2PC1A

Crystal structure of acetyltransferase gnat family (np_688560.1) from streptococcus agalactiae 2603 at 1.28 a resolution
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
173
structure length
173
Chain Sequence
NLYFQGMQIRLAFPNEIDQIMLLIEEARAEIAKTGSDQWQKEDGYPNRNDIIDDILNGYAWVGIEDGMLATYAAVIDGHEEVYDAIYEGKWLHDNHRYLTFHRIAISNQFRGRGLAQTFLQGLIEGHKGPDFRCDTHEKNVTMQHILNKLGYQYCGKVPLDGVRLAYQKIKEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of acetyltransferase GNAT family (NP_688560.1) from Streptococcus agalactiae 2603 at 1.28 A resolution
rcsb
source organism Streptococcus agalactiae 2603v/r
molecule tags Transferase
molecule keywords Acetyltransferase, GNAT family
total genus 55
structure length 173
sequence length 173
ec nomenclature ec 2.3.1.-:
pdb deposition date 2007-03-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 2pc1A00
2OZGA 4KOSA 4B5OA 4L8AA 2H5MA 4AG9A 1M4DA 2FCKA 1UFHA 1S7KA 2G0BA 5H84A 1YX0A 2HUZA 2Z11A 1IB1E 2ZW6A 2REEA 1YVKA 1VHSA 3FNCA 1B87A 1XIXA 3N7ZA 2KCWA 2PSWA 3BLNA 4RS2A 2P0WA 2PR1A 2J8NA 3R9GA 3R96A 3CXSA 3SXNA 2JEVA 3ZJ0A 4AVBA 1V0CA 4XPDB 3F8KA 2EUIA 2FIAA 1FY7A 4BMHA 2I00A 4NCZA 1J4JA 2O28A 4PK2A 3NE7A 3FYNA 3D3SA 2P6GA 4I49A 1K4JA 1PU9A 4E0AA 4XNHC 3WR7A 2JDCA 2AE6A 4NF1A 2B4DA 3UY5A 3DDDA 1QSMA 2WPWA 2Q44A 3P2HA 3R1KA 1MJAA 3FRMA 2Q0YA 3JUWA 4AVAA 5IV0A 4HNXB 2FL4A 2VZYA 3F0AA 5FVJA 5KTCA 3I3GA 1TIQA 4PSXA 1LRZA 4XNHB 5F49A 4KOUA 4U9ZA 4UWIA 1QSTA 4M85A 3S6HA 5JQ4A 4NXYA 4II9A 3IGRA 3VWDA 2K5TA 2B4DB 2PC1A 4CAVA 2P6EA 3EO4A 3SHPA 4CRZB 3W6XA 4R87A 2QECA 2D4PA 2FIWA 3E0KA 4NEXA 2VZZA 4J3GA 4XPLA 3DR8A 3W6SA 1OZPA 3DSBA 2R98A 1WWZA 3R9EA 1IYLA 1YVOA 4UBRA 4U9YA 4XPKA 2VI7A 3TFYA 2AJ6A 1MK4A 4OADA 1R57A 4YFJA 1QSRA 1U6MA 1KUXA 4KLVA 4KUAA 5H86A 1I1DA 2QIRA 3PGPA 1IYKA 1KUVA 4CAWA 4E8OA 1M4GA 4HNYB 4JJXA 5J8FA 4E2AA 3TOAA 4ORFA 3SXOA 2OU2A 3VWEA 1YGHA 3DNSA 2FSRA 4GS4A 4YRHA 4RI1A 1BOBA 4L89A 4QVTA 3T90A 4CAXA 4IUSA 1VKCA 2J8MA 3C26A 2Q04A 2IL4A 4AVCA 2ZW4A 1GHEA 4MJ8A 2Z0ZA 4R3KA 4NSQA 3FBUA 4M3SA 2BSWA 2VBQA 2B3VA 5F46A 1QSOA 3W91A 2PR8A 3GYAA 5C88A 5CNPA 2BUEA 3LD2A 2B4BA 2C27A 1P0HA 2J8RA 2RC4A 3KKWA 4KOYA 4UA3A 4LX9A 4PK3A 1NE9A 3JVNA 1Z4EA 4FD7A 1N71A 2F5IA 4MY3A 4ONUA 2HQYA 1MJBA 4F0YA 1S7LA 5I0CA 1PUAA 3GY9A 2B3UA 1YK3A 2DXQA 3B8GA 3D2PA 2Q7BA 4KLWA 4EVYA 2GE3A 2I79A 3FXTA 3EXNA 3QB8A 4B5PB 5F48A 1CJWA 2REFA 3T9YA 2JLMA 4H89A 5IB0A 4X5KA 1ON0A 4QB9A 3EY5A 1IIDA 4KORA 2FXFA 5HMNA 1RXTA 2B5GA 1KZFA 4F6AA 4R3LA 2VXKA 1S3ZA 3P2FA 5KTAA 3K9UA 4JLYA 2A4NA 1MJ9A 1S60A 1Q2YA 1WK4A 4B5PA 3G8WA 4KUBA 4U5YA 5DWMA 1CM0A 2VQYA 4KVXA 3EC4A 1IICA 5HH1A 3CXPA 3TCVA 1XMTA 3F5BA 3R95A 2R1IA 1M44A 2QMLA 2BEIA 4KZTA 4JD6A 5EBVA 2Q4VA 1XF8A 4XPDC 2ZW7A 4MHDA 2FT0A 3GKRA 1YLEA 3PZJA 1I21A 2B58A 4PSWA 2CNSA 2X7BA 1KUYA 2PDOA 2VEZA 2GANA 5J8CA 1I12A 1YREA 3TO7A 4H6UA 4QBJA 1M1DA 4FD5A 3TO6A 3S6KA 1M4IA 3OWCA 1Z4RA 4HKFA 1RO5A 2FS5A 4ZBGA 4JXQA 3DR6A 3MGDA 2Z10A 5ISVA 3BJ8A 2FE7A 4OLLA 4UWJA 1QSNA 3TTHA 4DNCA 3FIXA 4K30A 5EC4A 4FD4A 4KVOE 2ZW5A 2G3TA 1L0CA 4PV6A 5IX3A 1Z9UA 5DWNA 4FD6A 2CY2A 3CXQA 4KOXA 3H4QA 2GIVA 4Y49C 2G3AA 4R57A 2CNMA 2CNTA 3S6FA 2ZXVA 4AB7A 3TT2A 4KOTA 3BJ7A 4JWPA 1Q2CA 2Y0MA 3S6GA 3TE4A 1B6BA 2NMTA 1XEBA 2ARHA 4CS0B 3LODA 1XE4A 2PRBA 3IWGA 4HNWB 3EFAA 4KVME 3V8IA 5C82A 1S7NA 2B5GB 2OB0A 2D4OA 4QC6A 2R7HA 4MI4A 5JPHA 1Q2DA 3D2MA 1S7FA 3PP9A 2ZPAA 1Y7RA 1Y9WA 3ZZIA 1Y9KA 3D8PA 4H6ZA 5E96A 3TOBA 2BL1A 1BO4A 2R8VA 4AG7A 2EVNA 2JDDA 1S5KA 1NSLA 3FB3A 2OZHA 2HV2A 4OAEA 5F47A 2ATRA 3R9FA 4R9MA 1YR0A 4QUSA 3RYOA 1SQHA 2OZUA 4KOWA 1NMTA 4JXRA 4YGOA 5KTDA 4IF5A 2PQ8A 3I9SA 1P4NA 5GCNA 2P6FA 2OH1A 4KOVA 2WPXA 4MY0A 4MBUA 4LUAA 3QAHA 3G3SA 4Y49B 4CRYB 3TO9A 2Q4YA
chains in the Genus database with same CATH superfamily
2OZGA 4KOSA 4B12A 1TF8A 4L8AA 2H5MA 4AG9A 4B5OA 1M4DA 4LQ6A 2FCKA 1UFHA 1S7KA 2G0BA 2C6GA 5H84A 3RZAA 8CPAA 1YX0A 2HUZA 2Z11A 4NFRA 1IB1E 1IOIA 2ZW6A 3SJEA 2REEA 5D8NA 4A94A 1YVKA 1VHSA 3KI9A 1PYTB 3FNCA 3B3TA 2QYVA 1B87A 1XIXA 2V8VA 4F8ZA 4C7HA 3N7ZA 3JRUA 3S9MA 2C1CA 2XEJA 2KCWA 2PSWA 3BLNA 4RS2A 2P0WA 2PR1A 3VH9A 2J8NA 3NH5A 3R9GA 1BPMA 3IWEA 3R96A 4ZY1A 3CXSA 2CXAA 3SXNA 2JEVA 4B11A 3ZJ0A 4AVBA 1V0CA 2AFXA 4ZGYB 2YNCC 1R43A 4XPDB 2ZELA 1ARLA 2EUIA 1FY7A 1FNOA 2FIAA 3DGVA 3F8KA 3PRTA 4BMHA 4MCPA 2I00A 2PVWA 2V8HA 3D7HA 1QQ9A 2Z3PA 3V38A 4BINA 4FAIA 3NE8A 1ZG9A 2BOAA 2PJ0A 4NCZA 4B10A 1J4JA 2O28A 3B3CA 3WT4A 4PK2A 3NE7A 3FYNA 1IU8A 3D3SA 2P6GA 3K2KA 4R7MA 2GLFA 3BXMA 4I49A 1K4JA 1PU9A 4KSAA 1Y0RA 4Q38A 2PJ2A 4E0AA 1BPNA 4XNHC 3S9LA 3WR7A 2JDCA 2O4HA 3KL9A 3MN8A 4NGSA 4X8IA 2AE6A 4NF1A 2B4DA 3UY5A 3DDDA 1QSMA 2WPWA 2GU2A 2Q44A 3IJ3A 3VATA 4NGPA 5IB9A 3D7DA 4CGPA 1LAMA 4ZX8A 4ONWA 3P2HA 4FBEA 3R1KA 1MJAA 3FRMA 3RAMA 1F2OA 2Q0YA 2ZEDA 3JUWA 2HB6A 4KSIA 5G22A 4AVAA 5IV0A 4F9UA 4HNXB 3IU1A 2FL4A 2VZYA 5AG4A 2QVPA 4A31A 2Q43A 5G21A 3GUXA 1M4LA 4JYWA 3F0AA 1VHOA 2PJ1A 3FX6A 5FVJA 4CAEA 4ZI6A 5KTCA 3I3GA 1TIQA 4PSXA 2PCUA 1LOKA 1AYEA 1YQEA 1LRZA 4PXDA 4R8FA 4UFWA 4XNHB 2AFUA 5F49A 4KOUA 4U9ZA 4UWIA 3WABA 4OMEA 2WYRA 4CGMA 1QSTA 4G1PA 4M85A 3S6HA 3H8EA 4NXYA 2PJ6A 5JQ4A 3IGRA 3VWDA 2K5TA 4II9A 5BWAB 2B4DB 3LACA 2PC1A 4CAVA 2BCOA 2P6EA 3EO4A 1NSAA 3SHPA 4CRZB 4BD9A 2AFWA 4FWUA 3W6XA 4R87A 2QECA 2D4PA 2FIWA 3E0KA 2Z3LA 2PE3A 4NEXA 4ZY0A 2DPSA 2VZZA 3CDXA 4J3GA 2IQ6A 4Q7AA 4BBHA 1F2PA 5JH9A 4XPLA 3DR8A 4FUUA 4P10A 3W6SA 1OZPA 3D68A 1LAPA 3H5ZA 1CP7A 4UEEA 3DSBA 4AXVA 2R98A 3D66A 2NYQA 3PB4X 1WWZA 1LCPA 1CP6A 3R9EA 2HC9A 4P4IA 2V77A 3B7IA 3B35A 1IYLA 3FECA 1YVOA 2CTBA 2JBJA 4UBRA 3V7ZA 4JZ0A 4U9YA 4UCPA 4XPKA 2VI7A 4K3NA 5ELYA 4A32A 3TFYA 4MFQA 2AJ6A 1MK4A 4OADA 1R57A 2DPTA 4YFJA 1QSRA 1XJOA 3KHZA 1XMBA 4O23A 1U6MA 1KUXA 4KLVA 4KUAA 5H86A 1I1DA 2YNEA 4TWEA 3GLJA 1TKFA 3KQXA 2QIRA 3PGPA 4NGNA 1IYKA 1KUVA 3WC5A 4A2ZA 2Q7SA 4CAWA 2Z3NA 4E8OA 4UFXA 1M4GA 5G1ZA 4A37A 4HNYB 4JJXA 3CZXA 4ZYQA 5J8FA 1Q7LA 2YNCA 3H8FA 3SI0A 4E2AA 3TOAA 2GLJA 4PQAA 4YU9A 4ORFA 4X3RA 4IK2A 3SXOA 2CIJA 1X10A 2OU2A 3BHXA 5K8PA 2ZEOA 4B14A 3KR5A 2NSMA 3HUVA 3VWEA 4C2ZA 5HXDA 3PEIA 1YGHA 3DNSA 3RO0A 2PJ8A 2CF4A 2FSRA 1CPSA 3L2NA 4GS4A 4YRHA 4RI1A 4OP4A 2Z3KA 1BOBA 4L89A 2BO9A 4QVTA 1IOFA 1CPXA 1FT7A 3PB7X 4IUSA 1VKCA 3T90A 3WC7A 4CAXA 2J8MA 3C26A 2Q04A 5F09A 4MHNA 5HVHA 4PPZA 2RB7A 2IL4A 4AVCA 2ZW4A 1GHEA 4MJ8A 2XEFA 2PJ4A 2ZEHA 5CBMA 2Z0ZA 1X12A 1YLOA 4R3KA 4NSQA 3FBUA 4M3SA 5HVGA 2BSWA 2VBQA 1AUGA 2B3VA 5F46A 3VARA 3KHXA 1QSOA 3W91A 2PR8A 3GYAA 1XRYA 5C88A 2AFMA 5CNPA 2BUEA 4C2XA 5I4MA 5A28A 1TKHA 2B4BA 3LD2A 2C27A 1P0HA 2J8RA 2RC4A 3WC6A 2F8HA 3KASA 1AMPA 3IEHA 3KKWA 4KOYA 4UA3A 2EWBA 2ZEFA 3ISXA 4LX9A 4PK3A 1NE9A 2F7VA 4NJRA 3BI1A 3JVNA 1Z4EA 3FF3A 4FD7A 4UFVA 1N71A 1XOVA 2F5IA 3B3VA 4MRIA 4MY3A 3SJFA 4ONUA 4EMEA 2HQYA 1MJBA 4F0YA 3KGQA 5LRJA 2OR4A 1S7LA 5I0CA 1PUAA 3D4UA 3GY9A 2B3UA 1YK3A 2DXQA 4M6GA 3S9NA 3B8GA 3D2PA 2Q7BA 5K8NA 4KLWA 4EVYA 4C7IA 2GE3A 2I79A 3I1UA 4MFZA 3QNVA 4NGMA 1HDUA 3FXTA 1CX8A 3EXNA 3QB8A 5LYLA 4B5PB 5F48A 1PCAA 2DF5A 1ZLHA 1CJWA 2REFA 3T9YA 1VHEA 2JLMA 4ZY2A 2QJ8A 4H89A 2EBJA 5IB0A 4X5KA 1Z5RA 1ON0A 2XEGA 1TXRA 1H8LA 4OC1A 3EY5A 4QB9A 4MFLA 1IIDA 1XBUA 4KORA 4CYQA 2FXFA 5HMNA 5LYFA 1RXTA 2B5GA 1KZFA 4F6AA 2OOTA 4R3LA 2VXKA 4R6TA 3PB8X 2FVGA 1DE4C 5CPAA 1S3ZA 2PJ9A 2ZEGA 5A27A 4MCQA 2G9DA 3P2FA 4C2YA 4OC5A 5KTAA 3K9UA 4JLYA 2A4NA 1MJ9A 1S60A 1OBRA 3PBEA 1Q2YA 4F9VA 3A9LA 1WK4A 4PXBA 4B5PA 5JGFA 3PB9X 3G8WA 4KUBA 1YW6A 4U5YA 2C6PA 3CPAA 1HDQA 1JWQA 4P4DA 1CM0A 4UCMA 1ZLIA 5DWMA 2VQYA 1Y7EA 4IHMA 4KVXA 3N5FA 3EC4A 4ZX9A 4OIDA 5LRGA 1IICA 3FH4A 5HH1A 3CXPA 3TCVA 4WWVA 4A33A 5D29A 1XMTA 4KS9A 4A95A 1Z2LA 2XEIA 3F5BA 3R95A 4OC4A 2R1IA 1M44A 2QMLA 2JBKA 4CGLA 2O53A 4M6IA 2BEIA 4KZTA 4JD6A 3IU2A 2Q4VA 1XF8A 5EBVA 4UF4A 4XPDC 2ZW7A 3PFOA 2FT0A 3FEEA 4MHDA 1ARMA 3GKRA 1QMUA 1ELLP 2ZOGA 1YLEA 4YWYA 1ZG7A 2EK9A 2PJ7A 4PXCA 3SJXA 2AFOA 3PZJA 2GREA 3PFEA 4P4EA 1I21A 2B58A 4EWTA 4PSWA 2Q51A 3KZWA 1TF9A 2CNSA 4CYOA 2X7BA 3IO1A 2ODFA 1KUYA 1Z8LA 2PDOA 2VEZA 3SI2A 4CGOA 1Z8WA 4KSFA 2GANA 5EMIA 1DTDA 5J8CA 1I12A 1Y0YA 2YGWA 4X2TA 5LRKA 4Q36A 1IY7A 1IGBA 1YSJA 5AG5A 6CPAA 1YREA 2AFSA 2WSAA 3TO7A 3PB6X 3IFEA 4H6UA 4A39A 4QBJA 4OC2A 1M1DA 3D7GA 3NA6A 4MFKA 2EK8A 4OIWA 4NGRA 4P45A 4FD5A 3TO6A 2PVVA 4R76A 3S6KA 4F0XA 1M4IA 3OWCA 1Z4RA 3FJUA 4HKFA 3RNZA 3D67A 1RO5A 4UIBA 2FS5A 2AFZA 2ZEEA 4ZBGA 3DR6A 4JXQA 3LMSA 3MGDA 3B2YA 3D7FA 1JQGA 4MHYA 2Z10A 1ELMP 3SJGA 4A30A 5ISVA 2IMOA 3HLPA 4CYPA 3BJ8A 2J9AA 2PJBA 2FE7A 3PBBA 4HPSA 2DEAA 2GFQA 4OLLA 4UWJA 1QSNA 1ZG8A 3SI1A 3FIXA 3TTHA 3GIUA 4DNCA 4MMOA 1KWMA 2CTCA 5LYIA 2PJ3A 2POKA 2PIZA 2IJZA 3CPXA 3H8GA 4K30A 5EC4A 5THWA 2JEWA 4FD4A 4KVOE 2ZW5A 2G3TA 2ZEPA 3FEDA 4MHPA 4UEFA 3GB0A 1L0CA 2C6CA 4M6HA 4PV6A 5IX3A 1Z9UA 5DWNA 4FD6A 2CY2A 3CXQA 4KOXA 5LYDA 4Z65A 5JM6A 7CPAA 3H4QA 2PIYA 2GIVA 1R3NA 4CAFA 4Y49C 2G3AA 5J1QA 3NH8A 4R57A 2CNMA 2CNTA 2EO8A 4OC3A 2PJ5A 2ZXVA 3S6FA 4AB7A 3TT2A 1VIXA 1BLLE 4KOTA 4CGNA 4P44A 1BAVA 3BJ7A 3JTKA 1Q2CA 4JWPA 2Y0MA 3S6GA 5AG6A 4RN7A 1UWYA 3TE4A 1B6BA 2NMTA 1LFWA 1XEBA 2ARHA 3LWUA 3NH4A 4GM5A 3T8WA 3TX8A 4CS0B 3DLJA 4A38A 3LODA 4IAVA 1XE4A 3IWWA 4TNUA 4CYNA 4DJLA 1RTQA 2PRBA 3ISZA 4OC0A 3IWGA 4HNWB 2PJAA 3EFAA 4UIAA 4DUKA 4KVME 2PRQA 5G20A 5K8OA 3V8IA 5C82A 2WZNA 1S7NA 1Z8XA 2B5GB 2OB0A 2D4OA 4QC6A 1YMEA 2R7HA 4MI4A 4P4BA 5JPHA 1Q2DA 3D2MA 1F57A 3QAYA 1S7FA 3KR4A 3PP9A 2ZPAA 1Y7RA 1Y9WA 3CT9A 4NGTA 3ZZIA 1Y9KA 3D8PA 1VGYA 1YW4A 4H6ZA 4MCRA 4UCNA 5E96A 2BL1A 2ZOFA 3TOBA 1BO4A 2V8DA 4DYOA 2R8VA 4AG7A 2EVNA 2ANPA 2JDDA 1S5KA 3IC1A 1XFOA 4W9YA 1NSLA 3FB3A 3NFZA 4MFJA 4LQGA 2OZHA 4NJQA 2HV2A 4OAEA 5F47A 4P4JA 2ZEMA 1GYTA 2ATRA 3R9FA 4R9MA 3FMCA 1YR0A 1HEEA 2ZENA 5AGEA 3K9TA 4QUSA 3RYOA 4C68A 1SQHA 2I3CA 2OZUA 5HVFA 4H2KA 4MCSA 3B3WA 1A2ZA 4MFPA 3KQZA 2RFHA 3MRUA 4MHZA 4KOWA 1NMTA 4WJBA 5K8MA 4JXRA 4YGOA 5KTDA 4IF5A 4EFDA 1EE3P 2V8GA 2VL1A 4RUHA 3IIBA 4B13A 4UEZA 2PQ8A 5AG7A 2Z3OA 1CG2A 4B6ZA 3I9SA 3B3SA 1P4NA 5GCNA 2P6FA 1ZO0A 2OH1A 4OKOA 1CBXA 4KOVA 2Z3MA 2WPXA 4PXEA 4CPAA 4MY0A 1Z8TA 2ABZA 4MBUA 4P6YA 4LUAA 4GXHA 1TKJA 2PJCA 3RBUA 2WUUA 3QAHA 2YNDA 4NGQA 3G3SA 4P4FA 4MXUA 3TC8A 2Q4ZA 3BI0A 4Y49B 3TO9A 4CRYB 2Q4YA 3FVLA 5DS0A 1LANA
chains in the Genus database with same CATH topology
2OZGA 4KOSA 4B12A 4B5OA 4L8AA 2H5MA 4AG9A 1M4DA 2FCKA 1UFHA 1S7KA 2G0BA 5H84A 1YX0A 2HUZA 2Z11A 1IB1E 2ZW6A 2REEA 1YVKA 1VHSA 3FNCA 1B87A 1XIXA 4C7HA 3N7ZA 2KCWA 2PSWA 3BLNA 4RS2A 2P0WA 2PR1A 2J8NA 3R9GA 3IWEA 3R96A 3CXSA 2CXAA 3SXNA 2JEVA 4B11A 3ZJ0A 4AVBA 1V0CA 4ZGYB 2YNCC 4XPDB 3F8KA 2EUIA 2FIAA 1FY7A 4BMHA 2I00A 2Z3PA 4NCZA 4B10A 1J4JA 2O28A 4PK2A 3NE7A 3FYNA 3D3SA 2P6GA 4I49A 1K4JA 1PU9A 4KSAA 4Q38A 4E0AA 4XNHC 3WR7A 2JDCA 2AE6A 4NF1A 2B4DA 3UY5A 3DDDA 1QSMA 2WPWA 2Q44A 4CGPA 3P2HA 3R1KA 1MJAA 3FRMA 2Q0YA 3JUWA 5G22A 4AVAA 5IV0A 4HNXB 3IU1A 2FL4A 2VZYA 5AG4A 4A31A 5G21A 3F0AA 5FVJA 4CAEA 5KTCA 3I3GA 1TIQA 4PSXA 4UFWA 1LRZA 4XNHB 5F49A 4KOUA 4U9ZA 4UWIA 4CGMA 1QSTA 4M85A 3S6HA 5JQ4A 4NXYA 4II9A 3IGRA 3VWDA 2K5TA 5BWAB 2B4DB 2PC1A 4CAVA 2P6EA 3EO4A 3SHPA 4CRZB 3W6XA 4R87A 2QECA 2D4PA 2FIWA 3E0KA 2Z3LA 4NEXA 2DPSA 2VZZA 4J3GA 4BBHA 4XPLA 3DR8A 3W6SA 1OZPA 3H5ZA 3DSBA 2R98A 1WWZA 3R9EA 1IYLA 1YVOA 4UBRA 4U9YA 4UCPA 4XPKA 2VI7A 4A32A 3TFYA 4MFQA 2AJ6A 1MK4A 4OADA 1R57A 2DPTA 4YFJA 1QSRA 1U6MA 1KUXA 4KLVA 4KUAA 5H86A 1I1DA 2YNEA 2QIRA 3PGPA 1IYKA 1KUVA 4A2ZA 4CAWA 2Z3NA 4E8OA 4UFXA 1M4GA 5G1ZA 4HNYB 4JJXA 5J8FA 2YNCA 4E2AA 3TOAA 4ORFA 3SXOA 2OU2A 4B14A 4C2ZA 3VWEA 1YGHA 3DNSA 2FSRA 4GS4A 4YRHA 4RI1A 2Z3KA 1BOBA 4L89A 4QVTA 3T90A 4CAXA 4IUSA 1VKCA 2J8MA 3C26A 2Q04A 2IL4A 4AVCA 2ZW4A 1GHEA 4MJ8A 2Z0ZA 4R3KA 4NSQA 3FBUA 4M3SA 2BSWA 2VBQA 2B3VA 5F46A 1QSOA 3W91A 2PR8A 3GYAA 5C88A 5CNPA 2BUEA 4C2XA 5A28A 3LD2A 2B4BA 2C27A 1P0HA 2J8RA 2RC4A 3KKWA 4KOYA 4UA3A 4LX9A 4PK3A 1NE9A 3JVNA 1Z4EA 4FD7A 4UFVA 1N71A 2F5IA 4MY3A 4ONUA 2HQYA 1MJBA 4F0YA 1S7LA 5I0CA 1PUAA 3GY9A 2B3UA 1YK3A 2DXQA 3B8GA 3D2PA 2Q7BA 4KLWA 4EVYA 4C7IA 2GE3A 2I79A 4MFZA 3FXTA 3EXNA 3QB8A 4B5PB 5F48A 1CJWA 2REFA 3T9YA 2JLMA 4H89A 5IB0A 4X5KA 1ON0A 4QB9A 3EY5A 4MFLA 1IIDA 4KORA 4CYQA 2FXFA 5HMNA 1RXTA 2B5GA 1KZFA 4F6AA 4R3LA 2VXKA 1S3ZA 3P2FA 4C2YA 5KTAA 3K9UA 4JLYA 2A4NA 1MJ9A 1S60A 1Q2YA 3A9LA 1WK4A 4B5PA 3G8WA 4KUBA 4U5YA 5DWMA 1CM0A 4UCMA 2VQYA 4KVXA 3EC4A 1IICA 5HH1A 3CXPA 3TCVA 4A33A 1XMTA 4KS9A 4A95A 3F5BA 3R95A 2R1IA 1M44A 2QMLA 4CGLA 2BEIA 4KZTA 4JD6A 3IU2A 2Q4VA 1XF8A 5EBVA 4XPDC 2ZW7A 4MHDA 2FT0A 3GKRA 1YLEA 3PZJA 1I21A 2B58A 4PSWA 2CNSA 4CYOA 2X7BA 1KUYA 2PDOA 2VEZA 4CGOA 4KSFA 2GANA 5J8CA 1I12A 2YGWA 4Q36A 5AG5A 1YREA 2WSAA 3TO7A 4H6UA 4QBJA 1M1DA 4MFKA 4FD5A 3TO6A 3S6KA 4F0XA 1M4IA 3OWCA 1Z4RA 4HKFA 1RO5A 2FS5A 4ZBGA 4JXQA 3DR6A 3MGDA 2Z10A 4A30A 5ISVA 4CYPA 3BJ8A 2FE7A 5A27A 4OLLA 4UWJA 1QSNA 3TTHA 4DNCA 3FIXA 4K30A 5EC4A 4FD4A 4KVOE 2ZW5A 2G3TA 1L0CA 4PV6A 5IX3A 1Z9UA 5DWNA 4FD6A 2CY2A 3CXQA 4KOXA 3H4QA 2GIVA 4CAFA 4Y49C 2G3AA 4R57A 2CNMA 2CNTA 3S6FA 2ZXVA 4AB7A 3TT2A 4KOTA 4CGNA 3BJ7A 3JTKA 1Q2CA 4JWPA 2Y0MA 3S6GA 5AG6A 3TE4A 1B6BA 2NMTA 1XEBA 2ARHA 4CS0B 3LODA 1XE4A 4CYNA 2PRBA 3IWGA 4HNWB 3EFAA 4KVME 5G20A 3V8IA 5C82A 1S7NA 2B5GB 2OB0A 2D4OA 4QC6A 2R7HA 4MI4A 5JPHA 1Q2DA 3D2MA 1S7FA 3PP9A 2ZPAA 1Y7RA 1Y9WA 3ZZIA 1Y9KA 3D8PA 4H6ZA 4UCNA 5E96A 3TOBA 2BL1A 1BO4A 2R8VA 4AG7A 2EVNA 2JDDA 1S5KA 1NSLA 3FB3A 4MFJA 2OZHA 2HV2A 4OAEA 5F47A 2ATRA 3R9FA 4R9MA 1YR0A 5AGEA 4QUSA 3RYOA 4C68A 1SQHA 2OZUA 4MFPA 4KOWA 1NMTA 4JXRA 4YGOA 5KTDA 4IF5A 4B13A 2PQ8A 5AG7A 2Z3OA 3I9SA 1P4NA 5GCNA 2P6FA 1ZO0A 2OH1A 4KOVA 2Z3MA 2WPXA 4MY0A 4MBUA 4LUAA 2WUUA 3QAHA 2YNDA 3G3SA 4Y49B 4CRYB 3TO9A 2Q4YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OZG A;  4KOS A;  4B5O A;  4L8A A;  2H5M A;  4AG9 A;  1M4D A;  2FCK A;  1UFH A;  1S7K A;  2G0B A;  5H84 A;  1YX0 A;  2HUZ A;  2Z11 A;  1IB1 E;  2ZW6 A;  2REE A;  1YVK A;  1VHS A;  3FNC A;  1B87 A;  1XIX A;  3N7Z A;  2KCW A;  2PSW A;  3BLN A;  4RS2 A;  2P0W A;  2PR1 A;  2J8N A;  3R9G A;  3R96 A;  3CXS A;  3SXN A;  2JEV A;  3ZJ0 A;  4AVB A;  1V0C A;  4XPD B;  3F8K A;  2EUI A;  2FIA A;  1FY7 A;  4BMH A;  2I00 A;  4NCZ A;  1J4J A;  2O28 A;  4PK2 A;  3NE7 A;  3FYN A;  3D3S A;  2P6G A;  4I49 A;  1K4J A;  1PU9 A;  4E0A A;  4XNH C;  3WR7 A;  2JDC A;  2AE6 A;  4NF1 A;  2B4D A;  3UY5 A;  3DDD A;  1QSM A;  2WPW A;  2Q44 A;  3P2H A;  3R1K A;  1MJA A;  3FRM A;  2Q0Y A;  3JUW A;  4AVA A;  5IV0 A;  4HNX B;  2FL4 A;  2VZY A;  3F0A A;  5FVJ A;  5KTC A;  3I3G A;  1TIQ A;  4PSX A;  1LRZ A;  4XNH B;  5F49 A;  4KOU A;  4U9Z A;  4UWI A;  1QST A;  4M85 A;  3S6H A;  5JQ4 A;  4NXY A;  4II9 A;  3IGR A;  3VWD A;  2K5T A;  2B4D B;  2PC1 A;  4CAV A;  2P6E A;  3EO4 A;  3SHP A;  4CRZ B;  3W6X A;  4R87 A;  2QEC A;  2D4P A;  2FIW A;  3E0K A;  4NEX A;  2VZZ A;  4J3G A;  4XPL A;  3DR8 A;  3W6S A;  1OZP A;  3DSB A;  2R98 A;  1WWZ A;  3R9E A;  1IYL A;  1YVO A;  4UBR A;  4U9Y A;  4XPK A;  2VI7 A;  3TFY A;  2AJ6 A;  1MK4 A;  4OAD A;  1R57 A;  4YFJ A;  1QSR A;  1U6M A;  1KUX A;  4KLV A;  4KUA A;  5H86 A;  1I1D A;  2QIR A;  3PGP A;  1IYK A;  1KUV A;  4CAW A;  4E8O A;  1M4G A;  4HNY B;  4JJX A;  5J8F A;  4E2A A;  3TOA A;  4ORF A;  3SXO A;  2OU2 A;  3VWE A;  1YGH A;  3DNS A;  2FSR A;  4GS4 A;  4YRH A;  4RI1 A;  1BOB A;  4L89 A;  4QVT A;  3T90 A;  4CAX A;  4IUS A;  1VKC A;  2J8M A;  3C26 A;  2Q04 A;  2IL4 A;  4AVC A;  2ZW4 A;  1GHE A;  4MJ8 A;  2Z0Z A;  4R3K A;  4NSQ A;  3FBU A;  4M3S A;  2BSW A;  2VBQ A;  2B3V A;  5F46 A;  1QSO A;  3W91 A;  2PR8 A;  3GYA A;  5C88 A;  5CNP A;  2BUE A;  3LD2 A;  2B4B A;  2C27 A;  1P0H A;  2J8R A;  2RC4 A;  3KKW A;  4KOY A;  4UA3 A;  4LX9 A;  4PK3 A;  1NE9 A;  3JVN A;  1Z4E A;  4FD7 A;  1N71 A;  2F5I A;  4MY3 A;  4ONU A;  2HQY A;  1MJB A;  4F0Y A;  1S7L A;  5I0C A;  1PUA A;  3GY9 A;  2B3U A;  1YK3 A;  2DXQ A;  3B8G A;  3D2P A;  2Q7B A;  4KLW A;  4EVY A;  2GE3 A;  2I79 A;  3FXT A;  3EXN A;  3QB8 A;  4B5P B;  5F48 A;  1CJW A;  2REF A;  3T9Y A;  2JLM A;  4H89 A;  5IB0 A;  4X5K A;  1ON0 A;  4QB9 A;  3EY5 A;  1IID A;  4KOR A;  2FXF A;  5HMN A;  1RXT A;  2B5G A;  1KZF A;  4F6A A;  4R3L A;  2VXK A;  1S3Z A;  3P2F A;  5KTA A;  3K9U A;  4JLY A;  2A4N A;  1MJ9 A;  1S60 A;  1Q2Y A;  1WK4 A;  4B5P A;  3G8W A;  4KUB A;  4U5Y A;  5DWM A;  1CM0 A;  2VQY A;  4KVX A;  3EC4 A;  1IIC A;  5HH1 A;  3CXP A;  3TCV A;  1XMT A;  3F5B A;  3R95 A;  2R1I A;  1M44 A;  2QML A;  2BEI A;  4KZT A;  4JD6 A;  5EBV A;  2Q4V A;  1XF8 A;  4XPD C;  2ZW7 A;  4MHD A;  2FT0 A;  3GKR A;  1YLE A;  3PZJ A;  1I21 A;  2B58 A;  4PSW A;  2CNS A;  2X7B A;  1KUY A;  2PDO A;  2VEZ A;  2GAN A;  5J8C A;  1I12 A;  1YRE A;  3TO7 A;  4H6U A;  4QBJ A;  1M1D A;  4FD5 A;  3TO6 A;  3S6K A;  1M4I A;  3OWC A;  1Z4R A;  4HKF A;  1RO5 A;  2FS5 A;  4ZBG A;  4JXQ A;  3DR6 A;  3MGD A;  2Z10 A;  5ISV A;  3BJ8 A;  2FE7 A;  4OLL A;  4UWJ A;  1QSN A;  3TTH A;  4DNC A;  3FIX A;  4K30 A;  5EC4 A;  4FD4 A;  4KVO E;  2ZW5 A;  2G3T A;  1L0C A;  4PV6 A;  5IX3 A;  1Z9U A;  5DWN A;  4FD6 A;  2CY2 A;  3CXQ A;  4KOX A;  3H4Q A;  2GIV A;  4Y49 C;  2G3A A;  4R57 A;  2CNM A;  2CNT A;  3S6F A;  2ZXV A;  4AB7 A;  3TT2 A;  4KOT A;  3BJ7 A;  4JWP A;  1Q2C A;  2Y0M A;  3S6G A;  3TE4 A;  1B6B A;  2NMT A;  1XEB A;  2ARH A;  4CS0 B;  3LOD A;  1XE4 A;  2PRB A;  3IWG A;  4HNW B;  3EFA A;  4KVM E;  3V8I A;  5C82 A;  1S7N A;  2B5G B;  2OB0 A;  2D4O A;  4QC6 A;  2R7H A;  4MI4 A;  5JPH A;  1Q2D A;  3D2M A;  1S7F A;  3PP9 A;  2ZPA A;  1Y7R A;  1Y9W A;  3ZZI A;  1Y9K A;  3D8P A;  4H6Z A;  5E96 A;  3TOB A;  2BL1 A;  1BO4 A;  2R8V A;  4AG7 A;  2EVN A;  2JDD A;  1S5K A;  1NSL A;  3FB3 A;  2OZH A;  2HV2 A;  4OAE A;  5F47 A;  2ATR A;  3R9F A;  4R9M A;  1YR0 A;  4QUS A;  3RYO A;  1SQH A;  2OZU A;  4KOW A;  1NMT A;  4JXR A;  4YGO A;  5KTD A;  4IF5 A;  2PQ8 A;  3I9S A;  1P4N A;  5GCN A;  2P6F A;  2OH1 A;  4KOV A;  2WPX A;  4MY0 A;  4MBU A;  4LUA A;  3QAH A;  3G3S A;  4Y49 B;  4CRY B;  3TO9 A;  2Q4Y A; 
#chains in the Genus database with same CATH topology
 2OZG A;  4KOS A;  4B12 A;  1TF8 A;  4L8A A;  2H5M A;  4AG9 A;  4B5O A;  1M4D A;  4LQ6 A;  2FCK A;  1UFH A;  1S7K A;  2G0B A;  2C6G A;  5H84 A;  3RZA A;  8CPA A;  1YX0 A;  2HUZ A;  2Z11 A;  4NFR A;  1IB1 E;  1IOI A;  2ZW6 A;  3SJE A;  2REE A;  5D8N A;  4A94 A;  1YVK A;  1VHS A;  3KI9 A;  1PYT B;  3FNC A;  3B3T A;  2QYV A;  1B87 A;  1XIX A;  2V8V A;  4F8Z A;  4C7H A;  3N7Z A;  3JRU A;  3S9M A;  2C1C A;  2XEJ A;  2KCW A;  2PSW A;  3BLN A;  4RS2 A;  2P0W A;  2PR1 A;  3VH9 A;  2J8N A;  3NH5 A;  3R9G A;  1BPM A;  3IWE A;  3R96 A;  4ZY1 A;  3CXS A;  2CXA A;  3SXN A;  2JEV A;  4B11 A;  3ZJ0 A;  4AVB A;  1V0C A;  2AFX A;  4ZGY B;  2YNC C;  1R43 A;  4XPD B;  2ZEL A;  1ARL A;  2EUI A;  1FY7 A;  1FNO A;  2FIA A;  3DGV A;  3F8K A;  3PRT A;  4BMH A;  4MCP A;  2I00 A;  2PVW A;  2V8H A;  3D7H A;  1QQ9 A;  2Z3P A;  3V38 A;  4BIN A;  4FAI A;  3NE8 A;  1ZG9 A;  2BOA A;  2PJ0 A;  4NCZ A;  4B10 A;  1J4J A;  2O28 A;  3B3C A;  3WT4 A;  4PK2 A;  3NE7 A;  3FYN A;  1IU8 A;  3D3S A;  2P6G A;  3K2K A;  4R7M A;  2GLF A;  3BXM A;  4I49 A;  1K4J A;  1PU9 A;  4KSA A;  1Y0R A;  4Q38 A;  2PJ2 A;  4E0A A;  1BPN A;  4XNH C;  3S9L A;  3WR7 A;  2JDC A;  2O4H A;  3KL9 A;  3MN8 A;  4NGS A;  4X8I A;  2AE6 A;  4NF1 A;  2B4D A;  3UY5 A;  3DDD A;  1QSM A;  2WPW A;  2GU2 A;  2Q44 A;  3IJ3 A;  3VAT A;  4NGP A;  5IB9 A;  3D7D A;  4CGP A;  1LAM A;  4ZX8 A;  4ONW A;  3P2H A;  4FBE A;  3R1K A;  1MJA A;  3FRM A;  3RAM A;  1F2O A;  2Q0Y A;  2ZED A;  3JUW A;  2HB6 A;  4KSI A;  5G22 A;  4AVA A;  5IV0 A;  4F9U A;  4HNX B;  3IU1 A;  2FL4 A;  2VZY A;  5AG4 A;  2QVP A;  4A31 A;  2Q43 A;  5G21 A;  3GUX A;  1M4L A;  4JYW A;  3F0A A;  1VHO A;  2PJ1 A;  3FX6 A;  5FVJ A;  4CAE A;  4ZI6 A;  5KTC A;  3I3G A;  1TIQ A;  4PSX A;  2PCU A;  1LOK A;  1AYE A;  1YQE A;  1LRZ A;  4PXD A;  4R8F A;  4UFW A;  4XNH B;  2AFU A;  5F49 A;  4KOU A;  4U9Z A;  4UWI A;  3WAB A;  4OME A;  2WYR A;  4CGM A;  1QST A;  4G1P A;  4M85 A;  3S6H A;  3H8E A;  4NXY A;  2PJ6 A;  5JQ4 A;  3IGR A;  3VWD A;  2K5T A;  4II9 A;  5BWA B;  2B4D B;  3LAC A;  2PC1 A;  4CAV A;  2BCO A;  2P6E A;  3EO4 A;  1NSA A;  3SHP A;  4CRZ B;  4BD9 A;  2AFW A;  4FWU A;  3W6X A;  4R87 A;  2QEC A;  2D4P A;  2FIW A;  3E0K A;  2Z3L A;  2PE3 A;  4NEX A;  4ZY0 A;  2DPS A;  2VZZ A;  3CDX A;  4J3G A;  2IQ6 A;  4Q7A A;  4BBH A;  1F2P A;  5JH9 A;  4XPL A;  3DR8 A;  4FUU A;  4P10 A;  3W6S A;  1OZP A;  3D68 A;  1LAP A;  3H5Z A;  1CP7 A;  4UEE A;  3DSB A;  4AXV A;  2R98 A;  3D66 A;  2NYQ A;  3PB4 X;  1WWZ A;  1LCP A;  1CP6 A;  3R9E A;  2HC9 A;  4P4I A;  2V77 A;  3B7I A;  3B35 A;  1IYL A;  3FEC A;  1YVO A;  2CTB A;  2JBJ A;  4UBR A;  3V7Z A;  4JZ0 A;  4U9Y A;  4UCP A;  4XPK A;  2VI7 A;  4K3N A;  5ELY A;  4A32 A;  3TFY A;  4MFQ A;  2AJ6 A;  1MK4 A;  4OAD A;  1R57 A;  2DPT A;  4YFJ A;  1QSR A;  1XJO A;  3KHZ A;  1XMB A;  4O23 A;  1U6M A;  1KUX A;  4KLV A;  4KUA A;  5H86 A;  1I1D A;  2YNE A;  4TWE A;  3GLJ A;  1TKF A;  3KQX A;  2QIR A;  3PGP A;  4NGN A;  1IYK A;  1KUV A;  3WC5 A;  4A2Z A;  2Q7S A;  4CAW A;  2Z3N A;  4E8O A;  4UFX A;  1M4G A;  5G1Z A;  4A37 A;  4HNY B;  4JJX A;  3CZX A;  4ZYQ A;  5J8F A;  1Q7L A;  2YNC A;  3H8F A;  3SI0 A;  4E2A A;  3TOA A;  2GLJ A;  4PQA A;  4YU9 A;  4ORF A;  4X3R A;  4IK2 A;  3SXO A;  2CIJ A;  1X10 A;  2OU2 A;  3BHX A;  5K8P A;  2ZEO A;  4B14 A;  3KR5 A;  2NSM A;  3HUV A;  3VWE A;  4C2Z A;  5HXD A;  3PEI A;  1YGH A;  3DNS A;  3RO0 A;  2PJ8 A;  2CF4 A;  2FSR A;  1CPS A;  3L2N A;  4GS4 A;  4YRH A;  4RI1 A;  4OP4 A;  2Z3K A;  1BOB A;  4L89 A;  2BO9 A;  4QVT A;  1IOF A;  1CPX A;  1FT7 A;  3PB7 X;  4IUS A;  1VKC A;  3T90 A;  3WC7 A;  4CAX A;  2J8M A;  3C26 A;  2Q04 A;  5F09 A;  4MHN A;  5HVH A;  4PPZ A;  2RB7 A;  2IL4 A;  4AVC A;  2ZW4 A;  1GHE A;  4MJ8 A;  2XEF A;  2PJ4 A;  2ZEH A;  5CBM A;  2Z0Z A;  1X12 A;  1YLO A;  4R3K A;  4NSQ A;  3FBU A;  4M3S A;  5HVG A;  2BSW A;  2VBQ A;  1AUG A;  2B3V A;  5F46 A;  3VAR A;  3KHX A;  1QSO A;  3W91 A;  2PR8 A;  3GYA A;  1XRY A;  5C88 A;  2AFM A;  5CNP A;  2BUE A;  4C2X A;  5I4M A;  5A28 A;  1TKH A;  2B4B A;  3LD2 A;  2C27 A;  1P0H A;  2J8R A;  2RC4 A;  3WC6 A;  2F8H A;  3KAS A;  1AMP A;  3IEH A;  3KKW A;  4KOY A;  4UA3 A;  2EWB A;  2ZEF A;  3ISX A;  4LX9 A;  4PK3 A;  1NE9 A;  2F7V A;  4NJR A;  3BI1 A;  3JVN A;  1Z4E A;  3FF3 A;  4FD7 A;  4UFV A;  1N71 A;  1XOV A;  2F5I A;  3B3V A;  4MRI A;  4MY3 A;  3SJF A;  4ONU A;  4EME A;  2HQY A;  1MJB A;  4F0Y A;  3KGQ A;  5LRJ A;  2OR4 A;  1S7L A;  5I0C A;  1PUA A;  3D4U A;  3GY9 A;  2B3U A;  1YK3 A;  2DXQ A;  4M6G A;  3S9N A;  3B8G A;  3D2P A;  2Q7B A;  5K8N A;  4KLW A;  4EVY A;  4C7I A;  2GE3 A;  2I79 A;  3I1U A;  4MFZ A;  3QNV A;  4NGM A;  1HDU A;  3FXT A;  1CX8 A;  3EXN A;  3QB8 A;  5LYL A;  4B5P B;  5F48 A;  1PCA A;  2DF5 A;  1ZLH A;  1CJW A;  2REF A;  3T9Y A;  1VHE A;  2JLM A;  4ZY2 A;  2QJ8 A;  4H89 A;  2EBJ A;  5IB0 A;  4X5K A;  1Z5R A;  1ON0 A;  2XEG A;  1TXR A;  1H8L A;  4OC1 A;  3EY5 A;  4QB9 A;  4MFL A;  1IID A;  1XBU A;  4KOR A;  4CYQ A;  2FXF A;  5HMN A;  5LYF A;  1RXT A;  2B5G A;  1KZF A;  4F6A A;  2OOT A;  4R3L A;  2VXK A;  4R6T A;  3PB8 X;  2FVG A;  1DE4 C;  5CPA A;  1S3Z A;  2PJ9 A;  2ZEG A;  5A27 A;  4MCQ A;  2G9D A;  3P2F A;  4C2Y A;  4OC5 A;  5KTA A;  3K9U A;  4JLY A;  2A4N A;  1MJ9 A;  1S60 A;  1OBR A;  3PBE A;  1Q2Y A;  4F9V A;  3A9L A;  1WK4 A;  4PXB A;  4B5P A;  5JGF A;  3PB9 X;  3G8W A;  4KUB A;  1YW6 A;  4U5Y A;  2C6P A;  3CPA A;  1HDQ A;  1JWQ A;  4P4D A;  1CM0 A;  4UCM A;  1ZLI A;  5DWM A;  2VQY A;  1Y7E A;  4IHM A;  4KVX A;  3N5F A;  3EC4 A;  4ZX9 A;  4OID A;  5LRG A;  1IIC A;  3FH4 A;  5HH1 A;  3CXP A;  3TCV A;  4WWV A;  4A33 A;  5D29 A;  1XMT A;  4KS9 A;  4A95 A;  1Z2L A;  2XEI A;  3F5B A;  3R95 A;  4OC4 A;  2R1I A;  1M44 A;  2QML A;  2JBK A;  4CGL A;  2O53 A;  4M6I A;  2BEI A;  4KZT A;  4JD6 A;  3IU2 A;  2Q4V A;  1XF8 A;  5EBV A;  4UF4 A;  4XPD C;  2ZW7 A;  3PFO A;  2FT0 A;  3FEE A;  4MHD A;  1ARM A;  3GKR A;  1QMU A;  1ELL P;  2ZOG A;  1YLE A;  4YWY A;  1ZG7 A;  2EK9 A;  2PJ7 A;  4PXC A;  3SJX A;  2AFO A;  3PZJ A;  2GRE A;  3PFE A;  4P4E A;  1I21 A;  2B58 A;  4EWT A;  4PSW A;  2Q51 A;  3KZW A;  1TF9 A;  2CNS A;  4CYO A;  2X7B A;  3IO1 A;  2ODF A;  1KUY A;  1Z8L A;  2PDO A;  2VEZ A;  3SI2 A;  4CGO A;  1Z8W A;  4KSF A;  2GAN A;  5EMI A;  1DTD A;  5J8C A;  1I12 A;  1Y0Y A;  2YGW A;  4X2T A;  5LRK A;  4Q36 A;  1IY7 A;  1IGB A;  1YSJ A;  5AG5 A;  6CPA A;  1YRE A;  2AFS A;  2WSA A;  3TO7 A;  3PB6 X;  3IFE A;  4H6U A;  4A39 A;  4QBJ A;  4OC2 A;  1M1D A;  3D7G A;  3NA6 A;  4MFK A;  2EK8 A;  4OIW A;  4NGR A;  4P45 A;  4FD5 A;  3TO6 A;  2PVV A;  4R76 A;  3S6K A;  4F0X A;  1M4I A;  3OWC A;  1Z4R A;  3FJU A;  4HKF A;  3RNZ A;  3D67 A;  1RO5 A;  4UIB A;  2FS5 A;  2AFZ A;  2ZEE A;  4ZBG A;  3DR6 A;  4JXQ A;  3LMS A;  3MGD A;  3B2Y A;  3D7F A;  1JQG A;  4MHY A;  2Z10 A;  1ELM P;  3SJG A;  4A30 A;  5ISV A;  2IMO A;  3HLP A;  4CYP A;  3BJ8 A;  2J9A A;  2PJB A;  2FE7 A;  3PBB A;  4HPS A;  2DEA A;  2GFQ A;  4OLL A;  4UWJ A;  1QSN A;  1ZG8 A;  3SI1 A;  3FIX A;  3TTH A;  3GIU A;  4DNC A;  4MMO A;  1KWM A;  2CTC A;  5LYI A;  2PJ3 A;  2POK A;  2PIZ A;  2IJZ A;  3CPX A;  3H8G A;  4K30 A;  5EC4 A;  5THW A;  2JEW A;  4FD4 A;  4KVO E;  2ZW5 A;  2G3T A;  2ZEP A;  3FED A;  4MHP A;  4UEF A;  3GB0 A;  1L0C A;  2C6C A;  4M6H A;  4PV6 A;  5IX3 A;  1Z9U A;  5DWN A;  4FD6 A;  2CY2 A;  3CXQ A;  4KOX A;  5LYD A;  4Z65 A;  5JM6 A;  7CPA A;  3H4Q A;  2PIY A;  2GIV A;  1R3N A;  4CAF A;  4Y49 C;  2G3A A;  5J1Q A;  3NH8 A;  4R57 A;  2CNM A;  2CNT A;  2EO8 A;  4OC3 A;  2PJ5 A;  2ZXV A;  3S6F A;  4AB7 A;  3TT2 A;  1VIX A;  1BLL E;  4KOT A;  4CGN A;  4P44 A;  1BAV A;  3BJ7 A;  3JTK A;  1Q2C A;  4JWP A;  2Y0M A;  3S6G A;  5AG6 A;  4RN7 A;  1UWY A;  3TE4 A;  1B6B A;  2NMT A;  1LFW A;  1XEB A;  2ARH A;  3LWU A;  3NH4 A;  4GM5 A;  3T8W A;  3TX8 A;  4CS0 B;  3DLJ A;  4A38 A;  3LOD A;  4IAV A;  1XE4 A;  3IWW A;  4TNU A;  4CYN A;  4DJL A;  1RTQ A;  2PRB A;  3ISZ A;  4OC0 A;  3IWG A;  4HNW B;  2PJA A;  3EFA A;  4UIA A;  4DUK A;  4KVM E;  2PRQ A;  5G20 A;  5K8O A;  3V8I A;  5C82 A;  2WZN A;  1S7N A;  1Z8X A;  2B5G B;  2OB0 A;  2D4O A;  4QC6 A;  1YME A;  2R7H A;  4MI4 A;  4P4B A;  5JPH A;  1Q2D A;  3D2M A;  1F57 A;  3QAY A;  1S7F A;  3KR4 A;  3PP9 A;  2ZPA A;  1Y7R A;  1Y9W A;  3CT9 A;  4NGT A;  3ZZI A;  1Y9K A;  3D8P A;  1VGY A;  1YW4 A;  4H6Z A;  4MCR A;  4UCN A;  5E96 A;  2BL1 A;  2ZOF A;  3TOB A;  1BO4 A;  2V8D A;  4DYO A;  2R8V A;  4AG7 A;  2EVN A;  2ANP A;  2JDD A;  1S5K A;  3IC1 A;  1XFO A;  4W9Y A;  1NSL A;  3FB3 A;  3NFZ A;  4MFJ A;  4LQG A;  2OZH A;  4NJQ A;  2HV2 A;  4OAE A;  5F47 A;  4P4J A;  2ZEM A;  1GYT A;  2ATR A;  3R9F A;  4R9M A;  3FMC A;  1YR0 A;  1HEE A;  2ZEN A;  5AGE A;  3K9T A;  4QUS A;  3RYO A;  4C68 A;  1SQH A;  2I3C A;  2OZU A;  5HVF A;  4H2K A;  4MCS A;  3B3W A;  1A2Z A;  4MFP A;  3KQZ A;  2RFH A;  3MRU A;  4MHZ A;  4KOW A;  1NMT A;  4WJB A;  5K8M A;  4JXR A;  4YGO A;  5KTD A;  4IF5 A;  4EFD A;  1EE3 P;  2V8G A;  2VL1 A;  4RUH A;  3IIB A;  4B13 A;  4UEZ A;  2PQ8 A;  5AG7 A;  2Z3O A;  1CG2 A;  4B6Z A;  3I9S A;  3B3S A;  1P4N A;  5GCN A;  2P6F A;  1ZO0 A;  2OH1 A;  4OKO A;  1CBX A;  4KOV A;  2Z3M A;  2WPX A;  4PXE A;  4CPA A;  4MY0 A;  1Z8T A;  2ABZ A;  4MBU A;  4P6Y A;  4LUA A;  4GXH A;  1TKJ A;  2PJC A;  3RBU A;  2WUU A;  3QAH A;  2YND A;  4NGQ A;  3G3S A;  4P4F A;  4MXU A;  3TC8 A;  2Q4Z A;  3BI0 A;  4Y49 B;  3TO9 A;  4CRY B;  2Q4Y A;  3FVL A;  5DS0 A;  1LAN A; 
#chains in the Genus database with same CATH homology
 2OZG A;  4KOS A;  4B12 A;  4B5O A;  4L8A A;  2H5M A;  4AG9 A;  1M4D A;  2FCK A;  1UFH A;  1S7K A;  2G0B A;  5H84 A;  1YX0 A;  2HUZ A;  2Z11 A;  1IB1 E;  2ZW6 A;  2REE A;  1YVK A;  1VHS A;  3FNC A;  1B87 A;  1XIX A;  4C7H A;  3N7Z A;  2KCW A;  2PSW A;  3BLN A;  4RS2 A;  2P0W A;  2PR1 A;  2J8N A;  3R9G A;  3IWE A;  3R96 A;  3CXS A;  2CXA A;  3SXN A;  2JEV A;  4B11 A;  3ZJ0 A;  4AVB A;  1V0C A;  4ZGY B;  2YNC C;  4XPD B;  3F8K A;  2EUI A;  2FIA A;  1FY7 A;  4BMH A;  2I00 A;  2Z3P A;  4NCZ A;  4B10 A;  1J4J A;  2O28 A;  4PK2 A;  3NE7 A;  3FYN A;  3D3S A;  2P6G A;  4I49 A;  1K4J A;  1PU9 A;  4KSA A;  4Q38 A;  4E0A A;  4XNH C;  3WR7 A;  2JDC A;  2AE6 A;  4NF1 A;  2B4D A;  3UY5 A;  3DDD A;  1QSM A;  2WPW A;  2Q44 A;  4CGP A;  3P2H A;  3R1K A;  1MJA A;  3FRM A;  2Q0Y A;  3JUW A;  5G22 A;  4AVA A;  5IV0 A;  4HNX B;  3IU1 A;  2FL4 A;  2VZY A;  5AG4 A;  4A31 A;  5G21 A;  3F0A A;  5FVJ A;  4CAE A;  5KTC A;  3I3G A;  1TIQ A;  4PSX A;  4UFW A;  1LRZ A;  4XNH B;  5F49 A;  4KOU A;  4U9Z A;  4UWI A;  4CGM A;  1QST A;  4M85 A;  3S6H A;  5JQ4 A;  4NXY A;  4II9 A;  3IGR A;  3VWD A;  2K5T A;  5BWA B;  2B4D B;  2PC1 A;  4CAV A;  2P6E A;  3EO4 A;  3SHP A;  4CRZ B;  3W6X A;  4R87 A;  2QEC A;  2D4P A;  2FIW A;  3E0K A;  2Z3L A;  4NEX A;  2DPS A;  2VZZ A;  4J3G A;  4BBH A;  4XPL A;  3DR8 A;  3W6S A;  1OZP A;  3H5Z A;  3DSB A;  2R98 A;  1WWZ A;  3R9E A;  1IYL A;  1YVO A;  4UBR A;  4U9Y A;  4UCP A;  4XPK A;  2VI7 A;  4A32 A;  3TFY A;  4MFQ A;  2AJ6 A;  1MK4 A;  4OAD A;  1R57 A;  2DPT A;  4YFJ A;  1QSR A;  1U6M A;  1KUX A;  4KLV A;  4KUA A;  5H86 A;  1I1D A;  2YNE A;  2QIR A;  3PGP A;  1IYK A;  1KUV A;  4A2Z A;  4CAW A;  2Z3N A;  4E8O A;  4UFX A;  1M4G A;  5G1Z A;  4HNY B;  4JJX A;  5J8F A;  2YNC A;  4E2A A;  3TOA A;  4ORF A;  3SXO A;  2OU2 A;  4B14 A;  4C2Z A;  3VWE A;  1YGH A;  3DNS A;  2FSR A;  4GS4 A;  4YRH A;  4RI1 A;  2Z3K A;  1BOB A;  4L89 A;  4QVT A;  3T90 A;  4CAX A;  4IUS A;  1VKC A;  2J8M A;  3C26 A;  2Q04 A;  2IL4 A;  4AVC A;  2ZW4 A;  1GHE A;  4MJ8 A;  2Z0Z A;  4R3K A;  4NSQ A;  3FBU A;  4M3S A;  2BSW A;  2VBQ A;  2B3V A;  5F46 A;  1QSO A;  3W91 A;  2PR8 A;  3GYA A;  5C88 A;  5CNP A;  2BUE A;  4C2X A;  5A28 A;  3LD2 A;  2B4B A;  2C27 A;  1P0H A;  2J8R A;  2RC4 A;  3KKW A;  4KOY A;  4UA3 A;  4LX9 A;  4PK3 A;  1NE9 A;  3JVN A;  1Z4E A;  4FD7 A;  4UFV A;  1N71 A;  2F5I A;  4MY3 A;  4ONU A;  2HQY A;  1MJB A;  4F0Y A;  1S7L A;  5I0C A;  1PUA A;  3GY9 A;  2B3U A;  1YK3 A;  2DXQ A;  3B8G A;  3D2P A;  2Q7B A;  4KLW A;  4EVY A;  4C7I A;  2GE3 A;  2I79 A;  4MFZ A;  3FXT A;  3EXN A;  3QB8 A;  4B5P B;  5F48 A;  1CJW A;  2REF A;  3T9Y A;  2JLM A;  4H89 A;  5IB0 A;  4X5K A;  1ON0 A;  4QB9 A;  3EY5 A;  4MFL A;  1IID A;  4KOR A;  4CYQ A;  2FXF A;  5HMN A;  1RXT A;  2B5G A;  1KZF A;  4F6A A;  4R3L A;  2VXK A;  1S3Z A;  3P2F A;  4C2Y A;  5KTA A;  3K9U A;  4JLY A;  2A4N A;  1MJ9 A;  1S60 A;  1Q2Y A;  3A9L A;  1WK4 A;  4B5P A;  3G8W A;  4KUB A;  4U5Y A;  5DWM A;  1CM0 A;  4UCM A;  2VQY A;  4KVX A;  3EC4 A;  1IIC A;  5HH1 A;  3CXP A;  3TCV A;  4A33 A;  1XMT A;  4KS9 A;  4A95 A;  3F5B A;  3R95 A;  2R1I A;  1M44 A;  2QML A;  4CGL A;  2BEI A;  4KZT A;  4JD6 A;  3IU2 A;  2Q4V A;  1XF8 A;  5EBV A;  4XPD C;  2ZW7 A;  4MHD A;  2FT0 A;  3GKR A;  1YLE A;  3PZJ A;  1I21 A;  2B58 A;  4PSW A;  2CNS A;  4CYO A;  2X7B A;  1KUY A;  2PDO A;  2VEZ A;  4CGO A;  4KSF A;  2GAN A;  5J8C A;  1I12 A;  2YGW A;  4Q36 A;  5AG5 A;  1YRE A;  2WSA A;  3TO7 A;  4H6U A;  4QBJ A;  1M1D A;  4MFK A;  4FD5 A;  3TO6 A;  3S6K A;  4F0X A;  1M4I A;  3OWC A;  1Z4R A;  4HKF A;  1RO5 A;  2FS5 A;  4ZBG A;  4JXQ A;  3DR6 A;  3MGD A;  2Z10 A;  4A30 A;  5ISV A;  4CYP A;  3BJ8 A;  2FE7 A;  5A27 A;  4OLL A;  4UWJ A;  1QSN A;  3TTH A;  4DNC A;  3FIX A;  4K30 A;  5EC4 A;  4FD4 A;  4KVO E;  2ZW5 A;  2G3T A;  1L0C A;  4PV6 A;  5IX3 A;  1Z9U A;  5DWN A;  4FD6 A;  2CY2 A;  3CXQ A;  4KOX A;  3H4Q A;  2GIV A;  4CAF A;  4Y49 C;  2G3A A;  4R57 A;  2CNM A;  2CNT A;  3S6F A;  2ZXV A;  4AB7 A;  3TT2 A;  4KOT A;  4CGN A;  3BJ7 A;  3JTK A;  1Q2C A;  4JWP A;  2Y0M A;  3S6G A;  5AG6 A;  3TE4 A;  1B6B A;  2NMT A;  1XEB A;  2ARH A;  4CS0 B;  3LOD A;  1XE4 A;  4CYN A;  2PRB A;  3IWG A;  4HNW B;  3EFA A;  4KVM E;  5G20 A;  3V8I A;  5C82 A;  1S7N A;  2B5G B;  2OB0 A;  2D4O A;  4QC6 A;  2R7H A;  4MI4 A;  5JPH A;  1Q2D A;  3D2M A;  1S7F A;  3PP9 A;  2ZPA A;  1Y7R A;  1Y9W A;  3ZZI A;  1Y9K A;  3D8P A;  4H6Z A;  4UCN A;  5E96 A;  3TOB A;  2BL1 A;  1BO4 A;  2R8V A;  4AG7 A;  2EVN A;  2JDD A;  1S5K A;  1NSL A;  3FB3 A;  4MFJ A;  2OZH A;  2HV2 A;  4OAE A;  5F47 A;  2ATR A;  3R9F A;  4R9M A;  1YR0 A;  5AGE A;  4QUS A;  3RYO A;  4C68 A;  1SQH A;  2OZU A;  4MFP A;  4KOW A;  1NMT A;  4JXR A;  4YGO A;  5KTD A;  4IF5 A;  4B13 A;  2PQ8 A;  5AG7 A;  2Z3O A;  3I9S A;  1P4N A;  5GCN A;  2P6F A;  1ZO0 A;  2OH1 A;  4KOV A;  2Z3M A;  2WPX A;  4MY0 A;  4MBU A;  4LUA A;  2WUU A;  3QAH A;  2YND A;  3G3S A;  4Y49 B;  4CRY B;  3TO9 A;  2Q4Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...