2PC1A

Crystal structure of acetyltransferase gnat family (np_688560.1) from streptococcus agalactiae 2603 at 1.28 a resolution
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
173
structure length
173
Chain Sequence
NLYFQGMQIRLAFPNEIDQIMLLIEEARAEIAKTGSDQWQKEDGYPNRNDIIDDILNGYAWVGIEDGMLATYAAVIDGHEEVYDAIYEGKWLHDNHRYLTFHRIAISNQFRGRGLAQTFLQGLIEGHKGPDFRCDTHEKNVTMQHILNKLGYQYCGKVPLDGVRLAYQKIKEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Acetyltransferase, GNAT family
publication title Crystal structure of acetyltransferase GNAT family (NP_688560.1) from Streptococcus agalactiae 2603 at 1.28 A resolution
rcsb
source organism Streptococcus agalactiae 2603v/r
total genus 55
structure length 173
sequence length 173
ec nomenclature ec 2.3.1.-:
pdb deposition date 2007-03-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 2pc1A00
2BEIA 1Z4RA 4H6UA 4YGOA 4KZTA 2PR8A 4DNCA 1PUAA 3VWDA 2B3VA 4UWJA 1Y7RA 4YRHA 3TOBA 3DSBA 3FBUA 1IIDA 2PC1A 2JDDA 5DWMA 3JUWA 3S6GA 4OADA 2B3UA 3BJ7A 1M4GA 3S6KA 3F5BA 1UFHA 1P0HA 3ZJ0A 2HUZA 1KUVA 2D4OA 1R57A 3R9GA 2Q7BA 1KZFA 3RYOA 1XF8A 4B5PA 3B8GA 3E0KA 4UA3A 2OZGA 1S7NA 2KCWA 4XPLA 2I79A 4JLYA 4X5KA 1M4DA 3ZZIA 4KUAA 2ZW6A 5IB0A 4XNHB 3S6HA 2REEA 4FD6A 4AVBA 2FXFA 4U5YA 3LD2A 2PRBA 4RI1A 4KOYA 1S3ZA 2FCKA 5DWNA 4NF1A 1IB1E 2Q04A 2Q4YA 3T90A 5KTDA 2VEZA 1S7LA 2J8MA 3K9UA 3SXNA 1YR0A 3D8PA 4OLLA 2NMTA 2REFA 4LX9A 1SQHA 4MY0A 4F6AA 1I12A 3EY5A 3D2PA 2B4DA 3GYAA 2R8VA 4PSWA 2K5TA 4J3GA 4U9YA 1L0CA 4HNXB 1Y9KA 2CNSA 4QBJA 4F0YA 3P2HA 2VZZA 5C88A 3TFYA 4E2AA 2JDCA 4AVAA 2ZW7A 2Z0ZA 1OZPA 1U6MA 4BMHA 5FVJA 4CAVA 1BOBA 1I21A 3DR8A 3R9FA 4B5OA 4NCZA 1S7FA 3QB8A 2Q44A 1RO5A 5JPHA 3N7ZA 4XPKA 4CRZB 1Y9WA 3FB3A 4KVOE 3EC4A 5F47A 1MK4A 4FD5A 4KOVA 4RS2A 1XEBA 5F48A 2ARHA 3R96A 1ON0A 1B6BA 3BLNA 3F0AA 3W6XA 1VHSA 1CJWA 3IWGA 4M3SA 3UY5A 4CAXA 4QUSA 4JWPA 2Q0YA 3PGPA 2FIWA 2X7BA 4KUBA 3R9EA 1WK4A 4QB9A 2GE3A 4PK2A 1QSNA 2I00A 4KLWA 4KVXA 4MY3A 3OWCA 1IYLA 4L89A 1YVKA 2P6EA 3TO7A 2JLMA 4I49A 1S7KA 4PK3A 3T9YA 2GIVA 1Q2YA 5JQ4A 1FY7A 4MHDA 4Y49C 3SXOA 2PR1A 3DDDA 4JD6A 4LUAA 3FNCA 2VQYA 4KOUA 5EBVA 2FIAA 1YX0A 1P4NA 2QECA 3PZJA 3LODA 1QSTA 5IV0A 2QIRA 5J8CA 4NSQA 4AVCA 5GCNA 3BJ8A 4MBUA 2PSWA 2ZW4A 3V8IA 2Y0MA 1TIQA 3KKWA 4ZBGA 4HNWB 1CM0A 4QC6A 4AG7A 2R1IA 2IL4A 3FIXA 2GANA 4AG9A 1XIXA 4H6ZA 2FT0A 1S5KA 3D2MA 1RXTA 1LRZA 3W91A 2EVNA 3SHPA 1V0CA 1NSLA 3H4QA 2A4NA 1BO4A 4JXRA 4H89A 5I0CA 3D3SA 3CXQA 2FE7A 2RC4A 2ZXVA 1NE9A 1MJBA 5E96A 3G8WA 2WPXA 3TCVA 2HV2A 3TE4A 1GHEA 1M1DA 4PV6A 2BSWA 1YLEA 2O28A 1QSRA 2VBQA 4R3KA 2FS5A 1QSOA 2ZW5A 3IGRA 4HKFA 2PDOA 2B5GB 4MI4A 5H84A 2ZPAA 1WWZA 4MJ8A 4CRYB 4ORFA 2JEVA 3R1KA 4E8OA 5F46A 5HMNA 2VZYA 1XE4A 4JXQA 4PSXA 1Q2DA 3VWEA 2Z10A 3FRMA 1KUYA 1VKCA 4IF5A 3CXSA 4KVME 2B5GA 2OZHA 2EUIA 4CS0B 2R7HA 4NEXA 3TO9A 2BUEA 1NMTA 5ISVA 5J8FA 4QVTA 4Y49B 2G0BA 4HNYB 1Z9UA 5IX3A 1Z4EA 5KTAA 2R98A 3FXTA 1M4IA 4XPDB 3P2FA 4B5PB 2G3AA 3EXNA 1MJAA 3EFAA 4R87A 2VXKA 2OU2A 2Z11A 3NE7A 1MJ9A 1Q2CA 2QMLA 3QAHA 2CY2A 3GKRA 4FD4A 4FD7A 4R3LA 4U9ZA 4L8AA 3C26A 4JJXA 4KOSA 2OB0A 1B87A 3MGDA 3TTHA 2AJ6A 4YFJA 1M44A 2FL4A 4K30A 4XPDC 2P0WA 2CNMA 4OAEA 2B58A 3DR6A 3F8KA 4EVYA 2C27A 2DXQA 2BL1A 1YVOA 4M85A 4NXYA 2FSRA 2D4PA 1IICA 2B4BA 1IYKA 4KLVA 2P6FA 5CNPA 2F5IA 2HQYA 2G3TA 2AE6A 3EO4A 4KOTA 2B4DB 3TO6A 5EC4A 3PP9A 4KOXA 5C82A 2P6GA 4XNHC 1PU9A 4KOWA 2OZUA 4KORA 3TT2A 4UBRA 1N71A 1K4JA 3R95A 2J8RA 3S6FA 4R57A 4UWIA 3GY9A 2H5MA 2CNTA 1I1DA 3FYNA 1S60A 1QSMA 4IUSA 5F49A 3DNSA 4GS4A 1XMTA 1KUXA 1YGHA 2ATRA 3I9SA 1YREA 3WR7A 1J4JA 2WPWA 4CAWA 4II9A 5HH1A 3TOAA 3I3GA 3G3SA 4ONUA 4E0AA 2OH1A 3JVNA 5H86A 2VI7A 5KTCA 2PQ8A 1YK3A 4AB7A 2Q4VA 2J8NA 3CXPA 4R9MA 3W6SA
chains in the Genus database with same CATH superfamily
2BEIA 1Z4RA 1HEEA 2JEWA 3MRUA 1YW6A 4H6UA 4YGOA 4PXBA 3FF3A 4KZTA 4P44A 2PR8A 4DNCA 2HB6A 4NJRA 1PUAA 3SI2A 3VWDA 2B3VA 4UWJA 1Y7RA 4YRHA 3TOBA 1JQGA 3LWUA 3QNVA 3DSBA 3FBUA 3NH5A 3PRTA 1IIDA 3D7HA 4MXUA 2GLFA 2PC1A 3NE8A 2JDDA 4WJBA 5DWMA 3S9MA 3JUWA 3S6GA 4OADA 4BINA 4ONWA 2B3UA 4C2XA 2CTBA 3BJ7A 5LYIA 1M4GA 3S6KA 3F5BA 1UFHA 1P0HA 3IWEA 3DLJA 5LYLA 1DE4C 3ZJ0A 2HUZA 1KUVA 4B11A 5I4MA 2D4OA 1Z2LA 3FMCA 1R57A 7CPAA 3R9GA 5K8MA 4UCNA 3RBUA 2GLJA 2NYQA 2O53A 3FH4A 4CGLA 2Z3LA 2Q7BA 1KZFA 3RYOA 4ZY0A 4KS9A 2AFWA 1XF8A 4B5PA 1UWYA 2Z3PA 4CGPA 2PJ1A 3B8GA 3E0KA 4UA3A 2OZGA 2RFHA 1TKHA 1S7NA 2KCWA 4XPLA 2I79A 4JLYA 4X5KA 4UFVA 1M4DA 3ZZIA 4KUAA 3HUVA 2V8VA 2PIYA 2ZW6A 5IB0A 4XNHB 1Y0YA 3PB9X 4W9YA 3S6HA 2REEA 4B12A 3NH4A 4FD6A 4AVBA 2V8DA 2FXFA 2WSAA 3BHXA 2WUUA 4H2KA 4U5YA 1CX8A 4FAIA 3LD2A 2DPTA 2PRBA 4RI1A 3SJFA 3JTKA 1YMEA 5F09A 4KOYA 3PBEA 1S3ZA 4OIWA 4Q36A 4B13A 2FCKA 5DWNA 4NF1A 3T8WA 1IB1E 3NA6A 4F9VA 2PJ9A 2Q04A 2Q4YA 3T90A 5KTDA 2VEZA 2GREA 1S7LA 2PJCA 3B3SA 4RN7A 4UIAA 3KASA 2J8MA 5JM6A 4MFQA 2ZEMA 3DGVA 4BD9A 6CPAA 3K9UA 4KSFA 5AGEA 3SXNA 1YR0A 4FWUA 4FUUA 5A27A 3D8PA 4OLLA 5BWAB 4ZYQA 2Q7SA 1BAVA 4YWYA 2NMTA 2REFA 3H8GA 3KR5A 4X3RA 4LX9A 3RNZA 5HVFA 5AG6A 1ARLA 1SQHA 3FEDA 4MY0A 4F6AA 4F9UA 4PQAA 4NGTA 1I12A 2F7VA 3D7DA 2C6CA 3D7FA 3EY5A 5LYDA 3B35A 3S9LA 2EK9A 3D2PA 2B4DA 3GYAA 2R8VA 2ZEHA 4PSWA 1Y0RA 1NSAA 2K5TA 3S9NA 5K8NA 4UCMA 3GB0A 4O23A 3BI0A 4J3GA 4U9YA 1L0CA 4OC5A 4HNXB 1Y9KA 1ZG7A 2CNSA 3CT9A 4A30A 4QBJA 1DTDA 5LRGA 5D29A 2PCUA 2C1CA 2XEIA 4F0YA 2Q43A 2ZELA 3GLJA 3P2HA 4M6GA 2VZZA 4CYOA 5C88A 4ZX9A 3TFYA 4E2AA 1VIXA 1Z8TA 2JDCA 4AVAA 4EWTA 2ZW7A 2Z0ZA 1XMBA 1OZPA 1U6MA 2PRQA 2YNCC 5FVJA 1BOBA 2PVWA 1I21A 4UEZA 4BMHA 4CAVA 2XEJA 1TF8A 2FVGA 4R8FA 3DR8A 3R9FA 4B5OA 4GM5A 3D67A 4NCZA 4Q7AA 2XEFA 1S7FA 3B3TA 3L2NA 3QB8A 4OKOA 2Q44A 4A2ZA 3N5FA 1EE3P 1XJOA 3KHZA 1RO5A 5JPHA 2HC9A 5EMIA 1OBRA 3IWWA 2EO8A 3N7ZA 4XPKA 3WC7A 4CRZB 1Y9WA 2V8HA 1ZG9A 3FB3A 4WWVA 3SJXA 4EMEA 4KVOE 3EC4A 3D7GA 5F47A 1MK4A 5D8NA 4OC2A 2J9AA 4FD5A 1YQEA 4KOVA 4RS2A 1AUGA 5K8OA 1X10A 1CP7A 1XEBA 2ZEGA 5F48A 2ARHA 3R96A 1LANA 2Z3OA 4MHPA 1ON0A 2ANPA 4RUHA 5HXDA 1B6BA 4KSAA 3BLNA 3F0AA 3W6XA 1CJWA 1VHSA 3A9LA 3FEEA 4P45A 3VATA 4B6ZA 1CG2A 3IWGA 4M3SA 3UY5A 3TX8A 4CAXA 3CPAA 4QUSA 4JWPA 1ZG8A 2Q0YA 2PJ0A 4K3NA 2CTCA 3PGPA 2FIWA 2X7BA 5G22A 4KUBA 4MFZA 3R9EA 4X8IA 1YW4A 1WK4A 4QB9A 3SJEA 3PB4X 2BCOA 3SI0A 3BI1A 4P4FA 4CGOA 5J1QA 3IU2A 2GE3A 3B2YA 4PK2A 1QSNA 2I00A 4KLWA 4KVXA 4MY3A 3OWCA 4EFDA 1IOIA 1IYLA 4L89A 4KSIA 1YVKA 3CPXA 4UIBA 2P6EA 3K2KA 3TO7A 4UFWA 2JLMA 3IJ3A 4I49A 2JBJA 3KI9A 1S7KA 4PK3A 3T9YA 2GIVA 3CZXA 1Q2YA 3K9TA 4UEFA 4CPAA 5JQ4A 3GIUA 1FY7A 4IAVA 4MHDA 4Y49C 4ZGYB 3SXOA 2PR1A 4NGQA 1Y7EA 2YNDA 3DDDA 4JD6A 4LUAA 3FX6A 5G1ZA 3D66A 3FNCA 2VQYA 1BLLE 1VHOA 2OR4A 2YNEA 4JZ0A 5DS0A 4KOUA 5EBVA 4TWEA 2FIAA 1YX0A 3B3CA 1P4NA 2QECA 3PZJA 3LODA 4AXVA 1QSTA 1AYEA 1TKJA 2AFMA 1CBXA 2QIRA 5IV0A 5J8CA 4NSQA 4AVCA 5GCNA 3PFEA 1M4LA 3BJ8A 3LMSA 4MBUA 4Z65A 2PSWA 2V8GA 2ZW4A 4R76A 1XOVA 3V8IA 3NH8A 3FECA 3ISZA 4A32A 2Y0MA 2AFOA 1IU8A 4IK2A 2PJ6A 1TIQA 4NGNA 3KQZA 3KKWA 3KZWA 4NGSA 4P4JA 4ZBGA 1F2PA 1CM0A 3B3VA 4HNWB 4F0XA 1FNOA 4QC6A 1XFOA 3IIBA 2RB7A 1CPXA 4AG7A 5JGFA 2QVPA 4UCPA 4GXHA 1R3NA 4P6YA 1TF9A 2PJ2A 2R1IA 2IL4A 3FIXA 2GANA 3RAMA 1XIXA 4A94A 4AG9A 4PXCA 4C7HA 2IQ6A 1ELMP 4H6ZA 2WZNA 4MRIA 2FT0A 1S5KA 3D2MA 2CF4A 1RXTA 1LRZA 2PJ4A 1FT7A 2CIJA 4MHYA 3W91A 4R6TA 1TKFA 5LRKA 3KHXA 1ZO0A 2EVNA 3SHPA 3WC5A 1V0CA 2VL1A 4PXEA 1NSLA 1QQ9A 3H4QA 2A4NA 3IFEA 4IHMA 1BO4A 4JXRA 4H89A 4MCSA 1ELLP 4G1PA 5LRJA 2F8HA 1JWQA 1LOKA 3D3SA 3CXQA 5I0CA 2YNCA 2FE7A 2RC4A 2C6PA 2ZXVA 1NE9A 1H8LA 2PIZA 1MJBA 1ZLHA 3G8WA 2WPXA 1HDQA 1R43A 2HV2A 5E96A 3TCVA 1GHEA 3IEHA 4CYNA 3TE4A 1M1DA 4PV6A 4LQGA 2BSWA 1A2ZA 1KWMA 1YLEA 5IB9A 2O28A 3QAYA 4DYOA 4CGMA 1QSRA 2VBQA 4R3KA 1HDUA 4MCRA 2FS5A 1QSOA 2ZW5A 4P4EA 3TC8A 2ODFA 3IGRA 4HKFA 2PDOA 2GU2A 2B5GB 4MI4A 4A33A 1ZLIA 1CP6A 5H84A 2ZPAA 2OOTA 1LAMA 1WWZA 4MJ8A 4NGPA 2DEAA 5JH9A 3WT4A 5AG5A 2DPSA 1ARMA 2JEVA 3R1KA 4ORFA 3I1UA 5G20A 3RZAA 4CRYB 4E8OA 2Z3NA 5F46A 5HMNA 4OC4A 4UF4A 2VZYA 1Q7LA 5CPAA 2IJZA 1RTQA 4UFXA 1XE4A 4JXQA 4PSXA 1Q2DA 2GFQA 4PXDA 3VWEA 2Z10A 2G9DA 2ZENA 3FRMA 4JYWA 4MMOA 1KUYA 3KR4A 4MFKA 1BPMA 1VKCA 4YU9A 2EBJA 4B10A 4IF5A 3CXSA 1CPSA 2B5GA 2OZHA 2EUIA 4KVME 4MHZA 3PB8X 4CS0B 2R7HA 4NEXA 3TO9A 4ZI6A 2BUEA 3LACA 4PPZA 2QYVA 1NMTA 4A38A 2PJ5A 2V77A 2ZEOA 5THWA 5J8FA 1XBUA 4QVTA 4Y49B 5ISVA 2G0BA 2JBKA 4HNYB 4MFPA 1Z9UA 5IX3A 5LYFA 1Z4EA 3ISXA 5ELYA 5KTAA 2R98A 3FXTA 4A39A 1M4IA 1Z8LA 2C6GA 4XPDB 2PVVA 3NFZA 3P2FA 4B5PB 1IY7A 4HPSA 3IC1A 5HVHA 2G3AA 2CXAA 3EXNA 1LAPA 2Z3KA 4X2TA 3PEIA 2PJ8A 1MJAA 3EFAA 4R87A 1VGYA 2VXKA 2OU2A 2Z11A 3NE7A 3FVLA 4NGMA 1MJ9A 2ZOFA 1Q2CA 5K8PA 2QMLA 3QAHA 4CAEA 2PJBA 4UEEA 1QMUA 2CY2A 3GKRA 4FD4A 4FD7A 4MCQA 4R3LA 4U9ZA 4L8AA 4C68A 3C26A 4JJXA 3PBBA 3KGQA 2ZEEA 4KOSA 4OC1A 5HVGA 2OB0A 1B87A 3MGDA 3TTHA 1PCAA 2I3CA 2AJ6A 2EK8A 4OC3A 3WC6A 2IMOA 4YFJA 4R7MA 1M44A 2FL4A 1Z5RA 2ZEDA 4K30A 4XPDC 2P0WA 2Q4ZA 3IO1A 2CNMA 2AFXA 3PB7X 2ABZA 2ZOGA 4OAEA 2B58A 3DR6A 3B3WA 3F8KA 4EVYA 4ZY1A 2C27A 3VARA 3D68A 3GUXA 4Q38A 3V7ZA 4MFLA 2DXQA 1X12A 2BL1A 1YVOA 4M85A 4NXYA 2AFUA 1VHEA 1Z8WA 2PJ3A 4OMEA 3KL9A 4P4BA 3PB6X 2FSRA 1TXRA 2POKA 5CBMA 4F8ZA 2D4PA 1IICA 2B4BA 1IYKA 4KLVA 3RO0A 2AFZA 3H8EA 2P6FA 2AFSA 5CNPA 2F5IA 1BPNA 2HQYA 4CYQA 2G3TA 3SJGA 4B14A 4ZY2A 1AMPA 2ZEPA 2AE6A 3EO4A 4KOTA 1F2OA 2XEGA 4NJQA 2NSMA 2B4DB 3TO6A 5EC4A 3CDXA 3PP9A 4KOXA 5C82A 2P6GA 4XNHC 1PU9A 4BBHA 1XRYA 4KOWA 2O4HA 3SI1A 5G21A 2OZUA 3MN8A 4KORA 4OIDA 3HLPA 4MHNA 4C2ZA 4C2YA 8CPAA 1GYTA 3TT2A 5AG4A 4UBRA 2BOAA 1N71A 3BXMA 1K4JA 4MCPA 4P4DA 5AG7A 3R95A 3PFOA 3H8FA 1LFWA 1LCPA 2J8RA 2Z3MA 3S6FA 3WABA 1PYTB 4R57A 4UWIA 3B7IA 4A95A 3GY9A 2H5MA 2CNTA 4CGNA 1YSJA 1Z8XA 1I1DA 3FYNA 4TNUA 1S60A 1QSMA 4IUSA 2PJAA 5F49A 3DNSA 4GS4A 1XMTA 4OC0A 4LQ6A 4P4IA 2BO9A 1KUXA 1YGHA 2ATRA 4A37A 4A31A 3I9SA 1YREA 3WR7A 1J4JA 2WPWA 4M6IA 3D4UA 3KQXA 4OP4A 4CYPA 4CAWA 2Q51A 4II9A 5HH1A 2DF5A 3TOAA 3I3GA 3V38A 3H5ZA 5A28A 3IU1A 3VH9A 3G3SA 4ONUA 4DUKA 1IGBA 4C7IA 4E0AA 4FBEA 2OH1A 2ZEFA 2QJ8A 2PE3A 1IOFA 3JVNA 4MFJA 2VI7A 2WYRA 5H86A 5KTCA 4DJLA 2PQ8A 1F57A 1YK3A 2YGWA 4M6HA 4NGRA 4ZX8A 2EWBA 4CAFA 3FJUA 2PJ7A 3JRUA 4P10A 4AB7A 2Q4VA 2J8NA 3CXPA 4NFRA 4R9MA 1YLOA 3W6SA
chains in the Genus database with same CATH topology
2BEIA 1Z4RA 4H6UA 4YGOA 4KZTA 2PR8A 4DNCA 1PUAA 3VWDA 2B3VA 4UWJA 1Y7RA 4YRHA 3TOBA 3DSBA 3FBUA 1IIDA 2PC1A 2JDDA 5DWMA 3JUWA 3S6GA 4OADA 2B3UA 4C2XA 3BJ7A 1M4GA 3S6KA 3F5BA 1UFHA 1P0HA 3IWEA 3ZJ0A 2HUZA 1KUVA 4B11A 2D4OA 1R57A 3R9GA 4UCNA 4CGLA 2Z3LA 2Q7BA 1KZFA 3RYOA 4KS9A 1XF8A 4B5PA 2Z3PA 4CGPA 3B8GA 3E0KA 4UA3A 2OZGA 1S7NA 2KCWA 4XPLA 2I79A 4JLYA 4X5KA 4UFVA 1M4DA 3ZZIA 4KUAA 2ZW6A 5IB0A 4XNHB 3S6HA 2REEA 4B12A 4FD6A 4AVBA 2FXFA 2WSAA 2WUUA 4U5YA 3LD2A 2DPTA 2PRBA 4RI1A 3JTKA 4KOYA 1S3ZA 4Q36A 4B13A 2FCKA 5DWNA 4NF1A 1IB1E 2Q04A 2Q4YA 3T90A 5KTDA 2VEZA 1S7LA 2J8MA 4MFQA 3K9UA 4KSFA 5AGEA 3SXNA 1YR0A 5A27A 3D8PA 4OLLA 5BWAB 2NMTA 2REFA 4LX9A 5AG6A 1SQHA 4MY0A 4F6AA 1I12A 3EY5A 3GYAA 3D2PA 2B4DA 2R8VA 4PSWA 2K5TA 4UCMA 4J3GA 4U9YA 1L0CA 4HNXB 1Y9KA 2CNSA 4A30A 4QBJA 4F0YA 3P2HA 4CYOA 2VZZA 5C88A 3TFYA 4E2AA 2JDCA 4AVAA 2ZW7A 2Z0ZA 1OZPA 1U6MA 2YNCC 5FVJA 4BMHA 1BOBA 4CAVA 1I21A 3DR8A 3R9FA 4B5OA 4NCZA 1S7FA 3QB8A 2Q44A 4A2ZA 1RO5A 5JPHA 3N7ZA 4XPKA 4CRZB 1Y9WA 3FB3A 4KVOE 3EC4A 5F47A 1MK4A 4FD5A 4KOVA 4RS2A 1XEBA 5F48A 2ARHA 3R96A 2Z3OA 1ON0A 1B6BA 4KSAA 3BLNA 3F0AA 3W6XA 1VHSA 1CJWA 3A9LA 3IWGA 4M3SA 3UY5A 4CAXA 4QUSA 4JWPA 2Q0YA 3PGPA 2FIWA 2X7BA 5G22A 4KUBA 4MFZA 3R9EA 1WK4A 4QB9A 4CGOA 3IU2A 2GE3A 4PK2A 1QSNA 2I00A 4KLWA 4KVXA 4MY3A 3OWCA 1IYLA 4L89A 1YVKA 2P6EA 3TO7A 4UFWA 2JLMA 4I49A 1S7KA 4PK3A 3T9YA 2GIVA 1Q2YA 5JQ4A 4ZGYB 1FY7A 4MHDA 4Y49C 3SXOA 2PR1A 2YNDA 3DDDA 4JD6A 4LUAA 5G1ZA 3FNCA 2VQYA 2YNEA 4KOUA 5EBVA 2FIAA 1YX0A 1P4NA 2QECA 3PZJA 3LODA 1QSTA 5IV0A 2QIRA 5J8CA 4NSQA 4AVCA 5GCNA 3BJ8A 4MBUA 2PSWA 2ZW4A 3V8IA 4A32A 2Y0MA 1TIQA 3KKWA 4ZBGA 4HNWB 1CM0A 4F0XA 4QC6A 4AG7A 4UCPA 2R1IA 2IL4A 3FIXA 2GANA 4AG9A 1XIXA 4C7HA 4H6ZA 2FT0A 1S5KA 3D2MA 1RXTA 1LRZA 3W91A 1ZO0A 2EVNA 3SHPA 1V0CA 1NSLA 3H4QA 2A4NA 1BO4A 4JXRA 4H89A 5I0CA 3D3SA 3CXQA 2YNCA 2FE7A 2RC4A 2ZXVA 1NE9A 1MJBA 5E96A 3G8WA 2WPXA 3TCVA 2HV2A 4CYNA 3TE4A 1GHEA 1M1DA 4PV6A 2BSWA 1YLEA 2O28A 4CGMA 1QSRA 2VBQA 4R3KA 2FS5A 1QSOA 2ZW5A 3IGRA 4HKFA 2PDOA 2B5GB 4MI4A 4A33A 5H84A 2ZPAA 1WWZA 4MJ8A 5AG5A 2DPSA 4ORFA 2JEVA 3R1KA 4CRYB 4E8OA 5G20A 5F46A 2Z3NA 5HMNA 2VZYA 4UFXA 1XE4A 4JXQA 4PSXA 1Q2DA 3VWEA 2Z10A 3FRMA 1KUYA 4MFKA 1VKCA 4B10A 4IF5A 3CXSA 4KVME 2B5GA 2OZHA 2EUIA 4CS0B 2R7HA 4NEXA 3TO9A 2BUEA 1NMTA 5ISVA 5J8FA 4QVTA 4Y49B 2G0BA 4HNYB 4MFPA 1Z9UA 5IX3A 1Z4EA 5KTAA 2R98A 3FXTA 1M4IA 4XPDB 3P2FA 4B5PB 2G3AA 2CXAA 3EXNA 2Z3KA 1MJAA 3EFAA 4R87A 2VXKA 2OU2A 2Z11A 3NE7A 1MJ9A 1Q2CA 2QMLA 3QAHA 4CAEA 2CY2A 3GKRA 4FD4A 4FD7A 4R3LA 4U9ZA 4L8AA 4C68A 3C26A 4JJXA 4KOSA 2OB0A 1B87A 3MGDA 3TTHA 2AJ6A 4YFJA 1M44A 2FL4A 4K30A 4XPDC 2P0WA 2CNMA 4OAEA 2B58A 3DR6A 3F8KA 4EVYA 2C27A 4Q38A 4MFLA 2DXQA 2BL1A 1YVOA 4M85A 4NXYA 2FSRA 2D4PA 1IICA 2B4BA 1IYKA 4KLVA 2P6FA 5CNPA 2F5IA 2HQYA 4CYQA 2G3TA 4B14A 2AE6A 3EO4A 4KOTA 2B4DB 3TO6A 5EC4A 3PP9A 4KOXA 5C82A 2P6GA 4XNHC 1PU9A 4BBHA 4KOWA 5G21A 2OZUA 4KORA 4C2ZA 4C2YA 3TT2A 5AG4A 4UBRA 1N71A 1K4JA 5AG7A 3R95A 2Z3MA 2J8RA 3S6FA 4R57A 4UWIA 4A95A 3GY9A 2H5MA 2CNTA 4CGNA 1I1DA 3FYNA 1S60A 1QSMA 4IUSA 5F49A 3DNSA 4GS4A 1XMTA 1KUXA 1YGHA 2ATRA 4A31A 3I9SA 1YREA 3WR7A 1J4JA 2WPWA 4CYPA 4CAWA 4II9A 5HH1A 3TOAA 3I3GA 3H5ZA 5A28A 3IU1A 3G3SA 4ONUA 4E0AA 4C7IA 2OH1A 3JVNA 4MFJA 5H86A 2VI7A 5KTCA 2PQ8A 1YK3A 2YGWA 4CAFA 4AB7A 2Q4VA 2J8NA 3CXPA 4R9MA 3W6SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BEI A;  1Z4R A;  4H6U A;  4YGO A;  4KZT A;  2PR8 A;  4DNC A;  1PUA A;  3VWD A;  2B3V A;  4UWJ A;  1Y7R A;  4YRH A;  3TOB A;  3DSB A;  3FBU A;  1IID A;  2PC1 A;  2JDD A;  5DWM A;  3JUW A;  3S6G A;  4OAD A;  2B3U A;  3BJ7 A;  1M4G A;  3S6K A;  3F5B A;  1UFH A;  1P0H A;  3ZJ0 A;  2HUZ A;  1KUV A;  2D4O A;  1R57 A;  3R9G A;  2Q7B A;  1KZF A;  3RYO A;  1XF8 A;  4B5P A;  3B8G A;  3E0K A;  4UA3 A;  2OZG A;  1S7N A;  2KCW A;  4XPL A;  2I79 A;  4JLY A;  4X5K A;  1M4D A;  3ZZI A;  4KUA A;  2ZW6 A;  5IB0 A;  4XNH B;  3S6H A;  2REE A;  4FD6 A;  4AVB A;  2FXF A;  4U5Y A;  3LD2 A;  2PRB A;  4RI1 A;  4KOY A;  1S3Z A;  2FCK A;  5DWN A;  4NF1 A;  1IB1 E;  2Q04 A;  2Q4Y A;  3T90 A;  5KTD A;  2VEZ A;  1S7L A;  2J8M A;  3K9U A;  3SXN A;  1YR0 A;  3D8P A;  4OLL A;  2NMT A;  2REF A;  4LX9 A;  1SQH A;  4MY0 A;  4F6A A;  1I12 A;  3EY5 A;  3D2P A;  2B4D A;  3GYA A;  2R8V A;  4PSW A;  2K5T A;  4J3G A;  4U9Y A;  1L0C A;  4HNX B;  1Y9K A;  2CNS A;  4QBJ A;  4F0Y A;  3P2H A;  2VZZ A;  5C88 A;  3TFY A;  4E2A A;  2JDC A;  4AVA A;  2ZW7 A;  2Z0Z A;  1OZP A;  1U6M A;  4BMH A;  5FVJ A;  4CAV A;  1BOB A;  1I21 A;  3DR8 A;  3R9F A;  4B5O A;  4NCZ A;  1S7F A;  3QB8 A;  2Q44 A;  1RO5 A;  5JPH A;  3N7Z A;  4XPK A;  4CRZ B;  1Y9W A;  3FB3 A;  4KVO E;  3EC4 A;  5F47 A;  1MK4 A;  4FD5 A;  4KOV A;  4RS2 A;  1XEB A;  5F48 A;  2ARH A;  3R96 A;  1ON0 A;  1B6B A;  3BLN A;  3F0A A;  3W6X A;  1VHS A;  1CJW A;  3IWG A;  4M3S A;  3UY5 A;  4CAX A;  4QUS A;  4JWP A;  2Q0Y A;  3PGP A;  2FIW A;  2X7B A;  4KUB A;  3R9E A;  1WK4 A;  4QB9 A;  2GE3 A;  4PK2 A;  1QSN A;  2I00 A;  4KLW A;  4KVX A;  4MY3 A;  3OWC A;  1IYL A;  4L89 A;  1YVK A;  2P6E A;  3TO7 A;  2JLM A;  4I49 A;  1S7K A;  4PK3 A;  3T9Y A;  2GIV A;  1Q2Y A;  5JQ4 A;  1FY7 A;  4MHD A;  4Y49 C;  3SXO A;  2PR1 A;  3DDD A;  4JD6 A;  4LUA A;  3FNC A;  2VQY A;  4KOU A;  5EBV A;  2FIA A;  1YX0 A;  1P4N A;  2QEC A;  3PZJ A;  3LOD A;  1QST A;  5IV0 A;  2QIR A;  5J8C A;  4NSQ A;  4AVC A;  5GCN A;  3BJ8 A;  4MBU A;  2PSW A;  2ZW4 A;  3V8I A;  2Y0M A;  1TIQ A;  3KKW A;  4ZBG A;  4HNW B;  1CM0 A;  4QC6 A;  4AG7 A;  2R1I A;  2IL4 A;  3FIX A;  2GAN A;  4AG9 A;  1XIX A;  4H6Z A;  2FT0 A;  1S5K A;  3D2M A;  1RXT A;  1LRZ A;  3W91 A;  2EVN A;  3SHP A;  1V0C A;  1NSL A;  3H4Q A;  2A4N A;  1BO4 A;  4JXR A;  4H89 A;  5I0C A;  3D3S A;  3CXQ A;  2FE7 A;  2RC4 A;  2ZXV A;  1NE9 A;  1MJB A;  5E96 A;  3G8W A;  2WPX A;  3TCV A;  2HV2 A;  3TE4 A;  1GHE A;  1M1D A;  4PV6 A;  2BSW A;  1YLE A;  2O28 A;  1QSR A;  2VBQ A;  4R3K A;  2FS5 A;  1QSO A;  2ZW5 A;  3IGR A;  4HKF A;  2PDO A;  2B5G B;  4MI4 A;  5H84 A;  2ZPA A;  1WWZ A;  4MJ8 A;  4CRY B;  4ORF A;  2JEV A;  3R1K A;  4E8O A;  5F46 A;  5HMN A;  2VZY A;  1XE4 A;  4JXQ A;  4PSX A;  1Q2D A;  3VWE A;  2Z10 A;  3FRM A;  1KUY A;  1VKC A;  4IF5 A;  3CXS A;  4KVM E;  2B5G A;  2OZH A;  2EUI A;  4CS0 B;  2R7H A;  4NEX A;  3TO9 A;  2BUE A;  1NMT A;  5ISV A;  5J8F A;  4QVT A;  4Y49 B;  2G0B A;  4HNY B;  1Z9U A;  5IX3 A;  1Z4E A;  5KTA A;  2R98 A;  3FXT A;  1M4I A;  4XPD B;  3P2F A;  4B5P B;  2G3A A;  3EXN A;  1MJA A;  3EFA A;  4R87 A;  2VXK A;  2OU2 A;  2Z11 A;  3NE7 A;  1MJ9 A;  1Q2C A;  2QML A;  3QAH A;  2CY2 A;  3GKR A;  4FD4 A;  4FD7 A;  4R3L A;  4U9Z A;  4L8A A;  3C26 A;  4JJX A;  4KOS A;  2OB0 A;  1B87 A;  3MGD A;  3TTH A;  2AJ6 A;  4YFJ A;  1M44 A;  2FL4 A;  4K30 A;  4XPD C;  2P0W A;  2CNM A;  4OAE A;  2B58 A;  3DR6 A;  3F8K A;  4EVY A;  2C27 A;  2DXQ A;  2BL1 A;  1YVO A;  4M85 A;  4NXY A;  2FSR A;  2D4P A;  1IIC A;  2B4B A;  1IYK A;  4KLV A;  2P6F A;  5CNP A;  2F5I A;  2HQY A;  2G3T A;  2AE6 A;  3EO4 A;  4KOT A;  2B4D B;  3TO6 A;  5EC4 A;  3PP9 A;  4KOX A;  5C82 A;  2P6G A;  4XNH C;  1PU9 A;  4KOW A;  2OZU A;  4KOR A;  3TT2 A;  4UBR A;  1N71 A;  1K4J A;  3R95 A;  2J8R A;  3S6F A;  4R57 A;  4UWI A;  3GY9 A;  2H5M A;  2CNT A;  1I1D A;  3FYN A;  1S60 A;  1QSM A;  4IUS A;  5F49 A;  3DNS A;  4GS4 A;  1XMT A;  1KUX A;  1YGH A;  2ATR A;  3I9S A;  1YRE A;  3WR7 A;  1J4J A;  2WPW A;  4CAW A;  4II9 A;  5HH1 A;  3TOA A;  3I3G A;  3G3S A;  4ONU A;  4E0A A;  2OH1 A;  3JVN A;  5H86 A;  2VI7 A;  5KTC A;  2PQ8 A;  1YK3 A;  4AB7 A;  2Q4V A;  2J8N A;  3CXP A;  4R9M A;  3W6S A; 
#chains in the Genus database with same CATH topology
 2BEI A;  1Z4R A;  1HEE A;  2JEW A;  3MRU A;  1YW6 A;  4H6U A;  4YGO A;  4PXB A;  3FF3 A;  4KZT A;  4P44 A;  2PR8 A;  4DNC A;  2HB6 A;  4NJR A;  1PUA A;  3SI2 A;  3VWD A;  2B3V A;  4UWJ A;  1Y7R A;  4YRH A;  3TOB A;  1JQG A;  3LWU A;  3QNV A;  3DSB A;  3FBU A;  3NH5 A;  3PRT A;  1IID A;  3D7H A;  4MXU A;  2GLF A;  2PC1 A;  3NE8 A;  2JDD A;  4WJB A;  5DWM A;  3S9M A;  3JUW A;  3S6G A;  4OAD A;  4BIN A;  4ONW A;  2B3U A;  4C2X A;  2CTB A;  3BJ7 A;  5LYI A;  1M4G A;  3S6K A;  3F5B A;  1UFH A;  1P0H A;  3IWE A;  3DLJ A;  5LYL A;  1DE4 C;  3ZJ0 A;  2HUZ A;  1KUV A;  4B11 A;  5I4M A;  2D4O A;  1Z2L A;  3FMC A;  1R57 A;  7CPA A;  3R9G A;  5K8M A;  4UCN A;  3RBU A;  2GLJ A;  2NYQ A;  2O53 A;  3FH4 A;  4CGL A;  2Z3L A;  2Q7B A;  1KZF A;  3RYO A;  4ZY0 A;  4KS9 A;  2AFW A;  1XF8 A;  4B5P A;  1UWY A;  2Z3P A;  4CGP A;  2PJ1 A;  3B8G A;  3E0K A;  4UA3 A;  2OZG A;  2RFH A;  1TKH A;  1S7N A;  2KCW A;  4XPL A;  2I79 A;  4JLY A;  4X5K A;  4UFV A;  1M4D A;  3ZZI A;  4KUA A;  3HUV A;  2V8V A;  2PIY A;  2ZW6 A;  5IB0 A;  4XNH B;  1Y0Y A;  3PB9 X;  4W9Y A;  3S6H A;  2REE A;  4B12 A;  3NH4 A;  4FD6 A;  4AVB A;  2V8D A;  2FXF A;  2WSA A;  3BHX A;  2WUU A;  4H2K A;  4U5Y A;  1CX8 A;  4FAI A;  3LD2 A;  2DPT A;  2PRB A;  4RI1 A;  3SJF A;  3JTK A;  1YME A;  5F09 A;  4KOY A;  3PBE A;  1S3Z A;  4OIW A;  4Q36 A;  4B13 A;  2FCK A;  5DWN A;  4NF1 A;  3T8W A;  1IB1 E;  3NA6 A;  4F9V A;  2PJ9 A;  2Q04 A;  2Q4Y A;  3T90 A;  5KTD A;  2VEZ A;  2GRE A;  1S7L A;  2PJC A;  3B3S A;  4RN7 A;  4UIA A;  3KAS A;  2J8M A;  5JM6 A;  4MFQ A;  2ZEM A;  3DGV A;  4BD9 A;  6CPA A;  3K9U A;  4KSF A;  5AGE A;  3SXN A;  1YR0 A;  4FWU A;  4FUU A;  5A27 A;  3D8P A;  4OLL A;  5BWA B;  4ZYQ A;  2Q7S A;  1BAV A;  4YWY A;  2NMT A;  2REF A;  3H8G A;  3KR5 A;  4X3R A;  4LX9 A;  3RNZ A;  5HVF A;  5AG6 A;  1ARL A;  1SQH A;  3FED A;  4MY0 A;  4F6A A;  4F9U A;  4PQA A;  4NGT A;  1I12 A;  2F7V A;  3D7D A;  2C6C A;  3D7F A;  3EY5 A;  5LYD A;  3B35 A;  3S9L A;  2EK9 A;  3D2P A;  2B4D A;  3GYA A;  2R8V A;  2ZEH A;  4PSW A;  1Y0R A;  1NSA A;  2K5T A;  3S9N A;  5K8N A;  4UCM A;  3GB0 A;  4O23 A;  3BI0 A;  4J3G A;  4U9Y A;  1L0C A;  4OC5 A;  4HNX B;  1Y9K A;  1ZG7 A;  2CNS A;  3CT9 A;  4A30 A;  4QBJ A;  1DTD A;  5LRG A;  5D29 A;  2PCU A;  2C1C A;  2XEI A;  4F0Y A;  2Q43 A;  2ZEL A;  3GLJ A;  3P2H A;  4M6G A;  2VZZ A;  4CYO A;  5C88 A;  4ZX9 A;  3TFY A;  4E2A A;  1VIX A;  1Z8T A;  2JDC A;  4AVA A;  4EWT A;  2ZW7 A;  2Z0Z A;  1XMB A;  1OZP A;  1U6M A;  2PRQ A;  2YNC C;  5FVJ A;  1BOB A;  2PVW A;  1I21 A;  4UEZ A;  4BMH A;  4CAV A;  2XEJ A;  1TF8 A;  2FVG A;  4R8F A;  3DR8 A;  3R9F A;  4B5O A;  4GM5 A;  3D67 A;  4NCZ A;  4Q7A A;  2XEF A;  1S7F A;  3B3T A;  3L2N A;  3QB8 A;  4OKO A;  2Q44 A;  4A2Z A;  3N5F A;  1EE3 P;  1XJO A;  3KHZ A;  1RO5 A;  5JPH A;  2HC9 A;  5EMI A;  1OBR A;  3IWW A;  2EO8 A;  3N7Z A;  4XPK A;  3WC7 A;  4CRZ B;  1Y9W A;  2V8H A;  1ZG9 A;  3FB3 A;  4WWV A;  3SJX A;  4EME A;  4KVO E;  3EC4 A;  3D7G A;  5F47 A;  1MK4 A;  5D8N A;  4OC2 A;  2J9A A;  4FD5 A;  1YQE A;  4KOV A;  4RS2 A;  1AUG A;  5K8O A;  1X10 A;  1CP7 A;  1XEB A;  2ZEG A;  5F48 A;  2ARH A;  3R96 A;  1LAN A;  2Z3O A;  4MHP A;  1ON0 A;  2ANP A;  4RUH A;  5HXD A;  1B6B A;  4KSA A;  3BLN A;  3F0A A;  3W6X A;  1CJW A;  1VHS A;  3A9L A;  3FEE A;  4P45 A;  3VAT A;  4B6Z A;  1CG2 A;  3IWG A;  4M3S A;  3UY5 A;  3TX8 A;  4CAX A;  3CPA A;  4QUS A;  4JWP A;  1ZG8 A;  2Q0Y A;  2PJ0 A;  4K3N A;  2CTC A;  3PGP A;  2FIW A;  2X7B A;  5G22 A;  4KUB A;  4MFZ A;  3R9E A;  4X8I A;  1YW4 A;  1WK4 A;  4QB9 A;  3SJE A;  3PB4 X;  2BCO A;  3SI0 A;  3BI1 A;  4P4F A;  4CGO A;  5J1Q A;  3IU2 A;  2GE3 A;  3B2Y A;  4PK2 A;  1QSN A;  2I00 A;  4KLW A;  4KVX A;  4MY3 A;  3OWC A;  4EFD A;  1IOI A;  1IYL A;  4L89 A;  4KSI A;  1YVK A;  3CPX A;  4UIB A;  2P6E A;  3K2K A;  3TO7 A;  4UFW A;  2JLM A;  3IJ3 A;  4I49 A;  2JBJ A;  3KI9 A;  1S7K A;  4PK3 A;  3T9Y A;  2GIV A;  3CZX A;  1Q2Y A;  3K9T A;  4UEF A;  4CPA A;  5JQ4 A;  3GIU A;  1FY7 A;  4IAV A;  4MHD A;  4Y49 C;  4ZGY B;  3SXO A;  2PR1 A;  4NGQ A;  1Y7E A;  2YND A;  3DDD A;  4JD6 A;  4LUA A;  3FX6 A;  5G1Z A;  3D66 A;  3FNC A;  2VQY A;  1BLL E;  1VHO A;  2OR4 A;  2YNE A;  4JZ0 A;  5DS0 A;  4KOU A;  5EBV A;  4TWE A;  2FIA A;  1YX0 A;  3B3C A;  1P4N A;  2QEC A;  3PZJ A;  3LOD A;  4AXV A;  1QST A;  1AYE A;  1TKJ A;  2AFM A;  1CBX A;  2QIR A;  5IV0 A;  5J8C A;  4NSQ A;  4AVC A;  5GCN A;  3PFE A;  1M4L A;  3BJ8 A;  3LMS A;  4MBU A;  4Z65 A;  2PSW A;  2V8G A;  2ZW4 A;  4R76 A;  1XOV A;  3V8I A;  3NH8 A;  3FEC A;  3ISZ A;  4A32 A;  2Y0M A;  2AFO A;  1IU8 A;  4IK2 A;  2PJ6 A;  1TIQ A;  4NGN A;  3KQZ A;  3KKW A;  3KZW A;  4NGS A;  4P4J A;  4ZBG A;  1F2P A;  1CM0 A;  3B3V A;  4HNW B;  4F0X A;  1FNO A;  4QC6 A;  1XFO A;  3IIB A;  2RB7 A;  1CPX A;  4AG7 A;  5JGF A;  2QVP A;  4UCP A;  4GXH A;  1R3N A;  4P6Y A;  1TF9 A;  2PJ2 A;  2R1I A;  2IL4 A;  3FIX A;  2GAN A;  3RAM A;  1XIX A;  4A94 A;  4AG9 A;  4PXC A;  4C7H A;  2IQ6 A;  1ELM P;  4H6Z A;  2WZN A;  4MRI A;  2FT0 A;  1S5K A;  3D2M A;  2CF4 A;  1RXT A;  1LRZ A;  2PJ4 A;  1FT7 A;  2CIJ A;  4MHY A;  3W91 A;  4R6T A;  1TKF A;  5LRK A;  3KHX A;  1ZO0 A;  2EVN A;  3SHP A;  3WC5 A;  1V0C A;  2VL1 A;  4PXE A;  1NSL A;  1QQ9 A;  3H4Q A;  2A4N A;  3IFE A;  4IHM A;  1BO4 A;  4JXR A;  4H89 A;  4MCS A;  1ELL P;  4G1P A;  5LRJ A;  2F8H A;  1JWQ A;  1LOK A;  3D3S A;  3CXQ A;  5I0C A;  2YNC A;  2FE7 A;  2RC4 A;  2C6P A;  2ZXV A;  1NE9 A;  1H8L A;  2PIZ A;  1MJB A;  1ZLH A;  3G8W A;  2WPX A;  1HDQ A;  1R43 A;  2HV2 A;  5E96 A;  3TCV A;  1GHE A;  3IEH A;  4CYN A;  3TE4 A;  1M1D A;  4PV6 A;  4LQG A;  2BSW A;  1A2Z A;  1KWM A;  1YLE A;  5IB9 A;  2O28 A;  3QAY A;  4DYO A;  4CGM A;  1QSR A;  2VBQ A;  4R3K A;  1HDU A;  4MCR A;  2FS5 A;  1QSO A;  2ZW5 A;  4P4E A;  3TC8 A;  2ODF A;  3IGR A;  4HKF A;  2PDO A;  2GU2 A;  2B5G B;  4MI4 A;  4A33 A;  1ZLI A;  1CP6 A;  5H84 A;  2ZPA A;  2OOT A;  1LAM A;  1WWZ A;  4MJ8 A;  4NGP A;  2DEA A;  5JH9 A;  3WT4 A;  5AG5 A;  2DPS A;  1ARM A;  2JEV A;  3R1K A;  4ORF A;  3I1U A;  5G20 A;  3RZA A;  4CRY B;  4E8O A;  2Z3N A;  5F46 A;  5HMN A;  4OC4 A;  4UF4 A;  2VZY A;  1Q7L A;  5CPA A;  2IJZ A;  1RTQ A;  4UFX A;  1XE4 A;  4JXQ A;  4PSX A;  1Q2D A;  2GFQ A;  4PXD A;  3VWE A;  2Z10 A;  2G9D A;  2ZEN A;  3FRM A;  4JYW A;  4MMO A;  1KUY A;  3KR4 A;  4MFK A;  1BPM A;  1VKC A;  4YU9 A;  2EBJ A;  4B10 A;  4IF5 A;  3CXS A;  1CPS A;  2B5G A;  2OZH A;  2EUI A;  4KVM E;  4MHZ A;  3PB8 X;  4CS0 B;  2R7H A;  4NEX A;  3TO9 A;  4ZI6 A;  2BUE A;  3LAC A;  4PPZ A;  2QYV A;  1NMT A;  4A38 A;  2PJ5 A;  2V77 A;  2ZEO A;  5THW A;  5J8F A;  1XBU A;  4QVT A;  4Y49 B;  5ISV A;  2G0B A;  2JBK A;  4HNY B;  4MFP A;  1Z9U A;  5IX3 A;  5LYF A;  1Z4E A;  3ISX A;  5ELY A;  5KTA A;  2R98 A;  3FXT A;  4A39 A;  1M4I A;  1Z8L A;  2C6G A;  4XPD B;  2PVV A;  3NFZ A;  3P2F A;  4B5P B;  1IY7 A;  4HPS A;  3IC1 A;  5HVH A;  2G3A A;  2CXA A;  3EXN A;  1LAP A;  2Z3K A;  4X2T A;  3PEI A;  2PJ8 A;  1MJA A;  3EFA A;  4R87 A;  1VGY A;  2VXK A;  2OU2 A;  2Z11 A;  3NE7 A;  3FVL A;  4NGM A;  1MJ9 A;  2ZOF A;  1Q2C A;  5K8P A;  2QML A;  3QAH A;  4CAE A;  2PJB A;  4UEE A;  1QMU A;  2CY2 A;  3GKR A;  4FD4 A;  4FD7 A;  4MCQ A;  4R3L A;  4U9Z A;  4L8A A;  4C68 A;  3C26 A;  4JJX A;  3PBB A;  3KGQ A;  2ZEE A;  4KOS A;  4OC1 A;  5HVG A;  2OB0 A;  1B87 A;  3MGD A;  3TTH A;  1PCA A;  2I3C A;  2AJ6 A;  2EK8 A;  4OC3 A;  3WC6 A;  2IMO A;  4YFJ A;  4R7M A;  1M44 A;  2FL4 A;  1Z5R A;  2ZED A;  4K30 A;  4XPD C;  2P0W A;  2Q4Z A;  3IO1 A;  2CNM A;  2AFX A;  3PB7 X;  2ABZ A;  2ZOG A;  4OAE A;  2B58 A;  3DR6 A;  3B3W A;  3F8K A;  4EVY A;  4ZY1 A;  2C27 A;  3VAR A;  3D68 A;  3GUX A;  4Q38 A;  3V7Z A;  4MFL A;  2DXQ A;  1X12 A;  2BL1 A;  1YVO A;  4M85 A;  4NXY A;  2AFU A;  1VHE A;  1Z8W A;  2PJ3 A;  4OME A;  3KL9 A;  4P4B A;  3PB6 X;  2FSR A;  1TXR A;  2POK A;  5CBM A;  4F8Z A;  2D4P A;  1IIC A;  2B4B A;  1IYK A;  4KLV A;  3RO0 A;  2AFZ A;  3H8E A;  2P6F A;  2AFS A;  5CNP A;  2F5I A;  1BPN A;  2HQY A;  4CYQ A;  2G3T A;  3SJG A;  4B14 A;  4ZY2 A;  1AMP A;  2ZEP A;  2AE6 A;  3EO4 A;  4KOT A;  1F2O A;  2XEG A;  4NJQ A;  2NSM A;  2B4D B;  3TO6 A;  5EC4 A;  3CDX A;  3PP9 A;  4KOX A;  5C82 A;  2P6G A;  4XNH C;  1PU9 A;  4BBH A;  1XRY A;  4KOW A;  2O4H A;  3SI1 A;  5G21 A;  2OZU A;  3MN8 A;  4KOR A;  4OID A;  3HLP A;  4MHN A;  4C2Z A;  4C2Y A;  8CPA A;  1GYT A;  3TT2 A;  5AG4 A;  4UBR A;  2BOA A;  1N71 A;  3BXM A;  1K4J A;  4MCP A;  4P4D A;  5AG7 A;  3R95 A;  3PFO A;  3H8F A;  1LFW A;  1LCP A;  2J8R A;  2Z3M A;  3S6F A;  3WAB A;  1PYT B;  4R57 A;  4UWI A;  3B7I A;  4A95 A;  3GY9 A;  2H5M A;  2CNT A;  4CGN A;  1YSJ A;  1Z8X A;  1I1D A;  3FYN A;  4TNU A;  1S60 A;  1QSM A;  4IUS A;  2PJA A;  5F49 A;  3DNS A;  4GS4 A;  1XMT A;  4OC0 A;  4LQ6 A;  4P4I A;  2BO9 A;  1KUX A;  1YGH A;  2ATR A;  4A37 A;  4A31 A;  3I9S A;  1YRE A;  3WR7 A;  1J4J A;  2WPW A;  4M6I A;  3D4U A;  3KQX A;  4OP4 A;  4CYP A;  4CAW A;  2Q51 A;  4II9 A;  5HH1 A;  2DF5 A;  3TOA A;  3I3G A;  3V38 A;  3H5Z A;  5A28 A;  3IU1 A;  3VH9 A;  3G3S A;  4ONU A;  4DUK A;  1IGB A;  4C7I A;  4E0A A;  4FBE A;  2OH1 A;  2ZEF A;  2QJ8 A;  2PE3 A;  1IOF A;  3JVN A;  4MFJ A;  2VI7 A;  2WYR A;  5H86 A;  5KTC A;  4DJL A;  2PQ8 A;  1F57 A;  1YK3 A;  2YGW A;  4M6H A;  4NGR A;  4ZX8 A;  2EWB A;  4CAF A;  3FJU A;  2PJ7 A;  3JRU A;  4P10 A;  4AB7 A;  2Q4V A;  2J8N A;  3CXP A;  4NFR A;  4R9M A;  1YLO A;  3W6S A; 
#chains in the Genus database with same CATH homology
 2BEI A;  1Z4R A;  4H6U A;  4YGO A;  4KZT A;  2PR8 A;  4DNC A;  1PUA A;  3VWD A;  2B3V A;  4UWJ A;  1Y7R A;  4YRH A;  3TOB A;  3DSB A;  3FBU A;  1IID A;  2PC1 A;  2JDD A;  5DWM A;  3JUW A;  3S6G A;  4OAD A;  2B3U A;  4C2X A;  3BJ7 A;  1M4G A;  3S6K A;  3F5B A;  1UFH A;  1P0H A;  3IWE A;  3ZJ0 A;  2HUZ A;  1KUV A;  4B11 A;  2D4O A;  1R57 A;  3R9G A;  4UCN A;  4CGL A;  2Z3L A;  2Q7B A;  1KZF A;  3RYO A;  4KS9 A;  1XF8 A;  4B5P A;  2Z3P A;  4CGP A;  3B8G A;  3E0K A;  4UA3 A;  2OZG A;  1S7N A;  2KCW A;  4XPL A;  2I79 A;  4JLY A;  4X5K A;  4UFV A;  1M4D A;  3ZZI A;  4KUA A;  2ZW6 A;  5IB0 A;  4XNH B;  3S6H A;  2REE A;  4B12 A;  4FD6 A;  4AVB A;  2FXF A;  2WSA A;  2WUU A;  4U5Y A;  3LD2 A;  2DPT A;  2PRB A;  4RI1 A;  3JTK A;  4KOY A;  1S3Z A;  4Q36 A;  4B13 A;  2FCK A;  5DWN A;  4NF1 A;  1IB1 E;  2Q04 A;  2Q4Y A;  3T90 A;  5KTD A;  2VEZ A;  1S7L A;  2J8M A;  4MFQ A;  3K9U A;  4KSF A;  5AGE A;  3SXN A;  1YR0 A;  5A27 A;  3D8P A;  4OLL A;  5BWA B;  2NMT A;  2REF A;  4LX9 A;  5AG6 A;  1SQH A;  4MY0 A;  4F6A A;  1I12 A;  3EY5 A;  3GYA A;  3D2P A;  2B4D A;  2R8V A;  4PSW A;  2K5T A;  4UCM A;  4J3G A;  4U9Y A;  1L0C A;  4HNX B;  1Y9K A;  2CNS A;  4A30 A;  4QBJ A;  4F0Y A;  3P2H A;  4CYO A;  2VZZ A;  5C88 A;  3TFY A;  4E2A A;  2JDC A;  4AVA A;  2ZW7 A;  2Z0Z A;  1OZP A;  1U6M A;  2YNC C;  5FVJ A;  4BMH A;  1BOB A;  4CAV A;  1I21 A;  3DR8 A;  3R9F A;  4B5O A;  4NCZ A;  1S7F A;  3QB8 A;  2Q44 A;  4A2Z A;  1RO5 A;  5JPH A;  3N7Z A;  4XPK A;  4CRZ B;  1Y9W A;  3FB3 A;  4KVO E;  3EC4 A;  5F47 A;  1MK4 A;  4FD5 A;  4KOV A;  4RS2 A;  1XEB A;  5F48 A;  2ARH A;  3R96 A;  2Z3O A;  1ON0 A;  1B6B A;  4KSA A;  3BLN A;  3F0A A;  3W6X A;  1VHS A;  1CJW A;  3A9L A;  3IWG A;  4M3S A;  3UY5 A;  4CAX A;  4QUS A;  4JWP A;  2Q0Y A;  3PGP A;  2FIW A;  2X7B A;  5G22 A;  4KUB A;  4MFZ A;  3R9E A;  1WK4 A;  4QB9 A;  4CGO A;  3IU2 A;  2GE3 A;  4PK2 A;  1QSN A;  2I00 A;  4KLW A;  4KVX A;  4MY3 A;  3OWC A;  1IYL A;  4L89 A;  1YVK A;  2P6E A;  3TO7 A;  4UFW A;  2JLM A;  4I49 A;  1S7K A;  4PK3 A;  3T9Y A;  2GIV A;  1Q2Y A;  5JQ4 A;  4ZGY B;  1FY7 A;  4MHD A;  4Y49 C;  3SXO A;  2PR1 A;  2YND A;  3DDD A;  4JD6 A;  4LUA A;  5G1Z A;  3FNC A;  2VQY A;  2YNE A;  4KOU A;  5EBV A;  2FIA A;  1YX0 A;  1P4N A;  2QEC A;  3PZJ A;  3LOD A;  1QST A;  5IV0 A;  2QIR A;  5J8C A;  4NSQ A;  4AVC A;  5GCN A;  3BJ8 A;  4MBU A;  2PSW A;  2ZW4 A;  3V8I A;  4A32 A;  2Y0M A;  1TIQ A;  3KKW A;  4ZBG A;  4HNW B;  1CM0 A;  4F0X A;  4QC6 A;  4AG7 A;  4UCP A;  2R1I A;  2IL4 A;  3FIX A;  2GAN A;  4AG9 A;  1XIX A;  4C7H A;  4H6Z A;  2FT0 A;  1S5K A;  3D2M A;  1RXT A;  1LRZ A;  3W91 A;  1ZO0 A;  2EVN A;  3SHP A;  1V0C A;  1NSL A;  3H4Q A;  2A4N A;  1BO4 A;  4JXR A;  4H89 A;  5I0C A;  3D3S A;  3CXQ A;  2YNC A;  2FE7 A;  2RC4 A;  2ZXV A;  1NE9 A;  1MJB A;  5E96 A;  3G8W A;  2WPX A;  3TCV A;  2HV2 A;  4CYN A;  3TE4 A;  1GHE A;  1M1D A;  4PV6 A;  2BSW A;  1YLE A;  2O28 A;  4CGM A;  1QSR A;  2VBQ A;  4R3K A;  2FS5 A;  1QSO A;  2ZW5 A;  3IGR A;  4HKF A;  2PDO A;  2B5G B;  4MI4 A;  4A33 A;  5H84 A;  2ZPA A;  1WWZ A;  4MJ8 A;  5AG5 A;  2DPS A;  4ORF A;  2JEV A;  3R1K A;  4CRY B;  4E8O A;  5G20 A;  5F46 A;  2Z3N A;  5HMN A;  2VZY A;  4UFX A;  1XE4 A;  4JXQ A;  4PSX A;  1Q2D A;  3VWE A;  2Z10 A;  3FRM A;  1KUY A;  4MFK A;  1VKC A;  4B10 A;  4IF5 A;  3CXS A;  4KVM E;  2B5G A;  2OZH A;  2EUI A;  4CS0 B;  2R7H A;  4NEX A;  3TO9 A;  2BUE A;  1NMT A;  5ISV A;  5J8F A;  4QVT A;  4Y49 B;  2G0B A;  4HNY B;  4MFP A;  1Z9U A;  5IX3 A;  1Z4E A;  5KTA A;  2R98 A;  3FXT A;  1M4I A;  4XPD B;  3P2F A;  4B5P B;  2G3A A;  2CXA A;  3EXN A;  2Z3K A;  1MJA A;  3EFA A;  4R87 A;  2VXK A;  2OU2 A;  2Z11 A;  3NE7 A;  1MJ9 A;  1Q2C A;  2QML A;  3QAH A;  4CAE A;  2CY2 A;  3GKR A;  4FD4 A;  4FD7 A;  4R3L A;  4U9Z A;  4L8A A;  4C68 A;  3C26 A;  4JJX A;  4KOS A;  2OB0 A;  1B87 A;  3MGD A;  3TTH A;  2AJ6 A;  4YFJ A;  1M44 A;  2FL4 A;  4K30 A;  4XPD C;  2P0W A;  2CNM A;  4OAE A;  2B58 A;  3DR6 A;  3F8K A;  4EVY A;  2C27 A;  4Q38 A;  4MFL A;  2DXQ A;  2BL1 A;  1YVO A;  4M85 A;  4NXY A;  2FSR A;  2D4P A;  1IIC A;  2B4B A;  1IYK A;  4KLV A;  2P6F A;  5CNP A;  2F5I A;  2HQY A;  4CYQ A;  2G3T A;  4B14 A;  2AE6 A;  3EO4 A;  4KOT A;  2B4D B;  3TO6 A;  5EC4 A;  3PP9 A;  4KOX A;  5C82 A;  2P6G A;  4XNH C;  1PU9 A;  4BBH A;  4KOW A;  5G21 A;  2OZU A;  4KOR A;  4C2Z A;  4C2Y A;  3TT2 A;  5AG4 A;  4UBR A;  1N71 A;  1K4J A;  5AG7 A;  3R95 A;  2Z3M A;  2J8R A;  3S6F A;  4R57 A;  4UWI A;  4A95 A;  3GY9 A;  2H5M A;  2CNT A;  4CGN A;  1I1D A;  3FYN A;  1S60 A;  1QSM A;  4IUS A;  5F49 A;  3DNS A;  4GS4 A;  1XMT A;  1KUX A;  1YGH A;  2ATR A;  4A31 A;  3I9S A;  1YRE A;  3WR7 A;  1J4J A;  2WPW A;  4CYP A;  4CAW A;  4II9 A;  5HH1 A;  3TOA A;  3I3G A;  3H5Z A;  5A28 A;  3IU1 A;  3G3S A;  4ONU A;  4E0A A;  4C7I A;  2OH1 A;  3JVN A;  4MFJ A;  5H86 A;  2VI7 A;  5KTC A;  2PQ8 A;  1YK3 A;  2YGW A;  4CAF A;  4AB7 A;  2Q4V A;  2J8N A;  3CXP A;  4R9M A;  3W6S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...