2PR1A

Crystal structure of the bacillus subtilis n-acetyltransferase ylbp protein in complex with coenzyme-a
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
152
structure length
152
Chain Sequence
MTKVERLLINYKTLEEFKKFKEYGIQELSMLEELQDNIIENDSTSPFYGIYFGDKLVARMSLYQVNGKSNPYFDNRQDYLELWKLEVLPGYQNRGYGRALVEFAKSFKMPIRTNPRMKSAEFWNKMNFKTVKYDMARDKGEDPLIWHPDMDR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized N-acetyltransferase ylbP
publication title Crystal structure of the Bacillus subtilis N-acetyltransferase YlbP protein in complex with Coenzyme-A.
rcsb
source organism Bacillus subtilis
molecule tags Transferase
total genus 42
structure length 152
sequence length 152
chains with identical sequence B
ec nomenclature ec 2.3.1.-:
pdb deposition date 2007-05-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 2pr1A00
1S7NA 4OADA 1YVKA 4MI4A 2OB0A 4JJXA 4FD7A 1WWZA 3EXNA 2ARHA 2J8RA 2PSWA 2ZW4A 4XNHC 1S3ZA 3R9EA 1CJWA 2PR1A 1YLEA 1UFHA 5IB0A 3FNCA 4F6AA 2P6EA 2REFA 2WPXA 3FRMA 4R3KA 2VZYA 1KUYA 2PR8A 3RYOA 4KOWA 1VHSA 1PUAA 3FIXA 2H5MA 4E0AA 1RXTA 4B5PA 3FBUA 2Z0ZA 3D2PA 4AVCA 5J8FA 1TIQA 4NCZA 4U9ZA 4MY0A 2EUIA 2PQ8A 3G3SA 3BJ8A 1WK4A 1XIXA 4CAVA 5JPHA 1CM0A 4YRHA 4AG7A 2OZHA 2ATRA 3KKWA 4QC6A 1MJBA 4JXRA 4XPDB 3NE7A 3I3GA 2REEA 2IL4A 2Q0YA 2FL4A 4II9A 4AG9A 2WPWA 3DR6A 3S6FA 5KTAA 4UBRA 4EVYA 4MBUA 1IB1E 2EVNA 1P4NA 3FB3A 3SXNA 1BOBA 1VKCA 5FVJA 1S5KA 3PZJA 1QSNA 3IWGA 2C27A 4OAEA 2BL1A 2FCKA 3V8IA 5H86A 4XPKA 4RI1A 4UWIA 4B5OA 4KLWA 3H4QA 2OU2A 3B8GA 3W6XA 4E8OA 1J4JA 2HV2A 5F49A 4FD4A 1IIDA 3EFAA 4R9MA 4NEXA 1MJAA 1N71A 2QMLA 4YGOA 1XEBA 4XPLA 2QECA 1SQHA 1K4JA 2GE3A 4KUAA 4F0YA 2Q7BA 1Y9KA 2VBQA 2Q44A 1Z9UA 3R9GA 3TE4A 1Y7RA 1YVOA 4KORA 3BLNA 4H6ZA 4LX9A 4L8AA 4JD6A 3TT2A 4ZBGA 2JLMA 3QB8A 3PGPA 2J8NA 2BUEA 2VZZA 1Q2DA 4H6UA 1IYKA 2FT0A 3F8KA 3ZJ0A 2P6GA 4HNYB 1YREA 2R1IA 1GHEA 1L0CA 1NMTA 4IUSA 1S60A 5ISVA 4CAXA 4M3SA 3C26A 5IV0A 1YGHA 4PV6A 2F5IA 1XMTA 1R57A 3F0AA 2VXKA 3R9FA 4B5PB 4JXQA 2VQYA 2B58A 2HUZA 4KZTA 3TO9A 5KTCA 4KOYA 3JVNA 1P0HA 2Z11A 5EC4A 3SHPA 4JLYA 3VWDA 4Y49B 4ONUA 4R57A 2PC1A 3ZZIA 3IGRA 3UY5A 2FS5A 4RS2A 3TOAA 1BO4A 1IICA 2B5GB 2G3AA 4JWPA 3T9YA 4CAWA 4MY3A 1M44A 2B5GA 4KVXA 4QB9A 4MJ8A 2Q04A 2QIRA 5IX3A 2FE7A 4PK2A 1YX0A 2D4PA 2OH1A 4PK3A 1OZPA 2CNSA 3SXOA 5F47A 1ON0A 3BJ7A 5DWNA 3EC4A 4HNXB 4UA3A 3CXSA 4I49A 4E2AA 5J8CA 2RC4A 3D3SA 4KOXA 2JDCA 3TOBA 2O28A 4PSWA 4NXYA 3MGDA 2G3TA 4HKFA 4KOVA 3S6KA 5H84A 5GCNA 2GIVA 3TO7A 4X5KA 1Z4RA 3R95A 4ORFA 4NSQA 2P6FA 1NE9A 5HH1A 2A4NA 5EBVA 3TTHA 4AB7A 3I9SA 4U9YA 3LD2A 1Q2CA 4QVTA 5JQ4A 4GS4A 4L89A 2B3VA 5HMNA 2FIWA 3DDDA 3CXPA 2KCWA 4FD6A 5KTDA 2R7HA 4PSXA 3W6SA 1QSTA 2FSRA 4IF5A 2BSWA 1B6BA 2R8VA 4HNWB 4CRYB 2ZW6A 2ZXVA 5F46A 2B4DB 3CXQA 5C88A 4DNCA 2B4DA 1IYLA 3DNSA 2FXFA 3QAHA 3F5BA 2CNMA 4AVAA 1S7KA 1MJ9A 2BEIA 2VI7A 1KUXA 1YK3A 2X7BA 4CRZB 1QSRA 1Z4EA 2PRBA 4KUBA 1KZFA 4QUSA 4KVME 4XNHB 4LUAA 2CY2A 1QSOA 4KOTA 1NSLA 4J3GA 3FXTA 4MHDA 3TO6A 3GY9A 1S7LA 3N7ZA 4OLLA 4AVBA 4BMHA 3T90A 5F48A 4Y49C 1I1DA 5CNPA 4M85A 2ZPAA 3D8PA 1Y9WA 5C82A 3FYNA 2AJ6A 4KVOE 3P2HA 2CNTA 2DXQA 3DSBA 3GYAA 1FY7A 2Z10A 1B87A 3JUWA 1V0CA 2OZGA 1YR0A 3PP9A 4FD5A 3D2MA 4XPDC 2K5TA 4R87A 2P0WA 3R1KA 2AE6A 2HQYA 3P2FA 3S6GA 3LODA 1I12A 2R98A 4KOUA 2GANA 1I21A 2OZUA 2Q4VA 3W91A 2ZW5A 2JDDA 3E0KA 5I0CA 1QSMA 4QBJA 3EY5A 1U6MA 1KUVA 3R96A 2G0BA 5DWMA 1M4IA 4CS0B 1LRZA 1M1DA 1MK4A 4H89A 3GKRA 4NF1A 2FIAA 1PU9A 3EO4A 1M4GA 1S7FA 2B4BA 3VWEA 3DR8A 3S6HA 5E96A 1M4DA 2D4OA 1RO5A 4UWJA 1Q2YA 2ZW7A 3G8WA 4KLVA 4K30A 4U5YA 1XF8A 2B3UA 3OWCA 3TFYA 2PDOA 2JEVA 3WR7A 2I00A 2Y0MA 4YFJA 3TCVA 2J8MA 2Q4YA 4R3LA 2VEZA 1XE4A 2I79A 3K9UA 4KOSA 2NMTA
chains in the Genus database with same CATH superfamily
3KGQA 4BBHA 1S7NA 2Q43A 1JWQA 3IJ3A 4ZY1A 1LANA 3DLJA 4OADA 1YVKA 2PJBA 4MI4A 2YNCA 2OB0A 1LAPA 1ZLIA 1HDUA 4JJXA 4CGMA 4FD7A 2HB6A 3LMSA 1WWZA 2ZEOA 2GU2A 4OKOA 1F57A 4R7MA 1OBRA 4P4EA 2O53A 3EXNA 2PJ4A 3PRTA 4MFKA 2ARHA 3D67A 3H5ZA 2J8RA 2PSWA 3FMCA 2XEGA 1PCAA 2ZW4A 4LQ6A 4A94A 1Q7LA 1S3ZA 2GFQA 4XNHC 3R9EA 1CJWA 5AGEA 2PR1A 1YLEA 1UFHA 6CPAA 5IB0A 1VIXA 3FNCA 4ZYQA 4F6AA 3I1UA 2P6EA 2REFA 4MFLA 2WPXA 3FRMA 3RAMA 1X10A 4P6YA 3CDXA 4R3KA 4OIDA 2Q4ZA 4NJQA 2PJ5A 4YWYA 2VZYA 3GIUA 1KUYA 2PR8A 3QNVA 1AMPA 3RYOA 3S9LA 4KSIA 3B3CA 4MFPA 2JBKA 1VHSA 4KOWA 2JEWA 1HDQA 2C1CA 3IFEA 3LACA 1PUAA 3FIXA 2V77A 2H5MA 5G21A 4E0AA 1RXTA 5AG6A 4B5PA 3FBUA 2Z0ZA 3D2PA 1ELLP 4P4DA 4AVCA 5J8FA 1TIQA 1R3NA 4NCZA 4MY0A 4U9ZA 4KS9A 2EUIA 4MFZA 2PJCA 3B35A 5AG5A 2PQ8A 3G3SA 3BJ8A 3B7IA 1XFOA 5LYFA 3D66A 4A32A 1WK4A 1XIXA 5LYIA 4CAVA 4Z65A 4ONWA 1CM0A 5JPHA 1H8LA 4YRHA 1IOFA 3TX8A 4CGLA 4AG7A 5HVHA 2OZHA 4MFJA 2ATRA 3KKWA 4QC6A 8CPAA 2ZEHA 1MJBA 2CIJA 4JXRA 4XPDB 3NE7A 3I3GA 2PJ1A 5BWAB 5D8NA 2REEA 2IL4A 2QJ8A 4F8ZA 2Q0YA 3WC5A 3WABA 2FL4A 3VARA 1Y0YA 1Z5RA 4P10A 4PXDA 2YNDA 3IU2A 4F9UA 4II9A 2ZEFA 2NYQA 4AG9A 2WPWA 3DR6A 3KASA 2GLFA 3S6FA 5KTAA 4UBRA 2FVGA 4NGTA 3B3WA 3H8GA 4DUKA 4EVYA 4MBUA 2F7VA 3FX6A 1IB1E 4LQGA 2EVNA 3IU1A 3IC1A 1P4NA 2ODFA 1QQ9A 4R6TA 3FB3A 3TC8A 3SXNA 1BOBA 1VKCA 2ZEPA 3FF3A 2WZNA 5FVJA 2AFWA 4MHNA 3V7ZA 1S5KA 4NGSA 1YW6A 3PZJA 4CYNA 1QSNA 3IWGA 2C27A 4OAEA 2BL1A 5AG7A 2FCKA 3TE4A 3V8IA 5LRGA 5H86A 4OC5A 2ZENA 2ZELA 4XPKA 4RI1A 4UWIA 4B5OA 3IO1A 4OMEA 4KLWA 3H4QA 4OC3A 5HVGA 2OU2A 1TKFA 3B8GA 3PB6X 1CBXA 3D7DA 3W6XA 4E8OA 4FBEA 1J4JA 3KI9A 2GLJA 2HV2A 3PBEA 5F49A 3PEIA 5JH9A 4UCPA 4FD4A 2ABZA 1IIDA 3EFAA 5LYDA 3VH9A 1ARMA 4R9MA 4NEXA 1MJAA 1ARLA 1N71A 2QMLA 2V8GA 4YGOA 1XEBA 4XPLA 3FJUA 2QECA 1SQHA 3B3VA 3RO0A 3RNZA 4MRIA 1K4JA 4NGPA 2PIYA 4H2KA 2GE3A 2V8VA 2BO9A 4KUAA 4C7HA 3H8FA 4F0YA 1IOIA 2Q7BA 2J9AA 1Y9KA 2VBQA 1YSJA 2PJ6A 3LWUA 3BI1A 2AFOA 2Z3KA 4OC4A 2PJ3A 1Z9UA 2Q44A 1A2ZA 3FEDA 1Y7RA 3R9GA 1YVOA 4KORA 4X8IA 1LFWA 3BLNA 3BHXA 1Z8LA 4H6ZA 4LX9A 2C6PA 2XEJA 4JD6A 4L8AA 3TT2A 3K2KA 4NGNA 4ZBGA 2JLMA 3QB8A 3BI0A 3PGPA 2J8NA 3BXMA 2BUEA 2DEAA 2VZZA 1FNOA 1Q2DA 4H6UA 3D68A 4MFQA 1IYKA 2FT0A 1Z8WA 1Y0RA 3F8KA 1FT7A 5EMIA 4C2XA 1R43A 1ZLHA 3KHZA 3PB4X 5K8MA 5J1QA 3ISZA 3ZJ0A 2P6GA 4HNYB 4DYOA 4MHYA 2IMOA 1YREA 5IB9A 4UFVA 4BD9A 2R1IA 4M6GA 1XJOA 5ELYA 1GHEA 1L0CA 4O23A 1AYEA 2V8HA 1NMTA 4IUSA 1S60A 5ISVA 2QYVA 4CAXA 4GXHA 3KQXA 4M3SA 3C26A 5IV0A 3VATA 1CP7A 4WJBA 1YGHA 4PV6A 2F5IA 3KL9A 1XMTA 1R57A 2AFXA 2DPTA 2VL1A 3F0AA 2YNEA 2VXKA 1JQGA 4OC1A 4W9YA 3R9FA 4PXCA 1TKHA 4JXQA 4B5PB 2VQYA 2B58A 1YLOA 2HUZA 4KZTA 3TO9A 5KTCA 3T8WA 3JVNA 4KOYA 1P0HA 2Z11A 4M6IA 2PJ8A 5EC4A 3SHPA 4G1PA 3S9NA 2DF5A 1CX8A 4JLYA 3VWDA 4IAVA 4Y49B 4ONUA 4PXBA 2NSMA 4R57A 4OC2A 3WC6A 4MCPA 3HLPA 4UIBA 4B12A 2PJ9A 3K9TA 4ZX9A 2PC1A 3CPXA 4MHPA 3ZZIA 3IGRA 3UY5A 2FS5A 1Z2LA 4RS2A 2PVVA 3TOAA 2PJAA 3ISXA 1BO4A 4MCSA 4UFXA 4C68A 1IICA 2RFHA 2B5GB 2G3AA 1NSAA 2PRQA 3NA6A 1ZG8A 4FUUA 4JWPA 3T9YA 2PJ7A 4CAWA 4IK2A 1M44A 4MY3A 1TKJA 5K8OA 4A33A 4JYWA 1TF8A 2B5GA 4CYPA 4KVXA 4QB9A 3NH5A 4MJ8A 2Q04A 2QIRA 5IX3A 1DTDA 2FE7A 4PK2A 3PBBA 4NGRA 4UFWA 1YX0A 2Z3PA 1TXRA 2AFMA 2AFZA 2EBJA 2D4PA 2OH1A 3IWWA 1VHOA 1EE3P 1OZPA 4PK3A 2CNSA 5D29A 4TWEA 4UIAA 1ON0A 5F47A 3SXOA 3BJ7A 4JZ0A 5DWNA 5F09A 3EC4A 5I4MA 3FEEA 4HNXB 4UA3A 4UCNA 3CXSA 7CPAA 1Z8TA 4I49A 4E2AA 2C6GA 5J8CA 2RC4A 5DS0A 2OOTA 3D3SA 4KOXA 2JDCA 3TOBA 2O28A 2Z3OA 4P45A 4PSWA 4NXYA 3MGDA 2G3TA 4HKFA 3D4UA 4KOVA 3D7GA 2Z3LA 3S6KA 3SI0A 5H84A 4KSFA 4ZY2A 5GCNA 5LRJA 1AUGA 2GIVA 4NGQA 4Q38A 2CXAA 4X5KA 3TO7A 5JM6A 1Z4RA 3R95A 4NJRA 4ORFA 2POKA 2Q7SA 3JRUA 4NSQA 2P6FA 5LRKA 4UEFA 1NE9A 4YU9A 4B10A 2GREA 2OR4A 5HH1A 2HC9A 4C2YA 1RTQA 2A4NA 3CZXA 5EBVA 3TTHA 3I9SA 4AB7A 4B11A 2IJZA 4U9YA 3IIBA 3LD2A 1Q2CA 4QVTA 3PFOA 5JQ4A 4GS4A 4L89A 2B3VA 5HMNA 2FIWA 5G20A 1VHEA 3DDDA 3CXPA 4RN7A 2F8HA 2KCWA 4FD6A 4PPZA 3IWEA 5KTDA 2R7HA 3KQZA 4FWUA 1CPXA 2Q51A 3KZWA 3FVLA 5A28A 4PSXA 3W6SA 1QSTA 3CPAA 2FSRA 4OIWA 4A37A 3RZAA 2EO8A 5CBMA 4IF5A 2BSWA 1B6BA 5HVFA 2R8VA 4HNWB 4MXUA 4CRYB 3DGVA 1TF9A 2QVPA 2ZW6A 2ZXVA 1Z8XA 5F46A 4A38A 4A39A 5LYLA 2ZEEA 2WSAA 2B4DB 3S9MA 1DE4C 3CXQA 5C88A 2YNCC 4DNCA 2ZEMA 2Z3MA 2B4DA 1YW4A 2ZOFA 1IYLA 3DNSA 2FXFA 3GUXA 3QAHA 4B14A 4CGPA 4EWTA 2XEIA 4EMEA 3F5BA 3L2NA 2CNMA 1BAVA 2PVWA 3MRUA 3PB9X 4OC0A 4AVAA 4C2ZA 3KHXA 1HEEA 1S7KA 2PCUA 3N5FA 4ZX8A 5JGFA 4P4BA 4UF4A 3SJXA 1MJ9A 4BINA 3NH4A 1GYTA 3D7HA 2BEIA 2VI7A 1KUXA 1YK3A 2X7BA 1CPSA 1BPNA 3GLJA 4GM5A 4CRZB 1QSRA 1Z4EA 2PRBA 4KUBA 1KZFA 2EWBA 2V8DA 4QUSA 5G1ZA 5AG4A 4KVME 4XNHB 4LUAA 5THWA 2CY2A 3SJEA 4A30A 1QSOA 5K8PA 3KR4A 2AFUA 4R8FA 4KOTA 3FECA 1NSLA 4J3GA 3V38A 4CGOA 1XRYA 3PFEA 4ZY0A 3FXTA 4CGNA 4MHDA 2CTCA 1ZG7A 1ZG9A 3MN8A 2O4HA 4OP4A 3TO6A 3GY9A 4CPAA 1S7LA 2ZOGA 3N7ZA 2ZEGA 4OLLA 1BLLE 4AVBA 3KR5A 1VGYA 4P4JA 4BMHA 4PXEA 3T90A 5F48A 4Y49C 1I1DA 5CNPA 3CT9A 3B2YA 4M85A 2ZPAA 3D8PA 3JTKA 4MMOA 5HXDA 1Y9WA 5C82A 2AFSA 1PYTB 2BCOA 1IY7A 3FYNA 3WC7A 2AJ6A 4MCRA 4KVOE 3P2HA 2ANPA 3IEHA 4Q7AA 4B6ZA 4CYOA 1ELMP 2EK8A 2CNTA 2DXQA 1BPMA 2RB7A 2WYRA 3DSBA 1FY7A 2Z10A 1B87A 3GB0A 3GYAA 1V0CA 3JUWA 2XEFA 3NH8A 4RUHA 4M6HA 2OZGA 4A95A 4CYQA 1YR0A 3PP9A 1LCPA 4FD5A 3D2MA 4XPDC 2K5TA 1X12A 2CTBA 4AXVA 4P44A 1UWYA 2ZEDA 4R87A 2P0WA 5G22A 2G9DA 2IQ6A 3QAYA 4P4IA 4FAIA 2DPSA 3R1KA 2AE6A 1KWMA 2HQYA 3P2FA 1XMBA 3LODA 2PIZA 4K3NA 3S6GA 4C7IA 1XOVA 1I12A 2R98A 2WUUA 4P4FA 2JBJA 4KOUA 2GANA 1I21A 2OZUA 2Q4VA 3PB7X 3W91A 3H8EA 4X2TA 2ZW5A 2JDDA 4KSAA 3E0KA 4UEZA 5I0CA 1QSMA 2EK9A 4A2ZA 4QBJA 4TNUA 3FH4A 1QMUA 4F0XA 3EY5A 3NE8A 4EFDA 1U6MA 2PJ0A 1M4LA 1KUVA 4WWVA 3R96A 1F2PA 2G0BA 5DWMA 1M4IA 1XBUA 4MHZA 4X3RA 3RBUA 1YQEA 4CS0B 1IU8A 1LRZA 2BOAA 4IHMA 3SJFA 1LOKA 4CAEA 1M1DA 1MK4A 4H89A 3GKRA 4R76A 4ZGYB 2I3CA 4NF1A 2FIAA 4PQAA 5CPAA 3SJGA 4Q36A 4CAFA 3NFZA 1PU9A 3EO4A 1M4GA 1S7FA 4HPSA 4DJLA 2B4BA 2C6CA 3SI2A 3VWEA 5A27A 3DR8A 3S6HA 1CP6A 5E96A 2PE3A 1M4DA 2D4OA 4UCMA 1RO5A 2PJ2A 4UWJA 1Q2YA 2ZW7A 4F9VA 3HUVA 4NFRA 1YMEA 3G8WA 4KLVA 1Y7EA 4K30A 4NGMA 1ZO0A 4U5YA 3B3TA 5K8NA 3D7FA 3PB8X 1XF8A 2B3UA 3OWCA 2CF4A 3TFYA 3A9LA 1F2OA 2Z3NA 1LAMA 2PDOA 2JEVA 3WR7A 2I00A 1CG2A 2Y0MA 4YFJA 4UEEA 4ZI6A 4A31A 4MCQA 3TCVA 2YGWA 2J8MA 2Q4YA 3B3SA 4R3LA 2VEZA 3SI1A 1XE4A 2I79A 3K9UA 1IGBA 3WT4A 4B13A 4KOSA 2NMTA
chains in the Genus database with same CATH topology
4BBHA 1S7NA 4OADA 1YVKA 4MI4A 2YNCA 2OB0A 4JJXA 4CGMA 4FD7A 1WWZA 3EXNA 4MFKA 2ARHA 3H5ZA 2J8RA 2PSWA 2ZW4A 4XNHC 1S3ZA 3R9EA 1CJWA 5AGEA 2PR1A 1YLEA 1UFHA 5IB0A 3FNCA 4F6AA 2P6EA 2REFA 4MFLA 2WPXA 3FRMA 4R3KA 2VZYA 1KUYA 2PR8A 3RYOA 4MFPA 1VHSA 4KOWA 1PUAA 3FIXA 2H5MA 5G21A 4E0AA 1RXTA 5AG6A 4B5PA 3FBUA 2Z0ZA 3D2PA 4AVCA 5J8FA 1TIQA 4NCZA 4U9ZA 4MY0A 4KS9A 2EUIA 4MFZA 5AG5A 2PQ8A 3G3SA 3BJ8A 4A32A 1WK4A 1XIXA 4CAVA 5JPHA 1CM0A 4YRHA 4CGLA 4AG7A 2OZHA 4MFJA 2ATRA 3KKWA 4QC6A 1MJBA 4JXRA 4XPDB 3NE7A 3I3GA 5BWAB 2REEA 2IL4A 2Q0YA 2FL4A 4II9A 2YNDA 3IU2A 4AG9A 2WPWA 3DR6A 3S6FA 5KTAA 4UBRA 4EVYA 4MBUA 1IB1E 2EVNA 3IU1A 1P4NA 3FB3A 3SXNA 1BOBA 1VKCA 5FVJA 1S5KA 4CYNA 3PZJA 1QSNA 3IWGA 2C27A 4OAEA 2BL1A 5AG7A 2FCKA 3V8IA 5H86A 4XPKA 4RI1A 4UWIA 4B5OA 4KLWA 3H4QA 2OU2A 3B8GA 3W6XA 4E8OA 1J4JA 2HV2A 5F49A 4UCPA 4FD4A 1IIDA 3EFAA 4R9MA 4NEXA 1MJAA 1N71A 2QMLA 4YGOA 1XEBA 4XPLA 2QECA 1SQHA 1K4JA 2GE3A 4KUAA 4C7HA 4F0YA 2Q7BA 1Y9KA 2VBQA 2Z3KA 2Q44A 1Z9UA 3R9GA 3TE4A 4C2ZA 1Y7RA 1YVOA 4KORA 3BLNA 4H6ZA 4LX9A 4L8AA 4JD6A 3TT2A 4ZBGA 2JLMA 3QB8A 3PGPA 2J8NA 2BUEA 2VZZA 1Q2DA 4H6UA 4MFQA 1IYKA 2FT0A 3F8KA 4C2XA 3ZJ0A 2P6GA 4HNYB 1YREA 4UFVA 2R1IA 1GHEA 1L0CA 1NMTA 4IUSA 1S60A 5ISVA 4CAXA 4M3SA 3C26A 5IV0A 1YGHA 4PV6A 2F5IA 1XMTA 1R57A 3F0AA 2DPTA 2YNEA 2VXKA 3R9FA 4B5PB 4JXQA 2VQYA 2B58A 2HUZA 4KZTA 3TO9A 5KTCA 3JVNA 4KOYA 1P0HA 2Z11A 5EC4A 3SHPA 4JLYA 3VWDA 4Y49B 4ONUA 4R57A 4B12A 2PC1A 3ZZIA 3IGRA 3UY5A 2FS5A 4RS2A 3TOAA 1BO4A 4UFXA 4C68A 1IICA 2B5GB 2G3AA 4JWPA 3T9YA 4CAWA 4MY3A 1M44A 4A33A 2B5GA 4CYPA 4KVXA 4QB9A 4MJ8A 2Q04A 2QIRA 5IX3A 2FE7A 4PK2A 4UFWA 1YX0A 2Z3PA 2D4PA 2OH1A 4PK3A 1OZPA 2CNSA 3SXOA 5F47A 1ON0A 3BJ7A 5DWNA 3EC4A 4HNXB 4UA3A 4UCNA 3CXSA 4I49A 4E2AA 5J8CA 2RC4A 3D3SA 4KOXA 2JDCA 3TOBA 2O28A 2Z3OA 4PSWA 4NXYA 3MGDA 2G3TA 4HKFA 4KOVA 2Z3LA 3S6KA 5H84A 4KSFA 5GCNA 2GIVA 3TO7A 4Q38A 4X5KA 2CXAA 1Z4RA 3R95A 4ORFA 4NSQA 2P6FA 4B10A 1NE9A 5HH1A 4C2YA 2A4NA 5EBVA 3TTHA 4B11A 4AB7A 3I9SA 4U9YA 3LD2A 1Q2CA 4QVTA 5JQ4A 4GS4A 4L89A 2B3VA 5HMNA 2FIWA 5G20A 3DDDA 3CXPA 2KCWA 4FD6A 3IWEA 5KTDA 2R7HA 5A28A 4PSXA 3W6SA 1QSTA 2FSRA 4IF5A 2BSWA 1B6BA 2R8VA 4HNWB 4CRYB 2ZW6A 2ZXVA 5F46A 2WSAA 2B4DB 3CXQA 5C88A 2YNCC 4DNCA 2Z3MA 2B4DA 1IYLA 3DNSA 2FXFA 3QAHA 4B14A 4CGPA 3F5BA 2CNMA 4AVAA 1S7KA 1MJ9A 2BEIA 2VI7A 1KUXA 1YK3A 2X7BA 4CRZB 1QSRA 1Z4EA 2PRBA 4KUBA 1KZFA 5AG4A 4QUSA 5G1ZA 4KVME 4XNHB 4LUAA 2CY2A 4A30A 1QSOA 4KOTA 1NSLA 4J3GA 4CGOA 3FXTA 4CGNA 4MHDA 3TO6A 3GY9A 1S7LA 3N7ZA 4OLLA 4AVBA 4BMHA 3T90A 5F48A 4Y49C 1I1DA 5CNPA 4M85A 2ZPAA 3D8PA 3JTKA 1Y9WA 5C82A 3FYNA 2AJ6A 4KVOE 3P2HA 4CYOA 2CNTA 2DXQA 3DSBA 3GYAA 1FY7A 2Z10A 1B87A 3JUWA 1V0CA 2OZGA 4A95A 4CYQA 1YR0A 3PP9A 4FD5A 3D2MA 4XPDC 2K5TA 4R87A 2P0WA 5G22A 2DPSA 3R1KA 2AE6A 2HQYA 3P2FA 3S6GA 3LODA 4C7IA 1I12A 2R98A 2WUUA 4KOUA 2GANA 1I21A 2OZUA 2Q4VA 3W91A 2ZW5A 2JDDA 4KSAA 3E0KA 5I0CA 1QSMA 4A2ZA 4QBJA 4F0XA 3EY5A 1U6MA 1KUVA 3R96A 2G0BA 5DWMA 1M4IA 4CS0B 1LRZA 4CAEA 1M1DA 1MK4A 4H89A 3GKRA 4NF1A 2FIAA 4Q36A 4CAFA 1PU9A 3EO4A 1M4GA 1S7FA 2B4BA 3VWEA 5A27A 3DR8A 3S6HA 5E96A 1M4DA 2D4OA 4UCMA 1RO5A 4UWJA 1Q2YA 2ZW7A 3G8WA 4KLVA 4K30A 1ZO0A 4U5YA 1XF8A 2B3UA 3OWCA 3TFYA 3A9LA 2Z3NA 2PDOA 2JEVA 3WR7A 2I00A 2Y0MA 4YFJA 4A31A 3TCVA 2YGWA 2J8MA 2Q4YA 4R3LA 2VEZA 1XE4A 2I79A 3K9UA 4ZGYB 4B13A 4KOSA 2NMTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1S7N A;  4OAD A;  1YVK A;  4MI4 A;  2OB0 A;  4JJX A;  4FD7 A;  1WWZ A;  3EXN A;  2ARH A;  2J8R A;  2PSW A;  2ZW4 A;  4XNH C;  1S3Z A;  3R9E A;  1CJW A;  2PR1 A;  1YLE A;  1UFH A;  5IB0 A;  3FNC A;  4F6A A;  2P6E A;  2REF A;  2WPX A;  3FRM A;  4R3K A;  2VZY A;  1KUY A;  2PR8 A;  3RYO A;  4KOW A;  1VHS A;  1PUA A;  3FIX A;  2H5M A;  4E0A A;  1RXT A;  4B5P A;  3FBU A;  2Z0Z A;  3D2P A;  4AVC A;  5J8F A;  1TIQ A;  4NCZ A;  4U9Z A;  4MY0 A;  2EUI A;  2PQ8 A;  3G3S A;  3BJ8 A;  1WK4 A;  1XIX A;  4CAV A;  5JPH A;  1CM0 A;  4YRH A;  4AG7 A;  2OZH A;  2ATR A;  3KKW A;  4QC6 A;  1MJB A;  4JXR A;  4XPD B;  3NE7 A;  3I3G A;  2REE A;  2IL4 A;  2Q0Y A;  2FL4 A;  4II9 A;  4AG9 A;  2WPW A;  3DR6 A;  3S6F A;  5KTA A;  4UBR A;  4EVY A;  4MBU A;  1IB1 E;  2EVN A;  1P4N A;  3FB3 A;  3SXN A;  1BOB A;  1VKC A;  5FVJ A;  1S5K A;  3PZJ A;  1QSN A;  3IWG A;  2C27 A;  4OAE A;  2BL1 A;  2FCK A;  3V8I A;  5H86 A;  4XPK A;  4RI1 A;  4UWI A;  4B5O A;  4KLW A;  3H4Q A;  2OU2 A;  3B8G A;  3W6X A;  4E8O A;  1J4J A;  2HV2 A;  5F49 A;  4FD4 A;  1IID A;  3EFA A;  4R9M A;  4NEX A;  1MJA A;  1N71 A;  2QML A;  4YGO A;  1XEB A;  4XPL A;  2QEC A;  1SQH A;  1K4J A;  2GE3 A;  4KUA A;  4F0Y A;  2Q7B A;  1Y9K A;  2VBQ A;  2Q44 A;  1Z9U A;  3R9G A;  3TE4 A;  1Y7R A;  1YVO A;  4KOR A;  3BLN A;  4H6Z A;  4LX9 A;  4L8A A;  4JD6 A;  3TT2 A;  4ZBG A;  2JLM A;  3QB8 A;  3PGP A;  2J8N A;  2BUE A;  2VZZ A;  1Q2D A;  4H6U A;  1IYK A;  2FT0 A;  3F8K A;  3ZJ0 A;  2P6G A;  4HNY B;  1YRE A;  2R1I A;  1GHE A;  1L0C A;  1NMT A;  4IUS A;  1S60 A;  5ISV A;  4CAX A;  4M3S A;  3C26 A;  5IV0 A;  1YGH A;  4PV6 A;  2F5I A;  1XMT A;  1R57 A;  3F0A A;  2VXK A;  3R9F A;  4B5P B;  4JXQ A;  2VQY A;  2B58 A;  2HUZ A;  4KZT A;  3TO9 A;  5KTC A;  4KOY A;  3JVN A;  1P0H A;  2Z11 A;  5EC4 A;  3SHP A;  4JLY A;  3VWD A;  4Y49 B;  4ONU A;  4R57 A;  2PC1 A;  3ZZI A;  3IGR A;  3UY5 A;  2FS5 A;  4RS2 A;  3TOA A;  1BO4 A;  1IIC A;  2B5G B;  2G3A A;  4JWP A;  3T9Y A;  4CAW A;  4MY3 A;  1M44 A;  2B5G A;  4KVX A;  4QB9 A;  4MJ8 A;  2Q04 A;  2QIR A;  5IX3 A;  2FE7 A;  4PK2 A;  1YX0 A;  2D4P A;  2OH1 A;  4PK3 A;  1OZP A;  2CNS A;  3SXO A;  5F47 A;  1ON0 A;  3BJ7 A;  5DWN A;  3EC4 A;  4HNX B;  4UA3 A;  3CXS A;  4I49 A;  4E2A A;  5J8C A;  2RC4 A;  3D3S A;  4KOX A;  2JDC A;  3TOB A;  2O28 A;  4PSW A;  4NXY A;  3MGD A;  2G3T A;  4HKF A;  4KOV A;  3S6K A;  5H84 A;  5GCN A;  2GIV A;  3TO7 A;  4X5K A;  1Z4R A;  3R95 A;  4ORF A;  4NSQ A;  2P6F A;  1NE9 A;  5HH1 A;  2A4N A;  5EBV A;  3TTH A;  4AB7 A;  3I9S A;  4U9Y A;  3LD2 A;  1Q2C A;  4QVT A;  5JQ4 A;  4GS4 A;  4L89 A;  2B3V A;  5HMN A;  2FIW A;  3DDD A;  3CXP A;  2KCW A;  4FD6 A;  5KTD A;  2R7H A;  4PSX A;  3W6S A;  1QST A;  2FSR A;  4IF5 A;  2BSW A;  1B6B A;  2R8V A;  4HNW B;  4CRY B;  2ZW6 A;  2ZXV A;  5F46 A;  2B4D B;  3CXQ A;  5C88 A;  4DNC A;  2B4D A;  1IYL A;  3DNS A;  2FXF A;  3QAH A;  3F5B A;  2CNM A;  4AVA A;  1S7K A;  1MJ9 A;  2BEI A;  2VI7 A;  1KUX A;  1YK3 A;  2X7B A;  4CRZ B;  1QSR A;  1Z4E A;  2PRB A;  4KUB A;  1KZF A;  4QUS A;  4KVM E;  4XNH B;  4LUA A;  2CY2 A;  1QSO A;  4KOT A;  1NSL A;  4J3G A;  3FXT A;  4MHD A;  3TO6 A;  3GY9 A;  1S7L A;  3N7Z A;  4OLL A;  4AVB A;  4BMH A;  3T90 A;  5F48 A;  4Y49 C;  1I1D A;  5CNP A;  4M85 A;  2ZPA A;  3D8P A;  1Y9W A;  5C82 A;  3FYN A;  2AJ6 A;  4KVO E;  3P2H A;  2CNT A;  2DXQ A;  3DSB A;  3GYA A;  1FY7 A;  2Z10 A;  1B87 A;  3JUW A;  1V0C A;  2OZG A;  1YR0 A;  3PP9 A;  4FD5 A;  3D2M A;  4XPD C;  2K5T A;  4R87 A;  2P0W A;  3R1K A;  2AE6 A;  2HQY A;  3P2F A;  3S6G A;  3LOD A;  1I12 A;  2R98 A;  4KOU A;  2GAN A;  1I21 A;  2OZU A;  2Q4V A;  3W91 A;  2ZW5 A;  2JDD A;  3E0K A;  5I0C A;  1QSM A;  4QBJ A;  3EY5 A;  1U6M A;  1KUV A;  3R96 A;  2G0B A;  5DWM A;  1M4I A;  4CS0 B;  1LRZ A;  1M1D A;  1MK4 A;  4H89 A;  3GKR A;  4NF1 A;  2FIA A;  1PU9 A;  3EO4 A;  1M4G A;  1S7F A;  2B4B A;  3VWE A;  3DR8 A;  3S6H A;  5E96 A;  1M4D A;  2D4O A;  1RO5 A;  4UWJ A;  1Q2Y A;  2ZW7 A;  3G8W A;  4KLV A;  4K30 A;  4U5Y A;  1XF8 A;  2B3U A;  3OWC A;  3TFY A;  2PDO A;  2JEV A;  3WR7 A;  2I00 A;  2Y0M A;  4YFJ A;  3TCV A;  2J8M A;  2Q4Y A;  4R3L A;  2VEZ A;  1XE4 A;  2I79 A;  3K9U A;  4KOS A;  2NMT A; 
#chains in the Genus database with same CATH topology
 3KGQ A;  4BBH A;  1S7N A;  2Q43 A;  1JWQ A;  3IJ3 A;  4ZY1 A;  1LAN A;  3DLJ A;  4OAD A;  1YVK A;  2PJB A;  4MI4 A;  2YNC A;  2OB0 A;  1LAP A;  1ZLI A;  1HDU A;  4JJX A;  4CGM A;  4FD7 A;  2HB6 A;  3LMS A;  1WWZ A;  2ZEO A;  2GU2 A;  4OKO A;  1F57 A;  4R7M A;  1OBR A;  4P4E A;  2O53 A;  3EXN A;  2PJ4 A;  3PRT A;  4MFK A;  2ARH A;  3D67 A;  3H5Z A;  2J8R A;  2PSW A;  3FMC A;  2XEG A;  1PCA A;  2ZW4 A;  4LQ6 A;  4A94 A;  1Q7L A;  1S3Z A;  2GFQ A;  4XNH C;  3R9E A;  1CJW A;  5AGE A;  2PR1 A;  1YLE A;  1UFH A;  6CPA A;  5IB0 A;  1VIX A;  3FNC A;  4ZYQ A;  4F6A A;  3I1U A;  2P6E A;  2REF A;  4MFL A;  2WPX A;  3FRM A;  3RAM A;  1X10 A;  4P6Y A;  3CDX A;  4R3K A;  4OID A;  2Q4Z A;  4NJQ A;  2PJ5 A;  4YWY A;  2VZY A;  3GIU A;  1KUY A;  2PR8 A;  3QNV A;  1AMP A;  3RYO A;  3S9L A;  4KSI A;  3B3C A;  4MFP A;  2JBK A;  1VHS A;  4KOW A;  2JEW A;  1HDQ A;  2C1C A;  3IFE A;  3LAC A;  1PUA A;  3FIX A;  2V77 A;  2H5M A;  5G21 A;  4E0A A;  1RXT A;  5AG6 A;  4B5P A;  3FBU A;  2Z0Z A;  3D2P A;  1ELL P;  4P4D A;  4AVC A;  5J8F A;  1TIQ A;  1R3N A;  4NCZ A;  4MY0 A;  4U9Z A;  4KS9 A;  2EUI A;  4MFZ A;  2PJC A;  3B35 A;  5AG5 A;  2PQ8 A;  3G3S A;  3BJ8 A;  3B7I A;  1XFO A;  5LYF A;  3D66 A;  4A32 A;  1WK4 A;  1XIX A;  5LYI A;  4CAV A;  4Z65 A;  4ONW A;  1CM0 A;  5JPH A;  1H8L A;  4YRH A;  1IOF A;  3TX8 A;  4CGL A;  4AG7 A;  5HVH A;  2OZH A;  4MFJ A;  2ATR A;  3KKW A;  4QC6 A;  8CPA A;  2ZEH A;  1MJB A;  2CIJ A;  4JXR A;  4XPD B;  3NE7 A;  3I3G A;  2PJ1 A;  5BWA B;  5D8N A;  2REE A;  2IL4 A;  2QJ8 A;  4F8Z A;  2Q0Y A;  3WC5 A;  3WAB A;  2FL4 A;  3VAR A;  1Y0Y A;  1Z5R A;  4P10 A;  4PXD A;  2YND A;  3IU2 A;  4F9U A;  4II9 A;  2ZEF A;  2NYQ A;  4AG9 A;  2WPW A;  3DR6 A;  3KAS A;  2GLF A;  3S6F A;  5KTA A;  4UBR A;  2FVG A;  4NGT A;  3B3W A;  3H8G A;  4DUK A;  4EVY A;  4MBU A;  2F7V A;  3FX6 A;  1IB1 E;  4LQG A;  2EVN A;  3IU1 A;  3IC1 A;  1P4N A;  2ODF A;  1QQ9 A;  4R6T A;  3FB3 A;  3TC8 A;  3SXN A;  1BOB A;  1VKC A;  2ZEP A;  3FF3 A;  2WZN A;  5FVJ A;  2AFW A;  4MHN A;  3V7Z A;  1S5K A;  4NGS A;  1YW6 A;  3PZJ A;  4CYN A;  1QSN A;  3IWG A;  2C27 A;  4OAE A;  2BL1 A;  5AG7 A;  2FCK A;  3TE4 A;  3V8I A;  5LRG A;  5H86 A;  4OC5 A;  2ZEN A;  2ZEL A;  4XPK A;  4RI1 A;  4UWI A;  4B5O A;  3IO1 A;  4OME A;  4KLW A;  3H4Q A;  4OC3 A;  5HVG A;  2OU2 A;  1TKF A;  3B8G A;  3PB6 X;  1CBX A;  3D7D A;  3W6X A;  4E8O A;  4FBE A;  1J4J A;  3KI9 A;  2GLJ A;  2HV2 A;  3PBE A;  5F49 A;  3PEI A;  5JH9 A;  4UCP A;  4FD4 A;  2ABZ A;  1IID A;  3EFA A;  5LYD A;  3VH9 A;  1ARM A;  4R9M A;  4NEX A;  1MJA A;  1ARL A;  1N71 A;  2QML A;  2V8G A;  4YGO A;  1XEB A;  4XPL A;  3FJU A;  2QEC A;  1SQH A;  3B3V A;  3RO0 A;  3RNZ A;  4MRI A;  1K4J A;  4NGP A;  2PIY A;  4H2K A;  2GE3 A;  2V8V A;  2BO9 A;  4KUA A;  4C7H A;  3H8F A;  4F0Y A;  1IOI A;  2Q7B A;  2J9A A;  1Y9K A;  2VBQ A;  1YSJ A;  2PJ6 A;  3LWU A;  3BI1 A;  2AFO A;  2Z3K A;  4OC4 A;  2PJ3 A;  1Z9U A;  2Q44 A;  1A2Z A;  3FED A;  1Y7R A;  3R9G A;  1YVO A;  4KOR A;  4X8I A;  1LFW A;  3BLN A;  3BHX A;  1Z8L A;  4H6Z A;  4LX9 A;  2C6P A;  2XEJ A;  4JD6 A;  4L8A A;  3TT2 A;  3K2K A;  4NGN A;  4ZBG A;  2JLM A;  3QB8 A;  3BI0 A;  3PGP A;  2J8N A;  3BXM A;  2BUE A;  2DEA A;  2VZZ A;  1FNO A;  1Q2D A;  4H6U A;  3D68 A;  4MFQ A;  1IYK A;  2FT0 A;  1Z8W A;  1Y0R A;  3F8K A;  1FT7 A;  5EMI A;  4C2X A;  1R43 A;  1ZLH A;  3KHZ A;  3PB4 X;  5K8M A;  5J1Q A;  3ISZ A;  3ZJ0 A;  2P6G A;  4HNY B;  4DYO A;  4MHY A;  2IMO A;  1YRE A;  5IB9 A;  4UFV A;  4BD9 A;  2R1I A;  4M6G A;  1XJO A;  5ELY A;  1GHE A;  1L0C A;  4O23 A;  1AYE A;  2V8H A;  1NMT A;  4IUS A;  1S60 A;  5ISV A;  2QYV A;  4CAX A;  4GXH A;  3KQX A;  4M3S A;  3C26 A;  5IV0 A;  3VAT A;  1CP7 A;  4WJB A;  1YGH A;  4PV6 A;  2F5I A;  3KL9 A;  1XMT A;  1R57 A;  2AFX A;  2DPT A;  2VL1 A;  3F0A A;  2YNE A;  2VXK A;  1JQG A;  4OC1 A;  4W9Y A;  3R9F A;  4PXC A;  1TKH A;  4JXQ A;  4B5P B;  2VQY A;  2B58 A;  1YLO A;  2HUZ A;  4KZT A;  3TO9 A;  5KTC A;  3T8W A;  3JVN A;  4KOY A;  1P0H A;  2Z11 A;  4M6I A;  2PJ8 A;  5EC4 A;  3SHP A;  4G1P A;  3S9N A;  2DF5 A;  1CX8 A;  4JLY A;  3VWD A;  4IAV A;  4Y49 B;  4ONU A;  4PXB A;  2NSM A;  4R57 A;  4OC2 A;  3WC6 A;  4MCP A;  3HLP A;  4UIB A;  4B12 A;  2PJ9 A;  3K9T A;  4ZX9 A;  2PC1 A;  3CPX A;  4MHP A;  3ZZI A;  3IGR A;  3UY5 A;  2FS5 A;  1Z2L A;  4RS2 A;  2PVV A;  3TOA A;  2PJA A;  3ISX A;  1BO4 A;  4MCS A;  4UFX A;  4C68 A;  1IIC A;  2RFH A;  2B5G B;  2G3A A;  1NSA A;  2PRQ A;  3NA6 A;  1ZG8 A;  4FUU A;  4JWP A;  3T9Y A;  2PJ7 A;  4CAW A;  4IK2 A;  1M44 A;  4MY3 A;  1TKJ A;  5K8O A;  4A33 A;  4JYW A;  1TF8 A;  2B5G A;  4CYP A;  4KVX A;  4QB9 A;  3NH5 A;  4MJ8 A;  2Q04 A;  2QIR A;  5IX3 A;  1DTD A;  2FE7 A;  4PK2 A;  3PBB A;  4NGR A;  4UFW A;  1YX0 A;  2Z3P A;  1TXR A;  2AFM A;  2AFZ A;  2EBJ A;  2D4P A;  2OH1 A;  3IWW A;  1VHO A;  1EE3 P;  1OZP A;  4PK3 A;  2CNS A;  5D29 A;  4TWE A;  4UIA A;  1ON0 A;  5F47 A;  3SXO A;  3BJ7 A;  4JZ0 A;  5DWN A;  5F09 A;  3EC4 A;  5I4M A;  3FEE A;  4HNX B;  4UA3 A;  4UCN A;  3CXS A;  7CPA A;  1Z8T A;  4I49 A;  4E2A A;  2C6G A;  5J8C A;  2RC4 A;  5DS0 A;  2OOT A;  3D3S A;  4KOX A;  2JDC A;  3TOB A;  2O28 A;  2Z3O A;  4P45 A;  4PSW A;  4NXY A;  3MGD A;  2G3T A;  4HKF A;  3D4U A;  4KOV A;  3D7G A;  2Z3L A;  3S6K A;  3SI0 A;  5H84 A;  4KSF A;  4ZY2 A;  5GCN A;  5LRJ A;  1AUG A;  2GIV A;  4NGQ A;  4Q38 A;  2CXA A;  4X5K A;  3TO7 A;  5JM6 A;  1Z4R A;  3R95 A;  4NJR A;  4ORF A;  2POK A;  2Q7S A;  3JRU A;  4NSQ A;  2P6F A;  5LRK A;  4UEF A;  1NE9 A;  4YU9 A;  4B10 A;  2GRE A;  2OR4 A;  5HH1 A;  2HC9 A;  4C2Y A;  1RTQ A;  2A4N A;  3CZX A;  5EBV A;  3TTH A;  3I9S A;  4AB7 A;  4B11 A;  2IJZ A;  4U9Y A;  3IIB A;  3LD2 A;  1Q2C A;  4QVT A;  3PFO A;  5JQ4 A;  4GS4 A;  4L89 A;  2B3V A;  5HMN A;  2FIW A;  5G20 A;  1VHE A;  3DDD A;  3CXP A;  4RN7 A;  2F8H A;  2KCW A;  4FD6 A;  4PPZ A;  3IWE A;  5KTD A;  2R7H A;  3KQZ A;  4FWU A;  1CPX A;  2Q51 A;  3KZW A;  3FVL A;  5A28 A;  4PSX A;  3W6S A;  1QST A;  3CPA A;  2FSR A;  4OIW A;  4A37 A;  3RZA A;  2EO8 A;  5CBM A;  4IF5 A;  2BSW A;  1B6B A;  5HVF A;  2R8V A;  4HNW B;  4MXU A;  4CRY B;  3DGV A;  1TF9 A;  2QVP A;  2ZW6 A;  2ZXV A;  1Z8X A;  5F46 A;  4A38 A;  4A39 A;  5LYL A;  2ZEE A;  2WSA A;  2B4D B;  3S9M A;  1DE4 C;  3CXQ A;  5C88 A;  2YNC C;  4DNC A;  2ZEM A;  2Z3M A;  2B4D A;  1YW4 A;  2ZOF A;  1IYL A;  3DNS A;  2FXF A;  3GUX A;  3QAH A;  4B14 A;  4CGP A;  4EWT A;  2XEI A;  4EME A;  3F5B A;  3L2N A;  2CNM A;  1BAV A;  2PVW A;  3MRU A;  3PB9 X;  4OC0 A;  4AVA A;  4C2Z A;  3KHX A;  1HEE A;  1S7K A;  2PCU A;  3N5F A;  4ZX8 A;  5JGF A;  4P4B A;  4UF4 A;  3SJX A;  1MJ9 A;  4BIN A;  3NH4 A;  1GYT A;  3D7H A;  2BEI A;  2VI7 A;  1KUX A;  1YK3 A;  2X7B A;  1CPS A;  1BPN A;  3GLJ A;  4GM5 A;  4CRZ B;  1QSR A;  1Z4E A;  2PRB A;  4KUB A;  1KZF A;  2EWB A;  2V8D A;  4QUS A;  5G1Z A;  5AG4 A;  4KVM E;  4XNH B;  4LUA A;  5THW A;  2CY2 A;  3SJE A;  4A30 A;  1QSO A;  5K8P A;  3KR4 A;  2AFU A;  4R8F A;  4KOT A;  3FEC A;  1NSL A;  4J3G A;  3V38 A;  4CGO A;  1XRY A;  3PFE A;  4ZY0 A;  3FXT A;  4CGN A;  4MHD A;  2CTC A;  1ZG7 A;  1ZG9 A;  3MN8 A;  2O4H A;  4OP4 A;  3TO6 A;  3GY9 A;  4CPA A;  1S7L A;  2ZOG A;  3N7Z A;  2ZEG A;  4OLL A;  1BLL E;  4AVB A;  3KR5 A;  1VGY A;  4P4J A;  4BMH A;  4PXE A;  3T90 A;  5F48 A;  4Y49 C;  1I1D A;  5CNP A;  3CT9 A;  3B2Y A;  4M85 A;  2ZPA A;  3D8P A;  3JTK A;  4MMO A;  5HXD A;  1Y9W A;  5C82 A;  2AFS A;  1PYT B;  2BCO A;  1IY7 A;  3FYN A;  3WC7 A;  2AJ6 A;  4MCR A;  4KVO E;  3P2H A;  2ANP A;  3IEH A;  4Q7A A;  4B6Z A;  4CYO A;  1ELM P;  2EK8 A;  2CNT A;  2DXQ A;  1BPM A;  2RB7 A;  2WYR A;  3DSB A;  1FY7 A;  2Z10 A;  1B87 A;  3GB0 A;  3GYA A;  1V0C A;  3JUW A;  2XEF A;  3NH8 A;  4RUH A;  4M6H A;  2OZG A;  4A95 A;  4CYQ A;  1YR0 A;  3PP9 A;  1LCP A;  4FD5 A;  3D2M A;  4XPD C;  2K5T A;  1X12 A;  2CTB A;  4AXV A;  4P44 A;  1UWY A;  2ZED A;  4R87 A;  2P0W A;  5G22 A;  2G9D A;  2IQ6 A;  3QAY A;  4P4I A;  4FAI A;  2DPS A;  3R1K A;  2AE6 A;  1KWM A;  2HQY A;  3P2F A;  1XMB A;  3LOD A;  2PIZ A;  4K3N A;  3S6G A;  4C7I A;  1XOV A;  1I12 A;  2R98 A;  2WUU A;  4P4F A;  2JBJ A;  4KOU A;  2GAN A;  1I21 A;  2OZU A;  2Q4V A;  3PB7 X;  3W91 A;  3H8E A;  4X2T A;  2ZW5 A;  2JDD A;  4KSA A;  3E0K A;  4UEZ A;  5I0C A;  1QSM A;  2EK9 A;  4A2Z A;  4QBJ A;  4TNU A;  3FH4 A;  1QMU A;  4F0X A;  3EY5 A;  3NE8 A;  4EFD A;  1U6M A;  2PJ0 A;  1M4L A;  1KUV A;  4WWV A;  3R96 A;  1F2P A;  2G0B A;  5DWM A;  1M4I A;  1XBU A;  4MHZ A;  4X3R A;  3RBU A;  1YQE A;  4CS0 B;  1IU8 A;  1LRZ A;  2BOA A;  4IHM A;  3SJF A;  1LOK A;  4CAE A;  1M1D A;  1MK4 A;  4H89 A;  3GKR A;  4R76 A;  4ZGY B;  2I3C A;  4NF1 A;  2FIA A;  4PQA A;  5CPA A;  3SJG A;  4Q36 A;  4CAF A;  3NFZ A;  1PU9 A;  3EO4 A;  1M4G A;  1S7F A;  4HPS A;  4DJL A;  2B4B A;  2C6C A;  3SI2 A;  3VWE A;  5A27 A;  3DR8 A;  3S6H A;  1CP6 A;  5E96 A;  2PE3 A;  1M4D A;  2D4O A;  4UCM A;  1RO5 A;  2PJ2 A;  4UWJ A;  1Q2Y A;  2ZW7 A;  4F9V A;  3HUV A;  4NFR A;  1YME A;  3G8W A;  4KLV A;  1Y7E A;  4K30 A;  4NGM A;  1ZO0 A;  4U5Y A;  3B3T A;  5K8N A;  3D7F A;  3PB8 X;  1XF8 A;  2B3U A;  3OWC A;  2CF4 A;  3TFY A;  3A9L A;  1F2O A;  2Z3N A;  1LAM A;  2PDO A;  2JEV A;  3WR7 A;  2I00 A;  1CG2 A;  2Y0M A;  4YFJ A;  4UEE A;  4ZI6 A;  4A31 A;  4MCQ A;  3TCV A;  2YGW A;  2J8M A;  2Q4Y A;  3B3S A;  4R3L A;  2VEZ A;  3SI1 A;  1XE4 A;  2I79 A;  3K9U A;  1IGB A;  3WT4 A;  4B13 A;  4KOS A;  2NMT A; 
#chains in the Genus database with same CATH homology
 4BBH A;  1S7N A;  4OAD A;  1YVK A;  4MI4 A;  2YNC A;  2OB0 A;  4JJX A;  4CGM A;  4FD7 A;  1WWZ A;  3EXN A;  4MFK A;  2ARH A;  3H5Z A;  2J8R A;  2PSW A;  2ZW4 A;  4XNH C;  1S3Z A;  3R9E A;  1CJW A;  5AGE A;  2PR1 A;  1YLE A;  1UFH A;  5IB0 A;  3FNC A;  4F6A A;  2P6E A;  2REF A;  4MFL A;  2WPX A;  3FRM A;  4R3K A;  2VZY A;  1KUY A;  2PR8 A;  3RYO A;  4MFP A;  1VHS A;  4KOW A;  1PUA A;  3FIX A;  2H5M A;  5G21 A;  4E0A A;  1RXT A;  5AG6 A;  4B5P A;  3FBU A;  2Z0Z A;  3D2P A;  4AVC A;  5J8F A;  1TIQ A;  4NCZ A;  4U9Z A;  4MY0 A;  4KS9 A;  2EUI A;  4MFZ A;  5AG5 A;  2PQ8 A;  3G3S A;  3BJ8 A;  4A32 A;  1WK4 A;  1XIX A;  4CAV A;  5JPH A;  1CM0 A;  4YRH A;  4CGL A;  4AG7 A;  2OZH A;  4MFJ A;  2ATR A;  3KKW A;  4QC6 A;  1MJB A;  4JXR A;  4XPD B;  3NE7 A;  3I3G A;  5BWA B;  2REE A;  2IL4 A;  2Q0Y A;  2FL4 A;  4II9 A;  2YND A;  3IU2 A;  4AG9 A;  2WPW A;  3DR6 A;  3S6F A;  5KTA A;  4UBR A;  4EVY A;  4MBU A;  1IB1 E;  2EVN A;  3IU1 A;  1P4N A;  3FB3 A;  3SXN A;  1BOB A;  1VKC A;  5FVJ A;  1S5K A;  4CYN A;  3PZJ A;  1QSN A;  3IWG A;  2C27 A;  4OAE A;  2BL1 A;  5AG7 A;  2FCK A;  3V8I A;  5H86 A;  4XPK A;  4RI1 A;  4UWI A;  4B5O A;  4KLW A;  3H4Q A;  2OU2 A;  3B8G A;  3W6X A;  4E8O A;  1J4J A;  2HV2 A;  5F49 A;  4UCP A;  4FD4 A;  1IID A;  3EFA A;  4R9M A;  4NEX A;  1MJA A;  1N71 A;  2QML A;  4YGO A;  1XEB A;  4XPL A;  2QEC A;  1SQH A;  1K4J A;  2GE3 A;  4KUA A;  4C7H A;  4F0Y A;  2Q7B A;  1Y9K A;  2VBQ A;  2Z3K A;  2Q44 A;  1Z9U A;  3R9G A;  3TE4 A;  4C2Z A;  1Y7R A;  1YVO A;  4KOR A;  3BLN A;  4H6Z A;  4LX9 A;  4L8A A;  4JD6 A;  3TT2 A;  4ZBG A;  2JLM A;  3QB8 A;  3PGP A;  2J8N A;  2BUE A;  2VZZ A;  1Q2D A;  4H6U A;  4MFQ A;  1IYK A;  2FT0 A;  3F8K A;  4C2X A;  3ZJ0 A;  2P6G A;  4HNY B;  1YRE A;  4UFV A;  2R1I A;  1GHE A;  1L0C A;  1NMT A;  4IUS A;  1S60 A;  5ISV A;  4CAX A;  4M3S A;  3C26 A;  5IV0 A;  1YGH A;  4PV6 A;  2F5I A;  1XMT A;  1R57 A;  3F0A A;  2DPT A;  2YNE A;  2VXK A;  3R9F A;  4B5P B;  4JXQ A;  2VQY A;  2B58 A;  2HUZ A;  4KZT A;  3TO9 A;  5KTC A;  3JVN A;  4KOY A;  1P0H A;  2Z11 A;  5EC4 A;  3SHP A;  4JLY A;  3VWD A;  4Y49 B;  4ONU A;  4R57 A;  4B12 A;  2PC1 A;  3ZZI A;  3IGR A;  3UY5 A;  2FS5 A;  4RS2 A;  3TOA A;  1BO4 A;  4UFX A;  4C68 A;  1IIC A;  2B5G B;  2G3A A;  4JWP A;  3T9Y A;  4CAW A;  4MY3 A;  1M44 A;  4A33 A;  2B5G A;  4CYP A;  4KVX A;  4QB9 A;  4MJ8 A;  2Q04 A;  2QIR A;  5IX3 A;  2FE7 A;  4PK2 A;  4UFW A;  1YX0 A;  2Z3P A;  2D4P A;  2OH1 A;  4PK3 A;  1OZP A;  2CNS A;  3SXO A;  5F47 A;  1ON0 A;  3BJ7 A;  5DWN A;  3EC4 A;  4HNX B;  4UA3 A;  4UCN A;  3CXS A;  4I49 A;  4E2A A;  5J8C A;  2RC4 A;  3D3S A;  4KOX A;  2JDC A;  3TOB A;  2O28 A;  2Z3O A;  4PSW A;  4NXY A;  3MGD A;  2G3T A;  4HKF A;  4KOV A;  2Z3L A;  3S6K A;  5H84 A;  4KSF A;  5GCN A;  2GIV A;  3TO7 A;  4Q38 A;  4X5K A;  2CXA A;  1Z4R A;  3R95 A;  4ORF A;  4NSQ A;  2P6F A;  4B10 A;  1NE9 A;  5HH1 A;  4C2Y A;  2A4N A;  5EBV A;  3TTH A;  4B11 A;  4AB7 A;  3I9S A;  4U9Y A;  3LD2 A;  1Q2C A;  4QVT A;  5JQ4 A;  4GS4 A;  4L89 A;  2B3V A;  5HMN A;  2FIW A;  5G20 A;  3DDD A;  3CXP A;  2KCW A;  4FD6 A;  3IWE A;  5KTD A;  2R7H A;  5A28 A;  4PSX A;  3W6S A;  1QST A;  2FSR A;  4IF5 A;  2BSW A;  1B6B A;  2R8V A;  4HNW B;  4CRY B;  2ZW6 A;  2ZXV A;  5F46 A;  2WSA A;  2B4D B;  3CXQ A;  5C88 A;  2YNC C;  4DNC A;  2Z3M A;  2B4D A;  1IYL A;  3DNS A;  2FXF A;  3QAH A;  4B14 A;  4CGP A;  3F5B A;  2CNM A;  4AVA A;  1S7K A;  1MJ9 A;  2BEI A;  2VI7 A;  1KUX A;  1YK3 A;  2X7B A;  4CRZ B;  1QSR A;  1Z4E A;  2PRB A;  4KUB A;  1KZF A;  5AG4 A;  4QUS A;  5G1Z A;  4KVM E;  4XNH B;  4LUA A;  2CY2 A;  4A30 A;  1QSO A;  4KOT A;  1NSL A;  4J3G A;  4CGO A;  3FXT A;  4CGN A;  4MHD A;  3TO6 A;  3GY9 A;  1S7L A;  3N7Z A;  4OLL A;  4AVB A;  4BMH A;  3T90 A;  5F48 A;  4Y49 C;  1I1D A;  5CNP A;  4M85 A;  2ZPA A;  3D8P A;  3JTK A;  1Y9W A;  5C82 A;  3FYN A;  2AJ6 A;  4KVO E;  3P2H A;  4CYO A;  2CNT A;  2DXQ A;  3DSB A;  3GYA A;  1FY7 A;  2Z10 A;  1B87 A;  3JUW A;  1V0C A;  2OZG A;  4A95 A;  4CYQ A;  1YR0 A;  3PP9 A;  4FD5 A;  3D2M A;  4XPD C;  2K5T A;  4R87 A;  2P0W A;  5G22 A;  2DPS A;  3R1K A;  2AE6 A;  2HQY A;  3P2F A;  3S6G A;  3LOD A;  4C7I A;  1I12 A;  2R98 A;  2WUU A;  4KOU A;  2GAN A;  1I21 A;  2OZU A;  2Q4V A;  3W91 A;  2ZW5 A;  2JDD A;  4KSA A;  3E0K A;  5I0C A;  1QSM A;  4A2Z A;  4QBJ A;  4F0X A;  3EY5 A;  1U6M A;  1KUV A;  3R96 A;  2G0B A;  5DWM A;  1M4I A;  4CS0 B;  1LRZ A;  4CAE A;  1M1D A;  1MK4 A;  4H89 A;  3GKR A;  4NF1 A;  2FIA A;  4Q36 A;  4CAF A;  1PU9 A;  3EO4 A;  1M4G A;  1S7F A;  2B4B A;  3VWE A;  5A27 A;  3DR8 A;  3S6H A;  5E96 A;  1M4D A;  2D4O A;  4UCM A;  1RO5 A;  4UWJ A;  1Q2Y A;  2ZW7 A;  3G8W A;  4KLV A;  4K30 A;  1ZO0 A;  4U5Y A;  1XF8 A;  2B3U A;  3OWC A;  3TFY A;  3A9L A;  2Z3N A;  2PDO A;  2JEV A;  3WR7 A;  2I00 A;  2Y0M A;  4YFJ A;  4A31 A;  3TCV A;  2YGW A;  2J8M A;  2Q4Y A;  4R3L A;  2VEZ A;  1XE4 A;  2I79 A;  3K9U A;  4ZGY B;  4B13 A;  4KOS A;  2NMT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...