2WSAA

Crystal structure of leishmania major n-myristoyltransferase (nmt) with bound myristoyl-coa and a pyrazole sulphonamide ligand (ddd85646)
Total Genus 124
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
124
sequence length
411
structure length
411
Chain Sequence
AHAFWSTQPVPQTEDEDEKIVFAGPMDEPKTVADIPEEPYPIASTFEWWTPNMEAADDIHAIYELLRDNYVEDDDSMFRFNYSEEFLQWALCPPNYIPDWHVAVRRKADKKLLAFIAGVPVTLRMGTPKYMKVKAQEKGEGEEAAKYDEPRHICEINFLCVHKQLREKRLAPILIKEATRRVNRTNVWQAVYTAGVLLPTPYASGQYFHRSLNPEKLVEIRFSGIPAQYQKFQNPMAMLKRNYQLPSAPKNSGLREMKPSDVPQVRRILMNYLDSFDVGPVFSDAEISHYLLPRDGVVFTYVVENDKKVTDFFSFYRIPSTVIGNSNYNLLNAAYVHYYAATSIPLHQLILDLLIVAHSRGFDVCNMVEILDNRSFVEQLKFGAGDGHLRYYFYNWAYPKIKPSQVALVML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords GLYCYLPEPTIDE N-TETRADECANOYLTRANSFERASE
publication title N-Myristoyltransferase Inhibitors as New Leads to Treat Sleeping Sickness.
pubmed doi rcsb
source organism Leishmania major
total genus 124
structure length 411
sequence length 411
ec nomenclature ec 2.3.1.97: Glycylpeptide N-tetradecanoyltransferase.
pdb deposition date 2009-09-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01233 NMT Myristoyl-CoA:protein N-myristoyltransferase, N-terminal domain
A PF02799 NMT_C Myristoyl-CoA:protein N-myristoyltransferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.170 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 2wsaA00
3JTKA 4A95A 4CGMA 4CGNA 4UFWA 2YNCC 4A31A 5AG7A 5G21A 4CAEA 4CGOA 4UCPA 4C2XA 5G20A 4CYNA 4UFVA 4UCNA 4CYQA 2YNDA 5G1ZA 4B13A 4A33A 4CAFA 4C7HA 5A27A 5G22A 4A30A 5AGEA 4C7IA 5AG5A 4UCMA 4A2ZA 3IU2A 2YNEA 4B10A 2YNCA 4B14A 4CYOA 3H5ZA 4C2ZA 3IWEA 2WSAA 5A28A 4A32A 5AG6A 4UFXA 5AG4A 2WUUA 4B12A 3IU1A 4CGPA 4C2YA 4B11A 4BBHA 4CGLA 4CYPA 4C68A
chains in the Genus database with same CATH superfamily
4K3NA 3KQZA 3P2FA 2GU2A 4P4IA 4HNXB 1SQHA 4R76A 1F2OA 4M6IA 5LRJA 3TOBA 1Y0YA 4KOSA 4JZ0A 4OC1A 3NA6A 4UIAA 3FH4A 2XEJA 2PJ9A 4MCRA 2PVVA 4MFZA 1M1DA 4OKOA 4KVOE 3R96A 2ARHA 2AE6A 1M4LA 4U9ZA 2VI7A 2R7HA 3UY5A 4EVYA 2Z3LA 1CP6A 4A2ZA 4BD9A 2HQYA 3TX8A 4NGSA 2CF4A 4KLWA 5JGFA 3FEDA 2QMLA 2XEGA 3KHZA 1S7LA 1Z4RA 3BJ7A 4WWVA 4DJLA 4F0XA 5HXDA 2BOAA 1CBXA 2NSMA 3WC6A 3B7IA 1R43A 4KOVA 3K2KA 4QBJA 4FAIA 3D68A 3W6XA 1A2ZA 4BBHA 2Q44A 1Z8XA 3S6KA 2YNCC 2QVPA 4JXRA 4M3SA 2FL4A 2PR8A 3B3WA 3PB9X 2R1IA 4II9A 5JM6A 3IEHA 3KGQA 1ZG7A 2R98A 1M4GA 2PIZA 3BXMA 3NFZA 5F46A 4LUAA 4A30A 5K8OA 4UA3A 2J8NA 1ZG8A 2PCUA 4XPLA 1VGYA 4B14A 1L0CA 2EVNA 2HV2A 3DR6A 4FD5A 2EWBA 3PB6X 3IIBA 1B6BA 5D29A 2ZEMA 4F8ZA 4B12A 1IU8A 2BCOA 5IX3A 3QAHA 2AJ6A 4MFJA 5JQ4A 4L89A 1M44A 1YW6A 3PB4X 5HVHA 3C26A 1IIDA 1U6MA 1XOVA 4DNCA 2C1CA 3FXTA 3F5BA 2B58A 2EK9A 1LFWA 1TKJA 3T90A 3JUWA 3R9EA 4R3LA 4CYNA 3TT2A 3NE7A 4P4DA 1R3NA 1Y7RA 4R3KA 4UFVA 3I3GA 2GLJA 4ZX9A 3VATA 5KTCA 2Q43A 2GLFA 2HUZA 4CAFA 4CRZB 5A27A 4KSFA 3H8GA 2F8HA 3KHXA 3SJFA 2DPSA 2R8VA 4G1PA 3SJXA 4ZY2A 2VBQA 3CDXA 3GYAA 4MY0A 3S6GA 4OC0A 1GYTA 2J8RA 4CAVA 3GKRA 4KOXA 4KOUA 2PR1A 4PK2A 5H86A 2C6PA 4OIWA 4ONWA 1PYTB 3FF3A 4Z65A 2EK8A 4C68A 1OBRA 5IV0A 1YX0A 2PE3A 2ZENA 4UFWA 4AB7A 5EMIA 5G21A 3W6SA 5FVJA 2P6FA 2EO8A 2OZGA 3K9TA 4ZY1A 4M6HA 4KSIA 3P2HA 3S9NA 4UCMA 2PC1A 1Q7LA 1IYLA 3A9LA 2Q51A 1MJ9A 3VH9A 4B10A 2OU2A 3LACA 2AFOA 3JRUA 1S5KA 2Q4YA 4XNHB 4C2ZA 1QMUA 2GE3A 2C27A 2AFZA 1YMEA 3EXNA 3FNCA 3KR5A 3R1KA 3TO7A 4A32A 1YLOA 3PRTA 4LQGA 1S7FA 2FCKA 3QAYA 5K8PA 2PJCA 4NF1A 4CGLA 1XRYA 2C6CA 3LWUA 3RO0A 2PJBA 3N7ZA 5H84A 4MFPA 3H4QA 1XMTA 4EWTA 1M4IA 2DPTA 4UWJA 1XE4A 1FY7A 1PCAA 2ZW7A 3T8WA 2Z10A 4NEXA 5F48A 1JQGA 2HC9A 1KZFA 2OOTA 2RB7A 4ZY0A 2BO9A 3DLJA 4KORA 2B3VA 2BEIA 3TC8A 3B3CA 1CX8A 3L2NA 3B35A 5EC4A 3S9LA 1XF8A 1VIXA 2B3UA 3IU2A 2I00A 1YSJA 4NGTA 3CXSA 4UIBA 3IJ3A 3S9MA 3GIUA 4RI1A 1S3ZA 2GREA 4ZBGA 2PJ2A 3PFEA 4P4FA 2Q0YA 2V77A 2XEFA 4AVBA 4B11A 3IWWA 1F2PA 2JLMA 3FIXA 4PK3A 7CPAA 2Z3MA 4KVXA 4P4JA 2ZELA 4CGMA 3FECA 3V8IA 4XPDC 1BPNA 2Z3PA 3BLNA 3D7HA 3KL9A 4AG9A 5C82A 1ZO0A 3BHXA 4W9YA 3G8WA 4DUKA 2VEZA 2P6EA 5J1QA 1X10A 3SXOA 2EUIA 3D7GA 4X8IA 2FSRA 5C88A 3GY9A 5DWMA 4E8OA 3PBEA 1UWYA 2ABZA 1XMBA 4R7MA 4XNHC 3KI9A 1OZPA 2D4OA 5LYLA 2WPWA 1ARLA 1X12A 2FIAA 1WWZA 1Y0RA 1S7KA 1EE3P 1Y9KA 4CYPA 1AUGA 4PPZA 2AFSA 2ZOGA 1ZG9A 4AXVA 2Z3KA 1CP7A 2D4PA 5G20A 1QSMA 1J4JA 2Z11A 3V38A 1LOKA 4RN7A 2BUEA 4M6GA 4K30A 1HEEA 4LQ6A 4NGQA 4H2KA 5HVGA 1DTDA 1GHEA 2F7VA 2OH1A 5KTDA 3RZAA 1CG2A 5K8NA 2OR4A 3RYOA 5HH1A 5CPAA 1YVOA 3SHPA 4JJXA 3R95A 4OP4A 5E96A 2EBJA 2ZEHA 1ARMA 3FRMA 3IU1A 2Q7SA 4F6AA 2J8MA 2K5TA 2ZEOA 4X3RA 5IB0A 3K9UA 1IOIA 4PXEA 4B5PA 2PJ0A 3PZJA 1TXRA 1WK4A 1XEBA 4MHNA 4F0YA 3CT9A 4QVTA 2P0WA 4CGOA 2ZW5A 3PEIA 4C2XA 2PQ8A 4PXDA 3B3SA 2BL1A 4ZGYB 1TF9A 1ZLIA 3FBUA 1XJOA 5LYIA 2P6GA 4PV6A 4CYQA 1Y9WA 4Q36A 2CIJA 4LX9A 1IY7A 1TKHA 3N5FA 4TNUA 4R6TA 3D66A 2Q04A 3I1UA 4IUSA 4IF5A 4DYOA 4ONUA 3CPAA 1I12A 3D3SA 1NMTA 5EBVA 4MHZA 3D7DA 3FX6A 2PJ5A 2JBKA 3FVLA 5D8NA 4GS4A 3CPXA 2POKA 3NH8A 4PXCA 2VXKA 4I49A 2V8VA 1I1DA 2CNTA 2IMOA 3JTKA 4J3GA 4QUSA 3BI0A 2FXFA 2G0BA 4UBRA 2HB6A 2V8GA 4FD6A 3MN8A 4BMHA 3IWGA 2B4BA 3IO1A 4XPDB 2XEIA 4OMEA 1IGBA 3GLJA 2OB0A 3CXPA 3EC4A 2Q7BA 5ISVA 1KUVA 3ISXA 4UEZA 4RUHA 1Q2DA 4MI4A 5AGEA 4X5KA 3IFEA 3DNSA 5HMNA 2DXQA 1IOFA 4H6UA 4JYWA 3I9SA 3ISZA 4PSXA 2PJ3A 3KQXA 4YU9A 2WPXA 2WSAA 2ATRA 2V8HA 1MK4A 5ELYA 4UFXA 5IB9A 4RS2A 3D8PA 2A4NA 4HPSA 2VZYA 2B5GA 4NGPA 2JEWA 3CXQA 4KUBA 2AFUA 2CXAA 4JWPA 3VWEA 4FD4A 5J8FA 2PRBA 3D4UA 4B5OA 1QQ9A 3WT4A 4M85A 2ZEFA 4JLYA 2KCWA 2CY2A 4MHPA 4KS9A 2O4HA 4P45A 2CTBA 5F49A 4A94A 2PJ8A 3F8KA 4C7IA 3W91A 4FWUA 2Z0ZA 2I3CA 3V7ZA 2ZPAA 4MMOA 4NSQA 1YLEA 1F57A 1MJAA 2OZHA 4CS0B 3F0AA 2V8DA 2FS5A 4MFQA 5AG4A 5J8CA 1NSAA 1YVKA 4OC4A 2X7BA 4EMEA 4MCPA 3ZZIA 2PJAA 2J9AA 4NFRA 3PGPA 3DDDA 3PP9A 2PDOA 2ZXVA 2QECA 2FVGA 3TOAA 2YGWA 4MCQA 1KWMA 4CAEA 3FEEA 2Y0MA 5LYDA 1VKCA 3LODA 1XBUA 2H5MA 2VQYA 3KASA 4ZYQA 3FYNA 4UCNA 3LMSA 3EO4A 4TWEA 6CPAA 1CPSA 4OIDA 4MRIA 5G22A 2WZNA 3H8EA 4HKFA 2DEAA 3SI0A 4NGRA 1DE4C 1LCPA 3PBBA 3B2YA 1XIXA 2ZOFA 4ZX8A 1XFOA 1Y7EA 2O28A 1Z8LA 4KVME 1Z2LA 4F9UA 4AVCA 3FJUA 4X2TA 1HDUA 3RAMA 3RNZA 1BAVA 3ZJ0A 4GXHA 2BSWA 1IICA 2CTCA 3NH5A 3MGDA 4MHYA 2ANPA 1KUXA 1Z8TA 4ZI6A 2PIYA 2Q4ZA 4OC2A 3TO6A 4HNYB 3TTHA 4H89A 4IHMA 3PB7X 4YFJA 2JDDA 4E2AA 4WJBA 1FNOA 3SI2A 1CJWA 3LD2A 4OLLA 3TCVA 4C7HA 1CPXA 5F09A 2GANA 2VL1A 4KUAA 4PXBA 4KOYA 4P10A 4CAWA 4CYOA 3QNVA 4IK2A 1BOBA 2Z3OA 3TO9A 4B5PB 5CBMA 3DGVA 3IWEA 1LAPA 1AYEA 2RFHA 3NH4A 1YREA 2JEVA 2FT0A 2PJ1A 1Z4EA 4YRHA 1TF8A 5DWNA 2CNMA 3EFAA 4P6YA 4P4EA 2FE7A 4NGMA 4Q38A 2G3TA 2WYRA 3E0KA 4CRYB 4BINA 2QYVA 1YK3A 2ZW4A 3TFYA 1R57A 4UCPA 4MY3A 1QSNA 4Y49C 2AFMA 4PQAA 4R9MA 4B13A 3NE8A 1K4JA 2ZEPA 3PFOA 1IYKA 4OAEA 1FT7A 5AG5A 2REFA 4L8AA 4U9YA 1QSTA 1Q2YA 1RO5A 1UFHA 3H5ZA 2ODFA 4GM5A 2ZEGA 4YGOA 2FIWA 4CPAA 1P4NA 2AFXA 2OZUA 3QB8A 3GB0A 2I79A 5CNPA 4UEEA 2O53A 2F5IA 1BLLE 1PU9A 3IC1A 1PUAA 2REEA 4KZTA 3SJEA 4A39A 3DR8A 3KKWA 1NE9A 4ORFA 3T9YA 5F47A 5LRKA 4AVAA 1B87A 3JVNA 1QSOA 3MRUA 3R9GA 3WABA 4NXYA 1QSRA 4NCZA 4NJQA 1S7NA 5LRGA 2Q4VA 5KTAA 2PSWA 3SI1A 4KSAA 2PRQA 4A33A 2JBJA 3D2PA 4IAVA 4PSWA 1YW4A 2G9DA 4MFLA 3B8GA 2B4DB 4XPKA 3S6HA 2IQ6A 2B5GB 3BI1A 1LAMA 1BPMA 1V0CA 1ZLHA 3OWCA 3H8FA 4MHDA 4UEFA 5K8MA 4P4BA 4OC5A 3TE4A 2CNSA 2IL4A 2IJZA 4F9VA 2WUUA 4R57A 3BJ8A 3GUXA 2B4DA 4B6ZA 3B3VA 3VWDA 1ELLP 1Z8WA 1Z9UA 4JD6A 5BWAB 2PJ7A 4CGNA 3G3SA 3HLPA 4OADA 4A31A 5AG7A 1M4DA 2C6GA 1P0HA 1VHOA 2QJ8A 4MXUA 4O23A 4QB9A 3WC5A 3CZXA 1BO4A 1ELMP 1NSLA 4EFDA 2YNDA 3R9FA 2GFQA 4E0AA 2PJ4A 3SXNA 4A38A 4MJ8A 2ZEEA 3KR4A 4OC3A 4Q7AA 3SJGA 4R8FA 2ZEDA 5DS0A 1N71A 1H8LA 1IB1E 3IGRA 4MCSA 1LANA 2AFWA 3EY5A 1MJBA 2JDCA 5A28A 5I0CA 2RC4A 4MFKA 3WC7A 4R87A 3D7FA 1YR0A 5JPHA 1RTQA 4AG7A 4NJRA 4UWIA 3B3TA 3D2MA 4CGPA 4C2YA 3WR7A 2VZZA 4QC6A 4FBEA 4NGNA 4A95A 2QIRA 3FB3A 1S60A 3DSBA 2DF5A 2NYQA 5THWA 4HNWB 3RBUA 2PVWA 4JXQA 1CM0A 4KOWA 4UF4A 1RXTA 4MBUA 5G1ZA 3S6FA 1VHSA 5JH9A 3PB8X 2G3AA 4KLVA 4Y49B 2ZW6A 4KOTA 4FD7A 1I21A 3HUVA 4H6ZA 4YWYA 5HVFA 3VARA 1VHEA 3D67A 4CAXA 2GIVA 1TKFA 2YNEA 3KZWA 2YNCA 2NMTA 4A37A 1AMPA 2Z3NA 1JWQA 1HDQA 3FMCA 4P44A 1LRZA 1YGHA 5AG6A 1YQEA 8CPAA 5LYFA 5GCNA 4FUUA 1TIQA 1Z5RA 1Q2CA 5I4MA 1ON0A 1KUYA 4U5YA 2PJ6A
chains in the Genus database with same CATH topology
3P2FA 3TOBA 4HNXB 1SQHA 4KOSA 4MFZA 1M1DA 4KVOE 3R96A 2ARHA 2AE6A 4U9ZA 2VI7A 2R7HA 3UY5A 4EVYA 2Z3LA 4A2ZA 2HQYA 4KLWA 2QMLA 1S7LA 1Z4RA 3BJ7A 4F0XA 4KOVA 4QBJA 3W6XA 2Q44A 3S6KA 2YNCC 4M3SA 4JXRA 2FL4A 2PR8A 2R1IA 4II9A 2R98A 1M4GA 5F46A 4LUAA 4A30A 4UA3A 2J8NA 4XPLA 4B14A 1L0CA 2EVNA 2HV2A 3DR6A 4FD5A 1B6BA 4B12A 5IX3A 3QAHA 2AJ6A 4MFJA 5JQ4A 4L89A 1M44A 3C26A 1IIDA 1U6MA 4DNCA 3FXTA 3F5BA 2B58A 3T90A 3JUWA 3R9EA 4R3LA 4CYNA 3TT2A 3NE7A 4R3KA 1Y7RA 4UFVA 5KTCA 3I3GA 2HUZA 4CAFA 4CRZB 5A27A 4KSFA 2DPSA 2R8VA 2VBQA 3GYAA 4MY0A 3S6GA 4CAVA 2J8RA 3GKRA 4KOXA 4KOUA 2PR1A 4PK2A 5H86A 4C68A 5IV0A 1YX0A 4UFWA 4AB7A 5G21A 3W6SA 5FVJA 2P6FA 2OZGA 3P2HA 4UCMA 2PC1A 1IYLA 3A9LA 1MJ9A 4B10A 2OU2A 1S5KA 2Q4YA 4XNHB 4C2ZA 2GE3A 3FNCA 2C27A 3EXNA 3TO7A 3R1KA 4A32A 1S7FA 2FCKA 4NF1A 4CGLA 3N7ZA 5H84A 4MFPA 3H4QA 1XMTA 1M4IA 2DPTA 4UWJA 1XE4A 1FY7A 2ZW7A 2Z10A 4NEXA 5F48A 1KZFA 4KORA 2B3VA 2BEIA 5EC4A 1XF8A 2B3UA 3IU2A 2I00A 3CXSA 4RI1A 1S3ZA 4ZBGA 2Q0YA 4AVBA 4B11A 2JLMA 3FIXA 4PK3A 2Z3MA 4KVXA 4CGMA 3V8IA 4XPDC 2Z3PA 3BLNA 4AG9A 5C82A 1ZO0A 3G8WA 2VEZA 2P6EA 3SXOA 2EUIA 2FSRA 5C88A 3GY9A 5DWMA 4E8OA 4XNHC 1OZPA 2D4OA 2WPWA 2FIAA 1WWZA 1S7KA 1Y9KA 4CYPA 2Z3KA 2D4PA 5G20A 1QSMA 1J4JA 2Z11A 2BUEA 4K30A 1GHEA 2OH1A 5KTDA 3RYOA 5HH1A 1YVOA 3SHPA 4JJXA 3R95A 5E96A 3FRMA 3IU1A 4F6AA 2J8MA 2K5TA 5IB0A 3K9UA 4B5PA 3PZJA 1WK4A 1XEBA 4F0YA 4QVTA 2P0WA 4CGOA 2ZW5A 4C2XA 2PQ8A 4ZGYB 2BL1A 3FBUA 4CYQA 2P6GA 4PV6A 1Y9WA 4Q36A 4LX9A 2Q04A 4IUSA 4IF5A 4ONUA 1I12A 3D3SA 1NMTA 5EBVA 4GS4A 4I49A 2VXKA 3JTKA 1I1DA 2CNTA 4QUSA 4J3GA 2FXFA 2G0BA 4UBRA 4FD6A 4BMHA 3IWGA 2B4BA 4XPDB 2OB0A 3CXPA 3EC4A 2Q7BA 5ISVA 1KUVA 1Q2DA 4MI4A 5AGEA 4X5KA 3DNSA 5HMNA 2DXQA 4H6UA 3I9SA 4PSXA 2WPXA 2WSAA 2ATRA 1MK4A 4UFXA 4RS2A 3D8PA 2A4NA 2VZYA 2B5GA 4BBHA 3VWEA 3CXQA 2CXAA 4JWPA 4FD4A 5J8FA 2PRBA 4B5OA 4M85A 4JLYA 2KCWA 2CY2A 4KS9A 5F49A 3F8KA 4C7IA 3W91A 2Z0ZA 2ZPAA 4NSQA 1YLEA 1MJAA 2OZHA 4CS0B 3F0AA 2FS5A 4MFQA 5AG4A 5J8CA 1YVKA 2X7BA 3ZZIA 3PGPA 3DDDA 3PP9A 2PDOA 2ZXVA 2QECA 3TOAA 2YGWA 4CAEA 2Y0MA 1VKCA 3LODA 2H5MA 2VQYA 3FYNA 4UCNA 3EO4A 5G22A 4HKFA 1XIXA 2O28A 4KVME 4AVCA 3ZJ0A 2BSWA 1IICA 3MGDA 1KUXA 3TO6A 4HNYB 3TTHA 4H89A 4YFJA 2JDDA 4E2AA 1CJWA 3LD2A 4OLLA 3TCVA 4C7HA 2GANA 4KUAA 4KOYA 4CAWA 4CYOA 4B5PB 1BOBA 2Z3OA 3TO9A 3IWEA 1YREA 2JEVA 2FT0A 1Z4EA 4YRHA 5DWNA 3EFAA 2CNMA 2FE7A 4Q38A 2G3TA 3E0KA 4CRYB 1YK3A 2ZW4A 3TFYA 1R57A 4UCPA 4MY3A 1QSNA 4Y49C 4R9MA 4B13A 1K4JA 1IYKA 4OAEA 5AG5A 2REFA 4L8AA 4U9YA 1QSTA 1Q2YA 1RO5A 1UFHA 3H5ZA 4YGOA 2FIWA 1P4NA 2OZUA 3QB8A 5CNPA 2I79A 2F5IA 1PU9A 1PUAA 2REEA 4KZTA 3DR8A 3KKWA 1NE9A 4ORFA 3T9YA 5F47A 4AVAA 1B87A 3JVNA 1QSOA 3R9GA 4NXYA 1QSRA 4NCZA 1S7NA 2Q4VA 5KTAA 2PSWA 4KSAA 4A33A 3D2PA 4PSWA 4MFLA 3B8GA 2B4DB 4XPKA 3S6HA 2B5GB 3OWCA 1V0CA 4MHDA 3TE4A 2CNSA 2IL4A 2WUUA 4R57A 3BJ8A 2B4DA 3VWDA 1Z9UA 4JD6A 5BWAB 4CGNA 3G3SA 4OADA 4A31A 5AG7A 1M4DA 1P0HA 4QB9A 1BO4A 1NSLA 2YNDA 3R9FA 4E0AA 3SXNA 4MJ8A 1N71A 1IB1E 3IGRA 3EY5A 1MJBA 2JDCA 5A28A 5I0CA 2RC4A 4MFKA 5JPHA 4R87A 1YR0A 4AG7A 4UWIA 3D2MA 4CGPA 4C2YA 3WR7A 2VZZA 4QC6A 4A95A 2QIRA 3FB3A 1S60A 3DSBA 4HNWB 4JXQA 1CM0A 4KOWA 1RXTA 4MBUA 5G1ZA 3S6FA 1VHSA 2G3AA 4KLVA 4Y49B 2ZW6A 4KOTA 4FD7A 1I21A 4H6ZA 4CAXA 2GIVA 2YNEA 2YNCA 2NMTA 2Z3NA 5AG6A 1LRZA 1YGHA 5GCNA 1TIQA 1Q2CA 1ON0A 1KUYA 4U5YA 4KUBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3JTK A;  4A95 A;  4CGM A;  4CGN A;  4UFW A;  2YNC C;  4A31 A;  5AG7 A;  5G21 A;  4CAE A;  4CGO A;  4UCP A;  4C2X A;  5G20 A;  4CYN A;  4UFV A;  4UCN A;  4CYQ A;  2YND A;  5G1Z A;  4B13 A;  4A33 A;  4CAF A;  4C7H A;  5A27 A;  5G22 A;  4A30 A;  5AGE A;  4C7I A;  5AG5 A;  4UCM A;  4A2Z A;  3IU2 A;  2YNE A;  4B10 A;  2YNC A;  4B14 A;  4CYO A;  3H5Z A;  4C2Z A;  3IWE A;  2WSA A;  5A28 A;  4A32 A;  5AG6 A;  4UFX A;  5AG4 A;  2WUU A;  4B12 A;  3IU1 A;  4CGP A;  4C2Y A;  4B11 A;  4BBH A;  4CGL A;  4CYP A;  4C68 A; 
#chains in the Genus database with same CATH topology
 4K3N A;  3KQZ A;  3P2F A;  2GU2 A;  4P4I A;  4HNX B;  1SQH A;  4R76 A;  1F2O A;  4M6I A;  5LRJ A;  3TOB A;  1Y0Y A;  4KOS A;  4JZ0 A;  4OC1 A;  3NA6 A;  4UIA A;  3FH4 A;  2XEJ A;  2PJ9 A;  4MCR A;  2PVV A;  4MFZ A;  1M1D A;  4OKO A;  4KVO E;  3R96 A;  2ARH A;  2AE6 A;  1M4L A;  4U9Z A;  2VI7 A;  2R7H A;  3UY5 A;  4EVY A;  2Z3L A;  1CP6 A;  4A2Z A;  4BD9 A;  2HQY A;  3TX8 A;  4NGS A;  2CF4 A;  4KLW A;  5JGF A;  3FED A;  2QML A;  2XEG A;  3KHZ A;  1S7L A;  1Z4R A;  3BJ7 A;  4WWV A;  4DJL A;  4F0X A;  5HXD A;  2BOA A;  1CBX A;  2NSM A;  3WC6 A;  3B7I A;  1R43 A;  4KOV A;  3K2K A;  4QBJ A;  4FAI A;  3D68 A;  3W6X A;  1A2Z A;  4BBH A;  2Q44 A;  1Z8X A;  3S6K A;  2YNC C;  2QVP A;  4JXR A;  4M3S A;  2FL4 A;  2PR8 A;  3B3W A;  3PB9 X;  2R1I A;  4II9 A;  5JM6 A;  3IEH A;  3KGQ A;  1ZG7 A;  2R98 A;  1M4G A;  2PIZ A;  3BXM A;  3NFZ A;  5F46 A;  4LUA A;  4A30 A;  5K8O A;  4UA3 A;  2J8N A;  1ZG8 A;  2PCU A;  4XPL A;  1VGY A;  4B14 A;  1L0C A;  2EVN A;  2HV2 A;  3DR6 A;  4FD5 A;  2EWB A;  3PB6 X;  3IIB A;  1B6B A;  5D29 A;  2ZEM A;  4F8Z A;  4B12 A;  1IU8 A;  2BCO A;  5IX3 A;  3QAH A;  2AJ6 A;  4MFJ A;  5JQ4 A;  4L89 A;  1M44 A;  1YW6 A;  3PB4 X;  5HVH A;  3C26 A;  1IID A;  1U6M A;  1XOV A;  4DNC A;  2C1C A;  3FXT A;  3F5B A;  2B58 A;  2EK9 A;  1LFW A;  1TKJ A;  3T90 A;  3JUW A;  3R9E A;  4R3L A;  4CYN A;  3TT2 A;  3NE7 A;  4P4D A;  1R3N A;  1Y7R A;  4R3K A;  4UFV A;  3I3G A;  2GLJ A;  4ZX9 A;  3VAT A;  5KTC A;  2Q43 A;  2GLF A;  2HUZ A;  4CAF A;  4CRZ B;  5A27 A;  4KSF A;  3H8G A;  2F8H A;  3KHX A;  3SJF A;  2DPS A;  2R8V A;  4G1P A;  3SJX A;  4ZY2 A;  2VBQ A;  3CDX A;  3GYA A;  4MY0 A;  3S6G A;  4OC0 A;  1GYT A;  2J8R A;  4CAV A;  3GKR A;  4KOX A;  4KOU A;  2PR1 A;  4PK2 A;  5H86 A;  2C6P A;  4OIW A;  4ONW A;  1PYT B;  3FF3 A;  4Z65 A;  2EK8 A;  4C68 A;  1OBR A;  5IV0 A;  1YX0 A;  2PE3 A;  2ZEN A;  4UFW A;  4AB7 A;  5EMI A;  5G21 A;  3W6S A;  5FVJ A;  2P6F A;  2EO8 A;  2OZG A;  3K9T A;  4ZY1 A;  4M6H A;  4KSI A;  3P2H A;  3S9N A;  4UCM A;  2PC1 A;  1Q7L A;  1IYL A;  3A9L A;  2Q51 A;  1MJ9 A;  3VH9 A;  4B10 A;  2OU2 A;  3LAC A;  2AFO A;  3JRU A;  1S5K A;  2Q4Y A;  4XNH B;  4C2Z A;  1QMU A;  2GE3 A;  2C27 A;  2AFZ A;  1YME A;  3EXN A;  3FNC A;  3KR5 A;  3R1K A;  3TO7 A;  4A32 A;  1YLO A;  3PRT A;  4LQG A;  1S7F A;  2FCK A;  3QAY A;  5K8P A;  2PJC A;  4NF1 A;  4CGL A;  1XRY A;  2C6C A;  3LWU A;  3RO0 A;  2PJB A;  3N7Z A;  5H84 A;  4MFP A;  3H4Q A;  1XMT A;  4EWT A;  1M4I A;  2DPT A;  4UWJ A;  1XE4 A;  1FY7 A;  1PCA A;  2ZW7 A;  3T8W A;  2Z10 A;  4NEX A;  5F48 A;  1JQG A;  2HC9 A;  1KZF A;  2OOT A;  2RB7 A;  4ZY0 A;  2BO9 A;  3DLJ A;  4KOR A;  2B3V A;  2BEI A;  3TC8 A;  3B3C A;  1CX8 A;  3L2N A;  3B35 A;  5EC4 A;  3S9L A;  1XF8 A;  1VIX A;  2B3U A;  3IU2 A;  2I00 A;  1YSJ A;  4NGT A;  3CXS A;  4UIB A;  3IJ3 A;  3S9M A;  3GIU A;  4RI1 A;  1S3Z A;  2GRE A;  4ZBG A;  2PJ2 A;  3PFE A;  4P4F A;  2Q0Y A;  2V77 A;  2XEF A;  4AVB A;  4B11 A;  3IWW A;  1F2P A;  2JLM A;  3FIX A;  4PK3 A;  7CPA A;  2Z3M A;  4KVX A;  4P4J A;  2ZEL A;  4CGM A;  3FEC A;  3V8I A;  4XPD C;  1BPN A;  2Z3P A;  3BLN A;  3D7H A;  3KL9 A;  4AG9 A;  5C82 A;  1ZO0 A;  3BHX A;  4W9Y A;  3G8W A;  4DUK A;  2VEZ A;  2P6E A;  5J1Q A;  1X10 A;  3SXO A;  2EUI A;  3D7G A;  4X8I A;  2FSR A;  5C88 A;  3GY9 A;  5DWM A;  4E8O A;  3PBE A;  1UWY A;  2ABZ A;  1XMB A;  4R7M A;  4XNH C;  3KI9 A;  1OZP A;  2D4O A;  5LYL A;  2WPW A;  1ARL A;  1X12 A;  2FIA A;  1WWZ A;  1Y0R A;  1S7K A;  1EE3 P;  1Y9K A;  4CYP A;  1AUG A;  4PPZ A;  2AFS A;  2ZOG A;  1ZG9 A;  4AXV A;  2Z3K A;  1CP7 A;  2D4P A;  5G20 A;  1QSM A;  1J4J A;  2Z11 A;  3V38 A;  1LOK A;  4RN7 A;  2BUE A;  4M6G A;  4K30 A;  1HEE A;  4LQ6 A;  4NGQ A;  4H2K A;  5HVG A;  1DTD A;  1GHE A;  2F7V A;  2OH1 A;  5KTD A;  3RZA A;  1CG2 A;  5K8N A;  2OR4 A;  3RYO A;  5HH1 A;  5CPA A;  1YVO A;  3SHP A;  4JJX A;  3R95 A;  4OP4 A;  5E96 A;  2EBJ A;  2ZEH A;  1ARM A;  3FRM A;  3IU1 A;  2Q7S A;  4F6A A;  2J8M A;  2K5T A;  2ZEO A;  4X3R A;  5IB0 A;  3K9U A;  1IOI A;  4PXE A;  4B5P A;  2PJ0 A;  3PZJ A;  1TXR A;  1WK4 A;  1XEB A;  4MHN A;  4F0Y A;  3CT9 A;  4QVT A;  2P0W A;  4CGO A;  2ZW5 A;  3PEI A;  4C2X A;  2PQ8 A;  4PXD A;  3B3S A;  2BL1 A;  4ZGY B;  1TF9 A;  1ZLI A;  3FBU A;  1XJO A;  5LYI A;  2P6G A;  4PV6 A;  4CYQ A;  1Y9W A;  4Q36 A;  2CIJ A;  4LX9 A;  1IY7 A;  1TKH A;  3N5F A;  4TNU A;  4R6T A;  3D66 A;  2Q04 A;  3I1U A;  4IUS A;  4IF5 A;  4DYO A;  4ONU A;  3CPA A;  1I12 A;  3D3S A;  1NMT A;  5EBV A;  4MHZ A;  3D7D A;  3FX6 A;  2PJ5 A;  2JBK A;  3FVL A;  5D8N A;  4GS4 A;  3CPX A;  2POK A;  3NH8 A;  4PXC A;  2VXK A;  4I49 A;  2V8V A;  1I1D A;  2CNT A;  2IMO A;  3JTK A;  4J3G A;  4QUS A;  3BI0 A;  2FXF A;  2G0B A;  4UBR A;  2HB6 A;  2V8G A;  4FD6 A;  3MN8 A;  4BMH A;  3IWG A;  2B4B A;  3IO1 A;  4XPD B;  2XEI A;  4OME A;  1IGB A;  3GLJ A;  2OB0 A;  3CXP A;  3EC4 A;  2Q7B A;  5ISV A;  1KUV A;  3ISX A;  4UEZ A;  4RUH A;  1Q2D A;  4MI4 A;  5AGE A;  4X5K A;  3IFE A;  3DNS A;  5HMN A;  2DXQ A;  1IOF A;  4H6U A;  4JYW A;  3I9S A;  3ISZ A;  4PSX A;  2PJ3 A;  3KQX A;  4YU9 A;  2WPX A;  2WSA A;  2ATR A;  2V8H A;  1MK4 A;  5ELY A;  4UFX A;  5IB9 A;  4RS2 A;  3D8P A;  2A4N A;  4HPS A;  2VZY A;  2B5G A;  4NGP A;  2JEW A;  3CXQ A;  4KUB A;  2AFU A;  2CXA A;  4JWP A;  3VWE A;  4FD4 A;  5J8F A;  2PRB A;  3D4U A;  4B5O A;  1QQ9 A;  3WT4 A;  4M85 A;  2ZEF A;  4JLY A;  2KCW A;  2CY2 A;  4MHP A;  4KS9 A;  2O4H A;  4P45 A;  2CTB A;  5F49 A;  4A94 A;  2PJ8 A;  3F8K A;  4C7I A;  3W91 A;  4FWU A;  2Z0Z A;  2I3C A;  3V7Z A;  2ZPA A;  4MMO A;  4NSQ A;  1YLE A;  1F57 A;  1MJA A;  2OZH A;  4CS0 B;  3F0A A;  2V8D A;  2FS5 A;  4MFQ A;  5AG4 A;  5J8C A;  1NSA A;  1YVK A;  4OC4 A;  2X7B A;  4EME A;  4MCP A;  3ZZI A;  2PJA A;  2J9A A;  4NFR A;  3PGP A;  3DDD A;  3PP9 A;  2PDO A;  2ZXV A;  2QEC A;  2FVG A;  3TOA A;  2YGW A;  4MCQ A;  1KWM A;  4CAE A;  3FEE A;  2Y0M A;  5LYD A;  1VKC A;  3LOD A;  1XBU A;  2H5M A;  2VQY A;  3KAS A;  4ZYQ A;  3FYN A;  4UCN A;  3LMS A;  3EO4 A;  4TWE A;  6CPA A;  1CPS A;  4OID A;  4MRI A;  5G22 A;  2WZN A;  3H8E A;  4HKF A;  2DEA A;  3SI0 A;  4NGR A;  1DE4 C;  1LCP A;  3PBB A;  3B2Y A;  1XIX A;  2ZOF A;  4ZX8 A;  1XFO A;  1Y7E A;  2O28 A;  1Z8L A;  4KVM E;  1Z2L A;  4F9U A;  4AVC A;  3FJU A;  4X2T A;  1HDU A;  3RAM A;  3RNZ A;  1BAV A;  3ZJ0 A;  4GXH A;  2BSW A;  1IIC A;  2CTC A;  3NH5 A;  3MGD A;  4MHY A;  2ANP A;  1KUX A;  1Z8T A;  4ZI6 A;  2PIY A;  2Q4Z A;  4OC2 A;  3TO6 A;  4HNY B;  3TTH A;  4H89 A;  4IHM A;  3PB7 X;  4YFJ A;  2JDD A;  4E2A A;  4WJB A;  1FNO A;  3SI2 A;  1CJW A;  3LD2 A;  4OLL A;  3TCV A;  4C7H A;  1CPX A;  5F09 A;  2GAN A;  2VL1 A;  4KUA A;  4PXB A;  4KOY A;  4P10 A;  4CAW A;  4CYO A;  3QNV A;  4IK2 A;  1BOB A;  2Z3O A;  3TO9 A;  4B5P B;  5CBM A;  3DGV A;  3IWE A;  1LAP A;  1AYE A;  2RFH A;  3NH4 A;  1YRE A;  2JEV A;  2FT0 A;  2PJ1 A;  1Z4E A;  4YRH A;  1TF8 A;  5DWN A;  2CNM A;  3EFA A;  4P6Y A;  4P4E A;  2FE7 A;  4NGM A;  4Q38 A;  2G3T A;  2WYR A;  3E0K A;  4CRY B;  4BIN A;  2QYV A;  1YK3 A;  2ZW4 A;  3TFY A;  1R57 A;  4UCP A;  4MY3 A;  1QSN A;  4Y49 C;  2AFM A;  4PQA A;  4R9M A;  4B13 A;  3NE8 A;  1K4J A;  2ZEP A;  3PFO A;  1IYK A;  4OAE A;  1FT7 A;  5AG5 A;  2REF A;  4L8A A;  4U9Y A;  1QST A;  1Q2Y A;  1RO5 A;  1UFH A;  3H5Z A;  2ODF A;  4GM5 A;  2ZEG A;  4YGO A;  2FIW A;  4CPA A;  1P4N A;  2AFX A;  2OZU A;  3QB8 A;  3GB0 A;  2I79 A;  5CNP A;  4UEE A;  2O53 A;  2F5I A;  1BLL E;  1PU9 A;  3IC1 A;  1PUA A;  2REE A;  4KZT A;  3SJE A;  4A39 A;  3DR8 A;  3KKW A;  1NE9 A;  4ORF A;  3T9Y A;  5F47 A;  5LRK A;  4AVA A;  1B87 A;  3JVN A;  1QSO A;  3MRU A;  3R9G A;  3WAB A;  4NXY A;  1QSR A;  4NCZ A;  4NJQ A;  1S7N A;  5LRG A;  2Q4V A;  5KTA A;  2PSW A;  3SI1 A;  4KSA A;  2PRQ A;  4A33 A;  2JBJ A;  3D2P A;  4IAV A;  4PSW A;  1YW4 A;  2G9D A;  4MFL A;  3B8G A;  2B4D B;  4XPK A;  3S6H A;  2IQ6 A;  2B5G B;  3BI1 A;  1LAM A;  1BPM A;  1V0C A;  1ZLH A;  3OWC A;  3H8F A;  4MHD A;  4UEF A;  5K8M A;  4P4B A;  4OC5 A;  3TE4 A;  2CNS A;  2IL4 A;  2IJZ A;  4F9V A;  2WUU A;  4R57 A;  3BJ8 A;  3GUX A;  2B4D A;  4B6Z A;  3B3V A;  3VWD A;  1ELL P;  1Z8W A;  1Z9U A;  4JD6 A;  5BWA B;  2PJ7 A;  4CGN A;  3G3S A;  3HLP A;  4OAD A;  4A31 A;  5AG7 A;  1M4D A;  2C6G A;  1P0H A;  1VHO A;  2QJ8 A;  4MXU A;  4O23 A;  4QB9 A;  3WC5 A;  3CZX A;  1BO4 A;  1ELM P;  1NSL A;  4EFD A;  2YND A;  3R9F A;  2GFQ A;  4E0A A;  2PJ4 A;  3SXN A;  4A38 A;  4MJ8 A;  2ZEE A;  3KR4 A;  4OC3 A;  4Q7A A;  3SJG A;  4R8F A;  2ZED A;  5DS0 A;  1N71 A;  1H8L A;  1IB1 E;  3IGR A;  4MCS A;  1LAN A;  2AFW A;  3EY5 A;  1MJB A;  2JDC A;  5A28 A;  5I0C A;  2RC4 A;  4MFK A;  3WC7 A;  4R87 A;  3D7F A;  1YR0 A;  5JPH A;  1RTQ A;  4AG7 A;  4NJR A;  4UWI A;  3B3T A;  3D2M A;  4CGP A;  4C2Y A;  3WR7 A;  2VZZ A;  4QC6 A;  4FBE A;  4NGN A;  4A95 A;  2QIR A;  3FB3 A;  1S60 A;  3DSB A;  2DF5 A;  2NYQ A;  5THW A;  4HNW B;  3RBU A;  2PVW A;  4JXQ A;  1CM0 A;  4KOW A;  4UF4 A;  1RXT A;  4MBU A;  5G1Z A;  3S6F A;  1VHS A;  5JH9 A;  3PB8 X;  2G3A A;  4KLV A;  4Y49 B;  2ZW6 A;  4KOT A;  4FD7 A;  1I21 A;  3HUV A;  4H6Z A;  4YWY A;  5HVF A;  3VAR A;  1VHE A;  3D67 A;  4CAX A;  2GIV A;  1TKF A;  2YNE A;  3KZW A;  2YNC A;  2NMT A;  4A37 A;  1AMP A;  2Z3N A;  1JWQ A;  1HDQ A;  3FMC A;  4P44 A;  1LRZ A;  1YGH A;  5AG6 A;  1YQE A;  8CPA A;  5LYF A;  5GCN A;  4FUU A;  1TIQ A;  1Z5R A;  1Q2C A;  5I4M A;  1ON0 A;  1KUY A;  4U5Y A;  2PJ6 A; 
#chains in the Genus database with same CATH homology
 3P2F A;  3TOB A;  4HNX B;  1SQH A;  4KOS A;  4MFZ A;  1M1D A;  4KVO E;  3R96 A;  2ARH A;  2AE6 A;  4U9Z A;  2VI7 A;  2R7H A;  3UY5 A;  4EVY A;  2Z3L A;  4A2Z A;  2HQY A;  4KLW A;  2QML A;  1S7L A;  1Z4R A;  3BJ7 A;  4F0X A;  4KOV A;  4QBJ A;  3W6X A;  2Q44 A;  3S6K A;  2YNC C;  4M3S A;  4JXR A;  2FL4 A;  2PR8 A;  2R1I A;  4II9 A;  2R98 A;  1M4G A;  5F46 A;  4LUA A;  4A30 A;  4UA3 A;  2J8N A;  4XPL A;  4B14 A;  1L0C A;  2EVN A;  2HV2 A;  3DR6 A;  4FD5 A;  1B6B A;  4B12 A;  5IX3 A;  3QAH A;  2AJ6 A;  4MFJ A;  5JQ4 A;  4L89 A;  1M44 A;  3C26 A;  1IID A;  1U6M A;  4DNC A;  3FXT A;  3F5B A;  2B58 A;  3T90 A;  3JUW A;  3R9E A;  4R3L A;  4CYN A;  3TT2 A;  3NE7 A;  4R3K A;  1Y7R A;  4UFV A;  5KTC A;  3I3G A;  2HUZ A;  4CAF A;  4CRZ B;  5A27 A;  4KSF A;  2DPS A;  2R8V A;  2VBQ A;  3GYA A;  4MY0 A;  3S6G A;  4CAV A;  2J8R A;  3GKR A;  4KOX A;  4KOU A;  2PR1 A;  4PK2 A;  5H86 A;  4C68 A;  5IV0 A;  1YX0 A;  4UFW A;  4AB7 A;  5G21 A;  3W6S A;  5FVJ A;  2P6F A;  2OZG A;  3P2H A;  4UCM A;  2PC1 A;  1IYL A;  3A9L A;  1MJ9 A;  4B10 A;  2OU2 A;  1S5K A;  2Q4Y A;  4XNH B;  4C2Z A;  2GE3 A;  3FNC A;  2C27 A;  3EXN A;  3TO7 A;  3R1K A;  4A32 A;  1S7F A;  2FCK A;  4NF1 A;  4CGL A;  3N7Z A;  5H84 A;  4MFP A;  3H4Q A;  1XMT A;  1M4I A;  2DPT A;  4UWJ A;  1XE4 A;  1FY7 A;  2ZW7 A;  2Z10 A;  4NEX A;  5F48 A;  1KZF A;  4KOR A;  2B3V A;  2BEI A;  5EC4 A;  1XF8 A;  2B3U A;  3IU2 A;  2I00 A;  3CXS A;  4RI1 A;  1S3Z A;  4ZBG A;  2Q0Y A;  4AVB A;  4B11 A;  2JLM A;  3FIX A;  4PK3 A;  2Z3M A;  4KVX A;  4CGM A;  3V8I A;  4XPD C;  2Z3P A;  3BLN A;  4AG9 A;  5C82 A;  1ZO0 A;  3G8W A;  2VEZ A;  2P6E A;  3SXO A;  2EUI A;  2FSR A;  5C88 A;  3GY9 A;  5DWM A;  4E8O A;  4XNH C;  1OZP A;  2D4O A;  2WPW A;  2FIA A;  1WWZ A;  1S7K A;  1Y9K A;  4CYP A;  2Z3K A;  2D4P A;  5G20 A;  1QSM A;  1J4J A;  2Z11 A;  2BUE A;  4K30 A;  1GHE A;  2OH1 A;  5KTD A;  3RYO A;  5HH1 A;  1YVO A;  3SHP A;  4JJX A;  3R95 A;  5E96 A;  3FRM A;  3IU1 A;  4F6A A;  2J8M A;  2K5T A;  5IB0 A;  3K9U A;  4B5P A;  3PZJ A;  1WK4 A;  1XEB A;  4F0Y A;  4QVT A;  2P0W A;  4CGO A;  2ZW5 A;  4C2X A;  2PQ8 A;  4ZGY B;  2BL1 A;  3FBU A;  4CYQ A;  2P6G A;  4PV6 A;  1Y9W A;  4Q36 A;  4LX9 A;  2Q04 A;  4IUS A;  4IF5 A;  4ONU A;  1I12 A;  3D3S A;  1NMT A;  5EBV A;  4GS4 A;  4I49 A;  2VXK A;  3JTK A;  1I1D A;  2CNT A;  4QUS A;  4J3G A;  2FXF A;  2G0B A;  4UBR A;  4FD6 A;  4BMH A;  3IWG A;  2B4B A;  4XPD B;  2OB0 A;  3CXP A;  3EC4 A;  2Q7B A;  5ISV A;  1KUV A;  1Q2D A;  4MI4 A;  5AGE A;  4X5K A;  3DNS A;  5HMN A;  2DXQ A;  4H6U A;  3I9S A;  4PSX A;  2WPX A;  2WSA A;  2ATR A;  1MK4 A;  4UFX A;  4RS2 A;  3D8P A;  2A4N A;  2VZY A;  2B5G A;  4BBH A;  3VWE A;  3CXQ A;  2CXA A;  4JWP A;  4FD4 A;  5J8F A;  2PRB A;  4B5O A;  4M85 A;  4JLY A;  2KCW A;  2CY2 A;  4KS9 A;  5F49 A;  3F8K A;  4C7I A;  3W91 A;  2Z0Z A;  2ZPA A;  4NSQ A;  1YLE A;  1MJA A;  2OZH A;  4CS0 B;  3F0A A;  2FS5 A;  4MFQ A;  5AG4 A;  5J8C A;  1YVK A;  2X7B A;  3ZZI A;  3PGP A;  3DDD A;  3PP9 A;  2PDO A;  2ZXV A;  2QEC A;  3TOA A;  2YGW A;  4CAE A;  2Y0M A;  1VKC A;  3LOD A;  2H5M A;  2VQY A;  3FYN A;  4UCN A;  3EO4 A;  5G22 A;  4HKF A;  1XIX A;  2O28 A;  4KVM E;  4AVC A;  3ZJ0 A;  2BSW A;  1IIC A;  3MGD A;  1KUX A;  3TO6 A;  4HNY B;  3TTH A;  4H89 A;  4YFJ A;  2JDD A;  4E2A A;  1CJW A;  3LD2 A;  4OLL A;  3TCV A;  4C7H A;  2GAN A;  4KUA A;  4KOY A;  4CAW A;  4CYO A;  4B5P B;  1BOB A;  2Z3O A;  3TO9 A;  3IWE A;  1YRE A;  2JEV A;  2FT0 A;  1Z4E A;  4YRH A;  5DWN A;  3EFA A;  2CNM A;  2FE7 A;  4Q38 A;  2G3T A;  3E0K A;  4CRY B;  1YK3 A;  2ZW4 A;  3TFY A;  1R57 A;  4UCP A;  4MY3 A;  1QSN A;  4Y49 C;  4R9M A;  4B13 A;  1K4J A;  1IYK A;  4OAE A;  5AG5 A;  2REF A;  4L8A A;  4U9Y A;  1QST A;  1Q2Y A;  1RO5 A;  1UFH A;  3H5Z A;  4YGO A;  2FIW A;  1P4N A;  2OZU A;  3QB8 A;  5CNP A;  2I79 A;  2F5I A;  1PU9 A;  1PUA A;  2REE A;  4KZT A;  3DR8 A;  3KKW A;  1NE9 A;  4ORF A;  3T9Y A;  5F47 A;  4AVA A;  1B87 A;  3JVN A;  1QSO A;  3R9G A;  4NXY A;  1QSR A;  4NCZ A;  1S7N A;  2Q4V A;  5KTA A;  2PSW A;  4KSA A;  4A33 A;  3D2P A;  4PSW A;  4MFL A;  3B8G A;  2B4D B;  4XPK A;  3S6H A;  2B5G B;  3OWC A;  1V0C A;  4MHD A;  3TE4 A;  2CNS A;  2IL4 A;  2WUU A;  4R57 A;  3BJ8 A;  2B4D A;  3VWD A;  1Z9U A;  4JD6 A;  5BWA B;  4CGN A;  3G3S A;  4OAD A;  4A31 A;  5AG7 A;  1M4D A;  1P0H A;  4QB9 A;  1BO4 A;  1NSL A;  2YND A;  3R9F A;  4E0A A;  3SXN A;  4MJ8 A;  1N71 A;  1IB1 E;  3IGR A;  3EY5 A;  1MJB A;  2JDC A;  5A28 A;  5I0C A;  2RC4 A;  4MFK A;  5JPH A;  4R87 A;  1YR0 A;  4AG7 A;  4UWI A;  3D2M A;  4CGP A;  4C2Y A;  3WR7 A;  2VZZ A;  4QC6 A;  4A95 A;  2QIR A;  3FB3 A;  1S60 A;  3DSB A;  4HNW B;  4JXQ A;  1CM0 A;  4KOW A;  1RXT A;  4MBU A;  5G1Z A;  3S6F A;  1VHS A;  2G3A A;  4KLV A;  4Y49 B;  2ZW6 A;  4KOT A;  4FD7 A;  1I21 A;  4H6Z A;  4CAX A;  2GIV A;  2YNE A;  2YNC A;  2NMT A;  2Z3N A;  5AG6 A;  1LRZ A;  1YGH A;  5GCN A;  1TIQ A;  1Q2C A;  1ON0 A;  1KUY A;  4U5Y A;  4KUB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...