4FD7A

Crystal structure of insect putative arylalkylamine n-acetyltransferase 7 from the yellow fever mosquito aedes aegypt
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
237
structure length
237
Chain Sequence
KWTRSVKVPFPSVWHRFQAKDLTSQQLVWYRVQDLPEDRFEDAIRHMCDYFARDELMNQAKGLAKDLVAMGDVVALWKAMLPDRMSLVCFREGSDEIVGVNILDVASRSDKDNAQFNSAIFQAIYDTIEYVSHQANIFDRYNVDHYLNAMGLSVDPKYRGRGIATEILRARIPLCRAVGLKLSATCFTGPNSQTAATRVGFQEDFTITYGELARVDQRFNYPGIEENFCKYMSLRVD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords putative arylalkylamine N-Acetyltransferase 7
publication title Evolution of insect arylalkylamine N-acetyltransferases: structural evidence from the yellow fever mosquito, Aedes aegypti.
pubmed doi rcsb
source organism Aedes aegypti
molecule tags Transferase
total genus 83
structure length 237
sequence length 237
chains with identical sequence B, C, D
ec nomenclature ec 2.3.1.87: Aralkylamine N-acetyltransferase.
pdb deposition date 2012-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4fd7A00
5J8CA 4JWPA 4ONUA 5HH1A 3R95A 2DXQA 5F48A 2R98A 3SXOA 3TOAA 2B4BA 4KZTA 1MJ9A 1S7KA 3W6SA 5F49A 1KUYA 1V0CA 1M4DA 4QUSA 4PSWA 1S5KA 4RI1A 2REEA 4UWIA 2P6EA 1CJWA 4FD4A 1J4JA 3K9UA 3ZJ0A 3FNCA 2Q04A 1U6MA 2FSRA 4CRYB 1YK3A 2VI7A 2Z0ZA 1S60A 4DNCA 2KCWA 4LX9A 3I9SA 5IV0A 2CNMA 5GCNA 4JXQA 1I21A 1K4JA 2I79A 1ON0A 2AE6A 2O28A 2FIWA 5FVJA 4CAVA 2P6GA 3E0KA 4R57A 1S7NA 3N7ZA 1S3ZA 4XPKA 1WK4A 3FXTA 4YRHA 2B5GA 3W6XA 4JLYA 4XPDC 2JEVA 2IL4A 4AVCA 4ZBGA 2H5MA 1S7FA 3TO6A 3EC4A 3G3SA 4KUBA 4M3SA 3W91A 1NE9A 4FD5A 3TFYA 2ZW5A 4KOWA 5JQ4A 1XIXA 1IYKA 1YLEA 1MJBA 4LUAA 3JUWA 1YVKA 4YFJA 3TO9A 5IX3A 4AVAA 4R3KA 3S6FA 3OWCA 4CAWA 3R1KA 3QAHA 2Q0YA 5J8FA 2EVNA 1KZFA 2BEIA 1VKCA 4B5PA 2CNTA 2PRBA 3WR7A 2CNSA 4J3GA 3TO7A 1Z4RA 3VWEA 1TIQA 3T90A 1IICA 1QSRA 4K30A 3B8GA 1KUXA 1Y9KA 1GHEA 4OLLA 4NEXA 2CY2A 3EO4A 4XNHB 2VXKA 3CXPA 4FD6A 2B4DB 4KOXA 4B5PB 2FE7A 4L8AA 3D8PA 1BOBA 3P2FA 3GY9A 3FIXA 1QSMA 4OADA 2HQYA 4PSXA 2PQ8A 2VBQA 2NMTA 1Z4EA 2BSWA 1M4GA 1B6BA 1IB1E 3S6HA 3RYOA 2WPXA 1Y9WA 4CS0B 2J8MA 3PP9A 3P2HA 4QB9A 4PV6A 2ZXVA 2FIAA 2OB0A 3D2MA 2G3AA 1L0CA 2FXFA 4M85A 3R96A 4U5YA 3BLNA 4YGOA 1P4NA 4F6AA 1KUVA 2VZZA 2Q4YA 4JD6A 1Q2CA 2R1IA 2G0BA 3S6GA 5JPHA 4R9MA 3R9EA 3TTHA 4ORFA 2HUZA 3R9FA 2D4PA 3TCVA 2VEZA 4H6UA 2Q7BA 3TT2A 5DWNA 5C88A 4KLVA 3IGRA 3UY5A 4KUAA 3TOBA 5EBVA 1YREA 2PC1A 3JVNA 5KTCA 2BUEA 4QBJA 4AVBA 4KOUA 1XF8A 2Q4VA 4JXRA 4AG9A 2OZGA 1M44A 3SHPA 4KOYA 2JDDA 3FYNA 1YR0A 4QVTA 3FB3A 2OZUA 3EY5A 4CAXA 5DWMA 1QSTA 4HNWB 4I49A 3T9YA 4CRZB 4EVYA 4H89A 4KOSA 2OU2A 4NCZA 4MI4A 2K5TA 2OH1A 1IIDA 4XNHC 1CM0A 1LRZA 2B5GB 2J8NA 2GIVA 1S7LA 3S6KA 3FRMA 2P0WA 5KTDA 4AG7A 1Q2DA 4UBRA 1XEBA 1RXTA 3QB8A 3F5BA 2PR1A 2C27A 2OZHA 1IYLA 3G8WA 4MJ8A 5H84A 3SXNA 1P0HA 3DR8A 5EC4A 1I12A 4Y49B 1I1DA 4U9YA 3DR6A 1M4IA 3DSBA 1NSLA 2ZW4A 4XPLA 4FD7A 5I0CA 3V8IA 3ZZIA 4GS4A 2Z11A 2WPWA 2HV2A 2RC4A 1NMTA 2Z10A 4NF1A 3MGDA 2VZYA 2PDOA 2F5IA 4MBUA 2PSWA 4E0AA 2Q44A 4E2AA 4R3LA 3BJ7A 2G3TA 5F47A 3EXNA 1YX0A 4II9A 4KOVA 4PK3A 4IUSA 2PR8A 3EFAA 1Y7RA 4BMHA 3R9GA 2A4NA 3LODA 4L89A 3F8KA 4MY0A 2ZPAA 4KORA 1SQHA 1WWZA 4F0YA 4HNYB 3FBUA 3LD2A 3PZJA 2R8VA 4KVME 1BO4A 2BL1A 1M1DA 1XE4A 4NXYA 2B3UA 2Y0MA 3DDDA 2X7BA 3PGPA 4UA3A 2GANA 2QMLA 2EUIA 1MJAA 4HKFA 4R87A 2AJ6A 1MK4A 4X5KA 5F46A 4KOTA 4E8OA 4AB7A 3D3SA 4B5OA 3DNSA 5H86A 1RO5A 1PU9A 2FS5A 4PK2A 5C82A 4UWJA 3IWGA 1N71A 2D4OA 1QSOA 4IF5A 4MY3A 1XMTA 5IB0A 1Z9UA 3CXQA 3GYAA 2FL4A 3KKWA 1VHSA 3GKRA 5E96A 5KTAA 2QECA 3BJ8A 3I3GA 4KLWA 4Y49C 3C26A 4KVXA 4QC6A 4KVOE 2JLMA 1FY7A 1YGHA 3F0AA 4RS2A 4NSQA 3VWDA 3CXSA 2VQYA 5CNPA 4OAEA 4HNXB 4H6ZA 1UFHA 1PUAA 1OZPA 2B4DA 2QIRA 2R7HA 1QSNA 1YVOA 1B87A 2ZW6A 2B58A 3D2PA 4XPDB 2REFA 2J8RA 3NE7A 2ARHA 5HMNA 2P6FA 2ZW7A 2B3VA 1Q2YA 4JJXA 5ISVA 3TE4A 1R57A 4U9ZA 4MHDA 2FCKA 2JDCA 3H4QA 2GE3A 2ATRA 2I00A 2FT0A
chains in the Genus database with same CATH superfamily
5J8CA 4JWPA 1TF8A 2PJAA 4ONUA 5HH1A 5AGEA 4MHPA 3R95A 2DXQA 5THWA 5AG4A 1VGYA 2PCUA 5F48A 2R98A 4OC4A 3WABA 3SXOA 3TOAA 2B4BA 4KZTA 3NH5A 4RN7A 4YU9A 2CIJA 1MJ9A 3NA6A 1S7KA 4MHNA 1XOVA 4KS9A 3PRTA 4Z65A 4OC0A 3RBUA 2CF4A 1HDUA 3W6SA 5F49A 1KUYA 3ISXA 1ZG8A 1V0CA 1M4DA 4QUSA 4PSWA 1S5KA 3PFEA 4OIDA 4RI1A 3BHXA 4UEEA 4CPAA 2REEA 4UWIA 1PYTB 2ZEFA 4CGPA 2P6EA 2WZNA 1CJWA 4GXHA 4FD4A 4P4IA 1J4JA 1ZLIA 3KR4A 4P4DA 3K9UA 4P45A 1BPMA 2YNCC 3ZJ0A 3FNCA 1Z2LA 4FWUA 1GYTA 2Q04A 3PB9X 5CPAA 1U6MA 2YNEA 4A94A 5CBMA 1QQ9A 2V8GA 4B11A 2FSRA 3CDXA 4R7MA 4CRYB 4MCQA 1YK3A 4MCRA 2PJ7A 4UFWA 2GLFA 1OBRA 2VI7A 2Z0ZA 1S60A 4DNCA 2KCWA 4LX9A 3SI0A 1F2PA 2PJ5A 4BINA 4OMEA 1IGBA 3I9SA 4CAEA 1Z8XA 3B7IA 3VARA 5IV0A 4UCNA 2CNMA 4IK2A 4ZY1A 2Q51A 5GCNA 4JXQA 1K4JA 1I21A 5AG6A 2I79A 1ON0A 2AE6A 4F0XA 2BO9A 7CPAA 4B10A 2O28A 1XMBA 2FIWA 4R8FA 4UIAA 5FVJA 5G22A 4CAVA 1VHEA 2P6GA 3H8EA 3E0KA 4R57A 3VATA 4B13A 1S7NA 3N7ZA 1S3ZA 4M6HA 4XPKA 1WK4A 3FXTA 4YRHA 2B5GA 2PVWA 3W6XA 4JLYA 4XPDC 2JEVA 3D7GA 1R3NA 2IL4A 3D7DA 3IU2A 4A38A 4AVCA 4ZBGA 2H5MA 1S7FA 3S9NA 3KHXA 3FJUA 3KI9A 3TO6A 4EFDA 3EC4A 3G3SA 4KUBA 2CXAA 1M4LA 2Q7SA 4CGOA 4MMOA 2I3CA 2V8VA 4M3SA 3W91A 1NE9A 1XRYA 4FD5A 4X3RA 2C6PA 3TFYA 2ZW5A 3NE8A 4A2ZA 4KOWA 1ZG7A 5JQ4A 2V8DA 1XIXA 4Q7AA 4R76A 1IYKA 1YLEA 3SI2A 1MJBA 4OC2A 2C6GA 4LUAA 2GFQA 3JUWA 2ZELA 1YVKA 3HUVA 4PXBA 4YFJA 3TO9A 4NJQA 5LRGA 4MFJA 4AVAA 4R3KA 2F7VA 2ZENA 5HVHA 3B3WA 3FECA 1YSJA 3KGQA 4MFQA 3S6FA 3CPAA 4F9UA 3OWCA 4CAWA 5IX3A 3R1KA 4F8ZA 4Q36A 3QAHA 4NGPA 2Q0YA 5J8FA 2EVNA 3GLJA 4PQAA 1KZFA 3RNZA 3WC7A 3IIBA 3PBBA 3TC8A 2HB6A 2BEIA 1VKCA 4B5PA 2CNTA 2AFXA 2PRBA 3SJXA 2DPTA 2Z3OA 3WR7A 2CNSA 4J3GA 2OOTA 2XEFA 2BCOA 4DUKA 1TF9A 1Z5RA 4KSIA 1ZO0A 4JZ0A 4B14A 2POKA 3TO7A 1Q7LA 4AXVA 3N5FA 1Z4RA 1Z8LA 3VWEA 1TIQA 3T90A 1IICA 1IU8A 1QSRA 4K30A 3NH8A 3K2KA 2QJ8A 3IFEA 3B8GA 3CZXA 5LYIA 5G21A 3GB0A 1KUXA 2IQ6A 3MN8A 1Y9KA 1GHEA 2DPSA 1Y7EA 1PCAA 4OLLA 3SJEA 5AG5A 5HVFA 2GREA 2CTCA 4NEXA 1CBXA 2PJ0A 4PXCA 2CY2A 1F2OA 2YNDA 3FMCA 3KZWA 4UIBA 3LACA 3EO4A 4XNHB 2VXKA 4A33A 3CXPA 1FT7A 2B4DB 4FD6A 4W9YA 4KOXA 4B5PB 4CGLA 2FE7A 4L8AA 3ISZA 3D8PA 1BOBA 3P2FA 3GY9A 3FIXA 4A30A 2AFUA 2AFOA 4A37A 1QSMA 4OADA 2HQYA 5J1QA 4PSXA 2PQ8A 2VBQA 2NMTA 1Z4EA 2BSWA 1ELMP 1M4GA 2PIYA 1B6BA 1IB1E 2O4HA 4M6IA 3S6HA 3RYOA 2WPXA 3JRUA 3KASA 1Y9WA 4CYOA 4CS0B 2J8MA 3PP9A 2ZEGA 3P2HA 4QB9A 3KQXA 4PV6A 2ZXVA 1XJOA 1ZLHA 2FIAA 2NYQA 2OB0A 3D2MA 2XEIA 2G3AA 5G20A 1X12A 2Z3MA 2EWBA 1L0CA 2FXFA 4M85A 3R96A 4RUHA 4U5YA 3BLNA 3PEIA 3I1UA 3D68A 4YGOA 1P4NA 2RB7A 4F6AA 3BXMA 3SI1A 1KUVA 4IAVA 1IOIA 2VZZA 2Q4YA 3PFOA 4JD6A 3H8FA 3NH4A 2WYRA 1Q2CA 2R1IA 3RO0A 5HVGA 2G0BA 1UWYA 1A2ZA 3S6GA 5JPHA 3IU1A 5K8NA 4R9MA 3R9EA 4X2TA 3TTHA 1X10A 2ANPA 4OP4A 4ORFA 2AFSA 2HUZA 3R9FA 2Z3LA 2D4PA 2AFWA 3TCVA 2VEZA 3BI1A 4H6UA 3B3SA 2Q7BA 3TT2A 5AG7A 1LFWA 2OR4A 2O53A 2YNCA 5DWNA 5C88A 4P4FA 4KLVA 3IGRA 3UY5A 4KUAA 2IJZA 3IJ3A 3TOBA 1CPSA 3V38A 5JGFA 4KSFA 5EBVA 1YREA 2PC1A 3JVNA 4M6GA 3FH4A 2BUEA 4QBJA 5KTCA 4AVBA 1YQEA 4KOUA 4FBEA 5K8PA 3KHZA 1XF8A 2Q4VA 4JXRA 1LAMA 4AG9A 4CGMA 2ZEEA 2OZGA 1M44A 3MRUA 3SHPA 4NGRA 2PJCA 3B35A 4KOYA 2JDDA 4F9VA 1YLOA 4ZI6A 1EE3P 4OIWA 4IHMA 3FYNA 3B3CA 1YR0A 4QVTA 4CYQA 3LMSA 1NSAA 4Q38A 3FB3A 2OZUA 2PE3A 2ZEOA 3WT4A 3EY5A 2ZEPA 1IY7A 1CG2A 3B3VA 4ZY2A 3T8WA 4CAXA 3WC5A 1CPXA 2ABZA 5DWMA 1QSTA 1CP7A 4HNWB 4I49A 4PXEA 3T9YA 4CRZB 3PB6X 1TKJA 4EVYA 4H89A 4KOSA 3B3TA 2OU2A 4KSAA 4NCZA 5JM6A 4MI4A 2K5TA 2OH1A 2AFZA 4LQGA 1IIDA 8CPAA 4A32A 4XNHC 1Y0YA 1CM0A 5A27A 1LRZA 2B5GB 2PJ8A 2J8NA 2GIVA 3GUXA 3PB8X 3HLPA 1FNOA 1S7LA 2DF5A 3S6KA 3FRMA 3V7ZA 3WC6A 2P0WA 5KTDA 2J9AA 4NFRA 4MFZA 4AG7A 4OC3A 1Q2DA 4HPSA 1BLLE 5K8MA 4NGQA 4GM5A 2XEJA 4UBRA 3FEEA 1XEBA 4NGMA 1RXTA 3FVLA 1ELLP 3QB8A 2F8HA 3F5BA 2PR1A 1QMUA 3PB7X 3FX6A 2C27A 4LQ6A 1RTQA 2OZHA 1IYLA 3G8WA 4MJ8A 2CTBA 5H84A 4C68A 3SXNA 4C2YA 3QNVA 4ZX9A 5A28A 1P0HA 3DR8A 1IOFA 4P4EA 2Z3PA 5EC4A 1AMPA 1TKHA 3L2NA 4NGNA 1I12A 5K8OA 4Y49B 1I1DA 3B2YA 4U9YA 3DR6A 1M4IA 4PPZA 4UF4A 3DSBA 1NSLA 2ZW4A 2AFMA 2QVPA 3BI0A 4XPLA 4FD7A 4CGNA 3V8IA 5I0CA 1KWMA 5G1ZA 3ZZIA 4GS4A 5F09A 2G9DA 2Z11A 5D8NA 5EMIA 2WPWA 2V77A 4B6ZA 2PJ2A 2HV2A 4PXDA 4MCSA 2RC4A 1VIXA 1NMTA 5LYDA 1JQGA 2Z10A 4WJBA 4NF1A 3MGDA 2VZYA 2PDOA 2F5IA 2GLJA 1XBUA 3CPXA 2HC9A 4MBUA 5JH9A 4EMEA 5LYLA 2PSWA 4CYNA 4E0AA 2Q44A 4E2AA 1HDQA 4B12A 3LWUA 4R3LA 1YMEA 3BJ7A 2G3TA 2EBJA 3DLJA 3GIUA 2PJ6A 4UFVA 3EXNA 5F47A 4A39A 1YX0A 3H5ZA 3PBEA 4MXUA 4KOVA 4II9A 3S9MA 3K9TA 2ZOFA 4PK3A 4IUSA 5D29A 4P4BA 2PR8A 3EFAA 2YGWA 3RAMA 4A95A 4C2ZA 1Y7RA 5IB9A 4BMHA 4ZY0A 1YW6A 3R9GA 4NJRA 2A4NA 5ELYA 2ZEHA 3LODA 4MFLA 4L89A 4ZYQA 4OC5A 3F8KA 4MY0A 2ZPAA 4KORA 1SQHA 4NGSA 1WWZA 1ARLA 2Z3NA 4F0YA 4UCMA 4HNYB 3FBUA 4DYOA 4BBHA 3LD2A 2R8VA 2VL1A 3PZJA 3JTKA 4KVME 4C2XA 1BO4A 5I4MA 2BL1A 1M1DA 4JYWA 3KR5A 4P6YA 3VH9A 1TKFA 1TXRA 3NFZA 1XE4A 2JBJA 2ODFA 2B3UA 4NXYA 2Y0MA 3DDDA 5DS0A 2JEWA 2X7BA 4OC1A 4MFPA 3D7HA 4G1PA 2C6CA 1CX8A 3SJFA 3PGPA 4UA3A 2GANA 2QMLA 2V8HA 2EK9A 2Q43A 2EUIA 1MJAA 5LRJA 4HKFA 4X8IA 1ZG9A 2FVGA 4R87A 4DJLA 2AJ6A 1MK4A 2PJ4A 2PJBA 3FEDA 4X5KA 4YWYA 5F46A 2BOAA 4FUUA 4KOTA 4E8OA 4TWEA 4AB7A 3D3SA 4B5OA 3DNSA 4UCPA 1Z8TA 5H86A 1RO5A 1PU9A 2FS5A 4PK2A 4ZX8A 1DE4C 2WSAA 5C82A 3A9LA 1AYEA 4MHYA 4UWJA 1F57A 1LANA 2ZOGA 3IWGA 1N71A 2D4OA 3QAYA 1QSOA 3SJGA 4IF5A 1HEEA 4MY3A 1XMTA 3IC1A 2PIZA 3KQZA 5IB0A 1Z9UA 3S9LA 3CXQA 2ZEMA 3GYAA 4WWVA 2FL4A 5BWAB 4CYPA 6CPAA 3KKWA 4H2KA 4TNUA 4EWTA 1Z8WA 4MRIA 1VHSA 4C7IA 3GKRA 5LRKA 2PRQA 5E96A 5KTAA 2JBKA 2QECA 3BJ8A 3DGVA 3I3GA 4KLWA 4O23A 4UEFA 3C26A 4P44A 4Y49C 4KVXA 4QC6A 4KVOE 2JLMA 1FY7A 2PJ1A 4ONWA 1BAVA 4MFKA 3D4UA 1YGHA 2PJ3A 4OKOA 2PJ9A 3F0AA 4RS2A 3KL9A 4NSQA 1LCPA 3FF3A 3VWDA 3CXSA 3H8GA 2C1CA 4NGTA 5HXDA 2VQYA 1AUGA 1JWQA 5CNPA 4A31A 3IEHA 4MCPA 1R43A 2XEGA 3CT9A 1LAPA 2Q4ZA 2DEAA 2QYVA 2EO8A 2PVVA 4OAEA 3IO1A 4HNXB 4H6ZA 4FAIA 1UFHA 3RZAA 4UFXA 3D66A 1DTDA 1LOKA 1PUAA 1OZPA 2B4DA 2QIRA 2R7HA 1QSNA 1YVOA 1B87A 2ZW6A 2B58A 3D2PA 4MHZA 4XPDB 2REFA 4P4JA 3IWEA 4K3NA 2J8RA 2ZEDA 3NE7A 2ARHA 3D7FA 5HMNA 2IMOA 2P6FA 3IWWA 2ZW7A 2B3VA 3D67A 1Q2YA 1YW4A 2EK8A 4UEZA 2GU2A 3PB4X 4JJXA 5ISVA 3TE4A 4R6TA 1R57A 4U9ZA 1H8LA 4MHDA 2FCKA 1BPNA 1Y0RA 1XFOA 2JDCA 2RFHA 2GE3A 3H4QA 4P10A 2ATRA 1ARMA 1CP6A 3TX8A 4C7HA 1VHOA 2NSMA 2I00A 4BD9A 4ZGYB 5LYFA 4CAFA 2Z3KA 2FT0A 2WUUA
chains in the Genus database with same CATH topology
5J8CA 4JWPA 4ONUA 5HH1A 3R95A 5AG4A 5AGEA 2DXQA 5F48A 2R98A 3SXOA 3TOAA 2B4BA 4KZTA 1MJ9A 1S7KA 4KS9A 3W6SA 5F49A 1KUYA 1V0CA 1M4DA 4QUSA 4PSWA 1S5KA 4RI1A 2REEA 4UWIA 4CGPA 2P6EA 1CJWA 4FD4A 1J4JA 3K9UA 2YNCC 3ZJ0A 3FNCA 2Q04A 1U6MA 2YNEA 4B11A 2FSRA 4CRYB 1YK3A 4UFWA 2VI7A 2Z0ZA 1S60A 4DNCA 2KCWA 4LX9A 3I9SA 4CAEA 5IV0A 4UCNA 2CNMA 5GCNA 4JXQA 1I21A 1K4JA 5AG6A 2I79A 1ON0A 2AE6A 4F0XA 4B10A 2O28A 2FIWA 5G22A 5FVJA 4CAVA 2P6GA 3E0KA 4R57A 4B13A 1S7NA 3N7ZA 1S3ZA 4XPKA 1WK4A 3FXTA 4YRHA 2B5GA 3W6XA 4JLYA 4XPDC 2JEVA 2IL4A 3IU2A 4AVCA 4ZBGA 2H5MA 1S7FA 3TO6A 3EC4A 3G3SA 4KUBA 2CXAA 4CGOA 4M3SA 3W91A 1NE9A 4FD5A 3TFYA 2ZW5A 4A2ZA 4KOWA 5JQ4A 1XIXA 1IYKA 1YLEA 1MJBA 4LUAA 3JUWA 1YVKA 4YFJA 3TO9A 5IX3A 4MFJA 4AVAA 4R3KA 3S6FA 4MFQA 3OWCA 4CAWA 3R1KA 4Q36A 3QAHA 2Q0YA 5J8FA 2EVNA 1KZFA 2BEIA 1VKCA 4B5PA 2CNTA 2PRBA 2DPTA 2Z3OA 3WR7A 2CNSA 4J3GA 1ZO0A 4B14A 3TO7A 1Z4RA 3VWEA 1TIQA 3T90A 1IICA 1QSRA 4K30A 3B8GA 5G21A 1KUXA 1Y9KA 1GHEA 2DPSA 4OLLA 5AG5A 4NEXA 2CY2A 2YNDA 3EO4A 4XNHB 2VXKA 4A33A 3CXPA 4FD6A 2B4DB 4KOXA 4B5PB 4CGLA 2FE7A 4L8AA 3D8PA 1BOBA 3P2FA 3GY9A 3FIXA 4A30A 1QSMA 4OADA 2HQYA 4PSXA 2PQ8A 2VBQA 2NMTA 1Z4EA 2BSWA 1M4GA 1B6BA 1IB1E 3S6HA 3RYOA 2WPXA 1Y9WA 4CYOA 4CS0B 2J8MA 3PP9A 3P2HA 4QB9A 4PV6A 2ZXVA 2FIAA 5G20A 2OB0A 3D2MA 2G3AA 2Z3MA 1L0CA 2FXFA 4M85A 3R96A 4U5YA 3BLNA 4YGOA 1P4NA 4F6AA 1KUVA 2VZZA 2Q4YA 4JD6A 1Q2CA 2R1IA 2G0BA 3S6GA 5JPHA 3IU1A 4R9MA 3R9EA 3TTHA 4ORFA 2HUZA 3R9FA 2Z3LA 2D4PA 3TCVA 2VEZA 4H6UA 2Q7BA 3TT2A 5AG7A 2YNCA 5DWNA 5C88A 4KLVA 3IGRA 3UY5A 4KUAA 3TOBA 4KSFA 5EBVA 1YREA 2PC1A 3JVNA 5KTCA 2BUEA 4QBJA 4AVBA 4KOUA 1XF8A 2Q4VA 4JXRA 4AG9A 4CGMA 2OZGA 1M44A 3SHPA 4KOYA 2JDDA 3FYNA 1YR0A 4QVTA 4CYQA 4Q38A 3FB3A 2OZUA 3EY5A 4CAXA 5DWMA 1QSTA 4HNWB 4I49A 3T9YA 4CRZB 4EVYA 4H89A 4KOSA 2OU2A 4KSAA 4NCZA 4MI4A 2K5TA 2OH1A 1IIDA 4A32A 4XNHC 1CM0A 5A27A 1LRZA 2B5GB 2J8NA 2GIVA 1S7LA 3S6KA 3FRMA 2P0WA 5KTDA 4MFZA 4AG7A 1Q2DA 4UBRA 1XEBA 1RXTA 3QB8A 3F5BA 2PR1A 2C27A 2OZHA 1IYLA 3G8WA 4MJ8A 5H84A 4C68A 3SXNA 4C2YA 5A28A 1P0HA 3DR8A 5EC4A 2Z3PA 1I12A 4Y49B 1I1DA 4U9YA 3DR6A 1M4IA 3DSBA 1NSLA 2ZW4A 4XPLA 4FD7A 4CGNA 3V8IA 5I0CA 5G1ZA 3ZZIA 4GS4A 2Z11A 2WPWA 2HV2A 2RC4A 1NMTA 2Z10A 4NF1A 3MGDA 2VZYA 2PDOA 2F5IA 4MBUA 2PSWA 4CYNA 4E0AA 2Q44A 4E2AA 4B12A 4R3LA 3BJ7A 2G3TA 5F47A 4UFVA 3EXNA 1YX0A 3H5ZA 4II9A 4KOVA 4PK3A 4IUSA 2PR8A 3EFAA 2YGWA 4A95A 4C2ZA 1Y7RA 4BMHA 3R9GA 2A4NA 3LODA 4MFLA 4L89A 3F8KA 4MY0A 2ZPAA 4KORA 1SQHA 1WWZA 2Z3NA 4F0YA 4UCMA 4HNYB 3FBUA 4BBHA 3LD2A 3PZJA 2R8VA 4KVME 3JTKA 4C2XA 1BO4A 2BL1A 1M1DA 1XE4A 4NXYA 2B3UA 2Y0MA 3DDDA 2X7BA 4MFPA 3PGPA 4UA3A 2GANA 2QMLA 2EUIA 1MJAA 4HKFA 4R87A 2AJ6A 1MK4A 4X5KA 5F46A 4KOTA 4E8OA 4AB7A 3D3SA 4B5OA 3DNSA 4UCPA 5H86A 1RO5A 1PU9A 2FS5A 4PK2A 2WSAA 5C82A 3A9LA 4UWJA 3IWGA 1N71A 2D4OA 1QSOA 4IF5A 4MY3A 1XMTA 5IB0A 1Z9UA 3CXQA 3GYAA 2FL4A 5BWAB 4CYPA 3KKWA 1VHSA 4C7IA 3GKRA 5E96A 5KTAA 2QECA 3BJ8A 3I3GA 4KLWA 4Y49C 3C26A 4KVXA 4QC6A 4KVOE 2JLMA 1FY7A 4MFKA 1YGHA 3F0AA 4RS2A 4NSQA 3VWDA 3CXSA 2VQYA 5CNPA 4A31A 4OAEA 4HNXB 4H6ZA 1UFHA 4UFXA 1PUAA 1OZPA 2B4DA 2QIRA 2R7HA 1QSNA 1YVOA 1B87A 2ZW6A 2B58A 3D2PA 4XPDB 2REFA 3IWEA 2J8RA 3NE7A 2ARHA 5HMNA 2P6FA 2ZW7A 2B3VA 1Q2YA 4JJXA 5ISVA 3TE4A 1R57A 4U9ZA 4MHDA 2FCKA 2JDCA 3H4QA 2GE3A 2ATRA 4C7HA 2I00A 4ZGYB 4CAFA 2Z3KA 2FT0A 2WUUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5J8C A;  4JWP A;  4ONU A;  5HH1 A;  3R95 A;  2DXQ A;  5F48 A;  2R98 A;  3SXO A;  3TOA A;  2B4B A;  4KZT A;  1MJ9 A;  1S7K A;  3W6S A;  5F49 A;  1KUY A;  1V0C A;  1M4D A;  4QUS A;  4PSW A;  1S5K A;  4RI1 A;  2REE A;  4UWI A;  2P6E A;  1CJW A;  4FD4 A;  1J4J A;  3K9U A;  3ZJ0 A;  3FNC A;  2Q04 A;  1U6M A;  2FSR A;  4CRY B;  1YK3 A;  2VI7 A;  2Z0Z A;  1S60 A;  4DNC A;  2KCW A;  4LX9 A;  3I9S A;  5IV0 A;  2CNM A;  5GCN A;  4JXQ A;  1I21 A;  1K4J A;  2I79 A;  1ON0 A;  2AE6 A;  2O28 A;  2FIW A;  5FVJ A;  4CAV A;  2P6G A;  3E0K A;  4R57 A;  1S7N A;  3N7Z A;  1S3Z A;  4XPK A;  1WK4 A;  3FXT A;  4YRH A;  2B5G A;  3W6X A;  4JLY A;  4XPD C;  2JEV A;  2IL4 A;  4AVC A;  4ZBG A;  2H5M A;  1S7F A;  3TO6 A;  3EC4 A;  3G3S A;  4KUB A;  4M3S A;  3W91 A;  1NE9 A;  4FD5 A;  3TFY A;  2ZW5 A;  4KOW A;  5JQ4 A;  1XIX A;  1IYK A;  1YLE A;  1MJB A;  4LUA A;  3JUW A;  1YVK A;  4YFJ A;  3TO9 A;  5IX3 A;  4AVA A;  4R3K A;  3S6F A;  3OWC A;  4CAW A;  3R1K A;  3QAH A;  2Q0Y A;  5J8F A;  2EVN A;  1KZF A;  2BEI A;  1VKC A;  4B5P A;  2CNT A;  2PRB A;  3WR7 A;  2CNS A;  4J3G A;  3TO7 A;  1Z4R A;  3VWE A;  1TIQ A;  3T90 A;  1IIC A;  1QSR A;  4K30 A;  3B8G A;  1KUX A;  1Y9K A;  1GHE A;  4OLL A;  4NEX A;  2CY2 A;  3EO4 A;  4XNH B;  2VXK A;  3CXP A;  4FD6 A;  2B4D B;  4KOX A;  4B5P B;  2FE7 A;  4L8A A;  3D8P A;  1BOB A;  3P2F A;  3GY9 A;  3FIX A;  1QSM A;  4OAD A;  2HQY A;  4PSX A;  2PQ8 A;  2VBQ A;  2NMT A;  1Z4E A;  2BSW A;  1M4G A;  1B6B A;  1IB1 E;  3S6H A;  3RYO A;  2WPX A;  1Y9W A;  4CS0 B;  2J8M A;  3PP9 A;  3P2H A;  4QB9 A;  4PV6 A;  2ZXV A;  2FIA A;  2OB0 A;  3D2M A;  2G3A A;  1L0C A;  2FXF A;  4M85 A;  3R96 A;  4U5Y A;  3BLN A;  4YGO A;  1P4N A;  4F6A A;  1KUV A;  2VZZ A;  2Q4Y A;  4JD6 A;  1Q2C A;  2R1I A;  2G0B A;  3S6G A;  5JPH A;  4R9M A;  3R9E A;  3TTH A;  4ORF A;  2HUZ A;  3R9F A;  2D4P A;  3TCV A;  2VEZ A;  4H6U A;  2Q7B A;  3TT2 A;  5DWN A;  5C88 A;  4KLV A;  3IGR A;  3UY5 A;  4KUA A;  3TOB A;  5EBV A;  1YRE A;  2PC1 A;  3JVN A;  5KTC A;  2BUE A;  4QBJ A;  4AVB A;  4KOU A;  1XF8 A;  2Q4V A;  4JXR A;  4AG9 A;  2OZG A;  1M44 A;  3SHP A;  4KOY A;  2JDD A;  3FYN A;  1YR0 A;  4QVT A;  3FB3 A;  2OZU A;  3EY5 A;  4CAX A;  5DWM A;  1QST A;  4HNW B;  4I49 A;  3T9Y A;  4CRZ B;  4EVY A;  4H89 A;  4KOS A;  2OU2 A;  4NCZ A;  4MI4 A;  2K5T A;  2OH1 A;  1IID A;  4XNH C;  1CM0 A;  1LRZ A;  2B5G B;  2J8N A;  2GIV A;  1S7L A;  3S6K A;  3FRM A;  2P0W A;  5KTD A;  4AG7 A;  1Q2D A;  4UBR A;  1XEB A;  1RXT A;  3QB8 A;  3F5B A;  2PR1 A;  2C27 A;  2OZH A;  1IYL A;  3G8W A;  4MJ8 A;  5H84 A;  3SXN A;  1P0H A;  3DR8 A;  5EC4 A;  1I12 A;  4Y49 B;  1I1D A;  4U9Y A;  3DR6 A;  1M4I A;  3DSB A;  1NSL A;  2ZW4 A;  4XPL A;  4FD7 A;  5I0C A;  3V8I A;  3ZZI A;  4GS4 A;  2Z11 A;  2WPW A;  2HV2 A;  2RC4 A;  1NMT A;  2Z10 A;  4NF1 A;  3MGD A;  2VZY A;  2PDO A;  2F5I A;  4MBU A;  2PSW A;  4E0A A;  2Q44 A;  4E2A A;  4R3L A;  3BJ7 A;  2G3T A;  5F47 A;  3EXN A;  1YX0 A;  4II9 A;  4KOV A;  4PK3 A;  4IUS A;  2PR8 A;  3EFA A;  1Y7R A;  4BMH A;  3R9G A;  2A4N A;  3LOD A;  4L89 A;  3F8K A;  4MY0 A;  2ZPA A;  4KOR A;  1SQH A;  1WWZ A;  4F0Y A;  4HNY B;  3FBU A;  3LD2 A;  3PZJ A;  2R8V A;  4KVM E;  1BO4 A;  2BL1 A;  1M1D A;  1XE4 A;  4NXY A;  2B3U A;  2Y0M A;  3DDD A;  2X7B A;  3PGP A;  4UA3 A;  2GAN A;  2QML A;  2EUI A;  1MJA A;  4HKF A;  4R87 A;  2AJ6 A;  1MK4 A;  4X5K A;  5F46 A;  4KOT A;  4E8O A;  4AB7 A;  3D3S A;  4B5O A;  3DNS A;  5H86 A;  1RO5 A;  1PU9 A;  2FS5 A;  4PK2 A;  5C82 A;  4UWJ A;  3IWG A;  1N71 A;  2D4O A;  1QSO A;  4IF5 A;  4MY3 A;  1XMT A;  5IB0 A;  1Z9U A;  3CXQ A;  3GYA A;  2FL4 A;  3KKW A;  1VHS A;  3GKR A;  5E96 A;  5KTA A;  2QEC A;  3BJ8 A;  3I3G A;  4KLW A;  4Y49 C;  3C26 A;  4KVX A;  4QC6 A;  4KVO E;  2JLM A;  1FY7 A;  1YGH A;  3F0A A;  4RS2 A;  4NSQ A;  3VWD A;  3CXS A;  2VQY A;  5CNP A;  4OAE A;  4HNX B;  4H6Z A;  1UFH A;  1PUA A;  1OZP A;  2B4D A;  2QIR A;  2R7H A;  1QSN A;  1YVO A;  1B87 A;  2ZW6 A;  2B58 A;  3D2P A;  4XPD B;  2REF A;  2J8R A;  3NE7 A;  2ARH A;  5HMN A;  2P6F A;  2ZW7 A;  2B3V A;  1Q2Y A;  4JJX A;  5ISV A;  3TE4 A;  1R57 A;  4U9Z A;  4MHD A;  2FCK A;  2JDC A;  3H4Q A;  2GE3 A;  2ATR A;  2I00 A;  2FT0 A; 
#chains in the Genus database with same CATH topology
 5J8C A;  4JWP A;  1TF8 A;  2PJA A;  4ONU A;  5HH1 A;  5AGE A;  4MHP A;  3R95 A;  2DXQ A;  5THW A;  5AG4 A;  1VGY A;  2PCU A;  5F48 A;  2R98 A;  4OC4 A;  3WAB A;  3SXO A;  3TOA A;  2B4B A;  4KZT A;  3NH5 A;  4RN7 A;  4YU9 A;  2CIJ A;  1MJ9 A;  3NA6 A;  1S7K A;  4MHN A;  1XOV A;  4KS9 A;  3PRT A;  4Z65 A;  4OC0 A;  3RBU A;  2CF4 A;  1HDU A;  3W6S A;  5F49 A;  1KUY A;  3ISX A;  1ZG8 A;  1V0C A;  1M4D A;  4QUS A;  4PSW A;  1S5K A;  3PFE A;  4OID A;  4RI1 A;  3BHX A;  4UEE A;  4CPA A;  2REE A;  4UWI A;  1PYT B;  2ZEF A;  4CGP A;  2P6E A;  2WZN A;  1CJW A;  4GXH A;  4FD4 A;  4P4I A;  1J4J A;  1ZLI A;  3KR4 A;  4P4D A;  3K9U A;  4P45 A;  1BPM A;  2YNC C;  3ZJ0 A;  3FNC A;  1Z2L A;  4FWU A;  1GYT A;  2Q04 A;  3PB9 X;  5CPA A;  1U6M A;  2YNE A;  4A94 A;  5CBM A;  1QQ9 A;  2V8G A;  4B11 A;  2FSR A;  3CDX A;  4R7M A;  4CRY B;  4MCQ A;  1YK3 A;  4MCR A;  2PJ7 A;  4UFW A;  2GLF A;  1OBR A;  2VI7 A;  2Z0Z A;  1S60 A;  4DNC A;  2KCW A;  4LX9 A;  3SI0 A;  1F2P A;  2PJ5 A;  4BIN A;  4OME A;  1IGB A;  3I9S A;  4CAE A;  1Z8X A;  3B7I A;  3VAR A;  5IV0 A;  4UCN A;  2CNM A;  4IK2 A;  4ZY1 A;  2Q51 A;  5GCN A;  4JXQ A;  1K4J A;  1I21 A;  5AG6 A;  2I79 A;  1ON0 A;  2AE6 A;  4F0X A;  2BO9 A;  7CPA A;  4B10 A;  2O28 A;  1XMB A;  2FIW A;  4R8F A;  4UIA A;  5FVJ A;  5G22 A;  4CAV A;  1VHE A;  2P6G A;  3H8E A;  3E0K A;  4R57 A;  3VAT A;  4B13 A;  1S7N A;  3N7Z A;  1S3Z A;  4M6H A;  4XPK A;  1WK4 A;  3FXT A;  4YRH A;  2B5G A;  2PVW A;  3W6X A;  4JLY A;  4XPD C;  2JEV A;  3D7G A;  1R3N A;  2IL4 A;  3D7D A;  3IU2 A;  4A38 A;  4AVC A;  4ZBG A;  2H5M A;  1S7F A;  3S9N A;  3KHX A;  3FJU A;  3KI9 A;  3TO6 A;  4EFD A;  3EC4 A;  3G3S A;  4KUB A;  2CXA A;  1M4L A;  2Q7S A;  4CGO A;  4MMO A;  2I3C A;  2V8V A;  4M3S A;  3W91 A;  1NE9 A;  1XRY A;  4FD5 A;  4X3R A;  2C6P A;  3TFY A;  2ZW5 A;  3NE8 A;  4A2Z A;  4KOW A;  1ZG7 A;  5JQ4 A;  2V8D A;  1XIX A;  4Q7A A;  4R76 A;  1IYK A;  1YLE A;  3SI2 A;  1MJB A;  4OC2 A;  2C6G A;  4LUA A;  2GFQ A;  3JUW A;  2ZEL A;  1YVK A;  3HUV A;  4PXB A;  4YFJ A;  3TO9 A;  4NJQ A;  5LRG A;  4MFJ A;  4AVA A;  4R3K A;  2F7V A;  2ZEN A;  5HVH A;  3B3W A;  3FEC A;  1YSJ A;  3KGQ A;  4MFQ A;  3S6F A;  3CPA A;  4F9U A;  3OWC A;  4CAW A;  5IX3 A;  3R1K A;  4F8Z A;  4Q36 A;  3QAH A;  4NGP A;  2Q0Y A;  5J8F A;  2EVN A;  3GLJ A;  4PQA A;  1KZF A;  3RNZ A;  3WC7 A;  3IIB A;  3PBB A;  3TC8 A;  2HB6 A;  2BEI A;  1VKC A;  4B5P A;  2CNT A;  2AFX A;  2PRB A;  3SJX A;  2DPT A;  2Z3O A;  3WR7 A;  2CNS A;  4J3G A;  2OOT A;  2XEF A;  2BCO A;  4DUK A;  1TF9 A;  1Z5R A;  4KSI A;  1ZO0 A;  4JZ0 A;  4B14 A;  2POK A;  3TO7 A;  1Q7L A;  4AXV A;  3N5F A;  1Z4R A;  1Z8L A;  3VWE A;  1TIQ A;  3T90 A;  1IIC A;  1IU8 A;  1QSR A;  4K30 A;  3NH8 A;  3K2K A;  2QJ8 A;  3IFE A;  3B8G A;  3CZX A;  5LYI A;  5G21 A;  3GB0 A;  1KUX A;  2IQ6 A;  3MN8 A;  1Y9K A;  1GHE A;  2DPS A;  1Y7E A;  1PCA A;  4OLL A;  3SJE A;  5AG5 A;  5HVF A;  2GRE A;  2CTC A;  4NEX A;  1CBX A;  2PJ0 A;  4PXC A;  2CY2 A;  1F2O A;  2YND A;  3FMC A;  3KZW A;  4UIB A;  3LAC A;  3EO4 A;  4XNH B;  2VXK A;  4A33 A;  3CXP A;  1FT7 A;  2B4D B;  4FD6 A;  4W9Y A;  4KOX A;  4B5P B;  4CGL A;  2FE7 A;  4L8A A;  3ISZ A;  3D8P A;  1BOB A;  3P2F A;  3GY9 A;  3FIX A;  4A30 A;  2AFU A;  2AFO A;  4A37 A;  1QSM A;  4OAD A;  2HQY A;  5J1Q A;  4PSX A;  2PQ8 A;  2VBQ A;  2NMT A;  1Z4E A;  2BSW A;  1ELM P;  1M4G A;  2PIY A;  1B6B A;  1IB1 E;  2O4H A;  4M6I A;  3S6H A;  3RYO A;  2WPX A;  3JRU A;  3KAS A;  1Y9W A;  4CYO A;  4CS0 B;  2J8M A;  3PP9 A;  2ZEG A;  3P2H A;  4QB9 A;  3KQX A;  4PV6 A;  2ZXV A;  1XJO A;  1ZLH A;  2FIA A;  2NYQ A;  2OB0 A;  3D2M A;  2XEI A;  2G3A A;  5G20 A;  1X12 A;  2Z3M A;  2EWB A;  1L0C A;  2FXF A;  4M85 A;  3R96 A;  4RUH A;  4U5Y A;  3BLN A;  3PEI A;  3I1U A;  3D68 A;  4YGO A;  1P4N A;  2RB7 A;  4F6A A;  3BXM A;  3SI1 A;  1KUV A;  4IAV A;  1IOI A;  2VZZ A;  2Q4Y A;  3PFO A;  4JD6 A;  3H8F A;  3NH4 A;  2WYR A;  1Q2C A;  2R1I A;  3RO0 A;  5HVG A;  2G0B A;  1UWY A;  1A2Z A;  3S6G A;  5JPH A;  3IU1 A;  5K8N A;  4R9M A;  3R9E A;  4X2T A;  3TTH A;  1X10 A;  2ANP A;  4OP4 A;  4ORF A;  2AFS A;  2HUZ A;  3R9F A;  2Z3L A;  2D4P A;  2AFW A;  3TCV A;  2VEZ A;  3BI1 A;  4H6U A;  3B3S A;  2Q7B A;  3TT2 A;  5AG7 A;  1LFW A;  2OR4 A;  2O53 A;  2YNC A;  5DWN A;  5C88 A;  4P4F A;  4KLV A;  3IGR A;  3UY5 A;  4KUA A;  2IJZ A;  3IJ3 A;  3TOB A;  1CPS A;  3V38 A;  5JGF A;  4KSF A;  5EBV A;  1YRE A;  2PC1 A;  3JVN A;  4M6G A;  3FH4 A;  2BUE A;  4QBJ A;  5KTC A;  4AVB A;  1YQE A;  4KOU A;  4FBE A;  5K8P A;  3KHZ A;  1XF8 A;  2Q4V A;  4JXR A;  1LAM A;  4AG9 A;  4CGM A;  2ZEE A;  2OZG A;  1M44 A;  3MRU A;  3SHP A;  4NGR A;  2PJC A;  3B35 A;  4KOY A;  2JDD A;  4F9V A;  1YLO A;  4ZI6 A;  1EE3 P;  4OIW A;  4IHM A;  3FYN A;  3B3C A;  1YR0 A;  4QVT A;  4CYQ A;  3LMS A;  1NSA A;  4Q38 A;  3FB3 A;  2OZU A;  2PE3 A;  2ZEO A;  3WT4 A;  3EY5 A;  2ZEP A;  1IY7 A;  1CG2 A;  3B3V A;  4ZY2 A;  3T8W A;  4CAX A;  3WC5 A;  1CPX A;  2ABZ A;  5DWM A;  1QST A;  1CP7 A;  4HNW B;  4I49 A;  4PXE A;  3T9Y A;  4CRZ B;  3PB6 X;  1TKJ A;  4EVY A;  4H89 A;  4KOS A;  3B3T A;  2OU2 A;  4KSA A;  4NCZ A;  5JM6 A;  4MI4 A;  2K5T A;  2OH1 A;  2AFZ A;  4LQG A;  1IID A;  8CPA A;  4A32 A;  4XNH C;  1Y0Y A;  1CM0 A;  5A27 A;  1LRZ A;  2B5G B;  2PJ8 A;  2J8N A;  2GIV A;  3GUX A;  3PB8 X;  3HLP A;  1FNO A;  1S7L A;  2DF5 A;  3S6K A;  3FRM A;  3V7Z A;  3WC6 A;  2P0W A;  5KTD A;  2J9A A;  4NFR A;  4MFZ A;  4AG7 A;  4OC3 A;  1Q2D A;  4HPS A;  1BLL E;  5K8M A;  4NGQ A;  4GM5 A;  2XEJ A;  4UBR A;  3FEE A;  1XEB A;  4NGM A;  1RXT A;  3FVL A;  1ELL P;  3QB8 A;  2F8H A;  3F5B A;  2PR1 A;  1QMU A;  3PB7 X;  3FX6 A;  2C27 A;  4LQ6 A;  1RTQ A;  2OZH A;  1IYL A;  3G8W A;  4MJ8 A;  2CTB A;  5H84 A;  4C68 A;  3SXN A;  4C2Y A;  3QNV A;  4ZX9 A;  5A28 A;  1P0H A;  3DR8 A;  1IOF A;  4P4E A;  2Z3P A;  5EC4 A;  1AMP A;  1TKH A;  3L2N A;  4NGN A;  1I12 A;  5K8O A;  4Y49 B;  1I1D A;  3B2Y A;  4U9Y A;  3DR6 A;  1M4I A;  4PPZ A;  4UF4 A;  3DSB A;  1NSL A;  2ZW4 A;  2AFM A;  2QVP A;  3BI0 A;  4XPL A;  4FD7 A;  4CGN A;  3V8I A;  5I0C A;  1KWM A;  5G1Z A;  3ZZI A;  4GS4 A;  5F09 A;  2G9D A;  2Z11 A;  5D8N A;  5EMI A;  2WPW A;  2V77 A;  4B6Z A;  2PJ2 A;  2HV2 A;  4PXD A;  4MCS A;  2RC4 A;  1VIX A;  1NMT A;  5LYD A;  1JQG A;  2Z10 A;  4WJB A;  4NF1 A;  3MGD A;  2VZY A;  2PDO A;  2F5I A;  2GLJ A;  1XBU A;  3CPX A;  2HC9 A;  4MBU A;  5JH9 A;  4EME A;  5LYL A;  2PSW A;  4CYN A;  4E0A A;  2Q44 A;  4E2A A;  1HDQ A;  4B12 A;  3LWU A;  4R3L A;  1YME A;  3BJ7 A;  2G3T A;  2EBJ A;  3DLJ A;  3GIU A;  2PJ6 A;  4UFV A;  3EXN A;  5F47 A;  4A39 A;  1YX0 A;  3H5Z A;  3PBE A;  4MXU A;  4KOV A;  4II9 A;  3S9M A;  3K9T A;  2ZOF A;  4PK3 A;  4IUS A;  5D29 A;  4P4B A;  2PR8 A;  3EFA A;  2YGW A;  3RAM A;  4A95 A;  4C2Z A;  1Y7R A;  5IB9 A;  4BMH A;  4ZY0 A;  1YW6 A;  3R9G A;  4NJR A;  2A4N A;  5ELY A;  2ZEH A;  3LOD A;  4MFL A;  4L89 A;  4ZYQ A;  4OC5 A;  3F8K A;  4MY0 A;  2ZPA A;  4KOR A;  1SQH A;  4NGS A;  1WWZ A;  1ARL A;  2Z3N A;  4F0Y A;  4UCM A;  4HNY B;  3FBU A;  4DYO A;  4BBH A;  3LD2 A;  2R8V A;  2VL1 A;  3PZJ A;  3JTK A;  4KVM E;  4C2X A;  1BO4 A;  5I4M A;  2BL1 A;  1M1D A;  4JYW A;  3KR5 A;  4P6Y A;  3VH9 A;  1TKF A;  1TXR A;  3NFZ A;  1XE4 A;  2JBJ A;  2ODF A;  2B3U A;  4NXY A;  2Y0M A;  3DDD A;  5DS0 A;  2JEW A;  2X7B A;  4OC1 A;  4MFP A;  3D7H A;  4G1P A;  2C6C A;  1CX8 A;  3SJF A;  3PGP A;  4UA3 A;  2GAN A;  2QML A;  2V8H A;  2EK9 A;  2Q43 A;  2EUI A;  1MJA A;  5LRJ A;  4HKF A;  4X8I A;  1ZG9 A;  2FVG A;  4R87 A;  4DJL A;  2AJ6 A;  1MK4 A;  2PJ4 A;  2PJB A;  3FED A;  4X5K A;  4YWY A;  5F46 A;  2BOA A;  4FUU A;  4KOT A;  4E8O A;  4TWE A;  4AB7 A;  3D3S A;  4B5O A;  3DNS A;  4UCP A;  1Z8T A;  5H86 A;  1RO5 A;  1PU9 A;  2FS5 A;  4PK2 A;  4ZX8 A;  1DE4 C;  2WSA A;  5C82 A;  3A9L A;  1AYE A;  4MHY A;  4UWJ A;  1F57 A;  1LAN A;  2ZOG A;  3IWG A;  1N71 A;  2D4O A;  3QAY A;  1QSO A;  3SJG A;  4IF5 A;  1HEE A;  4MY3 A;  1XMT A;  3IC1 A;  2PIZ A;  3KQZ A;  5IB0 A;  1Z9U A;  3S9L A;  3CXQ A;  2ZEM A;  3GYA A;  4WWV A;  2FL4 A;  5BWA B;  4CYP A;  6CPA A;  3KKW A;  4H2K A;  4TNU A;  4EWT A;  1Z8W A;  4MRI A;  1VHS A;  4C7I A;  3GKR A;  5LRK A;  2PRQ A;  5E96 A;  5KTA A;  2JBK A;  2QEC A;  3BJ8 A;  3DGV A;  3I3G A;  4KLW A;  4O23 A;  4UEF A;  3C26 A;  4P44 A;  4Y49 C;  4KVX A;  4QC6 A;  4KVO E;  2JLM A;  1FY7 A;  2PJ1 A;  4ONW A;  1BAV A;  4MFK A;  3D4U A;  1YGH A;  2PJ3 A;  4OKO A;  2PJ9 A;  3F0A A;  4RS2 A;  3KL9 A;  4NSQ A;  1LCP A;  3FF3 A;  3VWD A;  3CXS A;  3H8G A;  2C1C A;  4NGT A;  5HXD A;  2VQY A;  1AUG A;  1JWQ A;  5CNP A;  4A31 A;  3IEH A;  4MCP A;  1R43 A;  2XEG A;  3CT9 A;  1LAP A;  2Q4Z A;  2DEA A;  2QYV A;  2EO8 A;  2PVV A;  4OAE A;  3IO1 A;  4HNX B;  4H6Z A;  4FAI A;  1UFH A;  3RZA A;  4UFX A;  3D66 A;  1DTD A;  1LOK A;  1PUA A;  1OZP A;  2B4D A;  2QIR A;  2R7H A;  1QSN A;  1YVO A;  1B87 A;  2ZW6 A;  2B58 A;  3D2P A;  4MHZ A;  4XPD B;  2REF A;  4P4J A;  3IWE A;  4K3N A;  2J8R A;  2ZED A;  3NE7 A;  2ARH A;  3D7F A;  5HMN A;  2IMO A;  2P6F A;  3IWW A;  2ZW7 A;  2B3V A;  3D67 A;  1Q2Y A;  1YW4 A;  2EK8 A;  4UEZ A;  2GU2 A;  3PB4 X;  4JJX A;  5ISV A;  3TE4 A;  4R6T A;  1R57 A;  4U9Z A;  1H8L A;  4MHD A;  2FCK A;  1BPN A;  1Y0R A;  1XFO A;  2JDC A;  2RFH A;  2GE3 A;  3H4Q A;  4P10 A;  2ATR A;  1ARM A;  1CP6 A;  3TX8 A;  4C7H A;  1VHO A;  2NSM A;  2I00 A;  4BD9 A;  4ZGY B;  5LYF A;  4CAF A;  2Z3K A;  2FT0 A;  2WUU A; 
#chains in the Genus database with same CATH homology
 5J8C A;  4JWP A;  4ONU A;  5HH1 A;  3R95 A;  5AG4 A;  5AGE A;  2DXQ A;  5F48 A;  2R98 A;  3SXO A;  3TOA A;  2B4B A;  4KZT A;  1MJ9 A;  1S7K A;  4KS9 A;  3W6S A;  5F49 A;  1KUY A;  1V0C A;  1M4D A;  4QUS A;  4PSW A;  1S5K A;  4RI1 A;  2REE A;  4UWI A;  4CGP A;  2P6E A;  1CJW A;  4FD4 A;  1J4J A;  3K9U A;  2YNC C;  3ZJ0 A;  3FNC A;  2Q04 A;  1U6M A;  2YNE A;  4B11 A;  2FSR A;  4CRY B;  1YK3 A;  4UFW A;  2VI7 A;  2Z0Z A;  1S60 A;  4DNC A;  2KCW A;  4LX9 A;  3I9S A;  4CAE A;  5IV0 A;  4UCN A;  2CNM A;  5GCN A;  4JXQ A;  1I21 A;  1K4J A;  5AG6 A;  2I79 A;  1ON0 A;  2AE6 A;  4F0X A;  4B10 A;  2O28 A;  2FIW A;  5G22 A;  5FVJ A;  4CAV A;  2P6G A;  3E0K A;  4R57 A;  4B13 A;  1S7N A;  3N7Z A;  1S3Z A;  4XPK A;  1WK4 A;  3FXT A;  4YRH A;  2B5G A;  3W6X A;  4JLY A;  4XPD C;  2JEV A;  2IL4 A;  3IU2 A;  4AVC A;  4ZBG A;  2H5M A;  1S7F A;  3TO6 A;  3EC4 A;  3G3S A;  4KUB A;  2CXA A;  4CGO A;  4M3S A;  3W91 A;  1NE9 A;  4FD5 A;  3TFY A;  2ZW5 A;  4A2Z A;  4KOW A;  5JQ4 A;  1XIX A;  1IYK A;  1YLE A;  1MJB A;  4LUA A;  3JUW A;  1YVK A;  4YFJ A;  3TO9 A;  5IX3 A;  4MFJ A;  4AVA A;  4R3K A;  3S6F A;  4MFQ A;  3OWC A;  4CAW A;  3R1K A;  4Q36 A;  3QAH A;  2Q0Y A;  5J8F A;  2EVN A;  1KZF A;  2BEI A;  1VKC A;  4B5P A;  2CNT A;  2PRB A;  2DPT A;  2Z3O A;  3WR7 A;  2CNS A;  4J3G A;  1ZO0 A;  4B14 A;  3TO7 A;  1Z4R A;  3VWE A;  1TIQ A;  3T90 A;  1IIC A;  1QSR A;  4K30 A;  3B8G A;  5G21 A;  1KUX A;  1Y9K A;  1GHE A;  2DPS A;  4OLL A;  5AG5 A;  4NEX A;  2CY2 A;  2YND A;  3EO4 A;  4XNH B;  2VXK A;  4A33 A;  3CXP A;  4FD6 A;  2B4D B;  4KOX A;  4B5P B;  4CGL A;  2FE7 A;  4L8A A;  3D8P A;  1BOB A;  3P2F A;  3GY9 A;  3FIX A;  4A30 A;  1QSM A;  4OAD A;  2HQY A;  4PSX A;  2PQ8 A;  2VBQ A;  2NMT A;  1Z4E A;  2BSW A;  1M4G A;  1B6B A;  1IB1 E;  3S6H A;  3RYO A;  2WPX A;  1Y9W A;  4CYO A;  4CS0 B;  2J8M A;  3PP9 A;  3P2H A;  4QB9 A;  4PV6 A;  2ZXV A;  2FIA A;  5G20 A;  2OB0 A;  3D2M A;  2G3A A;  2Z3M A;  1L0C A;  2FXF A;  4M85 A;  3R96 A;  4U5Y A;  3BLN A;  4YGO A;  1P4N A;  4F6A A;  1KUV A;  2VZZ A;  2Q4Y A;  4JD6 A;  1Q2C A;  2R1I A;  2G0B A;  3S6G A;  5JPH A;  3IU1 A;  4R9M A;  3R9E A;  3TTH A;  4ORF A;  2HUZ A;  3R9F A;  2Z3L A;  2D4P A;  3TCV A;  2VEZ A;  4H6U A;  2Q7B A;  3TT2 A;  5AG7 A;  2YNC A;  5DWN A;  5C88 A;  4KLV A;  3IGR A;  3UY5 A;  4KUA A;  3TOB A;  4KSF A;  5EBV A;  1YRE A;  2PC1 A;  3JVN A;  5KTC A;  2BUE A;  4QBJ A;  4AVB A;  4KOU A;  1XF8 A;  2Q4V A;  4JXR A;  4AG9 A;  4CGM A;  2OZG A;  1M44 A;  3SHP A;  4KOY A;  2JDD A;  3FYN A;  1YR0 A;  4QVT A;  4CYQ A;  4Q38 A;  3FB3 A;  2OZU A;  3EY5 A;  4CAX A;  5DWM A;  1QST A;  4HNW B;  4I49 A;  3T9Y A;  4CRZ B;  4EVY A;  4H89 A;  4KOS A;  2OU2 A;  4KSA A;  4NCZ A;  4MI4 A;  2K5T A;  2OH1 A;  1IID A;  4A32 A;  4XNH C;  1CM0 A;  5A27 A;  1LRZ A;  2B5G B;  2J8N A;  2GIV A;  1S7L A;  3S6K A;  3FRM A;  2P0W A;  5KTD A;  4MFZ A;  4AG7 A;  1Q2D A;  4UBR A;  1XEB A;  1RXT A;  3QB8 A;  3F5B A;  2PR1 A;  2C27 A;  2OZH A;  1IYL A;  3G8W A;  4MJ8 A;  5H84 A;  4C68 A;  3SXN A;  4C2Y A;  5A28 A;  1P0H A;  3DR8 A;  5EC4 A;  2Z3P A;  1I12 A;  4Y49 B;  1I1D A;  4U9Y A;  3DR6 A;  1M4I A;  3DSB A;  1NSL A;  2ZW4 A;  4XPL A;  4FD7 A;  4CGN A;  3V8I A;  5I0C A;  5G1Z A;  3ZZI A;  4GS4 A;  2Z11 A;  2WPW A;  2HV2 A;  2RC4 A;  1NMT A;  2Z10 A;  4NF1 A;  3MGD A;  2VZY A;  2PDO A;  2F5I A;  4MBU A;  2PSW A;  4CYN A;  4E0A A;  2Q44 A;  4E2A A;  4B12 A;  4R3L A;  3BJ7 A;  2G3T A;  5F47 A;  4UFV A;  3EXN A;  1YX0 A;  3H5Z A;  4II9 A;  4KOV A;  4PK3 A;  4IUS A;  2PR8 A;  3EFA A;  2YGW A;  4A95 A;  4C2Z A;  1Y7R A;  4BMH A;  3R9G A;  2A4N A;  3LOD A;  4MFL A;  4L89 A;  3F8K A;  4MY0 A;  2ZPA A;  4KOR A;  1SQH A;  1WWZ A;  2Z3N A;  4F0Y A;  4UCM A;  4HNY B;  3FBU A;  4BBH A;  3LD2 A;  3PZJ A;  2R8V A;  4KVM E;  3JTK A;  4C2X A;  1BO4 A;  2BL1 A;  1M1D A;  1XE4 A;  4NXY A;  2B3U A;  2Y0M A;  3DDD A;  2X7B A;  4MFP A;  3PGP A;  4UA3 A;  2GAN A;  2QML A;  2EUI A;  1MJA A;  4HKF A;  4R87 A;  2AJ6 A;  1MK4 A;  4X5K A;  5F46 A;  4KOT A;  4E8O A;  4AB7 A;  3D3S A;  4B5O A;  3DNS A;  4UCP A;  5H86 A;  1RO5 A;  1PU9 A;  2FS5 A;  4PK2 A;  2WSA A;  5C82 A;  3A9L A;  4UWJ A;  3IWG A;  1N71 A;  2D4O A;  1QSO A;  4IF5 A;  4MY3 A;  1XMT A;  5IB0 A;  1Z9U A;  3CXQ A;  3GYA A;  2FL4 A;  5BWA B;  4CYP A;  3KKW A;  1VHS A;  4C7I A;  3GKR A;  5E96 A;  5KTA A;  2QEC A;  3BJ8 A;  3I3G A;  4KLW A;  4Y49 C;  3C26 A;  4KVX A;  4QC6 A;  4KVO E;  2JLM A;  1FY7 A;  4MFK A;  1YGH A;  3F0A A;  4RS2 A;  4NSQ A;  3VWD A;  3CXS A;  2VQY A;  5CNP A;  4A31 A;  4OAE A;  4HNX B;  4H6Z A;  1UFH A;  4UFX A;  1PUA A;  1OZP A;  2B4D A;  2QIR A;  2R7H A;  1QSN A;  1YVO A;  1B87 A;  2ZW6 A;  2B58 A;  3D2P A;  4XPD B;  2REF A;  3IWE A;  2J8R A;  3NE7 A;  2ARH A;  5HMN A;  2P6F A;  2ZW7 A;  2B3V A;  1Q2Y A;  4JJX A;  5ISV A;  3TE4 A;  1R57 A;  4U9Z A;  4MHD A;  2FCK A;  2JDC A;  3H4Q A;  2GE3 A;  2ATR A;  4C7H A;  2I00 A;  4ZGY B;  4CAF A;  2Z3K A;  2FT0 A;  2WUU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...