4FD7A

Crystal structure of insect putative arylalkylamine n-acetyltransferase 7 from the yellow fever mosquito aedes aegypt
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
237
structure length
237
Chain Sequence
KWTRSVKVPFPSVWHRFQAKDLTSQQLVWYRVQDLPEDRFEDAIRHMCDYFARDELMNQAKGLAKDLVAMGDVVALWKAMLPDRMSLVCFREGSDEIVGVNILDVASRSDKDNAQFNSAIFQAIYDTIEYVSHQANIFDRYNVDHYLNAMGLSVDPKYRGRGIATEILRARIPLCRAVGLKLSATCFTGPNSQTAATRVGFQEDFTITYGELARVDQRFNYPGIEENFCKYMSLRVD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords putative arylalkylamine N-Acetyltransferase 7
publication title Evolution of insect arylalkylamine N-acetyltransferases: structural evidence from the yellow fever mosquito, Aedes aegypti.
pubmed doi rcsb
source organism Aedes aegypti
molecule tags Transferase
total genus 83
structure length 237
sequence length 237
chains with identical sequence B, C, D
ec nomenclature ec 2.3.1.87: Aralkylamine N-acetyltransferase.
pdb deposition date 2012-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4fd7A00
5IV0A 4U9ZA 5I0CA 3JVNA 2HV2A 2Q0YA 3QAHA 3JUWA 3SHPA 4LX9A 5F47A 2I00A 2HUZA 1S60A 2GIVA 2B5GB 4R3LA 2J8RA 2CNTA 4KUAA 1MJBA 3F5BA 2I79A 1B6BA 4JJXA 4LUAA 4FD4A 2OZGA 3EXNA 4R87A 4PSWA 4XPKA 2Z0ZA 4CAWA 4E8OA 1WK4A 1IYLA 3FYNA 4OLLA 4H89A 4JD6A 1YLEA 2Q44A 5JPHA 3BJ8A 2B3VA 2WPWA 1Y7RA 3TO7A 5HMNA 2Z11A 2R8VA 4UBRA 3BLNA 1R57A 2PR1A 1K4JA 4NCZA 2B58A 3GYAA 5KTDA 4DNCA 1SQHA 5KTAA 4KLWA 2JDDA 3TOBA 3LD2A 3TCVA 4H6ZA 1LRZA 3V8IA 1L0CA 2ZPAA 2ZXVA 4QBJA 4X5KA 1XMTA 1WWZA 4XNHC 1MJ9A 2RC4A 2CNMA 3S6FA 2QECA 3D2PA 1S7NA 1CJWA 4KORA 3F8KA 5DWMA 3TE4A 3R9EA 5EBVA 3E0KA 2C27A 2K5TA 3DR6A 1QSNA 4YFJA 2PSWA 5H84A 2X7BA 4PK2A 3R9GA 4HNXB 2FL4A 2AJ6A 4PSXA 3F0AA 2PC1A 1YVKA 1VHSA 2FXFA 4AG9A 3TT2A 1S5KA 3TTHA 2P0WA 3EO4A 2Q4YA 3N7ZA 2CY2A 4Y49C 1YK3A 4HNYB 5J8FA 5ISVA 3CXSA 4MY3A 4OADA 3BJ7A 4CRYB 1YX0A 1Z9UA 2FIWA 3R1KA 4KOVA 4U5YA 4UA3A 2VZYA 2B4DA 4OAEA 5C82A 3ZZIA 1Q2YA 1IIDA 3DNSA 2DXQA 4HKFA 5KTCA 4KOXA 1M44A 4KOUA 2D4OA 5FVJA 3KKWA 1S7LA 4MI4A 1S3ZA 5C88A 1Q2DA 2VI7A 4KVME 1I1DA 3IWGA 1S7FA 1XEBA 1RO5A 2PDOA 4JXQA 1P0HA 1IICA 2FS5A 3W6XA 5J8CA 4BMHA 3W91A 3RYOA 1ON0A 4MBUA 4B5PB 4L89A 1U6MA 2GANA 4L8AA 4PK3A 4KVOE 3FXTA 2O28A 1XIXA 2Y0MA 2P6FA 3FNCA 3I9SA 3MGDA 5E96A 4AVBA 2A4NA 1QSOA 2P6GA 1YREA 4CAVA 1IYKA 1BO4A 2BUEA 3FIXA 4XPLA 1QSTA 2H5MA 2AE6A 3PZJA 3UY5A 3TO9A 5JQ4A 2PRBA 2ZW4A 2B5GA 1M4IA 2VQYA 4AG7A 2Z10A 2ARHA 4JLYA 4K30A 1KUYA 2OB0A 4ZBGA 2B4BA 3ZJ0A 3S6HA 2WPXA 3D2MA 2B4DB 4QC6A 4XPDC 5EC4A 1Y9KA 4XPDB 3OWCA 2R7HA 2ZW5A 2VZZA 1PU9A 2ATRA 4KOTA 1Z4RA 3T90A 3SXOA 2OH1A 1XE4A 2EUIA 2JLMA 5F48A 1I21A 3D8PA 2EVNA 3NE7A 2REFA 1M1DA 4F0YA 3FB3A 2REEA 2IL4A 2G3TA 2G3AA 2VEZA 4II9A 3R95A 2JDCA 2FT0A 1Q2CA 2JEVA 1IB1E 1OZPA 4NSQA 1J4JA 4R3KA 1QSRA 4ONUA 3T9YA 4ORFA 3K9UA 3QB8A 3EC4A 3H4QA 4AB7A 2J8MA 4J3GA 1YR0A 4PV6A 4EVYA 1TIQA 2J8NA 1GHEA 4MY0A 4E2AA 4R57A 3DSBA 2Q7BA 1CM0A 1B87A 1XF8A 4IUSA 3LODA 4E0AA 2FE7A 1S7KA 3PGPA 3CXQA 2G0BA 2QMLA 3PP9A 2BSWA 2ZW6A 3C26A 1VKCA 3G3SA 3G8WA 5DWNA 3S6KA 4HNWB 2PQ8A 4H6UA 1M4DA 1UFHA 2P6EA 1KUXA 2B3UA 5F49A 3SXNA 4R9MA 3FBUA 3P2FA 1KUVA 3FRMA 3EFAA 2D4PA 2OU2A 1FY7A 3S6GA 2BEIA 4KUBA 3IGRA 5H86A 4F6AA 1MK4A 4NF1A 1BOBA 2NMTA 4KOWA 4RI1A 2FCKA 2FSRA 2Q4VA 4YRHA 2QIRA 4FD7A 1M4GA 2OZUA 3VWEA 3VWDA 1MJAA 4NEXA 4JWPA 4QUSA 4B5OA 2OZHA 3W6SA 4U9YA 2VXKA 2BL1A 4KLVA 2KCWA 4FD6A 4KOYA 4IF5A 1V0CA 4I49A 3I3GA 3TOAA 4CAXA 2FIAA 1NMTA 2ZW7A 1RXTA 1PUAA 4QB9A 4XNHB 5F46A 1YVOA 4M85A 1KZFA 3WR7A 4B5PA 4MJ8A 4YGOA 4AVCA 2Q04A 3TO6A 1QSMA 4MHDA 3TFYA 3R96A 4UWIA 4RS2A 1Z4EA 5IX3A 2R98A 2GE3A 2R1IA 3D3SA 4QVTA 4FD5A 3DR8A 1YGHA 3P2HA 4GS4A 3DDDA 5HH1A 3GY9A 2PR8A 3GKRA 1N71A 3CXPA 1P4NA 4CRZB 1NSLA 4UWJA 4NXYA 1Y9WA 2VBQA 5CNPA 1NE9A 4KZTA 4KVXA 5GCNA 4Y49B 5IB0A 3EY5A 4JXRA 2F5IA 3B8GA 3R9FA 4CS0B 1I12A 2CNSA 4AVAA 2HQYA 4M3SA 4KOSA
chains in the Genus database with same CATH superfamily
4ZX9A 2AFZA 4U9ZA 5IV0A 5I0CA 2OOTA 3JVNA 2HV2A 2Q0YA 3QAHA 4UEZA 7CPAA 3JUWA 3SHPA 3SI2A 1IU8A 1H8LA 1TF9A 4LX9A 4MFLA 2Z3MA 4C7IA 3ISZA 4UIBA 5F47A 2I00A 2HUZA 5HVGA 1S60A 5K8PA 4TNUA 1BLLE 4F9UA 4GM5A 4TWEA 4EMEA 2GIVA 2B5GB 4MRIA 4R3LA 4A37A 2J8RA 4CGMA 2CNTA 4KUAA 2PJCA 2FVGA 4C2YA 3MN8A 1MJBA 3F5BA 5JH9A 2I79A 2QYVA 3D7DA 1B6BA 4JJXA 5G21A 3WABA 4LUAA 1Z8LA 2C6PA 3IU1A 4FD4A 1Q7LA 4CYQA 2OZGA 2PCUA 3EXNA 4R87A 4PSWA 1BPNA 2AFUA 4XPKA 5JM6A 2Z0ZA 4CAWA 4E8OA 5K8NA 1WK4A 3NH4A 4R76A 4HPSA 2C6GA 4UFXA 2V8DA 4X8IA 1IYLA 3FYNA 4OLLA 4JZ0A 4H89A 2O53A 3IC1A 2O4HA 4JD6A 1Y0YA 1YLEA 2Q44A 3FVLA 3V38A 5JPHA 1XJOA 3KGQA 3BJ8A 2HB6A 2B3VA 2WPWA 1Y7RA 4PXDA 3TO7A 5HMNA 2Z11A 2R8VA 1TF8A 2YGWA 4UBRA 5AG7A 3BLNA 3B3SA 1R57A 2PR1A 1FT7A 1K4JA 3IFEA 4M6IA 1DE4C 1ZLIA 4P4FA 2Z3LA 4CAEA 4NCZA 2YNEA 1ARLA 2B58A 3GYAA 4C68A 4B11A 2Z3PA 5KTDA 5AGEA 1YMEA 4DNCA 1SQHA 4ZY1A 5KTAA 1IGBA 5AG5A 2GREA 1TKJA 2OR4A 4RN7A 1XOVA 4KLWA 4P4EA 2JDDA 3TOBA 3LD2A 2F8HA 3SI1A 3TCVA 4H6ZA 1LRZA 3V8IA 1L0CA 4PXEA 1Z2LA 4PXBA 2ZPAA 1KWMA 2ZXVA 2GLFA 5D29A 4QBJA 3FF3A 4X5KA 5CPAA 3H8FA 4MFKA 1XMTA 3NE8A 4NGRA 1WWZA 4P10A 4XNHC 1AYEA 4OP4A 2PJ0A 3FEDA 3IIBA 1MJ9A 2XEGA 1GYTA 4WJBA 2RC4A 4P45A 2PRQA 3QAYA 2CNMA 3S6FA 5THWA 2QECA 3D2PA 1S7NA 5LYLA 1CJWA 4KORA 4OC1A 2EK9A 3F8KA 5DWMA 2HC9A 3TE4A 3R9EA 2WSAA 5EBVA 3GLJA 2ZEPA 3E0KA 2C27A 2GFQA 2IQ6A 1CBXA 1HDUA 4CYNA 4UEFA 2K5TA 3DR6A 3IU2A 4MCPA 1QSNA 2ZOFA 2PSWA 3B7IA 4K3NA 4UCPA 4YFJA 5LRKA 2DPSA 1VHEA 4NGQA 4PQAA 2BCOA 3PBEA 3B3VA 5H84A 2X7BA 4PK2A 3R9GA 4A95A 1TKFA 5AG6A 4HNXB 2FL4A 1ARMA 3I1UA 2DEAA 2XEJA 1VGYA 2AJ6A 1CX8A 4MCRA 4PSXA 4RUHA 4P6YA 3F0AA 2PC1A 1A2ZA 3PB7X 1YVKA 1Y7EA 1VHSA 2FXFA 4AG9A 3TT2A 1S5KA 2PJ2A 4B13A 3JRUA 3TTHA 2P0WA 3EO4A 2Q4YA 1YQEA 3N7ZA 5ELYA 2CY2A 4Y49C 5G20A 1YK3A 4ZY2A 4HNYB 5J8FA 5LRJA 3IEHA 5ISVA 3CXSA 4MY3A 2I3CA 4OADA 3BJ7A 4CRYB 1YX0A 2PE3A 1CPXA 1Z9UA 2FIWA 2JBJA 3BXMA 2JBKA 2PJ5A 2ZEFA 3R1KA 4KOVA 4MFPA 4U5YA 4C2ZA 4UA3A 2VZYA 2B4DA 5DS0A 4OAEA 4PXCA 5C82A 3FEEA 3B3WA 3TC8A 3ZZIA 1Q2YA 4MFJA 1IIDA 2DF5A 3DNSA 3DGVA 2DXQA 4HKFA 5KTCA 3FMCA 1AMPA 3NA6A 4KOXA 3KL9A 1M44A 3D68A 4KOUA 2D4OA 3GUXA 3NFZA 4JYWA 4P4DA 5FVJA 2DPTA 3KKWA 1S7LA 5A27A 2PVVA 3IWWA 4MI4A 4F9VA 1S3ZA 3CPAA 4A94A 2RB7A 3MRUA 5C88A 3D7FA 4MCSA 1JQGA 1Q2DA 2VI7A 1I1DA 4KVME 3RZAA 3IWGA 2CXAA 3PB9X 1EE3P 8CPAA 2Z3NA 1OBRA 4UF4A 1S7FA 4P4BA 1XEBA 1RO5A 2PDOA 5IB9A 1F57A 3PRTA 1P0HA 1LFWA 4JXQA 1IICA 2FS5A 1TKHA 4X3RA 2Q7SA 2ZENA 5LYFA 3W6XA 5J8CA 3SJFA 2RFHA 4G1PA 4A38A 4BMHA 1Z8WA 4FAIA 3BHXA 2CIJA 3W91A 3RYOA 1ON0A 3RNZA 4MBUA 3WC6A 4B5PB 4L89A 1U6MA 2GANA 3PEIA 4M6HA 4L8AA 3KI9A 4PK3A 4KVOE 3FXTA 2O28A 2WZNA 4NGPA 2CTCA 4IK2A 4YWYA 3RBUA 1LAMA 1XIXA 2F7VA 4EFDA 2Y0MA 3PFOA 2P6FA 3FNCA 3I9SA 4MHPA 4BINA 3MGDA 5E96A 4AVBA 2ZEEA 4AXVA 2A4NA 1QSOA 2P6GA 4KSFA 4B6ZA 3D7GA 1YREA 4YU9A 1IYKA 1BO4A 2BUEA 3FIXA 3HUVA 4CAVA 4UFWA 4XPLA 4A2ZA 3VH9A 1QSTA 3GB0A 4NGSA 2H5MA 2AE6A 2ZELA 4M6GA 3PZJA 1UWYA 4FUUA 3UY5A 3TO9A 5JQ4A 4C7HA 3CT9A 3DLJA 4CGNA 1M4LA 2PRBA 3WC7A 4CGPA 2ZW4A 2B5GA 4FBEA 1M4IA 5HXDA 4UCMA 2VQYA 1ELMP 3B3TA 2ZEHA 4AG7A 2IJZA 2Z10A 3KHXA 4IHMA 3A9LA 4IAVA 2ARHA 4JLYA 2Z3KA 2BO9A 4K30A 4NJRA 1KUYA 2ODFA 1ZG9A 1X10A 2OB0A 3B3CA 4ZBGA 1R3NA 2B4BA 3TX8A 1IOIA 1PCAA 3ZJ0A 2EK8A 2V8VA 1XFOA 1X12A 3S6HA 1Z5RA 2WPXA 2B4DB 3D2MA 3PBBA 4QC6A 1XMBA 1NSAA 4OIDA 3S9LA 4XPDC 5EC4A 1Y9KA 3BI0A 4XPDB 3OWCA 5AG4A 3T8WA 3NH5A 3SJGA 3WT4A 2R7HA 2ZW5A 3FH4A 2VZZA 3BI1A 1PU9A 2EWBA 3CZXA 1ZG7A 2ATRA 4KOTA 4DYOA 1Z4RA 3K2KA 4OC5A 2CTBA 3SXOA 1TXRA 2OH1A 1XE4A 3T90A 4OC4A 4P44A 2EUIA 1F2OA 1RTQA 3KQZA 3L2NA 2JLMA 5F48A 1I21A 1Y0RA 3D8PA 2EVNA 3NE7A 4CYOA 2REFA 1M1DA 4F0YA 3FX6A 2V8GA 2BOAA 2WUUA 3B2YA 3FB3A 3ISXA 3SJXA 4ZX8A 4NGNA 4R8FA 3VARA 2REEA 1LCPA 1PYTB 2IL4A 2G3TA 2G3AA 2VEZA 5LRGA 3R95A 2JDCA 1HEEA 2FT0A 1Q2CA 2JEVA 3VATA 1IB1E 4II9A 1OZPA 4R7MA 4ZY0A 4NSQA 4OC2A 1J4JA 4R3KA 1QSRA 4X2TA 5HVFA 4ONUA 1HDQA 3T9YA 1CPSA 4ORFA 2PJ9A 4C2XA 3K9UA 2QVPA 5BWAB 1XRYA 2POKA 3QB8A 3EC4A 3H4QA 4AB7A 2PJ6A 2J8MA 2PJ3A 4J3GA 1YR0A 4PV6A 2JEWA 4EVYA 4DJLA 5J1QA 3H5ZA 1TIQA 5A28A 2J8NA 3KZWA 1GHEA 2GU2A 4MY0A 4OKOA 4B10A 4E2AA 1JWQA 4R57A 1ZO0A 2NYQA 3DSBA 2Q7BA 4UFVA 1BPMA 1CM0A 1B87A 4A31A 1IY7A 1XF8A 4IUSA 3D67A 3LODA 4E0AA 2FE7A 4F0XA 1AUGA 1S7KA 4CYPA 2PJAA 3PGPA 3CXQA 2G0BA 2QMLA 3PP9A 2BSWA 2ZW6A 1CP7A 3C26A 1VKCA 1VIXA 3G3SA 4CGOA 3LACA 3G8WA 4ONWA 2V77A 3N5FA 5DWNA 3S6KA 1YW6A 3FJUA 3IJ3A 4ZYQA 4P4JA 2AFOA 4HNWB 2PQ8A 5D8NA 6CPAA 2J9AA 4H6UA 1M4DA 2ZEMA 4MHYA 4UCNA 2G9DA 1UFHA 3V7ZA 2P6EA 2PJ8A 1KUXA 2QJ8A 3SJEA 1VHOA 2B3UA 2YNCC 4R9MA 3FBUA 5F49A 3P2FA 3SXNA 4CAFA 2EO8A 1KUVA 4DUKA 5F09A 3FRMA 3PB8X 1LANA 2AFMA 4MFZA 4CGLA 3EFAA 2AFWA 2D4PA 2OU2A 4A30A 1FY7A 3S6GA 2BEIA 4KUBA 4W9YA 3PB6X 4ZGYB 3IGRA 5H86A 4BD9A 1DTDA 1LAPA 4Q7AA 2PJ1A 4F6AA 1MK4A 4NF1A 1BOBA 4Q38A 5K8OA 4MMOA 4MHZA 2NMTA 3D7HA 3D4UA 4KOWA 4FWUA 3B35A 1IOFA 3D66A 2FCKA 4KSAA 4RI1A 2AFXA 5G1ZA 2FSRA 2C6CA 2Q4VA 2VL1A 3H8GA 3LMSA 4YRHA 2QIRA 4FD7A 1M4GA 2OZUA 3CPXA 3PB4X 3VWEA 3VWDA 1MJAA 4NEXA 4JWPA 4EWTA 4QUSA 4UEEA 2OZHA 4B5OA 3W6SA 4GXHA 4U9YA 5G22A 4MFQA 2VXKA 3KR5A 5JGFA 5K8MA 2BL1A 4F8ZA 4KLVA 1FNOA 2KCWA 3SI0A 2NSMA 4FD6A 4KOYA 1YLOA 4IF5A 2Q4ZA 4LQ6A 1V0CA 1ZLHA 4I49A 4UIAA 1ELLP 3I3GA 3KR4A 4NGMA 3TOAA 4CAXA 2FIAA 1NMTA 2ZW7A 4O23A 1RXTA 1PUAA 4MXUA 4QB9A 2PJ7A 4XNHB 3HLPA 2PIZA 4NJQA 3S9MA 4CPAA 5F46A 1YVOA 3WC5A 2C1CA 4M85A 1KZFA 3NH8A 3KASA 3WR7A 4B5PA 3S9NA 1BAVA 4MJ8A 2XEIA 2YNDA 4Q36A 3KHZA 3RO0A 4A32A 4YGOA 3H8EA 4B14A 2WYRA 3IWEA 4MCQA 1R43A 1Z8TA 2Q04A 2XEFA 4OIWA 4AVCA 3TO6A 1QSMA 4MHDA 2YNCA 3LWUA 3TFYA 3GIUA 4LQGA 4KSIA 4UWIA 2ABZA 3R96A 4P4IA 3CDXA 1Z8XA 1QMUA 2PJ4A 4RS2A 2EBJA 1Z4EA 5IX3A 2IMOA 2ZOGA 4PPZA 2R98A 3K9TA 1ZG8A 1CP6A 5I4MA 4NFRA 2GE3A 2PVWA 2R1IA 3D3SA 1F2PA 4QVTA 4A33A 4FD5A 5HVHA 3DR8A 1YGHA 3P2HA 4GS4A 4OC3A 5LYIA 3DDDA 5HH1A 3RAMA 4A39A 2PJBA 2AFSA 1CG2A 3GY9A 3QNVA 2Q43A 2PR8A 2ANPA 4BBHA 3GKRA 4Z65A 1N71A 1XBUA 2Q51A 3CXPA 4KS9A 2ZEGA 4R6TA 4MHNA 1P4NA 4CRZB 1QQ9A 1NSLA 5LYDA 2ZEDA 4UWJA 3PFEA 4NXYA 1Y9WA 1YSJA 4OC0A 1YW4A 2Z3OA 4NGTA 2VBQA 4ZI6A 5CNPA 3JTKA 1NE9A 4KZTA 5CBMA 4KVXA 2GLJA 5GCNA 4Y49B 3KQXA 2CF4A 5IB0A 2V8HA 4B12A 3EY5A 3IO1A 4JXRA 1LOKA 2F5IA 3B8GA 4WWVA 3R9FA 4CS0B 1I12A 2PIYA 2CNSA 2ZEOA 4AVAA 2HQYA 4M3SA 4OMEA 5EMIA 4KOSA 3FECA 4H2KA
chains in the Genus database with same CATH topology
5IV0A 4U9ZA 5I0CA 3JVNA 2HV2A 2Q0YA 3QAHA 3JUWA 3SHPA 4LX9A 4MFLA 2Z3MA 4C7IA 5F47A 2I00A 2HUZA 1S60A 2GIVA 2B5GB 4R3LA 2J8RA 4CGMA 2CNTA 4KUAA 4C2YA 1MJBA 3F5BA 2I79A 1B6BA 4JJXA 5G21A 4LUAA 3IU1A 4CYQA 4FD4A 2OZGA 3EXNA 4R87A 4PSWA 4XPKA 2Z0ZA 4CAWA 4E8OA 1WK4A 4UFXA 1IYLA 3FYNA 4OLLA 4H89A 4JD6A 1YLEA 2Q44A 5JPHA 3BJ8A 2B3VA 2WPWA 1Y7RA 3TO7A 5HMNA 2Z11A 2R8VA 2YGWA 4UBRA 5AG7A 3BLNA 1R57A 2PR1A 1K4JA 2Z3LA 4CAEA 4NCZA 2YNEA 2B58A 3GYAA 4C68A 4B11A 2Z3PA 5KTDA 5AGEA 4DNCA 1SQHA 5KTAA 5AG5A 4KLWA 2JDDA 3TOBA 3LD2A 3TCVA 4H6ZA 1LRZA 3V8IA 1L0CA 2ZPAA 2ZXVA 4QBJA 4X5KA 4MFKA 1XMTA 1WWZA 4XNHC 1MJ9A 2RC4A 2CNMA 3S6FA 2QECA 3D2PA 1S7NA 1CJWA 4KORA 3F8KA 5DWMA 3TE4A 3R9EA 2WSAA 5EBVA 3E0KA 2C27A 4CYNA 2K5TA 3DR6A 3IU2A 1QSNA 4YFJA 2PSWA 4UCPA 2DPSA 5H84A 2X7BA 4PK2A 3R9GA 4A95A 5AG6A 4HNXB 2FL4A 2AJ6A 4PSXA 3F0AA 2PC1A 1YVKA 1VHSA 2FXFA 4AG9A 3TT2A 1S5KA 4B13A 3TTHA 2P0WA 3EO4A 2Q4YA 3N7ZA 2CY2A 4Y49C 5G20A 1YK3A 4HNYB 5J8FA 5ISVA 3CXSA 4MY3A 4OADA 3BJ7A 4CRYB 1YX0A 1Z9UA 2FIWA 3R1KA 4KOVA 4MFPA 4U5YA 4C2ZA 4UA3A 2VZYA 2B4DA 4OAEA 5C82A 3ZZIA 1Q2YA 4MFJA 1IIDA 3DNSA 2DXQA 4HKFA 5KTCA 4KOXA 1M44A 4KOUA 2D4OA 5FVJA 2DPTA 3KKWA 1S7LA 5A27A 4MI4A 1S3ZA 5C88A 1Q2DA 2VI7A 4KVME 1I1DA 3IWGA 2CXAA 2Z3NA 1S7FA 1XEBA 1RO5A 2PDOA 4JXQA 1P0HA 1IICA 2FS5A 3W6XA 5J8CA 4BMHA 3W91A 3RYOA 1ON0A 4MBUA 4B5PB 4L89A 1U6MA 2GANA 4L8AA 4PK3A 4KVOE 3FXTA 2O28A 1XIXA 2Y0MA 2P6FA 3FNCA 3I9SA 3MGDA 5E96A 4AVBA 2A4NA 1QSOA 2P6GA 4KSFA 1YREA 4CAVA 1IYKA 1BO4A 2BUEA 3FIXA 4UFWA 4XPLA 4A2ZA 1QSTA 2H5MA 2AE6A 3PZJA 3UY5A 3TO9A 5JQ4A 4C7HA 4CGNA 2PRBA 4CGPA 2ZW4A 2B5GA 1M4IA 4UCMA 2VQYA 4AG7A 2Z10A 3A9LA 2ARHA 4JLYA 2Z3KA 4K30A 1KUYA 2OB0A 4ZBGA 2B4BA 3ZJ0A 3S6HA 2WPXA 3D2MA 2B4DB 4QC6A 4XPDC 5EC4A 1Y9KA 4XPDB 3OWCA 5AG4A 2R7HA 2ZW5A 2VZZA 1PU9A 2ATRA 4KOTA 1Z4RA 3T90A 3SXOA 2OH1A 1XE4A 2EUIA 2JLMA 5F48A 1I21A 3D8PA 2EVNA 3NE7A 4CYOA 2REFA 1M1DA 4F0YA 2WUUA 3FB3A 2REEA 2IL4A 2G3TA 2G3AA 2VEZA 4II9A 3R95A 2JDCA 2FT0A 1Q2CA 2JEVA 1IB1E 1OZPA 4NSQA 1J4JA 4R3KA 1QSRA 4ONUA 3T9YA 4ORFA 4C2XA 3K9UA 5BWAB 3QB8A 3EC4A 3H4QA 4AB7A 2J8MA 4J3GA 1YR0A 4PV6A 4EVYA 3H5ZA 1TIQA 5A28A 2J8NA 1GHEA 4MY0A 4B10A 4E2AA 4R57A 1ZO0A 3DSBA 2Q7BA 4UFVA 4A31A 1CM0A 1B87A 1XF8A 4IUSA 3LODA 4E0AA 2FE7A 4F0XA 1S7KA 4CYPA 3PGPA 3CXQA 2G0BA 2QMLA 3PP9A 2BSWA 2ZW6A 3C26A 1VKCA 4CGOA 3G3SA 3G8WA 5DWNA 3S6KA 4HNWB 2PQ8A 4H6UA 1M4DA 4UCNA 1UFHA 2P6EA 1KUXA 2B3UA 2YNCC 5F49A 4R9MA 3FBUA 3SXNA 3P2FA 4CAFA 1KUVA 3FRMA 4MFZA 4CGLA 3EFAA 2D4PA 2OU2A 4A30A 1FY7A 3S6GA 2BEIA 4KUBA 4ZGYB 3IGRA 5H86A 4F6AA 1MK4A 4NF1A 1BOBA 4Q38A 2NMTA 4KOWA 5G1ZA 4RI1A 2FCKA 4KSAA 2FSRA 2Q4VA 4YRHA 2QIRA 4FD7A 1M4GA 2OZUA 3VWEA 3VWDA 1MJAA 4NEXA 4JWPA 4QUSA 4B5OA 2OZHA 3W6SA 5G22A 4U9YA 4MFQA 2VXKA 2BL1A 4KLVA 2KCWA 4FD6A 4KOYA 4IF5A 1V0CA 4I49A 3I3GA 3TOAA 4CAXA 2FIAA 1NMTA 2ZW7A 1RXTA 1PUAA 4QB9A 4XNHB 5F46A 1YVOA 4M85A 1KZFA 3WR7A 4B5PA 4MJ8A 2YNDA 4Q36A 4A32A 4B14A 4YGOA 3IWEA 4AVCA 2Q04A 3TO6A 1QSMA 4MHDA 2YNCA 3TFYA 3R96A 4UWIA 4RS2A 1Z4EA 5IX3A 2R98A 2GE3A 2R1IA 3D3SA 4QVTA 4A33A 4FD5A 3DR8A 1YGHA 3P2HA 4GS4A 3DDDA 5HH1A 3GY9A 2PR8A 4BBHA 3GKRA 1N71A 3CXPA 4KS9A 1P4NA 4CRZB 1NSLA 4UWJA 4NXYA 1Y9WA 2Z3OA 2VBQA 5CNPA 3JTKA 1NE9A 4KZTA 4KVXA 5GCNA 4Y49B 5IB0A 4B12A 3EY5A 4JXRA 2F5IA 3B8GA 3R9FA 4CS0B 1I12A 2CNSA 4AVAA 2HQYA 4M3SA 4KOSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IV0 A;  4U9Z A;  5I0C A;  3JVN A;  2HV2 A;  2Q0Y A;  3QAH A;  3JUW A;  3SHP A;  4LX9 A;  5F47 A;  2I00 A;  2HUZ A;  1S60 A;  2GIV A;  2B5G B;  4R3L A;  2J8R A;  2CNT A;  4KUA A;  1MJB A;  3F5B A;  2I79 A;  1B6B A;  4JJX A;  4LUA A;  4FD4 A;  2OZG A;  3EXN A;  4R87 A;  4PSW A;  4XPK A;  2Z0Z A;  4CAW A;  4E8O A;  1WK4 A;  1IYL A;  3FYN A;  4OLL A;  4H89 A;  4JD6 A;  1YLE A;  2Q44 A;  5JPH A;  3BJ8 A;  2B3V A;  2WPW A;  1Y7R A;  3TO7 A;  5HMN A;  2Z11 A;  2R8V A;  4UBR A;  3BLN A;  1R57 A;  2PR1 A;  1K4J A;  4NCZ A;  2B58 A;  3GYA A;  5KTD A;  4DNC A;  1SQH A;  5KTA A;  4KLW A;  2JDD A;  3TOB A;  3LD2 A;  3TCV A;  4H6Z A;  1LRZ A;  3V8I A;  1L0C A;  2ZPA A;  2ZXV A;  4QBJ A;  4X5K A;  1XMT A;  1WWZ A;  4XNH C;  1MJ9 A;  2RC4 A;  2CNM A;  3S6F A;  2QEC A;  3D2P A;  1S7N A;  1CJW A;  4KOR A;  3F8K A;  5DWM A;  3TE4 A;  3R9E A;  5EBV A;  3E0K A;  2C27 A;  2K5T A;  3DR6 A;  1QSN A;  4YFJ A;  2PSW A;  5H84 A;  2X7B A;  4PK2 A;  3R9G A;  4HNX B;  2FL4 A;  2AJ6 A;  4PSX A;  3F0A A;  2PC1 A;  1YVK A;  1VHS A;  2FXF A;  4AG9 A;  3TT2 A;  1S5K A;  3TTH A;  2P0W A;  3EO4 A;  2Q4Y A;  3N7Z A;  2CY2 A;  4Y49 C;  1YK3 A;  4HNY B;  5J8F A;  5ISV A;  3CXS A;  4MY3 A;  4OAD A;  3BJ7 A;  4CRY B;  1YX0 A;  1Z9U A;  2FIW A;  3R1K A;  4KOV A;  4U5Y A;  4UA3 A;  2VZY A;  2B4D A;  4OAE A;  5C82 A;  3ZZI A;  1Q2Y A;  1IID A;  3DNS A;  2DXQ A;  4HKF A;  5KTC A;  4KOX A;  1M44 A;  4KOU A;  2D4O A;  5FVJ A;  3KKW A;  1S7L A;  4MI4 A;  1S3Z A;  5C88 A;  1Q2D A;  2VI7 A;  4KVM E;  1I1D A;  3IWG A;  1S7F A;  1XEB A;  1RO5 A;  2PDO A;  4JXQ A;  1P0H A;  1IIC A;  2FS5 A;  3W6X A;  5J8C A;  4BMH A;  3W91 A;  3RYO A;  1ON0 A;  4MBU A;  4B5P B;  4L89 A;  1U6M A;  2GAN A;  4L8A A;  4PK3 A;  4KVO E;  3FXT A;  2O28 A;  1XIX A;  2Y0M A;  2P6F A;  3FNC A;  3I9S A;  3MGD A;  5E96 A;  4AVB A;  2A4N A;  1QSO A;  2P6G A;  1YRE A;  4CAV A;  1IYK A;  1BO4 A;  2BUE A;  3FIX A;  4XPL A;  1QST A;  2H5M A;  2AE6 A;  3PZJ A;  3UY5 A;  3TO9 A;  5JQ4 A;  2PRB A;  2ZW4 A;  2B5G A;  1M4I A;  2VQY A;  4AG7 A;  2Z10 A;  2ARH A;  4JLY A;  4K30 A;  1KUY A;  2OB0 A;  4ZBG A;  2B4B A;  3ZJ0 A;  3S6H A;  2WPX A;  3D2M A;  2B4D B;  4QC6 A;  4XPD C;  5EC4 A;  1Y9K A;  4XPD B;  3OWC A;  2R7H A;  2ZW5 A;  2VZZ A;  1PU9 A;  2ATR A;  4KOT A;  1Z4R A;  3T90 A;  3SXO A;  2OH1 A;  1XE4 A;  2EUI A;  2JLM A;  5F48 A;  1I21 A;  3D8P A;  2EVN A;  3NE7 A;  2REF A;  1M1D A;  4F0Y A;  3FB3 A;  2REE A;  2IL4 A;  2G3T A;  2G3A A;  2VEZ A;  4II9 A;  3R95 A;  2JDC A;  2FT0 A;  1Q2C A;  2JEV A;  1IB1 E;  1OZP A;  4NSQ A;  1J4J A;  4R3K A;  1QSR A;  4ONU A;  3T9Y A;  4ORF A;  3K9U A;  3QB8 A;  3EC4 A;  3H4Q A;  4AB7 A;  2J8M A;  4J3G A;  1YR0 A;  4PV6 A;  4EVY A;  1TIQ A;  2J8N A;  1GHE A;  4MY0 A;  4E2A A;  4R57 A;  3DSB A;  2Q7B A;  1CM0 A;  1B87 A;  1XF8 A;  4IUS A;  3LOD A;  4E0A A;  2FE7 A;  1S7K A;  3PGP A;  3CXQ A;  2G0B A;  2QML A;  3PP9 A;  2BSW A;  2ZW6 A;  3C26 A;  1VKC A;  3G3S A;  3G8W A;  5DWN A;  3S6K A;  4HNW B;  2PQ8 A;  4H6U A;  1M4D A;  1UFH A;  2P6E A;  1KUX A;  2B3U A;  5F49 A;  3SXN A;  4R9M A;  3FBU A;  3P2F A;  1KUV A;  3FRM A;  3EFA A;  2D4P A;  2OU2 A;  1FY7 A;  3S6G A;  2BEI A;  4KUB A;  3IGR A;  5H86 A;  4F6A A;  1MK4 A;  4NF1 A;  1BOB A;  2NMT A;  4KOW A;  4RI1 A;  2FCK A;  2FSR A;  2Q4V A;  4YRH A;  2QIR A;  4FD7 A;  1M4G A;  2OZU A;  3VWE A;  3VWD A;  1MJA A;  4NEX A;  4JWP A;  4QUS A;  4B5O A;  2OZH A;  3W6S A;  4U9Y A;  2VXK A;  2BL1 A;  4KLV A;  2KCW A;  4FD6 A;  4KOY A;  4IF5 A;  1V0C A;  4I49 A;  3I3G A;  3TOA A;  4CAX A;  2FIA A;  1NMT A;  2ZW7 A;  1RXT A;  1PUA A;  4QB9 A;  4XNH B;  5F46 A;  1YVO A;  4M85 A;  1KZF A;  3WR7 A;  4B5P A;  4MJ8 A;  4YGO A;  4AVC A;  2Q04 A;  3TO6 A;  1QSM A;  4MHD A;  3TFY A;  3R96 A;  4UWI A;  4RS2 A;  1Z4E A;  5IX3 A;  2R98 A;  2GE3 A;  2R1I A;  3D3S A;  4QVT A;  4FD5 A;  3DR8 A;  1YGH A;  3P2H A;  4GS4 A;  3DDD A;  5HH1 A;  3GY9 A;  2PR8 A;  3GKR A;  1N71 A;  3CXP A;  1P4N A;  4CRZ B;  1NSL A;  4UWJ A;  4NXY A;  1Y9W A;  2VBQ A;  5CNP A;  1NE9 A;  4KZT A;  4KVX A;  5GCN A;  4Y49 B;  5IB0 A;  3EY5 A;  4JXR A;  2F5I A;  3B8G A;  3R9F A;  4CS0 B;  1I12 A;  2CNS A;  4AVA A;  2HQY A;  4M3S A;  4KOS A; 
#chains in the Genus database with same CATH topology
 4ZX9 A;  2AFZ A;  4U9Z A;  5IV0 A;  5I0C A;  2OOT A;  3JVN A;  2HV2 A;  2Q0Y A;  3QAH A;  4UEZ A;  7CPA A;  3JUW A;  3SHP A;  3SI2 A;  1IU8 A;  1H8L A;  1TF9 A;  4LX9 A;  4MFL A;  2Z3M A;  4C7I A;  3ISZ A;  4UIB A;  5F47 A;  2I00 A;  2HUZ A;  5HVG A;  1S60 A;  5K8P A;  4TNU A;  1BLL E;  4F9U A;  4GM5 A;  4TWE A;  4EME A;  2GIV A;  2B5G B;  4MRI A;  4R3L A;  4A37 A;  2J8R A;  4CGM A;  2CNT A;  4KUA A;  2PJC A;  2FVG A;  4C2Y A;  3MN8 A;  1MJB A;  3F5B A;  5JH9 A;  2I79 A;  2QYV A;  3D7D A;  1B6B A;  4JJX A;  5G21 A;  3WAB A;  4LUA A;  1Z8L A;  2C6P A;  3IU1 A;  4FD4 A;  1Q7L A;  4CYQ A;  2OZG A;  2PCU A;  3EXN A;  4R87 A;  4PSW A;  1BPN A;  2AFU A;  4XPK A;  5JM6 A;  2Z0Z A;  4CAW A;  4E8O A;  5K8N A;  1WK4 A;  3NH4 A;  4R76 A;  4HPS A;  2C6G A;  4UFX A;  2V8D A;  4X8I A;  1IYL A;  3FYN A;  4OLL A;  4JZ0 A;  4H89 A;  2O53 A;  3IC1 A;  2O4H A;  4JD6 A;  1Y0Y A;  1YLE A;  2Q44 A;  3FVL A;  3V38 A;  5JPH A;  1XJO A;  3KGQ A;  3BJ8 A;  2HB6 A;  2B3V A;  2WPW A;  1Y7R A;  4PXD A;  3TO7 A;  5HMN A;  2Z11 A;  2R8V A;  1TF8 A;  2YGW A;  4UBR A;  5AG7 A;  3BLN A;  3B3S A;  1R57 A;  2PR1 A;  1FT7 A;  1K4J A;  3IFE A;  4M6I A;  1DE4 C;  1ZLI A;  4P4F A;  2Z3L A;  4CAE A;  4NCZ A;  2YNE A;  1ARL A;  2B58 A;  3GYA A;  4C68 A;  4B11 A;  2Z3P A;  5KTD A;  5AGE A;  1YME A;  4DNC A;  1SQH A;  4ZY1 A;  5KTA A;  1IGB A;  5AG5 A;  2GRE A;  1TKJ A;  2OR4 A;  4RN7 A;  1XOV A;  4KLW A;  4P4E A;  2JDD A;  3TOB A;  3LD2 A;  2F8H A;  3SI1 A;  3TCV A;  4H6Z A;  1LRZ A;  3V8I A;  1L0C A;  4PXE A;  1Z2L A;  4PXB A;  2ZPA A;  1KWM A;  2ZXV A;  2GLF A;  5D29 A;  4QBJ A;  3FF3 A;  4X5K A;  5CPA A;  3H8F A;  4MFK A;  1XMT A;  3NE8 A;  4NGR A;  1WWZ A;  4P10 A;  4XNH C;  1AYE A;  4OP4 A;  2PJ0 A;  3FED A;  3IIB A;  1MJ9 A;  2XEG A;  1GYT A;  4WJB A;  2RC4 A;  4P45 A;  2PRQ A;  3QAY A;  2CNM A;  3S6F A;  5THW A;  2QEC A;  3D2P A;  1S7N A;  5LYL A;  1CJW A;  4KOR A;  4OC1 A;  2EK9 A;  3F8K A;  5DWM A;  2HC9 A;  3TE4 A;  3R9E A;  2WSA A;  5EBV A;  3GLJ A;  2ZEP A;  3E0K A;  2C27 A;  2GFQ A;  2IQ6 A;  1CBX A;  1HDU A;  4CYN A;  4UEF A;  2K5T A;  3DR6 A;  3IU2 A;  4MCP A;  1QSN A;  2ZOF A;  2PSW A;  3B7I A;  4K3N A;  4UCP A;  4YFJ A;  5LRK A;  2DPS A;  1VHE A;  4NGQ A;  4PQA A;  2BCO A;  3PBE A;  3B3V A;  5H84 A;  2X7B A;  4PK2 A;  3R9G A;  4A95 A;  1TKF A;  5AG6 A;  4HNX B;  2FL4 A;  1ARM A;  3I1U A;  2DEA A;  2XEJ A;  1VGY A;  2AJ6 A;  1CX8 A;  4MCR A;  4PSX A;  4RUH A;  4P6Y A;  3F0A A;  2PC1 A;  1A2Z A;  3PB7 X;  1YVK A;  1Y7E A;  1VHS A;  2FXF A;  4AG9 A;  3TT2 A;  1S5K A;  2PJ2 A;  4B13 A;  3JRU A;  3TTH A;  2P0W A;  3EO4 A;  2Q4Y A;  1YQE A;  3N7Z A;  5ELY A;  2CY2 A;  4Y49 C;  5G20 A;  1YK3 A;  4ZY2 A;  4HNY B;  5J8F A;  5LRJ A;  3IEH A;  5ISV A;  3CXS A;  4MY3 A;  2I3C A;  4OAD A;  3BJ7 A;  4CRY B;  1YX0 A;  2PE3 A;  1CPX A;  1Z9U A;  2FIW A;  2JBJ A;  3BXM A;  2JBK A;  2PJ5 A;  2ZEF A;  3R1K A;  4KOV A;  4MFP A;  4U5Y A;  4C2Z A;  4UA3 A;  2VZY A;  2B4D A;  5DS0 A;  4OAE A;  4PXC A;  5C82 A;  3FEE A;  3B3W A;  3TC8 A;  3ZZI A;  1Q2Y A;  4MFJ A;  1IID A;  2DF5 A;  3DNS A;  3DGV A;  2DXQ A;  4HKF A;  5KTC A;  3FMC A;  1AMP A;  3NA6 A;  4KOX A;  3KL9 A;  1M44 A;  3D68 A;  4KOU A;  2D4O A;  3GUX A;  3NFZ A;  4JYW A;  4P4D A;  5FVJ A;  2DPT A;  3KKW A;  1S7L A;  5A27 A;  2PVV A;  3IWW A;  4MI4 A;  4F9V A;  1S3Z A;  3CPA A;  4A94 A;  2RB7 A;  3MRU A;  5C88 A;  3D7F A;  4MCS A;  1JQG A;  1Q2D A;  2VI7 A;  1I1D A;  4KVM E;  3RZA A;  3IWG A;  2CXA A;  3PB9 X;  1EE3 P;  8CPA A;  2Z3N A;  1OBR A;  4UF4 A;  1S7F A;  4P4B A;  1XEB A;  1RO5 A;  2PDO A;  5IB9 A;  1F57 A;  3PRT A;  1P0H A;  1LFW A;  4JXQ A;  1IIC A;  2FS5 A;  1TKH A;  4X3R A;  2Q7S A;  2ZEN A;  5LYF A;  3W6X A;  5J8C A;  3SJF A;  2RFH A;  4G1P A;  4A38 A;  4BMH A;  1Z8W A;  4FAI A;  3BHX A;  2CIJ A;  3W91 A;  3RYO A;  1ON0 A;  3RNZ A;  4MBU A;  3WC6 A;  4B5P B;  4L89 A;  1U6M A;  2GAN A;  3PEI A;  4M6H A;  4L8A A;  3KI9 A;  4PK3 A;  4KVO E;  3FXT A;  2O28 A;  2WZN A;  4NGP A;  2CTC A;  4IK2 A;  4YWY A;  3RBU A;  1LAM A;  1XIX A;  2F7V A;  4EFD A;  2Y0M A;  3PFO A;  2P6F A;  3FNC A;  3I9S A;  4MHP A;  4BIN A;  3MGD A;  5E96 A;  4AVB A;  2ZEE A;  4AXV A;  2A4N A;  1QSO A;  2P6G A;  4KSF A;  4B6Z A;  3D7G A;  1YRE A;  4YU9 A;  1IYK A;  1BO4 A;  2BUE A;  3FIX A;  3HUV A;  4CAV A;  4UFW A;  4XPL A;  4A2Z A;  3VH9 A;  1QST A;  3GB0 A;  4NGS A;  2H5M A;  2AE6 A;  2ZEL A;  4M6G A;  3PZJ A;  1UWY A;  4FUU A;  3UY5 A;  3TO9 A;  5JQ4 A;  4C7H A;  3CT9 A;  3DLJ A;  4CGN A;  1M4L A;  2PRB A;  3WC7 A;  4CGP A;  2ZW4 A;  2B5G A;  4FBE A;  1M4I A;  5HXD A;  4UCM A;  2VQY A;  1ELM P;  3B3T A;  2ZEH A;  4AG7 A;  2IJZ A;  2Z10 A;  3KHX A;  4IHM A;  3A9L A;  4IAV A;  2ARH A;  4JLY A;  2Z3K A;  2BO9 A;  4K30 A;  4NJR A;  1KUY A;  2ODF A;  1ZG9 A;  1X10 A;  2OB0 A;  3B3C A;  4ZBG A;  1R3N A;  2B4B A;  3TX8 A;  1IOI A;  1PCA A;  3ZJ0 A;  2EK8 A;  2V8V A;  1XFO A;  1X12 A;  3S6H A;  1Z5R A;  2WPX A;  2B4D B;  3D2M A;  3PBB A;  4QC6 A;  1XMB A;  1NSA A;  4OID A;  3S9L A;  4XPD C;  5EC4 A;  1Y9K A;  3BI0 A;  4XPD B;  3OWC A;  5AG4 A;  3T8W A;  3NH5 A;  3SJG A;  3WT4 A;  2R7H A;  2ZW5 A;  3FH4 A;  2VZZ A;  3BI1 A;  1PU9 A;  2EWB A;  3CZX A;  1ZG7 A;  2ATR A;  4KOT A;  4DYO A;  1Z4R A;  3K2K A;  4OC5 A;  2CTB A;  3SXO A;  1TXR A;  2OH1 A;  1XE4 A;  3T90 A;  4OC4 A;  4P44 A;  2EUI A;  1F2O A;  1RTQ A;  3KQZ A;  3L2N A;  2JLM A;  5F48 A;  1I21 A;  1Y0R A;  3D8P A;  2EVN A;  3NE7 A;  4CYO A;  2REF A;  1M1D A;  4F0Y A;  3FX6 A;  2V8G A;  2BOA A;  2WUU A;  3B2Y A;  3FB3 A;  3ISX A;  3SJX A;  4ZX8 A;  4NGN A;  4R8F A;  3VAR A;  2REE A;  1LCP A;  1PYT B;  2IL4 A;  2G3T A;  2G3A A;  2VEZ A;  5LRG A;  3R95 A;  2JDC A;  1HEE A;  2FT0 A;  1Q2C A;  2JEV A;  3VAT A;  1IB1 E;  4II9 A;  1OZP A;  4R7M A;  4ZY0 A;  4NSQ A;  4OC2 A;  1J4J A;  4R3K A;  1QSR A;  4X2T A;  5HVF A;  4ONU A;  1HDQ A;  3T9Y A;  1CPS A;  4ORF A;  2PJ9 A;  4C2X A;  3K9U A;  2QVP A;  5BWA B;  1XRY A;  2POK A;  3QB8 A;  3EC4 A;  3H4Q A;  4AB7 A;  2PJ6 A;  2J8M A;  2PJ3 A;  4J3G A;  1YR0 A;  4PV6 A;  2JEW A;  4EVY A;  4DJL A;  5J1Q A;  3H5Z A;  1TIQ A;  5A28 A;  2J8N A;  3KZW A;  1GHE A;  2GU2 A;  4MY0 A;  4OKO A;  4B10 A;  4E2A A;  1JWQ A;  4R57 A;  1ZO0 A;  2NYQ A;  3DSB A;  2Q7B A;  4UFV A;  1BPM A;  1CM0 A;  1B87 A;  4A31 A;  1IY7 A;  1XF8 A;  4IUS A;  3D67 A;  3LOD A;  4E0A A;  2FE7 A;  4F0X A;  1AUG A;  1S7K A;  4CYP A;  2PJA A;  3PGP A;  3CXQ A;  2G0B A;  2QML A;  3PP9 A;  2BSW A;  2ZW6 A;  1CP7 A;  3C26 A;  1VKC A;  1VIX A;  3G3S A;  4CGO A;  3LAC A;  3G8W A;  4ONW A;  2V77 A;  3N5F A;  5DWN A;  3S6K A;  1YW6 A;  3FJU A;  3IJ3 A;  4ZYQ A;  4P4J A;  2AFO A;  4HNW B;  2PQ8 A;  5D8N A;  6CPA A;  2J9A A;  4H6U A;  1M4D A;  2ZEM A;  4MHY A;  4UCN A;  2G9D A;  1UFH A;  3V7Z A;  2P6E A;  2PJ8 A;  1KUX A;  2QJ8 A;  3SJE A;  1VHO A;  2B3U A;  2YNC C;  4R9M A;  3FBU A;  5F49 A;  3P2F A;  3SXN A;  4CAF A;  2EO8 A;  1KUV A;  4DUK A;  5F09 A;  3FRM A;  3PB8 X;  1LAN A;  2AFM A;  4MFZ A;  4CGL A;  3EFA A;  2AFW A;  2D4P A;  2OU2 A;  4A30 A;  1FY7 A;  3S6G A;  2BEI A;  4KUB A;  4W9Y A;  3PB6 X;  4ZGY B;  3IGR A;  5H86 A;  4BD9 A;  1DTD A;  1LAP A;  4Q7A A;  2PJ1 A;  4F6A A;  1MK4 A;  4NF1 A;  1BOB A;  4Q38 A;  5K8O A;  4MMO A;  4MHZ A;  2NMT A;  3D7H A;  3D4U A;  4KOW A;  4FWU A;  3B35 A;  1IOF A;  3D66 A;  2FCK A;  4KSA A;  4RI1 A;  2AFX A;  5G1Z A;  2FSR A;  2C6C A;  2Q4V A;  2VL1 A;  3H8G A;  3LMS A;  4YRH A;  2QIR A;  4FD7 A;  1M4G A;  2OZU A;  3CPX A;  3PB4 X;  3VWE A;  3VWD A;  1MJA A;  4NEX A;  4JWP A;  4EWT A;  4QUS A;  4UEE A;  2OZH A;  4B5O A;  3W6S A;  4GXH A;  4U9Y A;  5G22 A;  4MFQ A;  2VXK A;  3KR5 A;  5JGF A;  5K8M A;  2BL1 A;  4F8Z A;  4KLV A;  1FNO A;  2KCW A;  3SI0 A;  2NSM A;  4FD6 A;  4KOY A;  1YLO A;  4IF5 A;  2Q4Z A;  4LQ6 A;  1V0C A;  1ZLH A;  4I49 A;  4UIA A;  1ELL P;  3I3G A;  3KR4 A;  4NGM A;  3TOA A;  4CAX A;  2FIA A;  1NMT A;  2ZW7 A;  4O23 A;  1RXT A;  1PUA A;  4MXU A;  4QB9 A;  2PJ7 A;  4XNH B;  3HLP A;  2PIZ A;  4NJQ A;  3S9M A;  4CPA A;  5F46 A;  1YVO A;  3WC5 A;  2C1C A;  4M85 A;  1KZF A;  3NH8 A;  3KAS A;  3WR7 A;  4B5P A;  3S9N A;  1BAV A;  4MJ8 A;  2XEI A;  2YND A;  4Q36 A;  3KHZ A;  3RO0 A;  4A32 A;  4YGO A;  3H8E A;  4B14 A;  2WYR A;  3IWE A;  4MCQ A;  1R43 A;  1Z8T A;  2Q04 A;  2XEF A;  4OIW A;  4AVC A;  3TO6 A;  1QSM A;  4MHD A;  2YNC A;  3LWU A;  3TFY A;  3GIU A;  4LQG A;  4KSI A;  4UWI A;  2ABZ A;  3R96 A;  4P4I A;  3CDX A;  1Z8X A;  1QMU A;  2PJ4 A;  4RS2 A;  2EBJ A;  1Z4E A;  5IX3 A;  2IMO A;  2ZOG A;  4PPZ A;  2R98 A;  3K9T A;  1ZG8 A;  1CP6 A;  5I4M A;  4NFR A;  2GE3 A;  2PVW A;  2R1I A;  3D3S A;  1F2P A;  4QVT A;  4A33 A;  4FD5 A;  5HVH A;  3DR8 A;  1YGH A;  3P2H A;  4GS4 A;  4OC3 A;  5LYI A;  3DDD A;  5HH1 A;  3RAM A;  4A39 A;  2PJB A;  2AFS A;  1CG2 A;  3GY9 A;  3QNV A;  2Q43 A;  2PR8 A;  2ANP A;  4BBH A;  3GKR A;  4Z65 A;  1N71 A;  1XBU A;  2Q51 A;  3CXP A;  4KS9 A;  2ZEG A;  4R6T A;  4MHN A;  1P4N A;  4CRZ B;  1QQ9 A;  1NSL A;  5LYD A;  2ZED A;  4UWJ A;  3PFE A;  4NXY A;  1Y9W A;  1YSJ A;  4OC0 A;  1YW4 A;  2Z3O A;  4NGT A;  2VBQ A;  4ZI6 A;  5CNP A;  3JTK A;  1NE9 A;  4KZT A;  5CBM A;  4KVX A;  2GLJ A;  5GCN A;  4Y49 B;  3KQX A;  2CF4 A;  5IB0 A;  2V8H A;  4B12 A;  3EY5 A;  3IO1 A;  4JXR A;  1LOK A;  2F5I A;  3B8G A;  4WWV A;  3R9F A;  4CS0 B;  1I12 A;  2PIY A;  2CNS A;  2ZEO A;  4AVA A;  2HQY A;  4M3S A;  4OME A;  5EMI A;  4KOS A;  3FEC A;  4H2K A; 
#chains in the Genus database with same CATH homology
 5IV0 A;  4U9Z A;  5I0C A;  3JVN A;  2HV2 A;  2Q0Y A;  3QAH A;  3JUW A;  3SHP A;  4LX9 A;  4MFL A;  2Z3M A;  4C7I A;  5F47 A;  2I00 A;  2HUZ A;  1S60 A;  2GIV A;  2B5G B;  4R3L A;  2J8R A;  4CGM A;  2CNT A;  4KUA A;  4C2Y A;  1MJB A;  3F5B A;  2I79 A;  1B6B A;  4JJX A;  5G21 A;  4LUA A;  3IU1 A;  4CYQ A;  4FD4 A;  2OZG A;  3EXN A;  4R87 A;  4PSW A;  4XPK A;  2Z0Z A;  4CAW A;  4E8O A;  1WK4 A;  4UFX A;  1IYL A;  3FYN A;  4OLL A;  4H89 A;  4JD6 A;  1YLE A;  2Q44 A;  5JPH A;  3BJ8 A;  2B3V A;  2WPW A;  1Y7R A;  3TO7 A;  5HMN A;  2Z11 A;  2R8V A;  2YGW A;  4UBR A;  5AG7 A;  3BLN A;  1R57 A;  2PR1 A;  1K4J A;  2Z3L A;  4CAE A;  4NCZ A;  2YNE A;  2B58 A;  3GYA A;  4C68 A;  4B11 A;  2Z3P A;  5KTD A;  5AGE A;  4DNC A;  1SQH A;  5KTA A;  5AG5 A;  4KLW A;  2JDD A;  3TOB A;  3LD2 A;  3TCV A;  4H6Z A;  1LRZ A;  3V8I A;  1L0C A;  2ZPA A;  2ZXV A;  4QBJ A;  4X5K A;  4MFK A;  1XMT A;  1WWZ A;  4XNH C;  1MJ9 A;  2RC4 A;  2CNM A;  3S6F A;  2QEC A;  3D2P A;  1S7N A;  1CJW A;  4KOR A;  3F8K A;  5DWM A;  3TE4 A;  3R9E A;  2WSA A;  5EBV A;  3E0K A;  2C27 A;  4CYN A;  2K5T A;  3DR6 A;  3IU2 A;  1QSN A;  4YFJ A;  2PSW A;  4UCP A;  2DPS A;  5H84 A;  2X7B A;  4PK2 A;  3R9G A;  4A95 A;  5AG6 A;  4HNX B;  2FL4 A;  2AJ6 A;  4PSX A;  3F0A A;  2PC1 A;  1YVK A;  1VHS A;  2FXF A;  4AG9 A;  3TT2 A;  1S5K A;  4B13 A;  3TTH A;  2P0W A;  3EO4 A;  2Q4Y A;  3N7Z A;  2CY2 A;  4Y49 C;  5G20 A;  1YK3 A;  4HNY B;  5J8F A;  5ISV A;  3CXS A;  4MY3 A;  4OAD A;  3BJ7 A;  4CRY B;  1YX0 A;  1Z9U A;  2FIW A;  3R1K A;  4KOV A;  4MFP A;  4U5Y A;  4C2Z A;  4UA3 A;  2VZY A;  2B4D A;  4OAE A;  5C82 A;  3ZZI A;  1Q2Y A;  4MFJ A;  1IID A;  3DNS A;  2DXQ A;  4HKF A;  5KTC A;  4KOX A;  1M44 A;  4KOU A;  2D4O A;  5FVJ A;  2DPT A;  3KKW A;  1S7L A;  5A27 A;  4MI4 A;  1S3Z A;  5C88 A;  1Q2D A;  2VI7 A;  4KVM E;  1I1D A;  3IWG A;  2CXA A;  2Z3N A;  1S7F A;  1XEB A;  1RO5 A;  2PDO A;  4JXQ A;  1P0H A;  1IIC A;  2FS5 A;  3W6X A;  5J8C A;  4BMH A;  3W91 A;  3RYO A;  1ON0 A;  4MBU A;  4B5P B;  4L89 A;  1U6M A;  2GAN A;  4L8A A;  4PK3 A;  4KVO E;  3FXT A;  2O28 A;  1XIX A;  2Y0M A;  2P6F A;  3FNC A;  3I9S A;  3MGD A;  5E96 A;  4AVB A;  2A4N A;  1QSO A;  2P6G A;  4KSF A;  1YRE A;  4CAV A;  1IYK A;  1BO4 A;  2BUE A;  3FIX A;  4UFW A;  4XPL A;  4A2Z A;  1QST A;  2H5M A;  2AE6 A;  3PZJ A;  3UY5 A;  3TO9 A;  5JQ4 A;  4C7H A;  4CGN A;  2PRB A;  4CGP A;  2ZW4 A;  2B5G A;  1M4I A;  4UCM A;  2VQY A;  4AG7 A;  2Z10 A;  3A9L A;  2ARH A;  4JLY A;  2Z3K A;  4K30 A;  1KUY A;  2OB0 A;  4ZBG A;  2B4B A;  3ZJ0 A;  3S6H A;  2WPX A;  3D2M A;  2B4D B;  4QC6 A;  4XPD C;  5EC4 A;  1Y9K A;  4XPD B;  3OWC A;  5AG4 A;  2R7H A;  2ZW5 A;  2VZZ A;  1PU9 A;  2ATR A;  4KOT A;  1Z4R A;  3T90 A;  3SXO A;  2OH1 A;  1XE4 A;  2EUI A;  2JLM A;  5F48 A;  1I21 A;  3D8P A;  2EVN A;  3NE7 A;  4CYO A;  2REF A;  1M1D A;  4F0Y A;  2WUU A;  3FB3 A;  2REE A;  2IL4 A;  2G3T A;  2G3A A;  2VEZ A;  4II9 A;  3R95 A;  2JDC A;  2FT0 A;  1Q2C A;  2JEV A;  1IB1 E;  1OZP A;  4NSQ A;  1J4J A;  4R3K A;  1QSR A;  4ONU A;  3T9Y A;  4ORF A;  4C2X A;  3K9U A;  5BWA B;  3QB8 A;  3EC4 A;  3H4Q A;  4AB7 A;  2J8M A;  4J3G A;  1YR0 A;  4PV6 A;  4EVY A;  3H5Z A;  1TIQ A;  5A28 A;  2J8N A;  1GHE A;  4MY0 A;  4B10 A;  4E2A A;  4R57 A;  1ZO0 A;  3DSB A;  2Q7B A;  4UFV A;  4A31 A;  1CM0 A;  1B87 A;  1XF8 A;  4IUS A;  3LOD A;  4E0A A;  2FE7 A;  4F0X A;  1S7K A;  4CYP A;  3PGP A;  3CXQ A;  2G0B A;  2QML A;  3PP9 A;  2BSW A;  2ZW6 A;  3C26 A;  1VKC A;  4CGO A;  3G3S A;  3G8W A;  5DWN A;  3S6K A;  4HNW B;  2PQ8 A;  4H6U A;  1M4D A;  4UCN A;  1UFH A;  2P6E A;  1KUX A;  2B3U A;  2YNC C;  5F49 A;  4R9M A;  3FBU A;  3SXN A;  3P2F A;  4CAF A;  1KUV A;  3FRM A;  4MFZ A;  4CGL A;  3EFA A;  2D4P A;  2OU2 A;  4A30 A;  1FY7 A;  3S6G A;  2BEI A;  4KUB A;  4ZGY B;  3IGR A;  5H86 A;  4F6A A;  1MK4 A;  4NF1 A;  1BOB A;  4Q38 A;  2NMT A;  4KOW A;  5G1Z A;  4RI1 A;  2FCK A;  4KSA A;  2FSR A;  2Q4V A;  4YRH A;  2QIR A;  4FD7 A;  1M4G A;  2OZU A;  3VWE A;  3VWD A;  1MJA A;  4NEX A;  4JWP A;  4QUS A;  4B5O A;  2OZH A;  3W6S A;  5G22 A;  4U9Y A;  4MFQ A;  2VXK A;  2BL1 A;  4KLV A;  2KCW A;  4FD6 A;  4KOY A;  4IF5 A;  1V0C A;  4I49 A;  3I3G A;  3TOA A;  4CAX A;  2FIA A;  1NMT A;  2ZW7 A;  1RXT A;  1PUA A;  4QB9 A;  4XNH B;  5F46 A;  1YVO A;  4M85 A;  1KZF A;  3WR7 A;  4B5P A;  4MJ8 A;  2YND A;  4Q36 A;  4A32 A;  4B14 A;  4YGO A;  3IWE A;  4AVC A;  2Q04 A;  3TO6 A;  1QSM A;  4MHD A;  2YNC A;  3TFY A;  3R96 A;  4UWI A;  4RS2 A;  1Z4E A;  5IX3 A;  2R98 A;  2GE3 A;  2R1I A;  3D3S A;  4QVT A;  4A33 A;  4FD5 A;  3DR8 A;  1YGH A;  3P2H A;  4GS4 A;  3DDD A;  5HH1 A;  3GY9 A;  2PR8 A;  4BBH A;  3GKR A;  1N71 A;  3CXP A;  4KS9 A;  1P4N A;  4CRZ B;  1NSL A;  4UWJ A;  4NXY A;  1Y9W A;  2Z3O A;  2VBQ A;  5CNP A;  3JTK A;  1NE9 A;  4KZT A;  4KVX A;  5GCN A;  4Y49 B;  5IB0 A;  4B12 A;  3EY5 A;  4JXR A;  2F5I A;  3B8G A;  3R9F A;  4CS0 B;  1I12 A;  2CNS A;  4AVA A;  2HQY A;  4M3S A;  4KOS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...