4FD7A

Crystal structure of insect putative arylalkylamine n-acetyltransferase 7 from the yellow fever mosquito aedes aegypt
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
237
structure length
237
Chain Sequence
b'KWTRSVKVPFPSVWHRFQAKDLTSQQLVWYRVQDLPEDRFEDAIRHMCDYFARDELMNQAKGLAKDLVAMGDVVALWKAMLPDRMSLVCFREGSDEIVGVNILDVASRSDKDNAQFNSAIFQAIYDTIEYVSHQANIFDRYNVDHYLNAMGLSVDPKYRGRGIATEILRARIPLCRAVGLKLSATCFTGPNSQTAATRVGFQEDFTITYGELARVDQRFNYPGIEENFCKYMSLRVD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords putative arylalkylamine N-Acetyltransferase 7
molecule tags Transferase
source organism Aedes aegypti
publication title Evolution of insect arylalkylamine N-acetyltransferases: structural evidence from the yellow fever mosquito, Aedes aegypti.
pubmed doi rcsb
total genus 83
structure length 237
sequence length 237
chains with identical sequence B, C, D
ec nomenclature ec 2.3.1.87: Aralkylamine N-acetyltransferase.
pdb deposition date 2012-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4fd7A00
1Y9KA 3EFAA 1MJAA 3TOAA 3DNSA 1GHEA 2J8MA 2J8RA 4YRHA 3ZJ0A 1U6MA 1IB1E 2J8NA 1N71A 2PRBA 2AE6A 3GKRA 2ZW6A 4JJXA 4NF1A 4MY0A 4KOYA 5KTAA 3EC4A 1S5KA 1Y9WA 1M4IA 3K9UA 1YK3A 2FE7A 4F6AA 2P0WA 2G0BA 3WR7A 4HNXB 3R9GA 4R3LA 4AB7A 2H5MA 4DNCA 5C82A 1V0CA 2Z10A 4JXQA 5IV0A 4PK3A 4EVYA 4CAVA 2OU2A 2JEVA 1NMTA 3I3GA 1R57A 2R7HA 4FD5A 4JLYA 2FIWA 4KOXA 3BJ7A 2GE3A 2BL1A 2I00A 3I9SA 3KKWA 2CNTA 3LD2A 3TOBA 3F5BA 2PC1A 4Y49C 1QSOA 4KLWA 3FRMA 4E8OA 5F48A 4QBJA 1CM0A 4CAWA 2Z0ZA 1YVOA 3H4QA 1KZFA 2R98A 1XF8A 1XIXA 4MJ8A 4AG7A 1UFHA 3QB8A 5IX3A 2P6FA 1KUYA 1YGHA 2P6GA 2VQYA 3PZJA 3PP9A 3S6FA 3DSBA 3PGPA 4BMHA 2B4BA 3F0AA 4XPDC 4NEXA 1LRZA 1IYLA 2NMTA 1M4GA 4XNHC 1IYKA 2HV2A 1P4NA 4ORFA 1QSTA 4M3SA 3P2FA 3D2PA 2Q0YA 2HUZA 3JUWA 4HKFA 3GY9A 5FVJA 3R1KA 2QIRA 2WPWA 1ON0A 1Z9UA 2FS5A 1PUAA 1I21A 5F49A 4ONUA 2K5TA 3S6HA 3MGDA 4IF5A 3EY5A 2Q04A 3FXTA 3R96A 1S3ZA 2CNMA 4QVTA 3N7ZA 2ZXVA 2PSWA 3UY5A 2FIAA 4XPKA 2B3UA 4KVXA 5CNPA 2OZGA 2FT0A 5E96A 4R3KA 4B5OA 5HH1A 5DWNA 3G3SA 1MK4A 2RC4A 3VWEA 4FD4A 5J8CA 1YREA 2OH1A 2Z11A 5KTCA 1B87A 3T90A 3E0KA 2FSRA 4II9A 4YFJA 4KVME 4MHDA 1Y7RA 4H6ZA 4AVAA 2P6EA 2C27A 2B3VA 2FL4A 1OZPA 3R9EA 4B5PB 2OB0A 4U9YA 1RXTA 3TCVA 4GS4A 5KTDA 2BEIA 5JQ4A 4HNWB 3V8IA 4K30A 2G3AA 1L0CA 4E0AA 4JWPA 2R8VA 3VWDA 4F0YA 5C88A 4KZTA 3D8PA 2B4DB 3EXNA 1MJ9A 5H86A 4LUAA 4YGOA 3ZZIA 2AJ6A 3TFYA 4I49A 3TTHA 1MJBA 2OZUA 4Y49B 2B5GB 2GIVA 4AVCA 3W91A 1IIDA 4IUSA 4PV6A 3W6SA 4JXRA 4MBUA 3SXOA 3R95A 3CXSA 1VKCA 3S6KA 1S7LA 2VXKA 4AVBA 3DDDA 4XPDB 1XE4A 5DWMA 4NCZA 1S7KA 4UWIA 1Q2CA 1YLEA 2IL4A 4KOUA 2CNSA 3D3SA 5ISVA 1Q2DA 2REEA 3NE7A 4KOSA 2BUEA 4FD6A 4RS2A 5I0CA 4KORA 5EC4A 2B58A 3SXNA 3T9YA 2KCWA 4H89A 3QAHA 2PR1A 2WPXA 1BOBA 4KUAA 2JLMA 3IWGA 4MI4A 4KUBA 4UA3A 1FY7A 4XPLA 1RO5A 1Z4EA 5EBVA 4PSXA 4NSQA 4B5PA 1VHSA 4AG9A 4QC6A 4KOVA 3IGRA 1KUVA 1SQHA 1QSNA 3W6XA 3GYAA 2R1IA 4CS0B 1K4JA 2EUIA 4UBRA 4OLLA 4UWJA 2Q7BA 4CAXA 2VBQA 3CXQA 1KUXA 2G3TA 2D4OA 4XNHB 2CY2A 3OWCA 1YX0A 2ZW5A 2A4NA 3FIXA 1Q2YA 3DR6A 3EO4A 2FCKA 2PDOA 2VZYA 1I12A 1M1DA 1WWZA 3TO9A 1P0HA 2PR8A 4L8AA 2ZW4A 4OAEA 4QUSA 2EVNA 4JD6A 3RYOA 4U9ZA 1IICA 4RI1A 4OADA 4J3GA 3D2MA 4HNYB 2ARHA 4FD7A 5JPHA 4M85A 2D4PA 2ZW7A 4R87A 2ATRA 1M44A 3FBUA 4R57A 4KOWA 2Q4YA 5HMNA 2JDCA 2VZZA 1XMTA 2Q4VA 3B8GA 2HQYA 3R9FA 3S6GA 3DR8A 4KOTA 1BO4A 1WK4A 3F8KA 4L89A 1CJWA 2GANA 1PU9A 3SHPA 2JDDA 1QSRA 2BSWA 5F47A 2DXQA 4KVOE 4PSWA 1QSMA 1YR0A 1YVKA 3FB3A 4LX9A 5GCNA 4MY3A 3BJ8A 3FYNA 4ZBGA 4CRZB 4KLVA 1S60A 4H6UA 2QMLA 3JVNA 1S7FA 2VI7A 5H84A 2ZPAA 3LODA 4E2AA 1I1DA 3CXPA 3TO7A 3TT2A 3G8WA 5F46A 1Z4RA 1M4DA 2X7BA 3TE4A 2FXFA 1NE9A 3FNCA 4PK2A 5IB0A 2F5IA 2Q44A 1TIQA 1NSLA 2I79A 1J4JA 3P2HA 2VEZA 3BLNA 4U5YA 2OZHA 2REFA 4CRYB 2B4DA 2O28A 4NXYA 2Y0MA 1B6BA 1S7NA 3C26A 4R9MA 4X5KA 1XEBA 4QB9A 2QECA 3TO6A 2B5GA 5J8FA 2PQ8A
chains in the Genus database with same CATH superfamily
1Y9KA 1ZLIA 4P44A 3EFAA 5LYLA 1MJAA 3TOAA 1ZG8A 2RB7A 3DNSA 3B7IA 2PJ8A 1XJOA 1GHEA 2J8MA 2J8RA 2QVPA 2GFQA 3K2KA 4P4DA 4ZX9A 1TXRA 3SJXA 4YRHA 3LWUA 1U6MA 3ZJ0A 1IB1E 2J8NA 1N71A 1Z5RA 2AE6A 2PRBA 3H8EA 2POKA 3GKRA 2ZW6A 4WJBA 2Z3OA 4JJXA 4NF1A 4MY0A 3B3WA 4KOYA 1ZO0A 4DJLA 4EMEA 5KTAA 2C6CA 3IWWA 3EC4A 1S5KA 4CYNA 1Y9WA 3PFEA 4O23A 3CDXA 3PEIA 4A95A 5J1QA 4ONWA 4Z65A 1M4IA 3K9UA 4KS9A 1YK3A 1ARLA 2FE7A 4BD9A 2P0WA 5AG5A 2G0BA 2YNCA 2HB6A 4C7IA 2WUUA 3DGVA 3PB7X 4HNXB 4KSFA 4OKOA 3WR7A 4P6YA 4CAFA 4EWTA 3R9GA 4R3LA 4P4IA 4AB7A 1HEEA 2H5MA 3KGQA 3RAMA 4A31A 3WC7A 2IQ6A 3GB0A 3D66A 4DNCA 1TF9A 5C82A 1V0CA 2DPTA 2WZNA 4X3RA 4NJQA 4B13A 2Z10A 4JXQA 4CPAA 5IV0A 1CP7A 1ZLHA 4ZGYB 2GLJA 4PK3A 1OBRA 4CAVA 2OU2A 4B10A 4EVYA 3RO0A 3SI0A 1YQEA 3VATA 2JEVA 1IOFA 4PPZA 1NMTA 3I3GA 1R57A 2R7HA 3GLJA 4MHZA 4FD5A 4CYQA 4CYPA 3D67A 3WC5A 4JLYA 4MHYA 3SJGA 2FIWA 4KOXA 3BJ7A 5D8NA 2GE3A 1CBXA 1CPXA 4G1PA 2BL1A 2I00A 3I9SA 4MFQA 5LRGA 3KKWA 2CNTA 4MFZA 5J8FA 1DE4C 3LD2A 4UEEA 3F5BA 3TOBA 2PC1A 4Y49C 4F9VA 1QSOA 4IHMA 4KLWA 3FRMA 4UFXA 1AYEA 4MXUA 4P4BA 1CX8A 4E8OA 1YMEA 5F48A 1CM0A 2IMOA 2Z0ZA 4CAWA 2WSAA 1ARMA 3FVLA 3FEDA 4QBJA 1YVOA 1XMBA 3H4QA 3KZWA 3LACA 2ABZA 1KZFA 3PB6X 2R98A 1IGBA 4UFWA 2O4HA 3D7HA 1XF8A 1XIXA 4MJ8A 4AG7A 1UFHA 2Q4ZA 3QB8A 3ISXA 4DUKA 5IX3A 2P6FA 1KUYA 1YGHA 5G22A 2P6GA 2Q7SA 1IOIA 2VQYA 3PZJA 5HXDA 3PP9A 3S6FA 3IC1A 2JBJA 3DSBA 3PGPA 3PBBA 4BMHA 2B4BA 3KR5A 3F0AA 4XPDC 4NEXA 1LRZA 1IYLA 2NMTA 1Y7EA 4CGOA 1M4GA 4JZ0A 4XNHC 1IYKA 3IJ3A 3V7ZA 2AFWA 2HV2A 1P4NA 3T8WA 3WABA 1IY7A 4UEFA 4F8ZA 2AFOA 4ORFA 1AUGA 1QSTA 3IU2A 3P2FA 4M3SA 2ZEHA 5G21A 4ZYQA 1BPMA 4P4JA 2VL1A 1CPSA 3D2PA 2Q0YA 3VARA 2HUZA 3JUWA 4HKFA 1HDUA 3GY9A 1XOVA 3PFOA 2PRQA 5FVJA 3R1KA 4MFPA 2ZEPA 2PJBA 2EBJA 2QIRA 3D7GA 1RTQA 2DF5A 2WPWA 1A2ZA 1ON0A 3A9LA 4AXVA 1JWQA 4R6TA 1Z9UA 2FS5A 1PUAA 2AFZA 1I21A 3K9TA 2YNDA 2JEWA 3B35A 5F49A 4ONUA 1Z8WA 2HC9A 2K5TA 3S6HA 4MCSA 3DLJA 4NGPA 4CGPA 2CTCA 2DPSA 3MGDA 4P4FA 3S9NA 2WYRA 4UF4A 4IF5A 2ZOFA 3EY5A 2PJ6A 2Q04A 3FXTA 4MCRA 5LYDA 1KWMA 4M6GA 5G1ZA 4C2ZA 5DS0A 3R96A 1S3ZA 2CNMA 4QVTA 4UFVA 2PIYA 2ZXVA 3KHXA 3N7ZA 3NH5A 3PB9X 4GM5A 2PSWA 8CPAA 4FBEA 3UY5A 3BXMA 2FIAA 4XPKA 4A2ZA 2B3UA 2F7VA 4KVXA 4ZI6A 5CNPA 5K8OA 2OZGA 4MHPA 4GXHA 1GYTA 4K3NA 2FT0A 5AG4A 5E96A 5EMIA 2PVVA 4R3KA 5HH1A 4A38A 5DWNA 2PJCA 2YGWA 2NSMA 4B5OA 5JH9A 4BINA 2ZEOA 1MK4A 3G3SA 4NGNA 2RC4A 3VWEA 4LQGA 2CIJA 3QAYA 4FD4A 4CYOA 3H8FA 2XEGA 3V38A 2G9DA 1XFOA 2BOAA 1NSAA 4MFLA 4DYOA 3FMCA 5HVGA 5AG6A 4OP4A 2Z3KA 3N5FA 5J8CA 3I1UA 4MCPA 5I4MA 3S9MA 1ELLP 4R76A 1TKJA 1YREA 2F8HA 2CF4A 2OH1A 4FAIA 2Z11A 4NGMA 1B87A 3T90A 3E0KA 5KTCA 2FSRA 4II9A 3L2NA 4YFJA 2ZEGA 4KVME 4R7MA 2V8VA 4MHDA 2C6PA 1Y7RA 4H6ZA 3MRUA 3CPAA 4AVAA 2PE3A 2P6EA 2QJ8A 4OC1A 1Z8LA 2B3VA 1JQGA 2C27A 3IU1A 5D29A 3SJEA 3S9LA 2FL4A 1OZPA 4UIBA 1LCPA 3NA6A 3R9EA 4B5PB 4OC4A 3BI1A 5K8NA 2OB0A 4U9YA 1RXTA 3TCVA 4GS4A 4RN7A 5KTDA 2Z3PA 4NGRA 1CG2A 2XEJA 2GU2A 4PXEA 4FUUA 3RBUA 4OC2A 1LANA 2BEIA 3BHXA 1CP6A 5JGFA 4MMOA 2Q43A 5JQ4A 3TC8A 4HNWB 3V8IA 2YNCC 4K30A 2G3AA 5CBMA 4A37A 3RYOA 3FH4A 1L0CA 4E0AA 2R8VA 4JWPA 1BLLE 3KASA 3VWDA 4F0YA 2C1CA 5C88A 3JTKA 4KZTA 3D8PA 2B4DB 5A27A 2AFUA 3EXNA 1MJ9A 4W9YA 4CGNA 5H86A 3KL9A 4LUAA 3WC6A 4YGOA 1R43A 4IK2A 3ZZIA 3FECA 2GREA 4ZY0A 2AJ6A 4C2XA 2PCUA 2ZEEA 3TFYA 4I49A 1PCAA 4OC3A 3TTHA 4TWEA 1MJBA 2OZUA 4Y49B 2B5GB 2GIVA 4R8FA 3W91A 1IIDA 4IUSA 4PV6A 3W6SA 1LOKA 4OC5A 1F2PA 4JXRA 4MBUA 3SXOA 2BO9A 2NYQA 2PJ0A 3R95A 3CXSA 3FF3A 4P10A 1VKCA 4RUHA 5BWAB 3S6KA 1S7LA 2DEAA 2VXKA 3SI1A 4AVBA 5THWA 3DDDA 1LAMA 2EO8A 4XPDB 1XE4A 5IB9A 5DWMA 3PBEA 1Z2LA 4UCMA 4UCPA 4NCZA 3FEEA 1S7KA 4UWIA 2BCOA 1Q2CA 1YLEA 3IIBA 2C6GA 4YWYA 3RZAA 2IL4A 4KOUA 4NGQA 2CNSA 3D3SA 1EE3P 3NH8A 2AFXA 5ISVA 1Q2DA 2REEA 3NE7A 4KOSA 1TKFA 2BUEA 2I3CA 4FD6A 4RS2A 2AFMA 5I0CA 4KORA 5EC4A 2PJ1A 2B58A 3SXNA 3T9YA 2RFHA 2KCWA 4H89A 4AVCA 3QAHA 2OR4A 2PR1A 2WPXA 4A30A 1BOBA 3GUXA 2OOTA 4KUAA 2JLMA 3IWGA 4MI4A 2CTBA 3QNVA 4KUBA 5AG7A 5K8MA 4UA3A 4Q36A 1VIXA 1FY7A 4HPSA 4XPLA 4B12A 3B3VA 4M6IA 1RO5A 1Z4EA 4A33A 3PRTA 3CZXA 4B11A 1ELMP 5EBVA 4PSXA 5HVHA 5K8PA 1R3NA 2Z3LA 4NSQA 4KSAA 4B5PA 1VHSA 4AG9A 3BI0A 4QC6A 3PB4X 4KOVA 2V8HA 4PXDA 3GIUA 4NGTA 1BPNA 1KUVA 3IGRA 1F2OA 1LFWA 1SQHA 1UWYA 1QSNA 3W6XA 3GYAA 4C7HA 4F9UA 3D4UA 2R1IA 3H8GA 4CS0B 1K4JA 3D68A 2EUIA 4NFRA 4OLLA 4UBRA 4UWJA 2Q7BA 4C2YA 4CAXA 2V77A 2VBQA 3CXQA 3VH9A 1KUXA 2G3TA 3ISZA 2D4OA 4XNHB 2CY2A 3OWCA 2PJ4A 4LQ6A 4P4EA 1YX0A 2ZW5A 1H8LA 3NFZA 2A4NA 2ZEFA 3FIXA 1Q2YA 3DR6A 4B6ZA 2EK8A 4UEZA 1TKHA 2PJ9A 1YW6A 2EK9A 2FCKA 3EO4A 2PDOA 2VZYA 1I12A 1M1DA 1WWZA 1XBUA 3TO9A 1P0HA 2PR8A 3IEHA 4L8AA 1Q7LA 4MFKA 2ZW4A 2ZOGA 5F09A 3LMSA 1YSJA 5LYIA 5A28A 2Z3NA 4OAEA 1VHEA 4QUSA 1X12A 3B3TA 2EVNA 4JD6A 4JYWA 3CPXA 4P45A 1VHOA 1IICA 4TNUA 4U9ZA 1AMPA 4RI1A 5CPAA 4OADA 4C68A 4J3GA 3D2MA 2YNEA 4HNYB 1YLOA 1Y0YA 2ARHA 3TX8A 4FD7A 5JPHA 4M85A 2D4PA 4A32A 2ZW7A 4BBHA 5LRKA 4R87A 2ATRA 2PJ7A 1M44A 3FBUA 4FWUA 4R57A 4KOWA 2XEIA 1X10A 2Q4YA 2ZELA 4WWVA 5HMNA 4X8IA 3JRUA 4MHNA 2JDCA 2ODFA 2J9AA 2VZZA 4CGMA 4F6AA 1XMTA 3B2YA 1YW4A 2Q4VA 3B8GA 3D7FA 3KR4A 2CXAA 2HQYA 1VGYA 3R9FA 6CPAA 3PB8X 4M6HA 3S6GA 2Q51A 3DR8A 4KOTA 1BO4A 3IFEA 2PJ2A 2AFSA 3RNZA 7CPAA 1WK4A 3F8KA 4X2TA 3CT9A 4KSIA 4L89A 1CJWA 4Q7AA 4CGLA 2GANA 2JBKA 1PU9A 3SJFA 3SHPA 2JDDA 1QSRA 2BSWA 5F47A 5ELYA 5LYFA 2DXQA 4KVOE 4PSWA 5HVFA 4ZY1A 1QSMA 1YR0A 1YVKA 4OC0A 5G20A 4B14A 5JM6A 3FB3A 1HDQA 2GLFA 3NH4A 4LX9A 4OIWA 1FT7A 4UCNA 5GCNA 3WT4A 4MY3A 3BJ8A 3FYNA 4ZBGA 4CRZB 2IJZA 1LAPA 1Z8TA 4KLVA 1S60A 4H6UA 3KQXA 4UIAA 4PQAA 1FNOA 2QMLA 2ZENA 3JVNA 1S7FA 1Y0RA 2VI7A 1ZG7A 2PVWA 4A94A 2ANPA 5H84A 2ZPAA 4ZY2A 1DTDA 1QMUA 3LODA 1I1DA 1M4LA 4A39A 3IWEA 3CXPA 4E2AA 3SI2A 3TO7A 1IU8A 2QYVA 3G8WA 3TT2A 5F46A 4ZX8A 2FVGA 1Z4RA 3IO1A 4OMEA 4PXBA 2PJAA 2ZEDA 1PYTB 1M4DA 2X7BA 3KHZA 1ZG9A 4MRIA 2Z3MA 3KQZA 3TE4A 2FXFA 1NE9A 1QQ9A 2PJ3A 2PJ5A 3FNCA 4PK2A 5IB0A 2F5IA 4H2KA 4MFJA 2Q44A 1TIQA 2XEFA 1NSLA 3MN8A 2I79A 3FJUA 1J4JA 4EFDA 4CAEA 3B3CA 3P2HA 1TF8A 2VEZA 2V8DA 4PXCA 4F0XA 1F57A 3BLNA 2EWBA 3NE8A 4U5YA 2O53A 2OZHA 3HUVA 2REFA 4CRYB 4YU9A 3H5ZA 2B4DA 2PIZA 2O28A 2Y0MA 4NXYA 3KI9A 1B6BA 3D7DA 4OIDA 1S7NA 3C26A 4NGSA 1XRYA 3FX6A 4MCQA 4NJRA 4R9MA 1BAVA 4X5KA 4IAVA 1XEBA 3B3SA 4QB9A 5AGEA 1Z8XA 2ZEMA 5LRJA 4Q38A 2QECA 3TO6A 2B5GA 2V8GA 3HLPA 2PQ8A
chains in the Genus database with same CATH topology
1Y9KA 3EFAA 1MJAA 3TOAA 3DNSA 1GHEA 2J8MA 2J8RA 4YRHA 3ZJ0A 1U6MA 1IB1E 2J8NA 1N71A 2PRBA 2AE6A 3GKRA 2ZW6A 2Z3OA 4JJXA 4NF1A 4MY0A 4KOYA 1ZO0A 5KTAA 3EC4A 1S5KA 4CYNA 1Y9WA 4A95A 1M4IA 3K9UA 4KS9A 1YK3A 2FE7A 4F6AA 2P0WA 5AG5A 2G0BA 2YNCA 4C7IA 2WUUA 4KSFA 4HNXB 3WR7A 4CAFA 3R9GA 4R3LA 4AB7A 2H5MA 4A31A 4DNCA 5C82A 1V0CA 2DPTA 4B13A 2Z10A 4JXQA 5IV0A 4ZGYB 4PK3A 4EVYA 4CAVA 2OU2A 4B10A 2JEVA 4CYQA 1NMTA 3I3GA 1R57A 2R7HA 4CYPA 4FD5A 4JLYA 2FIWA 4KOXA 3BJ7A 2GE3A 4MFQA 2BL1A 2I00A 3I9SA 3KKWA 2CNTA 4MFZA 3LD2A 3TOBA 3F5BA 2PC1A 4Y49C 1QSOA 4KLWA 3FRMA 4UFXA 4E8OA 5F48A 4QBJA 1CM0A 4CAWA 2Z0ZA 2WSAA 1YVOA 3H4QA 1KZFA 2R98A 4UFWA 1XF8A 1XIXA 4MJ8A 4AG7A 1UFHA 3QB8A 5IX3A 2P6FA 1KUYA 1YGHA 5G22A 2P6GA 2VQYA 3PZJA 3PP9A 3S6FA 3DSBA 3PGPA 4BMHA 2B4BA 3F0AA 4XPDC 4NEXA 1LRZA 1IYLA 2NMTA 4CGOA 1M4GA 4XNHC 1IYKA 2HV2A 1P4NA 4ORFA 3IU2A 1QSTA 4M3SA 3P2FA 5G21A 3D2PA 2Q0YA 2HUZA 3JUWA 4HKFA 3GY9A 5FVJA 3R1KA 4MFPA 2QIRA 2WPWA 1ON0A 3A9LA 1Z9UA 2FS5A 1PUAA 1I21A 2YNDA 5F49A 4ONUA 2K5TA 3S6HA 4CGPA 2DPSA 3MGDA 4IF5A 3EY5A 2Q04A 3FXTA 5G1ZA 4C2ZA 3R96A 1S3ZA 2CNMA 4QVTA 4UFVA 3N7ZA 2ZXVA 2PSWA 3UY5A 2FIAA 4XPKA 4A2ZA 2B3UA 4KVXA 5CNPA 2OZGA 5AG4A 2FT0A 5E96A 4R3KA 4B5OA 5HH1A 5DWNA 2YGWA 3G3SA 1MK4A 2RC4A 3VWEA 4FD4A 4CYOA 4MFLA 5AG6A 2Z3KA 5J8CA 1YREA 2OH1A 2Z11A 5KTCA 1B87A 3T90A 3E0KA 2FSRA 4II9A 4YFJA 4KVME 4MHDA 1Y7RA 4H6ZA 4AVAA 2P6EA 2C27A 2B3VA 3IU1A 2FL4A 1OZPA 3R9EA 4B5PB 2OB0A 4U9YA 1RXTA 3TCVA 4GS4A 5KTDA 2Z3PA 2BEIA 5JQ4A 4HNWB 3V8IA 2YNCC 4K30A 2G3AA 1L0CA 4E0AA 4JWPA 2R8VA 3VWDA 4F0YA 5C88A 3JTKA 4KZTA 3D8PA 2B4DB 5A27A 3EXNA 1MJ9A 4CGNA 5H86A 4LUAA 4YGOA 3ZZIA 2AJ6A 4C2XA 3TFYA 4I49A 3TTHA 1MJBA 2OZUA 4Y49B 2B5GB 2GIVA 4AVCA 3W91A 1IIDA 4IUSA 4PV6A 3W6SA 4JXRA 4MBUA 3SXOA 3R95A 3CXSA 1VKCA 5BWAB 3S6KA 1S7LA 2VXKA 4AVBA 3DDDA 4XPDB 1XE4A 5DWMA 4UCMA 4UCPA 4NCZA 1S7KA 4UWIA 1Q2CA 1YLEA 2IL4A 4KOUA 2CNSA 3D3SA 5ISVA 1Q2DA 2REEA 3NE7A 4KOSA 2BUEA 4FD6A 4RS2A 5I0CA 4KORA 5EC4A 2B58A 3SXNA 3T9YA 2KCWA 4H89A 3QAHA 4A30A 2PR1A 2WPXA 1BOBA 4KUAA 2JLMA 3IWGA 4MI4A 5AG7A 4KUBA 4UA3A 4Q36A 1FY7A 4B12A 4XPLA 1RO5A 1Z4EA 4A33A 4B11A 5EBVA 4PSXA 2Z3LA 4NSQA 4KSAA 4B5PA 1VHSA 4AG9A 4QC6A 4KOVA 3IGRA 1KUVA 1SQHA 1QSNA 3W6XA 3GYAA 4C7HA 2R1IA 4CS0B 1K4JA 2EUIA 4UBRA 4OLLA 4UWJA 2Q7BA 4C2YA 4CAXA 2VBQA 3CXQA 1KUXA 2G3TA 2D4OA 4XNHB 2CY2A 3OWCA 1YX0A 2ZW5A 2A4NA 3FIXA 1Q2YA 3DR6A 3EO4A 2FCKA 2PDOA 2VZYA 1I12A 1M1DA 1WWZA 3TO9A 1P0HA 2PR8A 4L8AA 4MFKA 2ZW4A 5A28A 2Z3NA 4OAEA 4QUSA 2EVNA 4JD6A 3RYOA 4U9ZA 1IICA 4C68A 4RI1A 4OADA 4J3GA 3D2MA 2YNEA 4HNYB 2ARHA 4FD7A 5JPHA 4M85A 2D4PA 4A32A 2ZW7A 4BBHA 4R87A 2ATRA 1M44A 3FBUA 4R57A 4KOWA 2Q4YA 5HMNA 4CGMA 2JDCA 2VZZA 1XMTA 2Q4VA 3B8GA 2CXAA 2HQYA 3R9FA 3S6GA 3DR8A 4KOTA 1BO4A 1WK4A 3F8KA 4CGLA 4L89A 1CJWA 2GANA 1PU9A 3SHPA 2JDDA 1QSRA 2BSWA 5F47A 2DXQA 4KVOE 4PSWA 1QSMA 1YR0A 1YVKA 4B14A 5G20A 3FB3A 4LX9A 4UCNA 5GCNA 4MY3A 3BJ8A 3FYNA 4ZBGA 4CRZB 4KLVA 1S60A 4H6UA 2QMLA 3JVNA 1S7FA 2VI7A 5H84A 2ZPAA 3LODA 4E2AA 1I1DA 3IWEA 3CXPA 3TO7A 3TT2A 3G8WA 5F46A 1Z4RA 1M4DA 2X7BA 2Z3MA 3TE4A 2FXFA 1NE9A 3FNCA 4PK2A 5IB0A 2F5IA 4MFJA 2Q44A 1TIQA 1NSLA 2I79A 1J4JA 4CAEA 3P2HA 2VEZA 4F0XA 3BLNA 4U5YA 2OZHA 2REFA 4CRYB 3H5ZA 2B4DA 2O28A 2Y0MA 4NXYA 1B6BA 1S7NA 3C26A 4R9MA 4X5KA 1XEBA 4QB9A 5AGEA 4Q38A 2QECA 3TO6A 2B5GA 5J8FA 2PQ8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Y9K A;  3EFA A;  1MJA A;  3TOA A;  3DNS A;  1GHE A;  2J8M A;  2J8R A;  4YRH A;  3ZJ0 A;  1U6M A;  1IB1 E;  2J8N A;  1N71 A;  2PRB A;  2AE6 A;  3GKR A;  2ZW6 A;  4JJX A;  4NF1 A;  4MY0 A;  4KOY A;  5KTA A;  3EC4 A;  1S5K A;  1Y9W A;  1M4I A;  3K9U A;  1YK3 A;  2FE7 A;  4F6A A;  2P0W A;  2G0B A;  3WR7 A;  4HNX B;  3R9G A;  4R3L A;  4AB7 A;  2H5M A;  4DNC A;  5C82 A;  1V0C A;  2Z10 A;  4JXQ A;  5IV0 A;  4PK3 A;  4EVY A;  4CAV A;  2OU2 A;  2JEV A;  1NMT A;  3I3G A;  1R57 A;  2R7H A;  4FD5 A;  4JLY A;  2FIW A;  4KOX A;  3BJ7 A;  2GE3 A;  2BL1 A;  2I00 A;  3I9S A;  3KKW A;  2CNT A;  3LD2 A;  3TOB A;  3F5B A;  2PC1 A;  4Y49 C;  1QSO A;  4KLW A;  3FRM A;  4E8O A;  5F48 A;  4QBJ A;  1CM0 A;  4CAW A;  2Z0Z A;  1YVO A;  3H4Q A;  1KZF A;  2R98 A;  1XF8 A;  1XIX A;  4MJ8 A;  4AG7 A;  1UFH A;  3QB8 A;  5IX3 A;  2P6F A;  1KUY A;  1YGH A;  2P6G A;  2VQY A;  3PZJ A;  3PP9 A;  3S6F A;  3DSB A;  3PGP A;  4BMH A;  2B4B A;  3F0A A;  4XPD C;  4NEX A;  1LRZ A;  1IYL A;  2NMT A;  1M4G A;  4XNH C;  1IYK A;  2HV2 A;  1P4N A;  4ORF A;  1QST A;  4M3S A;  3P2F A;  3D2P A;  2Q0Y A;  2HUZ A;  3JUW A;  4HKF A;  3GY9 A;  5FVJ A;  3R1K A;  2QIR A;  2WPW A;  1ON0 A;  1Z9U A;  2FS5 A;  1PUA A;  1I21 A;  5F49 A;  4ONU A;  2K5T A;  3S6H A;  3MGD A;  4IF5 A;  3EY5 A;  2Q04 A;  3FXT A;  3R96 A;  1S3Z A;  2CNM A;  4QVT A;  3N7Z A;  2ZXV A;  2PSW A;  3UY5 A;  2FIA A;  4XPK A;  2B3U A;  4KVX A;  5CNP A;  2OZG A;  2FT0 A;  5E96 A;  4R3K A;  4B5O A;  5HH1 A;  5DWN A;  3G3S A;  1MK4 A;  2RC4 A;  3VWE A;  4FD4 A;  5J8C A;  1YRE A;  2OH1 A;  2Z11 A;  5KTC A;  1B87 A;  3T90 A;  3E0K A;  2FSR A;  4II9 A;  4YFJ A;  4KVM E;  4MHD A;  1Y7R A;  4H6Z A;  4AVA A;  2P6E A;  2C27 A;  2B3V A;  2FL4 A;  1OZP A;  3R9E A;  4B5P B;  2OB0 A;  4U9Y A;  1RXT A;  3TCV A;  4GS4 A;  5KTD A;  2BEI A;  5JQ4 A;  4HNW B;  3V8I A;  4K30 A;  2G3A A;  1L0C A;  4E0A A;  4JWP A;  2R8V A;  3VWD A;  4F0Y A;  5C88 A;  4KZT A;  3D8P A;  2B4D B;  3EXN A;  1MJ9 A;  5H86 A;  4LUA A;  4YGO A;  3ZZI A;  2AJ6 A;  3TFY A;  4I49 A;  3TTH A;  1MJB A;  2OZU A;  4Y49 B;  2B5G B;  2GIV A;  4AVC A;  3W91 A;  1IID A;  4IUS A;  4PV6 A;  3W6S A;  4JXR A;  4MBU A;  3SXO A;  3R95 A;  3CXS A;  1VKC A;  3S6K A;  1S7L A;  2VXK A;  4AVB A;  3DDD A;  4XPD B;  1XE4 A;  5DWM A;  4NCZ A;  1S7K A;  4UWI A;  1Q2C A;  1YLE A;  2IL4 A;  4KOU A;  2CNS A;  3D3S A;  5ISV A;  1Q2D A;  2REE A;  3NE7 A;  4KOS A;  2BUE A;  4FD6 A;  4RS2 A;  5I0C A;  4KOR A;  5EC4 A;  2B58 A;  3SXN A;  3T9Y A;  2KCW A;  4H89 A;  3QAH A;  2PR1 A;  2WPX A;  1BOB A;  4KUA A;  2JLM A;  3IWG A;  4MI4 A;  4KUB A;  4UA3 A;  1FY7 A;  4XPL A;  1RO5 A;  1Z4E A;  5EBV A;  4PSX A;  4NSQ A;  4B5P A;  1VHS A;  4AG9 A;  4QC6 A;  4KOV A;  3IGR A;  1KUV A;  1SQH A;  1QSN A;  3W6X A;  3GYA A;  2R1I A;  4CS0 B;  1K4J A;  2EUI A;  4UBR A;  4OLL A;  4UWJ A;  2Q7B A;  4CAX A;  2VBQ A;  3CXQ A;  1KUX A;  2G3T A;  2D4O A;  4XNH B;  2CY2 A;  3OWC A;  1YX0 A;  2ZW5 A;  2A4N A;  3FIX A;  1Q2Y A;  3DR6 A;  3EO4 A;  2FCK A;  2PDO A;  2VZY A;  1I12 A;  1M1D A;  1WWZ A;  3TO9 A;  1P0H A;  2PR8 A;  4L8A A;  2ZW4 A;  4OAE A;  4QUS A;  2EVN A;  4JD6 A;  3RYO A;  4U9Z A;  1IIC A;  4RI1 A;  4OAD A;  4J3G A;  3D2M A;  4HNY B;  2ARH A;  4FD7 A;  5JPH A;  4M85 A;  2D4P A;  2ZW7 A;  4R87 A;  2ATR A;  1M44 A;  3FBU A;  4R57 A;  4KOW A;  2Q4Y A;  5HMN A;  2JDC A;  2VZZ A;  1XMT A;  2Q4V A;  3B8G A;  2HQY A;  3R9F A;  3S6G A;  3DR8 A;  4KOT A;  1BO4 A;  1WK4 A;  3F8K A;  4L89 A;  1CJW A;  2GAN A;  1PU9 A;  3SHP A;  2JDD A;  1QSR A;  2BSW A;  5F47 A;  2DXQ A;  4KVO E;  4PSW A;  1QSM A;  1YR0 A;  1YVK A;  3FB3 A;  4LX9 A;  5GCN A;  4MY3 A;  3BJ8 A;  3FYN A;  4ZBG A;  4CRZ B;  4KLV A;  1S60 A;  4H6U A;  2QML A;  3JVN A;  1S7F A;  2VI7 A;  5H84 A;  2ZPA A;  3LOD A;  4E2A A;  1I1D A;  3CXP A;  3TO7 A;  3TT2 A;  3G8W A;  5F46 A;  1Z4R A;  1M4D A;  2X7B A;  3TE4 A;  2FXF A;  1NE9 A;  3FNC A;  4PK2 A;  5IB0 A;  2F5I A;  2Q44 A;  1TIQ A;  1NSL A;  2I79 A;  1J4J A;  3P2H A;  2VEZ A;  3BLN A;  4U5Y A;  2OZH A;  2REF A;  4CRY B;  2B4D A;  2O28 A;  4NXY A;  2Y0M A;  1B6B A;  1S7N A;  3C26 A;  4R9M A;  4X5K A;  1XEB A;  4QB9 A;  2QEC A;  3TO6 A;  2B5G A;  5J8F A;  2PQ8 A; 
#chains in the Genus database with same CATH topology
 1Y9K A;  1ZLI A;  4P44 A;  3EFA A;  5LYL A;  1MJA A;  3TOA A;  1ZG8 A;  2RB7 A;  3DNS A;  3B7I A;  2PJ8 A;  1XJO A;  1GHE A;  2J8M A;  2J8R A;  2QVP A;  2GFQ A;  3K2K A;  4P4D A;  4ZX9 A;  1TXR A;  3SJX A;  4YRH A;  3LWU A;  1U6M A;  3ZJ0 A;  1IB1 E;  2J8N A;  1N71 A;  1Z5R A;  2AE6 A;  2PRB A;  3H8E A;  2POK A;  3GKR A;  2ZW6 A;  4WJB A;  2Z3O A;  4JJX A;  4NF1 A;  4MY0 A;  3B3W A;  4KOY A;  1ZO0 A;  4DJL A;  4EME A;  5KTA A;  2C6C A;  3IWW A;  3EC4 A;  1S5K A;  4CYN A;  1Y9W A;  3PFE A;  4O23 A;  3CDX A;  3PEI A;  4A95 A;  5J1Q A;  4ONW A;  4Z65 A;  1M4I A;  3K9U A;  4KS9 A;  1YK3 A;  1ARL A;  2FE7 A;  4BD9 A;  2P0W A;  5AG5 A;  2G0B A;  2YNC A;  2HB6 A;  4C7I A;  2WUU A;  3DGV A;  3PB7 X;  4HNX B;  4KSF A;  4OKO A;  3WR7 A;  4P6Y A;  4CAF A;  4EWT A;  3R9G A;  4R3L A;  4P4I A;  4AB7 A;  1HEE A;  2H5M A;  3KGQ A;  3RAM A;  4A31 A;  3WC7 A;  2IQ6 A;  3GB0 A;  3D66 A;  4DNC A;  1TF9 A;  5C82 A;  1V0C A;  2DPT A;  2WZN A;  4X3R A;  4NJQ A;  4B13 A;  2Z10 A;  4JXQ A;  4CPA A;  5IV0 A;  1CP7 A;  1ZLH A;  4ZGY B;  2GLJ A;  4PK3 A;  1OBR A;  4CAV A;  2OU2 A;  4B10 A;  4EVY A;  3RO0 A;  3SI0 A;  1YQE A;  3VAT A;  2JEV A;  1IOF A;  4PPZ A;  1NMT A;  3I3G A;  1R57 A;  2R7H A;  3GLJ A;  4MHZ A;  4FD5 A;  4CYQ A;  4CYP A;  3D67 A;  3WC5 A;  4JLY A;  4MHY A;  3SJG A;  2FIW A;  4KOX A;  3BJ7 A;  5D8N A;  2GE3 A;  1CBX A;  1CPX A;  4G1P A;  2BL1 A;  2I00 A;  3I9S A;  4MFQ A;  5LRG A;  3KKW A;  2CNT A;  4MFZ A;  5J8F A;  1DE4 C;  3LD2 A;  4UEE A;  3F5B A;  3TOB A;  2PC1 A;  4Y49 C;  4F9V A;  1QSO A;  4IHM A;  4KLW A;  3FRM A;  4UFX A;  1AYE A;  4MXU A;  4P4B A;  1CX8 A;  4E8O A;  1YME A;  5F48 A;  1CM0 A;  2IMO A;  2Z0Z A;  4CAW A;  2WSA A;  1ARM A;  3FVL A;  3FED A;  4QBJ A;  1YVO A;  1XMB A;  3H4Q A;  3KZW A;  3LAC A;  2ABZ A;  1KZF A;  3PB6 X;  2R98 A;  1IGB A;  4UFW A;  2O4H A;  3D7H A;  1XF8 A;  1XIX A;  4MJ8 A;  4AG7 A;  1UFH A;  2Q4Z A;  3QB8 A;  3ISX A;  4DUK A;  5IX3 A;  2P6F A;  1KUY A;  1YGH A;  5G22 A;  2P6G A;  2Q7S A;  1IOI A;  2VQY A;  3PZJ A;  5HXD A;  3PP9 A;  3S6F A;  3IC1 A;  2JBJ A;  3DSB A;  3PGP A;  3PBB A;  4BMH A;  2B4B A;  3KR5 A;  3F0A A;  4XPD C;  4NEX A;  1LRZ A;  1IYL A;  2NMT A;  1Y7E A;  4CGO A;  1M4G A;  4JZ0 A;  4XNH C;  1IYK A;  3IJ3 A;  3V7Z A;  2AFW A;  2HV2 A;  1P4N A;  3T8W A;  3WAB A;  1IY7 A;  4UEF A;  4F8Z A;  2AFO A;  4ORF A;  1AUG A;  1QST A;  3IU2 A;  3P2F A;  4M3S A;  2ZEH A;  5G21 A;  4ZYQ A;  1BPM A;  4P4J A;  2VL1 A;  1CPS A;  3D2P A;  2Q0Y A;  3VAR A;  2HUZ A;  3JUW A;  4HKF A;  1HDU A;  3GY9 A;  1XOV A;  3PFO A;  2PRQ A;  5FVJ A;  3R1K A;  4MFP A;  2ZEP A;  2PJB A;  2EBJ A;  2QIR A;  3D7G A;  1RTQ A;  2DF5 A;  2WPW A;  1A2Z A;  1ON0 A;  3A9L A;  4AXV A;  1JWQ A;  4R6T A;  1Z9U A;  2FS5 A;  1PUA A;  2AFZ A;  1I21 A;  3K9T A;  2YND A;  2JEW A;  3B35 A;  5F49 A;  4ONU A;  1Z8W A;  2HC9 A;  2K5T A;  3S6H A;  4MCS A;  3DLJ A;  4NGP A;  4CGP A;  2CTC A;  2DPS A;  3MGD A;  4P4F A;  3S9N A;  2WYR A;  4UF4 A;  4IF5 A;  2ZOF A;  3EY5 A;  2PJ6 A;  2Q04 A;  3FXT A;  4MCR A;  5LYD A;  1KWM A;  4M6G A;  5G1Z A;  4C2Z A;  5DS0 A;  3R96 A;  1S3Z A;  2CNM A;  4QVT A;  4UFV A;  2PIY A;  2ZXV A;  3KHX A;  3N7Z A;  3NH5 A;  3PB9 X;  4GM5 A;  2PSW A;  8CPA A;  4FBE A;  3UY5 A;  3BXM A;  2FIA A;  4XPK A;  4A2Z A;  2B3U A;  2F7V A;  4KVX A;  4ZI6 A;  5CNP A;  5K8O A;  2OZG A;  4MHP A;  4GXH A;  1GYT A;  4K3N A;  2FT0 A;  5AG4 A;  5E96 A;  5EMI A;  2PVV A;  4R3K A;  5HH1 A;  4A38 A;  5DWN A;  2PJC A;  2YGW A;  2NSM A;  4B5O A;  5JH9 A;  4BIN A;  2ZEO A;  1MK4 A;  3G3S A;  4NGN A;  2RC4 A;  3VWE A;  4LQG A;  2CIJ A;  3QAY A;  4FD4 A;  4CYO A;  3H8F A;  2XEG A;  3V38 A;  2G9D A;  1XFO A;  2BOA A;  1NSA A;  4MFL A;  4DYO A;  3FMC A;  5HVG A;  5AG6 A;  4OP4 A;  2Z3K A;  3N5F A;  5J8C A;  3I1U A;  4MCP A;  5I4M A;  3S9M A;  1ELL P;  4R76 A;  1TKJ A;  1YRE A;  2F8H A;  2CF4 A;  2OH1 A;  4FAI A;  2Z11 A;  4NGM A;  1B87 A;  3T90 A;  3E0K A;  5KTC A;  2FSR A;  4II9 A;  3L2N A;  4YFJ A;  2ZEG A;  4KVM E;  4R7M A;  2V8V A;  4MHD A;  2C6P A;  1Y7R A;  4H6Z A;  3MRU A;  3CPA A;  4AVA A;  2PE3 A;  2P6E A;  2QJ8 A;  4OC1 A;  1Z8L A;  2B3V A;  1JQG A;  2C27 A;  3IU1 A;  5D29 A;  3SJE A;  3S9L A;  2FL4 A;  1OZP A;  4UIB A;  1LCP A;  3NA6 A;  3R9E A;  4B5P B;  4OC4 A;  3BI1 A;  5K8N A;  2OB0 A;  4U9Y A;  1RXT A;  3TCV A;  4GS4 A;  4RN7 A;  5KTD A;  2Z3P A;  4NGR A;  1CG2 A;  2XEJ A;  2GU2 A;  4PXE A;  4FUU A;  3RBU A;  4OC2 A;  1LAN A;  2BEI A;  3BHX A;  1CP6 A;  5JGF A;  4MMO A;  2Q43 A;  5JQ4 A;  3TC8 A;  4HNW B;  3V8I A;  2YNC C;  4K30 A;  2G3A A;  5CBM A;  4A37 A;  3RYO A;  3FH4 A;  1L0C A;  4E0A A;  2R8V A;  4JWP A;  1BLL E;  3KAS A;  3VWD A;  4F0Y A;  2C1C A;  5C88 A;  3JTK A;  4KZT A;  3D8P A;  2B4D B;  5A27 A;  2AFU A;  3EXN A;  1MJ9 A;  4W9Y A;  4CGN A;  5H86 A;  3KL9 A;  4LUA A;  3WC6 A;  4YGO A;  1R43 A;  4IK2 A;  3ZZI A;  3FEC A;  2GRE A;  4ZY0 A;  2AJ6 A;  4C2X A;  2PCU A;  2ZEE A;  3TFY A;  4I49 A;  1PCA A;  4OC3 A;  3TTH A;  4TWE A;  1MJB A;  2OZU A;  4Y49 B;  2B5G B;  2GIV A;  4R8F A;  3W91 A;  1IID A;  4IUS A;  4PV6 A;  3W6S A;  1LOK A;  4OC5 A;  1F2P A;  4JXR A;  4MBU A;  3SXO A;  2BO9 A;  2NYQ A;  2PJ0 A;  3R95 A;  3CXS A;  3FF3 A;  4P10 A;  1VKC A;  4RUH A;  5BWA B;  3S6K A;  1S7L A;  2DEA A;  2VXK A;  3SI1 A;  4AVB A;  5THW A;  3DDD A;  1LAM A;  2EO8 A;  4XPD B;  1XE4 A;  5IB9 A;  5DWM A;  3PBE A;  1Z2L A;  4UCM A;  4UCP A;  4NCZ A;  3FEE A;  1S7K A;  4UWI A;  2BCO A;  1Q2C A;  1YLE A;  3IIB A;  2C6G A;  4YWY A;  3RZA A;  2IL4 A;  4KOU A;  4NGQ A;  2CNS A;  3D3S A;  1EE3 P;  3NH8 A;  2AFX A;  5ISV A;  1Q2D A;  2REE A;  3NE7 A;  4KOS A;  1TKF A;  2BUE A;  2I3C A;  4FD6 A;  4RS2 A;  2AFM A;  5I0C A;  4KOR A;  5EC4 A;  2PJ1 A;  2B58 A;  3SXN A;  3T9Y A;  2RFH A;  2KCW A;  4H89 A;  4AVC A;  3QAH A;  2OR4 A;  2PR1 A;  2WPX A;  4A30 A;  1BOB A;  3GUX A;  2OOT A;  4KUA A;  2JLM A;  3IWG A;  4MI4 A;  2CTB A;  3QNV A;  4KUB A;  5AG7 A;  5K8M A;  4UA3 A;  4Q36 A;  1VIX A;  1FY7 A;  4HPS A;  4XPL A;  4B12 A;  3B3V A;  4M6I A;  1RO5 A;  1Z4E A;  4A33 A;  3PRT A;  3CZX A;  4B11 A;  1ELM P;  5EBV A;  4PSX A;  5HVH A;  5K8P A;  1R3N A;  2Z3L A;  4NSQ A;  4KSA A;  4B5P A;  1VHS A;  4AG9 A;  3BI0 A;  4QC6 A;  3PB4 X;  4KOV A;  2V8H A;  4PXD A;  3GIU A;  4NGT A;  1BPN A;  1KUV A;  3IGR A;  1F2O A;  1LFW A;  1SQH A;  1UWY A;  1QSN A;  3W6X A;  3GYA A;  4C7H A;  4F9U A;  3D4U A;  2R1I A;  3H8G A;  4CS0 B;  1K4J A;  3D68 A;  2EUI A;  4NFR A;  4OLL A;  4UBR A;  4UWJ A;  2Q7B A;  4C2Y A;  4CAX A;  2V77 A;  2VBQ A;  3CXQ A;  3VH9 A;  1KUX A;  2G3T A;  3ISZ A;  2D4O A;  4XNH B;  2CY2 A;  3OWC A;  2PJ4 A;  4LQ6 A;  4P4E A;  1YX0 A;  2ZW5 A;  1H8L A;  3NFZ A;  2A4N A;  2ZEF A;  3FIX A;  1Q2Y A;  3DR6 A;  4B6Z A;  2EK8 A;  4UEZ A;  1TKH A;  2PJ9 A;  1YW6 A;  2EK9 A;  2FCK A;  3EO4 A;  2PDO A;  2VZY A;  1I12 A;  1M1D A;  1WWZ A;  1XBU A;  3TO9 A;  1P0H A;  2PR8 A;  3IEH A;  4L8A A;  1Q7L A;  4MFK A;  2ZW4 A;  2ZOG A;  5F09 A;  3LMS A;  1YSJ A;  5LYI A;  5A28 A;  2Z3N A;  4OAE A;  1VHE A;  4QUS A;  1X12 A;  3B3T A;  2EVN A;  4JD6 A;  4JYW A;  3CPX A;  4P45 A;  1VHO A;  1IIC A;  4TNU A;  4U9Z A;  1AMP A;  4RI1 A;  5CPA A;  4OAD A;  4C68 A;  4J3G A;  3D2M A;  2YNE A;  4HNY B;  1YLO A;  1Y0Y A;  2ARH A;  3TX8 A;  4FD7 A;  5JPH A;  4M85 A;  2D4P A;  4A32 A;  2ZW7 A;  4BBH A;  5LRK A;  4R87 A;  2ATR A;  2PJ7 A;  1M44 A;  3FBU A;  4FWU A;  4R57 A;  4KOW A;  2XEI A;  1X10 A;  2Q4Y A;  2ZEL A;  4WWV A;  5HMN A;  4X8I A;  3JRU A;  4MHN A;  2JDC A;  2ODF A;  2J9A A;  2VZZ A;  4CGM A;  4F6A A;  1XMT A;  3B2Y A;  1YW4 A;  2Q4V A;  3B8G A;  3D7F A;  3KR4 A;  2CXA A;  2HQY A;  1VGY A;  3R9F A;  6CPA A;  3PB8 X;  4M6H A;  3S6G A;  2Q51 A;  3DR8 A;  4KOT A;  1BO4 A;  3IFE A;  2PJ2 A;  2AFS A;  3RNZ A;  7CPA A;  1WK4 A;  3F8K A;  4X2T A;  3CT9 A;  4KSI A;  4L89 A;  1CJW A;  4Q7A A;  4CGL A;  2GAN A;  2JBK A;  1PU9 A;  3SJF A;  3SHP A;  2JDD A;  1QSR A;  2BSW A;  5F47 A;  5ELY A;  5LYF A;  2DXQ A;  4KVO E;  4PSW A;  5HVF A;  4ZY1 A;  1QSM A;  1YR0 A;  1YVK A;  4OC0 A;  5G20 A;  4B14 A;  5JM6 A;  3FB3 A;  1HDQ A;  2GLF A;  3NH4 A;  4LX9 A;  4OIW A;  1FT7 A;  4UCN A;  5GCN A;  3WT4 A;  4MY3 A;  3BJ8 A;  3FYN A;  4ZBG A;  4CRZ B;  2IJZ A;  1LAP A;  1Z8T A;  4KLV A;  1S60 A;  4H6U A;  3KQX A;  4UIA A;  4PQA A;  1FNO A;  2QML A;  2ZEN A;  3JVN A;  1S7F A;  1Y0R A;  2VI7 A;  1ZG7 A;  2PVW A;  4A94 A;  2ANP A;  5H84 A;  2ZPA A;  4ZY2 A;  1DTD A;  1QMU A;  3LOD A;  1I1D A;  1M4L A;  4A39 A;  3IWE A;  3CXP A;  4E2A A;  3SI2 A;  3TO7 A;  1IU8 A;  2QYV A;  3G8W A;  3TT2 A;  5F46 A;  4ZX8 A;  2FVG A;  1Z4R A;  3IO1 A;  4OME A;  4PXB A;  2PJA A;  2ZED A;  1PYT B;  1M4D A;  2X7B A;  3KHZ A;  1ZG9 A;  4MRI A;  2Z3M A;  3KQZ A;  3TE4 A;  2FXF A;  1NE9 A;  1QQ9 A;  2PJ3 A;  2PJ5 A;  3FNC A;  4PK2 A;  5IB0 A;  2F5I A;  4H2K A;  4MFJ A;  2Q44 A;  1TIQ A;  2XEF A;  1NSL A;  3MN8 A;  2I79 A;  3FJU A;  1J4J A;  4EFD A;  4CAE A;  3B3C A;  3P2H A;  1TF8 A;  2VEZ A;  2V8D A;  4PXC A;  4F0X A;  1F57 A;  3BLN A;  2EWB A;  3NE8 A;  4U5Y A;  2O53 A;  2OZH A;  3HUV A;  2REF A;  4CRY B;  4YU9 A;  3H5Z A;  2B4D A;  2PIZ A;  2O28 A;  2Y0M A;  4NXY A;  3KI9 A;  1B6B A;  3D7D A;  4OID A;  1S7N A;  3C26 A;  4NGS A;  1XRY A;  3FX6 A;  4MCQ A;  4NJR A;  4R9M A;  1BAV A;  4X5K A;  4IAV A;  1XEB A;  3B3S A;  4QB9 A;  5AGE A;  1Z8X A;  2ZEM A;  5LRJ A;  4Q38 A;  2QEC A;  3TO6 A;  2B5G A;  2V8G A;  3HLP A;  2PQ8 A; 
#chains in the Genus database with same CATH homology
 1Y9K A;  3EFA A;  1MJA A;  3TOA A;  3DNS A;  1GHE A;  2J8M A;  2J8R A;  4YRH A;  3ZJ0 A;  1U6M A;  1IB1 E;  2J8N A;  1N71 A;  2PRB A;  2AE6 A;  3GKR A;  2ZW6 A;  2Z3O A;  4JJX A;  4NF1 A;  4MY0 A;  4KOY A;  1ZO0 A;  5KTA A;  3EC4 A;  1S5K A;  4CYN A;  1Y9W A;  4A95 A;  1M4I A;  3K9U A;  4KS9 A;  1YK3 A;  2FE7 A;  4F6A A;  2P0W A;  5AG5 A;  2G0B A;  2YNC A;  4C7I A;  2WUU A;  4KSF A;  4HNX B;  3WR7 A;  4CAF A;  3R9G A;  4R3L A;  4AB7 A;  2H5M A;  4A31 A;  4DNC A;  5C82 A;  1V0C A;  2DPT A;  4B13 A;  2Z10 A;  4JXQ A;  5IV0 A;  4ZGY B;  4PK3 A;  4EVY A;  4CAV A;  2OU2 A;  4B10 A;  2JEV A;  4CYQ A;  1NMT A;  3I3G A;  1R57 A;  2R7H A;  4CYP A;  4FD5 A;  4JLY A;  2FIW A;  4KOX A;  3BJ7 A;  2GE3 A;  4MFQ A;  2BL1 A;  2I00 A;  3I9S A;  3KKW A;  2CNT A;  4MFZ A;  3LD2 A;  3TOB A;  3F5B A;  2PC1 A;  4Y49 C;  1QSO A;  4KLW A;  3FRM A;  4UFX A;  4E8O A;  5F48 A;  4QBJ A;  1CM0 A;  4CAW A;  2Z0Z A;  2WSA A;  1YVO A;  3H4Q A;  1KZF A;  2R98 A;  4UFW A;  1XF8 A;  1XIX A;  4MJ8 A;  4AG7 A;  1UFH A;  3QB8 A;  5IX3 A;  2P6F A;  1KUY A;  1YGH A;  5G22 A;  2P6G A;  2VQY A;  3PZJ A;  3PP9 A;  3S6F A;  3DSB A;  3PGP A;  4BMH A;  2B4B A;  3F0A A;  4XPD C;  4NEX A;  1LRZ A;  1IYL A;  2NMT A;  4CGO A;  1M4G A;  4XNH C;  1IYK A;  2HV2 A;  1P4N A;  4ORF A;  3IU2 A;  1QST A;  4M3S A;  3P2F A;  5G21 A;  3D2P A;  2Q0Y A;  2HUZ A;  3JUW A;  4HKF A;  3GY9 A;  5FVJ A;  3R1K A;  4MFP A;  2QIR A;  2WPW A;  1ON0 A;  3A9L A;  1Z9U A;  2FS5 A;  1PUA A;  1I21 A;  2YND A;  5F49 A;  4ONU A;  2K5T A;  3S6H A;  4CGP A;  2DPS A;  3MGD A;  4IF5 A;  3EY5 A;  2Q04 A;  3FXT A;  5G1Z A;  4C2Z A;  3R96 A;  1S3Z A;  2CNM A;  4QVT A;  4UFV A;  3N7Z A;  2ZXV A;  2PSW A;  3UY5 A;  2FIA A;  4XPK A;  4A2Z A;  2B3U A;  4KVX A;  5CNP A;  2OZG A;  5AG4 A;  2FT0 A;  5E96 A;  4R3K A;  4B5O A;  5HH1 A;  5DWN A;  2YGW A;  3G3S A;  1MK4 A;  2RC4 A;  3VWE A;  4FD4 A;  4CYO A;  4MFL A;  5AG6 A;  2Z3K A;  5J8C A;  1YRE A;  2OH1 A;  2Z11 A;  5KTC A;  1B87 A;  3T90 A;  3E0K A;  2FSR A;  4II9 A;  4YFJ A;  4KVM E;  4MHD A;  1Y7R A;  4H6Z A;  4AVA A;  2P6E A;  2C27 A;  2B3V A;  3IU1 A;  2FL4 A;  1OZP A;  3R9E A;  4B5P B;  2OB0 A;  4U9Y A;  1RXT A;  3TCV A;  4GS4 A;  5KTD A;  2Z3P A;  2BEI A;  5JQ4 A;  4HNW B;  3V8I A;  2YNC C;  4K30 A;  2G3A A;  1L0C A;  4E0A A;  4JWP A;  2R8V A;  3VWD A;  4F0Y A;  5C88 A;  3JTK A;  4KZT A;  3D8P A;  2B4D B;  5A27 A;  3EXN A;  1MJ9 A;  4CGN A;  5H86 A;  4LUA A;  4YGO A;  3ZZI A;  2AJ6 A;  4C2X A;  3TFY A;  4I49 A;  3TTH A;  1MJB A;  2OZU A;  4Y49 B;  2B5G B;  2GIV A;  4AVC A;  3W91 A;  1IID A;  4IUS A;  4PV6 A;  3W6S A;  4JXR A;  4MBU A;  3SXO A;  3R95 A;  3CXS A;  1VKC A;  5BWA B;  3S6K A;  1S7L A;  2VXK A;  4AVB A;  3DDD A;  4XPD B;  1XE4 A;  5DWM A;  4UCM A;  4UCP A;  4NCZ A;  1S7K A;  4UWI A;  1Q2C A;  1YLE A;  2IL4 A;  4KOU A;  2CNS A;  3D3S A;  5ISV A;  1Q2D A;  2REE A;  3NE7 A;  4KOS A;  2BUE A;  4FD6 A;  4RS2 A;  5I0C A;  4KOR A;  5EC4 A;  2B58 A;  3SXN A;  3T9Y A;  2KCW A;  4H89 A;  3QAH A;  4A30 A;  2PR1 A;  2WPX A;  1BOB A;  4KUA A;  2JLM A;  3IWG A;  4MI4 A;  5AG7 A;  4KUB A;  4UA3 A;  4Q36 A;  1FY7 A;  4B12 A;  4XPL A;  1RO5 A;  1Z4E A;  4A33 A;  4B11 A;  5EBV A;  4PSX A;  2Z3L A;  4NSQ A;  4KSA A;  4B5P A;  1VHS A;  4AG9 A;  4QC6 A;  4KOV A;  3IGR A;  1KUV A;  1SQH A;  1QSN A;  3W6X A;  3GYA A;  4C7H A;  2R1I A;  4CS0 B;  1K4J A;  2EUI A;  4UBR A;  4OLL A;  4UWJ A;  2Q7B A;  4C2Y A;  4CAX A;  2VBQ A;  3CXQ A;  1KUX A;  2G3T A;  2D4O A;  4XNH B;  2CY2 A;  3OWC A;  1YX0 A;  2ZW5 A;  2A4N A;  3FIX A;  1Q2Y A;  3DR6 A;  3EO4 A;  2FCK A;  2PDO A;  2VZY A;  1I12 A;  1M1D A;  1WWZ A;  3TO9 A;  1P0H A;  2PR8 A;  4L8A A;  4MFK A;  2ZW4 A;  5A28 A;  2Z3N A;  4OAE A;  4QUS A;  2EVN A;  4JD6 A;  3RYO A;  4U9Z A;  1IIC A;  4C68 A;  4RI1 A;  4OAD A;  4J3G A;  3D2M A;  2YNE A;  4HNY B;  2ARH A;  4FD7 A;  5JPH A;  4M85 A;  2D4P A;  4A32 A;  2ZW7 A;  4BBH A;  4R87 A;  2ATR A;  1M44 A;  3FBU A;  4R57 A;  4KOW A;  2Q4Y A;  5HMN A;  4CGM A;  2JDC A;  2VZZ A;  1XMT A;  2Q4V A;  3B8G A;  2CXA A;  2HQY A;  3R9F A;  3S6G A;  3DR8 A;  4KOT A;  1BO4 A;  1WK4 A;  3F8K A;  4CGL A;  4L89 A;  1CJW A;  2GAN A;  1PU9 A;  3SHP A;  2JDD A;  1QSR A;  2BSW A;  5F47 A;  2DXQ A;  4KVO E;  4PSW A;  1QSM A;  1YR0 A;  1YVK A;  4B14 A;  5G20 A;  3FB3 A;  4LX9 A;  4UCN A;  5GCN A;  4MY3 A;  3BJ8 A;  3FYN A;  4ZBG A;  4CRZ B;  4KLV A;  1S60 A;  4H6U A;  2QML A;  3JVN A;  1S7F A;  2VI7 A;  5H84 A;  2ZPA A;  3LOD A;  4E2A A;  1I1D A;  3IWE A;  3CXP A;  3TO7 A;  3TT2 A;  3G8W A;  5F46 A;  1Z4R A;  1M4D A;  2X7B A;  2Z3M A;  3TE4 A;  2FXF A;  1NE9 A;  3FNC A;  4PK2 A;  5IB0 A;  2F5I A;  4MFJ A;  2Q44 A;  1TIQ A;  1NSL A;  2I79 A;  1J4J A;  4CAE A;  3P2H A;  2VEZ A;  4F0X A;  3BLN A;  4U5Y A;  2OZH A;  2REF A;  4CRY B;  3H5Z A;  2B4D A;  2O28 A;  2Y0M A;  4NXY A;  1B6B A;  1S7N A;  3C26 A;  4R9M A;  4X5K A;  1XEB A;  4QB9 A;  5AGE A;  4Q38 A;  2QEC A;  3TO6 A;  2B5G A;  5J8F A;  2PQ8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...