2WSAA

Crystal structure of leishmania major n-myristoyltransferase (nmt) with bound myristoyl-coa and a pyrazole sulphonamide ligand (ddd85646)
Total Genus 124
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
124
sequence length
411
structure length
411
Chain Sequence
AHAFWSTQPVPQTEDEDEKIVFAGPMDEPKTVADIPEEPYPIASTFEWWTPNMEAADDIHAIYELLRDNYVEDDDSMFRFNYSEEFLQWALCPPNYIPDWHVAVRRKADKKLLAFIAGVPVTLRMGTPKYMKVKAQEKGEGEEAAKYDEPRHICEINFLCVHKQLREKRLAPILIKEATRRVNRTNVWQAVYTAGVLLPTPYASGQYFHRSLNPEKLVEIRFSGIPAQYQKFQNPMAMLKRNYQLPSAPKNSGLREMKPSDVPQVRRILMNYLDSFDVGPVFSDAEISHYLLPRDGVVFTYVVENDKKVTDFFSFYRIPSTVIGNSNYNLLNAAYVHYYAATSIPLHQLILDLLIVAHSRGFDVCNMVEILDNRSFVEQLKFGAGDGHLRYYFYNWAYPKIKPSQVALVML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLYCYLPEPTIDE N-TETRADECANOYLTRANSFERASE
publication title N-Myristoyltransferase Inhibitors as New Leads to Treat Sleeping Sickness.
pubmed doi rcsb
source organism Leishmania major
molecule tags Transferase
total genus 124
structure length 411
sequence length 411
ec nomenclature ec 2.3.1.97: Glycylpeptide N-tetradecanoyltransferase.
pdb deposition date 2009-09-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01233 NMT Myristoyl-CoA:protein N-myristoyltransferase, N-terminal domain
A PF02799 NMT_C Myristoyl-CoA:protein N-myristoyltransferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.170 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 2wsaA00
4B11A 4C2YA 4BBHA 4UFXA 4C2XA 4CAEA 4CGPA 5G22A 2YNCA 4C2ZA 4C7IA 4CYNA 4UCMA 5AG7A 2YNCC 4A2ZA 4UCPA 4UFWA 4A30A 5AGEA 3JTKA 5A27A 2YNDA 5A28A 2WUUA 4UCNA 4CGLA 4CGOA 4C68A 3IU2A 4CYOA 4CYQA 2YNEA 5AG5A 4A95A 4CGMA 4CGNA 4CYPA 5G20A 4B14A 4A31A 3IWEA 4B10A 4B12A 4B13A 4A33A 5AG6A 4A32A 3IU1A 5G21A 4UFVA 5G1ZA 4CAFA 4C7HA 5AG4A 3H5ZA 2WSAA
chains in the Genus database with same CATH superfamily
4KOVA 2WPWA 2CXAA 3GIUA 4CAWA 3HLPA 2NMTA 3TC8A 2D4OA 4XPLA 4YGOA 3DDDA 3QB8A 1S60A 3I9SA 4WWVA 3JTKA 2AJ6A 1IY7A 3B35A 1HDQA 4OADA 4AVBA 2PJ2A 2C6PA 3GB0A 5J8CA 4FAIA 4ZX8A 4MFLA 2EBJA 2GFQA 4CGNA 4F9UA 3B3TA 4JD6A 1OZPA 2IL4A 1LRZA 1Y9WA 4L89A 2X7BA 3NFZA 2C6CA 3IWEA 5EC4A 4B13A 4ONUA 1WK4A 5F09A 3PRTA 2CNMA 1CM0A 4J3GA 1FT7A 2WZNA 4AXVA 1ZG9A 1QQ9A 1KUVA 3V38A 2ZW7A 3IWGA 4B11A 3LWUA 1RO5A 2C1CA 2WPXA 5DWNA 3FMCA 1R57A 1TF9A 2OB0A 4GM5A 4A37A 1IICA 2CNTA 2AFWA 2GANA 2J8RA 2VBQA 2ZELA 3D68A 3RO0A 3MGDA 4EVYA 3QAYA 1MJ9A 2PJBA 3CT9A 4H6UA 1F2OA 5JM6A 4MFKA 3LMSA 1ZLHA 3T90A 5JH9A 4PPZA 3CXSA 5F48A 3S9NA 3IIBA 3VH9A 2ZW4A 2OZHA 4UIBA 4CRYB 3TE4A 3IU1A 2PRQA 5F49A 2GREA 1AMPA 3K9TA 5G1ZA 5HVGA 3CPAA 3VWDA 3W6SA 2K5TA 3D3SA 4M85A 3S6HA 4GXHA 3TTHA 4H89A 3DGVA 4C7IA 3SXOA 3TX8A 3TO7A 5ELYA 2VXKA 2Q04A 3MRUA 4PXDA 3RBUA 3PB9X 3B8GA 1WWZA 4X3RA 2ZPAA 3SJEA 2EWBA 2PIZA 3D7GA 3HUVA 4HNYB 2CNSA 2DXQA 2HQYA 1B87A 3A9LA 3D8PA 1MJBA 3GKRA 3JUWA 4FD7A 4UCNA 4XPDC 4KOXA 3UY5A 5JGFA 2V8DA 5LYFA 1QSTA 4FWUA 1XFOA 2Q7BA 4CYPA 5HMNA 1JWQA 2OU2A 5LRGA 1QSOA 1V0CA 3T8WA 4UA3A 3FBUA 1Z8XA 4B5OA 4KVXA 2RFHA 3CXQA 1M4LA 4I49A 1ON0A 4K3NA 2GIVA 3KQXA 4KSAA 3E0KA 1NSAA 4MBUA 4RS2A 5CNPA 1XRYA 2F7VA 4UIAA 2CF4A 1XE4A 1ZLIA 1CPSA 1Y7EA 3D7FA 2AE6A 3P2FA 1QSNA 4RI1A 3TOAA 4FBEA 1BLLE 2XEJA 1U6MA 2PCUA 1H8LA 4XNHC 4MHDA 3JRUA 4OKOA 3PEIA 3GY9A 1CPXA 3FECA 1I1DA 4OIWA 3D7DA 4Y49B 4AG9A 4JZ0A 2PDOA 1BAVA 1Q2DA 5KTCA 1S5KA 1Z2LA 3CDXA 5DWMA 2ODFA 3DLJA 2FE7A 1VHSA 4KVME 2Q0YA 2Z3NA 5GCNA 2PJCA 1Z4RA 2PIYA 3B3CA 4MRIA 2NYQA 4MMOA 3RNZA 3SHPA 4ZI6A 4RN7A 4P10A 3W91A 1TKHA 1TKFA 3LD2A 2Q43A 4QUSA 4R6TA 4UFXA 3IC1A 2FIAA 4PXEA 4R57A 5HH1A 2ABZA 2EK8A 4R87A 4NEXA 4UCMA 4ZX9A 1R3NA 1ZO0A 3KI9A 3N7ZA 4M6HA 2JEVA 2VI7A 2P0WA 2VQYA 3R9FA 3K2KA 3IO1A 4MY3A 5LYDA 1NE9A 2FS5A 4LQ6A 3GLJA 2ZENA 1TF8A 2PJ1A 3EXNA 2ZEDA 3N5FA 4HNWB 4CYQA 4MFPA 2Q51A 4HNXB 3TFYA 3DR8A 1CBXA 4NF1A 4UBRA 3WC5A 1BPMA 3WC6A 3I1UA 2I00A 5G20A 3W6XA 2B4BA 2QYVA 4A31A 3GUXA 4KLWA 1YSJA 4UEEA 5IB0A 4NGNA 5K8MA 4MJ8A 2G9DA 2PJAA 4NCZA 4IUSA 4MFJA 1LANA 1MK4A 4KSIA 5THWA 3V8IA 1ARMA 4CRZB 4MY0A 1F57A 3VATA 2REEA 1ELMP 4ZGYB 1NMTA 1YQEA 2Z3MA 3R96A 3FYNA 3ZJ0A 5JPHA 3D66A 2ZXVA 4A30A 4B5PB 3CXPA 2VL1A 4OC1A 1P0HA 3FX6A 2WUUA 4X5KA 5A27A 1OBRA 4II9A 4AVCA 1PCAA 3IU2A 2R1IA 4BD9A 2Z3LA 4OMEA 5K8PA 1YREA 2V8HA 4PK2A 3BJ8A 2XEGA 3FH4A 4LUAA 8CPAA 4ZY0A 4PXCA 4KOSA 2PR8A 1JQGA 4ORFA 4BINA 4UFVA 4WJBA 3EY5A 2I79A 4Q36A 2PJ3A 4ONWA 4CGPA 3BLNA 2PSWA 1S7NA 3D4UA 3R95A 3S9LA 3NA6A 1VKCA 3TOBA 3S6FA 4A94A 2ZOFA 1X10A 3PB6X 3D2MA 4ZY1A 3SJXA 2P6GA 2QJ8A 4YWYA 4AG7A 3S9MA 5F47A 3BI0A 3WR7A 4NFRA 1N71A 2R7HA 5H84A 4YU9A 4NXYA 2EUIA 2BOAA 3B2YA 3FB3A 3FRMA 2Z11A 4OC4A 2J9AA 3H8GA 3PB8X 2Z3OA 1YW6A 2WYRA 3EFAA 1Q2CA 2ZEPA 3D2PA 4ZBGA 1S7FA 3ISZA 1IOIA 3FIXA 4P6YA 2B5GB 2FIWA 3SJFA 4M6IA 1IYKA 3KR4A 4C2ZA 4NGPA 4NGQA 2CTBA 4U5YA 4MCPA 1M4GA 4O23A 4NGSA 1LAPA 3S6GA 1AUGA 3WABA 4MHYA 4JXRA 4HPSA 3RAMA 2JDDA 2O4HA 1X12A 3KHXA 1DTDA 3LACA 1A2ZA 3MN8A 3B3WA 2PJ9A 4MFQA 5JQ4A 2F5IA 1XF8A 2B4DB 2DPTA 3RZAA 1BPNA 2EO8A 1XOVA 1EE3P 2BEIA 4E0AA 3D67A 2FCKA 5G21A 3F5BA 1R43A 4PV6A 4FUUA 1VGYA 2OZUA 4OLLA 4UF4A 3BJ7A 1LCPA 3P2HA 4LX9A 4JJXA 4OP4A 4QC6A 1I21A 1LOKA 1M4IA 1ZG7A 5K8OA 2A4NA 2AFMA 3KHZA 3SI0A 4G1PA 4E2AA 1Y0RA 4KOTA 4P45A 4A2ZA 3F8KA 3C26A 3R9EA 4MXUA 4KOWA 3VARA 2PR1A 2REFA 3B3VA 4JLYA 1CP6A 2HUZA 2ANPA 4CGOA 1LAMA 2V8VA 1IIDA 2PJ0A 4TWEA 4CYOA 5LYLA 5IX3A 3FVLA 2PVWA 2JBJA 2YGWA 3WC7A 2CTCA 2HV2A 4F6AA 2VZYA 1HDUA 3LODA 4KOUA 4B10A 4KORA 3IGRA 4KUAA 2NSMA 4PXBA 3D7HA 4C7HA 2P6EA 2ZEEA 3KKWA 2RC4A 1KUYA 1HEEA 2J8NA 1K4JA 4OIDA 3ZZIA 5LRKA 1Y7RA 2GLJA 3F0AA 2PJ6A 3NE8A 2PJ5A 1YLOA 3NE7A 4CYNA 1KUXA 4BMHA 3TT2A 4R7MA 4DYOA 3PBBA 2KCWA 5LRJA 1IU8A 5EBVA 2PJ7A 5ISVA 3GYAA 1B6BA 1M1DA 2DEAA 2FSRA 3BHXA 2BO9A 1IYLA 1RTQA 4DJLA 2Q44A 1QSRA 1GYTA 5AG6A 2FL4A 2CIJA 1Y9KA 4X2TA 3IJ3A 3DNSA 2AFZA 1XMTA 4R9MA 4KOYA 1TIQA 4NJQA 5IB9A 4DNCA 4C2XA 4IK2A 2RB7A 1Z8WA 4K30A 3PB7X 3FEDA 3H8FA 4MHPA 2IMOA 1XMBA 1VIXA 1TXRA 1XEBA 1YK3A 3NH4A 3FF3A 4XPDB 1BOBA 4GS4A 4R76A 2HB6A 4KS9A 5BWAB 2PRBA 4A38A 4MHNA 3SJGA 4PQAA 1XBUA 2OOTA 1ELLP 2AFXA 1VHOA 2Y0MA 2PJ8A 4OC2A 4PSXA 3DR6A 4NGTA 4MCRA 2QECA 4EFDA 4FD5A 2FT0A 4CAFA 3K9UA 4U9ZA 2POKA 3R9GA 2QIRA 4E8OA 5HXDA 4NJRA 4QB9A 6CPAA 4P44A 2V8GA 5F46A 5CBMA 2G3TA 4U9YA 4EMEA 1L0CA 4XNHB 1TKJA 4UCPA 4L8AA 5FVJA 2OZGA 4JWPA 2ATRA 2B58A 4P4EA 1KWMA 1CJWA 2Z3KA 1BO4A 2Z10A 3I3GA 4CGLA 3QAHA 3PFOA 2B3UA 1Q7LA 4Y49C 1QSMA 4CPAA 4ZYQA 2XEFA 2C6GA 3G8WA 4Z65A 2JBKA 2JDCA 2EK9A 2PJ4A 3SI1A 1ARLA 1F2PA 2PVVA 4A32A 3NH5A 4KZTA 4F9VA 1J4JA 1GHEA 2ZEHA 1UWYA 4DUKA 2B3VA 1Z8TA 1IB1E 3JVNA 4CAEA 2ZOGA 3IEHA 2PQ8A 2YNCA 1YVOA 2XEIA 1YW4A 2G3AA 3KQZA 2YNCC 2F8HA 1KZFA 3DSBA 4QVTA 5D8NA 1ZG8A 2BCOA 1Z9UA 4CAVA 4LQGA 3H4QA 2P6FA 3EO4A 2O53A 3CZXA 5C82A 2PE3A 1LFWA 3CPXA 2BL1A 4UWJA 2BUEA 3B7IA 2OR4A 2H5MA 4KSFA 1P4NA 2O28A 4OC3A 5K8NA 4YFJA 1IOFA 1PU9A 2Q4YA 4TNUA 2C27A 1YR0A 2Z3PA 4CS0B 3PP9A 4FD6A 5I0CA 4F0XA 5HVHA 5KTDA 3EC4A 2J8MA 4IAVA 3WT4A 3B3SA 1UFHA 1YMEA 1Q2YA 4JXQA 2AFOA 2AFSA 4F8ZA 1PYTB 1Z4EA 4Q38A 2ARHA 2GE3A 3KZWA 4UFWA 3L2NA 1I12A 5AGEA 4YRHA 5H86A 4B5PA 1NSLA 4OC5A 2YNDA 5A28A 1CX8A 1S3ZA 4HKFA 4MFZA 1M4DA 2HC9A 2Q4ZA 1YX0A 5CPAA 4CGMA 3SXNA 1YLEA 3BI1A 3T9YA 4AVAA 1AYEA 2QMLA 4IF5A 4B12A 5HVFA 2ZEGA 1MJAA 4KUBA 4R3LA 5J8FA 5J1QA 4W9YA 4R3KA 2WSAA 4P4FA 4Q7AA 2PC1A 5DS0A 3BXMA 4C2YA 2ZEMA 3FEEA 4BBHA 4CAXA 4B6ZA 3FNCA 1CP7A 2EVNA 4P4DA 4M6GA 4RUHA 5AG7A 1CG2A 3G3SA 2ZW5A 3PB4X 2ZW6A 2GU2A 3KR5A 4IHMA 3H8EA 4QBJA 4F0YA 1XIXA 3H5ZA 4ZY2A 2QVPA 3TO9A 4UEZA 4P4JA 1FNOA 2AFUA 4R8FA 2VZZA 4MCQA 4MHZA 4NSQA 2IQ6A 4C68A 3FJUA 2ZEOA 2R98A 3ISXA 4UEFA 1M44A 3NH8A 5AG5A 4EWTA 4H2KA 3PGPA 1Z8LA 3FXTA 3IWWA 4NGMA 4P4BA 3SI2A 4A39A 2V77A 5D29A 3VWEA 2G0BA 1RXTA 1Y0YA 4A33A 4OC0A 2DPSA 1FY7A 1XJOA 1QMUA 1S7LA 1DE4C 5AG4A 2B5GA 4KVOE 4M3SA 2DF5A 1YGHA 2VEZA 2FVGA 5G22A 4AB7A 7CPAA 4KLVA 2JLMA 2GLFA 1SQHA 1IGBA 1S7KA 2D4PA 2Q4VA 4UWIA 2I3CA 3KL9A 4X8IA 4FD4A 3QNVA 2Z0ZA 3PZJA 1YVKA 2CY2A 3OWCA 3RYOA 5EMIA 4P4IA 4XPKA 4H6ZA 2IJZA 2YNEA 4JYWA 4A95A 3TO6A 5IV0A 1VHEA 2R8VA 1Z5RA 5I4MA 3KASA 4PSWA 3S6KA 3PBEA 2B4DA 4B14A 2OH1A 2BSWA 5C88A 2FXFA 3KGQA 3PFEA 5KTAA 2JEWA 4OAEA 1PUAA 5E96A 3IFEA 4MI4A 4NGRA 4PK3A 5LYIA 3TCVA 3V7ZA 3R1KA 4MCSA 2Q7SA 2ZEFA
chains in the Genus database with same CATH topology
4KOVA 2WPWA 2CXAA 4CAWA 2NMTA 2D4OA 4XPLA 4YGOA 3DDDA 3QB8A 1S60A 3I9SA 3JTKA 2AJ6A 4OADA 4AVBA 5J8CA 4MFLA 4CGNA 4JD6A 1OZPA 2IL4A 1LRZA 1Y9WA 4L89A 2X7BA 5EC4A 3IWEA 4B13A 4ONUA 1WK4A 2CNMA 1CM0A 4J3GA 1KUVA 2ZW7A 3IWGA 4B11A 1RO5A 2WPXA 5DWNA 1R57A 2OB0A 1IICA 2CNTA 2GANA 2J8RA 2VBQA 3MGDA 4EVYA 1MJ9A 4H6UA 4MFKA 3T90A 3CXSA 5F48A 2ZW4A 2OZHA 4CRYB 3TE4A 3IU1A 5F49A 5G1ZA 3VWDA 3W6SA 2K5TA 3D3SA 4M85A 3S6HA 3TTHA 4H89A 4QBJA 4C7IA 3SXOA 3TO7A 2VXKA 2Q04A 3B8GA 1WWZA 2ZPAA 4HNYB 2CNSA 2DXQA 2HQYA 1B87A 3A9LA 3D8PA 1MJBA 3GKRA 3JUWA 4FD7A 4UCNA 4XPDC 4KOXA 3UY5A 1QSTA 2Q7BA 4CYPA 5HMNA 2OU2A 1QSOA 1V0CA 4UA3A 3FBUA 4B5OA 4KVXA 3CXQA 4I49A 1ON0A 4MBUA 2GIVA 5CNPA 4KSAA 3E0KA 4RS2A 1XE4A 2AE6A 3P2FA 1QSNA 4RI1A 3TOAA 1U6MA 4XNHC 4MHDA 3GY9A 1I1DA 4Y49B 4AG9A 2PDOA 1Q2DA 5KTCA 1S5KA 5DWMA 2FE7A 1VHSA 4KVME 2Q0YA 2Z3NA 5GCNA 1Z4RA 3SHPA 3W91A 3LD2A 4QUSA 4UFXA 2FIAA 4R57A 5HH1A 4R87A 4NEXA 4UCMA 1ZO0A 3N7ZA 2JEVA 2VI7A 2P0WA 2VQYA 3R9FA 4MY3A 1NE9A 2FS5A 3TFYA 3EXNA 4HNWB 4CYQA 4MFPA 4HNXB 3DR8A 4NF1A 4UBRA 3W6XA 2I00A 5G20A 2B4BA 4A31A 4KLWA 5IB0A 4MJ8A 4NCZA 4IUSA 4MFJA 1MK4A 3V8IA 4CRZB 4MY0A 2REEA 4ZGYB 1NMTA 2Z3MA 3ZJ0A 3R96A 3FYNA 5JPHA 2ZXVA 4A30A 4B5PB 3CXPA 4X5KA 5A27A 1P0HA 2WUUA 4II9A 4AVCA 3IU2A 2R1IA 2Z3LA 1YREA 4PK2A 3BJ8A 4LUAA 4KOSA 2PR8A 4ORFA 4UFVA 3EY5A 2I79A 4Q36A 4CGPA 3BLNA 2PSWA 1S7NA 3R95A 1VKCA 3TOBA 3S6FA 3D2MA 2P6GA 4AG7A 5F47A 3WR7A 1N71A 2R7HA 5H84A 4NXYA 2EUIA 3FB3A 3FRMA 2Z11A 2Z3OA 3EFAA 1Q2CA 3D2PA 4ZBGA 1S7FA 3FIXA 2B5GB 2FIWA 1IYKA 4C2ZA 4U5YA 1M4GA 3S6GA 4JXRA 2JDDA 4MFQA 5JQ4A 2F5IA 1XF8A 2B4DB 2DPTA 4B14A 2BEIA 4E0AA 2FCKA 5G21A 3F5BA 4PV6A 2OZUA 4OLLA 3BJ7A 3P2HA 4LX9A 4JJXA 4QC6A 1I21A 1M4IA 2A4NA 4E2AA 4A2ZA 4KOTA 3F8KA 3C26A 3R9EA 4KOWA 2PR1A 2REFA 4JLYA 4CGOA 2HUZA 4CYOA 1IIDA 5IX3A 2YGWA 2HV2A 4F6AA 2VZYA 3LODA 4KOUA 4B10A 4KORA 3IGRA 4KUAA 4C7HA 2P6EA 3KKWA 2RC4A 1KUYA 2J8NA 1K4JA 3ZZIA 1Y7RA 3F0AA 3NE7A 4CYNA 1KUXA 4BMHA 3TT2A 2KCWA 5EBVA 5ISVA 3GYAA 1B6BA 1M1DA 2FSRA 1IYLA 2Q44A 1QSRA 5AG6A 2FL4A 1Y9KA 3DNSA 4R9MA 1XMTA 4KOYA 1TIQA 4DNCA 4C2XA 4K30A 1YK3A 1XEBA 4XPDB 5BWAB 1BOBA 4GS4A 4KS9A 2PRBA 2Y0MA 4PSXA 3DR6A 2QECA 4FD5A 2FT0A 4CAFA 3K9UA 4U9ZA 3R9GA 2QIRA 4E8OA 4QB9A 5F46A 2G3TA 4U9YA 1L0CA 4XNHB 5FVJA 4UCPA 4L8AA 2OZGA 4JWPA 2ATRA 2B58A 1CJWA 2Z3KA 1BO4A 2Z10A 3I3GA 4CGLA 3QAHA 2B3UA 4Y49C 1QSMA 3G8WA 2JDCA 4A32A 4KZTA 1J4JA 1GHEA 2B3VA 1IB1E 3JVNA 4CAEA 2PQ8A 2YNCA 1YVOA 2G3AA 2YNCC 1KZFA 3DSBA 4QVTA 1Z9UA 4CAVA 3H4QA 2P6FA 3EO4A 5C82A 2BL1A 4UWJA 2BUEA 2H5MA 4KSFA 1P4NA 2O28A 4YFJA 1PU9A 2Q4YA 2C27A 1YR0A 2Z3PA 4CS0B 3PP9A 4FD6A 5I0CA 4F0XA 5KTDA 3EC4A 2J8MA 1UFHA 1Q2YA 4JXQA 1Z4EA 4Q38A 2ARHA 2GE3A 4UFWA 1I12A 5AGEA 4YRHA 5H86A 4B5PA 1NSLA 5A28A 2YNDA 1S3ZA 4HKFA 4MFZA 1M4DA 1YX0A 4CGMA 3SXNA 1YLEA 3T9YA 4AVAA 2QMLA 4IF5A 4B12A 1MJAA 4KUBA 4R3LA 5J8FA 4R3KA 2WSAA 4C2YA 2PC1A 4BBHA 4CAXA 3FNCA 2EVNA 5AG7A 3G3SA 2ZW5A 2ZW6A 4F0YA 1XIXA 3TO9A 2VZZA 4C68A 4NSQA 2R98A 5AG5A 1M44A 3PGPA 3FXTA 3VWEA 2G0BA 1RXTA 4A33A 2DPSA 1FY7A 1S7LA 5AG4A 2B5GA 4KVOE 4M3SA 1YGHA 2VEZA 5G22A 4AB7A 4KLVA 2JLMA 1SQHA 4UWIA 1S7KA 2D4PA 2Q4VA 4FD4A 2Z0ZA 3PZJA 1YVKA 2CY2A 3OWCA 3RYOA 4XPKA 4H6ZA 2YNEA 4A95A 3TO6A 5IV0A 2R8VA 4PSWA 3S6KA 2B4DA 2OH1A 2BSWA 5C88A 2FXFA 5KTAA 4OAEA 1PUAA 5E96A 4MI4A 4PK3A 3TCVA 3R1KA 3H5ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4B11 A;  4C2Y A;  4BBH A;  4UFX A;  4C2X A;  4CAE A;  4CGP A;  5G22 A;  2YNC A;  4C2Z A;  4C7I A;  4CYN A;  4UCM A;  5AG7 A;  2YNC C;  4A2Z A;  4UCP A;  4UFW A;  4A30 A;  5AGE A;  3JTK A;  5A27 A;  2YND A;  5A28 A;  2WUU A;  4UCN A;  4CGL A;  4CGO A;  4C68 A;  3IU2 A;  4CYO A;  4CYQ A;  2YNE A;  5AG5 A;  4A95 A;  4CGM A;  4CGN A;  4CYP A;  5G20 A;  4B14 A;  4A31 A;  3IWE A;  4B10 A;  4B12 A;  4B13 A;  4A33 A;  5AG6 A;  4A32 A;  3IU1 A;  5G21 A;  4UFV A;  5G1Z A;  4CAF A;  4C7H A;  5AG4 A;  3H5Z A;  2WSA A; 
#chains in the Genus database with same CATH topology
 4KOV A;  2WPW A;  2CXA A;  3GIU A;  4CAW A;  3HLP A;  2NMT A;  3TC8 A;  2D4O A;  4XPL A;  4YGO A;  3DDD A;  3QB8 A;  1S60 A;  3I9S A;  4WWV A;  3JTK A;  2AJ6 A;  1IY7 A;  3B35 A;  1HDQ A;  4OAD A;  4AVB A;  2PJ2 A;  2C6P A;  3GB0 A;  5J8C A;  4FAI A;  4ZX8 A;  4MFL A;  2EBJ A;  2GFQ A;  4CGN A;  4F9U A;  3B3T A;  4JD6 A;  1OZP A;  2IL4 A;  1LRZ A;  1Y9W A;  4L89 A;  2X7B A;  3NFZ A;  2C6C A;  3IWE A;  5EC4 A;  4B13 A;  4ONU A;  1WK4 A;  5F09 A;  3PRT A;  2CNM A;  1CM0 A;  4J3G A;  1FT7 A;  2WZN A;  4AXV A;  1ZG9 A;  1QQ9 A;  1KUV A;  3V38 A;  2ZW7 A;  3IWG A;  4B11 A;  3LWU A;  1RO5 A;  2C1C A;  2WPX A;  5DWN A;  3FMC A;  1R57 A;  1TF9 A;  2OB0 A;  4GM5 A;  4A37 A;  1IIC A;  2CNT A;  2AFW A;  2GAN A;  2J8R A;  2VBQ A;  2ZEL A;  3D68 A;  3RO0 A;  3MGD A;  4EVY A;  3QAY A;  1MJ9 A;  2PJB A;  3CT9 A;  4H6U A;  1F2O A;  5JM6 A;  4MFK A;  3LMS A;  1ZLH A;  3T90 A;  5JH9 A;  4PPZ A;  3CXS A;  5F48 A;  3S9N A;  3IIB A;  3VH9 A;  2ZW4 A;  2OZH A;  4UIB A;  4CRY B;  3TE4 A;  3IU1 A;  2PRQ A;  5F49 A;  2GRE A;  1AMP A;  3K9T A;  5G1Z A;  5HVG A;  3CPA A;  3VWD A;  3W6S A;  2K5T A;  3D3S A;  4M85 A;  3S6H A;  4GXH A;  3TTH A;  4H89 A;  3DGV A;  4C7I A;  3SXO A;  3TX8 A;  3TO7 A;  5ELY A;  2VXK A;  2Q04 A;  3MRU A;  4PXD A;  3RBU A;  3PB9 X;  3B8G A;  1WWZ A;  4X3R A;  2ZPA A;  3SJE A;  2EWB A;  2PIZ A;  3D7G A;  3HUV A;  4HNY B;  2CNS A;  2DXQ A;  2HQY A;  1B87 A;  3A9L A;  3D8P A;  1MJB A;  3GKR A;  3JUW A;  4FD7 A;  4UCN A;  4XPD C;  4KOX A;  3UY5 A;  5JGF A;  2V8D A;  5LYF A;  1QST A;  4FWU A;  1XFO A;  2Q7B A;  4CYP A;  5HMN A;  1JWQ A;  2OU2 A;  5LRG A;  1QSO A;  1V0C A;  3T8W A;  4UA3 A;  3FBU A;  1Z8X A;  4B5O A;  4KVX A;  2RFH A;  3CXQ A;  1M4L A;  4I49 A;  1ON0 A;  4K3N A;  2GIV A;  3KQX A;  4KSA A;  3E0K A;  1NSA A;  4MBU A;  4RS2 A;  5CNP A;  1XRY A;  2F7V A;  4UIA A;  2CF4 A;  1XE4 A;  1ZLI A;  1CPS A;  1Y7E A;  3D7F A;  2AE6 A;  3P2F A;  1QSN A;  4RI1 A;  3TOA A;  4FBE A;  1BLL E;  2XEJ A;  1U6M A;  2PCU A;  1H8L A;  4XNH C;  4MHD A;  3JRU A;  4OKO A;  3PEI A;  3GY9 A;  1CPX A;  3FEC A;  1I1D A;  4OIW A;  3D7D A;  4Y49 B;  4AG9 A;  4JZ0 A;  2PDO A;  1BAV A;  1Q2D A;  5KTC A;  1S5K A;  1Z2L A;  3CDX A;  5DWM A;  2ODF A;  3DLJ A;  2FE7 A;  1VHS A;  4KVM E;  2Q0Y A;  2Z3N A;  5GCN A;  2PJC A;  1Z4R A;  2PIY A;  3B3C A;  4MRI A;  2NYQ A;  4MMO A;  3RNZ A;  3SHP A;  4ZI6 A;  4RN7 A;  4P10 A;  3W91 A;  1TKH A;  1TKF A;  3LD2 A;  2Q43 A;  4QUS A;  4R6T A;  4UFX A;  3IC1 A;  2FIA A;  4PXE A;  4R57 A;  5HH1 A;  2ABZ A;  2EK8 A;  4R87 A;  4NEX A;  4UCM A;  4ZX9 A;  1R3N A;  1ZO0 A;  3KI9 A;  3N7Z A;  4M6H A;  2JEV A;  2VI7 A;  2P0W A;  2VQY A;  3R9F A;  3K2K A;  3IO1 A;  4MY3 A;  5LYD A;  1NE9 A;  2FS5 A;  4LQ6 A;  3GLJ A;  2ZEN A;  1TF8 A;  2PJ1 A;  3EXN A;  2ZED A;  3N5F A;  4HNW B;  4CYQ A;  4MFP A;  2Q51 A;  4HNX B;  3TFY A;  3DR8 A;  1CBX A;  4NF1 A;  4UBR A;  3WC5 A;  1BPM A;  3WC6 A;  3I1U A;  2I00 A;  5G20 A;  3W6X A;  2B4B A;  2QYV A;  4A31 A;  3GUX A;  4KLW A;  1YSJ A;  4UEE A;  5IB0 A;  4NGN A;  5K8M A;  4MJ8 A;  2G9D A;  2PJA A;  4NCZ A;  4IUS A;  4MFJ A;  1LAN A;  1MK4 A;  4KSI A;  5THW A;  3V8I A;  1ARM A;  4CRZ B;  4MY0 A;  1F57 A;  3VAT A;  2REE A;  1ELM P;  4ZGY B;  1NMT A;  1YQE A;  2Z3M A;  3R96 A;  3FYN A;  3ZJ0 A;  5JPH A;  3D66 A;  2ZXV A;  4A30 A;  4B5P B;  3CXP A;  2VL1 A;  4OC1 A;  1P0H A;  3FX6 A;  2WUU A;  4X5K A;  5A27 A;  1OBR A;  4II9 A;  4AVC A;  1PCA A;  3IU2 A;  2R1I A;  4BD9 A;  2Z3L A;  4OME A;  5K8P A;  1YRE A;  2V8H A;  4PK2 A;  3BJ8 A;  2XEG A;  3FH4 A;  4LUA A;  8CPA A;  4ZY0 A;  4PXC A;  4KOS A;  2PR8 A;  1JQG A;  4ORF A;  4BIN A;  4UFV A;  4WJB A;  3EY5 A;  2I79 A;  4Q36 A;  2PJ3 A;  4ONW A;  4CGP A;  3BLN A;  2PSW A;  1S7N A;  3D4U A;  3R95 A;  3S9L A;  3NA6 A;  1VKC A;  3TOB A;  3S6F A;  4A94 A;  2ZOF A;  1X10 A;  3PB6 X;  3D2M A;  4ZY1 A;  3SJX A;  2P6G A;  2QJ8 A;  4YWY A;  4AG7 A;  3S9M A;  5F47 A;  3BI0 A;  3WR7 A;  4NFR A;  1N71 A;  2R7H A;  5H84 A;  4YU9 A;  4NXY A;  2EUI A;  2BOA A;  3B2Y A;  3FB3 A;  3FRM A;  2Z11 A;  4OC4 A;  2J9A A;  3H8G A;  3PB8 X;  2Z3O A;  1YW6 A;  2WYR A;  3EFA A;  1Q2C A;  2ZEP A;  3D2P A;  4ZBG A;  1S7F A;  3ISZ A;  1IOI A;  3FIX A;  4P6Y A;  2B5G B;  2FIW A;  3SJF A;  4M6I A;  1IYK A;  3KR4 A;  4C2Z A;  4NGP A;  4NGQ A;  2CTB A;  4U5Y A;  4MCP A;  1M4G A;  4O23 A;  4NGS A;  1LAP A;  3S6G A;  1AUG A;  3WAB A;  4MHY A;  4JXR A;  4HPS A;  3RAM A;  2JDD A;  2O4H A;  1X12 A;  3KHX A;  1DTD A;  3LAC A;  1A2Z A;  3MN8 A;  3B3W A;  2PJ9 A;  4MFQ A;  5JQ4 A;  2F5I A;  1XF8 A;  2B4D B;  2DPT A;  3RZA A;  1BPN A;  2EO8 A;  1XOV A;  1EE3 P;  2BEI A;  4E0A A;  3D67 A;  2FCK A;  5G21 A;  3F5B A;  1R43 A;  4PV6 A;  4FUU A;  1VGY A;  2OZU A;  4OLL A;  4UF4 A;  3BJ7 A;  1LCP A;  3P2H A;  4LX9 A;  4JJX A;  4OP4 A;  4QC6 A;  1I21 A;  1LOK A;  1M4I A;  1ZG7 A;  5K8O A;  2A4N A;  2AFM A;  3KHZ A;  3SI0 A;  4G1P A;  4E2A A;  1Y0R A;  4KOT A;  4P45 A;  4A2Z A;  3F8K A;  3C26 A;  3R9E A;  4MXU A;  4KOW A;  3VAR A;  2PR1 A;  2REF A;  3B3V A;  4JLY A;  1CP6 A;  2HUZ A;  2ANP A;  4CGO A;  1LAM A;  2V8V A;  1IID A;  2PJ0 A;  4TWE A;  4CYO A;  5LYL A;  5IX3 A;  3FVL A;  2PVW A;  2JBJ A;  2YGW A;  3WC7 A;  2CTC A;  2HV2 A;  4F6A A;  2VZY A;  1HDU A;  3LOD A;  4KOU A;  4B10 A;  4KOR A;  3IGR A;  4KUA A;  2NSM A;  4PXB A;  3D7H A;  4C7H A;  2P6E A;  2ZEE A;  3KKW A;  2RC4 A;  1KUY A;  1HEE A;  2J8N A;  1K4J A;  4OID A;  3ZZI A;  5LRK A;  1Y7R A;  2GLJ A;  3F0A A;  2PJ6 A;  3NE8 A;  2PJ5 A;  1YLO A;  3NE7 A;  4CYN A;  1KUX A;  4BMH A;  3TT2 A;  4R7M A;  4DYO A;  3PBB A;  2KCW A;  5LRJ A;  1IU8 A;  5EBV A;  2PJ7 A;  5ISV A;  3GYA A;  1B6B A;  1M1D A;  2DEA A;  2FSR A;  3BHX A;  2BO9 A;  1IYL A;  1RTQ A;  4DJL A;  2Q44 A;  1QSR A;  1GYT A;  5AG6 A;  2FL4 A;  2CIJ A;  1Y9K A;  4X2T A;  3IJ3 A;  3DNS A;  2AFZ A;  1XMT A;  4R9M A;  4KOY A;  1TIQ A;  4NJQ A;  5IB9 A;  4DNC A;  4C2X A;  4IK2 A;  2RB7 A;  1Z8W A;  4K30 A;  3PB7 X;  3FED A;  3H8F A;  4MHP A;  2IMO A;  1XMB A;  1VIX A;  1TXR A;  1XEB A;  1YK3 A;  3NH4 A;  3FF3 A;  4XPD B;  1BOB A;  4GS4 A;  4R76 A;  2HB6 A;  4KS9 A;  5BWA B;  2PRB A;  4A38 A;  4MHN A;  3SJG A;  4PQA A;  1XBU A;  2OOT A;  1ELL P;  2AFX A;  1VHO A;  2Y0M A;  2PJ8 A;  4OC2 A;  4PSX A;  3DR6 A;  4NGT A;  4MCR A;  2QEC A;  4EFD A;  4FD5 A;  2FT0 A;  4CAF A;  3K9U A;  4U9Z A;  2POK A;  3R9G A;  2QIR A;  4E8O A;  5HXD A;  4NJR A;  4QB9 A;  6CPA A;  4P44 A;  2V8G A;  5F46 A;  5CBM A;  2G3T A;  4U9Y A;  4EME A;  1L0C A;  4XNH B;  1TKJ A;  4UCP A;  4L8A A;  5FVJ A;  2OZG A;  4JWP A;  2ATR A;  2B58 A;  4P4E A;  1KWM A;  1CJW A;  2Z3K A;  1BO4 A;  2Z10 A;  3I3G A;  4CGL A;  3QAH A;  3PFO A;  2B3U A;  1Q7L A;  4Y49 C;  1QSM A;  4CPA A;  4ZYQ A;  2XEF A;  2C6G A;  3G8W A;  4Z65 A;  2JBK A;  2JDC A;  2EK9 A;  2PJ4 A;  3SI1 A;  1ARL A;  1F2P A;  2PVV A;  4A32 A;  3NH5 A;  4KZT A;  4F9V A;  1J4J A;  1GHE A;  2ZEH A;  1UWY A;  4DUK A;  2B3V A;  1Z8T A;  1IB1 E;  3JVN A;  4CAE A;  2ZOG A;  3IEH A;  2PQ8 A;  2YNC A;  1YVO A;  2XEI A;  1YW4 A;  2G3A A;  3KQZ A;  2YNC C;  2F8H A;  1KZF A;  3DSB A;  4QVT A;  5D8N A;  1ZG8 A;  2BCO A;  1Z9U A;  4CAV A;  4LQG A;  3H4Q A;  2P6F A;  3EO4 A;  2O53 A;  3CZX A;  5C82 A;  2PE3 A;  1LFW A;  3CPX A;  2BL1 A;  4UWJ A;  2BUE A;  3B7I A;  2OR4 A;  2H5M A;  4KSF A;  1P4N A;  2O28 A;  4OC3 A;  5K8N A;  4YFJ A;  1IOF A;  1PU9 A;  2Q4Y A;  4TNU A;  2C27 A;  1YR0 A;  2Z3P A;  4CS0 B;  3PP9 A;  4FD6 A;  5I0C A;  4F0X A;  5HVH A;  5KTD A;  3EC4 A;  2J8M A;  4IAV A;  3WT4 A;  3B3S A;  1UFH A;  1YME A;  1Q2Y A;  4JXQ A;  2AFO A;  2AFS A;  4F8Z A;  1PYT B;  1Z4E A;  4Q38 A;  2ARH A;  2GE3 A;  3KZW A;  4UFW A;  3L2N A;  1I12 A;  5AGE A;  4YRH A;  5H86 A;  4B5P A;  1NSL A;  4OC5 A;  2YND A;  5A28 A;  1CX8 A;  1S3Z A;  4HKF A;  4MFZ A;  1M4D A;  2HC9 A;  2Q4Z A;  1YX0 A;  5CPA A;  4CGM A;  3SXN A;  1YLE A;  3BI1 A;  3T9Y A;  4AVA A;  1AYE A;  2QML A;  4IF5 A;  4B12 A;  5HVF A;  2ZEG A;  1MJA A;  4KUB A;  4R3L A;  5J8F A;  5J1Q A;  4W9Y A;  4R3K A;  2WSA A;  4P4F A;  4Q7A A;  2PC1 A;  5DS0 A;  3BXM A;  4C2Y A;  2ZEM A;  3FEE A;  4BBH A;  4CAX A;  4B6Z A;  3FNC A;  1CP7 A;  2EVN A;  4P4D A;  4M6G A;  4RUH A;  5AG7 A;  1CG2 A;  3G3S A;  2ZW5 A;  3PB4 X;  2ZW6 A;  2GU2 A;  3KR5 A;  4IHM A;  3H8E A;  4QBJ A;  4F0Y A;  1XIX A;  3H5Z A;  4ZY2 A;  2QVP A;  3TO9 A;  4UEZ A;  4P4J A;  1FNO A;  2AFU A;  4R8F A;  2VZZ A;  4MCQ A;  4MHZ A;  4NSQ A;  2IQ6 A;  4C68 A;  3FJU A;  2ZEO A;  2R98 A;  3ISX A;  4UEF A;  1M44 A;  3NH8 A;  5AG5 A;  4EWT A;  4H2K A;  3PGP A;  1Z8L A;  3FXT A;  3IWW A;  4NGM A;  4P4B A;  3SI2 A;  4A39 A;  2V77 A;  5D29 A;  3VWE A;  2G0B A;  1RXT A;  1Y0Y A;  4A33 A;  4OC0 A;  2DPS A;  1FY7 A;  1XJO A;  1QMU A;  1S7L A;  1DE4 C;  5AG4 A;  2B5G A;  4KVO E;  4M3S A;  2DF5 A;  1YGH A;  2VEZ A;  2FVG A;  5G22 A;  4AB7 A;  7CPA A;  4KLV A;  2JLM A;  2GLF A;  1SQH A;  1IGB A;  1S7K A;  2D4P A;  2Q4V A;  4UWI A;  2I3C A;  3KL9 A;  4X8I A;  4FD4 A;  3QNV A;  2Z0Z A;  3PZJ A;  1YVK A;  2CY2 A;  3OWC A;  3RYO A;  5EMI A;  4P4I A;  4XPK A;  4H6Z A;  2IJZ A;  2YNE A;  4JYW A;  4A95 A;  3TO6 A;  5IV0 A;  1VHE A;  2R8V A;  1Z5R A;  5I4M A;  3KAS A;  4PSW A;  3S6K A;  3PBE A;  2B4D A;  4B14 A;  2OH1 A;  2BSW A;  5C88 A;  2FXF A;  3KGQ A;  3PFE A;  5KTA A;  2JEW A;  4OAE A;  1PUA A;  5E96 A;  3IFE A;  4MI4 A;  4NGR A;  4PK3 A;  5LYI A;  3TCV A;  3V7Z A;  3R1K A;  4MCS A;  2Q7S A;  2ZEF A; 
#chains in the Genus database with same CATH homology
 4KOV A;  2WPW A;  2CXA A;  4CAW A;  2NMT A;  2D4O A;  4XPL A;  4YGO A;  3DDD A;  3QB8 A;  1S60 A;  3I9S A;  3JTK A;  2AJ6 A;  4OAD A;  4AVB A;  5J8C A;  4MFL A;  4CGN A;  4JD6 A;  1OZP A;  2IL4 A;  1LRZ A;  1Y9W A;  4L89 A;  2X7B A;  5EC4 A;  3IWE A;  4B13 A;  4ONU A;  1WK4 A;  2CNM A;  1CM0 A;  4J3G A;  1KUV A;  2ZW7 A;  3IWG A;  4B11 A;  1RO5 A;  2WPX A;  5DWN A;  1R57 A;  2OB0 A;  1IIC A;  2CNT A;  2GAN A;  2J8R A;  2VBQ A;  3MGD A;  4EVY A;  1MJ9 A;  4H6U A;  4MFK A;  3T90 A;  3CXS A;  5F48 A;  2ZW4 A;  2OZH A;  4CRY B;  3TE4 A;  3IU1 A;  5F49 A;  5G1Z A;  3VWD A;  3W6S A;  2K5T A;  3D3S A;  4M85 A;  3S6H A;  3TTH A;  4H89 A;  4QBJ A;  4C7I A;  3SXO A;  3TO7 A;  2VXK A;  2Q04 A;  3B8G A;  1WWZ A;  2ZPA A;  4HNY B;  2CNS A;  2DXQ A;  2HQY A;  1B87 A;  3A9L A;  3D8P A;  1MJB A;  3GKR A;  3JUW A;  4FD7 A;  4UCN A;  4XPD C;  4KOX A;  3UY5 A;  1QST A;  2Q7B A;  4CYP A;  5HMN A;  2OU2 A;  1QSO A;  1V0C A;  4UA3 A;  3FBU A;  4B5O A;  4KVX A;  3CXQ A;  4I49 A;  1ON0 A;  4MBU A;  2GIV A;  5CNP A;  4KSA A;  3E0K A;  4RS2 A;  1XE4 A;  2AE6 A;  3P2F A;  1QSN A;  4RI1 A;  3TOA A;  1U6M A;  4XNH C;  4MHD A;  3GY9 A;  1I1D A;  4Y49 B;  4AG9 A;  2PDO A;  1Q2D A;  5KTC A;  1S5K A;  5DWM A;  2FE7 A;  1VHS A;  4KVM E;  2Q0Y A;  2Z3N A;  5GCN A;  1Z4R A;  3SHP A;  3W91 A;  3LD2 A;  4QUS A;  4UFX A;  2FIA A;  4R57 A;  5HH1 A;  4R87 A;  4NEX A;  4UCM A;  1ZO0 A;  3N7Z A;  2JEV A;  2VI7 A;  2P0W A;  2VQY A;  3R9F A;  4MY3 A;  1NE9 A;  2FS5 A;  3TFY A;  3EXN A;  4HNW B;  4CYQ A;  4MFP A;  4HNX B;  3DR8 A;  4NF1 A;  4UBR A;  3W6X A;  2I00 A;  5G20 A;  2B4B A;  4A31 A;  4KLW A;  5IB0 A;  4MJ8 A;  4NCZ A;  4IUS A;  4MFJ A;  1MK4 A;  3V8I A;  4CRZ B;  4MY0 A;  2REE A;  4ZGY B;  1NMT A;  2Z3M A;  3ZJ0 A;  3R96 A;  3FYN A;  5JPH A;  2ZXV A;  4A30 A;  4B5P B;  3CXP A;  4X5K A;  5A27 A;  1P0H A;  2WUU A;  4II9 A;  4AVC A;  3IU2 A;  2R1I A;  2Z3L A;  1YRE A;  4PK2 A;  3BJ8 A;  4LUA A;  4KOS A;  2PR8 A;  4ORF A;  4UFV A;  3EY5 A;  2I79 A;  4Q36 A;  4CGP A;  3BLN A;  2PSW A;  1S7N A;  3R95 A;  1VKC A;  3TOB A;  3S6F A;  3D2M A;  2P6G A;  4AG7 A;  5F47 A;  3WR7 A;  1N71 A;  2R7H A;  5H84 A;  4NXY A;  2EUI A;  3FB3 A;  3FRM A;  2Z11 A;  2Z3O A;  3EFA A;  1Q2C A;  3D2P A;  4ZBG A;  1S7F A;  3FIX A;  2B5G B;  2FIW A;  1IYK A;  4C2Z A;  4U5Y A;  1M4G A;  3S6G A;  4JXR A;  2JDD A;  4MFQ A;  5JQ4 A;  2F5I A;  1XF8 A;  2B4D B;  2DPT A;  4B14 A;  2BEI A;  4E0A A;  2FCK A;  5G21 A;  3F5B A;  4PV6 A;  2OZU A;  4OLL A;  3BJ7 A;  3P2H A;  4LX9 A;  4JJX A;  4QC6 A;  1I21 A;  1M4I A;  2A4N A;  4E2A A;  4A2Z A;  4KOT A;  3F8K A;  3C26 A;  3R9E A;  4KOW A;  2PR1 A;  2REF A;  4JLY A;  4CGO A;  2HUZ A;  4CYO A;  1IID A;  5IX3 A;  2YGW A;  2HV2 A;  4F6A A;  2VZY A;  3LOD A;  4KOU A;  4B10 A;  4KOR A;  3IGR A;  4KUA A;  4C7H A;  2P6E A;  3KKW A;  2RC4 A;  1KUY A;  2J8N A;  1K4J A;  3ZZI A;  1Y7R A;  3F0A A;  3NE7 A;  4CYN A;  1KUX A;  4BMH A;  3TT2 A;  2KCW A;  5EBV A;  5ISV A;  3GYA A;  1B6B A;  1M1D A;  2FSR A;  1IYL A;  2Q44 A;  1QSR A;  5AG6 A;  2FL4 A;  1Y9K A;  3DNS A;  4R9M A;  1XMT A;  4KOY A;  1TIQ A;  4DNC A;  4C2X A;  4K30 A;  1YK3 A;  1XEB A;  4XPD B;  5BWA B;  1BOB A;  4GS4 A;  4KS9 A;  2PRB A;  2Y0M A;  4PSX A;  3DR6 A;  2QEC A;  4FD5 A;  2FT0 A;  4CAF A;  3K9U A;  4U9Z A;  3R9G A;  2QIR A;  4E8O A;  4QB9 A;  5F46 A;  2G3T A;  4U9Y A;  1L0C A;  4XNH B;  5FVJ A;  4UCP A;  4L8A A;  2OZG A;  4JWP A;  2ATR A;  2B58 A;  1CJW A;  2Z3K A;  1BO4 A;  2Z10 A;  3I3G A;  4CGL A;  3QAH A;  2B3U A;  4Y49 C;  1QSM A;  3G8W A;  2JDC A;  4A32 A;  4KZT A;  1J4J A;  1GHE A;  2B3V A;  1IB1 E;  3JVN A;  4CAE A;  2PQ8 A;  2YNC A;  1YVO A;  2G3A A;  2YNC C;  1KZF A;  3DSB A;  4QVT A;  1Z9U A;  4CAV A;  3H4Q A;  2P6F A;  3EO4 A;  5C82 A;  2BL1 A;  4UWJ A;  2BUE A;  2H5M A;  4KSF A;  1P4N A;  2O28 A;  4YFJ A;  1PU9 A;  2Q4Y A;  2C27 A;  1YR0 A;  2Z3P A;  4CS0 B;  3PP9 A;  4FD6 A;  5I0C A;  4F0X A;  5KTD A;  3EC4 A;  2J8M A;  1UFH A;  1Q2Y A;  4JXQ A;  1Z4E A;  4Q38 A;  2ARH A;  2GE3 A;  4UFW A;  1I12 A;  5AGE A;  4YRH A;  5H86 A;  4B5P A;  1NSL A;  5A28 A;  2YND A;  1S3Z A;  4HKF A;  4MFZ A;  1M4D A;  1YX0 A;  4CGM A;  3SXN A;  1YLE A;  3T9Y A;  4AVA A;  2QML A;  4IF5 A;  4B12 A;  1MJA A;  4KUB A;  4R3L A;  5J8F A;  4R3K A;  2WSA A;  4C2Y A;  2PC1 A;  4BBH A;  4CAX A;  3FNC A;  2EVN A;  5AG7 A;  3G3S A;  2ZW5 A;  2ZW6 A;  4F0Y A;  1XIX A;  3TO9 A;  2VZZ A;  4C68 A;  4NSQ A;  2R98 A;  5AG5 A;  1M44 A;  3PGP A;  3FXT A;  3VWE A;  2G0B A;  1RXT A;  4A33 A;  2DPS A;  1FY7 A;  1S7L A;  5AG4 A;  2B5G A;  4KVO E;  4M3S A;  1YGH A;  2VEZ A;  5G22 A;  4AB7 A;  4KLV A;  2JLM A;  1SQH A;  4UWI A;  1S7K A;  2D4P A;  2Q4V A;  4FD4 A;  2Z0Z A;  3PZJ A;  1YVK A;  2CY2 A;  3OWC A;  3RYO A;  4XPK A;  4H6Z A;  2YNE A;  4A95 A;  3TO6 A;  5IV0 A;  2R8V A;  4PSW A;  3S6K A;  2B4D A;  2OH1 A;  2BSW A;  5C88 A;  2FXF A;  5KTA A;  4OAE A;  1PUA A;  5E96 A;  4MI4 A;  4PK3 A;  3TCV A;  3R1K A;  3H5Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...