4FD7A

Crystal structure of insect putative arylalkylamine n-acetyltransferase 7 from the yellow fever mosquito aedes aegypt
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
237
structure length
237
Chain Sequence
KWTRSVKVPFPSVWHRFQAKDLTSQQLVWYRVQDLPEDRFEDAIRHMCDYFARDELMNQAKGLAKDLVAMGDVVALWKAMLPDRMSLVCFREGSDEIVGVNILDVASRSDKDNAQFNSAIFQAIYDTIEYVSHQANIFDRYNVDHYLNAMGLSVDPKYRGRGIATEILRARIPLCRAVGLKLSATCFTGPNSQTAATRVGFQEDFTITYGELARVDQRFNYPGIEENFCKYMSLRVD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords putative arylalkylamine N-Acetyltransferase 7
publication title Evolution of insect arylalkylamine N-acetyltransferases: structural evidence from the yellow fever mosquito, Aedes aegypti.
pubmed doi rcsb
source organism Aedes aegypti
total genus 83
structure length 237
sequence length 237
chains with identical sequence B, C, D
ec nomenclature ec 2.3.1.87: Aralkylamine N-acetyltransferase.
pdb deposition date 2012-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4fd7A00
4DNCA 3GY9A 1OZPA 3N7ZA 1J4JA 3FRMA 2ATRA 1IICA 4B5PA 4Y49B 3SXNA 1YX0A 2B4BA 4QUSA 2HV2A 3T90A 3SXOA 1QSMA 2GIVA 5F49A 4JJXA 4R3LA 4XNHC 2JDCA 4R3KA 3F5BA 4CAWA 2CNSA 1Y9WA 2Q4VA 2R7HA 2P0WA 1L0CA 1S3ZA 5KTAA 1I12A 2FSRA 4CAVA 5J8CA 2K5TA 1PUAA 2AJ6A 3QB8A 4MHDA 4PV6A 2PSWA 4M3SA 3TFYA 4HNWB 1M44A 2B4DA 3TOAA 4UBRA 2QMLA 1P4NA 4JXQA 1IYLA 1V0CA 3R1KA 3S6GA 3EXNA 2HQYA 2J8NA 4R9MA 5IV0A 3W6SA 4JWPA 2Q04A 1IYKA 4IUSA 4U5YA 3EO4A 1Q2DA 3BJ7A 3EC4A 4I49A 2REFA 4KLVA 1BOBA 2P6FA 4KORA 2Q0YA 2FIWA 4GS4A 1QSNA 2B3VA 1NE9A 3KKWA 2PRBA 1GHEA 3OWCA 2P6GA 2JLMA 2PR1A 1LRZA 4H6UA 1IIDA 4E0AA 4J3GA 3FXTA 4AVAA 2VBQA 4HNXB 5J8FA 4XNHB 1RO5A 3R9GA 2VZZA 1S7FA 1Q2YA 4F6AA 2P6EA 2NMTA 1ON0A 3VWDA 4KOSA 4II9A 3ZZIA 3R95A 5GCNA 3TO6A 4QBJA 1S7KA 2GANA 3FNCA 4NCZA 4KOXA 5F47A 2I00A 4AVCA 2FS5A 1WK4A 4YFJA 2A4NA 4YRHA 4HNYB 4K30A 3S6FA 5C88A 2ZW6A 3V8IA 1CJWA 3CXPA 2DXQA 1N71A 4KOTA 3QAHA 5DWMA 3D2PA 4QB9A 4PK2A 4U9ZA 2OH1A 4OLLA 3G3SA 5IX3A 1XF8A 4CRYB 4CRZB 2GE3A 4H6ZA 4RS2A 3D3SA 1QSOA 4UA3A 3I9SA 2Q4YA 1WWZA 3R9EA 1M4GA 2B5GA 2FE7A 2CY2A 5EC4A 2JEVA 3C26A 5H84A 3LODA 3DDDA 4QVTA 4MJ8A 4XPKA 2ARHA 1BO4A 3EFAA 4PK3A 4AG7A 1MJAA 2CNMA 2OZUA 3P2HA 3ZJ0A 1RXTA 4JD6A 3FIXA 4B5OA 5E96A 4FD6A 3R9FA 3JVNA 4QC6A 3DR8A 4MI4A 1YR0A 2R98A 1KUYA 4L8AA 2VZYA 4E8OA 3BJ8A 2F5IA 3P2FA 2JDDA 2B5GB 2PR8A 3MGDA 3GYAA 5H86A 4MY0A 4HKFA 1FY7A 3JUWA 2QIRA 4KVOE 1S7NA 4FD5A 5EBVA 3IGRA 5IB0A 4EVYA 2RC4A 1SQHA 1YREA 3TE4A 4H89A 4RI1A 4JXRA 4KUBA 3LD2A 1NMTA 5ISVA 4IF5A 3TTHA 3E0KA 2QECA 3T9YA 3DSBA 1KZFA 4LUAA 2Q44A 1MJ9A 3SHPA 4R87A 2HUZA 4ORFA 2OU2A 3K9UA 4OADA 2G3AA 3RYOA 4XPDB 1PU9A 2VXKA 4MY3A 4KLWA 2PC1A 3I3GA 1M4DA 2OB0A 3TCVA 4R57A 5FVJA 1YLEA 2FXFA 1K4JA 1KUXA 2J8RA 4PSXA 3CXSA 5HH1A 1Y7RA 1XE4A 1YVOA 1QSTA 2O28A 2Z10A 3S6KA 1Z9UA 2D4OA 5JPHA 4BMHA 3F8KA 2FT0A 3PZJA 3WR7A 1MK4A 4OAEA 2WPXA 4NF1A 2B3UA 1S7LA 4ONUA 1M1DA 2AE6A 3TO9A 2R8VA 1I1DA 4AG9A 1NSLA 3EY5A 1XMTA 4KOYA 3DR6A 2EUIA 4JLYA 5F48A 3UY5A 2ZW5A 5KTCA 4MBUA 3G8WA 4E2AA 2BEIA 4KVXA 2ZW4A 4NXYA 4UWJA 5KTDA 1XIXA 4M85A 2FCKA 2WPWA 3BLNA 3S6HA 2C27A 2ZPAA 2OZHA 4XPDC 2R1IA 1S60A 2I79A 3TOBA 1P0HA 2FL4A 4AVBA 4UWIA 2G3TA 3TT2A 4U9YA 3F0AA 2Q7BA 2B58A 2EVNA 1XEBA 1Y9KA 4KOVA 2G0BA 1UFHA 2Z0ZA 1YK3A 4F0YA 3IWGA 4CS0B 4X5KA 3NE7A 5C82A 3VWEA 4AB7A 4B5PB 2Z11A 2REEA 2BL1A 4KOWA 3DNSA 1TIQA 2IL4A 1YGHA 2J8MA 4FD7A 4YGOA 3GKRA 3PP9A 1KUVA 5HMNA 1B87A 4FD4A 4Y49C 2PDOA 4L89A 1U6MA 2D4PA 2BSWA 2PQ8A 3CXQA 2BUEA 1R57A 4PSWA 5I0CA 3FYNA 3FBUA 2VEZA 1Z4EA 2ZW7A 5CNPA 2B4DB 5JQ4A 1MJBA 1QSRA 4KVME 2ZXVA 2KCWA 4CAXA 3H4QA 2VI7A 1Q2CA 3R96A 2FIAA 1IB1E 3W6XA 1CM0A 1VHSA 4XPLA 3D2MA 2H5MA 1I21A 3D8PA 1B6BA 4KUAA 2VQYA 3FB3A 1VKCA 5DWNA 4KZTA 2X7BA 4LX9A 1S5KA 3PGPA 4NEXA 4NSQA 2OZGA 1M4IA 3W91A 4ZBGA 5F46A 3TO7A 2CNTA 4KOUA 1Z4RA 3B8GA 1YVKA 2Y0MA
chains in the Genus database with same CATH superfamily
1XFOA 3RZAA 4DNCA 3GY9A 5BWAB 1OZPA 8CPAA 3N7ZA 2Q4ZA 3IWWA 1J4JA 2CTCA 3FRMA 4F9VA 2ATRA 2Q43A 1AUGA 1IICA 2Z3NA 4B5PA 4RUHA 4Y49B 2WUUA 4A94A 1LAPA 1DTDA 4UCNA 5G20A 3RBUA 4YWYA 3SXNA 5HVHA 1YX0A 2B4BA 4QUSA 2HV2A 1Z8LA 4MHZA 2J9AA 1F57A 3T90A 3D7DA 3SXOA 1QSMA 1Z8XA 2GIVA 3D7FA 4X3RA 3A9LA 5HXDA 4EFDA 3KHZA 4NJQA 3H8EA 4R7MA 4JJXA 4R3LA 5F49A 4XNHC 4ZYQA 2JDCA 2GLFA 3KZWA 2AFMA 4R3KA 1ZO0A 3F5BA 3B3VA 4CAWA 2CNSA 1Y9WA 2Q4VA 3T8WA 3CDXA 2R7HA 3IJ3A 4OC2A 2P0WA 4DYOA 1L0CA 2PIZA 1S3ZA 2WSAA 5KTAA 1I12A 2F8HA 1RTQA 2FSRA 2AFWA 4CAVA 5J8CA 1Z8TA 2K5TA 1PYTB 1PUAA 2PJ3A 2AJ6A 3CZXA 3PBBA 3QB8A 2QYVA 4MHDA 5LRKA 3KR5A 2ODFA 1YLOA 1Y0RA 4PV6A 1ZLHA 2PSWA 4JYWA 1XOVA 4M3SA 3TFYA 4HNWB 1M44A 2B4DA 3JRUA 3TOAA 4UBRA 5D8NA 2QMLA 2JBKA 1P4NA 4JXQA 2Z3OA 1IYLA 4MRIA 1V0CA 3N5FA 3R1KA 3S6GA 3H8FA 3EXNA 4A31A 3FH4A 2HQYA 2J8NA 1IU8A 4P4FA 4R9MA 5IV0A 3PB8X 3W6SA 4JWPA 5J1QA 2Q04A 1IYKA 4MHPA 4P44A 4UCMA 2WZNA 4C2YA 3H8GA 1JQGA 3HLPA 4IUSA 4UIAA 4U5YA 3EO4A 4MFQA 1Q2DA 3BJ7A 4H2KA 4UFVA 5K8MA 3EC4A 5K8PA 4MFPA 4I49A 3FMCA 2RFHA 2REFA 4CGLA 3B3CA 4KLVA 1TKHA 1BOBA 4R8FA 4C2ZA 4B14A 2P6FA 1QMUA 4ZI6A 4KORA 2Q0YA 4MFLA 3WT4A 4B13A 2FIWA 4GS4A 1QSNA 1LAMA 4UIBA 2B3VA 4IAVA 4C2XA 1NE9A 2O4HA 3KKWA 2PRBA 2YNCC 1X12A 5A28A 1FNOA 2Z3KA 1GHEA 3OWCA 2P6GA 5LYIA 2JLMA 2PJ1A 2ZEGA 2PR1A 1LRZA 4H6UA 1IIDA 1ARLA 4E0AA 2V8DA 1CG2A 4J3GA 3FXTA 4EWTA 5IB9A 4UCPA 3RAMA 2VBQA 4AVAA 4HNXB 5J8FA 5G22A 1DE4C 4XNHB 3FX6A 1RO5A 4X2TA 3R9GA 4DJLA 5A27A 2VZZA 3GB0A 3QNVA 1S7FA 1Q2YA 4F6AA 2DPTA 1AYEA 5AG4A 2P6EA 2NMTA 2ANPA 1ON0A 4KSFA 3VWDA 4KOSA 2Z3LA 4OIWA 2PJCA 4II9A 4K3NA 1FT7A 4FUUA 3B7IA 3ZZIA 3R95A 5GCNA 5LRJA 3TO6A 4LQGA 2YNCA 2XEGA 4QBJA 1S7KA 4M6IA 4MMOA 3MRUA 3IFEA 2GANA 3NA6A 3SI2A 3FNCA 4NCZA 4KOXA 1F2PA 1TKJA 3PB6X 5F47A 2I00A 4P6YA 4AVCA 2FS5A 1WK4A 4UFXA 4FBEA 4YFJA 2A4NA 5THWA 3BI0A 4YRHA 2IMOA 3JTKA 2QJ8A 4OC5A 2ZEDA 2AFZA 2C6GA 4HNYB 2OOTA 4K30A 3S6FA 1VHOA 5C88A 1BPNA 2ZW6A 3V8IA 1EE3P 3FEEA 1CJWA 3CXPA 2ZOFA 2Q7SA 2DXQA 1N71A 4TNUA 4KOTA 2PE3A 2GLJA 2PJ2A 3QAHA 5CBMA 2PJ5A 4NJRA 4ONWA 4NGNA 5DWMA 3D2PA 4QB9A 2GREA 4MFKA 4PK2A 4U9ZA 4KS9A 2OH1A 3PBEA 4OLLA 3G3SA 1BPMA 4CGMA 1F2OA 5AGEA 3SJFA 5IX3A 1XF8A 3LACA 4FAIA 4CRYB 4CRZB 1HDQA 2C6PA 2GE3A 4F9UA 2ABZA 4H6ZA 4MHNA 4OMEA 1YQEA 3D3SA 4RS2A 4ZY0A 1QSOA 4UA3A 1OBRA 3WABA 3I9SA 1Y0YA 1WWZA 2POKA 3R9EA 2JEWA 3B3SA 3IU2A 1M4GA 2Z3MA 2B5GA 3NE8A 4MCSA 2FE7A 1KWMA 3BHXA 3KQZA 2CY2A 2PJ7A 5EC4A 4GM5A 4O23A 4B12A 2JEVA 4KSAA 4NGTA 3C26A 1GYTA 4PXDA 3IC1A 4R76A 1TXRA 2CXAA 5H84A 3LODA 4A2ZA 3DDDA 4QVTA 1UWYA 4YU9A 4MJ8A 5HVFA 4P10A 4XPKA 2ARHA 3RO0A 1BO4A 4PXCA 2NSMA 4A32A 1ELMP 3EFAA 4NGMA 4PK3A 1ELLP 4AG7A 4OC4A 1MJAA 3KHXA 2CNMA 2OZUA 3P2HA 3SJEA 3ZJ0A 1RXTA 4MXUA 2ZEMA 2HC9A 4JD6A 2WYRA 2O53A 4BD9A 3FIXA 3KL9A 4B5OA 4LQ6A 4CYQA 4P4DA 5E96A 4PPZA 2JBJA 5AG5A 2RB7A 4PXBA 4P4IA 3V7ZA 4IK2A 2YGWA 4FD6A 3R9FA 3JVNA 3PB9X 2EK8A 2PVWA 3DR8A 4MI4A 4QC6A 1YR0A 2BOAA 2R98A 3ISZA 1KUYA 4L8AA 1AMPA 3SI1A 1YMEA 2VZYA 2ZEHA 4E8OA 1LFWA 3BJ8A 2F5IA 3P2FA 2JDDA 2B5GB 2PR8A 3MGDA 4B6ZA 3GYAA 3MN8A 1H8LA 7CPAA 5H86A 4MY0A 4HKFA 3VH9A 1FY7A 3JUWA 2QIRA 4TWEA 4KVOE 1S7NA 4FD5A 5EBVA 2DEAA 3IGRA 4JZ0A 5I4MA 5IB0A 1Z8WA 3PEIA 2RC4A 4EVYA 1SQHA 2DPSA 4NGQA 1YREA 4NGRA 3TE4A 3NH4A 4H89A 4RI1A 4JXRA 2ZEOA 3KGQA 3LWUA 4M6GA 3D7GA 4KUBA 4W9YA 3LD2A 1NMTA 1VGYA 5ISVA 1JWQA 3B3WA 4IF5A 2ZOGA 2G9DA 3TTHA 4CAEA 1R43A 1IOFA 1NSAA 3NH8A 2ZEFA 5D29A 2C1CA 3E0KA 1CPSA 2QECA 4NGSA 3T9YA 5JM6A 3DSBA 4UEZA 1KZFA 5JH9A 4LUAA 5F09A 2Q44A 1ZG8A 2PCUA 2PJBA 1Q7LA 1MJ9A 1ZG7A 4A38A 3SHPA 2CIJA 4R87A 2HUZA 2Y0MA 4ORFA 1XBUA 4MFZA 2OU2A 3K9UA 2PJ4A 5LYFA 4OADA 2EO8A 2G3AA 3RYOA 5G21A 4Q38A 4CYPA 4XPDB 1R3NA 1PU9A 2PJAA 4NFRA 2VXKA 1VIXA 4MY3A 4KLWA 2I3CA 5K8OA 3WC7A 2PC1A 3I3GA 4B11A 3FJUA 1M4DA 1XRYA 1ZG9A 2OB0A 4R57A 3BI1A 4WJBA 1YLEA 2FXFA 1K4JA 1KUXA 2V8VA 3GIUA 4PQAA 2J8RA 2XEIA 4ZX9A 4PSXA 4BINA 3CXSA 5HH1A 1TF8A 3D67A 2OR4A 3WC6A 1Y7RA 2ZELA 1XE4A 1YVOA 2ZENA 3TX8A 3VATA 1QSTA 2O28A 5ELYA 2Z10A 3PFOA 5LYDA 3S6KA 2V8GA 2PVVA 1Z9UA 2D4OA 2AFSA 2PRQA 4Q7AA 4WWVA 4RN7A 4M6HA 4AXVA 3DGVA 4C7HA 2Z3PA 3F8KA 2FT0A 3S9MA 2EK9A 4BMHA 3PZJA 4EMEA 3NH5A 3WR7A 5K8NA 3KR4A 1MK4A 2PJ6A 2GFQA 4GXHA 4OAEA 4A39A 4CGPA 4UEFA 2WPXA 1LANA 2B3UA 1S7LA 4NF1A 4ONUA 5DS0A 3IWEA 4OC3A 1M1DA 1CBXA 5LYLA 2AE6A 3NFZA 5EMIA 3TO9A 2R8VA 1QQ9A 1I1DA 3RNZA 4AG9A 1NSLA 3EY5A 3IIBA 4B10A 1XMTA 1XMBA 4FWUA 1CP6A 1Y7EA 4KOYA 5FVJA 3DR6A 3ISXA 2EUIA 3HUVA 4JLYA 5F48A 6CPAA 4BBHA 3UY5A 2ZW5A 5KTCA 4MBUA 3G8WA 4E2AA 4PXEA 4C68A 4CAFA 2BEIA 3CT9A 4KVXA 3PRTA 2ZW4A 4NXYA 4UWJA 2IJZA 5KTDA 4X8IA 1XIXA 3IO1A 4P4EA 4M85A 2FCKA 2WPWA 3BLNA 4R6TA 4ZX8A 3S6HA 2C27A 2ZPAA 2OZHA 4XPDC 1CX8A 2R1IA 4A37A 1IOIA 3GUXA 5HVGA 4G1PA 1VHEA 3FEDA 5JPHA 1S60A 4DUKA 2I79A 2YNDA 1CPXA 3TC8A 1IGBA 1Z2LA 3D66A 3TOBA 2ZEEA 1HEEA 1P0HA 4MFJA 2FL4A 3D68A 4AVBA 1HDUA 4UWIA 3CPAA 2G3TA 3D7HA 3TT2A 4U9YA 2EBJA 3F0AA 3LMSA 2B58A 2Q7BA 5AG6A 4UFWA 4Z65A 4OP4A 2XEJA 2EVNA 1XEBA 1Y9KA 1YSJA 3SI0A 3K2KA 1YW4A 2G0BA 4KOVA 5G1ZA 4CGOA 1UFHA 2FVGA 2Z0ZA 1YK3A 4F0YA 3IWGA 3BXMA 3DLJA 5JGFA 1A2ZA 4CS0B 4X5KA 1YW6A 1Z5RA 3NE7A 5CPAA 5C82A 3VWEA 4AB7A 4B5PB 1ZLIA 2Q51A 3S9NA 2Z11A 3K9TA 2REEA 2BL1A 4KOWA 4P4BA 4MCQA 3DNSA 1TIQA 3B35A 4UEEA 5AG7A 2F7VA 4MCPA 3IU1A 2IL4A 2EWBA 1YGHA 2J8MA 4FD7A 4YGOA 3SJXA 3GKRA 3QAYA 2BCOA 2GU2A 2YNEA 4A33A 3PP9A 2ZEPA 2AFXA 1KUVA 5HMNA 1B87A 2DF5A 3FF3A 2BO9A 4FD4A 4Y49C 2PDOA 4L89A 1U6MA 3KQXA 1PCAA 3V38A 4UF4A 2D4PA 3KASA 3D4UA 2BSWA 3PFEA 4IHMA 3B3TA 2PQ8A 3CXQA 3L2NA 4Q36A 4ZGYB 3S9LA 2BUEA 1R57A 4PSWA 3B2YA 5I0CA 4C7IA 4F8ZA 3TCVA 3FBUA 3FYNA 2VEZA 2NYQA 4MHYA 3VARA 4CGNA 1M4LA 3PB7X 1Z4EA 2XEFA 4A95A 4OKOA 4P4JA 2ZW7A 5CNPA 4ZY1A 4F0XA 3SJGA 2B4DB 5JQ4A 3KI9A 1MJBA 2QVPA 2HB6A 2CF4A 4P45A 2VL1A 1QSRA 4A30A 3PB4X 4NGPA 5LRGA 4KVME 3H5ZA 2ZXVA 2AFUA 3FECA 2KCWA 4CAXA 1XJOA 3I1UA 1X10A 3H4QA 1ARMA 1IY7A 1Q2CA 2IQ6A 2VI7A 4MCRA 2FIAA 2PJ0A 1IB1E 3R96A 3W6XA 1CM0A 3IEHA 2V77A 3FVLA 1VHSA 4XPLA 2V8HA 3D2MA 4OC0A 2H5MA 3CPXA 1I21A 2PJ8A 3D8PA 1B6BA 4CPAA 3GLJA 4KUAA 1TF9A 2VQYA 4KSIA 4ZY2A 1LCPA 2PJ9A 2PIYA 3FB3A 1VKCA 4OC1A 4CYOA 1TKFA 4KZTA 5DWNA 2X7BA 4LX9A 1S5KA 1BLLE 3PGPA 3WC5A 1LOKA 4NEXA 4NSQA 2CTBA 4OIDA 2OZGA 2C6CA 1M4IA 4HPSA 3W91A 4ZBGA 5F46A 3TO7A 2CNTA 4CYNA 1CP7A 2AFOA 4KOUA 1Z4RA 1BAVA 3B8GA 1YVKA 2Q4YA
chains in the Genus database with same CATH topology
4DNCA 3GY9A 5BWAB 1OZPA 3N7ZA 1J4JA 3FRMA 2ATRA 1IICA 2Z3NA 4B5PA 4Y49B 2WUUA 4UCNA 5G20A 3SXNA 1YX0A 2B4BA 4QUSA 2HV2A 3T90A 3SXOA 1QSMA 2GIVA 3A9LA 5F49A 4JJXA 4R3LA 4XNHC 2JDCA 4R3KA 1ZO0A 3F5BA 4CAWA 2CNSA 1Y9WA 2Q4VA 2R7HA 2P0WA 1L0CA 2WSAA 1S3ZA 5KTAA 1I12A 2FSRA 4CAVA 5J8CA 2K5TA 1PUAA 2AJ6A 3QB8A 4MHDA 4PV6A 2PSWA 4M3SA 3TFYA 4HNWB 1M44A 2B4DA 3TOAA 4UBRA 2QMLA 1P4NA 4JXQA 2Z3OA 1IYLA 1V0CA 3R1KA 3S6GA 3EXNA 4A31A 2HQYA 2J8NA 4R9MA 5IV0A 3W6SA 4JWPA 2Q04A 1IYKA 4UCMA 4C2YA 4IUSA 4U5YA 3EO4A 4MFQA 1Q2DA 3BJ7A 4UFVA 3EC4A 4MFPA 4I49A 2REFA 4CGLA 4KLVA 4C2ZA 1BOBA 4B14A 2P6FA 4KORA 2Q0YA 4MFLA 4B13A 2FIWA 4GS4A 1QSNA 2B3VA 4C2XA 1NE9A 3KKWA 2PRBA 2YNCC 5A28A 2Z3KA 1GHEA 3OWCA 2P6GA 2JLMA 2PR1A 1LRZA 4H6UA 1IIDA 4E0AA 4J3GA 3FXTA 4UCPA 4AVAA 2VBQA 4HNXB 5J8FA 5G22A 4XNHB 1RO5A 3R9GA 5A27A 2VZZA 1S7FA 1Q2YA 4F6AA 2DPTA 5AG4A 2P6EA 2NMTA 1ON0A 4KSFA 3VWDA 4KOSA 2Z3LA 4II9A 3ZZIA 3R95A 5GCNA 3TO6A 2YNCA 4QBJA 1S7KA 2GANA 3FNCA 4NCZA 4KOXA 5F47A 2I00A 4AVCA 2FS5A 1WK4A 4UFXA 4YFJA 2A4NA 4YRHA 3JTKA 4HNYB 4K30A 3S6FA 5C88A 2ZW6A 3V8IA 1CJWA 3CXPA 2DXQA 1N71A 4KOTA 3QAHA 5DWMA 3D2PA 4QB9A 4MFKA 4PK2A 4U9ZA 4KS9A 2OH1A 4OLLA 3G3SA 4CGMA 5IX3A 5AGEA 1XF8A 4CRYB 4CRZB 2GE3A 4H6ZA 4RS2A 3D3SA 1QSOA 4UA3A 3I9SA 2Q4YA 1WWZA 3R9EA 3IU2A 1M4GA 2Z3MA 2B5GA 2FE7A 2CY2A 5EC4A 4B12A 2JEVA 4KSAA 3C26A 2CXAA 5H84A 3LODA 4A2ZA 3DDDA 4QVTA 4MJ8A 4XPKA 2ARHA 1BO4A 4A32A 3EFAA 4PK3A 4AG7A 1MJAA 2CNMA 2OZUA 3P2HA 3ZJ0A 1RXTA 4JD6A 3FIXA 4B5OA 4CYQA 5E96A 5AG5A 2YGWA 4FD6A 3R9FA 3JVNA 4QC6A 3DR8A 4MI4A 1YR0A 2R98A 1KUYA 4L8AA 2VZYA 4E8OA 3BJ8A 2F5IA 3P2FA 2JDDA 2B5GB 2PR8A 3MGDA 3GYAA 5H86A 4MY0A 4HKFA 1FY7A 3JUWA 2QIRA 4KVOE 1S7NA 4FD5A 5EBVA 3IGRA 5IB0A 4EVYA 2RC4A 1SQHA 2DPSA 1YREA 3TE4A 4H89A 4RI1A 4JXRA 4KUBA 3LD2A 1NMTA 5ISVA 4IF5A 3TTHA 4CAEA 3E0KA 2QECA 3T9YA 3DSBA 1KZFA 4LUAA 2Q44A 1MJ9A 3SHPA 4R87A 2HUZA 4ORFA 4MFZA 2OU2A 3K9UA 4OADA 2G3AA 3RYOA 5G21A 4Q38A 4CYPA 4XPDB 1PU9A 2VXKA 4MY3A 4KLWA 2PC1A 3I3GA 4B11A 1M4DA 2OB0A 3TCVA 4R57A 5FVJA 1YLEA 2FXFA 1K4JA 1KUXA 2J8RA 4PSXA 3CXSA 5HH1A 1Y7RA 1XE4A 1YVOA 1QSTA 2O28A 2Z10A 3S6KA 1Z9UA 2D4OA 4C7HA 5JPHA 2Z3PA 3F8KA 2FT0A 4BMHA 3PZJA 3WR7A 1MK4A 4CGPA 4OAEA 2WPXA 4NF1A 2B3UA 1S7LA 4ONUA 3IWEA 1M1DA 2AE6A 3TO9A 2R8VA 1I1DA 4AG9A 1NSLA 3EY5A 4B10A 4BBHA 1XMTA 4KOYA 3DR6A 2EUIA 4JLYA 5F48A 3UY5A 2ZW5A 5KTCA 4MBUA 3G8WA 4E2AA 4C68A 4CAFA 2BEIA 4KVXA 2ZW4A 4NXYA 4UWJA 5KTDA 1XIXA 4M85A 2FCKA 2WPWA 3BLNA 3S6HA 2C27A 2ZPAA 2OZHA 4XPDC 2R1IA 1S60A 2I79A 2YNDA 3TOBA 1P0HA 4MFJA 2FL4A 4AVBA 4UWIA 2G3TA 3TT2A 4U9YA 3F0AA 2Q7BA 2B58A 5AG6A 4UFWA 2EVNA 1XEBA 1Y9KA 4KOVA 2G0BA 4CGOA 5G1ZA 1UFHA 2Z0ZA 1YK3A 4F0YA 3IWGA 4CS0B 4X5KA 3NE7A 5C82A 3VWEA 4AB7A 4B5PB 2Z11A 2REEA 2BL1A 4KOWA 3DNSA 1TIQA 5AG7A 3IU1A 2IL4A 1YGHA 2J8MA 4FD7A 4YGOA 3GKRA 2YNEA 4A33A 3PP9A 1KUVA 5HMNA 1B87A 4FD4A 4Y49C 2PDOA 4L89A 1U6MA 2D4PA 2BSWA 2PQ8A 3CXQA 4Q36A 4ZGYB 2BUEA 1R57A 4PSWA 5I0CA 4C7IA 3FYNA 3FBUA 2VEZA 4CGNA 1Z4EA 4A95A 2ZW7A 5CNPA 4F0XA 2B4DB 5JQ4A 1MJBA 1QSRA 4A30A 4KVME 3H5ZA 2ZXVA 2KCWA 4CAXA 3H4QA 2VI7A 1Q2CA 3R96A 2FIAA 1IB1E 3W6XA 1CM0A 1VHSA 4XPLA 3D2MA 2H5MA 1I21A 3D8PA 1B6BA 4KUAA 2VQYA 3FB3A 1VKCA 4CYOA 5DWNA 4KZTA 2X7BA 4LX9A 1S5KA 3PGPA 4NEXA 4NSQA 2OZGA 1M4IA 3W91A 4ZBGA 5F46A 3TO7A 2CNTA 4CYNA 4KOUA 1Z4RA 3B8GA 1YVKA 2Y0MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DNC A;  3GY9 A;  1OZP A;  3N7Z A;  1J4J A;  3FRM A;  2ATR A;  1IIC A;  4B5P A;  4Y49 B;  3SXN A;  1YX0 A;  2B4B A;  4QUS A;  2HV2 A;  3T90 A;  3SXO A;  1QSM A;  2GIV A;  5F49 A;  4JJX A;  4R3L A;  4XNH C;  2JDC A;  4R3K A;  3F5B A;  4CAW A;  2CNS A;  1Y9W A;  2Q4V A;  2R7H A;  2P0W A;  1L0C A;  1S3Z A;  5KTA A;  1I12 A;  2FSR A;  4CAV A;  5J8C A;  2K5T A;  1PUA A;  2AJ6 A;  3QB8 A;  4MHD A;  4PV6 A;  2PSW A;  4M3S A;  3TFY A;  4HNW B;  1M44 A;  2B4D A;  3TOA A;  4UBR A;  2QML A;  1P4N A;  4JXQ A;  1IYL A;  1V0C A;  3R1K A;  3S6G A;  3EXN A;  2HQY A;  2J8N A;  4R9M A;  5IV0 A;  3W6S A;  4JWP A;  2Q04 A;  1IYK A;  4IUS A;  4U5Y A;  3EO4 A;  1Q2D A;  3BJ7 A;  3EC4 A;  4I49 A;  2REF A;  4KLV A;  1BOB A;  2P6F A;  4KOR A;  2Q0Y A;  2FIW A;  4GS4 A;  1QSN A;  2B3V A;  1NE9 A;  3KKW A;  2PRB A;  1GHE A;  3OWC A;  2P6G A;  2JLM A;  2PR1 A;  1LRZ A;  4H6U A;  1IID A;  4E0A A;  4J3G A;  3FXT A;  4AVA A;  2VBQ A;  4HNX B;  5J8F A;  4XNH B;  1RO5 A;  3R9G A;  2VZZ A;  1S7F A;  1Q2Y A;  4F6A A;  2P6E A;  2NMT A;  1ON0 A;  3VWD A;  4KOS A;  4II9 A;  3ZZI A;  3R95 A;  5GCN A;  3TO6 A;  4QBJ A;  1S7K A;  2GAN A;  3FNC A;  4NCZ A;  4KOX A;  5F47 A;  2I00 A;  4AVC A;  2FS5 A;  1WK4 A;  4YFJ A;  2A4N A;  4YRH A;  4HNY B;  4K30 A;  3S6F A;  5C88 A;  2ZW6 A;  3V8I A;  1CJW A;  3CXP A;  2DXQ A;  1N71 A;  4KOT A;  3QAH A;  5DWM A;  3D2P A;  4QB9 A;  4PK2 A;  4U9Z A;  2OH1 A;  4OLL A;  3G3S A;  5IX3 A;  1XF8 A;  4CRY B;  4CRZ B;  2GE3 A;  4H6Z A;  4RS2 A;  3D3S A;  1QSO A;  4UA3 A;  3I9S A;  2Q4Y A;  1WWZ A;  3R9E A;  1M4G A;  2B5G A;  2FE7 A;  2CY2 A;  5EC4 A;  2JEV A;  3C26 A;  5H84 A;  3LOD A;  3DDD A;  4QVT A;  4MJ8 A;  4XPK A;  2ARH A;  1BO4 A;  3EFA A;  4PK3 A;  4AG7 A;  1MJA A;  2CNM A;  2OZU A;  3P2H A;  3ZJ0 A;  1RXT A;  4JD6 A;  3FIX A;  4B5O A;  5E96 A;  4FD6 A;  3R9F A;  3JVN A;  4QC6 A;  3DR8 A;  4MI4 A;  1YR0 A;  2R98 A;  1KUY A;  4L8A A;  2VZY A;  4E8O A;  3BJ8 A;  2F5I A;  3P2F A;  2JDD A;  2B5G B;  2PR8 A;  3MGD A;  3GYA A;  5H86 A;  4MY0 A;  4HKF A;  1FY7 A;  3JUW A;  2QIR A;  4KVO E;  1S7N A;  4FD5 A;  5EBV A;  3IGR A;  5IB0 A;  4EVY A;  2RC4 A;  1SQH A;  1YRE A;  3TE4 A;  4H89 A;  4RI1 A;  4JXR A;  4KUB A;  3LD2 A;  1NMT A;  5ISV A;  4IF5 A;  3TTH A;  3E0K A;  2QEC A;  3T9Y A;  3DSB A;  1KZF A;  4LUA A;  2Q44 A;  1MJ9 A;  3SHP A;  4R87 A;  2HUZ A;  4ORF A;  2OU2 A;  3K9U A;  4OAD A;  2G3A A;  3RYO A;  4XPD B;  1PU9 A;  2VXK A;  4MY3 A;  4KLW A;  2PC1 A;  3I3G A;  1M4D A;  2OB0 A;  3TCV A;  4R57 A;  5FVJ A;  1YLE A;  2FXF A;  1K4J A;  1KUX A;  2J8R A;  4PSX A;  3CXS A;  5HH1 A;  1Y7R A;  1XE4 A;  1YVO A;  1QST A;  2O28 A;  2Z10 A;  3S6K A;  1Z9U A;  2D4O A;  5JPH A;  4BMH A;  3F8K A;  2FT0 A;  3PZJ A;  3WR7 A;  1MK4 A;  4OAE A;  2WPX A;  4NF1 A;  2B3U A;  1S7L A;  4ONU A;  1M1D A;  2AE6 A;  3TO9 A;  2R8V A;  1I1D A;  4AG9 A;  1NSL A;  3EY5 A;  1XMT A;  4KOY A;  3DR6 A;  2EUI A;  4JLY A;  5F48 A;  3UY5 A;  2ZW5 A;  5KTC A;  4MBU A;  3G8W A;  4E2A A;  2BEI A;  4KVX A;  2ZW4 A;  4NXY A;  4UWJ A;  5KTD A;  1XIX A;  4M85 A;  2FCK A;  2WPW A;  3BLN A;  3S6H A;  2C27 A;  2ZPA A;  2OZH A;  4XPD C;  2R1I A;  1S60 A;  2I79 A;  3TOB A;  1P0H A;  2FL4 A;  4AVB A;  4UWI A;  2G3T A;  3TT2 A;  4U9Y A;  3F0A A;  2Q7B A;  2B58 A;  2EVN A;  1XEB A;  1Y9K A;  4KOV A;  2G0B A;  1UFH A;  2Z0Z A;  1YK3 A;  4F0Y A;  3IWG A;  4CS0 B;  4X5K A;  3NE7 A;  5C82 A;  3VWE A;  4AB7 A;  4B5P B;  2Z11 A;  2REE A;  2BL1 A;  4KOW A;  3DNS A;  1TIQ A;  2IL4 A;  1YGH A;  2J8M A;  4FD7 A;  4YGO A;  3GKR A;  3PP9 A;  1KUV A;  5HMN A;  1B87 A;  4FD4 A;  4Y49 C;  2PDO A;  4L89 A;  1U6M A;  2D4P A;  2BSW A;  2PQ8 A;  3CXQ A;  2BUE A;  1R57 A;  4PSW A;  5I0C A;  3FYN A;  3FBU A;  2VEZ A;  1Z4E A;  2ZW7 A;  5CNP A;  2B4D B;  5JQ4 A;  1MJB A;  1QSR A;  4KVM E;  2ZXV A;  2KCW A;  4CAX A;  3H4Q A;  2VI7 A;  1Q2C A;  3R96 A;  2FIA A;  1IB1 E;  3W6X A;  1CM0 A;  1VHS A;  4XPL A;  3D2M A;  2H5M A;  1I21 A;  3D8P A;  1B6B A;  4KUA A;  2VQY A;  3FB3 A;  1VKC A;  5DWN A;  4KZT A;  2X7B A;  4LX9 A;  1S5K A;  3PGP A;  4NEX A;  4NSQ A;  2OZG A;  1M4I A;  3W91 A;  4ZBG A;  5F46 A;  3TO7 A;  2CNT A;  4KOU A;  1Z4R A;  3B8G A;  1YVK A;  2Y0M A; 
#chains in the Genus database with same CATH topology
 1XFO A;  3RZA A;  4DNC A;  3GY9 A;  5BWA B;  1OZP A;  8CPA A;  3N7Z A;  2Q4Z A;  3IWW A;  1J4J A;  2CTC A;  3FRM A;  4F9V A;  2ATR A;  2Q43 A;  1AUG A;  1IIC A;  2Z3N A;  4B5P A;  4RUH A;  4Y49 B;  2WUU A;  4A94 A;  1LAP A;  1DTD A;  4UCN A;  5G20 A;  3RBU A;  4YWY A;  3SXN A;  5HVH A;  1YX0 A;  2B4B A;  4QUS A;  2HV2 A;  1Z8L A;  4MHZ A;  2J9A A;  1F57 A;  3T90 A;  3D7D A;  3SXO A;  1QSM A;  1Z8X A;  2GIV A;  3D7F A;  4X3R A;  3A9L A;  5HXD A;  4EFD A;  3KHZ A;  4NJQ A;  3H8E A;  4R7M A;  4JJX A;  4R3L A;  5F49 A;  4XNH C;  4ZYQ A;  2JDC A;  2GLF A;  3KZW A;  2AFM A;  4R3K A;  1ZO0 A;  3F5B A;  3B3V A;  4CAW A;  2CNS A;  1Y9W A;  2Q4V A;  3T8W A;  3CDX A;  2R7H A;  3IJ3 A;  4OC2 A;  2P0W A;  4DYO A;  1L0C A;  2PIZ A;  1S3Z A;  2WSA A;  5KTA A;  1I12 A;  2F8H A;  1RTQ A;  2FSR A;  2AFW A;  4CAV A;  5J8C A;  1Z8T A;  2K5T A;  1PYT B;  1PUA A;  2PJ3 A;  2AJ6 A;  3CZX A;  3PBB A;  3QB8 A;  2QYV A;  4MHD A;  5LRK A;  3KR5 A;  2ODF A;  1YLO A;  1Y0R A;  4PV6 A;  1ZLH A;  2PSW A;  4JYW A;  1XOV A;  4M3S A;  3TFY A;  4HNW B;  1M44 A;  2B4D A;  3JRU A;  3TOA A;  4UBR A;  5D8N A;  2QML A;  2JBK A;  1P4N A;  4JXQ A;  2Z3O A;  1IYL A;  4MRI A;  1V0C A;  3N5F A;  3R1K A;  3S6G A;  3H8F A;  3EXN A;  4A31 A;  3FH4 A;  2HQY A;  2J8N A;  1IU8 A;  4P4F A;  4R9M A;  5IV0 A;  3PB8 X;  3W6S A;  4JWP A;  5J1Q A;  2Q04 A;  1IYK A;  4MHP A;  4P44 A;  4UCM A;  2WZN A;  4C2Y A;  3H8G A;  1JQG A;  3HLP A;  4IUS A;  4UIA A;  4U5Y A;  3EO4 A;  4MFQ A;  1Q2D A;  3BJ7 A;  4H2K A;  4UFV A;  5K8M A;  3EC4 A;  5K8P A;  4MFP A;  4I49 A;  3FMC A;  2RFH A;  2REF A;  4CGL A;  3B3C A;  4KLV A;  1TKH A;  1BOB A;  4R8F A;  4C2Z A;  4B14 A;  2P6F A;  1QMU A;  4ZI6 A;  4KOR A;  2Q0Y A;  4MFL A;  3WT4 A;  4B13 A;  2FIW A;  4GS4 A;  1QSN A;  1LAM A;  4UIB A;  2B3V A;  4IAV A;  4C2X A;  1NE9 A;  2O4H A;  3KKW A;  2PRB A;  2YNC C;  1X12 A;  5A28 A;  1FNO A;  2Z3K A;  1GHE A;  3OWC A;  2P6G A;  5LYI A;  2JLM A;  2PJ1 A;  2ZEG A;  2PR1 A;  1LRZ A;  4H6U A;  1IID A;  1ARL A;  4E0A A;  2V8D A;  1CG2 A;  4J3G A;  3FXT A;  4EWT A;  5IB9 A;  4UCP A;  3RAM A;  2VBQ A;  4AVA A;  4HNX B;  5J8F A;  5G22 A;  1DE4 C;  4XNH B;  3FX6 A;  1RO5 A;  4X2T A;  3R9G A;  4DJL A;  5A27 A;  2VZZ A;  3GB0 A;  3QNV A;  1S7F A;  1Q2Y A;  4F6A A;  2DPT A;  1AYE A;  5AG4 A;  2P6E A;  2NMT A;  2ANP A;  1ON0 A;  4KSF A;  3VWD A;  4KOS A;  2Z3L A;  4OIW A;  2PJC A;  4II9 A;  4K3N A;  1FT7 A;  4FUU A;  3B7I A;  3ZZI A;  3R95 A;  5GCN A;  5LRJ A;  3TO6 A;  4LQG A;  2YNC A;  2XEG A;  4QBJ A;  1S7K A;  4M6I A;  4MMO A;  3MRU A;  3IFE A;  2GAN A;  3NA6 A;  3SI2 A;  3FNC A;  4NCZ A;  4KOX A;  1F2P A;  1TKJ A;  3PB6 X;  5F47 A;  2I00 A;  4P6Y A;  4AVC A;  2FS5 A;  1WK4 A;  4UFX A;  4FBE A;  4YFJ A;  2A4N A;  5THW A;  3BI0 A;  4YRH A;  2IMO A;  3JTK A;  2QJ8 A;  4OC5 A;  2ZED A;  2AFZ A;  2C6G A;  4HNY B;  2OOT A;  4K30 A;  3S6F A;  1VHO A;  5C88 A;  1BPN A;  2ZW6 A;  3V8I A;  1EE3 P;  3FEE A;  1CJW A;  3CXP A;  2ZOF A;  2Q7S A;  2DXQ A;  1N71 A;  4TNU A;  4KOT A;  2PE3 A;  2GLJ A;  2PJ2 A;  3QAH A;  5CBM A;  2PJ5 A;  4NJR A;  4ONW A;  4NGN A;  5DWM A;  3D2P A;  4QB9 A;  2GRE A;  4MFK A;  4PK2 A;  4U9Z A;  4KS9 A;  2OH1 A;  3PBE A;  4OLL A;  3G3S A;  1BPM A;  4CGM A;  1F2O A;  5AGE A;  3SJF A;  5IX3 A;  1XF8 A;  3LAC A;  4FAI A;  4CRY B;  4CRZ B;  1HDQ A;  2C6P A;  2GE3 A;  4F9U A;  2ABZ A;  4H6Z A;  4MHN A;  4OME A;  1YQE A;  3D3S A;  4RS2 A;  4ZY0 A;  1QSO A;  4UA3 A;  1OBR A;  3WAB A;  3I9S A;  1Y0Y A;  1WWZ A;  2POK A;  3R9E A;  2JEW A;  3B3S A;  3IU2 A;  1M4G A;  2Z3M A;  2B5G A;  3NE8 A;  4MCS A;  2FE7 A;  1KWM A;  3BHX A;  3KQZ A;  2CY2 A;  2PJ7 A;  5EC4 A;  4GM5 A;  4O23 A;  4B12 A;  2JEV A;  4KSA A;  4NGT A;  3C26 A;  1GYT A;  4PXD A;  3IC1 A;  4R76 A;  1TXR A;  2CXA A;  5H84 A;  3LOD A;  4A2Z A;  3DDD A;  4QVT A;  1UWY A;  4YU9 A;  4MJ8 A;  5HVF A;  4P10 A;  4XPK A;  2ARH A;  3RO0 A;  1BO4 A;  4PXC A;  2NSM A;  4A32 A;  1ELM P;  3EFA A;  4NGM A;  4PK3 A;  1ELL P;  4AG7 A;  4OC4 A;  1MJA A;  3KHX A;  2CNM A;  2OZU A;  3P2H A;  3SJE A;  3ZJ0 A;  1RXT A;  4MXU A;  2ZEM A;  2HC9 A;  4JD6 A;  2WYR A;  2O53 A;  4BD9 A;  3FIX A;  3KL9 A;  4B5O A;  4LQ6 A;  4CYQ A;  4P4D A;  5E96 A;  4PPZ A;  2JBJ A;  5AG5 A;  2RB7 A;  4PXB A;  4P4I A;  3V7Z A;  4IK2 A;  2YGW A;  4FD6 A;  3R9F A;  3JVN A;  3PB9 X;  2EK8 A;  2PVW A;  3DR8 A;  4MI4 A;  4QC6 A;  1YR0 A;  2BOA A;  2R98 A;  3ISZ A;  1KUY A;  4L8A A;  1AMP A;  3SI1 A;  1YME A;  2VZY A;  2ZEH A;  4E8O A;  1LFW A;  3BJ8 A;  2F5I A;  3P2F A;  2JDD A;  2B5G B;  2PR8 A;  3MGD A;  4B6Z A;  3GYA A;  3MN8 A;  1H8L A;  7CPA A;  5H86 A;  4MY0 A;  4HKF A;  3VH9 A;  1FY7 A;  3JUW A;  2QIR A;  4TWE A;  4KVO E;  1S7N A;  4FD5 A;  5EBV A;  2DEA A;  3IGR A;  4JZ0 A;  5I4M A;  5IB0 A;  1Z8W A;  3PEI A;  2RC4 A;  4EVY A;  1SQH A;  2DPS A;  4NGQ A;  1YRE A;  4NGR A;  3TE4 A;  3NH4 A;  4H89 A;  4RI1 A;  4JXR A;  2ZEO A;  3KGQ A;  3LWU A;  4M6G A;  3D7G A;  4KUB A;  4W9Y A;  3LD2 A;  1NMT A;  1VGY A;  5ISV A;  1JWQ A;  3B3W A;  4IF5 A;  2ZOG A;  2G9D A;  3TTH A;  4CAE A;  1R43 A;  1IOF A;  1NSA A;  3NH8 A;  2ZEF A;  5D29 A;  2C1C A;  3E0K A;  1CPS A;  2QEC A;  4NGS A;  3T9Y A;  5JM6 A;  3DSB A;  4UEZ A;  1KZF A;  5JH9 A;  4LUA A;  5F09 A;  2Q44 A;  1ZG8 A;  2PCU A;  2PJB A;  1Q7L A;  1MJ9 A;  1ZG7 A;  4A38 A;  3SHP A;  2CIJ A;  4R87 A;  2HUZ A;  2Y0M A;  4ORF A;  1XBU A;  4MFZ A;  2OU2 A;  3K9U A;  2PJ4 A;  5LYF A;  4OAD A;  2EO8 A;  2G3A A;  3RYO A;  5G21 A;  4Q38 A;  4CYP A;  4XPD B;  1R3N A;  1PU9 A;  2PJA A;  4NFR A;  2VXK A;  1VIX A;  4MY3 A;  4KLW A;  2I3C A;  5K8O A;  3WC7 A;  2PC1 A;  3I3G A;  4B11 A;  3FJU A;  1M4D A;  1XRY A;  1ZG9 A;  2OB0 A;  4R57 A;  3BI1 A;  4WJB A;  1YLE A;  2FXF A;  1K4J A;  1KUX A;  2V8V A;  3GIU A;  4PQA A;  2J8R A;  2XEI A;  4ZX9 A;  4PSX A;  4BIN A;  3CXS A;  5HH1 A;  1TF8 A;  3D67 A;  2OR4 A;  3WC6 A;  1Y7R A;  2ZEL A;  1XE4 A;  1YVO A;  2ZEN A;  3TX8 A;  3VAT A;  1QST A;  2O28 A;  5ELY A;  2Z10 A;  3PFO A;  5LYD A;  3S6K A;  2V8G A;  2PVV A;  1Z9U A;  2D4O A;  2AFS A;  2PRQ A;  4Q7A A;  4WWV A;  4RN7 A;  4M6H A;  4AXV A;  3DGV A;  4C7H A;  2Z3P A;  3F8K A;  2FT0 A;  3S9M A;  2EK9 A;  4BMH A;  3PZJ A;  4EME A;  3NH5 A;  3WR7 A;  5K8N A;  3KR4 A;  1MK4 A;  2PJ6 A;  2GFQ A;  4GXH A;  4OAE A;  4A39 A;  4CGP A;  4UEF A;  2WPX A;  1LAN A;  2B3U A;  1S7L A;  4NF1 A;  4ONU A;  5DS0 A;  3IWE A;  4OC3 A;  1M1D A;  1CBX A;  5LYL A;  2AE6 A;  3NFZ A;  5EMI A;  3TO9 A;  2R8V A;  1QQ9 A;  1I1D A;  3RNZ A;  4AG9 A;  1NSL A;  3EY5 A;  3IIB A;  4B10 A;  1XMT A;  1XMB A;  4FWU A;  1CP6 A;  1Y7E A;  4KOY A;  5FVJ A;  3DR6 A;  3ISX A;  2EUI A;  3HUV A;  4JLY A;  5F48 A;  6CPA A;  4BBH A;  3UY5 A;  2ZW5 A;  5KTC A;  4MBU A;  3G8W A;  4E2A A;  4PXE A;  4C68 A;  4CAF A;  2BEI A;  3CT9 A;  4KVX A;  3PRT A;  2ZW4 A;  4NXY A;  4UWJ A;  2IJZ A;  5KTD A;  4X8I A;  1XIX A;  3IO1 A;  4P4E A;  4M85 A;  2FCK A;  2WPW A;  3BLN A;  4R6T A;  4ZX8 A;  3S6H A;  2C27 A;  2ZPA A;  2OZH A;  4XPD C;  1CX8 A;  2R1I A;  4A37 A;  1IOI A;  3GUX A;  5HVG A;  4G1P A;  1VHE A;  3FED A;  5JPH A;  1S60 A;  4DUK A;  2I79 A;  2YND A;  1CPX A;  3TC8 A;  1IGB A;  1Z2L A;  3D66 A;  3TOB A;  2ZEE A;  1HEE A;  1P0H A;  4MFJ A;  2FL4 A;  3D68 A;  4AVB A;  1HDU A;  4UWI A;  3CPA A;  2G3T A;  3D7H A;  3TT2 A;  4U9Y A;  2EBJ A;  3F0A A;  3LMS A;  2B58 A;  2Q7B A;  5AG6 A;  4UFW A;  4Z65 A;  4OP4 A;  2XEJ A;  2EVN A;  1XEB A;  1Y9K A;  1YSJ A;  3SI0 A;  3K2K A;  1YW4 A;  2G0B A;  4KOV A;  5G1Z A;  4CGO A;  1UFH A;  2FVG A;  2Z0Z A;  1YK3 A;  4F0Y A;  3IWG A;  3BXM A;  3DLJ A;  5JGF A;  1A2Z A;  4CS0 B;  4X5K A;  1YW6 A;  1Z5R A;  3NE7 A;  5CPA A;  5C82 A;  3VWE A;  4AB7 A;  4B5P B;  1ZLI A;  2Q51 A;  3S9N A;  2Z11 A;  3K9T A;  2REE A;  2BL1 A;  4KOW A;  4P4B A;  4MCQ A;  3DNS A;  1TIQ A;  3B35 A;  4UEE A;  5AG7 A;  2F7V A;  4MCP A;  3IU1 A;  2IL4 A;  2EWB A;  1YGH A;  2J8M A;  4FD7 A;  4YGO A;  3SJX A;  3GKR A;  3QAY A;  2BCO A;  2GU2 A;  2YNE A;  4A33 A;  3PP9 A;  2ZEP A;  2AFX A;  1KUV A;  5HMN A;  1B87 A;  2DF5 A;  3FF3 A;  2BO9 A;  4FD4 A;  4Y49 C;  2PDO A;  4L89 A;  1U6M A;  3KQX A;  1PCA A;  3V38 A;  4UF4 A;  2D4P A;  3KAS A;  3D4U A;  2BSW A;  3PFE A;  4IHM A;  3B3T A;  2PQ8 A;  3CXQ A;  3L2N A;  4Q36 A;  4ZGY B;  3S9L A;  2BUE A;  1R57 A;  4PSW A;  3B2Y A;  5I0C A;  4C7I A;  4F8Z A;  3TCV A;  3FBU A;  3FYN A;  2VEZ A;  2NYQ A;  4MHY A;  3VAR A;  4CGN A;  1M4L A;  3PB7 X;  1Z4E A;  2XEF A;  4A95 A;  4OKO A;  4P4J A;  2ZW7 A;  5CNP A;  4ZY1 A;  4F0X A;  3SJG A;  2B4D B;  5JQ4 A;  3KI9 A;  1MJB A;  2QVP A;  2HB6 A;  2CF4 A;  4P45 A;  2VL1 A;  1QSR A;  4A30 A;  3PB4 X;  4NGP A;  5LRG A;  4KVM E;  3H5Z A;  2ZXV A;  2AFU A;  3FEC A;  2KCW A;  4CAX A;  1XJO A;  3I1U A;  1X10 A;  3H4Q A;  1ARM A;  1IY7 A;  1Q2C A;  2IQ6 A;  2VI7 A;  4MCR A;  2FIA A;  2PJ0 A;  1IB1 E;  3R96 A;  3W6X A;  1CM0 A;  3IEH A;  2V77 A;  3FVL A;  1VHS A;  4XPL A;  2V8H A;  3D2M A;  4OC0 A;  2H5M A;  3CPX A;  1I21 A;  2PJ8 A;  3D8P A;  1B6B A;  4CPA A;  3GLJ A;  4KUA A;  1TF9 A;  2VQY A;  4KSI A;  4ZY2 A;  1LCP A;  2PJ9 A;  2PIY A;  3FB3 A;  1VKC A;  4OC1 A;  4CYO A;  1TKF A;  4KZT A;  5DWN A;  2X7B A;  4LX9 A;  1S5K A;  1BLL E;  3PGP A;  3WC5 A;  1LOK A;  4NEX A;  4NSQ A;  2CTB A;  4OID A;  2OZG A;  2C6C A;  1M4I A;  4HPS A;  3W91 A;  4ZBG A;  5F46 A;  3TO7 A;  2CNT A;  4CYN A;  1CP7 A;  2AFO A;  4KOU A;  1Z4R A;  1BAV A;  3B8G A;  1YVK A;  2Q4Y A; 
#chains in the Genus database with same CATH homology
 4DNC A;  3GY9 A;  5BWA B;  1OZP A;  3N7Z A;  1J4J A;  3FRM A;  2ATR A;  1IIC A;  2Z3N A;  4B5P A;  4Y49 B;  2WUU A;  4UCN A;  5G20 A;  3SXN A;  1YX0 A;  2B4B A;  4QUS A;  2HV2 A;  3T90 A;  3SXO A;  1QSM A;  2GIV A;  3A9L A;  5F49 A;  4JJX A;  4R3L A;  4XNH C;  2JDC A;  4R3K A;  1ZO0 A;  3F5B A;  4CAW A;  2CNS A;  1Y9W A;  2Q4V A;  2R7H A;  2P0W A;  1L0C A;  2WSA A;  1S3Z A;  5KTA A;  1I12 A;  2FSR A;  4CAV A;  5J8C A;  2K5T A;  1PUA A;  2AJ6 A;  3QB8 A;  4MHD A;  4PV6 A;  2PSW A;  4M3S A;  3TFY A;  4HNW B;  1M44 A;  2B4D A;  3TOA A;  4UBR A;  2QML A;  1P4N A;  4JXQ A;  2Z3O A;  1IYL A;  1V0C A;  3R1K A;  3S6G A;  3EXN A;  4A31 A;  2HQY A;  2J8N A;  4R9M A;  5IV0 A;  3W6S A;  4JWP A;  2Q04 A;  1IYK A;  4UCM A;  4C2Y A;  4IUS A;  4U5Y A;  3EO4 A;  4MFQ A;  1Q2D A;  3BJ7 A;  4UFV A;  3EC4 A;  4MFP A;  4I49 A;  2REF A;  4CGL A;  4KLV A;  4C2Z A;  1BOB A;  4B14 A;  2P6F A;  4KOR A;  2Q0Y A;  4MFL A;  4B13 A;  2FIW A;  4GS4 A;  1QSN A;  2B3V A;  4C2X A;  1NE9 A;  3KKW A;  2PRB A;  2YNC C;  5A28 A;  2Z3K A;  1GHE A;  3OWC A;  2P6G A;  2JLM A;  2PR1 A;  1LRZ A;  4H6U A;  1IID A;  4E0A A;  4J3G A;  3FXT A;  4UCP A;  4AVA A;  2VBQ A;  4HNX B;  5J8F A;  5G22 A;  4XNH B;  1RO5 A;  3R9G A;  5A27 A;  2VZZ A;  1S7F A;  1Q2Y A;  4F6A A;  2DPT A;  5AG4 A;  2P6E A;  2NMT A;  1ON0 A;  4KSF A;  3VWD A;  4KOS A;  2Z3L A;  4II9 A;  3ZZI A;  3R95 A;  5GCN A;  3TO6 A;  2YNC A;  4QBJ A;  1S7K A;  2GAN A;  3FNC A;  4NCZ A;  4KOX A;  5F47 A;  2I00 A;  4AVC A;  2FS5 A;  1WK4 A;  4UFX A;  4YFJ A;  2A4N A;  4YRH A;  3JTK A;  4HNY B;  4K30 A;  3S6F A;  5C88 A;  2ZW6 A;  3V8I A;  1CJW A;  3CXP A;  2DXQ A;  1N71 A;  4KOT A;  3QAH A;  5DWM A;  3D2P A;  4QB9 A;  4MFK A;  4PK2 A;  4U9Z A;  4KS9 A;  2OH1 A;  4OLL A;  3G3S A;  4CGM A;  5IX3 A;  5AGE A;  1XF8 A;  4CRY B;  4CRZ B;  2GE3 A;  4H6Z A;  4RS2 A;  3D3S A;  1QSO A;  4UA3 A;  3I9S A;  2Q4Y A;  1WWZ A;  3R9E A;  3IU2 A;  1M4G A;  2Z3M A;  2B5G A;  2FE7 A;  2CY2 A;  5EC4 A;  4B12 A;  2JEV A;  4KSA A;  3C26 A;  2CXA A;  5H84 A;  3LOD A;  4A2Z A;  3DDD A;  4QVT A;  4MJ8 A;  4XPK A;  2ARH A;  1BO4 A;  4A32 A;  3EFA A;  4PK3 A;  4AG7 A;  1MJA A;  2CNM A;  2OZU A;  3P2H A;  3ZJ0 A;  1RXT A;  4JD6 A;  3FIX A;  4B5O A;  4CYQ A;  5E96 A;  5AG5 A;  2YGW A;  4FD6 A;  3R9F A;  3JVN A;  4QC6 A;  3DR8 A;  4MI4 A;  1YR0 A;  2R98 A;  1KUY A;  4L8A A;  2VZY A;  4E8O A;  3BJ8 A;  2F5I A;  3P2F A;  2JDD A;  2B5G B;  2PR8 A;  3MGD A;  3GYA A;  5H86 A;  4MY0 A;  4HKF A;  1FY7 A;  3JUW A;  2QIR A;  4KVO E;  1S7N A;  4FD5 A;  5EBV A;  3IGR A;  5IB0 A;  4EVY A;  2RC4 A;  1SQH A;  2DPS A;  1YRE A;  3TE4 A;  4H89 A;  4RI1 A;  4JXR A;  4KUB A;  3LD2 A;  1NMT A;  5ISV A;  4IF5 A;  3TTH A;  4CAE A;  3E0K A;  2QEC A;  3T9Y A;  3DSB A;  1KZF A;  4LUA A;  2Q44 A;  1MJ9 A;  3SHP A;  4R87 A;  2HUZ A;  4ORF A;  4MFZ A;  2OU2 A;  3K9U A;  4OAD A;  2G3A A;  3RYO A;  5G21 A;  4Q38 A;  4CYP A;  4XPD B;  1PU9 A;  2VXK A;  4MY3 A;  4KLW A;  2PC1 A;  3I3G A;  4B11 A;  1M4D A;  2OB0 A;  3TCV A;  4R57 A;  5FVJ A;  1YLE A;  2FXF A;  1K4J A;  1KUX A;  2J8R A;  4PSX A;  3CXS A;  5HH1 A;  1Y7R A;  1XE4 A;  1YVO A;  1QST A;  2O28 A;  2Z10 A;  3S6K A;  1Z9U A;  2D4O A;  4C7H A;  5JPH A;  2Z3P A;  3F8K A;  2FT0 A;  4BMH A;  3PZJ A;  3WR7 A;  1MK4 A;  4CGP A;  4OAE A;  2WPX A;  4NF1 A;  2B3U A;  1S7L A;  4ONU A;  3IWE A;  1M1D A;  2AE6 A;  3TO9 A;  2R8V A;  1I1D A;  4AG9 A;  1NSL A;  3EY5 A;  4B10 A;  4BBH A;  1XMT A;  4KOY A;  3DR6 A;  2EUI A;  4JLY A;  5F48 A;  3UY5 A;  2ZW5 A;  5KTC A;  4MBU A;  3G8W A;  4E2A A;  4C68 A;  4CAF A;  2BEI A;  4KVX A;  2ZW4 A;  4NXY A;  4UWJ A;  5KTD A;  1XIX A;  4M85 A;  2FCK A;  2WPW A;  3BLN A;  3S6H A;  2C27 A;  2ZPA A;  2OZH A;  4XPD C;  2R1I A;  1S60 A;  2I79 A;  2YND A;  3TOB A;  1P0H A;  4MFJ A;  2FL4 A;  4AVB A;  4UWI A;  2G3T A;  3TT2 A;  4U9Y A;  3F0A A;  2Q7B A;  2B58 A;  5AG6 A;  4UFW A;  2EVN A;  1XEB A;  1Y9K A;  4KOV A;  2G0B A;  4CGO A;  5G1Z A;  1UFH A;  2Z0Z A;  1YK3 A;  4F0Y A;  3IWG A;  4CS0 B;  4X5K A;  3NE7 A;  5C82 A;  3VWE A;  4AB7 A;  4B5P B;  2Z11 A;  2REE A;  2BL1 A;  4KOW A;  3DNS A;  1TIQ A;  5AG7 A;  3IU1 A;  2IL4 A;  1YGH A;  2J8M A;  4FD7 A;  4YGO A;  3GKR A;  2YNE A;  4A33 A;  3PP9 A;  1KUV A;  5HMN A;  1B87 A;  4FD4 A;  4Y49 C;  2PDO A;  4L89 A;  1U6M A;  2D4P A;  2BSW A;  2PQ8 A;  3CXQ A;  4Q36 A;  4ZGY B;  2BUE A;  1R57 A;  4PSW A;  5I0C A;  4C7I A;  3FYN A;  3FBU A;  2VEZ A;  4CGN A;  1Z4E A;  4A95 A;  2ZW7 A;  5CNP A;  4F0X A;  2B4D B;  5JQ4 A;  1MJB A;  1QSR A;  4A30 A;  4KVM E;  3H5Z A;  2ZXV A;  2KCW A;  4CAX A;  3H4Q A;  2VI7 A;  1Q2C A;  3R96 A;  2FIA A;  1IB1 E;  3W6X A;  1CM0 A;  1VHS A;  4XPL A;  3D2M A;  2H5M A;  1I21 A;  3D8P A;  1B6B A;  4KUA A;  2VQY A;  3FB3 A;  1VKC A;  4CYO A;  5DWN A;  4KZT A;  2X7B A;  4LX9 A;  1S5K A;  3PGP A;  4NEX A;  4NSQ A;  2OZG A;  1M4I A;  3W91 A;  4ZBG A;  5F46 A;  3TO7 A;  2CNT A;  4CYN A;  4KOU A;  1Z4R A;  3B8G A;  1YVK A;  2Y0M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...