2PC1A

Crystal structure of acetyltransferase gnat family (np_688560.1) from streptococcus agalactiae 2603 at 1.28 a resolution
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
173
structure length
173
Chain Sequence
b'NLYFQGMQIRLAFPNEIDQIMLLIEEARAEIAKTGSDQWQKEDGYPNRNDIIDDILNGYAWVGIEDGMLATYAAVIDGHEEVYDAIYEGKWLHDNHRYLTFHRIAISNQFRGRGLAQTFLQGLIEGHKGPDFRCDTHEKNVTMQHILNKLGYQYCGKVPLDGVRLAYQKIKEK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Acetyltransferase, GNAT family
publication title Crystal structure of acetyltransferase GNAT family (NP_688560.1) from Streptococcus agalactiae 2603 at 1.28 A resolution
rcsb
source organism Streptococcus agalactiae 2603v/r
molecule tags Transferase
total genus 55
structure length 173
sequence length 173
ec nomenclature ec 2.3.1.-:
pdb deposition date 2007-03-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 2pc1A00
3GY9A 3R1KA 2Z11A 1IYKA 3ZJ0A 2GIVA 1NE9A 1QSOA 2JDCA 3R9FA 4CAVA 3TOBA 3TE4A 4MY3A 1NSLA 1Y9WA 4NCZA 3EXNA 4FD6A 2Q4YA 2QIRA 1SQHA 2HUZA 4HNWB 3W6SA 4CS0B 3WR7A 2B4DB 2J8MA 4CRZB 2OZHA 3BLNA 2B4DA 3TT2A 5F49A 4MJ8A 5KTCA 3IWGA 2FCKA 3DDDA 1XMTA 2FIAA 2D4PA 3VWEA 2G3TA 5IB0A 2O28A 1VKCA 4F6AA 4KOTA 2P6FA 2VXKA 5HMNA 2GANA 4II9A 2WPWA 2Q7BA 5EBVA 4H89A 4JJXA 5GCNA 3V8IA 1S5KA 4QB9A 3FRMA 3ZZIA 4KOVA 2PQ8A 4KOYA 1IB1E 2ARHA 1YK3A 1Q2CA 5FVJA 4KLWA 1PU9A 2R98A 4KUBA 3DSBA 3TCVA 4XNHC 4E2AA 1ON0A 1WK4A 1M4GA 3QAHA 1RXTA 4MHDA 1KUXA 4UWIA 4Y49B 4KLVA 2FIWA 3JUWA 2FS5A 2ZW5A 2Q44A 3T9YA 2NMTA 4KVOE 1VHSA 3P2HA 5HH1A 3PZJA 4RI1A 3E0KA 2B5GB 4QVTA 4KOWA 5JPHA 2FXFA 2Z10A 2HQYA 1YREA 5EC4A 5H84A 4F0YA 3RYOA 1BO4A 2OB0A 3CXPA 3BJ8A 4X5KA 4NXYA 2PDOA 5KTDA 5H86A 1Q2YA 4NSQA 3R9GA 3FYNA 3MGDA 4JXRA 2A4NA 2B3UA 3IGRA 4KZTA 1P0HA 5ISVA 2CNMA 1M1DA 3VWDA 4CAWA 2ATRA 4PK3A 1Y9KA 3TTHA 4L8AA 2P0WA 2R8VA 4HNYB 5F48A 5CNPA 4KOSA 1WWZA 3SXOA 2BSWA 3GKRA 4PK2A 3B8GA 4JWPA 1RO5A 5J8FA 1NMTA 3G3SA 3EC4A 1GHEA 4CAXA 1M4DA 2VI7A 1Z9UA 3EY5A 4RS2A 2VQYA 4AG7A 2VZZA 5J8CA 4QUSA 3S6KA 4EVYA 2G3AA 3TOAA 3UY5A 2DXQA 2B4BA 1M4IA 2OZGA 1V0CA 4PV6A 4Y49C 1L0CA 4U9ZA 1M44A 2OH1A 2RC4A 3LD2A 1UFHA 2ZW7A 2J8RA 4FD5A 2REFA 4L89A 5DWMA 3NE7A 2ZW6A 4MBUA 2Q04A 4ORFA 2KCWA 3TO9A 3CXQA 3S6FA 4B5PB 4CRYB 2D4OA 1PUAA 2ZPAA 2ZW4A 3TFYA 2VEZA 4H6UA 2FSRA 4ZBGA 3EFAA 1YGHA 4B5PA 2BUEA 3PP9A 2PR8A 4H6ZA 3P2FA 4KVXA 3FNCA 4JXQA 3F5BA 2J8NA 3FIXA 4MY0A 1BOBA 4FD7A 1XF8A 1I12A 4XPDB 2R1IA 3D8PA 1S7LA 4R87A 4R3LA 3N7ZA 2CNSA 2OZUA 2CNTA 4AG9A 4MI4A 4YGOA 1R57A 2PC1A 4B5OA 1B87A 1MJAA 2REEA 3KKWA 2JLMA 1TIQA 5C82A 1S7FA 1I21A 4JD6A 3F0AA 1MJBA 5JQ4A 4KVME 4PSWA 4AVCA 2HV2A 4FD4A 4AVBA 3I9SA 2PSWA 3PGPA 1B6BA 4YRHA 4K30A 4R9MA 3FB3A 4U9YA 4UA3A 3H4QA 2X7BA 3FBUA 2IL4A 1S3ZA 2Z0ZA 4KOXA 2R7HA 4ONUA 3D2MA 1MK4A 1Q2DA 2C27A 3DR8A 3R96A 4IUSA 4AB7A 1IICA 2BEIA 5E96A 2B3VA 4QC6A 4KUAA 3OWCA 3W6XA 2BL1A 3D3SA 5I0CA 3SXNA 4OADA 1XIXA 5IX3A 3W91A 1KUVA 2CY2A 4OAEA 1Z4RA 4XPLA 2P6EA 2Q0YA 1FY7A 4PSXA 1N71A 2PRBA 4LUAA 5F46A 4HNXB 5F47A 2ZXVA 3C26A 4AVAA 1QSNA 1K4JA 1U6MA 3EO4A 2GE3A 1YVKA 3G8WA 4JLYA 5DWNA 1QSTA 2JEVA 3TO6A 1CJWA 3LODA 3I3GA 4XPDC 3DR6A 1YR0A 4R57A 5KTAA 4M85A 3JVNA 3F8KA 1P4NA 2F5IA 2K5TA 2AE6A 4IF5A 3SHPA 3R9EA 1S60A 5IV0A 4KORA 2FE7A 1CM0A 3FXTA 4I49A 3S6HA 1XE4A 1YVOA 4E8OA 2FT0A 2WPXA 3GYAA 2OU2A 2H5MA 3QB8A 3TO7A 2Q4VA 2FL4A 4UWJA 3DNSA 4KOUA 2I00A 1YLEA 2PR1A 3BJ7A 1QSMA 2EVNA 4U5YA 4DNCA 4M3SA 1KZFA 3K9UA 2EUIA 1OZPA 3D2PA 2QECA 4E0AA 4R3KA 4LX9A 3R95A 4QBJA 2VZYA 1S7KA 3T90A 2I79A 1MJ9A 4UBRA 5C88A 3CXSA 1I1DA 2QMLA 3S6GA 1LRZA 2JDDA 1QSRA 4BMHA 4GS4A 4NF1A 4HKFA 1J4JA 2AJ6A 1KUYA 4NEXA 1IIDA 2P6GA 2G0BA 1IYLA 2B58A 1YX0A 4YFJA 1XEBA 1Y7RA 1S7NA 2B5GA 2VBQA 4XPKA 2Y0MA 4OLLA 1Z4EA 4XNHB 4J3GA
chains in the Genus database with same CATH superfamily
4UFVA 2AFZA 3GY9A 2ZEFA 3R1KA 2Z11A 1IYKA 3KGQA 2CF4A 5AGEA 3ZJ0A 2GIVA 2I3CA 1NE9A 1QSOA 2JDCA 4MFJA 3R9FA 4UCMA 3FH4A 4WJBA 4CAVA 4PXBA 4MFZA 3TOBA 3MRUA 2F7VA 4A94A 5D8NA 4X2TA 3TE4A 3I1UA 4MY3A 5J1QA 1LANA 1DE4C 4UIBA 1X12A 3PFOA 1NSLA 1YW6A 1Y9WA 2WZNA 4BBHA 2C1CA 3QNVA 4NCZA 3CPAA 3EXNA 4FD6A 4PXCA 2Q4YA 4C7IA 2IQ6A 5G20A 2JEWA 2QIRA 1SQHA 4CYNA 2HUZA 2V8HA 4HNWB 4CAFA 3W6SA 4CS0B 5D29A 3WR7A 2B4DB 2J8MA 4CRZB 4DUKA 1ZG7A 2OZHA 3BLNA 3BXMA 4OP4A 5LYFA 2B4DA 2AFUA 3TT2A 2WYRA 5F49A 4MJ8A 5G22A 5HVFA 1TKJA 2Q4ZA 5KTCA 3IWGA 4NGPA 2FCKA 3DDDA 1XMTA 4F9UA 4BINA 2FIAA 1Y7EA 2D4PA 2G3TA 3VWEA 2PJ1A 4CGPA 5IB0A 4UEFA 3B3VA 3CPXA 1VGYA 2O28A 2XEJA 4LQ6A 4P4EA 1VKCA 3FVLA 5DS0A 4F6AA 3JTKA 4KOTA 1YQEA 3D7FA 2P6FA 2VXKA 4FAIA 5HMNA 3KL9A 3GUXA 4F0XA 2GANA 4OMEA 4II9A 1YW4A 1QMUA 4B11A 2WPWA 2Q7BA 5EBVA 4H89A 4JJXA 5GCNA 1LOKA 3V8IA 4OIDA 1S5KA 4QB9A 3FRMA 3B3SA 3ZZIA 4G1PA 4KOVA 2PQ8A 4MHZA 4OKOA 4EMEA 3NE8A 2Z3KA 4KOYA 4GM5A 1ZG9A 1IB1E 2ARHA 1YK3A 3KHXA 1Q2CA 2CTCA 2ABZA 5FVJA 4KLWA 1PU9A 3FEDA 2R98A 1CPSA 1CPXA 5HVHA 3H8EA 4KUBA 3DSBA 4R7MA 3RAMA 3TCVA 3NH8A 4XNHC 4E2AA 5K8PA 1ON0A 1WK4A 3PB9X 4UEEA 1M4GA 5K8NA 4RUHA 4UFWA 2G9DA 3QAHA 1RXTA 4MHDA 4KSIA 1KUXA 1ARLA 3NH4A 4UWIA 4Y49B 4KLVA 2FIWA 3SI1A 3JUWA 4OC2A 1ELLP 4B6ZA 2FS5A 1IY7A 4PXDA 3D66A 4C7HA 5I4MA 3CT9A 3B7IA 2ZW5A 2DPSA 1GYTA 2EBJA 2Q44A 4W9YA 3T9YA 4MFQA 2YNCC 2NMTA 4KVOE 1HDUA 1IOFA 2DF5A 1VHSA 1XOVA 2PJ9A 3P2HA 1BAVA 4CGOA 4MFPA 5HH1A 4TNUA 3PZJA 4RI1A 2F8HA 3E0KA 4DYOA 5IB9A 2B5GB 4QVTA 3H8GA 4KOWA 5JPHA 2CTBA 2ZOGA 4R8FA 2FXFA 3KR4A 2PJ2A 3SI0A 5LYIA 5AG7A 4UIAA 4M6GA 2PIZA 2Z10A 2JBKA 2ZEPA 4NGSA 4R76A 4OC0A 3BI0A 1TF9A 5LYLA 2PJ4A 2HQYA 2AFMA 1YREA 4WWVA 5EC4A 5H84A 1IGBA 3HUVA 3K2KA 4KSFA 2JBJA 4F0YA 3KZWA 1R43A 3RYOA 1BO4A 1LAPA 2OB0A 3CXPA 3BJ8A 4X5KA 1XJOA 1XRYA 2V8GA 4ZGYB 4NXYA 2PDOA 5KTDA 3FEEA 1IU8A 4P4FA 1LFWA 1VHOA 3PB7X 4Q7AA 4DJLA 3D7GA 4UEZA 4MHPA 5H86A 1Q2YA 4NSQA 2ZEGA 3R9GA 5ELYA 2CIJA 1AYEA 3FYNA 3MGDA 4JXRA 4Q36A 2IMOA 2A4NA 4B10A 2B3UA 3IGRA 2BCOA 5CBMA 4IK2A 4CYPA 3PBEA 4B13A 4KZTA 1P0HA 2PRQA 4MCSA 5ISVA 2CNMA 4B14A 4AXVA 1M1DA 3IU2A 3VWDA 1AMPA 4CAWA 2ATRA 1TXRA 3D7DA 3H5ZA 2GREA 4PK3A 2OR4A 4NFRA 1Y9KA 3RZAA 3TTHA 3FJUA 3S9LA 3IC1A 1YSJA 4L8AA 2P0WA 2R8VA 4HNYB 2PJ7A 4O23A 5CNPA 5F48A 4KOSA 2PJAA 2PE3A 4MXUA 2ZOFA 1WWZA 1BPMA 1OBRA 2BSWA 2ZEOA 3GKRA 3SXOA 4PK2A 2WSAA 3B8GA 1CP6A 4JWPA 2Z3MA 1RO5A 2BO9A 5J8FA 1NMTA 3G3SA 5AG5A 3NA6A 2ZEMA 3CDXA 5LRGA 4ZYQA 3EC4A 1GHEA 4CAXA 1M4DA 1ELMP 1Z8TA 2VI7A 1Z9UA 3EY5A 4RS2A 2VQYA 4AG7A 2VZZA 4ZY2A 4C2ZA 5J8CA 5LYDA 4QUSA 4P4DA 2PJ8A 3KASA 2GU2A 4IAVA 3WC6A 3B2YA 4UFXA 3S6KA 4EVYA 5A27A 2G3AA 4MFKA 3TOAA 3UY5A 2DXQA 2B4BA 3GIUA 1M4IA 2OZGA 2V8VA 1V0CA 3IWWA 4P6YA 4PV6A 4Y49C 4BD9A 1L0CA 1UWYA 4U9ZA 4P10A 3SJEA 5K8MA 2WUUA 1M44A 2QVPA 3WT4A 2OH1A 2RC4A 3LD2A 4MHNA 1UFHA 4YU9A 2ZW7A 5JM6A 1KWMA 2J9AA 4P4BA 2J8RA 1BLLE 4FD5A 2REFA 1F2OA 2GLFA 1YMEA 3IO1A 4L89A 2EK8A 3KQXA 2ZW6A 3NE7A 4MBUA 4MCPA 5DWMA 2Q04A 3H8FA 3GB0A 4ORFA 2Z3OA 2KCWA 3TO9A 5HVGA 3CXQA 2EK9A 3S6FA 2IJZA 4FWUA 4B5PB 2PJCA 3RBUA 4CRYB 2D4OA 1JWQA 1PUAA 2ZW4A 2ZPAA 2EWBA 3B3CA 1ZG8A 5G21A 3TFYA 2VEZA 1HEEA 4H6UA 2FSRA 2NSMA 3EFAA 3FX6A 4ZBGA 1YGHA 2PJ3A 2BUEA 4B5PA 1Y0YA 4FBEA 3PP9A 4F8ZA 3PB8X 4A31A 2CXAA 2PR8A 4H6ZA 4CGMA 3P2FA 4KVXA 3PBBA 3FNCA 4JXQA 4EFDA 3S9MA 3F5BA 2J8NA 2ZEHA 4C68A 3FIXA 4MY0A 4JYWA 1BOBA 4FD7A 3TC8A 1XF8A 3TX8A 4C2XA 1I12A 2VL1A 4XPDB 2R1IA 4OC4A 5BWAB 2ZELA 3D8PA 1S7LA 2XEIA 4R87A 4UCPA 4CYQA 4R3LA 5JH9A 3N7ZA 2BOAA 2CNSA 2OZUA 1R3NA 2CNTA 4TWEA 4CPAA 2QJ8A 4EWTA 3LWUA 3NH5A 1Z8WA 4ONWA 3PFEA 1X10A 3D68A 4AG9A 5JGFA 1M4LA 4A38A 3PB4X 2XEFA 4MI4A 3B3TA 4MHYA 1BPNA 5CPAA 1ZLHA 4MFLA 4OIWA 4YGOA 1R57A 2PC1A 4MCRA 4A95A 1B87A 4B5OA 1MJAA 4NGRA 2REEA 3FF3A 3KKWA 2JLMA 2YGWA 1TIQA 5C82A 1S7FA 1I21A 4JD6A 4K3NA 2PVWA 3F0AA 4H2KA 1MJBA 1PYTB 5JQ4A 2AFOA 3GLJA 4KVME 4PSWA 4AVCA 2HV2A 4FD4A 4NJRA 3KQZA 4P44A 4AVBA 1YLOA 3I9SA 2PSWA 2ZEDA 5K8OA 2FVGA 4C2YA 3FMCA 3PGPA 3KR5A 1F2PA 1B6BA 2YNDA 4FUUA 4YRHA 4K30A 4R9MA 3FB3A 4B12A 4U9YA 4UA3A 3H4QA 3BHXA 1AUGA 1TF8A 4X3RA 2ANPA 2X7BA 3FBUA 2IL4A 3DLJA 1S3ZA 2Z0ZA 4NGQA 5LRKA 4KOXA 3RNZA 2R7HA 3B3WA 3D2MA 4ONUA 1MK4A 1VIXA 1Z2LA 1Q2DA 5AG6A 2C27A 3DR8A 3R96A 4F9VA 4IUSA 4AB7A 1IICA 2BEIA 5E96A 2B3VA 2Q7SA 4QC6A 2GFQA 2HB6A 8CPAA 4KUAA 3OWCA 3W6XA 2ODFA 2XEGA 2BL1A 3D3SA 3BI1A 3KI9A 5I0CA 2PJ5A 4OADA 2RFHA 4KSAA 3SXNA 1FNOA 1XIXA 3T8WA 4A37A 3K9TA 3CZXA 5IX3A 3W91A 1KUVA 2CY2A 4OAEA 1Z4RA 4XPLA 5F09A 4NGTA 4M6IA 1HDQA 3WC5A 4ZX8A 4LQGA 2P6EA 2PJ0A 3SJXA 2Q0YA 1F57A 2Z3NA 2OOTA 1ZO0A 1FY7A 4M6HA 3JRUA 1Z5RA 1N71A 2PRBA 4PSXA 4LUAA 3ISXA 2HC9A 4ZY1A 2YNCA 4HNXB 5F47A 3IFEA 7CPAA 3RO0A 5F46A 5HXDA 2ZXVA 3KHZA 3C26A 4AVAA 1QSNA 1K4JA 1U6MA 1TKHA 3EO4A 2GE3A 3MN8A 4HPSA 1Z8LA 1YVKA 1IOIA 2AFWA 2V8DA 3G8WA 3V7ZA 4JLYA 5DWNA 1QSTA 3D7HA 2JEVA 3TO6A 1CJWA 3LODA 4UCNA 3VH9A 3I3GA 4MMOA 4XPDC 2O4HA 3DR6A 2AFXA 2O53A 1YR0A 4UF4A 5AG4A 1JQGA 3N5FA 4R57A 2PIYA 5KTAA 4A39A 4M85A 2DPTA 3JVNA 3F8KA 1P4NA 1NSAA 2F5IA 2K5TA 4CGNA 2AE6A 3QAYA 4IF5A 4NGMA 3SHPA 3R9EA 4A32A 1DTDA 1S60A 2PJ6A 3WC7A 5IV0A 4OC3A 2Z3PA 4KORA 2FE7A 1CM0A 2PVVA 3FXTA 3D4UA 4I49A 3S6HA 1XE4A 1YVOA 4OC1A 4A2ZA 1QQ9A 2FT0A 4E8OA 1Q7LA 4ZI6A 2V77A 4PPZA 2WPXA 2PJBA 3GYAA 2POKA 2OU2A 2H5MA 1LAMA 3QB8A 3TO7A 5A28A 3VATA 4MCQA 3S9NA 2Q4VA 1Y0RA 4P4IA 2FL4A 3L2NA 3LMSA 4UWJA 3DNSA 3WABA 4P45A 4KOUA 2DEAA 2RB7A 4GXHA 5LRJA 1CG2A 2I00A 4CAEA 1YLEA 2PR1A 1CX8A 2Z3LA 4JZ0A 5THWA 1XFOA 1ARMA 3FECA 6CPAA 4ZX9A 4P4JA 3BJ7A 4NJQA 4KS9A 1XBUA 1QSMA 2C6CA 4A33A 1CBXA 2EVNA 4U5YA 4DNCA 5EMIA 4M3SA 3VARA 1LCPA 1KZFA 4PXEA 4IHMA 3K9UA 2EUIA 1H8LA 1OZPA 3D2PA 3IEHA 2QECA 2PCUA 2Q43A 4Z65A 4E0AA 2ZEEA 4R3KA 3DGVA 3PB6X 4LX9A 3SI2A 4ZY0A 4NGNA 3R95A 4QBJA 2VZYA 1EE3P 1S7KA 2ZENA 3D67A 5G1ZA 3T90A 3NFZA 4OC5A 3IJ3A 1A2ZA 4A30A 2I79A 1MJ9A 4R6TA 4UBRA 5C88A 4Q38A 2C6GA 3CXSA 1I1DA 1ZLIA 2NYQA 2QMLA 3IIBA 3PRTA 2QYVA 4MRIA 4YWYA 3S6GA 1CP7A 1LRZA 2JDDA 1QSRA 3A9LA 2AFSA 4GS4A 4BMHA 2EO8A 2Q51A 3PEIA 1PCAA 1VHEA 4NF1A 4PQAA 2C6PA 2GLJA 4HKFA 4RN7A 1J4JA 3B35A 2AJ6A 3SJFA 1FT7A 1KUYA 1TKFA 4NEXA 3HLPA 1IIDA 2P6GA 2YNEA 3LACA 2G0BA 1IYLA 1Z8XA 2B58A 3IWEA 1XMBA 3SJGA 1YX0A 4YFJA 4X8IA 1XEBA 3IU1A 1Y7RA 3ISZA 1S7NA 1RTQA 4CGLA 2B5GA 3V38A 2VBQA 4XPKA 2Y0MA 4CYOA 4OLLA 1Z4EA 4XNHB 4J3GA
chains in the Genus database with same CATH topology
4UFVA 3GY9A 3R1KA 2Z11A 1IYKA 5AGEA 3ZJ0A 2GIVA 1NE9A 1QSOA 2JDCA 4MFJA 3R9FA 4UCMA 4CAVA 4MFZA 3TOBA 3TE4A 4MY3A 1NSLA 1Y9WA 4NCZA 3EXNA 4FD6A 2Q4YA 4C7IA 5G20A 2QIRA 1SQHA 4CYNA 2HUZA 4HNWB 4CAFA 3W6SA 4CS0B 3WR7A 2B4DB 2J8MA 4CRZB 2OZHA 3BLNA 2B4DA 3TT2A 5F49A 4MJ8A 5G22A 5KTCA 3IWGA 2FCKA 3DDDA 1XMTA 2FIAA 2D4PA 3VWEA 2G3TA 4CGPA 5IB0A 2O28A 1VKCA 4F6AA 3JTKA 4KOTA 2P6FA 2VXKA 5HMNA 4F0XA 2GANA 4II9A 4B11A 2WPWA 2Q7BA 5EBVA 4H89A 4JJXA 5GCNA 3V8IA 1S5KA 4QB9A 3FRMA 3ZZIA 4KOVA 2PQ8A 2Z3KA 4KOYA 1IB1E 2ARHA 1YK3A 1Q2CA 5FVJA 4KLWA 1PU9A 2R98A 4KUBA 3DSBA 3TCVA 4XNHC 4E2AA 1ON0A 1WK4A 1M4GA 4UFWA 3QAHA 1RXTA 4MHDA 1KUXA 4UWIA 4Y49B 4KLVA 2FIWA 3JUWA 4C7HA 2FS5A 2ZW5A 2DPSA 2Q44A 3T9YA 4MFQA 2YNCC 2NMTA 4KVOE 1VHSA 3P2HA 4CGOA 4MFPA 5HH1A 3PZJA 4RI1A 3E0KA 2B5GB 4QVTA 4KOWA 5JPHA 2FXFA 5AG7A 2Z10A 2HQYA 1YREA 5EC4A 5H84A 4KSFA 4F0YA 3RYOA 1BO4A 2OB0A 3CXPA 3BJ8A 4X5KA 4ZGYB 4NXYA 2PDOA 5KTDA 5H86A 1Q2YA 4NSQA 3R9GA 3FYNA 3MGDA 4JXRA 4Q36A 2A4NA 4B10A 2B3UA 3IGRA 4CYPA 4B13A 4KZTA 1P0HA 5ISVA 2CNMA 4B14A 1M1DA 3IU2A 3VWDA 4CAWA 2ATRA 3H5ZA 4PK3A 1Y9KA 3TTHA 4L8AA 2P0WA 2R8VA 4HNYB 5F48A 5CNPA 4KOSA 1WWZA 3SXOA 2BSWA 3GKRA 4PK2A 2WSAA 3B8GA 4JWPA 2Z3MA 1RO5A 5J8FA 1NMTA 3G3SA 5AG5A 3EC4A 1GHEA 4CAXA 1M4DA 2VI7A 1Z9UA 3EY5A 4RS2A 2VQYA 4AG7A 2VZZA 4C2ZA 5J8CA 4QUSA 4UFXA 3S6KA 4EVYA 5A27A 2G3AA 4MFKA 3TOAA 3UY5A 2DXQA 2B4BA 1M4IA 2OZGA 1V0CA 4PV6A 4Y49C 1L0CA 4U9ZA 2WUUA 1M44A 2OH1A 2RC4A 3LD2A 1UFHA 2ZW7A 2J8RA 4FD5A 2REFA 4L89A 5DWMA 3NE7A 2ZW6A 4MBUA 2Q04A 4ORFA 2Z3OA 2KCWA 3TO9A 3CXQA 3S6FA 4B5PB 4CRYB 2D4OA 1PUAA 2ZPAA 2ZW4A 5G21A 3TFYA 2VEZA 4H6UA 2FSRA 4ZBGA 3EFAA 1YGHA 4B5PA 2BUEA 3PP9A 4A31A 2CXAA 2PR8A 4H6ZA 4CGMA 3P2FA 4KVXA 3FNCA 4JXQA 3F5BA 2J8NA 4C68A 3FIXA 4MY0A 1BOBA 4FD7A 4C2XA 1XF8A 1I12A 4XPDB 2R1IA 5BWAB 3D8PA 1S7LA 4R87A 4UCPA 4CYQA 4R3LA 3N7ZA 2CNSA 2OZUA 2CNTA 4AG9A 4MI4A 4MFLA 4YGOA 4A95A 1R57A 2PC1A 4B5OA 1B87A 1MJAA 2REEA 3KKWA 2JLMA 2YGWA 1TIQA 5C82A 1S7FA 1I21A 4JD6A 3F0AA 1MJBA 5JQ4A 4KVME 4PSWA 4AVCA 2HV2A 4FD4A 4AVBA 3I9SA 2PSWA 4C2YA 3PGPA 1B6BA 2YNDA 4YRHA 4K30A 4R9MA 3FB3A 4B12A 4U9YA 4UA3A 3H4QA 2X7BA 3FBUA 2IL4A 1S3ZA 2Z0ZA 4KOXA 2R7HA 4ONUA 3D2MA 5AG6A 1MK4A 4BBHA 1Q2DA 2C27A 3DR8A 3R96A 4IUSA 4AB7A 1IICA 2BEIA 5E96A 2B3VA 4QC6A 4KUAA 3OWCA 3W6XA 2BL1A 3D3SA 5I0CA 3SXNA 4OADA 4KSAA 1XIXA 5IX3A 3W91A 1KUVA 2CY2A 4OAEA 1Z4RA 4XPLA 2P6EA 2Q0YA 2Z3NA 1ZO0A 1FY7A 4PSXA 1N71A 2PRBA 4LUAA 5F46A 2YNCA 4HNXB 5F47A 2ZXVA 3C26A 4AVAA 1QSNA 1K4JA 1U6MA 3EO4A 2GE3A 1YVKA 3G8WA 4JLYA 5DWNA 1QSTA 2JEVA 3TO6A 1CJWA 3LODA 4UCNA 3I3GA 4XPDC 3DR6A 1YR0A 5AG4A 4R57A 5KTAA 4M85A 2DPTA 3JVNA 3F8KA 1P4NA 2F5IA 2K5TA 4CGNA 2AE6A 4IF5A 3SHPA 3R9EA 4A32A 1S60A 5IV0A 2Z3PA 4KORA 2FE7A 1CM0A 3FXTA 4I49A 3S6HA 1XE4A 1YVOA 4A2ZA 4E8OA 2FT0A 2WPXA 3GYAA 2OU2A 2H5MA 3QB8A 3TO7A 5A28A 2Q4VA 2FL4A 4UWJA 3DNSA 4KOUA 4CAEA 2I00A 1YLEA 2PR1A 2Z3LA 3BJ7A 4KS9A 1QSMA 4A33A 2EVNA 4U5YA 4DNCA 4M3SA 1KZFA 3K9UA 2EUIA 1OZPA 3D2PA 2QECA 4E0AA 4R3KA 4LX9A 3R95A 4QBJA 2VZYA 1S7KA 5G1ZA 3T90A 4A30A 2I79A 1MJ9A 4UBRA 5C88A 4Q38A 3CXSA 1I1DA 2QMLA 3S6GA 1LRZA 2JDDA 1QSRA 3A9LA 4BMHA 4GS4A 4NF1A 4HKFA 1J4JA 2AJ6A 1KUYA 4NEXA 2YNEA 1IIDA 2P6GA 2G0BA 1IYLA 2B58A 3IWEA 1YX0A 4YFJA 1XEBA 3IU1A 1Y7RA 1S7NA 4CGLA 2B5GA 2VBQA 4XPKA 2Y0MA 4CYOA 4OLLA 1Z4EA 4XNHB 4J3GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GY9 A;  3R1K A;  2Z11 A;  1IYK A;  3ZJ0 A;  2GIV A;  1NE9 A;  1QSO A;  2JDC A;  3R9F A;  4CAV A;  3TOB A;  3TE4 A;  4MY3 A;  1NSL A;  1Y9W A;  4NCZ A;  3EXN A;  4FD6 A;  2Q4Y A;  2QIR A;  1SQH A;  2HUZ A;  4HNW B;  3W6S A;  4CS0 B;  3WR7 A;  2B4D B;  2J8M A;  4CRZ B;  2OZH A;  3BLN A;  2B4D A;  3TT2 A;  5F49 A;  4MJ8 A;  5KTC A;  3IWG A;  2FCK A;  3DDD A;  1XMT A;  2FIA A;  2D4P A;  3VWE A;  2G3T A;  5IB0 A;  2O28 A;  1VKC A;  4F6A A;  4KOT A;  2P6F A;  2VXK A;  5HMN A;  2GAN A;  4II9 A;  2WPW A;  2Q7B A;  5EBV A;  4H89 A;  4JJX A;  5GCN A;  3V8I A;  1S5K A;  4QB9 A;  3FRM A;  3ZZI A;  4KOV A;  2PQ8 A;  4KOY A;  1IB1 E;  2ARH A;  1YK3 A;  1Q2C A;  5FVJ A;  4KLW A;  1PU9 A;  2R98 A;  4KUB A;  3DSB A;  3TCV A;  4XNH C;  4E2A A;  1ON0 A;  1WK4 A;  1M4G A;  3QAH A;  1RXT A;  4MHD A;  1KUX A;  4UWI A;  4Y49 B;  4KLV A;  2FIW A;  3JUW A;  2FS5 A;  2ZW5 A;  2Q44 A;  3T9Y A;  2NMT A;  4KVO E;  1VHS A;  3P2H A;  5HH1 A;  3PZJ A;  4RI1 A;  3E0K A;  2B5G B;  4QVT A;  4KOW A;  5JPH A;  2FXF A;  2Z10 A;  2HQY A;  1YRE A;  5EC4 A;  5H84 A;  4F0Y A;  3RYO A;  1BO4 A;  2OB0 A;  3CXP A;  3BJ8 A;  4X5K A;  4NXY A;  2PDO A;  5KTD A;  5H86 A;  1Q2Y A;  4NSQ A;  3R9G A;  3FYN A;  3MGD A;  4JXR A;  2A4N A;  2B3U A;  3IGR A;  4KZT A;  1P0H A;  5ISV A;  2CNM A;  1M1D A;  3VWD A;  4CAW A;  2ATR A;  4PK3 A;  1Y9K A;  3TTH A;  4L8A A;  2P0W A;  2R8V A;  4HNY B;  5F48 A;  5CNP A;  4KOS A;  1WWZ A;  3SXO A;  2BSW A;  3GKR A;  4PK2 A;  3B8G A;  4JWP A;  1RO5 A;  5J8F A;  1NMT A;  3G3S A;  3EC4 A;  1GHE A;  4CAX A;  1M4D A;  2VI7 A;  1Z9U A;  3EY5 A;  4RS2 A;  2VQY A;  4AG7 A;  2VZZ A;  5J8C A;  4QUS A;  3S6K A;  4EVY A;  2G3A A;  3TOA A;  3UY5 A;  2DXQ A;  2B4B A;  1M4I A;  2OZG A;  1V0C A;  4PV6 A;  4Y49 C;  1L0C A;  4U9Z A;  1M44 A;  2OH1 A;  2RC4 A;  3LD2 A;  1UFH A;  2ZW7 A;  2J8R A;  4FD5 A;  2REF A;  4L89 A;  5DWM A;  3NE7 A;  2ZW6 A;  4MBU A;  2Q04 A;  4ORF A;  2KCW A;  3TO9 A;  3CXQ A;  3S6F A;  4B5P B;  4CRY B;  2D4O A;  1PUA A;  2ZPA A;  2ZW4 A;  3TFY A;  2VEZ A;  4H6U A;  2FSR A;  4ZBG A;  3EFA A;  1YGH A;  4B5P A;  2BUE A;  3PP9 A;  2PR8 A;  4H6Z A;  3P2F A;  4KVX A;  3FNC A;  4JXQ A;  3F5B A;  2J8N A;  3FIX A;  4MY0 A;  1BOB A;  4FD7 A;  1XF8 A;  1I12 A;  4XPD B;  2R1I A;  3D8P A;  1S7L A;  4R87 A;  4R3L A;  3N7Z A;  2CNS A;  2OZU A;  2CNT A;  4AG9 A;  4MI4 A;  4YGO A;  1R57 A;  2PC1 A;  4B5O A;  1B87 A;  1MJA A;  2REE A;  3KKW A;  2JLM A;  1TIQ A;  5C82 A;  1S7F A;  1I21 A;  4JD6 A;  3F0A A;  1MJB A;  5JQ4 A;  4KVM E;  4PSW A;  4AVC A;  2HV2 A;  4FD4 A;  4AVB A;  3I9S A;  2PSW A;  3PGP A;  1B6B A;  4YRH A;  4K30 A;  4R9M A;  3FB3 A;  4U9Y A;  4UA3 A;  3H4Q A;  2X7B A;  3FBU A;  2IL4 A;  1S3Z A;  2Z0Z A;  4KOX A;  2R7H A;  4ONU A;  3D2M A;  1MK4 A;  1Q2D A;  2C27 A;  3DR8 A;  3R96 A;  4IUS A;  4AB7 A;  1IIC A;  2BEI A;  5E96 A;  2B3V A;  4QC6 A;  4KUA A;  3OWC A;  3W6X A;  2BL1 A;  3D3S A;  5I0C A;  3SXN A;  4OAD A;  1XIX A;  5IX3 A;  3W91 A;  1KUV A;  2CY2 A;  4OAE A;  1Z4R A;  4XPL A;  2P6E A;  2Q0Y A;  1FY7 A;  4PSX A;  1N71 A;  2PRB A;  4LUA A;  5F46 A;  4HNX B;  5F47 A;  2ZXV A;  3C26 A;  4AVA A;  1QSN A;  1K4J A;  1U6M A;  3EO4 A;  2GE3 A;  1YVK A;  3G8W A;  4JLY A;  5DWN A;  1QST A;  2JEV A;  3TO6 A;  1CJW A;  3LOD A;  3I3G A;  4XPD C;  3DR6 A;  1YR0 A;  4R57 A;  5KTA A;  4M85 A;  3JVN A;  3F8K A;  1P4N A;  2F5I A;  2K5T A;  2AE6 A;  4IF5 A;  3SHP A;  3R9E A;  1S60 A;  5IV0 A;  4KOR A;  2FE7 A;  1CM0 A;  3FXT A;  4I49 A;  3S6H A;  1XE4 A;  1YVO A;  4E8O A;  2FT0 A;  2WPX A;  3GYA A;  2OU2 A;  2H5M A;  3QB8 A;  3TO7 A;  2Q4V A;  2FL4 A;  4UWJ A;  3DNS A;  4KOU A;  2I00 A;  1YLE A;  2PR1 A;  3BJ7 A;  1QSM A;  2EVN A;  4U5Y A;  4DNC A;  4M3S A;  1KZF A;  3K9U A;  2EUI A;  1OZP A;  3D2P A;  2QEC A;  4E0A A;  4R3K A;  4LX9 A;  3R95 A;  4QBJ A;  2VZY A;  1S7K A;  3T90 A;  2I79 A;  1MJ9 A;  4UBR A;  5C88 A;  3CXS A;  1I1D A;  2QML A;  3S6G A;  1LRZ A;  2JDD A;  1QSR A;  4BMH A;  4GS4 A;  4NF1 A;  4HKF A;  1J4J A;  2AJ6 A;  1KUY A;  4NEX A;  1IID A;  2P6G A;  2G0B A;  1IYL A;  2B58 A;  1YX0 A;  4YFJ A;  1XEB A;  1Y7R A;  1S7N A;  2B5G A;  2VBQ A;  4XPK A;  2Y0M A;  4OLL A;  1Z4E A;  4XNH B;  4J3G A; 
#chains in the Genus database with same CATH topology
 4UFV A;  2AFZ A;  3GY9 A;  2ZEF A;  3R1K A;  2Z11 A;  1IYK A;  3KGQ A;  2CF4 A;  5AGE A;  3ZJ0 A;  2GIV A;  2I3C A;  1NE9 A;  1QSO A;  2JDC A;  4MFJ A;  3R9F A;  4UCM A;  3FH4 A;  4WJB A;  4CAV A;  4PXB A;  4MFZ A;  3TOB A;  3MRU A;  2F7V A;  4A94 A;  5D8N A;  4X2T A;  3TE4 A;  3I1U A;  4MY3 A;  5J1Q A;  1LAN A;  1DE4 C;  4UIB A;  1X12 A;  3PFO A;  1NSL A;  1YW6 A;  1Y9W A;  2WZN A;  4BBH A;  2C1C A;  3QNV A;  4NCZ A;  3CPA A;  3EXN A;  4FD6 A;  4PXC A;  2Q4Y A;  4C7I A;  2IQ6 A;  5G20 A;  2JEW A;  2QIR A;  1SQH A;  4CYN A;  2HUZ A;  2V8H A;  4HNW B;  4CAF A;  3W6S A;  4CS0 B;  5D29 A;  3WR7 A;  2B4D B;  2J8M A;  4CRZ B;  4DUK A;  1ZG7 A;  2OZH A;  3BLN A;  3BXM A;  4OP4 A;  5LYF A;  2B4D A;  2AFU A;  3TT2 A;  2WYR A;  5F49 A;  4MJ8 A;  5G22 A;  5HVF A;  1TKJ A;  2Q4Z A;  5KTC A;  3IWG A;  4NGP A;  2FCK A;  3DDD A;  1XMT A;  4F9U A;  4BIN A;  2FIA A;  1Y7E A;  2D4P A;  2G3T A;  3VWE A;  2PJ1 A;  4CGP A;  5IB0 A;  4UEF A;  3B3V A;  3CPX A;  1VGY A;  2O28 A;  2XEJ A;  4LQ6 A;  4P4E A;  1VKC A;  3FVL A;  5DS0 A;  4F6A A;  3JTK A;  4KOT A;  1YQE A;  3D7F A;  2P6F A;  2VXK A;  4FAI A;  5HMN A;  3KL9 A;  3GUX A;  4F0X A;  2GAN A;  4OME A;  4II9 A;  1YW4 A;  1QMU A;  4B11 A;  2WPW A;  2Q7B A;  5EBV A;  4H89 A;  4JJX A;  5GCN A;  1LOK A;  3V8I A;  4OID A;  1S5K A;  4QB9 A;  3FRM A;  3B3S A;  3ZZI A;  4G1P A;  4KOV A;  2PQ8 A;  4MHZ A;  4OKO A;  4EME A;  3NE8 A;  2Z3K A;  4KOY A;  4GM5 A;  1ZG9 A;  1IB1 E;  2ARH A;  1YK3 A;  3KHX A;  1Q2C A;  2CTC A;  2ABZ A;  5FVJ A;  4KLW A;  1PU9 A;  3FED A;  2R98 A;  1CPS A;  1CPX A;  5HVH A;  3H8E A;  4KUB A;  3DSB A;  4R7M A;  3RAM A;  3TCV A;  3NH8 A;  4XNH C;  4E2A A;  5K8P A;  1ON0 A;  1WK4 A;  3PB9 X;  4UEE A;  1M4G A;  5K8N A;  4RUH A;  4UFW A;  2G9D A;  3QAH A;  1RXT A;  4MHD A;  4KSI A;  1KUX A;  1ARL A;  3NH4 A;  4UWI A;  4Y49 B;  4KLV A;  2FIW A;  3SI1 A;  3JUW A;  4OC2 A;  1ELL P;  4B6Z A;  2FS5 A;  1IY7 A;  4PXD A;  3D66 A;  4C7H A;  5I4M A;  3CT9 A;  3B7I A;  2ZW5 A;  2DPS A;  1GYT A;  2EBJ A;  2Q44 A;  4W9Y A;  3T9Y A;  4MFQ A;  2YNC C;  2NMT A;  4KVO E;  1HDU A;  1IOF A;  2DF5 A;  1VHS A;  1XOV A;  2PJ9 A;  3P2H A;  1BAV A;  4CGO A;  4MFP A;  5HH1 A;  4TNU A;  3PZJ A;  4RI1 A;  2F8H A;  3E0K A;  4DYO A;  5IB9 A;  2B5G B;  4QVT A;  3H8G A;  4KOW A;  5JPH A;  2CTB A;  2ZOG A;  4R8F A;  2FXF A;  3KR4 A;  2PJ2 A;  3SI0 A;  5LYI A;  5AG7 A;  4UIA A;  4M6G A;  2PIZ A;  2Z10 A;  2JBK A;  2ZEP A;  4NGS A;  4R76 A;  4OC0 A;  3BI0 A;  1TF9 A;  5LYL A;  2PJ4 A;  2HQY A;  2AFM A;  1YRE A;  4WWV A;  5EC4 A;  5H84 A;  1IGB A;  3HUV A;  3K2K A;  4KSF A;  2JBJ A;  4F0Y A;  3KZW A;  1R43 A;  3RYO A;  1BO4 A;  1LAP A;  2OB0 A;  3CXP A;  3BJ8 A;  4X5K A;  1XJO A;  1XRY A;  2V8G A;  4ZGY B;  4NXY A;  2PDO A;  5KTD A;  3FEE A;  1IU8 A;  4P4F A;  1LFW A;  1VHO A;  3PB7 X;  4Q7A A;  4DJL A;  3D7G A;  4UEZ A;  4MHP A;  5H86 A;  1Q2Y A;  4NSQ A;  2ZEG A;  3R9G A;  5ELY A;  2CIJ A;  1AYE A;  3FYN A;  3MGD A;  4JXR A;  4Q36 A;  2IMO A;  2A4N A;  4B10 A;  2B3U A;  3IGR A;  2BCO A;  5CBM A;  4IK2 A;  4CYP A;  3PBE A;  4B13 A;  4KZT A;  1P0H A;  2PRQ A;  4MCS A;  5ISV A;  2CNM A;  4B14 A;  4AXV A;  1M1D A;  3IU2 A;  3VWD A;  1AMP A;  4CAW A;  2ATR A;  1TXR A;  3D7D A;  3H5Z A;  2GRE A;  4PK3 A;  2OR4 A;  4NFR A;  1Y9K A;  3RZA A;  3TTH A;  3FJU A;  3S9L A;  3IC1 A;  1YSJ A;  4L8A A;  2P0W A;  2R8V A;  4HNY B;  2PJ7 A;  4O23 A;  5CNP A;  5F48 A;  4KOS A;  2PJA A;  2PE3 A;  4MXU A;  2ZOF A;  1WWZ A;  1BPM A;  1OBR A;  2BSW A;  2ZEO A;  3GKR A;  3SXO A;  4PK2 A;  2WSA A;  3B8G A;  1CP6 A;  4JWP A;  2Z3M A;  1RO5 A;  2BO9 A;  5J8F A;  1NMT A;  3G3S A;  5AG5 A;  3NA6 A;  2ZEM A;  3CDX A;  5LRG A;  4ZYQ A;  3EC4 A;  1GHE A;  4CAX A;  1M4D A;  1ELM P;  1Z8T A;  2VI7 A;  1Z9U A;  3EY5 A;  4RS2 A;  2VQY A;  4AG7 A;  2VZZ A;  4ZY2 A;  4C2Z A;  5J8C A;  5LYD A;  4QUS A;  4P4D A;  2PJ8 A;  3KAS A;  2GU2 A;  4IAV A;  3WC6 A;  3B2Y A;  4UFX A;  3S6K A;  4EVY A;  5A27 A;  2G3A A;  4MFK A;  3TOA A;  3UY5 A;  2DXQ A;  2B4B A;  3GIU A;  1M4I A;  2OZG A;  2V8V A;  1V0C A;  3IWW A;  4P6Y A;  4PV6 A;  4Y49 C;  4BD9 A;  1L0C A;  1UWY A;  4U9Z A;  4P10 A;  3SJE A;  5K8M A;  2WUU A;  1M44 A;  2QVP A;  3WT4 A;  2OH1 A;  2RC4 A;  3LD2 A;  4MHN A;  1UFH A;  4YU9 A;  2ZW7 A;  5JM6 A;  1KWM A;  2J9A A;  4P4B A;  2J8R A;  1BLL E;  4FD5 A;  2REF A;  1F2O A;  2GLF A;  1YME A;  3IO1 A;  4L89 A;  2EK8 A;  3KQX A;  2ZW6 A;  3NE7 A;  4MBU A;  4MCP A;  5DWM A;  2Q04 A;  3H8F A;  3GB0 A;  4ORF A;  2Z3O A;  2KCW A;  3TO9 A;  5HVG A;  3CXQ A;  2EK9 A;  3S6F A;  2IJZ A;  4FWU A;  4B5P B;  2PJC A;  3RBU A;  4CRY B;  2D4O A;  1JWQ A;  1PUA A;  2ZW4 A;  2ZPA A;  2EWB A;  3B3C A;  1ZG8 A;  5G21 A;  3TFY A;  2VEZ A;  1HEE A;  4H6U A;  2FSR A;  2NSM A;  3EFA A;  3FX6 A;  4ZBG A;  1YGH A;  2PJ3 A;  2BUE A;  4B5P A;  1Y0Y A;  4FBE A;  3PP9 A;  4F8Z A;  3PB8 X;  4A31 A;  2CXA A;  2PR8 A;  4H6Z A;  4CGM A;  3P2F A;  4KVX A;  3PBB A;  3FNC A;  4JXQ A;  4EFD A;  3S9M A;  3F5B A;  2J8N A;  2ZEH A;  4C68 A;  3FIX A;  4MY0 A;  4JYW A;  1BOB A;  4FD7 A;  3TC8 A;  1XF8 A;  3TX8 A;  4C2X A;  1I12 A;  2VL1 A;  4XPD B;  2R1I A;  4OC4 A;  5BWA B;  2ZEL A;  3D8P A;  1S7L A;  2XEI A;  4R87 A;  4UCP A;  4CYQ A;  4R3L A;  5JH9 A;  3N7Z A;  2BOA A;  2CNS A;  2OZU A;  1R3N A;  2CNT A;  4TWE A;  4CPA A;  2QJ8 A;  4EWT A;  3LWU A;  3NH5 A;  1Z8W A;  4ONW A;  3PFE A;  1X10 A;  3D68 A;  4AG9 A;  5JGF A;  1M4L A;  4A38 A;  3PB4 X;  2XEF A;  4MI4 A;  3B3T A;  4MHY A;  1BPN A;  5CPA A;  1ZLH A;  4MFL A;  4OIW A;  4YGO A;  1R57 A;  2PC1 A;  4MCR A;  4A95 A;  1B87 A;  4B5O A;  1MJA A;  4NGR A;  2REE A;  3FF3 A;  3KKW A;  2JLM A;  2YGW A;  1TIQ A;  5C82 A;  1S7F A;  1I21 A;  4JD6 A;  4K3N A;  2PVW A;  3F0A A;  4H2K A;  1MJB A;  1PYT B;  5JQ4 A;  2AFO A;  3GLJ A;  4KVM E;  4PSW A;  4AVC A;  2HV2 A;  4FD4 A;  4NJR A;  3KQZ A;  4P44 A;  4AVB A;  1YLO A;  3I9S A;  2PSW A;  2ZED A;  5K8O A;  2FVG A;  4C2Y A;  3FMC A;  3PGP A;  3KR5 A;  1F2P A;  1B6B A;  2YND A;  4FUU A;  4YRH A;  4K30 A;  4R9M A;  3FB3 A;  4B12 A;  4U9Y A;  4UA3 A;  3H4Q A;  3BHX A;  1AUG A;  1TF8 A;  4X3R A;  2ANP A;  2X7B A;  3FBU A;  2IL4 A;  3DLJ A;  1S3Z A;  2Z0Z A;  4NGQ A;  5LRK A;  4KOX A;  3RNZ A;  2R7H A;  3B3W A;  3D2M A;  4ONU A;  1MK4 A;  1VIX A;  1Z2L A;  1Q2D A;  5AG6 A;  2C27 A;  3DR8 A;  3R96 A;  4F9V A;  4IUS A;  4AB7 A;  1IIC A;  2BEI A;  5E96 A;  2B3V A;  2Q7S A;  4QC6 A;  2GFQ A;  2HB6 A;  8CPA A;  4KUA A;  3OWC A;  3W6X A;  2ODF A;  2XEG A;  2BL1 A;  3D3S A;  3BI1 A;  3KI9 A;  5I0C A;  2PJ5 A;  4OAD A;  2RFH A;  4KSA A;  3SXN A;  1FNO A;  1XIX A;  3T8W A;  4A37 A;  3K9T A;  3CZX A;  5IX3 A;  3W91 A;  1KUV A;  2CY2 A;  4OAE A;  1Z4R A;  4XPL A;  5F09 A;  4NGT A;  4M6I A;  1HDQ A;  3WC5 A;  4ZX8 A;  4LQG A;  2P6E A;  2PJ0 A;  3SJX A;  2Q0Y A;  1F57 A;  2Z3N A;  2OOT A;  1ZO0 A;  1FY7 A;  4M6H A;  3JRU A;  1Z5R A;  1N71 A;  2PRB A;  4PSX A;  4LUA A;  3ISX A;  2HC9 A;  4ZY1 A;  2YNC A;  4HNX B;  5F47 A;  3IFE A;  7CPA A;  3RO0 A;  5F46 A;  5HXD A;  2ZXV A;  3KHZ A;  3C26 A;  4AVA A;  1QSN A;  1K4J A;  1U6M A;  1TKH A;  3EO4 A;  2GE3 A;  3MN8 A;  4HPS A;  1Z8L A;  1YVK A;  1IOI A;  2AFW A;  2V8D A;  3G8W A;  3V7Z A;  4JLY A;  5DWN A;  1QST A;  3D7H A;  2JEV A;  3TO6 A;  1CJW A;  3LOD A;  4UCN A;  3VH9 A;  3I3G A;  4MMO A;  4XPD C;  2O4H A;  3DR6 A;  2AFX A;  2O53 A;  1YR0 A;  4UF4 A;  5AG4 A;  1JQG A;  3N5F A;  4R57 A;  2PIY A;  5KTA A;  4A39 A;  4M85 A;  2DPT A;  3JVN A;  3F8K A;  1P4N A;  1NSA A;  2F5I A;  2K5T A;  4CGN A;  2AE6 A;  3QAY A;  4IF5 A;  4NGM A;  3SHP A;  3R9E A;  4A32 A;  1DTD A;  1S60 A;  2PJ6 A;  3WC7 A;  5IV0 A;  4OC3 A;  2Z3P A;  4KOR A;  2FE7 A;  1CM0 A;  2PVV A;  3FXT A;  3D4U A;  4I49 A;  3S6H A;  1XE4 A;  1YVO A;  4OC1 A;  4A2Z A;  1QQ9 A;  2FT0 A;  4E8O A;  1Q7L A;  4ZI6 A;  2V77 A;  4PPZ A;  2WPX A;  2PJB A;  3GYA A;  2POK A;  2OU2 A;  2H5M A;  1LAM A;  3QB8 A;  3TO7 A;  5A28 A;  3VAT A;  4MCQ A;  3S9N A;  2Q4V A;  1Y0R A;  4P4I A;  2FL4 A;  3L2N A;  3LMS A;  4UWJ A;  3DNS A;  3WAB A;  4P45 A;  4KOU A;  2DEA A;  2RB7 A;  4GXH A;  5LRJ A;  1CG2 A;  2I00 A;  4CAE A;  1YLE A;  2PR1 A;  1CX8 A;  2Z3L A;  4JZ0 A;  5THW A;  1XFO A;  1ARM A;  3FEC A;  6CPA A;  4ZX9 A;  4P4J A;  3BJ7 A;  4NJQ A;  4KS9 A;  1XBU A;  1QSM A;  2C6C A;  4A33 A;  1CBX A;  2EVN A;  4U5Y A;  4DNC A;  5EMI A;  4M3S A;  3VAR A;  1LCP A;  1KZF A;  4PXE A;  4IHM A;  3K9U A;  2EUI A;  1H8L A;  1OZP A;  3D2P A;  3IEH A;  2QEC A;  2PCU A;  2Q43 A;  4Z65 A;  4E0A A;  2ZEE A;  4R3K A;  3DGV A;  3PB6 X;  4LX9 A;  3SI2 A;  4ZY0 A;  4NGN A;  3R95 A;  4QBJ A;  2VZY A;  1EE3 P;  1S7K A;  2ZEN A;  3D67 A;  5G1Z A;  3T90 A;  3NFZ A;  4OC5 A;  3IJ3 A;  1A2Z A;  4A30 A;  2I79 A;  1MJ9 A;  4R6T A;  4UBR A;  5C88 A;  4Q38 A;  2C6G A;  3CXS A;  1I1D A;  1ZLI A;  2NYQ A;  2QML A;  3IIB A;  3PRT A;  2QYV A;  4MRI A;  4YWY A;  3S6G A;  1CP7 A;  1LRZ A;  2JDD A;  1QSR A;  3A9L A;  2AFS A;  4GS4 A;  4BMH A;  2EO8 A;  2Q51 A;  3PEI A;  1PCA A;  1VHE A;  4NF1 A;  4PQA A;  2C6P A;  2GLJ A;  4HKF A;  4RN7 A;  1J4J A;  3B35 A;  2AJ6 A;  3SJF A;  1FT7 A;  1KUY A;  1TKF A;  4NEX A;  3HLP A;  1IID A;  2P6G A;  2YNE A;  3LAC A;  2G0B A;  1IYL A;  1Z8X A;  2B58 A;  3IWE A;  1XMB A;  3SJG A;  1YX0 A;  4YFJ A;  4X8I A;  1XEB A;  3IU1 A;  1Y7R A;  3ISZ A;  1S7N A;  1RTQ A;  4CGL A;  2B5G A;  3V38 A;  2VBQ A;  4XPK A;  2Y0M A;  4CYO A;  4OLL A;  1Z4E A;  4XNH B;  4J3G A; 
#chains in the Genus database with same CATH homology
 4UFV A;  3GY9 A;  3R1K A;  2Z11 A;  1IYK A;  5AGE A;  3ZJ0 A;  2GIV A;  1NE9 A;  1QSO A;  2JDC A;  4MFJ A;  3R9F A;  4UCM A;  4CAV A;  4MFZ A;  3TOB A;  3TE4 A;  4MY3 A;  1NSL A;  1Y9W A;  4NCZ A;  3EXN A;  4FD6 A;  2Q4Y A;  4C7I A;  5G20 A;  2QIR A;  1SQH A;  4CYN A;  2HUZ A;  4HNW B;  4CAF A;  3W6S A;  4CS0 B;  3WR7 A;  2B4D B;  2J8M A;  4CRZ B;  2OZH A;  3BLN A;  2B4D A;  3TT2 A;  5F49 A;  4MJ8 A;  5G22 A;  5KTC A;  3IWG A;  2FCK A;  3DDD A;  1XMT A;  2FIA A;  2D4P A;  3VWE A;  2G3T A;  4CGP A;  5IB0 A;  2O28 A;  1VKC A;  4F6A A;  3JTK A;  4KOT A;  2P6F A;  2VXK A;  5HMN A;  4F0X A;  2GAN A;  4II9 A;  4B11 A;  2WPW A;  2Q7B A;  5EBV A;  4H89 A;  4JJX A;  5GCN A;  3V8I A;  1S5K A;  4QB9 A;  3FRM A;  3ZZI A;  4KOV A;  2PQ8 A;  2Z3K A;  4KOY A;  1IB1 E;  2ARH A;  1YK3 A;  1Q2C A;  5FVJ A;  4KLW A;  1PU9 A;  2R98 A;  4KUB A;  3DSB A;  3TCV A;  4XNH C;  4E2A A;  1ON0 A;  1WK4 A;  1M4G A;  4UFW A;  3QAH A;  1RXT A;  4MHD A;  1KUX A;  4UWI A;  4Y49 B;  4KLV A;  2FIW A;  3JUW A;  4C7H A;  2FS5 A;  2ZW5 A;  2DPS A;  2Q44 A;  3T9Y A;  4MFQ A;  2YNC C;  2NMT A;  4KVO E;  1VHS A;  3P2H A;  4CGO A;  4MFP A;  5HH1 A;  3PZJ A;  4RI1 A;  3E0K A;  2B5G B;  4QVT A;  4KOW A;  5JPH A;  2FXF A;  5AG7 A;  2Z10 A;  2HQY A;  1YRE A;  5EC4 A;  5H84 A;  4KSF A;  4F0Y A;  3RYO A;  1BO4 A;  2OB0 A;  3CXP A;  3BJ8 A;  4X5K A;  4ZGY B;  4NXY A;  2PDO A;  5KTD A;  5H86 A;  1Q2Y A;  4NSQ A;  3R9G A;  3FYN A;  3MGD A;  4JXR A;  4Q36 A;  2A4N A;  4B10 A;  2B3U A;  3IGR A;  4CYP A;  4B13 A;  4KZT A;  1P0H A;  5ISV A;  2CNM A;  4B14 A;  1M1D A;  3IU2 A;  3VWD A;  4CAW A;  2ATR A;  3H5Z A;  4PK3 A;  1Y9K A;  3TTH A;  4L8A A;  2P0W A;  2R8V A;  4HNY B;  5F48 A;  5CNP A;  4KOS A;  1WWZ A;  3SXO A;  2BSW A;  3GKR A;  4PK2 A;  2WSA A;  3B8G A;  4JWP A;  2Z3M A;  1RO5 A;  5J8F A;  1NMT A;  3G3S A;  5AG5 A;  3EC4 A;  1GHE A;  4CAX A;  1M4D A;  2VI7 A;  1Z9U A;  3EY5 A;  4RS2 A;  2VQY A;  4AG7 A;  2VZZ A;  4C2Z A;  5J8C A;  4QUS A;  4UFX A;  3S6K A;  4EVY A;  5A27 A;  2G3A A;  4MFK A;  3TOA A;  3UY5 A;  2DXQ A;  2B4B A;  1M4I A;  2OZG A;  1V0C A;  4PV6 A;  4Y49 C;  1L0C A;  4U9Z A;  2WUU A;  1M44 A;  2OH1 A;  2RC4 A;  3LD2 A;  1UFH A;  2ZW7 A;  2J8R A;  4FD5 A;  2REF A;  4L89 A;  5DWM A;  3NE7 A;  2ZW6 A;  4MBU A;  2Q04 A;  4ORF A;  2Z3O A;  2KCW A;  3TO9 A;  3CXQ A;  3S6F A;  4B5P B;  4CRY B;  2D4O A;  1PUA A;  2ZPA A;  2ZW4 A;  5G21 A;  3TFY A;  2VEZ A;  4H6U A;  2FSR A;  4ZBG A;  3EFA A;  1YGH A;  4B5P A;  2BUE A;  3PP9 A;  4A31 A;  2CXA A;  2PR8 A;  4H6Z A;  4CGM A;  3P2F A;  4KVX A;  3FNC A;  4JXQ A;  3F5B A;  2J8N A;  4C68 A;  3FIX A;  4MY0 A;  1BOB A;  4FD7 A;  4C2X A;  1XF8 A;  1I12 A;  4XPD B;  2R1I A;  5BWA B;  3D8P A;  1S7L A;  4R87 A;  4UCP A;  4CYQ A;  4R3L A;  3N7Z A;  2CNS A;  2OZU A;  2CNT A;  4AG9 A;  4MI4 A;  4MFL A;  4YGO A;  4A95 A;  1R57 A;  2PC1 A;  4B5O A;  1B87 A;  1MJA A;  2REE A;  3KKW A;  2JLM A;  2YGW A;  1TIQ A;  5C82 A;  1S7F A;  1I21 A;  4JD6 A;  3F0A A;  1MJB A;  5JQ4 A;  4KVM E;  4PSW A;  4AVC A;  2HV2 A;  4FD4 A;  4AVB A;  3I9S A;  2PSW A;  4C2Y A;  3PGP A;  1B6B A;  2YND A;  4YRH A;  4K30 A;  4R9M A;  3FB3 A;  4B12 A;  4U9Y A;  4UA3 A;  3H4Q A;  2X7B A;  3FBU A;  2IL4 A;  1S3Z A;  2Z0Z A;  4KOX A;  2R7H A;  4ONU A;  3D2M A;  5AG6 A;  1MK4 A;  4BBH A;  1Q2D A;  2C27 A;  3DR8 A;  3R96 A;  4IUS A;  4AB7 A;  1IIC A;  2BEI A;  5E96 A;  2B3V A;  4QC6 A;  4KUA A;  3OWC A;  3W6X A;  2BL1 A;  3D3S A;  5I0C A;  3SXN A;  4OAD A;  4KSA A;  1XIX A;  5IX3 A;  3W91 A;  1KUV A;  2CY2 A;  4OAE A;  1Z4R A;  4XPL A;  2P6E A;  2Q0Y A;  2Z3N A;  1ZO0 A;  1FY7 A;  4PSX A;  1N71 A;  2PRB A;  4LUA A;  5F46 A;  2YNC A;  4HNX B;  5F47 A;  2ZXV A;  3C26 A;  4AVA A;  1QSN A;  1K4J A;  1U6M A;  3EO4 A;  2GE3 A;  1YVK A;  3G8W A;  4JLY A;  5DWN A;  1QST A;  2JEV A;  3TO6 A;  1CJW A;  3LOD A;  4UCN A;  3I3G A;  4XPD C;  3DR6 A;  1YR0 A;  5AG4 A;  4R57 A;  5KTA A;  4M85 A;  2DPT A;  3JVN A;  3F8K A;  1P4N A;  2F5I A;  2K5T A;  4CGN A;  2AE6 A;  4IF5 A;  3SHP A;  3R9E A;  4A32 A;  1S60 A;  5IV0 A;  2Z3P A;  4KOR A;  2FE7 A;  1CM0 A;  3FXT A;  4I49 A;  3S6H A;  1XE4 A;  1YVO A;  4A2Z A;  4E8O A;  2FT0 A;  2WPX A;  3GYA A;  2OU2 A;  2H5M A;  3QB8 A;  3TO7 A;  5A28 A;  2Q4V A;  2FL4 A;  4UWJ A;  3DNS A;  4KOU A;  4CAE A;  2I00 A;  1YLE A;  2PR1 A;  2Z3L A;  3BJ7 A;  4KS9 A;  1QSM A;  4A33 A;  2EVN A;  4U5Y A;  4DNC A;  4M3S A;  1KZF A;  3K9U A;  2EUI A;  1OZP A;  3D2P A;  2QEC A;  4E0A A;  4R3K A;  4LX9 A;  3R95 A;  4QBJ A;  2VZY A;  1S7K A;  5G1Z A;  3T90 A;  4A30 A;  2I79 A;  1MJ9 A;  4UBR A;  5C88 A;  4Q38 A;  3CXS A;  1I1D A;  2QML A;  3S6G A;  1LRZ A;  2JDD A;  1QSR A;  3A9L A;  4BMH A;  4GS4 A;  4NF1 A;  4HKF A;  1J4J A;  2AJ6 A;  1KUY A;  4NEX A;  2YNE A;  1IID A;  2P6G A;  2G0B A;  1IYL A;  2B58 A;  3IWE A;  1YX0 A;  4YFJ A;  1XEB A;  3IU1 A;  1Y7R A;  1S7N A;  4CGL A;  2B5G A;  2VBQ A;  4XPK A;  2Y0M A;  4CYO A;  4OLL A;  1Z4E A;  4XNH B;  4J3G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...