2PC1A

Crystal structure of acetyltransferase gnat family (np_688560.1) from streptococcus agalactiae 2603 at 1.28 a resolution
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
173
structure length
173
Chain Sequence
NLYFQGMQIRLAFPNEIDQIMLLIEEARAEIAKTGSDQWQKEDGYPNRNDIIDDILNGYAWVGIEDGMLATYAAVIDGHEEVYDAIYEGKWLHDNHRYLTFHRIAISNQFRGRGLAQTFLQGLIEGHKGPDFRCDTHEKNVTMQHILNKLGYQYCGKVPLDGVRLAYQKIKEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Acetyltransferase, GNAT family
publication title Crystal structure of acetyltransferase GNAT family (NP_688560.1) from Streptococcus agalactiae 2603 at 1.28 A resolution
rcsb
source organism Streptococcus agalactiae 2603v/r
molecule tags Transferase
total genus 55
structure length 173
sequence length 173
ec nomenclature ec 2.3.1.-:
pdb deposition date 2007-03-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 2pc1A00
2ZW4A 4RS2A 1YR0A 4RI1A 2GIVA 1YX0A 4E0AA 3T90A 4PK2A 3DNSA 1S60A 4IUSA 4XPLA 4KOVA 3LODA 1KUVA 1S3ZA 4XPKA 2JEVA 3F0AA 2ZW7A 5GCNA 5HH1A 4H6ZA 1PUAA 2FL4A 4AG7A 2OU2A 3ZZIA 2EUIA 4NCZA 3VWEA 4ONUA 3QB8A 4H89A 2OH1A 1QSNA 4M3SA 4R57A 4R9MA 5F49A 3TOAA 1VKCA 2ZPAA 2Z11A 3I9SA 2R8VA 2I00A 2P0WA 5DWMA 2B4BA 4FD4A 3R9GA 2G3AA 2FIWA 5F48A 4JLYA 3DSBA 4MI4A 1KUYA 4CRZB 4PSWA 4CAWA 3N7ZA 2VBQA 5KTDA 2R1IA 4AVCA 4QUSA 3DDDA 3S6HA 2A4NA 1YREA 1UFHA 4LUAA 3SXOA 3SHPA 1WK4A 2EVNA 4MHDA 5C82A 2JLMA 1Q2DA 2FIAA 4I49A 4DNCA 2FT0A 5EC4A 3TO6A 1KUXA 4YRHA 4CAXA 4CRYB 2PC1A 1CJWA 4UWIA 4ORFA 2J8NA 4MJ8A 4NSQA 3TTHA 4R87A 4QBJA 2ZW6A 2B4DB 1XIXA 4UA3A 1YGHA 3S6GA 4L89A 3JVNA 4FD7A 2Z10A 3EY5A 3UY5A 4OLLA 2QIRA 4FD6A 2G0BA 3W6XA 1RXTA 3CXSA 5C88A 4JD6A 1L0CA 1MJBA 1XEBA 1Z4EA 4JXRA 2PSWA 3TT2A 5I0CA 4U5YA 1S7NA 4XNHB 3TO7A 3FYNA 2JDCA 4UBRA 2B3UA 2Q7BA 1K4JA 1V0CA 1NE9A 2REEA 2X7BA 4K30A 4U9ZA 3R96A 2ARHA 4OADA 4JWPA 1RO5A 4Y49B 2B5GB 1M4GA 4QC6A 4AG9A 4X5KA 1MK4A 2GANA 4OAEA 3OWCA 3F8KA 4XPDB 1NSLA 3DR8A 2H5MA 3ZJ0A 1Y7RA 5FVJA 2PR8A 4GS4A 3CXQA 4NEXA 1IICA 1QSTA 3F5BA 4KOXA 4E8OA 2OZUA 4XNHC 1J4JA 2HQYA 1PU9A 4AVAA 2PDOA 2CNMA 1BO4A 5J8FA 3C26A 1MJ9A 2AJ6A 3TO9A 4IF5A 5ISVA 3G8WA 3FRMA 4KVOE 1M1DA 2P6EA 4B5PB 1GHEA 2VXKA 3R95A 1SQHA 3I3GA 4HNXB 1QSRA 2CNTA 4HNYB 4Y49C 2AE6A 4NXYA 4MY0A 3V8IA 1Z4RA 2RC4A 3VWDA 3H4QA 4XPDC 1IYKA 1YVOA 5H84A 3D8PA 1I1DA 4QVTA 2B4DA 3FB3A 3K9UA 2B58A 4L8AA 2JDDA 3S6FA 4JJXA 1U6MA 4PK3A 4BMHA 3JUWA 3W6SA 4KOYA 4M85A 1N71A 1YVKA 3S6KA 2Q0YA 4KLVA 1B87A 2R7HA 3D2PA 1YLEA 3TOBA 3MGDA 4HKFA 2VZZA 4YFJA 5F46A 1IYLA 2CY2A 1Y9KA 1Y9WA 4JXQA 2QECA 3EFAA 3PGPA 2K5TA 3PZJA 2WPXA 1ON0A 2QMLA 5KTAA 5H86A 1S7KA 4R3KA 3EO4A 3BJ8A 2FCKA 3BJ7A 2PR1A 1VHSA 5HMNA 3FXTA 1I21A 2CNSA 3R9EA 2VQYA 4E2AA 2D4OA 2VZYA 2FS5A 2PQ8A 4MBUA 1P0HA 3IWGA 2HUZA 5IX3A 2OZGA 2NMTA 2REFA 2VI7A 3KKWA 3GKRA 4MY3A 4F0YA 3QAHA 4H6UA 2Q44A 2C27A 3P2FA 2PRBA 1S5KA 1NMTA 4YGOA 5E96A 4II9A 5KTCA 4FD5A 2BUEA 3D3SA 1XF8A 2KCWA 4KOTA 2DXQA 4B5PA 5J8CA 5IB0A 4UWJA 2IL4A 1TIQA 3BLNA 5JPHA 2Q04A 3FIXA 4B5OA 3FBUA 2FXFA 2GE3A 1MJAA 3PP9A 1I12A 3R1KA 4CS0B 1QSOA 3EXNA 5EBVA 4AB7A 4KOWA 1Z9UA 2BSWA 2P6GA 3IGRA 1M44A 4F6AA 4KOUA 5DWNA 2D4PA 1FY7A 4EVYA 1B6BA 1BOBA 3D2MA 5CNPA 2G3TA 4KORA 4J3GA 1M4DA 2Y0MA 2OB0A 2I79A 1QSMA 2O28A 1R57A 3RYOA 1Q2CA 4KZTA 1YK3A 2BL1A 3GY9A 1S7FA 2Q4YA 3G3SA 3NE7A 3TFYA 2HV2A 4QB9A 1P4NA 1OZPA 1XE4A 2BEIA 4KLWA 2WPWA 1S7LA 4HNWB 2OZHA 3W91A 1XMTA 3P2HA 2ATRA 3SXNA 2F5IA 1KZFA 3E0KA 1M4IA 2J8MA 3TE4A 5JQ4A 4ZBGA 4PV6A 2J8RA 2R98A 3T9YA 3B8GA 2FSRA 3FNCA 2B3VA 4R3LA 4KOSA 4LX9A 1WWZA 4NF1A 2B5GA 1LRZA 4U9YA 2P6FA 3LD2A 4KVXA 4PSXA 4CAVA 3EC4A 5IV0A 1IB1E 3DR6A 4KUAA 3R9FA 1CM0A 2ZXVA 1IIDA 3TCVA 2ZW5A 4AVBA 2VEZA 1Q2YA 4KVME 2FE7A 5F47A 2Z0ZA 3GYAA 3CXPA 3WR7A 4KUBA 2Q4VA
chains in the Genus database with same CATH superfamily
2ZOGA 2F7VA 2ZEMA 3LWUA 1XOVA 2ZW4A 4RS2A 2PCUA 4MXUA 4P4FA 1YR0A 4YWYA 2V77A 1HEEA 1Y0RA 4RI1A 3T8WA 2GIVA 4MHNA 4CYQA 1YX0A 1HDUA 1TXRA 2YNCC 4C7IA 2PIYA 2I3CA 4A39A 4ZI6A 3DLJA 4E0AA 1XMBA 3QNVA 3T90A 4PK2A 4TWEA 3DNSA 3JRUA 4M6HA 1S60A 4JYWA 4IUSA 4XPLA 4KOVA 3LODA 4OC4A 1KUVA 1S3ZA 4XPKA 3SJEA 2JEVA 1AUGA 2ZW7A 3F0AA 3FEDA 5GCNA 4CGPA 1XBUA 4MCQA 4A33A 4O23A 3PFEA 4UCNA 4A37A 5HH1A 4H6ZA 1IY7A 4CGLA 4MCRA 1ZLHA 3I1UA 4UEZA 5DS0A 4M6IA 1PUAA 1Y0YA 3RZAA 2FL4A 1CPSA 2PJ3A 4P4EA 1Y7EA 4AG7A 2OU2A 3ZZIA 4PXBA 1AYEA 1VIXA 2EUIA 4NCZA 4NGTA 1YW6A 3VWEA 3CT9A 4ONUA 4BD9A 3GLJA 3QB8A 4P4JA 2C1CA 2XEJA 2OH1A 4H89A 4P44A 5IB9A 1QSNA 4M3SA 4R57A 3IEHA 4R9MA 5F49A 3TOAA 1VKCA 1ZG7A 2ZPAA 1JWQA 2Z11A 3I9SA 5LRGA 2R8VA 2I00A 2P0WA 5DWMA 5G21A 2ANPA 2B4BA 2NYQA 4FD4A 3WC5A 4DUKA 3R9GA 2G3AA 4FAIA 2FIWA 5F48A 1ZG8A 5G22A 2BO9A 4JLYA 3DSBA 3WC7A 4MI4A 1KUYA 2YNEA 4CRZB 4PSWA 4CAWA 1PCAA 3IC1A 4FUUA 4UCMA 5K8OA 3N7ZA 5CBMA 1CP7A 2VBQA 5KTDA 2R1IA 4AVCA 4MFKA 1TKFA 5AGEA 4A38A 4ZX9A 4UFWA 2OOTA 2V8VA 1TKHA 4QUSA 5EMIA 1F2OA 3DDDA 4CGMA 1LAPA 3CDXA 3L2NA 2EBJA 2YNCA 4B6ZA 3S6HA 2A4NA 1YREA 1UFHA 4LUAA 3SXOA 3SHPA 1WK4A 2EVNA 4MHDA 5C82A 2JLMA 2EO8A 3A9LA 3KL9A 1F2PA 1Q2DA 2GU2A 2Z3LA 5LYDA 2FIAA 4P4IA 4I49A 5A28A 8CPAA 2Q4ZA 3KQXA 4DNCA 2FT0A 1AMPA 5HVGA 5EC4A 3VATA 4C2YA 3TO6A 3IFEA 4FWUA 1KUXA 4YRHA 4CAXA 2Z3MA 4CRYB 1UWYA 2PC1A 5D8NA 1CJWA 5LRKA 4HPSA 2WUUA 4UWIA 4CGOA 2XEIA 1YLOA 2ZEHA 4ORFA 1TKJA 4B13A 1H8LA 2J8NA 2HB6A 4MJ8A 4NSQA 3TTHA 4R87A 4B12A 4QBJA 1ZLIA 2DPSA 2O53A 4NGSA 3HLPA 2ZW6A 2B4DB 4MMOA 4C2XA 2ZEDA 1XIXA 3K2KA 4UA3A 4A31A 1YGHA 1BPNA 3S6GA 2GLJA 4L89A 3JVNA 4FD7A 1IOIA 1GYTA 4UFXA 1Q7LA 2Z10A 4UEFA 3EY5A 5G20A 5LYLA 3UY5A 3D67A 2Q51A 2EWBA 4PQAA 1Z8TA 4OLLA 3B3TA 2QIRA 4FD6A 2G0BA 4CAFA 5AG6A 2PJAA 2GLFA 2CIJA 3W6XA 1CG2A 1RXTA 1TF8A 3CXSA 4NFRA 5C88A 4JD6A 1L0CA 1MJBA 1XEBA 1Z4EA 4JXRA 2AFZA 3PB7X 4P6YA 5LRJA 2PSWA 3TT2A 5I0CA 4U5YA 3FF3A 3VARA 1S7NA 1X12A 1FT7A 4XNHB 3PRTA 4Q36A 4A2ZA 3TO7A 2QYVA 3FYNA 2JDCA 4UBRA 2B3UA 3GB0A 2Q7BA 3S9MA 1DTDA 3B35A 3IU1A 4MRIA 4A94A 4UIAA 4MHPA 1K4JA 1NSAA 2AFWA 3MN8A 3V38A 2PVVA 1V0CA 4NGNA 1NE9A 2QJ8A 2REEA 2X7BA 4K30A 4MHYA 1BAVA 2ARHA 4MHZA 4U9ZA 4ZX8A 3R96A 4PXCA 5HXDA 2AFSA 1LFWA 4JWPA 4OADA 5JH9A 1RO5A 4Y49B 2B5GB 4UEEA 2IJZA 1M4GA 4QC6A 4AG9A 3SI1A 4R6TA 4X5KA 1MK4A 4OC0A 2GANA 4OAEA 3OWCA 3F8KA 4XPDB 1NSLA 3DR8A 3FJUA 1Z8WA 2AFOA 4PXDA 4DYOA 3S9NA 4MCPA 4IAVA 3V7ZA 3D4UA 2C6GA 2H5MA 3SJGA 2Z3KA 2IQ6A 3ZJ0A 1Y7RA 2O4HA 4MFZA 5J1QA 5FVJA 2PR8A 3NH5A 1TF9A 4KSAA 4GS4A 3CZXA 3CXQA 2JEWA 4NEXA 4MFPA 4DJLA 2PJ2A 3KZWA 1IICA 4OP4A 1IGBA 3D7DA 1QSTA 3F5BA 4KOXA 4CAEA 4E8OA 1HDQA 2OZUA 2VL1A 4XNHC 2RFHA 1J4JA 2HQYA 1PU9A 4AVAA 1LAMA 2PDOA 2CNMA 3KR4A 4ZYQA 1BO4A 4PPZA 4X2TA 2PJBA 2ODFA 1MJ9A 2AJ6A 3C26A 3NFZA 5J8FA 1VHOA 2AFXA 4R8FA 3TO9A 4CPAA 4IF5A 1XRYA 3G8WA 2Z3PA 4OIDA 5ISVA 3FRMA 4KVOE 1M1DA 2P6EA 5JM6A 4NGRA 4B5PB 3GUXA 1GHEA 4CYOA 2EK9A 2VXKA 3R95A 1SQHA 3I3GA 4KSIA 2JBKA 4HNXB 1QSRA 2ZEPA 4OIWA 2CNTA 2RB7A 4HNYB 4P4BA 4Y49C 2AE6A 1ARLA 4MY0A 4NXYA 2DF5A 3RBUA 3V8IA 3H8GA 5AG7A 3GIUA 4A30A 1Z4RA 3LMSA 2RC4A 3KASA 3VWDA 3PFOA 2C6PA 4X3RA 4R7MA 5LYFA 2GFQA 3H4QA 4XPDC 3SI0A 1IYKA 3B3SA 4ZGYB 1YVOA 5H84A 3D8PA 4MFLA 1I1DA 1LOKA 4QVTA 1A2ZA 4ONWA 4FBEA 2B4DA 3FB3A 4ZY0A 3CPXA 3NA6A 3K9UA 2B58A 4L8AA 4P10A 2JDDA 4M6GA 3S6FA 4OC1A 3FVLA 3HUVA 4JJXA 1CX8A 4BBHA 1U6MA 3MRUA 4PK3A 4C7HA 4BMHA 2ABZA 2IMOA 3JUWA 1Z8XA 3W6SA 4KOYA 1YQEA 2XEFA 4M85A 2CF4A 1N71A 1YVKA 5BWAB 3S6KA 2Q0YA 4KLVA 1B87A 2R7HA 3B3CA 3D2PA 4NJRA 1YLEA 2Z3NA 3TOBA 3MGDA 4OC5A 4HKFA 2VZZA 4YFJA 3IWWA 3D66A 1CPXA 3D7GA 3TC8A 5F46A 4CYPA 1IYLA 5CPAA 2CY2A 1Y9KA 3IWEA 1Y9WA 4MFJA 4JXQA 1ZO0A 4UFVA 4R76A 5A27A 3WC6A 4ZY2A 1DE4C 2DPTA 2PIZA 2QECA 2POKA 3EFAA 3PGPA 2K5TA 2AFMA 3WABA 3PZJA 4G1PA 1BPMA 2WPXA 4IK2A 1ON0A 2QMLA 5KTAA 5H86A 1S7KA 4RUHA 2PJ0A 4A95A 4CYNA 1R43A 4GXHA 4R3KA 6CPAA 3EO4A 4BINA 2PJ1A 3BJ8A 3TX8A 2FCKA 3NH4A 5K8NA 3BJ7A 2PR1A 3ISZA 1VHSA 2PJ4A 5HMNA 3FXTA 3SJFA 1I21A 1YMEA 1Z2LA 3H5ZA 4NGPA 2CNSA 3R9EA 2VQYA 4E2AA 2D4OA 3CPAA 2VZYA 1IOFA 3IU2A 3KI9A 2FS5A 4WWVA 4JZ0A 2PQ8A 4MBUA 1P0HA 3IJ3A 3IWGA 2HUZA 3B7IA 2OZGA 3FMCA 5IX3A 2NMTA 2NSMA 4CGNA 2REFA 2VI7A 3KKWA 3GKRA 4MY3A 4F0YA 3QAHA 1EE3P 4H6UA 2Q44A 4C2ZA 2J9AA 2C27A 3B3WA 2PJCA 2PRBA 3P2FA 1S5KA 1NMTA 2ZENA 4YGOA 5E96A 1VGYA 1Z5RA 4II9A 3D68A 4OC3A 5KTCA 1OBRA 4FD5A 2BUEA 3D3SA 1ELMP 1XF8A 1RTQA 1LCPA 2KCWA 2V8GA 4KOTA 2DXQA 2HC9A 3KR5A 2BOAA 4B5PA 5HVHA 5J8CA 5IB0A 3PB6X 3KQZA 1YW4A 4UWJA 3BXMA 2IL4A 5K8PA 4MCSA 3IIBA 1TIQA 3BLNA 5JPHA 5D29A 1KWMA 3DGVA 2Q04A 1R3NA 4F9VA 2FVGA 2PE3A 3FIXA 4B5OA 2V8HA 3FBUA 2Q7SA 4Q38A 2FXFA 2GE3A 1MJAA 3PP9A 4UCPA 1XJOA 1I12A 3IO1A 1CP6A 3R1KA 4NGQA 1QSOA 4UIBA 4CS0B 3EXNA 5EBVA 4AB7A 5JGFA 3B3VA 4KOWA 1Z9UA 2BSWA 4ZY1A 1PYTB 2YNDA 4YU9A 2OR4A 2P6GA 3FX6A 3IGRA 5F09A 1M44A 4F6AA 3QAYA 4KOUA 5DWNA 5AG5A 2D4PA 4F0XA 4P45A 1FY7A 3JTKA 3RAMA 4OMEA 4EVYA 2XEGA 3D7HA 1B6BA 2GREA 4AXVA 1BOBA 3D2MA 5CNPA 3VH9A 5I4MA 2G3TA 2C6CA 2ZEOA 4KORA 3K9TA 1IU8A 3D7FA 1CBXA 4J3GA 1M4DA 2Y0MA 4EWTA 3PBBA 4F9UA 2OB0A 2I79A 1QSMA 2O28A 4OC2A 1ARMA 1R57A 3RYOA 1Q2CA 3BI0A 4KZTA 4C68A 5G1ZA 3NH8A 4MFQA 3B2YA 2PJ7A 5LYIA 1Z8LA 2PJ9A 1YK3A 2BL1A 3GY9A 3WT4A 2G9DA 5AG4A 3ISXA 3LACA 1S7FA 4KS9A 2Q4YA 3G3SA 4B11A 3SJXA 3NE7A 5HVFA 3TFYA 4LQ6A 2HV2A 2DEAA 1FNOA 2WZNA 4QB9A 1P4NA 4W9YA 2ZEFA 3FH4A 2ZEGA 4H2KA 1M4LA 1OZPA 1XE4A 2BEIA 2PRQA 2WPWA 3FEEA 4KLWA 1S7LA 2PJ6A 2OZHA 4HNWB 3PEIA 2JBJA 4NGMA 3W91A 2ZOFA 4Q7AA 1XMTA 3P2HA 2CTCA 2ATRA 1X10A 2PVWA 1QQ9A 3SXNA 2F8HA 2F5IA 1KZFA 2WSAA 3E0KA 1M4IA 2CXAA 2J8MA 3TE4A 5JQ4A 4ZBGA 4PV6A 2WYRA 2J8RA 1XFOA 4A32A 2R98A 4Z65A 3T9YA 3B8GA 1LANA 4WJBA 4GM5A 5ELYA 5THWA 2FSRA 3FNCA 2YGWA 2B3VA 4IHMA 4R3LA 7CPAA 2CTBA 4KOSA 2AFUA 3FECA 1BLLE 1QMUA 4LX9A 3N5FA 5K8MA 4LQGA 1WWZA 1ELLP 4NF1A 2B5GA 1ZG9A 4OKOA 2Z3OA 3S9LA 1LRZA 2PJ8A 3KHXA 4U9YA 3NE8A 3H8FA 3KGQA 2P6FA 3BHXA 3LD2A 3PB8X 4KVXA 3PB9X 4PSXA 4CAVA 4K3NA 3EC4A 4EFDA 5IV0A 1IB1E 3DR6A 1JQGA 4KUAA 4EMEA 3R9FA 3BI1A 1CM0A 1F57A 3RO0A 2ZXVA 4PXEA 2Q43A 3PBEA 1IIDA 3TCVA 4B10A 2ZW5A 2QVPA 2ZELA 4UF4A 4AVBA 4B14A 4F8ZA 4TNUA 3PB4X 3KHZA 2VEZA 2BCOA 1Q2YA 4KVME 3H8EA 2V8DA 2FE7A 5F47A 3SI2A 2Z0ZA 3GYAA 2ZEEA 3RNZA 1YSJA 2EK8A 3CXPA 3WR7A 4P4DA 1VHEA 2PJ5A 4RN7A 4NJQA 4KUBA 4KSFA 4X8IA 2Q4VA
chains in the Genus database with same CATH topology
2ZW4A 4RS2A 1YR0A 4RI1A 2GIVA 4CYQA 1YX0A 2YNCC 4C7IA 4E0AA 3T90A 4PK2A 3DNSA 1S60A 4IUSA 4XPLA 4KOVA 3LODA 1KUVA 1S3ZA 4XPKA 4CGPA 2JEVA 3F0AA 2ZW7A 5GCNA 4A33A 4UCNA 5HH1A 4H6ZA 4CGLA 1PUAA 2FL4A 4AG7A 2OU2A 3ZZIA 2EUIA 4NCZA 3VWEA 4ONUA 3QB8A 4H89A 2OH1A 1QSNA 4M3SA 4R57A 4R9MA 5F49A 3TOAA 1VKCA 2ZPAA 2Z11A 3I9SA 2R8VA 2I00A 2P0WA 5DWMA 5G21A 2B4BA 4FD4A 3R9GA 2G3AA 2FIWA 5F48A 5G22A 4JLYA 3DSBA 4MI4A 1KUYA 2YNEA 4CRZB 4PSWA 4CAWA 4UCMA 3N7ZA 2VBQA 5KTDA 2R1IA 4AVCA 4MFKA 5AGEA 4UFWA 4QUSA 3DDDA 4CGMA 2YNCA 3S6HA 2A4NA 1YREA 1UFHA 4LUAA 3SXOA 3SHPA 1WK4A 2EVNA 4MHDA 5C82A 2JLMA 3A9LA 1Q2DA 2Z3LA 2FIAA 4I49A 5A28A 4DNCA 2FT0A 5EC4A 4C2YA 3TO6A 1KUXA 4YRHA 4CAXA 2Z3MA 4CRYB 2PC1A 1CJWA 4UWIA 2WUUA 4CGOA 4ORFA 4B13A 2J8NA 4MJ8A 4NSQA 3TTHA 4B12A 4R87A 4QBJA 2DPSA 2ZW6A 2B4DB 4C2XA 1XIXA 4UA3A 4A31A 1YGHA 3S6GA 4L89A 3JVNA 4FD7A 4UFXA 2Z10A 3EY5A 5G20A 3UY5A 4OLLA 2QIRA 4FD6A 2G0BA 4CAFA 5AG6A 3W6XA 1RXTA 3CXSA 5C88A 4JD6A 1L0CA 1MJBA 1XEBA 1Z4EA 4JXRA 2PSWA 3TT2A 5I0CA 4U5YA 1S7NA 4XNHB 4Q36A 4A2ZA 3TO7A 3FYNA 2JDCA 4UBRA 2B3UA 2Q7BA 3IU1A 1K4JA 1V0CA 1NE9A 2REEA 2X7BA 4K30A 4U9ZA 3R96A 2ARHA 4OADA 4JWPA 1RO5A 4Y49B 2B5GB 1M4GA 4QC6A 4AG9A 4X5KA 1MK4A 2GANA 4OAEA 3OWCA 3F8KA 4XPDB 1NSLA 3DR8A 2H5MA 2Z3KA 3ZJ0A 1Y7RA 4MFZA 5FVJA 2PR8A 4KSAA 4GS4A 3CXQA 4NEXA 4MFPA 1IICA 1QSTA 3F5BA 4KOXA 4CAEA 4E8OA 2OZUA 4XNHC 1J4JA 2HQYA 1PU9A 4AVAA 2PDOA 2CNMA 1BO4A 5J8FA 3C26A 1MJ9A 2AJ6A 3TO9A 4IF5A 5ISVA 3G8WA 2Z3PA 3FRMA 4KVOE 1M1DA 2P6EA 4B5PB 1GHEA 4CYOA 2VXKA 3R95A 1SQHA 3I3GA 4HNXB 1QSRA 2CNTA 4HNYB 4Y49C 2AE6A 4NXYA 4MY0A 3V8IA 5AG7A 4A30A 1Z4RA 2RC4A 3VWDA 3H4QA 4XPDC 1IYKA 4ZGYB 1YVOA 5H84A 3D8PA 4MFLA 1I1DA 4QVTA 2B4DA 3FB3A 3K9UA 2B58A 4L8AA 2JDDA 3S6FA 4JJXA 4BBHA 4C7HA 1U6MA 4PK3A 4BMHA 3JUWA 3W6SA 4KOYA 4M85A 5BWAB 1N71A 1YVKA 3S6KA 2Q0YA 4KLVA 1B87A 2R7HA 3D2PA 1YLEA 2Z3NA 3TOBA 3MGDA 4HKFA 2VZZA 4YFJA 5F46A 4CYPA 1IYLA 2CY2A 1Y9KA 3IWEA 1Y9WA 4MFJA 4JXQA 1ZO0A 4UFVA 5A27A 2DPTA 2QECA 3EFAA 3PGPA 2K5TA 3PZJA 2WPXA 1ON0A 2QMLA 5KTAA 5H86A 1S7KA 4A95A 4CYNA 4R3KA 3EO4A 3BJ8A 2FCKA 3BJ7A 2PR1A 1VHSA 5HMNA 3FXTA 1I21A 3H5ZA 2CNSA 3R9EA 2VQYA 4E2AA 2D4OA 2VZYA 3IU2A 2FS5A 2PQ8A 4MBUA 1P0HA 3IWGA 2HUZA 5IX3A 2OZGA 2NMTA 4CGNA 2REFA 2VI7A 3KKWA 3GKRA 4MY3A 4F0YA 3QAHA 4H6UA 2Q44A 4C2ZA 2C27A 3P2FA 2PRBA 1S5KA 1NMTA 4YGOA 5E96A 4II9A 5KTCA 4FD5A 2BUEA 3D3SA 1XF8A 2KCWA 4KOTA 2DXQA 4B5PA 5J8CA 5IB0A 4UWJA 2IL4A 1TIQA 3BLNA 5JPHA 2Q04A 3FIXA 4B5OA 3FBUA 4Q38A 2FXFA 2GE3A 1MJAA 3PP9A 4UCPA 1I12A 3R1KA 4CS0B 1QSOA 3EXNA 5EBVA 4AB7A 4KOWA 1Z9UA 2BSWA 2YNDA 2P6GA 3IGRA 1M44A 4F6AA 4KOUA 5DWNA 4F0XA 2D4PA 1FY7A 3JTKA 4EVYA 1B6BA 1BOBA 3D2MA 5CNPA 2G3TA 4KORA 4J3GA 1M4DA 2Y0MA 2OB0A 2I79A 1QSMA 2O28A 1R57A 3RYOA 1Q2CA 4KZTA 4C68A 5G1ZA 4MFQA 1YK3A 2BL1A 3GY9A 5AG4A 1S7FA 4KS9A 2Q4YA 3G3SA 4B11A 3NE7A 3TFYA 2HV2A 4QB9A 1P4NA 5AG5A 1OZPA 1XE4A 2BEIA 4KLWA 2WPWA 1S7LA 4HNWB 2OZHA 3W91A 1XMTA 3P2HA 2ATRA 3SXNA 2F5IA 1KZFA 2WSAA 3E0KA 1M4IA 2CXAA 2J8MA 3TE4A 5JQ4A 4ZBGA 4PV6A 2J8RA 4A32A 2R98A 3T9YA 3B8GA 2FSRA 3FNCA 2YGWA 2B3VA 4R3LA 4KOSA 4LX9A 1WWZA 4NF1A 2B5GA 2Z3OA 1LRZA 4U9YA 2P6FA 3LD2A 4KVXA 4PSXA 4CAVA 3EC4A 5IV0A 1IB1E 3DR6A 4KUAA 3R9FA 1CM0A 2ZXVA 1IIDA 3TCVA 4B10A 2ZW5A 4AVBA 4B14A 2VEZA 1Q2YA 4KVME 2FE7A 5F47A 2Z0ZA 3GYAA 3CXPA 3WR7A 4KUBA 4KSFA 2Q4VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZW4 A;  4RS2 A;  1YR0 A;  4RI1 A;  2GIV A;  1YX0 A;  4E0A A;  3T90 A;  4PK2 A;  3DNS A;  1S60 A;  4IUS A;  4XPL A;  4KOV A;  3LOD A;  1KUV A;  1S3Z A;  4XPK A;  2JEV A;  3F0A A;  2ZW7 A;  5GCN A;  5HH1 A;  4H6Z A;  1PUA A;  2FL4 A;  4AG7 A;  2OU2 A;  3ZZI A;  2EUI A;  4NCZ A;  3VWE A;  4ONU A;  3QB8 A;  4H89 A;  2OH1 A;  1QSN A;  4M3S A;  4R57 A;  4R9M A;  5F49 A;  3TOA A;  1VKC A;  2ZPA A;  2Z11 A;  3I9S A;  2R8V A;  2I00 A;  2P0W A;  5DWM A;  2B4B A;  4FD4 A;  3R9G A;  2G3A A;  2FIW A;  5F48 A;  4JLY A;  3DSB A;  4MI4 A;  1KUY A;  4CRZ B;  4PSW A;  4CAW A;  3N7Z A;  2VBQ A;  5KTD A;  2R1I A;  4AVC A;  4QUS A;  3DDD A;  3S6H A;  2A4N A;  1YRE A;  1UFH A;  4LUA A;  3SXO A;  3SHP A;  1WK4 A;  2EVN A;  4MHD A;  5C82 A;  2JLM A;  1Q2D A;  2FIA A;  4I49 A;  4DNC A;  2FT0 A;  5EC4 A;  3TO6 A;  1KUX A;  4YRH A;  4CAX A;  4CRY B;  2PC1 A;  1CJW A;  4UWI A;  4ORF A;  2J8N A;  4MJ8 A;  4NSQ A;  3TTH A;  4R87 A;  4QBJ A;  2ZW6 A;  2B4D B;  1XIX A;  4UA3 A;  1YGH A;  3S6G A;  4L89 A;  3JVN A;  4FD7 A;  2Z10 A;  3EY5 A;  3UY5 A;  4OLL A;  2QIR A;  4FD6 A;  2G0B A;  3W6X A;  1RXT A;  3CXS A;  5C88 A;  4JD6 A;  1L0C A;  1MJB A;  1XEB A;  1Z4E A;  4JXR A;  2PSW A;  3TT2 A;  5I0C A;  4U5Y A;  1S7N A;  4XNH B;  3TO7 A;  3FYN A;  2JDC A;  4UBR A;  2B3U A;  2Q7B A;  1K4J A;  1V0C A;  1NE9 A;  2REE A;  2X7B A;  4K30 A;  4U9Z A;  3R96 A;  2ARH A;  4OAD A;  4JWP A;  1RO5 A;  4Y49 B;  2B5G B;  1M4G A;  4QC6 A;  4AG9 A;  4X5K A;  1MK4 A;  2GAN A;  4OAE A;  3OWC A;  3F8K A;  4XPD B;  1NSL A;  3DR8 A;  2H5M A;  3ZJ0 A;  1Y7R A;  5FVJ A;  2PR8 A;  4GS4 A;  3CXQ A;  4NEX A;  1IIC A;  1QST A;  3F5B A;  4KOX A;  4E8O A;  2OZU A;  4XNH C;  1J4J A;  2HQY A;  1PU9 A;  4AVA A;  2PDO A;  2CNM A;  1BO4 A;  5J8F A;  3C26 A;  1MJ9 A;  2AJ6 A;  3TO9 A;  4IF5 A;  5ISV A;  3G8W A;  3FRM A;  4KVO E;  1M1D A;  2P6E A;  4B5P B;  1GHE A;  2VXK A;  3R95 A;  1SQH A;  3I3G A;  4HNX B;  1QSR A;  2CNT A;  4HNY B;  4Y49 C;  2AE6 A;  4NXY A;  4MY0 A;  3V8I A;  1Z4R A;  2RC4 A;  3VWD A;  3H4Q A;  4XPD C;  1IYK A;  1YVO A;  5H84 A;  3D8P A;  1I1D A;  4QVT A;  2B4D A;  3FB3 A;  3K9U A;  2B58 A;  4L8A A;  2JDD A;  3S6F A;  4JJX A;  1U6M A;  4PK3 A;  4BMH A;  3JUW A;  3W6S A;  4KOY A;  4M85 A;  1N71 A;  1YVK A;  3S6K A;  2Q0Y A;  4KLV A;  1B87 A;  2R7H A;  3D2P A;  1YLE A;  3TOB A;  3MGD A;  4HKF A;  2VZZ A;  4YFJ A;  5F46 A;  1IYL A;  2CY2 A;  1Y9K A;  1Y9W A;  4JXQ A;  2QEC A;  3EFA A;  3PGP A;  2K5T A;  3PZJ A;  2WPX A;  1ON0 A;  2QML A;  5KTA A;  5H86 A;  1S7K A;  4R3K A;  3EO4 A;  3BJ8 A;  2FCK A;  3BJ7 A;  2PR1 A;  1VHS A;  5HMN A;  3FXT A;  1I21 A;  2CNS A;  3R9E A;  2VQY A;  4E2A A;  2D4O A;  2VZY A;  2FS5 A;  2PQ8 A;  4MBU A;  1P0H A;  3IWG A;  2HUZ A;  5IX3 A;  2OZG A;  2NMT A;  2REF A;  2VI7 A;  3KKW A;  3GKR A;  4MY3 A;  4F0Y A;  3QAH A;  4H6U A;  2Q44 A;  2C27 A;  3P2F A;  2PRB A;  1S5K A;  1NMT A;  4YGO A;  5E96 A;  4II9 A;  5KTC A;  4FD5 A;  2BUE A;  3D3S A;  1XF8 A;  2KCW A;  4KOT A;  2DXQ A;  4B5P A;  5J8C A;  5IB0 A;  4UWJ A;  2IL4 A;  1TIQ A;  3BLN A;  5JPH A;  2Q04 A;  3FIX A;  4B5O A;  3FBU A;  2FXF A;  2GE3 A;  1MJA A;  3PP9 A;  1I12 A;  3R1K A;  4CS0 B;  1QSO A;  3EXN A;  5EBV A;  4AB7 A;  4KOW A;  1Z9U A;  2BSW A;  2P6G A;  3IGR A;  1M44 A;  4F6A A;  4KOU A;  5DWN A;  2D4P A;  1FY7 A;  4EVY A;  1B6B A;  1BOB A;  3D2M A;  5CNP A;  2G3T A;  4KOR A;  4J3G A;  1M4D A;  2Y0M A;  2OB0 A;  2I79 A;  1QSM A;  2O28 A;  1R57 A;  3RYO A;  1Q2C A;  4KZT A;  1YK3 A;  2BL1 A;  3GY9 A;  1S7F A;  2Q4Y A;  3G3S A;  3NE7 A;  3TFY A;  2HV2 A;  4QB9 A;  1P4N A;  1OZP A;  1XE4 A;  2BEI A;  4KLW A;  2WPW A;  1S7L A;  4HNW B;  2OZH A;  3W91 A;  1XMT A;  3P2H A;  2ATR A;  3SXN A;  2F5I A;  1KZF A;  3E0K A;  1M4I A;  2J8M A;  3TE4 A;  5JQ4 A;  4ZBG A;  4PV6 A;  2J8R A;  2R98 A;  3T9Y A;  3B8G A;  2FSR A;  3FNC A;  2B3V A;  4R3L A;  4KOS A;  4LX9 A;  1WWZ A;  4NF1 A;  2B5G A;  1LRZ A;  4U9Y A;  2P6F A;  3LD2 A;  4KVX A;  4PSX A;  4CAV A;  3EC4 A;  5IV0 A;  1IB1 E;  3DR6 A;  4KUA A;  3R9F A;  1CM0 A;  2ZXV A;  1IID A;  3TCV A;  2ZW5 A;  4AVB A;  2VEZ A;  1Q2Y A;  4KVM E;  2FE7 A;  5F47 A;  2Z0Z A;  3GYA A;  3CXP A;  3WR7 A;  4KUB A;  2Q4V A; 
#chains in the Genus database with same CATH topology
 2ZOG A;  2F7V A;  2ZEM A;  3LWU A;  1XOV A;  2ZW4 A;  4RS2 A;  2PCU A;  4MXU A;  4P4F A;  1YR0 A;  4YWY A;  2V77 A;  1HEE A;  1Y0R A;  4RI1 A;  3T8W A;  2GIV A;  4MHN A;  4CYQ A;  1YX0 A;  1HDU A;  1TXR A;  2YNC C;  4C7I A;  2PIY A;  2I3C A;  4A39 A;  4ZI6 A;  3DLJ A;  4E0A A;  1XMB A;  3QNV A;  3T90 A;  4PK2 A;  4TWE A;  3DNS A;  3JRU A;  4M6H A;  1S60 A;  4JYW A;  4IUS A;  4XPL A;  4KOV A;  3LOD A;  4OC4 A;  1KUV A;  1S3Z A;  4XPK A;  3SJE A;  2JEV A;  1AUG A;  2ZW7 A;  3F0A A;  3FED A;  5GCN A;  4CGP A;  1XBU A;  4MCQ A;  4A33 A;  4O23 A;  3PFE A;  4UCN A;  4A37 A;  5HH1 A;  4H6Z A;  1IY7 A;  4CGL A;  4MCR A;  1ZLH A;  3I1U A;  4UEZ A;  5DS0 A;  4M6I A;  1PUA A;  1Y0Y A;  3RZA A;  2FL4 A;  1CPS A;  2PJ3 A;  4P4E A;  1Y7E A;  4AG7 A;  2OU2 A;  3ZZI A;  4PXB A;  1AYE A;  1VIX A;  2EUI A;  4NCZ A;  4NGT A;  1YW6 A;  3VWE A;  3CT9 A;  4ONU A;  4BD9 A;  3GLJ A;  3QB8 A;  4P4J A;  2C1C A;  2XEJ A;  2OH1 A;  4H89 A;  4P44 A;  5IB9 A;  1QSN A;  4M3S A;  4R57 A;  3IEH A;  4R9M A;  5F49 A;  3TOA A;  1VKC A;  1ZG7 A;  2ZPA A;  1JWQ A;  2Z11 A;  3I9S A;  5LRG A;  2R8V A;  2I00 A;  2P0W A;  5DWM A;  5G21 A;  2ANP A;  2B4B A;  2NYQ A;  4FD4 A;  3WC5 A;  4DUK A;  3R9G A;  2G3A A;  4FAI A;  2FIW A;  5F48 A;  1ZG8 A;  5G22 A;  2BO9 A;  4JLY A;  3DSB A;  3WC7 A;  4MI4 A;  1KUY A;  2YNE A;  4CRZ B;  4PSW A;  4CAW A;  1PCA A;  3IC1 A;  4FUU A;  4UCM A;  5K8O A;  3N7Z A;  5CBM A;  1CP7 A;  2VBQ A;  5KTD A;  2R1I A;  4AVC A;  4MFK A;  1TKF A;  5AGE A;  4A38 A;  4ZX9 A;  4UFW A;  2OOT A;  2V8V A;  1TKH A;  4QUS A;  5EMI A;  1F2O A;  3DDD A;  4CGM A;  1LAP A;  3CDX A;  3L2N A;  2EBJ A;  2YNC A;  4B6Z A;  3S6H A;  2A4N A;  1YRE A;  1UFH A;  4LUA A;  3SXO A;  3SHP A;  1WK4 A;  2EVN A;  4MHD A;  5C82 A;  2JLM A;  2EO8 A;  3A9L A;  3KL9 A;  1F2P A;  1Q2D A;  2GU2 A;  2Z3L A;  5LYD A;  2FIA A;  4P4I A;  4I49 A;  5A28 A;  8CPA A;  2Q4Z A;  3KQX A;  4DNC A;  2FT0 A;  1AMP A;  5HVG A;  5EC4 A;  3VAT A;  4C2Y A;  3TO6 A;  3IFE A;  4FWU A;  1KUX A;  4YRH A;  4CAX A;  2Z3M A;  4CRY B;  1UWY A;  2PC1 A;  5D8N A;  1CJW A;  5LRK A;  4HPS A;  2WUU A;  4UWI A;  4CGO A;  2XEI A;  1YLO A;  2ZEH A;  4ORF A;  1TKJ A;  4B13 A;  1H8L A;  2J8N A;  2HB6 A;  4MJ8 A;  4NSQ A;  3TTH A;  4R87 A;  4B12 A;  4QBJ A;  1ZLI A;  2DPS A;  2O53 A;  4NGS A;  3HLP A;  2ZW6 A;  2B4D B;  4MMO A;  4C2X A;  2ZED A;  1XIX A;  3K2K A;  4UA3 A;  4A31 A;  1YGH A;  1BPN A;  3S6G A;  2GLJ A;  4L89 A;  3JVN A;  4FD7 A;  1IOI A;  1GYT A;  4UFX A;  1Q7L A;  2Z10 A;  4UEF A;  3EY5 A;  5G20 A;  5LYL A;  3UY5 A;  3D67 A;  2Q51 A;  2EWB A;  4PQA A;  1Z8T A;  4OLL A;  3B3T A;  2QIR A;  4FD6 A;  2G0B A;  4CAF A;  5AG6 A;  2PJA A;  2GLF A;  2CIJ A;  3W6X A;  1CG2 A;  1RXT A;  1TF8 A;  3CXS A;  4NFR A;  5C88 A;  4JD6 A;  1L0C A;  1MJB A;  1XEB A;  1Z4E A;  4JXR A;  2AFZ A;  3PB7 X;  4P6Y A;  5LRJ A;  2PSW A;  3TT2 A;  5I0C A;  4U5Y A;  3FF3 A;  3VAR A;  1S7N A;  1X12 A;  1FT7 A;  4XNH B;  3PRT A;  4Q36 A;  4A2Z A;  3TO7 A;  2QYV A;  3FYN A;  2JDC A;  4UBR A;  2B3U A;  3GB0 A;  2Q7B A;  3S9M A;  1DTD A;  3B35 A;  3IU1 A;  4MRI A;  4A94 A;  4UIA A;  4MHP A;  1K4J A;  1NSA A;  2AFW A;  3MN8 A;  3V38 A;  2PVV A;  1V0C A;  4NGN A;  1NE9 A;  2QJ8 A;  2REE A;  2X7B A;  4K30 A;  4MHY A;  1BAV A;  2ARH A;  4MHZ A;  4U9Z A;  4ZX8 A;  3R96 A;  4PXC A;  5HXD A;  2AFS A;  1LFW A;  4JWP A;  4OAD A;  5JH9 A;  1RO5 A;  4Y49 B;  2B5G B;  4UEE A;  2IJZ A;  1M4G A;  4QC6 A;  4AG9 A;  3SI1 A;  4R6T A;  4X5K A;  1MK4 A;  4OC0 A;  2GAN A;  4OAE A;  3OWC A;  3F8K A;  4XPD B;  1NSL A;  3DR8 A;  3FJU A;  1Z8W A;  2AFO A;  4PXD A;  4DYO A;  3S9N A;  4MCP A;  4IAV A;  3V7Z A;  3D4U A;  2C6G A;  2H5M A;  3SJG A;  2Z3K A;  2IQ6 A;  3ZJ0 A;  1Y7R A;  2O4H A;  4MFZ A;  5J1Q A;  5FVJ A;  2PR8 A;  3NH5 A;  1TF9 A;  4KSA A;  4GS4 A;  3CZX A;  3CXQ A;  2JEW A;  4NEX A;  4MFP A;  4DJL A;  2PJ2 A;  3KZW A;  1IIC A;  4OP4 A;  1IGB A;  3D7D A;  1QST A;  3F5B A;  4KOX A;  4CAE A;  4E8O A;  1HDQ A;  2OZU A;  2VL1 A;  4XNH C;  2RFH A;  1J4J A;  2HQY A;  1PU9 A;  4AVA A;  1LAM A;  2PDO A;  2CNM A;  3KR4 A;  4ZYQ A;  1BO4 A;  4PPZ A;  4X2T A;  2PJB A;  2ODF A;  1MJ9 A;  2AJ6 A;  3C26 A;  3NFZ A;  5J8F A;  1VHO A;  2AFX A;  4R8F A;  3TO9 A;  4CPA A;  4IF5 A;  1XRY A;  3G8W A;  2Z3P A;  4OID A;  5ISV A;  3FRM A;  4KVO E;  1M1D A;  2P6E A;  5JM6 A;  4NGR A;  4B5P B;  3GUX A;  1GHE A;  4CYO A;  2EK9 A;  2VXK A;  3R95 A;  1SQH A;  3I3G A;  4KSI A;  2JBK A;  4HNX B;  1QSR A;  2ZEP A;  4OIW A;  2CNT A;  2RB7 A;  4HNY B;  4P4B A;  4Y49 C;  2AE6 A;  1ARL A;  4MY0 A;  4NXY A;  2DF5 A;  3RBU A;  3V8I A;  3H8G A;  5AG7 A;  3GIU A;  4A30 A;  1Z4R A;  3LMS A;  2RC4 A;  3KAS A;  3VWD A;  3PFO A;  2C6P A;  4X3R A;  4R7M A;  5LYF A;  2GFQ A;  3H4Q A;  4XPD C;  3SI0 A;  1IYK A;  3B3S A;  4ZGY B;  1YVO A;  5H84 A;  3D8P A;  4MFL A;  1I1D A;  1LOK A;  4QVT A;  1A2Z A;  4ONW A;  4FBE A;  2B4D A;  3FB3 A;  4ZY0 A;  3CPX A;  3NA6 A;  3K9U A;  2B58 A;  4L8A A;  4P10 A;  2JDD A;  4M6G A;  3S6F A;  4OC1 A;  3FVL A;  3HUV A;  4JJX A;  1CX8 A;  4BBH A;  1U6M A;  3MRU A;  4PK3 A;  4C7H A;  4BMH A;  2ABZ A;  2IMO A;  3JUW A;  1Z8X A;  3W6S A;  4KOY A;  1YQE A;  2XEF A;  4M85 A;  2CF4 A;  1N71 A;  1YVK A;  5BWA B;  3S6K A;  2Q0Y A;  4KLV A;  1B87 A;  2R7H A;  3B3C A;  3D2P A;  4NJR A;  1YLE A;  2Z3N A;  3TOB A;  3MGD A;  4OC5 A;  4HKF A;  2VZZ A;  4YFJ A;  3IWW A;  3D66 A;  1CPX A;  3D7G A;  3TC8 A;  5F46 A;  4CYP A;  1IYL A;  5CPA A;  2CY2 A;  1Y9K A;  3IWE A;  1Y9W A;  4MFJ A;  4JXQ A;  1ZO0 A;  4UFV A;  4R76 A;  5A27 A;  3WC6 A;  4ZY2 A;  1DE4 C;  2DPT A;  2PIZ A;  2QEC A;  2POK A;  3EFA A;  3PGP A;  2K5T A;  2AFM A;  3WAB A;  3PZJ A;  4G1P A;  1BPM A;  2WPX A;  4IK2 A;  1ON0 A;  2QML A;  5KTA A;  5H86 A;  1S7K A;  4RUH A;  2PJ0 A;  4A95 A;  4CYN A;  1R43 A;  4GXH A;  4R3K A;  6CPA A;  3EO4 A;  4BIN A;  2PJ1 A;  3BJ8 A;  3TX8 A;  2FCK A;  3NH4 A;  5K8N A;  3BJ7 A;  2PR1 A;  3ISZ A;  1VHS A;  2PJ4 A;  5HMN A;  3FXT A;  3SJF A;  1I21 A;  1YME A;  1Z2L A;  3H5Z A;  4NGP A;  2CNS A;  3R9E A;  2VQY A;  4E2A A;  2D4O A;  3CPA A;  2VZY A;  1IOF A;  3IU2 A;  3KI9 A;  2FS5 A;  4WWV A;  4JZ0 A;  2PQ8 A;  4MBU A;  1P0H A;  3IJ3 A;  3IWG A;  2HUZ A;  3B7I A;  2OZG A;  3FMC A;  5IX3 A;  2NMT A;  2NSM A;  4CGN A;  2REF A;  2VI7 A;  3KKW A;  3GKR A;  4MY3 A;  4F0Y A;  3QAH A;  1EE3 P;  4H6U A;  2Q44 A;  4C2Z A;  2J9A A;  2C27 A;  3B3W A;  2PJC A;  2PRB A;  3P2F A;  1S5K A;  1NMT A;  2ZEN A;  4YGO A;  5E96 A;  1VGY A;  1Z5R A;  4II9 A;  3D68 A;  4OC3 A;  5KTC A;  1OBR A;  4FD5 A;  2BUE A;  3D3S A;  1ELM P;  1XF8 A;  1RTQ A;  1LCP A;  2KCW A;  2V8G A;  4KOT A;  2DXQ A;  2HC9 A;  3KR5 A;  2BOA A;  4B5P A;  5HVH A;  5J8C A;  5IB0 A;  3PB6 X;  3KQZ A;  1YW4 A;  4UWJ A;  3BXM A;  2IL4 A;  5K8P A;  4MCS A;  3IIB A;  1TIQ A;  3BLN A;  5JPH A;  5D29 A;  1KWM A;  3DGV A;  2Q04 A;  1R3N A;  4F9V A;  2FVG A;  2PE3 A;  3FIX A;  4B5O A;  2V8H A;  3FBU A;  2Q7S A;  4Q38 A;  2FXF A;  2GE3 A;  1MJA A;  3PP9 A;  4UCP A;  1XJO A;  1I12 A;  3IO1 A;  1CP6 A;  3R1K A;  4NGQ A;  1QSO A;  4UIB A;  4CS0 B;  3EXN A;  5EBV A;  4AB7 A;  5JGF A;  3B3V A;  4KOW A;  1Z9U A;  2BSW A;  4ZY1 A;  1PYT B;  2YND A;  4YU9 A;  2OR4 A;  2P6G A;  3FX6 A;  3IGR A;  5F09 A;  1M44 A;  4F6A A;  3QAY A;  4KOU A;  5DWN A;  5AG5 A;  2D4P A;  4F0X A;  4P45 A;  1FY7 A;  3JTK A;  3RAM A;  4OME A;  4EVY A;  2XEG A;  3D7H A;  1B6B A;  2GRE A;  4AXV A;  1BOB A;  3D2M A;  5CNP A;  3VH9 A;  5I4M A;  2G3T A;  2C6C A;  2ZEO A;  4KOR A;  3K9T A;  1IU8 A;  3D7F A;  1CBX A;  4J3G A;  1M4D A;  2Y0M A;  4EWT A;  3PBB A;  4F9U A;  2OB0 A;  2I79 A;  1QSM A;  2O28 A;  4OC2 A;  1ARM A;  1R57 A;  3RYO A;  1Q2C A;  3BI0 A;  4KZT A;  4C68 A;  5G1Z A;  3NH8 A;  4MFQ A;  3B2Y A;  2PJ7 A;  5LYI A;  1Z8L A;  2PJ9 A;  1YK3 A;  2BL1 A;  3GY9 A;  3WT4 A;  2G9D A;  5AG4 A;  3ISX A;  3LAC A;  1S7F A;  4KS9 A;  2Q4Y A;  3G3S A;  4B11 A;  3SJX A;  3NE7 A;  5HVF A;  3TFY A;  4LQ6 A;  2HV2 A;  2DEA A;  1FNO A;  2WZN A;  4QB9 A;  1P4N A;  4W9Y A;  2ZEF A;  3FH4 A;  2ZEG A;  4H2K A;  1M4L A;  1OZP A;  1XE4 A;  2BEI A;  2PRQ A;  2WPW A;  3FEE A;  4KLW A;  1S7L A;  2PJ6 A;  2OZH A;  4HNW B;  3PEI A;  2JBJ A;  4NGM A;  3W91 A;  2ZOF A;  4Q7A A;  1XMT A;  3P2H A;  2CTC A;  2ATR A;  1X10 A;  2PVW A;  1QQ9 A;  3SXN A;  2F8H A;  2F5I A;  1KZF A;  2WSA A;  3E0K A;  1M4I A;  2CXA A;  2J8M A;  3TE4 A;  5JQ4 A;  4ZBG A;  4PV6 A;  2WYR A;  2J8R A;  1XFO A;  4A32 A;  2R98 A;  4Z65 A;  3T9Y A;  3B8G A;  1LAN A;  4WJB A;  4GM5 A;  5ELY A;  5THW A;  2FSR A;  3FNC A;  2YGW A;  2B3V A;  4IHM A;  4R3L A;  7CPA A;  2CTB A;  4KOS A;  2AFU A;  3FEC A;  1BLL E;  1QMU A;  4LX9 A;  3N5F A;  5K8M A;  4LQG A;  1WWZ A;  1ELL P;  4NF1 A;  2B5G A;  1ZG9 A;  4OKO A;  2Z3O A;  3S9L A;  1LRZ A;  2PJ8 A;  3KHX A;  4U9Y A;  3NE8 A;  3H8F A;  3KGQ A;  2P6F A;  3BHX A;  3LD2 A;  3PB8 X;  4KVX A;  3PB9 X;  4PSX A;  4CAV A;  4K3N A;  3EC4 A;  4EFD A;  5IV0 A;  1IB1 E;  3DR6 A;  1JQG A;  4KUA A;  4EME A;  3R9F A;  3BI1 A;  1CM0 A;  1F57 A;  3RO0 A;  2ZXV A;  4PXE A;  2Q43 A;  3PBE A;  1IID A;  3TCV A;  4B10 A;  2ZW5 A;  2QVP A;  2ZEL A;  4UF4 A;  4AVB A;  4B14 A;  4F8Z A;  4TNU A;  3PB4 X;  3KHZ A;  2VEZ A;  2BCO A;  1Q2Y A;  4KVM E;  3H8E A;  2V8D A;  2FE7 A;  5F47 A;  3SI2 A;  2Z0Z A;  3GYA A;  2ZEE A;  3RNZ A;  1YSJ A;  2EK8 A;  3CXP A;  3WR7 A;  4P4D A;  1VHE A;  2PJ5 A;  4RN7 A;  4NJQ A;  4KUB A;  4KSF A;  4X8I A;  2Q4V A; 
#chains in the Genus database with same CATH homology
 2ZW4 A;  4RS2 A;  1YR0 A;  4RI1 A;  2GIV A;  4CYQ A;  1YX0 A;  2YNC C;  4C7I A;  4E0A A;  3T90 A;  4PK2 A;  3DNS A;  1S60 A;  4IUS A;  4XPL A;  4KOV A;  3LOD A;  1KUV A;  1S3Z A;  4XPK A;  4CGP A;  2JEV A;  3F0A A;  2ZW7 A;  5GCN A;  4A33 A;  4UCN A;  5HH1 A;  4H6Z A;  4CGL A;  1PUA A;  2FL4 A;  4AG7 A;  2OU2 A;  3ZZI A;  2EUI A;  4NCZ A;  3VWE A;  4ONU A;  3QB8 A;  4H89 A;  2OH1 A;  1QSN A;  4M3S A;  4R57 A;  4R9M A;  5F49 A;  3TOA A;  1VKC A;  2ZPA A;  2Z11 A;  3I9S A;  2R8V A;  2I00 A;  2P0W A;  5DWM A;  5G21 A;  2B4B A;  4FD4 A;  3R9G A;  2G3A A;  2FIW A;  5F48 A;  5G22 A;  4JLY A;  3DSB A;  4MI4 A;  1KUY A;  2YNE A;  4CRZ B;  4PSW A;  4CAW A;  4UCM A;  3N7Z A;  2VBQ A;  5KTD A;  2R1I A;  4AVC A;  4MFK A;  5AGE A;  4UFW A;  4QUS A;  3DDD A;  4CGM A;  2YNC A;  3S6H A;  2A4N A;  1YRE A;  1UFH A;  4LUA A;  3SXO A;  3SHP A;  1WK4 A;  2EVN A;  4MHD A;  5C82 A;  2JLM A;  3A9L A;  1Q2D A;  2Z3L A;  2FIA A;  4I49 A;  5A28 A;  4DNC A;  2FT0 A;  5EC4 A;  4C2Y A;  3TO6 A;  1KUX A;  4YRH A;  4CAX A;  2Z3M A;  4CRY B;  2PC1 A;  1CJW A;  4UWI A;  2WUU A;  4CGO A;  4ORF A;  4B13 A;  2J8N A;  4MJ8 A;  4NSQ A;  3TTH A;  4B12 A;  4R87 A;  4QBJ A;  2DPS A;  2ZW6 A;  2B4D B;  4C2X A;  1XIX A;  4UA3 A;  4A31 A;  1YGH A;  3S6G A;  4L89 A;  3JVN A;  4FD7 A;  4UFX A;  2Z10 A;  3EY5 A;  5G20 A;  3UY5 A;  4OLL A;  2QIR A;  4FD6 A;  2G0B A;  4CAF A;  5AG6 A;  3W6X A;  1RXT A;  3CXS A;  5C88 A;  4JD6 A;  1L0C A;  1MJB A;  1XEB A;  1Z4E A;  4JXR A;  2PSW A;  3TT2 A;  5I0C A;  4U5Y A;  1S7N A;  4XNH B;  4Q36 A;  4A2Z A;  3TO7 A;  3FYN A;  2JDC A;  4UBR A;  2B3U A;  2Q7B A;  3IU1 A;  1K4J A;  1V0C A;  1NE9 A;  2REE A;  2X7B A;  4K30 A;  4U9Z A;  3R96 A;  2ARH A;  4OAD A;  4JWP A;  1RO5 A;  4Y49 B;  2B5G B;  1M4G A;  4QC6 A;  4AG9 A;  4X5K A;  1MK4 A;  2GAN A;  4OAE A;  3OWC A;  3F8K A;  4XPD B;  1NSL A;  3DR8 A;  2H5M A;  2Z3K A;  3ZJ0 A;  1Y7R A;  4MFZ A;  5FVJ A;  2PR8 A;  4KSA A;  4GS4 A;  3CXQ A;  4NEX A;  4MFP A;  1IIC A;  1QST A;  3F5B A;  4KOX A;  4CAE A;  4E8O A;  2OZU A;  4XNH C;  1J4J A;  2HQY A;  1PU9 A;  4AVA A;  2PDO A;  2CNM A;  1BO4 A;  5J8F A;  3C26 A;  1MJ9 A;  2AJ6 A;  3TO9 A;  4IF5 A;  5ISV A;  3G8W A;  2Z3P A;  3FRM A;  4KVO E;  1M1D A;  2P6E A;  4B5P B;  1GHE A;  4CYO A;  2VXK A;  3R95 A;  1SQH A;  3I3G A;  4HNX B;  1QSR A;  2CNT A;  4HNY B;  4Y49 C;  2AE6 A;  4NXY A;  4MY0 A;  3V8I A;  5AG7 A;  4A30 A;  1Z4R A;  2RC4 A;  3VWD A;  3H4Q A;  4XPD C;  1IYK A;  4ZGY B;  1YVO A;  5H84 A;  3D8P A;  4MFL A;  1I1D A;  4QVT A;  2B4D A;  3FB3 A;  3K9U A;  2B58 A;  4L8A A;  2JDD A;  3S6F A;  4JJX A;  4BBH A;  4C7H A;  1U6M A;  4PK3 A;  4BMH A;  3JUW A;  3W6S A;  4KOY A;  4M85 A;  5BWA B;  1N71 A;  1YVK A;  3S6K A;  2Q0Y A;  4KLV A;  1B87 A;  2R7H A;  3D2P A;  1YLE A;  2Z3N A;  3TOB A;  3MGD A;  4HKF A;  2VZZ A;  4YFJ A;  5F46 A;  4CYP A;  1IYL A;  2CY2 A;  1Y9K A;  3IWE A;  1Y9W A;  4MFJ A;  4JXQ A;  1ZO0 A;  4UFV A;  5A27 A;  2DPT A;  2QEC A;  3EFA A;  3PGP A;  2K5T A;  3PZJ A;  2WPX A;  1ON0 A;  2QML A;  5KTA A;  5H86 A;  1S7K A;  4A95 A;  4CYN A;  4R3K A;  3EO4 A;  3BJ8 A;  2FCK A;  3BJ7 A;  2PR1 A;  1VHS A;  5HMN A;  3FXT A;  1I21 A;  3H5Z A;  2CNS A;  3R9E A;  2VQY A;  4E2A A;  2D4O A;  2VZY A;  3IU2 A;  2FS5 A;  2PQ8 A;  4MBU A;  1P0H A;  3IWG A;  2HUZ A;  5IX3 A;  2OZG A;  2NMT A;  4CGN A;  2REF A;  2VI7 A;  3KKW A;  3GKR A;  4MY3 A;  4F0Y A;  3QAH A;  4H6U A;  2Q44 A;  4C2Z A;  2C27 A;  3P2F A;  2PRB A;  1S5K A;  1NMT A;  4YGO A;  5E96 A;  4II9 A;  5KTC A;  4FD5 A;  2BUE A;  3D3S A;  1XF8 A;  2KCW A;  4KOT A;  2DXQ A;  4B5P A;  5J8C A;  5IB0 A;  4UWJ A;  2IL4 A;  1TIQ A;  3BLN A;  5JPH A;  2Q04 A;  3FIX A;  4B5O A;  3FBU A;  4Q38 A;  2FXF A;  2GE3 A;  1MJA A;  3PP9 A;  4UCP A;  1I12 A;  3R1K A;  4CS0 B;  1QSO A;  3EXN A;  5EBV A;  4AB7 A;  4KOW A;  1Z9U A;  2BSW A;  2YND A;  2P6G A;  3IGR A;  1M44 A;  4F6A A;  4KOU A;  5DWN A;  4F0X A;  2D4P A;  1FY7 A;  3JTK A;  4EVY A;  1B6B A;  1BOB A;  3D2M A;  5CNP A;  2G3T A;  4KOR A;  4J3G A;  1M4D A;  2Y0M A;  2OB0 A;  2I79 A;  1QSM A;  2O28 A;  1R57 A;  3RYO A;  1Q2C A;  4KZT A;  4C68 A;  5G1Z A;  4MFQ A;  1YK3 A;  2BL1 A;  3GY9 A;  5AG4 A;  1S7F A;  4KS9 A;  2Q4Y A;  3G3S A;  4B11 A;  3NE7 A;  3TFY A;  2HV2 A;  4QB9 A;  1P4N A;  5AG5 A;  1OZP A;  1XE4 A;  2BEI A;  4KLW A;  2WPW A;  1S7L A;  4HNW B;  2OZH A;  3W91 A;  1XMT A;  3P2H A;  2ATR A;  3SXN A;  2F5I A;  1KZF A;  2WSA A;  3E0K A;  1M4I A;  2CXA A;  2J8M A;  3TE4 A;  5JQ4 A;  4ZBG A;  4PV6 A;  2J8R A;  4A32 A;  2R98 A;  3T9Y A;  3B8G A;  2FSR A;  3FNC A;  2YGW A;  2B3V A;  4R3L A;  4KOS A;  4LX9 A;  1WWZ A;  4NF1 A;  2B5G A;  2Z3O A;  1LRZ A;  4U9Y A;  2P6F A;  3LD2 A;  4KVX A;  4PSX A;  4CAV A;  3EC4 A;  5IV0 A;  1IB1 E;  3DR6 A;  4KUA A;  3R9F A;  1CM0 A;  2ZXV A;  1IID A;  3TCV A;  4B10 A;  2ZW5 A;  4AVB A;  4B14 A;  2VEZ A;  1Q2Y A;  4KVM E;  2FE7 A;  5F47 A;  2Z0Z A;  3GYA A;  3CXP A;  3WR7 A;  4KUB A;  4KSF A;  2Q4V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...