2WSAA

Crystal structure of leishmania major n-myristoyltransferase (nmt) with bound myristoyl-coa and a pyrazole sulphonamide ligand (ddd85646)
Total Genus 124
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
124
sequence length
411
structure length
411
Chain Sequence
AHAFWSTQPVPQTEDEDEKIVFAGPMDEPKTVADIPEEPYPIASTFEWWTPNMEAADDIHAIYELLRDNYVEDDDSMFRFNYSEEFLQWALCPPNYIPDWHVAVRRKADKKLLAFIAGVPVTLRMGTPKYMKVKAQEKGEGEEAAKYDEPRHICEINFLCVHKQLREKRLAPILIKEATRRVNRTNVWQAVYTAGVLLPTPYASGQYFHRSLNPEKLVEIRFSGIPAQYQKFQNPMAMLKRNYQLPSAPKNSGLREMKPSDVPQVRRILMNYLDSFDVGPVFSDAEISHYLLPRDGVVFTYVVENDKKVTDFFSFYRIPSTVIGNSNYNLLNAAYVHYYAATSIPLHQLILDLLIVAHSRGFDVCNMVEILDNRSFVEQLKFGAGDGHLRYYFYNWAYPKIKPSQVALVML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title N-Myristoyltransferase Inhibitors as New Leads to Treat Sleeping Sickness.
pubmed doi rcsb
source organism Leishmania major
molecule tags Transferase
molecule keywords GLYCYLPEPTIDE N-TETRADECANOYLTRANSFERASE
total genus 124
structure length 411
sequence length 411
ec nomenclature ec 2.3.1.97: Glycylpeptide N-tetradecanoyltransferase.
pdb deposition date 2009-09-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01233 NMT Myristoyl-CoA:protein N-myristoyltransferase, N-terminal domain
A PF02799 NMT_C Myristoyl-CoA:protein N-myristoyltransferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.170 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 2wsaA00
5A28A 4B10A 4UFXA 2YNEA 3JTKA 4C68A 5AGEA 4C7IA 4A33A 4CGNA 4CGMA 4CYQA 4UCNA 4A31A 4CGPA 5AG4A 4UCPA 4C2YA 5AG5A 4CAEA 4CYNA 2YNCA 4A95A 4A30A 3IU2A 4B13A 5AG7A 5AG6A 4A32A 4CYOA 5G22A 5A27A 3IU1A 3IWEA 4CGOA 4A2ZA 5G21A 4C7HA 5G1ZA 2YNCC 2WUUA 4BBHA 4CGLA 4B14A 2YNDA 4B11A 4CYPA 4UFVA 4B12A 4C2ZA 3H5ZA 5G20A 4UFWA 4CAFA 2WSAA 4UCMA 4C2XA
chains in the Genus database with same CATH superfamily
4H6UA 4ZYQA 4FD7A 2AJ6A 1IOFA 3RYOA 1Z8WA 3KZWA 1CX8A 1AUGA 3B8GA 1WK4A 3RAMA 2H5MA 2VZYA 4G1PA 3TFYA 1P4NA 2Q4ZA 4NFRA 4A30A 1YGHA 4Y49C 4R7MA 3H8FA 5G22A 3S9LA 4MCSA 3FIXA 3TTHA 4PXDA 2EVNA 1YLOA 1Y9KA 4Q38A 3NH8A 2VXKA 5F47A 4ZX8A 4B5OA 5IV0A 2XEIA 3BXMA 1F2OA 2CXAA 2Q4YA 4FWUA 3IEHA 4XNHB 3PB7X 3HUVA 2BL1A 4J3GA 3L2NA 3H4QA 3BI0A 2GLJA 3FVLA 4CGNA 4ORFA 1M4IA 2PR8A 3A9LA 2ABZA 4AVAA 1IYLA 2Q51A 4MFKA 5CPAA 1QSNA 3ZZIA 2CTCA 1Z5RA 3MGDA 2P0WA 2VBQA 2VI7A 4TNUA 3CZXA 5K8PA 2VQYA 2VZZA 5D29A 1J4JA 2O53A 2C27A 2WPWA 3GLJA 4YGOA 4AG9A 2WZNA 3DDDA 4JD6A 4IK2A 4KOYA 4RS2A 4KSAA 5G21A 1XMTA 4OMEA 5LYDA 1Z8LA 4NCZA 3CXPA 3GY9A 4FAIA 3TCVA 2YNDA 4CYPA 3EO4A 1L0CA 3LODA 4YFJA 2BOAA 2OOTA 1Z8TA 2WSAA 3IFEA 4AG7A 4RUHA 1M1DA 1FNOA 3KR4A 3KQZA 4XPDB 2HB6A 4LQGA 6CPAA 2GIVA 4HNYB 2REFA 2VL1A 5D8NA 3IGRA 1GHEA 1MJBA 3SI0A 1TIQA 3G8WA 4MRIA 4OKOA 2Y0MA 4IAVA 4X3RA 2YNCA 3TE4A 5LRJA 1M4DA 2F5IA 1S7NA 2HV2A 3E0KA 4JWPA 4MHDA 4A95A 2JDDA 3JUWA 2QJ8A 2P6EA 4NF1A 4XPKA 3ISZA 2ZW5A 3FH4A 4BINA 3FB3A 5HVFA 2ZEGA 2JLMA 3W91A 2NSMA 2WUUA 2ZEDA 1GYTA 3B35A 4QC6A 4CGLA 1I12A 2P6GA 1TKJA 5C82A 1UWYA 4A37A 2EK9A 4RN7A 5LYIA 4B6ZA 4Z65A 2PJ3A 1ELMP 1YQEA 2PJ0A 1YREA 3B3SA 4CAWA 4W9YA 3UY5A 1F57A 4F9VA 1IYKA 3TO6A 4A31A 2PSWA 8CPAA 5H86A 5HH1A 2FS5A 4JLYA 1HEEA 2ZW7A 4UWJA 4AB7A 4CS0B 2B4BA 3BJ8A 4YRHA 2O4HA 1ZG9A 3WT4A 4B13A 5J1QA 1TXRA 4FUUA 4M6IA 1VHEA 3DGVA 3VARA 1S5KA 3IWGA 4LQ6A 2ARHA 3NH5A 3R95A 1AMPA 3FRMA 1Z8XA 5ISVA 3IJ3A 3FECA 4CPAA 4UIAA 4F9UA 2AFSA 2J9AA 3K9TA 3EXNA 2ZEPA 3PGPA 2OZUA 4P44A 4NGTA 4F0YA 4MHPA 4DUKA 2AFMA 5AGEA 3I3GA 1NSLA 1CP6A 1NE9A 1YX0A 2PJ5A 2XEFA 3QAHA 4X8IA 1YK3A 4PXCA 4L89A 4R8FA 2YGWA 3VATA 2WPXA 2D4PA 4OP4A 3PRTA 2JEWA 3P2HA 2Q0YA 1PCAA 2EK8A 2Z11A 3G3SA 2QVPA 1XRYA 4II9A 1K4JA 4EFDA 2JBJA 2HC9A 4B11A 2K5TA 2CNSA 2PVWA 3D2PA 4MMOA 1Y0YA 2R1IA 4OIWA 2ZXVA 2XEGA 5E96A 4R6TA 4X5KA 2PCUA 1ELLP 2D4OA 5A28A 1I1DA 1R57A 3V7ZA 1MJAA 7CPAA 5HVHA 3JTKA 4ZI6A 1LANA 1KUYA 3KGQA 1CM0A 3PP9A 3KHXA 5EMIA 5AG4A 4CGPA 4F8ZA 4UF4A 1WWZA 3QNVA 4C2YA 3EFAA 5F48A 3VWDA 1PYTB 4R3LA 3WABA 4NGNA 4PXEA 2BEIA 3SXOA 5AG7A 3N7ZA 3PB6X 5JM6A 1S7FA 2C6GA 2JBKA 4GM5A 3R9GA 4PPZA 1M4GA 4DYOA 2Z3PA 4MY0A 3B2YA 4A38A 3SI1A 3WR7A 2AFWA 5F49A 2RFHA 4KOUA 4MHZA 2PDOA 4M6HA 4CRZB 1QSRA 4R57A 4UEEA 3VH9A 2CNMA 2ZEOA 3S9MA 1P0HA 4PQAA 2DXQA 3DNSA 1OBRA 5EBVA 4MFPA 4C7IA 4CAXA 1EE3P 2YNEA 1ON0A 1X12A 4KVXA 2R8VA 3B3CA 1VKCA 3WC5A 5JPHA 3LWUA 2OH1A 2G9DA 4H89A 2PJ4A 3NH4A 3SJFA 4MCRA 3D2MA 4X2TA 3WC7A 4Q7AA 2PJ2A 3PB4X 2Z3KA 5IB9A 3I1UA 3RO0A 4F0XA 4MI4A 3TO7A 1XEBA 4E0AA 2PE3A 4Q36A 4KVME 2PR1A 4FBEA 3BI1A 4P45A 3SI2A 4A2ZA 2PJ8A 3FYNA 1XMBA 2OZHA 3EY5A 4FD5A 1RTQA 2ZEEA 3GIUA 2AFXA 1IIDA 1ZLIA 4HKFA 4KOXA 2PC1A 4C2ZA 3ZJ0A 1YMEA 1CBXA 1CPSA 1V0CA 2IJZA 3D7HA 4EMEA 2X7BA 4GS4A 2I3CA 1IICA 4KS9A 3FNCA 4CYNA 3D7DA 2PJ1A 3IU2A 1NSAA 4ZX9A 3D4UA 2ZW6A 3JVNA 4PXBA 2PJBA 1VHSA 4B5PA 4JYWA 3V8IA 3PEIA 3S6FA 5JGFA 4QB9A 3D68A 3ISXA 4C7HA 5G1ZA 5ELYA 5KTCA 2B3UA 1Z4RA 4UBRA 2EUIA 1XIXA 2FT0A 3FXTA 3KKWA 2V8HA 3LMSA 4OC5A 1BAVA 1TKFA 2C1CA 1VIXA 4ZBGA 1IU8A 4I49A 4UCMA 2Z3MA 4JXRA 3H8EA 4KOTA 3HLPA 4JJXA 4KUBA 4YU9A 2PJCA 4CAEA 1Z4EA 3TX8A 4RI1A 4E2AA 5CBMA 1QQ9A 5LYFA 2Q7BA 5HXDA 5A27A 1Z9UA 2JDCA 4KZTA 2PIYA 4O23A 1CP7A 3R9EA 4OC2A 1BPNA 1KUXA 4XNHC 2PVVA 1YSJA 2HQYA 1M44A 4QUSA 3TC8A 3GYAA 4P4FA 2V8VA 4M6GA 5HMNA 1OZPA 2GANA 2IQ6A 4CRYB 4IUSA 1R43A 3KR5A 1S7LA 1ZG8A 3SJEA 1VGYA 4A33A 5K8MA 4P4BA 4PSXA 4UCNA 1QSTA 2ZEHA 3T9YA 4UA3A 2F7VA 2PJAA 2DPTA 3LACA 1LOKA 3FEDA 1LAMA 4MFJA 2OZGA 5DWMA 1HDUA 4DJLA 4XPLA 4CYOA 4UWIA 3TT2A 4OLLA 4UIBA 4IHMA 4HPSA 1BLLE 2C6PA 2G0BA 1MK4A 1CJWA 1Q7LA 1XE4A 4MHNA 3FBUA 4ONUA 2BCOA 3P2FA 3WC6A 3F5BA 3JRUA 3D7FA 4R87A 3PFOA 2CF4A 5G20A 3SJXA 5I4MA 2PRBA 4EWTA 2CTBA 1BO4A 4XPDC 4KOVA 4PK2A 4B10A 5GCNA 2GREA 3TOAA 3V38A 5J8FA 3CPAA 3KL9A 5I0CA 4OC1A 4OC3A 3PB8X 2J8MA 1TF8A 1Y0RA 4LX9A 2DF5A 4H6ZA 4QVTA 4IF5A 2J8NA 4BD9A 4A32A 5H84A 1YVKA 4F6AA 3BHXA 1N71A 2BO9A 1IY7A 2FIWA 2RB7A 2B3VA 2EBJA 4H2KA 4NGMA 5DWNA 3D67A 5THWA 4E8OA 1KZFA 4NGRA 5KTDA 4AVBA 2I79A 2YNCC 1YLEA 4A39A 3DLJA 2Z3LA 3DR8A 2Q7SA 1S7KA 3GKRA 1YR0A 4UFVA 5LRGA 3BJ7A 2ATRA 3GUXA 3MRUA 2ZELA 2OR4A 1X10A 2ZEFA 2JEVA 3TO9A 1HDQA 1ZG7A 2AE6A 4WJBA 1LRZA 2G3AA 2RC4A 4NJQA 1M4LA 2PJ7A 2BSWA 1AYEA 2PQ8A 4UEZA 3T8WA 5K8NA 1TKHA 2NMTA 2V8DA 3QAYA 5AG6A 3RBUA 5J8CA 2HUZA 3KI9A 5LYLA 4KOWA 3NA6A 4MCPA 5DS0A 1KWMA 4MXUA 2Q44A 4CGOA 1YVOA 2QYVA 4Y49B 5BWAB 2KCWA 1ZLHA 3K2KA 4U9YA 3PB9X 4P4IA 5JQ4A 3GB0A 2GU2A 3K9UA 1NMTA 2FL4A 3C26A 2POKA 2QIRA 5EC4A 3NE7A 5JH9A 3D66A 2DPSA 1S60A 3S6GA 3B3WA 4ZY2A 1CPXA 4CGMA 2B5GA 3KQXA 1FT7A 3OWCA 4NGQA 1ARLA 1YW4A 4P6YA 1Q2DA 2AFUA 4KLWA 2EWBA 5HVGA 2PIZA 4A94A 1UFHA 1Y7EA 3DSBA 2WYRA 1B6BA 1IGBA 3S6KA 3KHZA 1R3NA 3IWEA 4JZ0A 4M85A 4KOSA 4LUAA 4DNCA 2I00A 4MHYA 1PUAA 1A2ZA 2AFOA 4B14A 3F0AA 3CT9A 1Z2LA 4ONWA 2B58A 3FMCA 2GE3A 1LFWA 3SHPA 3W6XA 4B5PB 5C88A 4B12A 2OB0A 1VHOA 3SXNA 1XFOA 3R96A 1RO5A 4KSFA 4CAFA 3B3VA 3MN8A 3VWEA 3IWWA 4C68A 5IX3A 4OC4A 1Q2YA 2PRQA 2DEAA 5LRKA 1DE4C 2J8RA 5F46A 4NXYA 4U5YA 4R9MA 4UCPA 4M3SA 4EVYA 1CG2A 2PJ9A 2ODFA 4NGPA 4QBJA 4PSWA 4AVCA 4NEXA 4AXVA 4K30A 1IOIA 4UEFA 4WWVA 4GXHA 3H8GA 4ZY1A 1Y7RA 2NYQA 4KVOE 4TWEA 4P4DA 3PZJA 3TOBA 3FX6A 4BMHA 2IMOA 4KSIA 2Q43A 4MFQA 2FVGA 2C6CA 2O28A 2ZW4A 4PK3A 4CAVA 4NJRA 4KUAA 4OAEA 3EC4A 1RXTA 4OADA 3S9NA 3D3SA 2CIJA 2P6FA 2Z3OA 4U9ZA 3D7GA 3RZAA 1ARMA 1KUVA 2Q04A 2FSRA 3W6SA 4CYQA 4KLVA 1DTDA 2ANPA 3R9FA 4HNWB 2FXFA 2Q4VA 1IB1E 3IO1A 4L8AA 4YWYA 5KTAA 3PBEA 3D8PA 1QMUA 2B4DB 3BLNA 3NFZA 1LAPA 1U6MA 4R3KA 2ZOFA 3R1KA 4JXQA 1SQHA 5IB0A 1Q2CA 4MFZA 1QSOA 3CDXA 4ZY0A 2FE7A 4FD6A 4P4JA 1MJ9A 2B4DA 1Y9WA 2EO8A 2F8HA 3KASA 2CY2A 1BOBA 2OU2A 4FD4A 2QMLA 3DR6A 4BBHA 3CXQA 3LD2A 2G3TA 2QECA 4MY3A 1JWQA 4OC0A 1XF8A 3SJGA 2Z3NA 2Z10A 2CNTA 3FJUA 4KORA 1B87A 3QB8A 4C2XA 3PFEA 4NSQA 3FF3A 1LCPA 4K3NA 4UFXA 2ZPAA 3B3TA 2IL4A 1XBUA 1XOVA 1YW6A 2R98A 1JQGA 3IC1A 4P4EA 2V77A 1H8LA 2Z0ZA 2BUEA 1FY7A 2PJ6A 4MCQA 2VEZA 3NE8A 2FIAA 2ZOGA 5AG5A 4P10A 3T90A 3N5FA 3IIBA 5F09A 1S3ZA 4PV6A 2FCKA 3B7IA 4HNXB 2A4NA 4OIDA 5FVJA 4MFLA 3I9SA 2ZEMA 1ZO0A 2V8GA 3IU1A 2REEA 4R76A 3CPXA 2GFQA 1TF9A 3PBBA 3F8KA 2AFZA 1PU9A 1BPMA 1F2PA 2GLFA 2R7HA 2ZENA 1I21A 2XEJA 1QSMA 4MJ8A 4NGSA 5K8OA 3S6HA 4MBUA 3H5ZA 1XJOA 4UFWA 3RNZA 2B5GB 5CNPA 3FEEA 4ZGYB 3CXSA
chains in the Genus database with same CATH topology
4H6UA 4FD7A 2AJ6A 3RYOA 3B8GA 1WK4A 2H5MA 2VZYA 3TFYA 1P4NA 4A30A 1YGHA 4Y49C 5G22A 3FIXA 3TTHA 2EVNA 1Y9KA 4Q38A 5F47A 2VXKA 4B5OA 5IV0A 2CXAA 2Q4YA 4XNHB 4J3GA 2BL1A 3H4QA 4CGNA 4ORFA 1M4IA 2PR8A 3A9LA 4AVAA 1IYLA 4MFKA 1QSNA 3ZZIA 3MGDA 2P0WA 2VBQA 2VI7A 2VQYA 2VZZA 1J4JA 2C27A 2WPWA 4YGOA 4AG9A 3DDDA 4JD6A 4KOYA 4RS2A 4KSAA 5G21A 1XMTA 4NCZA 3CXPA 3GY9A 3TCVA 2YNDA 4CYPA 3EO4A 1L0CA 3LODA 4YFJA 4AG7A 2WSAA 1M1DA 4XPDB 2GIVA 4HNYB 2REFA 3IGRA 1GHEA 1MJBA 1TIQA 3G8WA 2Y0MA 3TE4A 2YNCA 1M4DA 2F5IA 1S7NA 2HV2A 3E0KA 4MHDA 4JWPA 4A95A 2JDDA 3JUWA 4NF1A 2P6EA 4XPKA 2ZW5A 3FB3A 2JLMA 3W91A 2WUUA 4QC6A 4CGLA 1I12A 2P6GA 5C82A 1YREA 4CAWA 3UY5A 1IYKA 3TO6A 4A31A 2PSWA 5H86A 5HH1A 2FS5A 4JLYA 2ZW7A 4UWJA 4AB7A 4CS0B 2B4BA 3BJ8A 4YRHA 4B13A 1S5KA 3IWGA 2ARHA 3R95A 3FRMA 5ISVA 3EXNA 3PGPA 2OZUA 4F0YA 5AGEA 3I3GA 1NSLA 1NE9A 1YX0A 3QAHA 1YK3A 4L89A 2YGWA 2WPXA 2D4PA 3P2HA 2Q0YA 2Z11A 3G3SA 4II9A 1K4JA 4B11A 2K5TA 2CNSA 3D2PA 2R1IA 2ZXVA 5E96A 4X5KA 2D4OA 5A28A 1I1DA 1R57A 1MJAA 3JTKA 1KUYA 3PP9A 1CM0A 5AG4A 4CGPA 1WWZA 4C2YA 3EFAA 5F48A 3VWDA 4R3LA 2BEIA 3SXOA 5AG7A 3N7ZA 1S7FA 3R9GA 1M4GA 2Z3PA 4MY0A 3WR7A 5F49A 4KOUA 2PDOA 4CRZB 1QSRA 4R57A 2CNMA 1P0HA 2DXQA 3DNSA 5EBVA 4C7IA 4MFPA 4CAXA 2YNEA 1ON0A 4KVXA 2R8VA 1VKCA 5JPHA 2OH1A 4H89A 3D2MA 2Z3KA 4F0XA 4MI4A 3TO7A 1XEBA 4E0AA 4Q36A 4KVME 2PR1A 4A2ZA 3FYNA 2OZHA 3EY5A 4FD5A 4KOXA 1IIDA 4HKFA 4C2ZA 2PC1A 3ZJ0A 1V0CA 2X7BA 4GS4A 1IICA 4KS9A 3FNCA 4CYNA 3IU2A 2ZW6A 3JVNA 1VHSA 4B5PA 3V8IA 3S6FA 4QB9A 4C7HA 5G1ZA 5KTCA 2B3UA 1Z4RA 4UBRA 2EUIA 1XIXA 2FT0A 3FXTA 3KKWA 4ZBGA 4I49A 4UCMA 2Z3MA 4JXRA 4KOTA 4JJXA 4KUBA 4CAEA 1Z4EA 4RI1A 4E2AA 2Q7BA 5A27A 1Z9UA 2JDCA 4KZTA 3R9EA 1KUXA 4XNHC 2HQYA 1M44A 4QUSA 3GYAA 5HMNA 1OZPA 2GANA 4CRYB 4IUSA 1S7LA 4A33A 4PSXA 4UCNA 1QSTA 3T9YA 4UA3A 2DPTA 4MFJA 5DWMA 2OZGA 4XPLA 4CYOA 4UWIA 3TT2A 4OLLA 2G0BA 1MK4A 1CJWA 1XE4A 3FBUA 4ONUA 3P2FA 3F5BA 4R87A 5G20A 2PRBA 1BO4A 4XPDC 4KOVA 4PK2A 4B10A 5GCNA 3TOAA 5J8FA 5I0CA 2J8MA 4LX9A 4H6ZA 4QVTA 4IF5A 2J8NA 4A32A 5H84A 1YVKA 4F6AA 1N71A 5DWNA 2FIWA 2B3VA 4E8OA 1KZFA 5KTDA 4AVBA 2I79A 2YNCC 1YLEA 2Z3LA 3DR8A 3GKRA 1S7KA 4UFVA 1YR0A 3BJ7A 2ATRA 2JEVA 3TO9A 2AE6A 1LRZA 2G3AA 2RC4A 2BSWA 2PQ8A 2NMTA 5AG6A 5J8CA 2HUZA 4KOWA 2Q44A 4CGOA 1YVOA 4Y49B 5BWAB 2KCWA 4U9YA 5JQ4A 3K9UA 1NMTA 2FL4A 3C26A 2QIRA 5EC4A 3NE7A 2DPSA 1S60A 3S6GA 4CGMA 2B5GA 3OWCA 1Q2DA 4KLWA 1UFHA 3DSBA 1B6BA 3S6KA 3IWEA 4M85A 4KOSA 4LUAA 4DNCA 2I00A 1PUAA 4B14A 3F0AA 3W6XA 5C88A 2B58A 3SHPA 2GE3A 4B5PB 4B12A 2OB0A 3SXNA 3R96A 1RO5A 4KSFA 4CAFA 3VWEA 4C68A 5IX3A 1Q2YA 2J8RA 5F46A 4NXYA 4U5YA 4R9MA 4UCPA 4M3SA 4EVYA 4QBJA 4PSWA 4AVCA 4NEXA 4K30A 1Y7RA 4KVOE 3PZJA 3TOBA 4BMHA 4MFQA 2O28A 2ZW4A 4PK3A 4CAVA 4KUAA 4OAEA 3EC4A 1RXTA 4OADA 3D3SA 2P6FA 4U9ZA 2Z3OA 1KUVA 2Q04A 2FSRA 3W6SA 4CYQA 4KLVA 3R9FA 4HNWB 2FXFA 2Q4VA 1IB1E 4L8AA 5KTAA 3D8PA 3BLNA 2B4DB 1U6MA 4R3KA 3R1KA 4JXQA 1SQHA 5IB0A 1Q2CA 4MFZA 1QSOA 2FE7A 4FD6A 1MJ9A 2B4DA 1Y9WA 2CY2A 1BOBA 4FD4A 2OU2A 2QMLA 3DR6A 4BBHA 3LD2A 3CXQA 2G3TA 2QECA 4MY3A 1XF8A 2Z3NA 2Z10A 2CNTA 4KORA 1B87A 3QB8A 4C2XA 4NSQA 4UFXA 2ZPAA 2IL4A 2R98A 2Z0ZA 2BUEA 1FY7A 2VEZA 5AG5A 2FIAA 3T90A 1S3ZA 4PV6A 2FCKA 4HNXB 2A4NA 5FVJA 4MFLA 3I9SA 1ZO0A 3IU1A 2REEA 3F8KA 1PU9A 2R7HA 1I21A 4MJ8A 1QSMA 3S6HA 4MBUA 3H5ZA 4UFWA 2B5GB 5CNPA 4ZGYB 3CXSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5A28 A;  4B10 A;  4UFX A;  2YNE A;  3JTK A;  4C68 A;  5AGE A;  4C7I A;  4A33 A;  4CGN A;  4CGM A;  4CYQ A;  4UCN A;  4A31 A;  4CGP A;  5AG4 A;  4UCP A;  4C2Y A;  5AG5 A;  4CAE A;  4CYN A;  2YNC A;  4A95 A;  4A30 A;  3IU2 A;  4B13 A;  5AG7 A;  5AG6 A;  4A32 A;  4CYO A;  5G22 A;  5A27 A;  3IU1 A;  3IWE A;  4CGO A;  4A2Z A;  5G21 A;  4C7H A;  5G1Z A;  2YNC C;  2WUU A;  4BBH A;  4CGL A;  4B14 A;  2YND A;  4B11 A;  4CYP A;  4UFV A;  4B12 A;  4C2Z A;  3H5Z A;  5G20 A;  4UFW A;  4CAF A;  2WSA A;  4UCM A;  4C2X A; 
#chains in the Genus database with same CATH topology
 4H6U A;  4ZYQ A;  4FD7 A;  2AJ6 A;  1IOF A;  3RYO A;  1Z8W A;  3KZW A;  1CX8 A;  1AUG A;  3B8G A;  1WK4 A;  3RAM A;  2H5M A;  2VZY A;  4G1P A;  3TFY A;  1P4N A;  2Q4Z A;  4NFR A;  4A30 A;  1YGH A;  4Y49 C;  4R7M A;  3H8F A;  5G22 A;  3S9L A;  4MCS A;  3FIX A;  3TTH A;  4PXD A;  2EVN A;  1YLO A;  1Y9K A;  4Q38 A;  3NH8 A;  2VXK A;  5F47 A;  4ZX8 A;  4B5O A;  5IV0 A;  2XEI A;  3BXM A;  1F2O A;  2CXA A;  2Q4Y A;  4FWU A;  3IEH A;  4XNH B;  3PB7 X;  3HUV A;  2BL1 A;  4J3G A;  3L2N A;  3H4Q A;  3BI0 A;  2GLJ A;  3FVL A;  4CGN A;  4ORF A;  1M4I A;  2PR8 A;  3A9L A;  2ABZ A;  4AVA A;  1IYL A;  2Q51 A;  4MFK A;  5CPA A;  1QSN A;  3ZZI A;  2CTC A;  1Z5R A;  3MGD A;  2P0W A;  2VBQ A;  2VI7 A;  4TNU A;  3CZX A;  5K8P A;  2VQY A;  2VZZ A;  5D29 A;  1J4J A;  2O53 A;  2C27 A;  2WPW A;  3GLJ A;  4YGO A;  4AG9 A;  2WZN A;  3DDD A;  4JD6 A;  4IK2 A;  4KOY A;  4RS2 A;  4KSA A;  5G21 A;  1XMT A;  4OME A;  5LYD A;  1Z8L A;  4NCZ A;  3CXP A;  3GY9 A;  4FAI A;  3TCV A;  2YND A;  4CYP A;  3EO4 A;  1L0C A;  3LOD A;  4YFJ A;  2BOA A;  2OOT A;  1Z8T A;  2WSA A;  3IFE A;  4AG7 A;  4RUH A;  1M1D A;  1FNO A;  3KR4 A;  3KQZ A;  4XPD B;  2HB6 A;  4LQG A;  6CPA A;  2GIV A;  4HNY B;  2REF A;  2VL1 A;  5D8N A;  3IGR A;  1GHE A;  1MJB A;  3SI0 A;  1TIQ A;  3G8W A;  4MRI A;  4OKO A;  2Y0M A;  4IAV A;  4X3R A;  2YNC A;  3TE4 A;  5LRJ A;  1M4D A;  2F5I A;  1S7N A;  2HV2 A;  3E0K A;  4JWP A;  4MHD A;  4A95 A;  2JDD A;  3JUW A;  2QJ8 A;  2P6E A;  4NF1 A;  4XPK A;  3ISZ A;  2ZW5 A;  3FH4 A;  4BIN A;  3FB3 A;  5HVF A;  2ZEG A;  2JLM A;  3W91 A;  2NSM A;  2WUU A;  2ZED A;  1GYT A;  3B35 A;  4QC6 A;  4CGL A;  1I12 A;  2P6G A;  1TKJ A;  5C82 A;  1UWY A;  4A37 A;  2EK9 A;  4RN7 A;  5LYI A;  4B6Z A;  4Z65 A;  2PJ3 A;  1ELM P;  1YQE A;  2PJ0 A;  1YRE A;  3B3S A;  4CAW A;  4W9Y A;  3UY5 A;  1F57 A;  4F9V A;  1IYK A;  3TO6 A;  4A31 A;  2PSW A;  8CPA A;  5H86 A;  5HH1 A;  2FS5 A;  4JLY A;  1HEE A;  2ZW7 A;  4UWJ A;  4AB7 A;  4CS0 B;  2B4B A;  3BJ8 A;  4YRH A;  2O4H A;  1ZG9 A;  3WT4 A;  4B13 A;  5J1Q A;  1TXR A;  4FUU A;  4M6I A;  1VHE A;  3DGV A;  3VAR A;  1S5K A;  3IWG A;  4LQ6 A;  2ARH A;  3NH5 A;  3R95 A;  1AMP A;  3FRM A;  1Z8X A;  5ISV A;  3IJ3 A;  3FEC A;  4CPA A;  4UIA A;  4F9U A;  2AFS A;  2J9A A;  3K9T A;  3EXN A;  2ZEP A;  3PGP A;  2OZU A;  4P44 A;  4NGT A;  4F0Y A;  4MHP A;  4DUK A;  2AFM A;  5AGE A;  3I3G A;  1NSL A;  1CP6 A;  1NE9 A;  1YX0 A;  2PJ5 A;  2XEF A;  3QAH A;  4X8I A;  1YK3 A;  4PXC A;  4L89 A;  4R8F A;  2YGW A;  3VAT A;  2WPX A;  2D4P A;  4OP4 A;  3PRT A;  2JEW A;  3P2H A;  2Q0Y A;  1PCA A;  2EK8 A;  2Z11 A;  3G3S A;  2QVP A;  1XRY A;  4II9 A;  1K4J A;  4EFD A;  2JBJ A;  2HC9 A;  4B11 A;  2K5T A;  2CNS A;  2PVW A;  3D2P A;  4MMO A;  1Y0Y A;  2R1I A;  4OIW A;  2ZXV A;  2XEG A;  5E96 A;  4R6T A;  4X5K A;  2PCU A;  1ELL P;  2D4O A;  5A28 A;  1I1D A;  1R57 A;  3V7Z A;  1MJA A;  7CPA A;  5HVH A;  3JTK A;  4ZI6 A;  1LAN A;  1KUY A;  3KGQ A;  1CM0 A;  3PP9 A;  3KHX A;  5EMI A;  5AG4 A;  4CGP A;  4F8Z A;  4UF4 A;  1WWZ A;  3QNV A;  4C2Y A;  3EFA A;  5F48 A;  3VWD A;  1PYT B;  4R3L A;  3WAB A;  4NGN A;  4PXE A;  2BEI A;  3SXO A;  5AG7 A;  3N7Z A;  3PB6 X;  5JM6 A;  1S7F A;  2C6G A;  2JBK A;  4GM5 A;  3R9G A;  4PPZ A;  1M4G A;  4DYO A;  2Z3P A;  4MY0 A;  3B2Y A;  4A38 A;  3SI1 A;  3WR7 A;  2AFW A;  5F49 A;  2RFH A;  4KOU A;  4MHZ A;  2PDO A;  4M6H A;  4CRZ B;  1QSR A;  4R57 A;  4UEE A;  3VH9 A;  2CNM A;  2ZEO A;  3S9M A;  1P0H A;  4PQA A;  2DXQ A;  3DNS A;  1OBR A;  5EBV A;  4MFP A;  4C7I A;  4CAX A;  1EE3 P;  2YNE A;  1ON0 A;  1X12 A;  4KVX A;  2R8V A;  3B3C A;  1VKC A;  3WC5 A;  5JPH A;  3LWU A;  2OH1 A;  2G9D A;  4H89 A;  2PJ4 A;  3NH4 A;  3SJF A;  4MCR A;  3D2M A;  4X2T A;  3WC7 A;  4Q7A A;  2PJ2 A;  3PB4 X;  2Z3K A;  5IB9 A;  3I1U A;  3RO0 A;  4F0X A;  4MI4 A;  3TO7 A;  1XEB A;  4E0A A;  2PE3 A;  4Q36 A;  4KVM E;  2PR1 A;  4FBE A;  3BI1 A;  4P45 A;  3SI2 A;  4A2Z A;  2PJ8 A;  3FYN A;  1XMB A;  2OZH A;  3EY5 A;  4FD5 A;  1RTQ A;  2ZEE A;  3GIU A;  2AFX A;  1IID A;  1ZLI A;  4HKF A;  4KOX A;  2PC1 A;  4C2Z A;  3ZJ0 A;  1YME A;  1CBX A;  1CPS A;  1V0C A;  2IJZ A;  3D7H A;  4EME A;  2X7B A;  4GS4 A;  2I3C A;  1IIC A;  4KS9 A;  3FNC A;  4CYN A;  3D7D A;  2PJ1 A;  3IU2 A;  1NSA A;  4ZX9 A;  3D4U A;  2ZW6 A;  3JVN A;  4PXB A;  2PJB A;  1VHS A;  4B5P A;  4JYW A;  3V8I A;  3PEI A;  3S6F A;  5JGF A;  4QB9 A;  3D68 A;  3ISX A;  4C7H A;  5G1Z A;  5ELY A;  5KTC A;  2B3U A;  1Z4R A;  4UBR A;  2EUI A;  1XIX A;  2FT0 A;  3FXT A;  3KKW A;  2V8H A;  3LMS A;  4OC5 A;  1BAV A;  1TKF A;  2C1C A;  1VIX A;  4ZBG A;  1IU8 A;  4I49 A;  4UCM A;  2Z3M A;  4JXR A;  3H8E A;  4KOT A;  3HLP A;  4JJX A;  4KUB A;  4YU9 A;  2PJC A;  4CAE A;  1Z4E A;  3TX8 A;  4RI1 A;  4E2A A;  5CBM A;  1QQ9 A;  5LYF A;  2Q7B A;  5HXD A;  5A27 A;  1Z9U A;  2JDC A;  4KZT A;  2PIY A;  4O23 A;  1CP7 A;  3R9E A;  4OC2 A;  1BPN A;  1KUX A;  4XNH C;  2PVV A;  1YSJ A;  2HQY A;  1M44 A;  4QUS A;  3TC8 A;  3GYA A;  4P4F A;  2V8V A;  4M6G A;  5HMN A;  1OZP A;  2GAN A;  2IQ6 A;  4CRY B;  4IUS A;  1R43 A;  3KR5 A;  1S7L A;  1ZG8 A;  3SJE A;  1VGY A;  4A33 A;  5K8M A;  4P4B A;  4PSX A;  4UCN A;  1QST A;  2ZEH A;  3T9Y A;  4UA3 A;  2F7V A;  2PJA A;  2DPT A;  3LAC A;  1LOK A;  3FED A;  1LAM A;  4MFJ A;  2OZG A;  5DWM A;  1HDU A;  4DJL A;  4XPL A;  4CYO A;  4UWI A;  3TT2 A;  4OLL A;  4UIB A;  4IHM A;  4HPS A;  1BLL E;  2C6P A;  2G0B A;  1MK4 A;  1CJW A;  1Q7L A;  1XE4 A;  4MHN A;  3FBU A;  4ONU A;  2BCO A;  3P2F A;  3WC6 A;  3F5B A;  3JRU A;  3D7F A;  4R87 A;  3PFO A;  2CF4 A;  5G20 A;  3SJX A;  5I4M A;  2PRB A;  4EWT A;  2CTB A;  1BO4 A;  4XPD C;  4KOV A;  4PK2 A;  4B10 A;  5GCN A;  2GRE A;  3TOA A;  3V38 A;  5J8F A;  3CPA A;  3KL9 A;  5I0C A;  4OC1 A;  4OC3 A;  3PB8 X;  2J8M A;  1TF8 A;  1Y0R A;  4LX9 A;  2DF5 A;  4H6Z A;  4QVT A;  4IF5 A;  2J8N A;  4BD9 A;  4A32 A;  5H84 A;  1YVK A;  4F6A A;  3BHX A;  1N71 A;  2BO9 A;  1IY7 A;  2FIW A;  2RB7 A;  2B3V A;  2EBJ A;  4H2K A;  4NGM A;  5DWN A;  3D67 A;  5THW A;  4E8O A;  1KZF A;  4NGR A;  5KTD A;  4AVB A;  2I79 A;  2YNC C;  1YLE A;  4A39 A;  3DLJ A;  2Z3L A;  3DR8 A;  2Q7S A;  1S7K A;  3GKR A;  1YR0 A;  4UFV A;  5LRG A;  3BJ7 A;  2ATR A;  3GUX A;  3MRU A;  2ZEL A;  2OR4 A;  1X10 A;  2ZEF A;  2JEV A;  3TO9 A;  1HDQ A;  1ZG7 A;  2AE6 A;  4WJB A;  1LRZ A;  2G3A A;  2RC4 A;  4NJQ A;  1M4L A;  2PJ7 A;  2BSW A;  1AYE A;  2PQ8 A;  4UEZ A;  3T8W A;  5K8N A;  1TKH A;  2NMT A;  2V8D A;  3QAY A;  5AG6 A;  3RBU A;  5J8C A;  2HUZ A;  3KI9 A;  5LYL A;  4KOW A;  3NA6 A;  4MCP A;  5DS0 A;  1KWM A;  4MXU A;  2Q44 A;  4CGO A;  1YVO A;  2QYV A;  4Y49 B;  5BWA B;  2KCW A;  1ZLH A;  3K2K A;  4U9Y A;  3PB9 X;  4P4I A;  5JQ4 A;  3GB0 A;  2GU2 A;  3K9U A;  1NMT A;  2FL4 A;  3C26 A;  2POK A;  2QIR A;  5EC4 A;  3NE7 A;  5JH9 A;  3D66 A;  2DPS A;  1S60 A;  3S6G A;  3B3W A;  4ZY2 A;  1CPX A;  4CGM A;  2B5G A;  3KQX A;  1FT7 A;  3OWC A;  4NGQ A;  1ARL A;  1YW4 A;  4P6Y A;  1Q2D A;  2AFU A;  4KLW A;  2EWB A;  5HVG A;  2PIZ A;  4A94 A;  1UFH A;  1Y7E A;  3DSB A;  2WYR A;  1B6B A;  1IGB A;  3S6K A;  3KHZ A;  1R3N A;  3IWE A;  4JZ0 A;  4M85 A;  4KOS A;  4LUA A;  4DNC A;  2I00 A;  4MHY A;  1PUA A;  1A2Z A;  2AFO A;  4B14 A;  3F0A A;  3CT9 A;  1Z2L A;  4ONW A;  2B58 A;  3FMC A;  2GE3 A;  1LFW A;  3SHP A;  3W6X A;  4B5P B;  5C88 A;  4B12 A;  2OB0 A;  1VHO A;  3SXN A;  1XFO A;  3R96 A;  1RO5 A;  4KSF A;  4CAF A;  3B3V A;  3MN8 A;  3VWE A;  3IWW A;  4C68 A;  5IX3 A;  4OC4 A;  1Q2Y A;  2PRQ A;  2DEA A;  5LRK A;  1DE4 C;  2J8R A;  5F46 A;  4NXY A;  4U5Y A;  4R9M A;  4UCP A;  4M3S A;  4EVY A;  1CG2 A;  2PJ9 A;  2ODF A;  4NGP A;  4QBJ A;  4PSW A;  4AVC A;  4NEX A;  4AXV A;  4K30 A;  1IOI A;  4UEF A;  4WWV A;  4GXH A;  3H8G A;  4ZY1 A;  1Y7R A;  2NYQ A;  4KVO E;  4TWE A;  4P4D A;  3PZJ A;  3TOB A;  3FX6 A;  4BMH A;  2IMO A;  4KSI A;  2Q43 A;  4MFQ A;  2FVG A;  2C6C A;  2O28 A;  2ZW4 A;  4PK3 A;  4CAV A;  4NJR A;  4KUA A;  4OAE A;  3EC4 A;  1RXT A;  4OAD A;  3S9N A;  3D3S A;  2CIJ A;  2P6F A;  2Z3O A;  4U9Z A;  3D7G A;  3RZA A;  1ARM A;  1KUV A;  2Q04 A;  2FSR A;  3W6S A;  4CYQ A;  4KLV A;  1DTD A;  2ANP A;  3R9F A;  4HNW B;  2FXF A;  2Q4V A;  1IB1 E;  3IO1 A;  4L8A A;  4YWY A;  5KTA A;  3PBE A;  3D8P A;  1QMU A;  2B4D B;  3BLN A;  3NFZ A;  1LAP A;  1U6M A;  4R3K A;  2ZOF A;  3R1K A;  4JXQ A;  1SQH A;  5IB0 A;  1Q2C A;  4MFZ A;  1QSO A;  3CDX A;  4ZY0 A;  2FE7 A;  4FD6 A;  4P4J A;  1MJ9 A;  2B4D A;  1Y9W A;  2EO8 A;  2F8H A;  3KAS A;  2CY2 A;  1BOB A;  2OU2 A;  4FD4 A;  2QML A;  3DR6 A;  4BBH A;  3CXQ A;  3LD2 A;  2G3T A;  2QEC A;  4MY3 A;  1JWQ A;  4OC0 A;  1XF8 A;  3SJG A;  2Z3N A;  2Z10 A;  2CNT A;  3FJU A;  4KOR A;  1B87 A;  3QB8 A;  4C2X A;  3PFE A;  4NSQ A;  3FF3 A;  1LCP A;  4K3N A;  4UFX A;  2ZPA A;  3B3T A;  2IL4 A;  1XBU A;  1XOV A;  1YW6 A;  2R98 A;  1JQG A;  3IC1 A;  4P4E A;  2V77 A;  1H8L A;  2Z0Z A;  2BUE A;  1FY7 A;  2PJ6 A;  4MCQ A;  2VEZ A;  3NE8 A;  2FIA A;  2ZOG A;  5AG5 A;  4P10 A;  3T90 A;  3N5F A;  3IIB A;  5F09 A;  1S3Z A;  4PV6 A;  2FCK A;  3B7I A;  4HNX B;  2A4N A;  4OID A;  5FVJ A;  4MFL A;  3I9S A;  2ZEM A;  1ZO0 A;  2V8G A;  3IU1 A;  2REE A;  4R76 A;  3CPX A;  2GFQ A;  1TF9 A;  3PBB A;  3F8K A;  2AFZ A;  1PU9 A;  1BPM A;  1F2P A;  2GLF A;  2R7H A;  2ZEN A;  1I21 A;  2XEJ A;  1QSM A;  4MJ8 A;  4NGS A;  5K8O A;  3S6H A;  4MBU A;  3H5Z A;  1XJO A;  4UFW A;  3RNZ A;  2B5G B;  5CNP A;  3FEE A;  4ZGY B;  3CXS A; 
#chains in the Genus database with same CATH homology
 4H6U A;  4FD7 A;  2AJ6 A;  3RYO A;  3B8G A;  1WK4 A;  2H5M A;  2VZY A;  3TFY A;  1P4N A;  4A30 A;  1YGH A;  4Y49 C;  5G22 A;  3FIX A;  3TTH A;  2EVN A;  1Y9K A;  4Q38 A;  5F47 A;  2VXK A;  4B5O A;  5IV0 A;  2CXA A;  2Q4Y A;  4XNH B;  4J3G A;  2BL1 A;  3H4Q A;  4CGN A;  4ORF A;  1M4I A;  2PR8 A;  3A9L A;  4AVA A;  1IYL A;  4MFK A;  1QSN A;  3ZZI A;  3MGD A;  2P0W A;  2VBQ A;  2VI7 A;  2VQY A;  2VZZ A;  1J4J A;  2C27 A;  2WPW A;  4YGO A;  4AG9 A;  3DDD A;  4JD6 A;  4KOY A;  4RS2 A;  4KSA A;  5G21 A;  1XMT A;  4NCZ A;  3CXP A;  3GY9 A;  3TCV A;  2YND A;  4CYP A;  3EO4 A;  1L0C A;  3LOD A;  4YFJ A;  4AG7 A;  2WSA A;  1M1D A;  4XPD B;  2GIV A;  4HNY B;  2REF A;  3IGR A;  1GHE A;  1MJB A;  1TIQ A;  3G8W A;  2Y0M A;  3TE4 A;  2YNC A;  1M4D A;  2F5I A;  1S7N A;  2HV2 A;  3E0K A;  4MHD A;  4JWP A;  4A95 A;  2JDD A;  3JUW A;  4NF1 A;  2P6E A;  4XPK A;  2ZW5 A;  3FB3 A;  2JLM A;  3W91 A;  2WUU A;  4QC6 A;  4CGL A;  1I12 A;  2P6G A;  5C82 A;  1YRE A;  4CAW A;  3UY5 A;  1IYK A;  3TO6 A;  4A31 A;  2PSW A;  5H86 A;  5HH1 A;  2FS5 A;  4JLY A;  2ZW7 A;  4UWJ A;  4AB7 A;  4CS0 B;  2B4B A;  3BJ8 A;  4YRH A;  4B13 A;  1S5K A;  3IWG A;  2ARH A;  3R95 A;  3FRM A;  5ISV A;  3EXN A;  3PGP A;  2OZU A;  4F0Y A;  5AGE A;  3I3G A;  1NSL A;  1NE9 A;  1YX0 A;  3QAH A;  1YK3 A;  4L89 A;  2YGW A;  2WPX A;  2D4P A;  3P2H A;  2Q0Y A;  2Z11 A;  3G3S A;  4II9 A;  1K4J A;  4B11 A;  2K5T A;  2CNS A;  3D2P A;  2R1I A;  2ZXV A;  5E96 A;  4X5K A;  2D4O A;  5A28 A;  1I1D A;  1R57 A;  1MJA A;  3JTK A;  1KUY A;  3PP9 A;  1CM0 A;  5AG4 A;  4CGP A;  1WWZ A;  4C2Y A;  3EFA A;  5F48 A;  3VWD A;  4R3L A;  2BEI A;  3SXO A;  5AG7 A;  3N7Z A;  1S7F A;  3R9G A;  1M4G A;  2Z3P A;  4MY0 A;  3WR7 A;  5F49 A;  4KOU A;  2PDO A;  4CRZ B;  1QSR A;  4R57 A;  2CNM A;  1P0H A;  2DXQ A;  3DNS A;  5EBV A;  4C7I A;  4MFP A;  4CAX A;  2YNE A;  1ON0 A;  4KVX A;  2R8V A;  1VKC A;  5JPH A;  2OH1 A;  4H89 A;  3D2M A;  2Z3K A;  4F0X A;  4MI4 A;  3TO7 A;  1XEB A;  4E0A A;  4Q36 A;  4KVM E;  2PR1 A;  4A2Z A;  3FYN A;  2OZH A;  3EY5 A;  4FD5 A;  4KOX A;  1IID A;  4HKF A;  4C2Z A;  2PC1 A;  3ZJ0 A;  1V0C A;  2X7B A;  4GS4 A;  1IIC A;  4KS9 A;  3FNC A;  4CYN A;  3IU2 A;  2ZW6 A;  3JVN A;  1VHS A;  4B5P A;  3V8I A;  3S6F A;  4QB9 A;  4C7H A;  5G1Z A;  5KTC A;  2B3U A;  1Z4R A;  4UBR A;  2EUI A;  1XIX A;  2FT0 A;  3FXT A;  3KKW A;  4ZBG A;  4I49 A;  4UCM A;  2Z3M A;  4JXR A;  4KOT A;  4JJX A;  4KUB A;  4CAE A;  1Z4E A;  4RI1 A;  4E2A A;  2Q7B A;  5A27 A;  1Z9U A;  2JDC A;  4KZT A;  3R9E A;  1KUX A;  4XNH C;  2HQY A;  1M44 A;  4QUS A;  3GYA A;  5HMN A;  1OZP A;  2GAN A;  4CRY B;  4IUS A;  1S7L A;  4A33 A;  4PSX A;  4UCN A;  1QST A;  3T9Y A;  4UA3 A;  2DPT A;  4MFJ A;  5DWM A;  2OZG A;  4XPL A;  4CYO A;  4UWI A;  3TT2 A;  4OLL A;  2G0B A;  1MK4 A;  1CJW A;  1XE4 A;  3FBU A;  4ONU A;  3P2F A;  3F5B A;  4R87 A;  5G20 A;  2PRB A;  1BO4 A;  4XPD C;  4KOV A;  4PK2 A;  4B10 A;  5GCN A;  3TOA A;  5J8F A;  5I0C A;  2J8M A;  4LX9 A;  4H6Z A;  4QVT A;  4IF5 A;  2J8N A;  4A32 A;  5H84 A;  1YVK A;  4F6A A;  1N71 A;  5DWN A;  2FIW A;  2B3V A;  4E8O A;  1KZF A;  5KTD A;  4AVB A;  2I79 A;  2YNC C;  1YLE A;  2Z3L A;  3DR8 A;  3GKR A;  1S7K A;  4UFV A;  1YR0 A;  3BJ7 A;  2ATR A;  2JEV A;  3TO9 A;  2AE6 A;  1LRZ A;  2G3A A;  2RC4 A;  2BSW A;  2PQ8 A;  2NMT A;  5AG6 A;  5J8C A;  2HUZ A;  4KOW A;  2Q44 A;  4CGO A;  1YVO A;  4Y49 B;  5BWA B;  2KCW A;  4U9Y A;  5JQ4 A;  3K9U A;  1NMT A;  2FL4 A;  3C26 A;  2QIR A;  5EC4 A;  3NE7 A;  2DPS A;  1S60 A;  3S6G A;  4CGM A;  2B5G A;  3OWC A;  1Q2D A;  4KLW A;  1UFH A;  3DSB A;  1B6B A;  3S6K A;  3IWE A;  4M85 A;  4KOS A;  4LUA A;  4DNC A;  2I00 A;  1PUA A;  4B14 A;  3F0A A;  3W6X A;  5C88 A;  2B58 A;  3SHP A;  2GE3 A;  4B5P B;  4B12 A;  2OB0 A;  3SXN A;  3R96 A;  1RO5 A;  4KSF A;  4CAF A;  3VWE A;  4C68 A;  5IX3 A;  1Q2Y A;  2J8R A;  5F46 A;  4NXY A;  4U5Y A;  4R9M A;  4UCP A;  4M3S A;  4EVY A;  4QBJ A;  4PSW A;  4AVC A;  4NEX A;  4K30 A;  1Y7R A;  4KVO E;  3PZJ A;  3TOB A;  4BMH A;  4MFQ A;  2O28 A;  2ZW4 A;  4PK3 A;  4CAV A;  4KUA A;  4OAE A;  3EC4 A;  1RXT A;  4OAD A;  3D3S A;  2P6F A;  4U9Z A;  2Z3O A;  1KUV A;  2Q04 A;  2FSR A;  3W6S A;  4CYQ A;  4KLV A;  3R9F A;  4HNW B;  2FXF A;  2Q4V A;  1IB1 E;  4L8A A;  5KTA A;  3D8P A;  3BLN A;  2B4D B;  1U6M A;  4R3K A;  3R1K A;  4JXQ A;  1SQH A;  5IB0 A;  1Q2C A;  4MFZ A;  1QSO A;  2FE7 A;  4FD6 A;  1MJ9 A;  2B4D A;  1Y9W A;  2CY2 A;  1BOB A;  4FD4 A;  2OU2 A;  2QML A;  3DR6 A;  4BBH A;  3LD2 A;  3CXQ A;  2G3T A;  2QEC A;  4MY3 A;  1XF8 A;  2Z3N A;  2Z10 A;  2CNT A;  4KOR A;  1B87 A;  3QB8 A;  4C2X A;  4NSQ A;  4UFX A;  2ZPA A;  2IL4 A;  2R98 A;  2Z0Z A;  2BUE A;  1FY7 A;  2VEZ A;  5AG5 A;  2FIA A;  3T90 A;  1S3Z A;  4PV6 A;  2FCK A;  4HNX B;  2A4N A;  5FVJ A;  4MFL A;  3I9S A;  1ZO0 A;  3IU1 A;  2REE A;  3F8K A;  1PU9 A;  2R7H A;  1I21 A;  4MJ8 A;  1QSM A;  3S6H A;  4MBU A;  3H5Z A;  4UFW A;  2B5G B;  5CNP A;  4ZGY B;  3CXS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...