A;  3H5Z A;  2FE7 A;  4LUA A;  4NF1 A;  4LX9 A;  4UFW A;  4MFZ A;  4CS0 B;  3B8G A;  3EY5 A;  4PSX A;  3WR7 A;  4PSW A;  3JVN A;  1YGH A;  3F8K A;  4C68 A;  1VHS A;  4U5Y A;  4AVB A;  2IL4 A;  4AVA A;  3R9F A;  2YND A;  2G0B A;  2PR1 A;  1L0C A;  2J8N A;  3DR6 A;  4KOR A;  2REE A;  4FD4 A;  2FSR A;  2PQ8 A;  4B13 A;  4AVC A;  2C27 A;  4HNW B;  1VKC A;  4KOX A;  1Q2D A;  2Z3K A;  3I3G A;  5AG5 A;  5G22 A;  3VWD A;  2PR8 A;  3ZZI A;  1XIX A;  2WUU A;  1XE4 A;  2B4D B;  2OZH A;  1YX0 A;  4ZGY B;  3FIX A;  1RO5 A;  4CAV A;  3TOA A;  3EC4 A;  5F48 A;  5KTC A;  1M4G A;  4JLY A;  4R3K A;  4Y49 C;  4KVX A;  1S5K A;  3F5B A;  4KOW A;  4NSQ A;  4PK3 A;  1NMT A;  4CGL A;  4Y49 B;  4M3S A;  3R9E A;  2Z11 A;  2CY2 A;  2GE3 A;  5F47 A;  2D4O A;  1QSR A;  4KSF A;  2VQY A;  1KZF A;  5A28 A;  1YVK A;  5F49 A;  3P2H A;  4F0X A;  2G3A A;  4MFL A;  4NEX A;  4JJX A;  4AG7 A;  4MBU A;  1CM0 A;  2H5M A;  4KOS A;  4C7H A;  3C26 A;  1YK3 A;  2VEZ A;  2Q04 A;  4KVO E;  4E8O A;  3TFY A;  3FYN A;  2WPW A;  3N7Z A;  3LOD A;  2JDD A;  2ZW4 A;  1Z4R A;  3PP9 A;  2RC4 A;  5A27 A;  2Q44 A;  2Y0M A;  4OAD A;  3JTK A;  4UWJ A;  2O28 A;  1Y9W A;  3FB3 A;  3JUW A;  2Z3N A;  1J4J A;  2DXQ A;  4FD5 A;  4CAW A;  5C88 A;  4RI1 A;  4JXQ A;  4C2X A;  5HMN A;  1Z4E A;  3EFA A;  3SHP A;  2VI7 A;  3BJ7 A;  3LD2 A;  1ON0 A;  4OLL A;  4HNX B;  2Q4V A;  1NSL A;  4GS4 A;  2P0W A;  4CRY B;  5AG6 A;  4KSA A;  2YNE A;  4CYP A;  4I49 A;  4L8A A;  3D2P A;  3IGR A;  1ZO0 A;  4H6U A;  4YFJ A;  4F0Y A;  4KLW A;  2Q4Y A;  1CJW A;  3G3S A;  4E0A A;  5CNP A;  2VXK A;  2F5I A;  3K9U A;  3W6S A;  4MY3 A;  4B5P B;  3S6G A;  5IV0 A;  2QEC A;  4JWP A;  1YR0 A;  2Z3O A;  2ATR A;  4A95 A;  1BO4 A;  4B5O A;  3IWG A;  2A4N A;  4DNC A;  3G8W A;  4K30 A;  4M85 A;  2BSW A;  4QC6 A;  3DSB A;  4A2Z A;  1Q2C A;  3VWE A;  3GY9 A;  4XNH C;  2PRB A;  4UCP A;  4ONU A;  2P6G A;  4B14 A;  4KZT A;  2Z0Z A;  2Q7B A;  3IU1 A;  3S6K A;  3FBU A;  5JPH A;  3IWE A;  1I12 A;  2BEI A;  4UCN A;  4MHD A;  3D8P A;  4KS9 A;  1I21 A;  4CYO A;  2KCW A;  1Y7R A;  2WSA A;  3EO4 A;  3MGD A;  3CXP A;  4IF5 A;  1QSO A;  4MFK A;  2GIV A;  2B4D A;  4II9 A;  2NMT A;  1M1D A;  5G20 A;  4JD6 A;  1B87 A;  3F0A A;  3S6F A;  1BOB A;  4HKF A;  1LRZ A;  5JQ4 A;  2OZU A;  2DPT A;  2R8V A;  4IUS A;  2HV2 A;  4ZBG A;  4X5K A;  1MJ9 A;  2D4P A;  3BLN A;  3QAH A;  2CNS A;  2Z3P A;  4U9Y A;  4MFP A;  4AB7 A;  2B58 A;  1M4I A;  3GYA A;  1YRE A;  4MI4 A;  1OZP A;  4CGM A;  3TO6 A;  3R1K A;  3R96 A;  1B6B A;  4FD6 A;  3DNS A;  1S7N A;  2R7H A;  4PK2 A;  1QST A;  4Q38 A;  4R3L A;  4B12 A;  4R9M A;  1M44 A;  2JEV A;  2WPX A;  4KUB A;  2J8M A;  3CXQ A;  2YNC C;  4NCZ A;  4C7I A;  3PZJ A;  1I1D A;  2J8R A;  5J8C A;  1Z9U A;  1WWZ A;  3D3S A;  3SXO A;  3UY5 A;  1N71 A;  2FIA A;  1WK4 A;  1IYK A;  3W91 A;  4KUA A;  5KTA A;  1IIC A;  4B10 A;  1XEB A;  2HUZ A;  5DWN A;  3FNC A;  3TTH A;  3NE7 A;  3FXT A;  4A30 A;  1NE9 A;  2HQY A;  3I9S A;  4CAX A;  2YNC A;  4B5P A;  4A31 A;  2AE6 A;  3EXN A;  3W6X A;  2VZZ A;  1S60 A;  1S7F A;  1FY7 A;  2K5T A;  2AJ6 A;  1MK4 A;  4CGO A;  2OU2 A;  4UCM A;  5G21 A;  1IYL A;  4KOU A;  4QVT A;  2ARH A;  4JXR A;  2VBQ A;  5E96 A;  1M4D A;  2FT0 A;  1S7K A;  3KKW A;  3E0K A;  3D2M A;  1RXT A;  2R98 A;  3S6H A;  4UFV A;  3R95 A;  4EVY A;  2VZY A;  5IB0 A;  3TO9 A;  2ZPA A;  4BBH A;  3BJ8 A;  5ISV A;  5EC4 A;  2BL1 A;  2EVN A;  2EUI A;  2YGW A;  3PGP A;  3R9G A;  4B11 A;  1PU9 A;  2CNM A;  2CNT A;  3RYO A;  4KOV A;  1SQH A;  4XPD C;  5I0C A;  4R57 A;  1MJB A;  3TT2 A;  4HNY B;  2ZW7 A;  2FL4 A;  4A32 A;  4CYQ A;  3TE4 A;  4YRH A;  2I79 A;  2OH1 A;  3IU2 A;  2P6E A;  3CXS A;  4H6Z A;  5AG7 A;  3OWC A;  2REF A;  5HH1 A;  1QSM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...