2WSAA

Crystal structure of leishmania major n-myristoyltransferase (nmt) with bound myristoyl-coa and a pyrazole sulphonamide ligand (ddd85646)
Total Genus 124
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
124
sequence length
411
structure length
411
Chain Sequence
AHAFWSTQPVPQTEDEDEKIVFAGPMDEPKTVADIPEEPYPIASTFEWWTPNMEAADDIHAIYELLRDNYVEDDDSMFRFNYSEEFLQWALCPPNYIPDWHVAVRRKADKKLLAFIAGVPVTLRMGTPKYMKVKAQEKGEGEEAAKYDEPRHICEINFLCVHKQLREKRLAPILIKEATRRVNRTNVWQAVYTAGVLLPTPYASGQYFHRSLNPEKLVEIRFSGIPAQYQKFQNPMAMLKRNYQLPSAPKNSGLREMKPSDVPQVRRILMNYLDSFDVGPVFSDAEISHYLLPRDGVVFTYVVENDKKVTDFFSFYRIPSTVIGNSNYNLLNAAYVHYYAATSIPLHQLILDLLIVAHSRGFDVCNMVEILDNRSFVEQLKFGAGDGHLRYYFYNWAYPKIKPSQVALVML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLYCYLPEPTIDE N-TETRADECANOYLTRANSFERASE
publication title N-Myristoyltransferase Inhibitors as New Leads to Treat Sleeping Sickness.
pubmed doi rcsb
source organism Leishmania major
molecule tags Transferase
total genus 124
structure length 411
sequence length 411
ec nomenclature ec 2.3.1.97: Glycylpeptide N-tetradecanoyltransferase.
pdb deposition date 2009-09-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01233 NMT Myristoyl-CoA:protein N-myristoyltransferase, N-terminal domain
A PF02799 NMT_C Myristoyl-CoA:protein N-myristoyltransferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.170 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 2wsaA00
4C7IA 4B10A 4UCMA 3JTKA 4A2ZA 4UCPA 5G22A 4CAEA 4CGNA 2YNCA 4CYOA 4A95A 3IU2A 4A32A 4UFWA 4B11A 5AG7A 4C2YA 4CGMA 4CGLA 5AG6A 4B12A 4B13A 4B14A 2YNCC 5G21A 4A33A 4CAFA 4CYNA 2YNDA 4CYPA 5AGEA 5AG5A 4C68A 4UFVA 5G20A 5G1ZA 4CGPA 4UFXA 5A28A 4C2ZA 3IWEA 2WSAA 5A27A 4C2XA 4CYQA 4BBHA 5AG4A 3IU1A 4A31A 4A30A 2WUUA 4C7HA 2YNEA 3H5ZA 4CGOA 4UCNA
chains in the Genus database with same CATH superfamily
2OB0A 4UCMA 3KR5A 4GXHA 2G0BA 1VHSA 4Y49C 2G3TA 3T8WA 1GHEA 4HPSA 4MFKA 1IICA 4RS2A 1S7LA 2IJZA 3FEEA 4CGMA 2GLFA 4U5YA 1XFOA 4CS0B 1IYKA 3CPAA 4PSWA 2YNCC 2VZZA 3BI0A 2NMTA 4KORA 4XPDC 2PJ8A 2XEJA 3E0KA 3PB8X 4KOVA 4NF1A 3WT4A 1JQGA 3FMCA 1IOIA 1XBUA 5ISVA 5EBVA 2JLMA 3C26A 1TIQA 2NYQA 2I3CA 4P4IA 4ZX8A 3VARA 4BBHA 1XRYA 4A39A 4KZTA 2R8VA 4UWJA 5H86A 4FBEA 3H5ZA 1YLEA 2ABZA 3IFEA 1Y7EA 4R3LA 4E0AA 8CPAA 4R87A 3KL9A 3UY5A 5G22A 4CGNA 5HVFA 2Q7SA 4IHMA 4CPAA 2X7BA 2ZELA 3KASA 1VHOA 1L0CA 2PJ5A 2RC4A 3BI1A 5AG7A 3N7ZA 2IL4A 5THWA 4F0XA 2B3VA 1OBRA 1TKJA 3K9UA 4IAVA 4P4DA 1RO5A 4EVYA 3D2MA 4P4FA 3GUXA 3JUWA 2ANPA 2HC9A 1ARLA 5LYIA 3G3SA 1TKFA 2K5TA 4PXDA 1KUYA 4C2ZA 4P44A 4QUSA 4OIDA 4HNWB 2ZEMA 1CBXA 2C6PA 3IWWA 3VATA 2Q51A 1Y0RA 3IU1A 4UWIA 2BCOA 2CTCA 5F47A 1B6BA 1TKHA 1LAMA 1S7FA 5LRKA 5EMIA 3FJUA 3NA6A 1J4JA 4M6HA 4CAEA 2P0WA 3WABA 1VKCA 2ZEOA 1MJ9A 5DS0A 1DE4C 3QB8A 5H84A 2Z3LA 4W9YA 4E2AA 2PR1A 1CP7A 5AG6A 3PB4X 5C88A 4QB9A 3V38A 2PJ2A 4II9A 2J8MA 4RI1A 4TWEA 2FS5A 2EBJA 4ZY0A 5JGFA 2J8NA 3MRUA 1P4NA 2PJ3A 2EVNA 3GKRA 4CRYB 4C2XA 1XMTA 2I79A 3PGPA 2CNMA 4BINA 3KKWA 4X3RA 4Q36A 1YW4A 5LYLA 1QSMA 3SJFA 2C1CA 5CBMA 4ZGYB 4PV6A 4C7HA 2GANA 4OC0A 2ZEHA 1AUGA 2ZW5A 5FVJA 1BLLE 3NE7A 3D66A 1RTQA 2AFUA 2B58A 2P6EA 2WZNA 1YMEA 4UCPA 3TX8A 3DR8A 3GB0A 3VH9A 5D29A 3KHXA 4YFJA 1Q2YA 1YREA 2XEGA 4MCQA 2Z3PA 1S60A 3FH4A 1PU9A 4JYWA 2DPTA 2OZHA 4A33A 2XEIA 1ZG7A 1A2ZA 3SHPA 5F46A 3A9LA 5JM6A 7CPAA 2PC1A 1PCAA 3ZZIA 1NE9A 2C27A 1BO4A 3CXPA 4JXRA 4JJXA 5ELYA 4UFXA 3BXMA 4MXUA 5KTCA 1YX0A 1ELMP 4JWPA 2ATRA 4JLYA 5DWMA 2KCWA 2GE3A 1I21A 3OWCA 4MCPA 1OZPA 1WK4A 1YR0A 4MCRA 4WWVA 2D4PA 3R95A 4UCNA 3V7ZA 3JTKA 4NGMA 4MY0A 4NGPA 4B5PA 1LOKA 2REFA 4ZBGA 3L2NA 4BD9A 4M6GA 3RYOA 2V8GA 3I1UA 3TO7A 2Z3OA 4JXQA 1LANA 3TCVA 1TF8A 4DUKA 2YNDA 1BPNA 2NSMA 1R3NA 2ZXVA 4C68A 2ZW6A 3KQXA 2VI7A 4NXYA 3NE8A 2ZW4A 4PK3A 5F09A 4U9ZA 4OMEA 4OKOA 2R1IA 5AG4A 3PB6X 1LRZA 4R3KA 2P6GA 3R1KA 2CTBA 4MRIA 1IY7A 2YNEA 4B5PB 3TE4A 4IUSA 4DNCA 4B10A 4OC1A 3PBBA 4HKFA 3EXNA 3S6KA 2D4OA 2PJ1A 3IEHA 1X10A 4X8IA 3IO1A 4MFQA 4KOUA 2Z11A 3SI1A 3TTHA 5GCNA 4AVCA 1Z4RA 4PXBA 4KVOE 1KUXA 4ONWA 4TNUA 3NH4A 4LUAA 4CYNA 2FL4A 2VBQA 4NJQA 2QJ8A 4XPLA 2YGWA 5K8MA 3MGDA 2PVWA 3DSBA 4P4EA 1HDQA 3F0AA 4FD4A 4P10A 4EWTA 1IU8A 1QMUA 1NMTA 2B3UA 4PPZA 1ELLP 2PJBA 2BOAA 4UIBA 4MHNA 3H8FA 3TFYA 1ZG9A 2PJ6A 1TXRA 3B3SA 1S3ZA 4R76A 5F48A 3P2HA 3S6HA 5HMNA 1LFWA 2F7VA 2ZPAA 2PRQA 3V8IA 4C2YA 1IYLA 4B12A 3WC7A 4KOTA 3NFZA 2QECA 2OOTA 3D7FA 1EE3P 1Y0YA 2VQYA 5LRGA 5AGEA 2Q04A 2FIAA 3H8EA 2F5IA 1YW6A 3SI0A 5JPHA 2Z3NA 4KVXA 5F49A 3N5FA 2DXQA 3QAHA 3IWEA 4AB7A 2AFSA 1U6MA 1Z9UA 1M4GA 4H2KA 3LD2A 4F9VA 2GLJA 3EY5A 1XF8A 3H4QA 4P45A 1Z8WA 1QQ9A 2R7HA 4KUAA 4JD6A 4KSAA 1R43A 4CYOA 2I00A 2J8RA 3NH5A 2PCUA 3F5BA 4ZI6A 2VL1A 4NGQA 2FXFA 4L8AA 3IGRA 1S5KA 4UF4A 1LCPA 2PJAA 1AMPA 2WPXA 3DNSA 2PJ9A 3FF3A 4GM5A 2QVPA 3LACA 4FD7A 5AG5A 4OIWA 5G1ZA 3PEIA 1B87A 3P2FA 2O53A 3DLJA 3PRTA 2WSAA 2EK9A 4M85A 2Z10A 4IF5A 4MFPA 4NGTA 1QSTA 4FD6A 4OAEA 3D3SA 4X5KA 3T9YA 4AG7A 2GREA 1YQEA 4P4BA 2OZGA 3CT9A 3DR6A 3EC4A 1BAVA 4OLLA 3TT2A 5CPAA 3RZAA 4YGOA 1VGYA 2FSRA 3FIXA 3D4UA 3FECA 3KQZA 4ZX9A 1IOFA 3RO0A 4AVBA 2ZW7A 3GLJA 3I3GA 3CXSA 4A95A 4MJ8A 4XNHB 4B11A 1M4DA 1CM0A 1XMBA 2AFOA 2VXKA 3FB3A 4KOWA 1H8LA 4K3NA 4PQAA 3RNZA 1SQHA 2VZYA 4QC6A 2C6CA 3KGQA 4ZY2A 3T90A 1M4IA 4FUUA 3G8WA 3PZJA 3D7HA 4KOYA 2ZEPA 3R9FA 1FY7A 2A4NA 3B8GA 4MI4A 4PSXA 3WC5A 5HXDA 1MJAA 3TO9A 2DEAA 2Q0YA 4KOXA 2CIJA 2Q4YA 4OADA 5EC4A 4OC5A 4A30A 3B3CA 4CYQA 3B3VA 1UFHA 4B6ZA 2BO9A 4K30A 1F2OA 3B35A 3IC1A 3S9LA 1F57A 4M6IA 2YNCA 4F9UA 3I9SA 1Q2CA 2AFXA 2PIZA 4Q38A 4A37A 3W91A 2O4HA 1ARMA 4MHDA 2REEA 4UFWA 3D7DA 2ARHA 5LYFA 1V0CA 2JDCA 2VEZA 1MJBA 4UEFA 3ISZA 4IK2A 5IB9A 4CAFA 3ISXA 1R57A 2PJ4A 2ZOGA 3CZXA 3DDDA 3LWUA 4NJRA 1JWQA 1I1DA 2AFZA 1AYEA 5DWNA 5LYDA 4MMOA 4Y49B 3EO4A 2J9AA 2RFHA 4GS4A 4AXVA 2HUZA 2AE6A 2FE7A 3FYNA 1F2PA 1HDUA 2IQ6A 3PP9A 2Y0MA 1NSAA 4MY3A 4NGSA 4NGNA 3IWGA 1CG2A 4O23A 4ONUA 4R9MA 2EK8A 4R6TA 3RAMA 4LQGA 2B5GA 4PK2A 1NSLA 6CPAA 2B4DA 1BOBA 4EMEA 2OZUA 1HEEA 2IMOA 1P0HA 3D68A 2EO8A 3CDXA 1Z2LA 2BSWA 2HQYA 3JVNA 1CP6A 1IGBA 4UEZA 3GY9A 1YLOA 3D7GA 1FT7A 4PXEA 2AJ6A 3NH8A 2PVVA 4QVTA 3PFOA 4MFLA 5HVHA 4R7MA 2PJCA 3HLPA 2JDDA 4UA3A 4AVAA 4MHZA 1S7NA 4CAXA 1XE4A 4DJLA 3LODA 3HUVA 4KS9A 5IV0A 1QSNA 3SJGA 4H6UA 3TC8A 1QSOA 1WWZA 2FCKA 2FIWA 1VIXA 2OH1A 1IIDA 2CNTA 1KUVA 4CGOA 3S6FA 2AFMA 1K4JA 4P4JA 2C6GA 1LAPA 2B5GB 3VWEA 3WR7A 4A2ZA 2B4DB 5K8OA 2Q7BA 4Q7AA 1Z8LA 2GIVA 4CAVA 2QIRA 4CGLA 4ZYQA 1Q2DA 1Y9WA 3EFAA 4B14A 1UWYA 5G21A 4RN7A 1GYTA 4MHPA 2RB7A 1PUAA 3SXNA 4ZY1A 3S9NA 3FVLA 4R8FA 4U9YA 4F8ZA 3TO6A 4MBUA 3W6XA 4BMHA 4CGPA 4A94A 5K8PA 5KTDA 1YVOA 4CAWA 5HH1A 1XOVA 2CXAA 1IB1E 2PSWA 3FNCA 3BHXA 1KWMA 3B7IA 3SJXA 2Z0ZA 3VWDA 4F6AA 3H8GA 5J8FA 4I49A 1XEBA 2Z3KA 4MFJA 3PBEA 2ZEGA 3PFEA 4OP4A 4QBJA 5BWAB 3TOAA 2XEFA 5HVGA 3IU2A 4P6YA 3FX6A 2PE3A 2ZEDA 3BJ7A 1Y9KA 3GYAA 2ODFA 1Z8XA 2G9DA 2GFQA 5JQ4A 3PB7X 4KLWA 3SJEA 1ON0A 4LX9A 3SXOA 2Q44A 4B5OA 2CNSA 5IB0A 4MFZA 4UEEA 2P6FA 5D8NA 3KI9A 2JBKA 2V8HA 2V8VA 2F8HA 4KVME 3SI2A 4FD5A 4ORFA 4DYOA 2EUIA 4MHYA 5J1QA 1I12A 2GU2A 1YGHA 1ZLIA 1Q7LA 3KZWA 4NCZA 2BEIA 4G1PA 4EFDA 4NSQA 4A31A 2ZENA 4H89A 2ZEEA 2Q4VA 4KUBA 4MCSA 4KOSA 4B13A 4C7IA 3D2PA 1M4LA 2JEVA 2PJ7A 1CJWA 1YK3A 2G3AA 4NEXA 2OU2A 2QMLA 3FBUA 3GIUA 2Q43A 4YU9A 5J8CA 4JZ0A 4X2TA 4L89A 3W6SA 1ZG8A 2EWBA 5E96A 3S9MA 2FVGA 3PB9X 5LRJA 4RUHA 4Z65A 3FXTA 4M3SA 5IX3A 2B4BA 2O28A 3IJ3A 1ZLHA 4PXCA 2ZEFA 1FNOA 3FRMA 4WJBA 2POKA 2H5MA 1PYTB 2JBJA 4LQ6A 2CY2A 4A38A 4KLVA 3CXQA 1S7KA 3B3WA 4UIAA 3JRUA 2AFWA 1CPXA 3LMSA 1VHEA 4J3GA 3FEDA 3CPXA 2PQ8A 2V77A 2HV2A 2DF5A 2PR8A 1CPSA 3K2KA 1RXTA 3QAYA 4HNYB 1KZFA 1Z4EA 3KR4A 3D67A 3TOBA 3K9TA 4NFRA 1TF9A 3R96A 3B2YA 3BJ8A 2R98A 2PIYA 5CNPA 4CYPA 2JEWA 1M44A 1Z8TA 5KTAA 4UFVA 2BL1A 4XNHC 5I0CA 1YSJA 4UBRA 5K8NA 1XJOA 1CX8A 3F8KA 5A28A 4OC2A 2BUEA 3QNVA 4HNXB 3B3TA 3KHZA 4OC3A 5C82A 3ZJ0A 1YVKA 3D8PA 1N71A 4FAIA 4AG9A 2PJ0A 1BPMA 1X12A 2DPSA 3BLNA 3S6GA 3R9GA 1DTDA 2Z3MA 2Q4ZA 4XPDB 4A32A 3R9EA 4YRHA 4R57A 5I4MA 5JH9A 1Z5RA 4F0YA 1M1DA 4FWUA 4CRZB 3MN8A 4YWYA 3WC6A 2CF4A 2FT0A 2WPWA 1ZO0A 5G20A 1XIXA 4NGRA 2OR4A 5A27A 4H6ZA 1Y7RA 1QSRA 2V8DA 4KSIA 3IIBA 1MK4A 2WYRA 2PDOA 4E8OA 2QYVA 3RBUA 2PRBA 4OC4A 2WUUA 4XPKA 2ZOFA 3DGVA 4KSFA 2HB6A
chains in the Genus database with same CATH topology
2OB0A 4UCMA 2G0BA 1VHSA 4Y49C 2G3TA 1GHEA 4MFKA 1IICA 4RS2A 1S7LA 4CGMA 4U5YA 4CS0B 1IYKA 4PSWA 2YNCC 2VZZA 2NMTA 4KORA 4XPDC 3E0KA 4KOVA 4NF1A 5ISVA 5EBVA 2JLMA 3C26A 1TIQA 4BBHA 4KZTA 2R8VA 4UWJA 5H86A 3H5ZA 1YLEA 4E0AA 4R3LA 4R87A 3UY5A 5G22A 4CGNA 2X7BA 1L0CA 2RC4A 5AG7A 3N7ZA 2IL4A 4F0XA 2B3VA 3K9UA 1RO5A 4EVYA 3D2MA 3JUWA 3G3SA 2K5TA 1KUYA 4C2ZA 4QUSA 4HNWB 3IU1A 4UWIA 5F47A 1B6BA 1S7FA 1J4JA 4CAEA 2P0WA 1VKCA 1MJ9A 3QB8A 5H84A 2Z3LA 4E2AA 2PR1A 5AG6A 5C88A 4QB9A 4II9A 2J8MA 4RI1A 2FS5A 2J8NA 1P4NA 2EVNA 3GKRA 4CRYB 4C2XA 1XMTA 2I79A 3PGPA 2CNMA 3KKWA 4Q36A 1QSMA 4ZGYB 4PV6A 4C7HA 2GANA 5FVJA 2ZW5A 3NE7A 2B58A 2P6EA 4UCPA 3DR8A 4YFJA 1Q2YA 1YREA 2Z3PA 1S60A 1PU9A 2DPTA 2OZHA 4A33A 3SHPA 5F46A 3A9LA 2PC1A 3ZZIA 1NE9A 2C27A 1BO4A 3CXPA 4JXRA 4JJXA 5KTCA 4UFXA 4JWPA 1YX0A 2ATRA 4JLYA 5DWMA 2KCWA 2GE3A 1I21A 3OWCA 1OZPA 1WK4A 1YR0A 2D4PA 3R95A 4UCNA 3JTKA 4MY0A 4B5PA 2REFA 4ZBGA 3RYOA 3TO7A 2Z3OA 4JXQA 3TCVA 2YNDA 2ZXVA 4C68A 2ZW6A 2VI7A 4NXYA 2ZW4A 4PK3A 4U9ZA 2R1IA 5AG4A 1LRZA 4R3KA 2P6GA 3R1KA 2YNEA 4B5PB 3TE4A 4IUSA 4DNCA 4B10A 4HKFA 3EXNA 3S6KA 2D4OA 4MFQA 4KOUA 2Z11A 3TTHA 4AVCA 5GCNA 1Z4RA 4KVOE 1KUXA 4LUAA 4CYNA 2FL4A 2VBQA 4XPLA 2YGWA 3MGDA 3DSBA 4FD4A 3F0AA 1NMTA 2B3UA 3TFYA 5F48A 1S3ZA 3P2HA 3S6HA 5HMNA 2ZPAA 4C2YA 3V8IA 1IYLA 4B12A 4KOTA 2QECA 2VQYA 5AGEA 2Q04A 2FIAA 2F5IA 5JPHA 2Z3NA 4KVXA 5F49A 2DXQA 3QAHA 3IWEA 4AB7A 1U6MA 1Z9UA 1M4GA 3LD2A 3EY5A 1XF8A 3H4QA 2R7HA 4KUAA 4JD6A 4KSAA 4CYOA 2I00A 2J8RA 3F5BA 2FXFA 4L8AA 3IGRA 1S5KA 2WPXA 3DNSA 4FD7A 5AG5A 5G1ZA 1B87A 3P2FA 2WSAA 4M85A 4IF5A 2Z10A 4MFPA 4X5KA 4FD6A 1QSTA 4OAEA 3D3SA 3T9YA 4AG7A 2OZGA 3DR6A 3EC4A 4OLLA 3TT2A 4YGOA 2FSRA 3FIXA 4AVBA 2ZW7A 3I3GA 3CXSA 4A95A 4MJ8A 4XNHB 4B11A 1M4DA 1CM0A 2VXKA 3FB3A 4KOWA 1SQHA 2VZYA 4QC6A 3T90A 1M4IA 3G8WA 3PZJA 4KOYA 3R9FA 1FY7A 2A4NA 3B8GA 4MI4A 4PSXA 1MJAA 3TO9A 2Q0YA 4KOXA 4OADA 2Q4YA 5EC4A 4A30A 4CYQA 1UFHA 4K30A 2YNCA 3I9SA 1Q2CA 4Q38A 3W91A 4UFWA 4MHDA 2REEA 2ARHA 1V0CA 2JDCA 2VEZA 1MJBA 4CAFA 1R57A 3DDDA 1I1DA 5DWNA 4Y49B 3EO4A 4GS4A 2HUZA 2AE6A 2FE7A 3FYNA 3PP9A 2Y0MA 4MY3A 4ONUA 3IWGA 4R9MA 2B5GA 4PK2A 1NSLA 2B4DA 1BOBA 2OZUA 1P0HA 2BSWA 2HQYA 3JVNA 3GY9A 2AJ6A 4QVTA 4MFLA 2JDDA 4UA3A 4AVAA 1S7NA 4CAXA 1XE4A 5IV0A 3LODA 4KS9A 1QSNA 4H6UA 1QSOA 1WWZA 2FCKA 2FIWA 2OH1A 1IIDA 2CNTA 1KUVA 4CGOA 3S6FA 1K4JA 2B5GB 3VWEA 3WR7A 4A2ZA 2B4DB 2Q7BA 2GIVA 4CAVA 2QIRA 4CGLA 1Q2DA 1Y9WA 3EFAA 4B14A 5G21A 3SXNA 1PUAA 4U9YA 3TO6A 4MBUA 3W6XA 4BMHA 4CGPA 5KTDA 1YVOA 4CAWA 5HH1A 2CXAA 1IB1E 2PSWA 3FNCA 2Z0ZA 3VWDA 4F6AA 5J8FA 4I49A 1XEBA 2Z3KA 4MFJA 4QBJA 5BWAB 3TOAA 3IU2A 3BJ7A 3GYAA 1Y9KA 5JQ4A 4KLWA 1ON0A 4LX9A 3SXOA 2Q44A 4B5OA 2CNSA 5IB0A 4MFZA 2P6FA 4KVME 4FD5A 4ORFA 2EUIA 1I12A 4NCZA 1YGHA 2BEIA 4NSQA 4A31A 4H89A 2Q4VA 4KUBA 4KOSA 4B13A 4C7IA 3D2PA 2JEVA 1CJWA 1YK3A 2G3AA 4NEXA 2OU2A 2QMLA 3FBUA 5J8CA 4L89A 3W6SA 5E96A 3FXTA 4M3SA 5IX3A 2B4BA 2O28A 3FRMA 2H5MA 2CY2A 4KLVA 3CXQA 1S7KA 4J3GA 2PQ8A 2HV2A 2PR8A 1RXTA 4HNYB 1KZFA 1Z4EA 3TOBA 3R96A 3BJ8A 2R98A 5CNPA 4CYPA 1M44A 5KTAA 4UFVA 2BL1A 4XNHC 5I0CA 4UBRA 3F8KA 5A28A 2BUEA 4HNXB 5C82A 3ZJ0A 1YVKA 3D8PA 1N71A 4AG9A 2DPSA 3BLNA 3S6GA 3R9GA 2Z3MA 4XPDB 4A32A 3R9EA 4YRHA 4R57A 4F0YA 1M1DA 4CRZB 2FT0A 2WPWA 1ZO0A 5G20A 1XIXA 5A27A 4H6ZA 1Y7RA 1QSRA 1MK4A 2PDOA 4E8OA 2PRBA 2WUUA 4XPKA 4KSFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4C7I A;  4B10 A;  4UCM A;  3JTK A;  4A2Z A;  4UCP A;  5G22 A;  4CAE A;  4CGN A;  2YNC A;  4CYO A;  4A95 A;  3IU2 A;  4A32 A;  4UFW A;  4B11 A;  5AG7 A;  4C2Y A;  4CGM A;  4CGL A;  5AG6 A;  4B12 A;  4B13 A;  4B14 A;  2YNC C;  5G21 A;  4A33 A;  4CAF A;  4CYN A;  2YND A;  4CYP A;  5AGE A;  5AG5 A;  4C68 A;  4UFV A;  5G20 A;  5G1Z A;  4CGP A;  4UFX A;  5A28 A;  4C2Z A;  3IWE A;  2WSA A;  5A27 A;  4C2X A;  4CYQ A;  4BBH A;  5AG4 A;  3IU1 A;  4A31 A;  4A30 A;  2WUU A;  4C7H A;  2YNE A;  3H5Z A;  4CGO A;  4UCN A; 
#chains in the Genus database with same CATH topology
 2OB0 A;  4UCM A;  3KR5 A;  4GXH A;  2G0B A;  1VHS A;  4Y49 C;  2G3T A;  3T8W A;  1GHE A;  4HPS A;  4MFK A;  1IIC A;  4RS2 A;  1S7L A;  2IJZ A;  3FEE A;  4CGM A;  2GLF A;  4U5Y A;  1XFO A;  4CS0 B;  1IYK A;  3CPA A;  4PSW A;  2YNC C;  2VZZ A;  3BI0 A;  2NMT A;  4KOR A;  4XPD C;  2PJ8 A;  2XEJ A;  3E0K A;  3PB8 X;  4KOV A;  4NF1 A;  3WT4 A;  1JQG A;  3FMC A;  1IOI A;  1XBU A;  5ISV A;  5EBV A;  2JLM A;  3C26 A;  1TIQ A;  2NYQ A;  2I3C A;  4P4I A;  4ZX8 A;  3VAR A;  4BBH A;  1XRY A;  4A39 A;  4KZT A;  2R8V A;  4UWJ A;  5H86 A;  4FBE A;  3H5Z A;  1YLE A;  2ABZ A;  3IFE A;  1Y7E A;  4R3L A;  4E0A A;  8CPA A;  4R87 A;  3KL9 A;  3UY5 A;  5G22 A;  4CGN A;  5HVF A;  2Q7S A;  4IHM A;  4CPA A;  2X7B A;  2ZEL A;  3KAS A;  1VHO A;  1L0C A;  2PJ5 A;  2RC4 A;  3BI1 A;  5AG7 A;  3N7Z A;  2IL4 A;  5THW A;  4F0X A;  2B3V A;  1OBR A;  1TKJ A;  3K9U A;  4IAV A;  4P4D A;  1RO5 A;  4EVY A;  3D2M A;  4P4F A;  3GUX A;  3JUW A;  2ANP A;  2HC9 A;  1ARL A;  5LYI A;  3G3S A;  1TKF A;  2K5T A;  4PXD A;  1KUY A;  4C2Z A;  4P44 A;  4QUS A;  4OID A;  4HNW B;  2ZEM A;  1CBX A;  2C6P A;  3IWW A;  3VAT A;  2Q51 A;  1Y0R A;  3IU1 A;  4UWI A;  2BCO A;  2CTC A;  5F47 A;  1B6B A;  1TKH A;  1LAM A;  1S7F A;  5LRK A;  5EMI A;  3FJU A;  3NA6 A;  1J4J A;  4M6H A;  4CAE A;  2P0W A;  3WAB A;  1VKC A;  2ZEO A;  1MJ9 A;  5DS0 A;  1DE4 C;  3QB8 A;  5H84 A;  2Z3L A;  4W9Y A;  4E2A A;  2PR1 A;  1CP7 A;  5AG6 A;  3PB4 X;  5C88 A;  4QB9 A;  3V38 A;  2PJ2 A;  4II9 A;  2J8M A;  4RI1 A;  4TWE A;  2FS5 A;  2EBJ A;  4ZY0 A;  5JGF A;  2J8N A;  3MRU A;  1P4N A;  2PJ3 A;  2EVN A;  3GKR A;  4CRY B;  4C2X A;  1XMT A;  2I79 A;  3PGP A;  2CNM A;  4BIN A;  3KKW A;  4X3R A;  4Q36 A;  1YW4 A;  5LYL A;  1QSM A;  3SJF A;  2C1C A;  5CBM A;  4ZGY B;  4PV6 A;  4C7H A;  2GAN A;  4OC0 A;  2ZEH A;  1AUG A;  2ZW5 A;  5FVJ A;  1BLL E;  3NE7 A;  3D66 A;  1RTQ A;  2AFU A;  2B58 A;  2P6E A;  2WZN A;  1YME A;  4UCP A;  3TX8 A;  3DR8 A;  3GB0 A;  3VH9 A;  5D29 A;  3KHX A;  4YFJ A;  1Q2Y A;  1YRE A;  2XEG A;  4MCQ A;  2Z3P A;  1S60 A;  3FH4 A;  1PU9 A;  4JYW A;  2DPT A;  2OZH A;  4A33 A;  2XEI A;  1ZG7 A;  1A2Z A;  3SHP A;  5F46 A;  3A9L A;  5JM6 A;  7CPA A;  2PC1 A;  1PCA A;  3ZZI A;  1NE9 A;  2C27 A;  1BO4 A;  3CXP A;  4JXR A;  4JJX A;  5ELY A;  4UFX A;  3BXM A;  4MXU A;  5KTC A;  1YX0 A;  1ELM P;  4JWP A;  2ATR A;  4JLY A;  5DWM A;  2KCW A;  2GE3 A;  1I21 A;  3OWC A;  4MCP A;  1OZP A;  1WK4 A;  1YR0 A;  4MCR A;  4WWV A;  2D4P A;  3R95 A;  4UCN A;  3V7Z A;  3JTK A;  4NGM A;  4MY0 A;  4NGP A;  4B5P A;  1LOK A;  2REF A;  4ZBG A;  3L2N A;  4BD9 A;  4M6G A;  3RYO A;  2V8G A;  3I1U A;  3TO7 A;  2Z3O A;  4JXQ A;  1LAN A;  3TCV A;  1TF8 A;  4DUK A;  2YND A;  1BPN A;  2NSM A;  1R3N A;  2ZXV A;  4C68 A;  2ZW6 A;  3KQX A;  2VI7 A;  4NXY A;  3NE8 A;  2ZW4 A;  4PK3 A;  5F09 A;  4U9Z A;  4OME A;  4OKO A;  2R1I A;  5AG4 A;  3PB6 X;  1LRZ A;  4R3K A;  2P6G A;  3R1K A;  2CTB A;  4MRI A;  1IY7 A;  2YNE A;  4B5P B;  3TE4 A;  4IUS A;  4DNC A;  4B10 A;  4OC1 A;  3PBB A;  4HKF A;  3EXN A;  3S6K A;  2D4O A;  2PJ1 A;  3IEH A;  1X10 A;  4X8I A;  3IO1 A;  4MFQ A;  4KOU A;  2Z11 A;  3SI1 A;  3TTH A;  5GCN A;  4AVC A;  1Z4R A;  4PXB A;  4KVO E;  1KUX A;  4ONW A;  4TNU A;  3NH4 A;  4LUA A;  4CYN A;  2FL4 A;  2VBQ A;  4NJQ A;  2QJ8 A;  4XPL A;  2YGW A;  5K8M A;  3MGD A;  2PVW A;  3DSB A;  4P4E A;  1HDQ A;  3F0A A;  4FD4 A;  4P10 A;  4EWT A;  1IU8 A;  1QMU A;  1NMT A;  2B3U A;  4PPZ A;  1ELL P;  2PJB A;  2BOA A;  4UIB A;  4MHN A;  3H8F A;  3TFY A;  1ZG9 A;  2PJ6 A;  1TXR A;  3B3S A;  1S3Z A;  4R76 A;  5F48 A;  3P2H A;  3S6H A;  5HMN A;  1LFW A;  2F7V A;  2ZPA A;  2PRQ A;  3V8I A;  4C2Y A;  1IYL A;  4B12 A;  3WC7 A;  4KOT A;  3NFZ A;  2QEC A;  2OOT A;  3D7F A;  1EE3 P;  1Y0Y A;  2VQY A;  5LRG A;  5AGE A;  2Q04 A;  2FIA A;  3H8E A;  2F5I A;  1YW6 A;  3SI0 A;  5JPH A;  2Z3N A;  4KVX A;  5F49 A;  3N5F A;  2DXQ A;  3QAH A;  3IWE A;  4AB7 A;  2AFS A;  1U6M A;  1Z9U A;  1M4G A;  4H2K A;  3LD2 A;  4F9V A;  2GLJ A;  3EY5 A;  1XF8 A;  3H4Q A;  4P45 A;  1Z8W A;  1QQ9 A;  2R7H A;  4KUA A;  4JD6 A;  4KSA A;  1R43 A;  4CYO A;  2I00 A;  2J8R A;  3NH5 A;  2PCU A;  3F5B A;  4ZI6 A;  2VL1 A;  4NGQ A;  2FXF A;  4L8A A;  3IGR A;  1S5K A;  4UF4 A;  1LCP A;  2PJA A;  1AMP A;  2WPX A;  3DNS A;  2PJ9 A;  3FF3 A;  4GM5 A;  2QVP A;  3LAC A;  4FD7 A;  5AG5 A;  4OIW A;  5G1Z A;  3PEI A;  1B87 A;  3P2F A;  2O53 A;  3DLJ A;  3PRT A;  2WSA A;  2EK9 A;  4M85 A;  2Z10 A;  4IF5 A;  4MFP A;  4NGT A;  1QST A;  4FD6 A;  4OAE A;  3D3S A;  4X5K A;  3T9Y A;  4AG7 A;  2GRE A;  1YQE A;  4P4B A;  2OZG A;  3CT9 A;  3DR6 A;  3EC4 A;  1BAV A;  4OLL A;  3TT2 A;  5CPA A;  3RZA A;  4YGO A;  1VGY A;  2FSR A;  3FIX A;  3D4U A;  3FEC A;  3KQZ A;  4ZX9 A;  1IOF A;  3RO0 A;  4AVB A;  2ZW7 A;  3GLJ A;  3I3G A;  3CXS A;  4A95 A;  4MJ8 A;  4XNH B;  4B11 A;  1M4D A;  1CM0 A;  1XMB A;  2AFO A;  2VXK A;  3FB3 A;  4KOW A;  1H8L A;  4K3N A;  4PQA A;  3RNZ A;  1SQH A;  2VZY A;  4QC6 A;  2C6C A;  3KGQ A;  4ZY2 A;  3T90 A;  1M4I A;  4FUU A;  3G8W A;  3PZJ A;  3D7H A;  4KOY A;  2ZEP A;  3R9F A;  1FY7 A;  2A4N A;  3B8G A;  4MI4 A;  4PSX A;  3WC5 A;  5HXD A;  1MJA A;  3TO9 A;  2DEA A;  2Q0Y A;  4KOX A;  2CIJ A;  2Q4Y A;  4OAD A;  5EC4 A;  4OC5 A;  4A30 A;  3B3C A;  4CYQ A;  3B3V A;  1UFH A;  4B6Z A;  2BO9 A;  4K30 A;  1F2O A;  3B35 A;  3IC1 A;  3S9L A;  1F57 A;  4M6I A;  2YNC A;  4F9U A;  3I9S A;  1Q2C A;  2AFX A;  2PIZ A;  4Q38 A;  4A37 A;  3W91 A;  2O4H A;  1ARM A;  4MHD A;  2REE A;  4UFW A;  3D7D A;  2ARH A;  5LYF A;  1V0C A;  2JDC A;  2VEZ A;  1MJB A;  4UEF A;  3ISZ A;  4IK2 A;  5IB9 A;  4CAF A;  3ISX A;  1R57 A;  2PJ4 A;  2ZOG A;  3CZX A;  3DDD A;  3LWU A;  4NJR A;  1JWQ A;  1I1D A;  2AFZ A;  1AYE A;  5DWN A;  5LYD A;  4MMO A;  4Y49 B;  3EO4 A;  2J9A A;  2RFH A;  4GS4 A;  4AXV A;  2HUZ A;  2AE6 A;  2FE7 A;  3FYN A;  1F2P A;  1HDU A;  2IQ6 A;  3PP9 A;  2Y0M A;  1NSA A;  4MY3 A;  4NGS A;  4NGN A;  3IWG A;  1CG2 A;  4O23 A;  4ONU A;  4R9M A;  2EK8 A;  4R6T A;  3RAM A;  4LQG A;  2B5G A;  4PK2 A;  1NSL A;  6CPA A;  2B4D A;  1BOB A;  4EME A;  2OZU A;  1HEE A;  2IMO A;  1P0H A;  3D68 A;  2EO8 A;  3CDX A;  1Z2L A;  2BSW A;  2HQY A;  3JVN A;  1CP6 A;  1IGB A;  4UEZ A;  3GY9 A;  1YLO A;  3D7G A;  1FT7 A;  4PXE A;  2AJ6 A;  3NH8 A;  2PVV A;  4QVT A;  3PFO A;  4MFL A;  5HVH A;  4R7M A;  2PJC A;  3HLP A;  2JDD A;  4UA3 A;  4AVA A;  4MHZ A;  1S7N A;  4CAX A;  1XE4 A;  4DJL A;  3LOD A;  3HUV A;  4KS9 A;  5IV0 A;  1QSN A;  3SJG A;  4H6U A;  3TC8 A;  1QSO A;  1WWZ A;  2FCK A;  2FIW A;  1VIX A;  2OH1 A;  1IID A;  2CNT A;  1KUV A;  4CGO A;  3S6F A;  2AFM A;  1K4J A;  4P4J A;  2C6G A;  1LAP A;  2B5G B;  3VWE A;  3WR7 A;  4A2Z A;  2B4D B;  5K8O A;  2Q7B A;  4Q7A A;  1Z8L A;  2GIV A;  4CAV A;  2QIR A;  4CGL A;  4ZYQ A;  1Q2D A;  1Y9W A;  3EFA A;  4B14 A;  1UWY A;  5G21 A;  4RN7 A;  1GYT A;  4MHP A;  2RB7 A;  1PUA A;  3SXN A;  4ZY1 A;  3S9N A;  3FVL A;  4R8F A;  4U9Y A;  4F8Z A;  3TO6 A;  4MBU A;  3W6X A;  4BMH A;  4CGP A;  4A94 A;  5K8P A;  5KTD A;  1YVO A;  4CAW A;  5HH1 A;  1XOV A;  2CXA A;  1IB1 E;  2PSW A;  3FNC A;  3BHX A;  1KWM A;  3B7I A;  3SJX A;  2Z0Z A;  3VWD A;  4F6A A;  3H8G A;  5J8F A;  4I49 A;  1XEB A;  2Z3K A;  4MFJ A;  3PBE A;  2ZEG A;  3PFE A;  4OP4 A;  4QBJ A;  5BWA B;  3TOA A;  2XEF A;  5HVG A;  3IU2 A;  4P6Y A;  3FX6 A;  2PE3 A;  2ZED A;  3BJ7 A;  1Y9K A;  3GYA A;  2ODF A;  1Z8X A;  2G9D A;  2GFQ A;  5JQ4 A;  3PB7 X;  4KLW A;  3SJE A;  1ON0 A;  4LX9 A;  3SXO A;  2Q44 A;  4B5O A;  2CNS A;  5IB0 A;  4MFZ A;  4UEE A;  2P6F A;  5D8N A;  3KI9 A;  2JBK A;  2V8H A;  2V8V A;  2F8H A;  4KVM E;  3SI2 A;  4FD5 A;  4ORF A;  4DYO A;  2EUI A;  4MHY A;  5J1Q A;  1I12 A;  2GU2 A;  1YGH A;  1ZLI A;  1Q7L A;  3KZW A;  4NCZ A;  2BEI A;  4G1P A;  4EFD A;  4NSQ A;  4A31 A;  2ZEN A;  4H89 A;  2ZEE A;  2Q4V A;  4KUB A;  4MCS A;  4KOS A;  4B13 A;  4C7I A;  3D2P A;  1M4L A;  2JEV A;  2PJ7 A;  1CJW A;  1YK3 A;  2G3A A;  4NEX A;  2OU2 A;  2QML A;  3FBU A;  3GIU A;  2Q43 A;  4YU9 A;  5J8C A;  4JZ0 A;  4X2T A;  4L89 A;  3W6S A;  1ZG8 A;  2EWB A;  5E96 A;  3S9M A;  2FVG A;  3PB9 X;  5LRJ A;  4RUH A;  4Z65 A;  3FXT A;  4M3S A;  5IX3 A;  2B4B A;  2O28 A;  3IJ3 A;  1ZLH A;  4PXC A;  2ZEF A;  1FNO A;  3FRM A;  4WJB A;  2POK A;  2H5M A;  1PYT B;  2JBJ A;  4LQ6 A;  2CY2 A;  4A38 A;  4KLV A;  3CXQ A;  1S7K A;  3B3W A;  4UIA A;  3JRU A;  2AFW A;  1CPX A;  3LMS A;  1VHE A;  4J3G A;  3FED A;  3CPX A;  2PQ8 A;  2V77 A;  2HV2 A;  2DF5 A;  2PR8 A;  1CPS A;  3K2K A;  1RXT A;  3QAY A;  4HNY B;  1KZF A;  1Z4E A;  3KR4 A;  3D67 A;  3TOB A;  3K9T A;  4NFR A;  1TF9 A;  3R96 A;  3B2Y A;  3BJ8 A;  2R98 A;  2PIY A;  5CNP A;  4CYP A;  2JEW A;  1M44 A;  1Z8T A;  5KTA A;  4UFV A;  2BL1 A;  4XNH C;  5I0C A;  1YSJ A;  4UBR A;  5K8N A;  1XJO A;  1CX8 A;  3F8K A;  5A28 A;  4OC2 A;  2BUE A;  3QNV A;  4HNX B;  3B3T A;  3KHZ A;  4OC3 A;  5C82 A;  3ZJ0 A;  1YVK A;  3D8P A;  1N71 A;  4FAI A;  4AG9 A;  2PJ0 A;  1BPM A;  1X12 A;  2DPS A;  3BLN A;  3S6G A;  3R9G A;  1DTD A;  2Z3M A;  2Q4Z A;  4XPD B;  4A32 A;  3R9E A;  4YRH A;  4R57 A;  5I4M A;  5JH9 A;  1Z5R A;  4F0Y A;  1M1D A;  4FWU A;  4CRZ B;  3MN8 A;  4YWY A;  3WC6 A;  2CF4 A;  2FT0 A;  2WPW A;  1ZO0 A;  5G20 A;  1XIX A;  4NGR A;  2OR4 A;  5A27 A;  4H6Z A;  1Y7R A;  1QSR A;  2V8D A;  4KSI A;  3IIB A;  1MK4 A;  2WYR A;  2PDO A;  4E8O A;  2QYV A;  3RBU A;  2PRB A;  4OC4 A;  2WUU A;  4XPK A;  2ZOF A;  3DGV A;  4KSF A;  2HB6 A; 
#chains in the Genus database with same CATH homology
 2OB0 A;  4UCM A;  2G0B A;  1VHS A;  4Y49 C;  2G3T A;  1GHE A;  4MFK A;  1IIC A;  4RS2 A;  1S7L A;  4CGM A;  4U5Y A;  4CS0 B;  1IYK A;  4PSW A;  2YNC C;  2VZZ A;  2NMT A;  4KOR A;  4XPD C;  3E0K A;  4KOV A;  4NF1 A;  5ISV A;  5EBV A;  2JLM A;  3C26 A;  1TIQ A;  4BBH A;  4KZT A;  2R8V A;  4UWJ A;  5H86 A;  3H5Z A;  1YLE A;  4E0A A;  4R3L A;  4R87 A;  3UY5 A;  5G22 A;  4CGN A;  2X7B A;  1L0C A;  2RC4 A;  5AG7 A;  3N7Z A;  2IL4 A;  4F0X A;  2B3V A;  3K9U A;  1RO5 A;  4EVY A;  3D2M A;  3JUW A;  3G3S A;  2K5T A;  1KUY A;  4C2Z A;  4QUS A;  4HNW B;  3IU1 A;  4UWI A;  5F47 A;  1B6B A;  1S7F A;  1J4J A;  4CAE A;  2P0W A;  1VKC A;  1MJ9 A;  3QB8 A;  5H84 A;  2Z3L A;  4E2A A;  2PR1 A;  5AG6 A;  5C88 A;  4QB9 A;  4II9 A;  2J8M A;  4RI1 A;  2FS5 A;  2J8N A;  1P4N A;  2EVN A;  3GKR A;  4CRY B;  4C2X A;  1XMT A;  2I79 A;  3PGP A;  2CNM A;  3KKW A;  4Q36 A;  1QSM A;  4ZGY B;  4PV6 A;  4C7H A;  2GAN A;  5FVJ A;  2ZW5 A;  3NE7 A;  2B58 A;  2P6E A;  4UCP A;  3DR8 A;  4YFJ A;  1Q2Y A;  1YRE A;  2Z3P A;  1S60 A;  1PU9 A;  2DPT A;  2OZH A;  4A33 A;  3SHP A;  5F46 A;  3A9L A;  2PC1 A;  3ZZI A;  1NE9 A;  2C27 A;  1BO4 A;  3CXP A;  4JXR A;  4JJX A;  5KTC A;  4UFX A;  4JWP A;  1YX0 A;  2ATR A;  4JLY A;  5DWM A;  2KCW A;  2GE3 A;  1I21 A;  3OWC A;  1OZP A;  1WK4 A;  1YR0 A;  2D4P A;  3R95 A;  4UCN A;  3JTK A;  4MY0 A;  4B5P A;  2REF A;  4ZBG A;  3RYO A;  3TO7 A;  2Z3O A;  4JXQ A;  3TCV A;  2YND A;  2ZXV A;  4C68 A;  2ZW6 A;  2VI7 A;  4NXY A;  2ZW4 A;  4PK3 A;  4U9Z A;  2R1I A;  5AG4 A;  1LRZ A;  4R3K A;  2P6G A;  3R1K A;  2YNE A;  4B5P B;  3TE4 A;  4IUS A;  4DNC A;  4B10 A;  4HKF A;  3EXN A;  3S6K A;  2D4O A;  4MFQ A;  4KOU A;  2Z11 A;  3TTH A;  4AVC A;  5GCN A;  1Z4R A;  4KVO E;  1KUX A;  4LUA A;  4CYN A;  2FL4 A;  2VBQ A;  4XPL A;  2YGW A;  3MGD A;  3DSB A;  4FD4 A;  3F0A A;  1NMT A;  2B3U A;  3TFY A;  5F48 A;  1S3Z A;  3P2H A;  3S6H A;  5HMN A;  2ZPA A;  4C2Y A;  3V8I A;  1IYL A;  4B12 A;  4KOT A;  2QEC A;  2VQY A;  5AGE A;  2Q04 A;  2FIA A;  2F5I A;  5JPH A;  2Z3N A;  4KVX A;  5F49 A;  2DXQ A;  3QAH A;  3IWE A;  4AB7 A;  1U6M A;  1Z9U A;  1M4G A;  3LD2 A;  3EY5 A;  1XF8 A;  3H4Q A;  2R7H A;  4KUA A;  4JD6 A;  4KSA A;  4CYO A;  2I00 A;  2J8R A;  3F5B A;  2FXF A;  4L8A A;  3IGR A;  1S5K A;  2WPX A;  3DNS A;  4FD7 A;  5AG5 A;  5G1Z A;  1B87 A;  3P2F A;  2WSA A;  4M85 A;  4IF5 A;  2Z10 A;  4MFP A;  4X5K A;  4FD6 A;  1QST A;  4OAE A;  3D3S A;  3T9Y A;  4AG7 A;  2OZG A;  3DR6 A;  3EC4 A;  4OLL A;  3TT2 A;  4YGO A;  2FSR A;  3FIX A;  4AVB A;  2ZW7 A;  3I3G A;  3CXS A;  4A95 A;  4MJ8 A;  4XNH B;  4B11 A;  1M4D A;  1CM0 A;  2VXK A;  3FB3 A;  4KOW A;  1SQH A;  2VZY A;  4QC6 A;  3T90 A;  1M4I A;  3G8W A;  3PZJ A;  4KOY A;  3R9F A;  1FY7 A;  2A4N A;  3B8G A;  4MI4 A;  4PSX A;  1MJA A;  3TO9 A;  2Q0Y A;  4KOX A;  4OAD A;  2Q4Y A;  5EC4 A;  4A30 A;  4CYQ A;  1UFH A;  4K30 A;  2YNC A;  3I9S A;  1Q2C A;  4Q38 A;  3W91 A;  4UFW A;  4MHD A;  2REE A;  2ARH A;  1V0C A;  2JDC A;  2VEZ A;  1MJB A;  4CAF A;  1R57 A;  3DDD A;  1I1D A;  5DWN A;  4Y49 B;  3EO4 A;  4GS4 A;  2HUZ A;  2AE6 A;  2FE7 A;  3FYN A;  3PP9 A;  2Y0M A;  4MY3 A;  4ONU A;  3IWG A;  4R9M A;  2B5G A;  4PK2 A;  1NSL A;  2B4D A;  1BOB A;  2OZU A;  1P0H A;  2BSW A;  2HQY A;  3JVN A;  3GY9 A;  2AJ6 A;  4QVT A;  4MFL A;  2JDD A;  4UA3 A;  4AVA A;  1S7N A;  4CAX A;  1XE4 A;  5IV0 A;  3LOD A;  4KS9 A;  1QSN A;  4H6U A;  1QSO A;  1WWZ A;  2FCK A;  2FIW A;  2OH1 A;  1IID A;  2CNT A;  1KUV A;  4CGO A;  3S6F A;  1K4J A;  2B5G B;  3VWE A;  3WR7 A;  4A2Z A;  2B4D B;  2Q7B A;  2GIV A;  4CAV A;  2QIR A;  4CGL A;  1Q2D A;  1Y9W A;  3EFA A;  4B14 A;  5G21 A;  3SXN A;  1PUA A;  4U9Y A;  3TO6 A;  4MBU A;  3W6X A;  4BMH A;  4CGP A;  5KTD A;  1YVO A;  4CAW A;  5HH1 A;  2CXA A;  1IB1 E;  2PSW A;  3FNC A;  2Z0Z A;  3VWD A;  4F6A A;  5J8F A;  4I49 A;  1XEB A;  2Z3K A;  4MFJ A;  4QBJ A;  5BWA B;  3TOA A;  3IU2 A;  3BJ7 A;  3GYA A;  1Y9K A;  5JQ4 A;  4KLW A;  1ON0 A;  4LX9 A;  3SXO A;  2Q44 A;  4B5O A;  2CNS A;  5IB0 A;  4MFZ A;  2P6F A;  4KVM E;  4FD5 A;  4ORF A;  2EUI A;  1I12 A;  4NCZ A;  1YGH A;  2BEI A;  4NSQ A;  4A31 A;  4H89 A;  2Q4V A;  4KUB A;  4KOS A;  4B13 A;  4C7I A;  3D2P A;  2JEV A;  1CJW A;  1YK3 A;  2G3A A;  4NEX A;  2OU2 A;  2QML A;  3FBU A;  5J8C A;  4L89 A;  3W6S A;  5E96 A;  3FXT A;  4M3S A;  5IX3 A;  2B4B A;  2O28 A;  3FRM A;  2H5M A;  2CY2 A;  4KLV A;  3CXQ A;  1S7K A;  4J3G A;  2PQ8 A;  2HV2 A;  2PR8 A;  1RXT A;  4HNY B;  1KZF A;  1Z4E A;  3TOB A;  3R96 A;  3BJ8 A;  2R98 A;  5CNP A;  4CYP A;  1M44 A;  5KTA A;  4UFV A;  2BL1 A;  4XNH C;  5I0C A;  4UBR A;  3F8K A;  5A28 A;  2BUE A;  4HNX B;  5C82 A;  3ZJ0 A;  1YVK A;  3D8P A;  1N71 A;  4AG9 A;  2DPS A;  3BLN A;  3S6G A;  3R9G A;  2Z3M A;  4XPD B;  4A32 A;  3R9E A;  4YRH A;  4R57 A;  4F0Y A;  1M1D A;  4CRZ B;  2FT0 A;  2WPW A;  1ZO0 A;  5G20 A;  1XIX A;  5A27 A;  4H6Z A;  1Y7R A;  1QSR A;  1MK4 A;  2PDO A;  4E8O A;  2PRB A;  2WUU A;  4XPK A;  4KSF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...