2PC1A

Crystal structure of acetyltransferase gnat family (np_688560.1) from streptococcus agalactiae 2603 at 1.28 a resolution
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
173
structure length
173
Chain Sequence
NLYFQGMQIRLAFPNEIDQIMLLIEEARAEIAKTGSDQWQKEDGYPNRNDIIDDILNGYAWVGIEDGMLATYAAVIDGHEEVYDAIYEGKWLHDNHRYLTFHRIAISNQFRGRGLAQTFLQGLIEGHKGPDFRCDTHEKNVTMQHILNKLGYQYCGKVPLDGVRLAYQKIKEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Acetyltransferase, GNAT family
publication title Crystal structure of acetyltransferase GNAT family (NP_688560.1) from Streptococcus agalactiae 2603 at 1.28 A resolution
rcsb
source organism Streptococcus agalactiae 2603v/r
molecule tags Transferase
total genus 55
structure length 173
sequence length 173
ec nomenclature ec 2.3.1.-:
pdb deposition date 2007-03-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 2pc1A00
1XMTA 4KOUA 3I9SA 4KOTA 5GCNA 2VBQA 4GS4A 3OWCA 1YLEA 1YK3A 3I3GA 2QECA 4ONUA 2B4BA 3EY5A 4AG9A 2RC4A 3R9EA 3ZJ0A 3IGRA 4B5OA 1XIXA 2R8VA 3TO6A 2IL4A 3EFAA 1MJAA 1V0CA 1XEBA 3S6FA 2VXKA 3DDDA 1Q2CA 3FNCA 4J3GA 3T9YA 4EVYA 1FY7A 3JUWA 2FS5A 3BJ7A 2ZW4A 2Q7BA 3WR7A 5KTCA 4R57A 1OZPA 2WPWA 4KUBA 3D2PA 3D8PA 3P2HA 4KOSA 3N7ZA 3V8IA 5C88A 4NEXA 1YVOA 1NSLA 2B4DA 3R95A 3ZZIA 1IICA 1QSTA 5EC4A 4JJXA 4U9ZA 2PDOA 3FRMA 1B87A 4HKFA 1UFHA 2OZHA 1CM0A 4CRYB 3LD2A 1U6MA 3LODA 4PV6A 2P0WA 4IF5A 1S7LA 4CAXA 3FYNA 2R98A 1ON0A 5ISVA 1RXTA 4DNCA 4H6UA 1M4IA 4QBJA 3DNSA 1KZFA 4MBUA 4Y49C 5F46A 1GHEA 4FD7A 4KVOE 3F0AA 4F6AA 3W6XA 5IX3A 5JPHA 2B5GA 1Q2YA 4I49A 3KKWA 3FB3A 2JDCA 4IUSA 2EVNA 2GANA 1I21A 2FIAA 2Q4YA 2KCWA 4MY0A 5FVJA 4LUAA 1S5KA 3S6KA 1QSRA 3TFYA 1XF8A 1P4NA 2FXFA 4AVCA 1M4GA 2VEZA 1L0CA 2FSRA 2REFA 4QVTA 2CY2A 1YX0A 1Z4RA 2BL1A 5H86A 4HNXB 2OZUA 5I0CA 2D4OA 3D2MA 1B6BA 4Y49B 1MJ9A 3EC4A 4KOYA 2Q44A 2FCKA 4CS0B 3W91A 1I1DA 3TE4A 2B58A 1CJWA 3S6GA 2ZPAA 1SQHA 4E8OA 4R3LA 4NCZA 4FD4A 1MK4A 4XPLA 4QC6A 4JXQA 4E2AA 3F8KA 3MGDA 5DWNA 5F48A 2G3TA 2Z0ZA 2B4DB 4JWPA 2C27A 2K5TA 4H89A 5IB0A 2D4PA 1IB1E 2ZW5A 3PGPA 1KUYA 4M85A 2HUZA 1BO4A 4YFJA 4CAWA 4NF1A 3TO9A 2VQYA 2PRBA 1S60A 3T90A 2PC1A 3BLNA 4YRHA 2DXQA 1PUAA 4KVXA 4JLYA 2NMTA 3R1KA 2WPXA 3R96A 3PP9A 1WK4A 5DWMA 1S7NA 3VWEA 2ARHA 4X5KA 4R87A 5HMNA 3SXOA 2P6FA 2FE7A 3JVNA 4KZTA 1VKCA 3CXSA 2OZGA 5KTAA 2VZYA 1P0HA 4H6ZA 4KVME 1YREA 4M3SA 3E0KA 4AB7A 4U5YA 1KUXA 1Y9WA 2CNTA 1Q2DA 1M4DA 4B5PB 3IWGA 3FBUA 4MY3A 4ZBGA 5EBVA 1Z4EA 2B3UA 4MJ8A 1S7FA 2BUEA 3TO7A 4NXYA 1N71A 3B8GA 2HQYA 4KORA 3TT2A 2G3AA 3DSBA 4AVBA 2H5MA 2ZW6A 4KLWA 4OAEA 3TOAA 1IYKA 1M44A 2Z10A 3UY5A 1LRZA 2J8MA 3SXNA 1M1DA 3DR6A 1NE9A 4JXRA 4K30A 2HV2A 2OB0A 2P6EA 3CXQA 4JD6A 4U9YA 5KTDA 2PR8A 1IIDA 1J4JA 1VHSA 3QB8A 1QSOA 2VI7A 5IV0A 1YR0A 4XPKA 2REEA 2Y0MA 2OH1A 2FT0A 2GIVA 1YVKA 4PK2A 4KUAA 2FIWA 4UBRA 1TIQA 3NE7A 1QSNA 3EO4A 3RYOA 2JLMA 1YGHA 1WWZA 2Z11A 3DR8A 4OLLA 1KUVA 2A4NA 3SHPA 2BSWA 2Q04A 4NSQA 2ATRA 4AG7A 1QSMA 4ORFA 4BMHA 2Q4VA 1NMTA 2QMLA 3G3SA 4HNYB 4XNHC 2ZW7A 5E96A 3S6HA 2JEVA 3VWDA 5CNPA 3TTHA 2EUIA 2PR1A 5JQ4A 1XE4A 4HNWB 4L8AA 2AJ6A 4F0YA 1Z9UA 1Y9KA 4FD6A 2B5GB 4E0AA 3GYAA 2F5IA 4II9A 1K4JA 4UWIA 2PSWA 4MHDA 2R7HA 2VZZA 5H84A 5F49A 4PK3A 5C82A 3TOBA 4QB9A 4RI1A 5J8CA 2I79A 4XNHB 2AE6A 5J8FA 3TCVA 3BJ8A 4CAVA 4UWJA 4XPDC 4MI4A 2B3VA 2CNMA 4KOXA 3CXPA 4PSXA 1IYLA 2Q0YA 1Y7RA 2FL4A 2J8RA 4FD5A 4RS2A 1MJBA 3G8WA 3C26A 1BOBA 4OADA 3W6SA 3FIXA 2GE3A 2G0BA 2PQ8A 4AVAA 1I12A 2P6GA 3QAHA 3D3SA 4KOVA 1R57A 4R3KA 2R1IA 4L89A 2X7BA 3K9UA 4KOWA 4LX9A 4UA3A 3FXTA 1S7KA 1PU9A 2QIRA 3GY9A 3PZJA 2OU2A 4XPDB 4R9MA 3F5BA 1S3ZA 2I00A 1RO5A 2CNSA 2J8NA 2JDDA 3R9FA 3GKRA 3H4QA 5F47A 2ZXVA 4B5PA 3R9GA 4CRZB 3P2FA 4KLVA 4PSWA 2O28A 4YGOA 3EXNA 5HH1A 2BEIA 4QUSA
chains in the Genus database with same CATH superfamily
4R6TA 1XMTA 4UFVA 4KOUA 3PB6X 1YSJA 1LAPA 1OBRA 2HB6A 3I9SA 4KOTA 5LYDA 2WYRA 2JEWA 1IY7A 2VBQA 4PXDA 4QUSA 3D7HA 3FVLA 1ARMA 1YLEA 1YK3A 3OWCA 2PJ9A 4GS4A 3I3GA 2QECA 4C7HA 4MHZA 5K8MA 2EBJA 2ZOFA 4ONUA 3FF3A 2B4BA 3EY5A 3SI2A 4AG9A 2RC4A 3R9EA 3MRUA 3ZJ0A 4C2YA 3IGRA 4B5OA 1HDQA 3DLJA 1XIXA 3H8EA 2GLJA 3H5ZA 3KASA 2R8VA 4YU9A 3TO6A 4MCRA 4DUKA 2IL4A 4UCMA 5ELYA 2O4HA 3EFAA 3KZWA 4H2KA 1MJAA 1V0CA 1XEBA 3QAYA 3S6FA 2VXKA 3DDDA 1Q2CA 3FNCA 1Z8XA 4A30A 4J3GA 4CGLA 3T9YA 4MCPA 2V8DA 4EVYA 3SI0A 3MN8A 1FY7A 2IMOA 2PIZA 3JUWA 3WC5A 1PCAA 3FMCA 2AFUA 1CX8A 2FS5A 2ZW4A 3BJ7A 2CTBA 3CT9A 2Q7BA 3WR7A 5KTCA 4ZYQA 2ODFA 1XJOA 3PBEA 4R57A 1OZPA 2WPWA 4KUBA 3D2PA 3D8PA 3P2HA 4KOSA 4C2XA 1ZG9A 3N7ZA 4NFRA 2ZEEA 3V8IA 3IFEA 3PFEA 5C88A 4NEXA 3ISZA 2PVWA 2J9AA 3K9TA 2Q4ZA 3LACA 4NGNA 5DS0A 1YVOA 1NSLA 2B4DA 3R95A 3ZZIA 1IICA 4B6ZA 2Q7SA 1QSTA 5EC4A 4UCNA 4JJXA 1XOVA 2Z3LA 1CBXA 3KQXA 2PDOA 4U9ZA 4UIAA 3FRMA 1B87A 3D66A 4HKFA 2Q43A 1UFHA 2OZHA 4Z65A 1CM0A 6CPAA 4CRYB 3LD2A 4B13A 1U6MA 3LODA 4PV6A 2P0WA 1F57A 4IF5A 4YWYA 3BHXA 3CPAA 1S7LA 4CAXA 3FYNA 4MFZA 4F8ZA 2R98A 1ON0A 2Z3NA 5ISVA 1RXTA 4MHNA 4H6UA 4DNCA 8CPAA 1M4IA 3IU1A 4QBJA 3DNSA 4OC4A 1KZFA 1H8LA 3NH4A 4MBUA 4P4DA 4Y49C 5F46A 1GHEA 4FD7A 4KVOE 3F0AA 4F6AA 2AFOA 1CG2A 1TF9A 2Q51A 4KSAA 4OKOA 3W6XA 5IX3A 2QYVA 5JPHA 1VHOA 4GM5A 2QJ8A 2XEGA 4X8IA 4KSIA 2B5GA 4CYQA 2Z3PA 4MXUA 2C1CA 2PJ0A 1Q2YA 1Z5RA 3FEDA 4I49A 3SJEA 3KKWA 4DYOA 1ARLA 1CPXA 2CTCA 4FAIA 3GB0A 1IU8A 2PVVA 3SJGA 4CYNA 3FB3A 2JDCA 4IUSA 2EVNA 4UIBA 2GANA 4DJLA 4ZI6A 4CAEA 1AUGA 3KHXA 4HPSA 1I21A 2FIAA 3B3WA 2Q4YA 2KCWA 2XEIA 4PXBA 3PB7X 4P10A 2IQ6A 2EK9A 4MY0A 5FVJA 5JM6A 1S5KA 4LUAA 3S6KA 2HC9A 1QSRA 3TFYA 1XF8A 1P4NA 2FXFA 3NH8A 4AVCA 1M4GA 4OMEA 5JGFA 3WC6A 2VEZA 2CXAA 2C6GA 3GIUA 1L0CA 2PJAA 2PE3A 3JTKA 2FSRA 2REFA 4UEZA 3D68A 4QVTA 2CY2A 5LYLA 1YX0A 1Z4RA 5AG4A 1IOFA 2BL1A 2C6CA 5H86A 4NGSA 4HNXB 2OZUA 2Z3OA 2D4OA 2BO9A 5I0CA 3D2MA 4IHMA 3KHZA 1ZLHA 1B6BA 4Y49B 4C68A 1MJ9A 3B3TA 3EC4A 4KOYA 4A39A 2Q44A 1AYEA 3LMSA 2FCKA 4CS0B 4LQGA 1TF8A 4P6YA 1I1DA 3W91A 3TE4A 2B58A 5CBMA 3GLJA 3CPXA 5LYIA 4Q38A 1CJWA 1FNOA 1R43A 3S6GA 4LQ6A 1M4LA 3JRUA 2Z3KA 2ZPAA 1SQHA 2GU2A 2QVPA 5LRJA 4E8OA 3NH5A 4R3LA 4NCZA 4FD4A 1MK4A 1TKFA 2YNCC 4QC6A 4JXQA 4XPLA 2CIJA 4EFDA 4E2AA 3F8KA 1XBUA 3MGDA 2C6PA 4WJBA 5DWNA 5F48A 4RN7A 2JBKA 1NSAA 3V38A 4MFPA 2RB7A 2G3TA 2Z0ZA 3D67A 2B4DB 2ABZA 3IWWA 4UEFA 3TX8A 4JWPA 2EK8A 2C27A 4MMOA 2K5TA 4A32A 3IEHA 4H89A 5IB0A 2D4PA 4MHYA 1CP6A 1IB1E 2ZW5A 5I4MA 1VGYA 3PGPA 1KUYA 4M85A 5G21A 2HUZA 4UF4A 1BO4A 4YFJA 4CAWA 4B14A 3BI1A 2XEFA 4NF1A 5AG6A 2PJ7A 3TO9A 2VQYA 4NJQA 1KWMA 1ZO0A 4PXCA 2PRBA 3WC7A 1S60A 3KL9A 3T90A 2PC1A 3BLNA 3LWUA 3KR5A 2V77A 1ZLIA 1PUAA 2DXQA 4W9YA 4YRHA 1LANA 4KVXA 4R8FA 4M6GA 4JLYA 2NMTA 3PRTA 3R1KA 2WPXA 3R96A 3PP9A 1WK4A 2O53A 5DWMA 3ISXA 4JYWA 4ZX9A 1QQ9A 4OC1A 1S7NA 3VWEA 3H8FA 2ARHA 3PB8X 3NFZA 4OC3A 4X5KA 4R87A 5HMNA 3VH9A 3VARA 3SXOA 2P6FA 2FE7A 2PJCA 3JVNA 1BPMA 2V8HA 4KZTA 3B2YA 3T8WA 1VKCA 3CXSA 1LFWA 2OZGA 5KTAA 2VZYA 1TKJA 3DGVA 3K2KA 1P0HA 3NE8A 4A33A 4A37A 4B10A 4H6ZA 4NGQA 5CPAA 2CF4A 4KVME 1YREA 4WWVA 4M3SA 3E0KA 4AB7A 4U5YA 1KUXA 3IO1A 4NGPA 1Y9WA 1DTDA 2BOAA 4P45A 2CNTA 1Q2DA 3FX6A 1M4DA 1FT7A 4MRIA 4F9UA 2VL1A 1CP7A 4B5PB 2PJ3A 2PJ4A 3IWGA 3CZXA 4FUUA 3FBUA 4CGPA 2AFSA 2ZEPA 4MY3A 4ZBGA 2PJ1A 1XMBA 4ZGYB 5EBVA 1Z4EA 2GREA 3RAMA 1JWQA 4R7MA 2B3UA 1YW6A 4G1PA 4MJ8A 4P4FA 1QMUA 3D7FA 4TWEA 1S7FA 2AFZA 3HLPA 4X3RA 2BUEA 3TO7A 4NXYA 1ZG8A 4EWTA 5LRGA 1N71A 3B8GA 1Z8LA 2HQYA 4KORA 4F0XA 5G20A 3TT2A 4NGTA 2G3AA 3DSBA 1BAVA 4TNUA 1LAMA 2H5MA 2ZW6A 4AVBA 2PCUA 3IIBA 1Z2LA 4KLWA 4P44A 5HVFA 2RFHA 3B3SA 4OAEA 4ZX8A 3TOAA 2PJ6A 4ZY0A 5D8NA 1IYKA 2G9DA 4KS9A 4BBHA 1M44A 2Z10A 3UY5A 1VIXA 3IU2A 1LRZA 1IGBA 2J8MA 2NSMA 3SXNA 1M1DA 3DR6A 4NJRA 2PJBA 2JBJA 1NE9A 4JXRA 3RZAA 4K30A 1VHEA 4CYOA 5HXDA 2YNEA 4EMEA 4OP4A 2HV2A 3D7DA 2F7VA 2PRQA 5AG5A 2OB0A 2AFXA 2P6EA 2BCOA 3CXQA 4JD6A 3KGQA 4U9YA 5KTDA 3PFOA 2PR8A 1IIDA 7CPAA 1J4JA 2IJZA 3VATA 1VHSA 2ZEMA 2ZEOA 3QB8A 1QSOA 1YQEA 2VI7A 2ZEHA 4BINA 3HUVA 4MFKA 5IV0A 1YR0A 4XPKA 5A27A 1Y0RA 4RUHA 2REEA 5HVHA 4Q7AA 3S9LA 2Y0MA 2OH1A 2FT0A 1BPNA 3WABA 2GIVA 1YVKA 4PK2A 3PB9X 4A95A 4ZY1A 4KUAA 2FIWA 2Z3MA 4UBRA 3SI1A 1F2OA 2GFQA 1TIQA 3NE7A 1QSNA 2ZEGA 3EO4A 2DPTA 3RYOA 4CGNA 1ELLP 2JLMA 3WT4A 1YGHA 4NGMA 3CDXA 3V7ZA 1WWZA 4CAFA 4K3NA 2Z11A 3KI9A 3B7IA 2EWBA 1GYTA 3BXMA 4P4IA 3DR8A 5HVGA 2V8VA 4OLLA 4BD9A 1KUVA 2A4NA 2WSAA 3SHPA 3GUXA 2BSWA 2Q04A 3S9NA 4NSQA 2ATRA 4OC2A 4AG7A 1QSMA 4ORFA 3IJ3A 4CYPA 2DEAA 4F9VA 4BMHA 1CPSA 1NMTA 2Q4VA 2QMLA 3G3SA 4HNYB 4XNHC 2ZW7A 2YNDA 5E96A 3S6HA 1HDUA 2JEVA 1XRYA 3VWDA 4UCPA 2FVGA 4MHPA 5CNPA 3TTHA 1Z8TA 2EUIA 4B11A 2PR1A 5JQ4A 1XE4A 4HNWB 4L8AA 4PPZA 2AJ6A 2AFMA 4F0YA 4CGMA 2F8HA 1Z9UA 1Y9KA 4FD6A 4OIWA 3D4UA 2B5GB 4E0AA 4MFQA 4X2TA 3L2NA 3GYAA 2F5IA 4II9A 1ELMP 1K4JA 4UWIA 4R76A 1YW4A 2PSWA 2I3CA 5GCNA 5F09A 4MHDA 1TXRA 5K8PA 2ZEFA 4MCQA 2R7HA 2VZZA 3TC8A 4GXHA 5H84A 5F49A 1RTQA 3SJFA 2EO8A 1BLLE 2DPSA 4PK3A 2NYQA 4A38A 2PJ2A 3PEIA 1F2PA 1PYTB 1XFOA 3BI0A 4C2ZA 5C82A 5LYFA 3TOBA 4ONWA 4UFWA 4QB9A 2YGWA 4RI1A 5IB9A 5J8CA 3B35A 2I79A 4XNHB 4NGRA 2AE6A 5J8FA 5G1ZA 3TCVA 3BJ8A 1YLOA 4O23A 2OOTA 5BWAB 1X12A 4CAVA 4UWJA 3KQZA 4C7IA 4ZY2A 3NA6A 4XPDC 3SJXA 2ZEDA 1YMEA 3A9LA 4MI4A 5K8OA 2B3VA 2CNMA 4UFXA 4FBEA 4KOXA 2OR4A 3CXPA 4PSXA 4AXVA 1IYLA 1UWYA 3N5FA 2WUUA 4OC0A 1ZG7A 2Q0YA 1Y7RA 2FL4A 2J8RA 3FH4A 3D7GA 2POKA 4FD5A 3KR4A 3B3VA 3QNVA 2WZNA 5A28A 1DE4C 4RS2A 1MJBA 5G22A 4A94A 3G8WA 4M6HA 1TKHA 3I1UA 2ZOGA 1BOBA 3C26A 4OADA 3FECA 3W6SA 3FJUA 3RBUA 3FIXA 2GE3A 4MFJA 2AFWA 2G0BA 2PQ8A 3PBBA 4AVAA 1I12A 2P6GA 3QAHA 3D3SA 5JH9A 5AGEA 4KOVA 1R57A 1X10A 1Y0YA 2YNCA 4R3KA 2R1IA 5D29A 4L89A 2X7BA 5LRKA 4B12A 1R3NA 3K9UA 4KOWA 3IWEA 4MFLA 2PJ5A 4JZ0A 3S9MA 4LX9A 4PQAA 1HEEA 4UA3A 3FXTA 3RO0A 2ZELA 2DF5A 5EMIA 2PIYA 4FWUA 2V8GA 1LOKA 4CGOA 1S7KA 1PU9A 2QIRA 3GY9A 1EE3P 2GLFA 3PZJA 2XEJA 1LCPA 2OU2A 4MCSA 4XPDB 4R9MA 3F5BA 3H8GA 1S3ZA 2I00A 4IK2A 2ANPA 1RO5A 3PB4X 2CNSA 4A31A 2J8NA 2JDDA 5K8NA 1A2ZA 3FEEA 3R9FA 3B3CA 3GKRA 3H4QA 5F47A 4UEEA 2ZXVA 4OIDA 3RNZA 4B5PA 3IC1A 4P4JA 1JQGA 3R9GA 3P2FA 4CRZB 1IOIA 4OC5A 1Z8WA 4PXEA 4KLVA 4PSWA 4KSFA 4M6IA 1Y7EA 4P4BA 2O28A 4A2ZA 4P4EA 4YGOA 3EXNA 5HH1A 1AMPA 2BEIA 2PJ8A 5AG7A 4Q36A 5J1QA 4CPAA 5THWA 2ZENA 1Q7LA 4IAVA
chains in the Genus database with same CATH topology
4UFVA 1XMTA 4KOUA 3I9SA 4KOTA 5GCNA 2VBQA 4GS4A 3OWCA 1YLEA 1YK3A 3I3GA 2QECA 4C7HA 4ONUA 2B4BA 3EY5A 4AG9A 2RC4A 3R9EA 3ZJ0A 4C2YA 3IGRA 4B5OA 1XIXA 3H5ZA 2R8VA 3TO6A 2IL4A 4UCMA 3EFAA 1MJAA 1V0CA 1XEBA 3S6FA 2VXKA 3DDDA 1Q2CA 3FNCA 4A30A 4J3GA 4CGLA 3T9YA 4EVYA 1FY7A 3JUWA 2FS5A 3BJ7A 2ZW4A 2Q7BA 3WR7A 5KTCA 4R57A 1OZPA 2WPWA 4KUBA 3D2PA 3D8PA 3P2HA 4KOSA 4C2XA 3N7ZA 3V8IA 5C88A 4NEXA 1YVOA 1NSLA 2B4DA 3R95A 3ZZIA 1IICA 1QSTA 5EC4A 4UCNA 4JJXA 2Z3LA 4U9ZA 2PDOA 3FRMA 1B87A 4HKFA 1UFHA 2OZHA 1CM0A 4CRYB 3LD2A 4B13A 1U6MA 3LODA 4PV6A 2P0WA 4IF5A 1S7LA 4CAXA 3FYNA 4MFZA 2R98A 1ON0A 2Z3NA 5ISVA 1RXTA 4DNCA 4H6UA 1M4IA 3IU1A 4QBJA 3DNSA 1KZFA 4MBUA 4Y49C 5F46A 1GHEA 4FD7A 4KVOE 3F0AA 4F6AA 3W6XA 4KSAA 5IX3A 5JPHA 4CYQA 2B5GA 2Z3PA 1Q2YA 4I49A 3KKWA 4CYNA 3FB3A 2JDCA 4IUSA 2EVNA 2GANA 4CAEA 1I21A 2FIAA 2Q4YA 2KCWA 4MY0A 5FVJA 1S5KA 4LUAA 3S6KA 1QSRA 3TFYA 1XF8A 1P4NA 2FXFA 4AVCA 1M4GA 2VEZA 2CXAA 1L0CA 3JTKA 2FSRA 2REFA 4QVTA 2CY2A 1YX0A 1Z4RA 5AG4A 2BL1A 5H86A 4HNXB 2OZUA 2Z3OA 2D4OA 5I0CA 3D2MA 1B6BA 4Y49B 4C68A 1MJ9A 3EC4A 4KOYA 2Q44A 2FCKA 4CS0B 3W91A 1I1DA 3TE4A 2B58A 4Q38A 1CJWA 3S6GA 2Z3KA 2ZPAA 1SQHA 4E8OA 4R3LA 4NCZA 4FD4A 1MK4A 2YNCC 4XPLA 4QC6A 4JXQA 4E2AA 3F8KA 3MGDA 5DWNA 5F48A 4MFPA 2G3TA 2Z0ZA 2B4DB 4JWPA 2C27A 2K5TA 4A32A 4H89A 5IB0A 2D4PA 1IB1E 2ZW5A 3PGPA 1KUYA 4M85A 5G21A 2HUZA 1BO4A 4YFJA 4CAWA 4B14A 4NF1A 5AG6A 3TO9A 2VQYA 1ZO0A 2PRBA 1S60A 3T90A 2PC1A 3BLNA 4YRHA 2DXQA 1PUAA 4KVXA 4JLYA 2NMTA 3R1KA 2WPXA 3R96A 3PP9A 1WK4A 5DWMA 1S7NA 3VWEA 2ARHA 4X5KA 4R87A 5HMNA 3SXOA 2P6FA 2FE7A 3JVNA 4KZTA 1VKCA 3CXSA 2OZGA 5KTAA 2VZYA 4A33A 1P0HA 4B10A 4H6ZA 4KVME 1YREA 4M3SA 3E0KA 4AB7A 4U5YA 1KUXA 1Y9WA 2CNTA 1Q2DA 1M4DA 4B5PB 3IWGA 4CGPA 3FBUA 4MY3A 4ZBGA 4ZGYB 5EBVA 1Z4EA 2B3UA 4MJ8A 1S7FA 2BUEA 3TO7A 4NXYA 1N71A 3B8GA 2HQYA 4KORA 4F0XA 5G20A 3TT2A 2G3AA 3DSBA 4AVBA 2H5MA 2ZW6A 4KLWA 4OAEA 3TOAA 1IYKA 4KS9A 4BBHA 1M44A 2Z10A 3UY5A 3IU2A 1LRZA 2J8MA 3SXNA 1M1DA 3DR6A 1NE9A 4JXRA 4K30A 4CYOA 2YNEA 2HV2A 5AG5A 2OB0A 2P6EA 3CXQA 4JD6A 4U9YA 5KTDA 2PR8A 1IIDA 1J4JA 1VHSA 3QB8A 1QSOA 2VI7A 4MFKA 5IV0A 1YR0A 4XPKA 5A27A 2REEA 2Y0MA 2OH1A 2FT0A 2GIVA 1YVKA 4PK2A 4A95A 4KUAA 2FIWA 2Z3MA 4UBRA 1TIQA 3NE7A 1QSNA 3EO4A 3RYOA 2DPTA 4CGNA 2JLMA 1YGHA 4CAFA 1WWZA 2Z11A 3DR8A 4OLLA 1KUVA 2A4NA 2WSAA 3SHPA 2BSWA 2Q04A 4NSQA 2ATRA 4AG7A 1QSMA 4ORFA 4CYPA 4BMHA 2Q4VA 1NMTA 2QMLA 3G3SA 4HNYB 4XNHC 2ZW7A 2YNDA 5E96A 3S6HA 2JEVA 3VWDA 4UCPA 5CNPA 3TTHA 2EUIA 4B11A 2PR1A 5JQ4A 1XE4A 4HNWB 4L8AA 2AJ6A 4F0YA 4CGMA 1Z9UA 1Y9KA 4FD6A 2B5GB 4E0AA 4MFQA 3GYAA 2F5IA 4II9A 1K4JA 4UWIA 2PSWA 4MHDA 2R7HA 2VZZA 5H84A 5F49A 2DPSA 4PK3A 4C2ZA 5C82A 3TOBA 4UFWA 4QB9A 2YGWA 4RI1A 5J8CA 2I79A 4XNHB 2AE6A 5J8FA 5G1ZA 3TCVA 3BJ8A 5BWAB 4CAVA 4UWJA 4C7IA 4XPDC 3A9LA 4MI4A 2B3VA 2CNMA 4UFXA 4KOXA 3CXPA 4PSXA 1IYLA 2WUUA 2Q0YA 1Y7RA 2FL4A 2J8RA 4FD5A 5A28A 4RS2A 1MJBA 5G22A 3G8WA 3C26A 1BOBA 4OADA 3W6SA 3FIXA 2GE3A 4MFJA 2G0BA 2PQ8A 4AVAA 1I12A 2P6GA 3QAHA 3D3SA 5AGEA 4KOVA 1R57A 2YNCA 4R3KA 2R1IA 4L89A 2X7BA 4B12A 3K9UA 4KOWA 3IWEA 4MFLA 4LX9A 4UA3A 3FXTA 4CGOA 1S7KA 1PU9A 2QIRA 3GY9A 3PZJA 2OU2A 4XPDB 4R9MA 3F5BA 1S3ZA 2I00A 1RO5A 4A31A 2CNSA 2J8NA 2JDDA 3R9FA 3GKRA 3H4QA 5F47A 2ZXVA 4B5PA 3R9GA 4CRZB 3P2FA 4KLVA 4PSWA 4KSFA 2O28A 4A2ZA 4YGOA 3EXNA 5HH1A 2BEIA 5AG7A 4Q36A 4QUSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XMT A;  4KOU A;  3I9S A;  4KOT A;  5GCN A;  2VBQ A;  4GS4 A;  3OWC A;  1YLE A;  1YK3 A;  3I3G A;  2QEC A;  4ONU A;  2B4B A;  3EY5 A;  4AG9 A;  2RC4 A;  3R9E A;  3ZJ0 A;  3IGR A;  4B5O A;  1XIX A;  2R8V A;  3TO6 A;  2IL4 A;  3EFA A;  1MJA A;  1V0C A;  1XEB A;  3S6F A;  2VXK A;  3DDD A;  1Q2C A;  3FNC A;  4J3G A;  3T9Y A;  4EVY A;  1FY7 A;  3JUW A;  2FS5 A;  3BJ7 A;  2ZW4 A;  2Q7B A;  3WR7 A;  5KTC A;  4R57 A;  1OZP A;  2WPW A;  4KUB A;  3D2P A;  3D8P A;  3P2H A;  4KOS A;  3N7Z A;  3V8I A;  5C88 A;  4NEX A;  1YVO A;  1NSL A;  2B4D A;  3R95 A;  3ZZI A;  1IIC A;  1QST A;  5EC4 A;  4JJX A;  4U9Z A;  2PDO A;  3FRM A;  1B87 A;  4HKF A;  1UFH A;  2OZH A;  1CM0 A;  4CRY B;  3LD2 A;  1U6M A;  3LOD A;  4PV6 A;  2P0W A;  4IF5 A;  1S7L A;  4CAX A;  3FYN A;  2R98 A;  1ON0 A;  5ISV A;  1RXT A;  4DNC A;  4H6U A;  1M4I A;  4QBJ A;  3DNS A;  1KZF A;  4MBU A;  4Y49 C;  5F46 A;  1GHE A;  4FD7 A;  4KVO E;  3F0A A;  4F6A A;  3W6X A;  5IX3 A;  5JPH A;  2B5G A;  1Q2Y A;  4I49 A;  3KKW A;  3FB3 A;  2JDC A;  4IUS A;  2EVN A;  2GAN A;  1I21 A;  2FIA A;  2Q4Y A;  2KCW A;  4MY0 A;  5FVJ A;  4LUA A;  1S5K A;  3S6K A;  1QSR A;  3TFY A;  1XF8 A;  1P4N A;  2FXF A;  4AVC A;  1M4G A;  2VEZ A;  1L0C A;  2FSR A;  2REF A;  4QVT A;  2CY2 A;  1YX0 A;  1Z4R A;  2BL1 A;  5H86 A;  4HNX B;  2OZU A;  5I0C A;  2D4O A;  3D2M A;  1B6B A;  4Y49 B;  1MJ9 A;  3EC4 A;  4KOY A;  2Q44 A;  2FCK A;  4CS0 B;  3W91 A;  1I1D A;  3TE4 A;  2B58 A;  1CJW A;  3S6G A;  2ZPA A;  1SQH A;  4E8O A;  4R3L A;  4NCZ A;  4FD4 A;  1MK4 A;  4XPL A;  4QC6 A;  4JXQ A;  4E2A A;  3F8K A;  3MGD A;  5DWN A;  5F48 A;  2G3T A;  2Z0Z A;  2B4D B;  4JWP A;  2C27 A;  2K5T A;  4H89 A;  5IB0 A;  2D4P A;  1IB1 E;  2ZW5 A;  3PGP A;  1KUY A;  4M85 A;  2HUZ A;  1BO4 A;  4YFJ A;  4CAW A;  4NF1 A;  3TO9 A;  2VQY A;  2PRB A;  1S60 A;  3T90 A;  2PC1 A;  3BLN A;  4YRH A;  2DXQ A;  1PUA A;  4KVX A;  4JLY A;  2NMT A;  3R1K A;  2WPX A;  3R96 A;  3PP9 A;  1WK4 A;  5DWM A;  1S7N A;  3VWE A;  2ARH A;  4X5K A;  4R87 A;  5HMN A;  3SXO A;  2P6F A;  2FE7 A;  3JVN A;  4KZT A;  1VKC A;  3CXS A;  2OZG A;  5KTA A;  2VZY A;  1P0H A;  4H6Z A;  4KVM E;  1YRE A;  4M3S A;  3E0K A;  4AB7 A;  4U5Y A;  1KUX A;  1Y9W A;  2CNT A;  1Q2D A;  1M4D A;  4B5P B;  3IWG A;  3FBU A;  4MY3 A;  4ZBG A;  5EBV A;  1Z4E A;  2B3U A;  4MJ8 A;  1S7F A;  2BUE A;  3TO7 A;  4NXY A;  1N71 A;  3B8G A;  2HQY A;  4KOR A;  3TT2 A;  2G3A A;  3DSB A;  4AVB A;  2H5M A;  2ZW6 A;  4KLW A;  4OAE A;  3TOA A;  1IYK A;  1M44 A;  2Z10 A;  3UY5 A;  1LRZ A;  2J8M A;  3SXN A;  1M1D A;  3DR6 A;  1NE9 A;  4JXR A;  4K30 A;  2HV2 A;  2OB0 A;  2P6E A;  3CXQ A;  4JD6 A;  4U9Y A;  5KTD A;  2PR8 A;  1IID A;  1J4J A;  1VHS A;  3QB8 A;  1QSO A;  2VI7 A;  5IV0 A;  1YR0 A;  4XPK A;  2REE A;  2Y0M A;  2OH1 A;  2FT0 A;  2GIV A;  1YVK A;  4PK2 A;  4KUA A;  2FIW A;  4UBR A;  1TIQ A;  3NE7 A;  1QSN A;  3EO4 A;  3RYO A;  2JLM A;  1YGH A;  1WWZ A;  2Z11 A;  3DR8 A;  4OLL A;  1KUV A;  2A4N A;  3SHP A;  2BSW A;  2Q04 A;  4NSQ A;  2ATR A;  4AG7 A;  1QSM A;  4ORF A;  4BMH A;  2Q4V A;  1NMT A;  2QML A;  3G3S A;  4HNY B;  4XNH C;  2ZW7 A;  5E96 A;  3S6H A;  2JEV A;  3VWD A;  5CNP A;  3TTH A;  2EUI A;  2PR1 A;  5JQ4 A;  1XE4 A;  4HNW B;  4L8A A;  2AJ6 A;  4F0Y A;  1Z9U A;  1Y9K A;  4FD6 A;  2B5G B;  4E0A A;  3GYA A;  2F5I A;  4II9 A;  1K4J A;  4UWI A;  2PSW A;  4MHD A;  2R7H A;  2VZZ A;  5H84 A;  5F49 A;  4PK3 A;  5C82 A;  3TOB A;  4QB9 A;  4RI1 A;  5J8C A;  2I79 A;  4XNH B;  2AE6 A;  5J8F A;  3TCV A;  3BJ8 A;  4CAV A;  4UWJ A;  4XPD C;  4MI4 A;  2B3V A;  2CNM A;  4KOX A;  3CXP A;  4PSX A;  1IYL A;  2Q0Y A;  1Y7R A;  2FL4 A;  2J8R A;  4FD5 A;  4RS2 A;  1MJB A;  3G8W A;  3C26 A;  1BOB A;  4OAD A;  3W6S A;  3FIX A;  2GE3 A;  2G0B A;  2PQ8 A;  4AVA A;  1I12 A;  2P6G A;  3QAH A;  3D3S A;  4KOV A;  1R57 A;  4R3K A;  2R1I A;  4L89 A;  2X7B A;  3K9U A;  4KOW A;  4LX9 A;  4UA3 A;  3FXT A;  1S7K A;  1PU9 A;  2QIR A;  3GY9 A;  3PZJ A;  2OU2 A;  4XPD B;  4R9M A;  3F5B A;  1S3Z A;  2I00 A;  1RO5 A;  2CNS A;  2J8N A;  2JDD A;  3R9F A;  3GKR A;  3H4Q A;  5F47 A;  2ZXV A;  4B5P A;  3R9G A;  4CRZ B;  3P2F A;  4KLV A;  4PSW A;  2O28 A;  4YGO A;  3EXN A;  5HH1 A;  2BEI A;  4QUS A; 
#chains in the Genus database with same CATH topology
 4R6T A;  1XMT A;  4UFV A;  4KOU A;  3PB6 X;  1YSJ A;  1LAP A;  1OBR A;  2HB6 A;  3I9S A;  4KOT A;  5LYD A;  2WYR A;  2JEW A;  1IY7 A;  2VBQ A;  4PXD A;  4QUS A;  3D7H A;  3FVL A;  1ARM A;  1YLE A;  1YK3 A;  3OWC A;  2PJ9 A;  4GS4 A;  3I3G A;  2QEC A;  4C7H A;  4MHZ A;  5K8M A;  2EBJ A;  2ZOF A;  4ONU A;  3FF3 A;  2B4B A;  3EY5 A;  3SI2 A;  4AG9 A;  2RC4 A;  3R9E A;  3MRU A;  3ZJ0 A;  4C2Y A;  3IGR A;  4B5O A;  1HDQ A;  3DLJ A;  1XIX A;  3H8E A;  2GLJ A;  3H5Z A;  3KAS A;  2R8V A;  4YU9 A;  3TO6 A;  4MCR A;  4DUK A;  2IL4 A;  4UCM A;  5ELY A;  2O4H A;  3EFA A;  3KZW A;  4H2K A;  1MJA A;  1V0C A;  1XEB A;  3QAY A;  3S6F A;  2VXK A;  3DDD A;  1Q2C A;  3FNC A;  1Z8X A;  4A30 A;  4J3G A;  4CGL A;  3T9Y A;  4MCP A;  2V8D A;  4EVY A;  3SI0 A;  3MN8 A;  1FY7 A;  2IMO A;  2PIZ A;  3JUW A;  3WC5 A;  1PCA A;  3FMC A;  2AFU A;  1CX8 A;  2FS5 A;  2ZW4 A;  3BJ7 A;  2CTB A;  3CT9 A;  2Q7B A;  3WR7 A;  5KTC A;  4ZYQ A;  2ODF A;  1XJO A;  3PBE A;  4R57 A;  1OZP A;  2WPW A;  4KUB A;  3D2P A;  3D8P A;  3P2H A;  4KOS A;  4C2X A;  1ZG9 A;  3N7Z A;  4NFR A;  2ZEE A;  3V8I A;  3IFE A;  3PFE A;  5C88 A;  4NEX A;  3ISZ A;  2PVW A;  2J9A A;  3K9T A;  2Q4Z A;  3LAC A;  4NGN A;  5DS0 A;  1YVO A;  1NSL A;  2B4D A;  3R95 A;  3ZZI A;  1IIC A;  4B6Z A;  2Q7S A;  1QST A;  5EC4 A;  4UCN A;  4JJX A;  1XOV A;  2Z3L A;  1CBX A;  3KQX A;  2PDO A;  4U9Z A;  4UIA A;  3FRM A;  1B87 A;  3D66 A;  4HKF A;  2Q43 A;  1UFH A;  2OZH A;  4Z65 A;  1CM0 A;  6CPA A;  4CRY B;  3LD2 A;  4B13 A;  1U6M A;  3LOD A;  4PV6 A;  2P0W A;  1F57 A;  4IF5 A;  4YWY A;  3BHX A;  3CPA A;  1S7L A;  4CAX A;  3FYN A;  4MFZ A;  4F8Z A;  2R98 A;  1ON0 A;  2Z3N A;  5ISV A;  1RXT A;  4MHN A;  4H6U A;  4DNC A;  8CPA A;  1M4I A;  3IU1 A;  4QBJ A;  3DNS A;  4OC4 A;  1KZF A;  1H8L A;  3NH4 A;  4MBU A;  4P4D A;  4Y49 C;  5F46 A;  1GHE A;  4FD7 A;  4KVO E;  3F0A A;  4F6A A;  2AFO A;  1CG2 A;  1TF9 A;  2Q51 A;  4KSA A;  4OKO A;  3W6X A;  5IX3 A;  2QYV A;  5JPH A;  1VHO A;  4GM5 A;  2QJ8 A;  2XEG A;  4X8I A;  4KSI A;  2B5G A;  4CYQ A;  2Z3P A;  4MXU A;  2C1C A;  2PJ0 A;  1Q2Y A;  1Z5R A;  3FED A;  4I49 A;  3SJE A;  3KKW A;  4DYO A;  1ARL A;  1CPX A;  2CTC A;  4FAI A;  3GB0 A;  1IU8 A;  2PVV A;  3SJG A;  4CYN A;  3FB3 A;  2JDC A;  4IUS A;  2EVN A;  4UIB A;  2GAN A;  4DJL A;  4ZI6 A;  4CAE A;  1AUG A;  3KHX A;  4HPS A;  1I21 A;  2FIA A;  3B3W A;  2Q4Y A;  2KCW A;  2XEI A;  4PXB A;  3PB7 X;  4P10 A;  2IQ6 A;  2EK9 A;  4MY0 A;  5FVJ A;  5JM6 A;  1S5K A;  4LUA A;  3S6K A;  2HC9 A;  1QSR A;  3TFY A;  1XF8 A;  1P4N A;  2FXF A;  3NH8 A;  4AVC A;  1M4G A;  4OME A;  5JGF A;  3WC6 A;  2VEZ A;  2CXA A;  2C6G A;  3GIU A;  1L0C A;  2PJA A;  2PE3 A;  3JTK A;  2FSR A;  2REF A;  4UEZ A;  3D68 A;  4QVT A;  2CY2 A;  5LYL A;  1YX0 A;  1Z4R A;  5AG4 A;  1IOF A;  2BL1 A;  2C6C A;  5H86 A;  4NGS A;  4HNX B;  2OZU A;  2Z3O A;  2D4O A;  2BO9 A;  5I0C A;  3D2M A;  4IHM A;  3KHZ A;  1ZLH A;  1B6B A;  4Y49 B;  4C68 A;  1MJ9 A;  3B3T A;  3EC4 A;  4KOY A;  4A39 A;  2Q44 A;  1AYE A;  3LMS A;  2FCK A;  4CS0 B;  4LQG A;  1TF8 A;  4P6Y A;  1I1D A;  3W91 A;  3TE4 A;  2B58 A;  5CBM A;  3GLJ A;  3CPX A;  5LYI A;  4Q38 A;  1CJW A;  1FNO A;  1R43 A;  3S6G A;  4LQ6 A;  1M4L A;  3JRU A;  2Z3K A;  2ZPA A;  1SQH A;  2GU2 A;  2QVP A;  5LRJ A;  4E8O A;  3NH5 A;  4R3L A;  4NCZ A;  4FD4 A;  1MK4 A;  1TKF A;  2YNC C;  4QC6 A;  4JXQ A;  4XPL A;  2CIJ A;  4EFD A;  4E2A A;  3F8K A;  1XBU A;  3MGD A;  2C6P A;  4WJB A;  5DWN A;  5F48 A;  4RN7 A;  2JBK A;  1NSA A;  3V38 A;  4MFP A;  2RB7 A;  2G3T A;  2Z0Z A;  3D67 A;  2B4D B;  2ABZ A;  3IWW A;  4UEF A;  3TX8 A;  4JWP A;  2EK8 A;  2C27 A;  4MMO A;  2K5T A;  4A32 A;  3IEH A;  4H89 A;  5IB0 A;  2D4P A;  4MHY A;  1CP6 A;  1IB1 E;  2ZW5 A;  5I4M A;  1VGY A;  3PGP A;  1KUY A;  4M85 A;  5G21 A;  2HUZ A;  4UF4 A;  1BO4 A;  4YFJ A;  4CAW A;  4B14 A;  3BI1 A;  2XEF A;  4NF1 A;  5AG6 A;  2PJ7 A;  3TO9 A;  2VQY A;  4NJQ A;  1KWM A;  1ZO0 A;  4PXC A;  2PRB A;  3WC7 A;  1S60 A;  3KL9 A;  3T90 A;  2PC1 A;  3BLN A;  3LWU A;  3KR5 A;  2V77 A;  1ZLI A;  1PUA A;  2DXQ A;  4W9Y A;  4YRH A;  1LAN A;  4KVX A;  4R8F A;  4M6G A;  4JLY A;  2NMT A;  3PRT A;  3R1K A;  2WPX A;  3R96 A;  3PP9 A;  1WK4 A;  2O53 A;  5DWM A;  3ISX A;  4JYW A;  4ZX9 A;  1QQ9 A;  4OC1 A;  1S7N A;  3VWE A;  3H8F A;  2ARH A;  3PB8 X;  3NFZ A;  4OC3 A;  4X5K A;  4R87 A;  5HMN A;  3VH9 A;  3VAR A;  3SXO A;  2P6F A;  2FE7 A;  2PJC A;  3JVN A;  1BPM A;  2V8H A;  4KZT A;  3B2Y A;  3T8W A;  1VKC A;  3CXS A;  1LFW A;  2OZG A;  5KTA A;  2VZY A;  1TKJ A;  3DGV A;  3K2K A;  1P0H A;  3NE8 A;  4A33 A;  4A37 A;  4B10 A;  4H6Z A;  4NGQ A;  5CPA A;  2CF4 A;  4KVM E;  1YRE A;  4WWV A;  4M3S A;  3E0K A;  4AB7 A;  4U5Y A;  1KUX A;  3IO1 A;  4NGP A;  1Y9W A;  1DTD A;  2BOA A;  4P45 A;  2CNT A;  1Q2D A;  3FX6 A;  1M4D A;  1FT7 A;  4MRI A;  4F9U A;  2VL1 A;  1CP7 A;  4B5P B;  2PJ3 A;  2PJ4 A;  3IWG A;  3CZX A;  4FUU A;  3FBU A;  4CGP A;  2AFS A;  2ZEP A;  4MY3 A;  4ZBG A;  2PJ1 A;  1XMB A;  4ZGY B;  5EBV A;  1Z4E A;  2GRE A;  3RAM A;  1JWQ A;  4R7M A;  2B3U A;  1YW6 A;  4G1P A;  4MJ8 A;  4P4F A;  1QMU A;  3D7F A;  4TWE A;  1S7F A;  2AFZ A;  3HLP A;  4X3R A;  2BUE A;  3TO7 A;  4NXY A;  1ZG8 A;  4EWT A;  5LRG A;  1N71 A;  3B8G A;  1Z8L A;  2HQY A;  4KOR A;  4F0X A;  5G20 A;  3TT2 A;  4NGT A;  2G3A A;  3DSB A;  1BAV A;  4TNU A;  1LAM A;  2H5M A;  2ZW6 A;  4AVB A;  2PCU A;  3IIB A;  1Z2L A;  4KLW A;  4P44 A;  5HVF A;  2RFH A;  3B3S A;  4OAE A;  4ZX8 A;  3TOA A;  2PJ6 A;  4ZY0 A;  5D8N A;  1IYK A;  2G9D A;  4KS9 A;  4BBH A;  1M44 A;  2Z10 A;  3UY5 A;  1VIX A;  3IU2 A;  1LRZ A;  1IGB A;  2J8M A;  2NSM A;  3SXN A;  1M1D A;  3DR6 A;  4NJR A;  2PJB A;  2JBJ A;  1NE9 A;  4JXR A;  3RZA A;  4K30 A;  1VHE A;  4CYO A;  5HXD A;  2YNE A;  4EME A;  4OP4 A;  2HV2 A;  3D7D A;  2F7V A;  2PRQ A;  5AG5 A;  2OB0 A;  2AFX A;  2P6E A;  2BCO A;  3CXQ A;  4JD6 A;  3KGQ A;  4U9Y A;  5KTD A;  3PFO A;  2PR8 A;  1IID A;  7CPA A;  1J4J A;  2IJZ A;  3VAT A;  1VHS A;  2ZEM A;  2ZEO A;  3QB8 A;  1QSO A;  1YQE A;  2VI7 A;  2ZEH A;  4BIN A;  3HUV A;  4MFK A;  5IV0 A;  1YR0 A;  4XPK A;  5A27 A;  1Y0R A;  4RUH A;  2REE A;  5HVH A;  4Q7A A;  3S9L A;  2Y0M A;  2OH1 A;  2FT0 A;  1BPN A;  3WAB A;  2GIV A;  1YVK A;  4PK2 A;  3PB9 X;  4A95 A;  4ZY1 A;  4KUA A;  2FIW A;  2Z3M A;  4UBR A;  3SI1 A;  1F2O A;  2GFQ A;  1TIQ A;  3NE7 A;  1QSN A;  2ZEG A;  3EO4 A;  2DPT A;  3RYO A;  4CGN A;  1ELL P;  2JLM A;  3WT4 A;  1YGH A;  4NGM A;  3CDX A;  3V7Z A;  1WWZ A;  4CAF A;  4K3N A;  2Z11 A;  3KI9 A;  3B7I A;  2EWB A;  1GYT A;  3BXM A;  4P4I A;  3DR8 A;  5HVG A;  2V8V A;  4OLL A;  4BD9 A;  1KUV A;  2A4N A;  2WSA A;  3SHP A;  3GUX A;  2BSW A;  2Q04 A;  3S9N A;  4NSQ A;  2ATR A;  4OC2 A;  4AG7 A;  1QSM A;  4ORF A;  3IJ3 A;  4CYP A;  2DEA A;  4F9V A;  4BMH A;  1CPS A;  1NMT A;  2Q4V A;  2QML A;  3G3S A;  4HNY B;  4XNH C;  2ZW7 A;  2YND A;  5E96 A;  3S6H A;  1HDU A;  2JEV A;  1XRY A;  3VWD A;  4UCP A;  2FVG A;  4MHP A;  5CNP A;  3TTH A;  1Z8T A;  2EUI A;  4B11 A;  2PR1 A;  5JQ4 A;  1XE4 A;  4HNW B;  4L8A A;  4PPZ A;  2AJ6 A;  2AFM A;  4F0Y A;  4CGM A;  2F8H A;  1Z9U A;  1Y9K A;  4FD6 A;  4OIW A;  3D4U A;  2B5G B;  4E0A A;  4MFQ A;  4X2T A;  3L2N A;  3GYA A;  2F5I A;  4II9 A;  1ELM P;  1K4J A;  4UWI A;  4R76 A;  1YW4 A;  2PSW A;  2I3C A;  5GCN A;  5F09 A;  4MHD A;  1TXR A;  5K8P A;  2ZEF A;  4MCQ A;  2R7H A;  2VZZ A;  3TC8 A;  4GXH A;  5H84 A;  5F49 A;  1RTQ A;  3SJF A;  2EO8 A;  1BLL E;  2DPS A;  4PK3 A;  2NYQ A;  4A38 A;  2PJ2 A;  3PEI A;  1F2P A;  1PYT B;  1XFO A;  3BI0 A;  4C2Z A;  5C82 A;  5LYF A;  3TOB A;  4ONW A;  4UFW A;  4QB9 A;  2YGW A;  4RI1 A;  5IB9 A;  5J8C A;  3B35 A;  2I79 A;  4XNH B;  4NGR A;  2AE6 A;  5J8F A;  5G1Z A;  3TCV A;  3BJ8 A;  1YLO A;  4O23 A;  2OOT A;  5BWA B;  1X12 A;  4CAV A;  4UWJ A;  3KQZ A;  4C7I A;  4ZY2 A;  3NA6 A;  4XPD C;  3SJX A;  2ZED A;  1YME A;  3A9L A;  4MI4 A;  5K8O A;  2B3V A;  2CNM A;  4UFX A;  4FBE A;  4KOX A;  2OR4 A;  3CXP A;  4PSX A;  4AXV A;  1IYL A;  1UWY A;  3N5F A;  2WUU A;  4OC0 A;  1ZG7 A;  2Q0Y A;  1Y7R A;  2FL4 A;  2J8R A;  3FH4 A;  3D7G A;  2POK A;  4FD5 A;  3KR4 A;  3B3V A;  3QNV A;  2WZN A;  5A28 A;  1DE4 C;  4RS2 A;  1MJB A;  5G22 A;  4A94 A;  3G8W A;  4M6H A;  1TKH A;  3I1U A;  2ZOG A;  1BOB A;  3C26 A;  4OAD A;  3FEC A;  3W6S A;  3FJU A;  3RBU A;  3FIX A;  2GE3 A;  4MFJ A;  2AFW A;  2G0B A;  2PQ8 A;  3PBB A;  4AVA A;  1I12 A;  2P6G A;  3QAH A;  3D3S A;  5JH9 A;  5AGE A;  4KOV A;  1R57 A;  1X10 A;  1Y0Y A;  2YNC A;  4R3K A;  2R1I A;  5D29 A;  4L89 A;  2X7B A;  5LRK A;  4B12 A;  1R3N A;  3K9U A;  4KOW A;  3IWE A;  4MFL A;  2PJ5 A;  4JZ0 A;  3S9M A;  4LX9 A;  4PQA A;  1HEE A;  4UA3 A;  3FXT A;  3RO0 A;  2ZEL A;  2DF5 A;  5EMI A;  2PIY A;  4FWU A;  2V8G A;  1LOK A;  4CGO A;  1S7K A;  1PU9 A;  2QIR A;  3GY9 A;  1EE3 P;  2GLF A;  3PZJ A;  2XEJ A;  1LCP A;  2OU2 A;  4MCS A;  4XPD B;  4R9M A;  3F5B A;  3H8G A;  1S3Z A;  2I00 A;  4IK2 A;  2ANP A;  1RO5 A;  3PB4 X;  2CNS A;  4A31 A;  2J8N A;  2JDD A;  5K8N A;  1A2Z A;  3FEE A;  3R9F A;  3B3C A;  3GKR A;  3H4Q A;  5F47 A;  4UEE A;  2ZXV A;  4OID A;  3RNZ A;  4B5P A;  3IC1 A;  4P4J A;  1JQG A;  3R9G A;  3P2F A;  4CRZ B;  1IOI A;  4OC5 A;  1Z8W A;  4PXE A;  4KLV A;  4PSW A;  4KSF A;  4M6I A;  1Y7E A;  4P4B A;  2O28 A;  4A2Z A;  4P4E A;  4YGO A;  3EXN A;  5HH1 A;  1AMP A;  2BEI A;  2PJ8 A;  5AG7 A;  4Q36 A;  5J1Q A;  4CPA A;  5THW A;  2ZEN A;  1Q7L A;  4IAV A; 
#chains in the Genus database with same CATH homology
 4UFV A;  1XMT A;  4KOU A;  3I9S A;  4KOT A;  5GCN A;  2VBQ A;  4GS4 A;  3OWC A;  1YLE A;  1YK3 A;  3I3G A;  2QEC A;  4C7H A;  4ONU A;  2B4B A;  3EY5 A;  4AG9 A;  2RC4 A;  3R9E A;  3ZJ0 A;  4C2Y A;  3IGR A;  4B5O A;  1XIX A;  3H5Z A;  2R8V A;  3TO6 A;  2IL4 A;  4UCM A;  3EFA A;  1MJA A;  1V0C A;  1XEB A;  3S6F A;  2VXK A;  3DDD A;  1Q2C A;  3FNC A;  4A30 A;  4J3G A;  4CGL A;  3T9Y A;  4EVY A;  1FY7 A;  3JUW A;  2FS5 A;  3BJ7 A;  2ZW4 A;  2Q7B A;  3WR7 A;  5KTC A;  4R57 A;  1OZP A;  2WPW A;  4KUB A;  3D2P A;  3D8P A;  3P2H A;  4KOS A;  4C2X A;  3N7Z A;  3V8I A;  5C88 A;  4NEX A;  1YVO A;  1NSL A;  2B4D A;  3R95 A;  3ZZI A;  1IIC A;  1QST A;  5EC4 A;  4UCN A;  4JJX A;  2Z3L A;  4U9Z A;  2PDO A;  3FRM A;  1B87 A;  4HKF A;  1UFH A;  2OZH A;  1CM0 A;  4CRY B;  3LD2 A;  4B13 A;  1U6M A;  3LOD A;  4PV6 A;  2P0W A;  4IF5 A;  1S7L A;  4CAX A;  3FYN A;  4MFZ A;  2R98 A;  1ON0 A;  2Z3N A;  5ISV A;  1RXT A;  4DNC A;  4H6U A;  1M4I A;  3IU1 A;  4QBJ A;  3DNS A;  1KZF A;  4MBU A;  4Y49 C;  5F46 A;  1GHE A;  4FD7 A;  4KVO E;  3F0A A;  4F6A A;  3W6X A;  4KSA A;  5IX3 A;  5JPH A;  4CYQ A;  2B5G A;  2Z3P A;  1Q2Y A;  4I49 A;  3KKW A;  4CYN A;  3FB3 A;  2JDC A;  4IUS A;  2EVN A;  2GAN A;  4CAE A;  1I21 A;  2FIA A;  2Q4Y A;  2KCW A;  4MY0 A;  5FVJ A;  1S5K A;  4LUA A;  3S6K A;  1QSR A;  3TFY A;  1XF8 A;  1P4N A;  2FXF A;  4AVC A;  1M4G A;  2VEZ A;  2CXA A;  1L0C A;  3JTK A;  2FSR A;  2REF A;  4QVT A;  2CY2 A;  1YX0 A;  1Z4R A;  5AG4 A;  2BL1 A;  5H86 A;  4HNX B;  2OZU A;  2Z3O A;  2D4O A;  5I0C A;  3D2M A;  1B6B A;  4Y49 B;  4C68 A;  1MJ9 A;  3EC4 A;  4KOY A;  2Q44 A;  2FCK A;  4CS0 B;  3W91 A;  1I1D A;  3TE4 A;  2B58 A;  4Q38 A;  1CJW A;  3S6G A;  2Z3K A;  2ZPA A;  1SQH A;  4E8O A;  4R3L A;  4NCZ A;  4FD4 A;  1MK4 A;  2YNC C;  4XPL A;  4QC6 A;  4JXQ A;  4E2A A;  3F8K A;  3MGD A;  5DWN A;  5F48 A;  4MFP A;  2G3T A;  2Z0Z A;  2B4D B;  4JWP A;  2C27 A;  2K5T A;  4A32 A;  4H89 A;  5IB0 A;  2D4P A;  1IB1 E;  2ZW5 A;  3PGP A;  1KUY A;  4M85 A;  5G21 A;  2HUZ A;  1BO4 A;  4YFJ A;  4CAW A;  4B14 A;  4NF1 A;  5AG6 A;  3TO9 A;  2VQY A;  1ZO0 A;  2PRB A;  1S60 A;  3T90 A;  2PC1 A;  3BLN A;  4YRH A;  2DXQ A;  1PUA A;  4KVX A;  4JLY A;  2NMT A;  3R1K A;  2WPX A;  3R96 A;  3PP9 A;  1WK4 A;  5DWM A;  1S7N A;  3VWE A;  2ARH A;  4X5K A;  4R87 A;  5HMN A;  3SXO A;  2P6F A;  2FE7 A;  3JVN A;  4KZT A;  1VKC A;  3CXS A;  2OZG A;  5KTA A;  2VZY A;  4A33 A;  1P0H A;  4B10 A;  4H6Z A;  4KVM E;  1YRE A;  4M3S A;  3E0K A;  4AB7 A;  4U5Y A;  1KUX A;  1Y9W A;  2CNT A;  1Q2D A;  1M4D A;  4B5P B;  3IWG A;  4CGP A;  3FBU A;  4MY3 A;  4ZBG A;  4ZGY B;  5EBV A;  1Z4E A;  2B3U A;  4MJ8 A;  1S7F A;  2BUE A;  3TO7 A;  4NXY A;  1N71 A;  3B8G A;  2HQY A;  4KOR A;  4F0X A;  5G20 A;  3TT2 A;  2G3A A;  3DSB A;  4AVB A;  2H5M A;  2ZW6 A;  4KLW A;  4OAE A;  3TOA A;  1IYK A;  4KS9 A;  4BBH A;  1M44 A;  2Z10 A;  3UY5 A;  3IU2 A;  1LRZ A;  2J8M A;  3SXN A;  1M1D A;  3DR6 A;  1NE9 A;  4JXR A;  4K30 A;  4CYO A;  2YNE A;  2HV2 A;  5AG5 A;  2OB0 A;  2P6E A;  3CXQ A;  4JD6 A;  4U9Y A;  5KTD A;  2PR8 A;  1IID A;  1J4J A;  1VHS A;  3QB8 A;  1QSO A;  2VI7 A;  4MFK A;  5IV0 A;  1YR0 A;  4XPK A;  5A27 A;  2REE A;  2Y0M A;  2OH1 A;  2FT0 A;  2GIV A;  1YVK A;  4PK2 A;  4A95 A;  4KUA A;  2FIW A;  2Z3M A;  4UBR A;  1TIQ A;  3NE7 A;  1QSN A;  3EO4 A;  3RYO A;  2DPT A;  4CGN A;  2JLM A;  1YGH A;  4CAF A;  1WWZ A;  2Z11 A;  3DR8 A;  4OLL A;  1KUV A;  2A4N A;  2WSA A;  3SHP A;  2BSW A;  2Q04 A;  4NSQ A;  2ATR A;  4AG7 A;  1QSM A;  4ORF A;  4CYP A;  4BMH A;  2Q4V A;  1NMT A;  2QML A;  3G3S A;  4HNY B;  4XNH C;  2ZW7 A;  2YND A;  5E96 A;  3S6H A;  2JEV A;  3VWD A;  4UCP A;  5CNP A;  3TTH A;  2EUI A;  4B11 A;  2PR1 A;  5JQ4 A;  1XE4 A;  4HNW B;  4L8A A;  2AJ6 A;  4F0Y A;  4CGM A;  1Z9U A;  1Y9K A;  4FD6 A;  2B5G B;  4E0A A;  4MFQ A;  3GYA A;  2F5I A;  4II9 A;  1K4J A;  4UWI A;  2PSW A;  4MHD A;  2R7H A;  2VZZ A;  5H84 A;  5F49 A;  2DPS A;  4PK3 A;  4C2Z A;  5C82 A;  3TOB A;  4UFW A;  4QB9 A;  2YGW A;  4RI1 A;  5J8C A;  2I79 A;  4XNH B;  2AE6 A;  5J8F A;  5G1Z A;  3TCV A;  3BJ8 A;  5BWA B;  4CAV A;  4UWJ A;  4C7I A;  4XPD C;  3A9L A;  4MI4 A;  2B3V A;  2CNM A;  4UFX A;  4KOX A;  3CXP A;  4PSX A;  1IYL A;  2WUU A;  2Q0Y A;  1Y7R A;  2FL4 A;  2J8R A;  4FD5 A;  5A28 A;  4RS2 A;  1MJB A;  5G22 A;  3G8W A;  3C26 A;  1BOB A;  4OAD A;  3W6S A;  3FIX A;  2GE3 A;  4MFJ A;  2G0B A;  2PQ8 A;  4AVA A;  1I12 A;  2P6G A;  3QAH A;  3D3S A;  5AGE A;  4KOV A;  1R57 A;  2YNC A;  4R3K A;  2R1I A;  4L89 A;  2X7B A;  4B12 A;  3K9U A;  4KOW A;  3IWE A;  4MFL A;  4LX9 A;  4UA3 A;  3FXT A;  4CGO A;  1S7K A;  1PU9 A;  2QIR A;  3GY9 A;  3PZJ A;  2OU2 A;  4XPD B;  4R9M A;  3F5B A;  1S3Z A;  2I00 A;  1RO5 A;  4A31 A;  2CNS A;  2J8N A;  2JDD A;  3R9F A;  3GKR A;  3H4Q A;  5F47 A;  2ZXV A;  4B5P A;  3R9G A;  4CRZ B;  3P2F A;  4KLV A;  4PSW A;  4KSF A;  2O28 A;  4A2Z A;  4YGO A;  3EXN A;  5HH1 A;  2BEI A;  5AG7 A;  4Q36 A;  4QUS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...