2PR1A

Crystal structure of the bacillus subtilis n-acetyltransferase ylbp protein in complex with coenzyme-a
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
152
structure length
152
Chain Sequence
MTKVERLLINYKTLEEFKKFKEYGIQELSMLEELQDNIIENDSTSPFYGIYFGDKLVARMSLYQVNGKSNPYFDNRQDYLELWKLEVLPGYQNRGYGRALVEFAKSFKMPIRTNPRMKSAEFWNKMNFKTVKYDMARDKGEDPLIWHPDMDR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Uncharacterized N-acetyltransferase ylbP
publication title Crystal structure of the Bacillus subtilis N-acetyltransferase YlbP protein in complex with Coenzyme-A.
rcsb
source organism Bacillus subtilis
total genus 42
structure length 152
sequence length 152
chains with identical sequence B
ec nomenclature ec 2.3.1.-:
pdb deposition date 2007-05-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 2pr1A00
3EO4A 4HNXB 1S7KA 2Q4VA 4MBUA 3JUWA 2OH1A 3V8IA 2WPWA 4KOYA 4KOUA 4E2AA 4QB9A 1IYLA 3RYOA 4PK3A 4YGOA 3TT2A 2OB0A 3FIXA 4JJXA 1KZFA 2CY2A 4XPKA 3SXNA 2Q7BA 2ATRA 4B5PA 3G3SA 2ZW4A 4MY0A 2P0WA 2FT0A 3B8GA 1Q2CA 4HKFA 1KUXA 4UA3A 1UFHA 2PR1A 1B87A 1YGHA 5F46A 5JQ4A 1MJ9A 3CXPA 5F48A 4CRZB 3IWGA 2GANA 3FYNA 3K9UA 2GIVA 3W6XA 3FNCA 2CNTA 1QSMA 1CM0A 1M4IA 4FD7A 3P2HA 5IV0A 2B4DB 4KUBA 2G3TA 4RI1A 4AVAA 2ARHA 3QAHA 4U9ZA 1PUAA 4CAXA 2VZYA 2R98A 2PC1A 1S7NA 5F47A 2AJ6A 4CAVA 3CXQA 2Q4YA 2PSWA 5GCNA 5IX3A 2P6EA 1XEBA 2CNSA 1R57A 1Y9WA 3FB3A 4HNWB 4KOXA 4H6UA 4UWJA 3F5BA 2G0BA 3DSBA 1KUYA 4AVCA 2JLMA 1M44A 1ON0A 4AG7A 1IYKA 4IF5A 3GY9A 3T90A 5DWNA 1L0CA 4R3KA 3DDDA 4XPDB 4F0YA 4E8OA 2FIWA 2Q0YA 2FE7A 4GS4A 4LUAA 4R9MA 3TE4A 2B4BA 4K30A 2JEVA 3R95A 2Q04A 3GKRA 3W91A 1IICA 3QB8A 2ZW6A 3I9SA 3R9FA 1QSRA 4I49A 4XPDC 4Y49B 2AE6A 4JLYA 4MI4A 2B5GB 4NEXA 3TO6A 2EVNA 2I79A 2FXFA 1S7LA 4L89A 2Z11A 5EBVA 1Z9UA 3TFYA 2J8RA 2OZHA 3BJ7A 2HV2A 1XIXA 4Y49C 3CXSA 3TCVA 2VI7A 1CJWA 1KUVA 1YR0A 2PDOA 2ZPAA 4J3GA 4DNCA 2CNMA 1IIDA 5C88A 4KZTA 2WPXA 1OZPA 4PV6A 2D4OA 2QMLA 3F8KA 2H5MA 3PZJA 5KTDA 4MY3A 2ZW5A 3OWCA 2BUEA 2PRBA 4XPLA 2OZUA 3I3GA 2Z10A 4KLVA 1YREA 4KOTA 4JXRA 4B5PB 1WWZA 1XF8A 2Z0ZA 2VEZA 2O28A 4CRYB 3H4QA 3IGRA 2QECA 2J8NA 5H86A 1I1DA 2ZW7A 4JXQA 1YX0A 4KOSA 4AG9A 4CS0B 1M4GA 1QSNA 3S6HA 5I0CA 2VXKA 3UY5A 5ISVA 3S6FA 2P6FA 3R96A 1I12A 2FL4A 3WR7A 3R1KA 4BMHA 1Q2DA 2G3AA 4CAWA 1P4NA 4OAEA 4FD5A 2NMTA 1S5KA 2REFA 2BSWA 5E96A 3ZJ0A 2FCKA 2JDCA 1S7FA 1BO4A 4F6AA 3G8WA 4UWIA 1M4DA 4M85A 1V0CA 2R7HA 2K5TA 4KVME 2VBQA 2QIRA 4KOVA 5EC4A 3EFAA 4RS2A 1U6MA 2ZXVA 1I21A 3D2MA 2JDDA 2IL4A 4ORFA 1BOBA 5FVJA 3P2FA 5JPHA 1MJAA 3BJ8A 4U9YA 2FIAA 4HNYB 5HH1A 3FXTA 1Z4EA 4KVXA 4ONUA 5H84A 3DNSA 4L8AA 1Y7RA 4ZBGA 3BLNA 4MHDA 2I00A 3MGDA 1Q2YA 2RC4A 2VZZA 4B5OA 1VKCA 4KLWA 4R87A 2J8MA 1B6BA 2FSRA 4PSXA 2R8VA 1YK3A 1J4JA 1NMTA 4JWPA 5KTAA 2KCWA 3GYAA 2BEIA 3DR6A 5KTCA 2A4NA 1MK4A 4H89A 4FD4A 2X7BA 2FS5A 3E0KA 2B4DA 4X5KA 4OADA 3TOBA 2OZGA 2Q44A 3S6GA 4AVBA 3EXNA 4NCZA 4H6ZA 3T9YA 4NF1A 1Z4RA 2EUIA 3LODA 4QBJA 3FBUA 1M1DA 2D4PA 4JD6A 4OLLA 4KOWA 1SQHA 3W6SA 5J8CA 3SXOA 1N71A 4EVYA 5CNPA 1YVOA 1FY7A 2OU2A 1NSLA 4NXYA 3PGPA 3TOAA 3EY5A 3FRMA 1XE4A 5HMNA 2DXQA 1MJBA 4QVTA 2B3VA 4QC6A 3SHPA 4R57A 3C26A 1K4JA 2VQYA 1LRZA 3D3SA 3JVNA 4XNHB 4E0AA 5J8FA 3D8PA 2PQ8A 3EC4A 3PP9A 2C27A 3N7ZA 2BL1A 3VWDA 4AB7A 2HQYA 5DWMA 4KVOE 1PU9A 4QUSA 1IB1E 2Y0MA 3VWEA 3D2PA 3TTHA 4R3LA 4II9A 3LD2A 3TO7A 2R1IA 1VHSA 4KUAA 4XNHC 1S3ZA 1YLEA 4IUSA 3NE7A 3F0AA 4YRHA 2B5GA 1QSTA 4U5YA 2HUZA 4LX9A 3TO9A 3R9GA 4M3SA 3ZZIA 1RXTA 4UBRA 1RO5A 4PK2A 4NSQA 2P6GA 3DR8A 2B3UA 2F5IA 1NE9A 4YFJA 2REEA 4FD6A 5F49A 3R9EA 4PSWA 4KORA 1GHEA 1XMTA 2GE3A 1Y9KA 5C82A 1P0HA 2PR8A 1WK4A 1QSOA 1YVKA 1TIQA 4MJ8A 3S6KA 1S60A 5IB0A 3KKWA 2B58A
chains in the Genus database with same CATH superfamily
1IOIA 3EO4A 2IMOA 4HNXB 2PJ9A 5CBMA 1S7KA 2PJBA 2XEJA 2Q4VA 2ZOFA 4MBUA 5THWA 1XFOA 4ZX8A 3D7DA 3JUWA 2OH1A 3V8IA 4MFJA 2WPWA 4KOYA 4KOUA 3KASA 4NGTA 4QB9A 4CGNA 4E2AA 5HVGA 5G21A 2BO9A 4B14A 5K8PA 1IYLA 3RYOA 3KR4A 4PK3A 4K3NA 2O53A 3VH9A 5IB9A 4YGOA 3TT2A 2OB0A 3FIXA 2PJ0A 4DYOA 4JJXA 3V7ZA 1KZFA 3PB4X 4XPKA 3SXNA 2Q7BA 2ATRA 3PB8X 4B5PA 1DTDA 1Z8LA 3G3SA 4ZY2A 2Q51A 2ZW4A 2GU2A 4MY0A 2ZOGA 4PXDA 7CPAA 5J1QA 2P0WA 2FT0A 4O23A 4G1PA 2ABZA 3B8GA 1Q2CA 4HKFA 4JYWA 1KUXA 2PCUA 4UA3A 3PEIA 1FT7A 2PJ8A 2CTCA 1UFHA 2PR1A 3RNZA 1B87A 1YGHA 3B3VA 3D7HA 3WC7A 1MJ9A 3CXPA 5F48A 4A38A 4CRZB 5F46A 5G20A 1XJOA 5HXDA 4OIWA 3IWGA 2GANA 3V38A 3FYNA 1GYTA 3K9UA 2ZEHA 3QNVA 4M6GA 2GIVA 3W6XA 1CP7A 3FNCA 4UCPA 2CNTA 1QSMA 1CM0A 4R6TA 1M4IA 2J9AA 4FD7A 4A30A 4MFZA 3FEDA 3P2HA 3CT9A 5AGEA 3D68A 2B4DB 5IV0A 4MXUA 5LRGA 4KUBA 1Z8WA 2G3TA 4RI1A 4AVAA 3IWEA 4MHPA 2ARHA 5AG4A 4JZ0A 3QAHA 1YMEA 4U9ZA 1PUAA 4CAXA 2VZYA 4X3RA 4EMEA 2R98A 1BPNA 2PC1A 3SJEA 4B12A 4F8ZA 4ZYQA 3PRTA 4IK2A 5K8NA 1S7NA 1ZG7A 4OIDA 3FVLA 5F47A 2AJ6A 3T8WA 1Y0YA 4CAVA 4OC5A 3CXQA 2Q4YA 4FUUA 1OBRA 1Q7LA 2PSWA 3QAYA 5GCNA 5IX3A 1LANA 2P6EA 2CNSA 1XEBA 5JQ4A 1R57A 1Y9WA 1VIXA 4UCMA 3FB3A 1LOKA 3FH4A 4H6UA 4HNWB 3F5BA 4KOXA 4UWJA 4YU9A 4X2TA 4MCQA 4Z65A 4MRIA 2G0BA 1CPSA 3RO0A 2AFXA 3DSBA 1KUYA 4AVCA 2JLMA 1M44A 1Y0RA 2YGWA 1ON0A 4AG7A 1IYKA 4IF5A 4CGPA 1Z8XA 4ZY0A 4NGNA 3GY9A 3IEHA 5DWNA 3T90A 1L0CA 4KSAA 5LYDA 4R3KA 3DDDA 4MFQA 3BI1A 3H8FA 4XPDB 5AG5A 5K8OA 4F0YA 2XEIA 4CAEA 5LYFA 3DGVA 4P6YA 2FIWA 2Q0YA 2FE7A 4GS4A 4LUAA 2CTBA 4R9MA 4E8OA 4EFDA 2O4HA 2B4BA 5JM6A 1PCAA 4K30A 3K2KA 2JEVA 3R95A 4P45A 2Q04A 3GKRA 2EBJA 3JTKA 4LQGA 3W91A 4A32A 3TE4A 1IICA 4LQ6A 3QB8A 3SJGA 2CF4A 2ZW6A 4CGOA 5AG7A 4MCPA 2ZEMA 4MFLA 3I9SA 1H8LA 3SI2A 2OR4A 4WWVA 3R9FA 2ZENA 1QSRA 4I49A 4OMEA 4XPDC 4Y49B 2PE3A 2Z3LA 2PJ1A 2AE6A 4X8IA 3PB9X 4JLYA 4NGSA 4PXBA 4CGMA 4MI4A 3SI1A 2B5GB 4NEXA 3TO6A 4UEEA 1YSJA 4NGPA 3TC8A 3IWWA 2EVNA 3RZAA 3BXMA 4MHZA 3BI0A 2I79A 3ISXA 2FXFA 2HB6A 1S7LA 4L89A 4C68A 2Z11A 2AFMA 5EBVA 1Z9UA 2ZEGA 3WC6A 4M6IA 3TFYA 2J8RA 2OZHA 3BJ7A 3B35A 3WT4A 2EWBA 3CPAA 4B10A 4FAIA 2HV2A 4NJRA 1XIXA 3IU2A 4Y49C 2WSAA 4ZGYB 2IQ6A 3CXSA 1QQ9A 3TCVA 5LYLA 2RB7A 2VI7A 2Z3KA 1CJWA 1KUVA 1YR0A 4F9VA 2PDOA 1VGYA 2ZPAA 4J3GA 4KSIA 2YNCA 3LACA 1JWQA 2CNMA 1IIDA 4PPZA 5C88A 2QYVA 4KZTA 2WPXA 3N5FA 1OZPA 4PV6A 4P4DA 2I3CA 4BBHA 5HVHA 2D4OA 8CPAA 3CPXA 1IOFA 2QMLA 3F8KA 1X12A 2H5MA 3PZJA 4NGRA 4P44A 3VARA 5KTDA 3ISZA 4ZI6A 1BAVA 2POKA 3L2NA 2AFOA 1YLOA 2ODFA 3D7GA 4OC0A 4MY3A 2G9DA 4UFVA 2ZW5A 3B3SA 3SI0A 1YQEA 2ZELA 3OWCA 2BUEA 2XEGA 4CYNA 3MRUA 2PRBA 4DUKA 1IGBA 1ARLA 4A37A 4OKOA 4XPLA 1UWYA 1R43A 2OZUA 4R76A 4FBEA 3I3GA 2WYRA 2Z10A 3IFEA 2PJ6A 2PJ4A 3H5ZA 4B11A 1X10A 2DEAA 2Q43A 4KLVA 1HDUA 1YREA 2NYQA 3KKWA 4JXRA 4KOTA 1LFWA 3KR5A 4B5PB 1WWZA 4P4JA 1XF8A 2WZNA 2Z0ZA 3H8GA 1VHOA 4P10A 1HEEA 2VEZA 4Q36A 4R7MA 2Z3OA 1FNOA 2O28A 3PB6X 4MMOA 4CRYB 3H4QA 3PB7X 1XRYA 2EK8A 3IGRA 3IU1A 2QECA 2J8NA 1TXRA 4MCRA 2XEFA 2BOAA 5H86A 1I1DA 2ZW7A 4W9YA 4JXQA 1YX0A 1F2PA 3NH5A 4MHNA 4KOSA 4AG9A 4CAFA 3GUXA 1ZLHA 4CS0B 2Z3NA 1M4GA 1QSNA 3S6HA 5I0CA 4IAVA 2VXKA 3UY5A 1KWMA 4KS9A 5ISVA 3FMCA 3S6FA 1Z2LA 2V77A 3D7FA 3KQXA 4ONWA 2P6FA 3R96A 1I12A 2FL4A 1XMBA 3WR7A 3R1KA 3PFOA 2QVPA 4BMHA 1Q2DA 2AFSA 2PJCA 3CDXA 3RBUA 2G3AA 4Q38A 5I4MA 1LAMA 4CAWA 1P4NA 2JBJA 4OAEA 4BD9A 2ANPA 4FD5A 5CPAA 2RFHA 2NMTA 2PJ3A 4OC4A 1S5KA 2DF5A 2REFA 2BSWA 3NH4A 3GB0A 5E96A 1TKHA 3IC1A 3ZJ0A 2FCKA 2JDCA 4B13A 1S7FA 1BO4A 4F6AA 4RUHA 3G8WA 2CIJA 4HPSA 2EK9A 5AG6A 3SJFA 4C7HA 5LRKA 2Z3PA 4UWIA 4GM5A 1M4DA 3D66A 4UFXA 4M85A 1V0CA 1NSAA 2R7HA 2K5TA 4KVME 2VBQA 3RAMA 4PXEA 2GREA 2ZEDA 1AUGA 1TF9A 2GFQA 5ELYA 2QIRA 1TKJA 2C6GA 4KOVA 1ELLP 2HC9A 3VATA 3D4UA 5EC4A 3A9LA 3EFAA 5D8NA 1HDQA 4NGMA 4RS2A 5K8MA 1U6MA 5BWAB 1CG2A 3TX8A 2ZXVA 1I21A 3D2MA 2JDDA 2IL4A 3K9TA 3NE8A 4F9UA 3HLPA 2C6CA 3KQZA 1R3NA 4ORFA 1BOBA 2VL1A 5FVJA 2Z3MA 1IU8A 4TNUA 3P2FA 5JPHA 1F57A 4UEFA 1MJAA 3BJ8A 4U9YA 2QJ8A 1AYEA 2FIAA 4HNYB 5HH1A 3I1UA 3MN8A 3FXTA 3S9MA 5D29A 3B2YA 3NA6A 2EO8A 1Z4EA 4ZY1A 3DLJA 5EMIA 4KVXA 2JEWA 3PFEA 4ONUA 5H84A 1LAPA 2WUUA 3DNSA 4AXVA 4L8AA 1Y7RA 4ZBGA 3JRUA 2IJZA 4C2XA 2AFWA 2PRQA 3LMSA 3FJUA 4OC1A 3BLNA 3HUVA 4MHDA 4GXHA 3KL9A 5JGFA 2I00A 3MGDA 1Q2YA 2RC4A 5HVFA 2VZZA 4B5OA 1VKCA 2PJ5A 4P4BA 2ZEOA 1XBUA 5DS0A 4KLWA 4R87A 2GLFA 2J8MA 1ZG9A 1B6BA 2BCOA 2FSRA 1RTQA 2FVGA 4FWUA 4PQAA 2YNDA 4PSXA 2R8VA 1YK3A 2PVWA 3KGQA 3KI9A 4UFWA 2V8HA 3H8EA 1J4JA 4UIBA 1NMTA 2PIZA 4JWPA 3FX6A 5LRJA 5KTAA 2KCWA 3B3CA 3GYAA 4A94A 2BEIA 4MFPA 2Q7SA 3DR6A 2ZEEA 5KTCA 2A4NA 1MK4A 2DPSA 4C2ZA 4H89A 4FD4A 4Q7AA 4IHMA 4UF4A 2X7BA 3KHZA 2FS5A 3E0KA 2B4DA 4X5KA 3FECA 1YW4A 1CX8A 4OADA 3TOBA 2OZGA 2Q44A 2V8DA 3S6GA 4AVBA 3EXNA 4A39A 3B7IA 2F8HA 4NCZA 4H6ZA 3T9YA 4NF1A 2C1CA 4CYQA 1ZLIA 1QMUA 1Z4RA 2EUIA 3LODA 4A2ZA 3FBUA 3IO1A 4RN7A 1A2ZA 4QBJA 1M1DA 4UEZA 2D4PA 2YNCC 4JD6A 4OLLA 4YWYA 4KOWA 3S9NA 1SQHA 4UIAA 3NFZA 3W6SA 3GLJA 3KHXA 5LYIA 1BLLE 2PJ7A 2JBKA 3BHXA 4WJBA 1F2OA 5J8CA 2DPTA 1VHEA 2YNEA 4MCSA 3SXOA 1N71A 1ZO0A 4EVYA 5JH9A 1CPXA 3IIBA 3NH8A 1YVOA 1FY7A 5CNPA 2CXAA 2OU2A 4P4EA 4KSFA 1NSLA 4NXYA 3FEEA 3PGPA 3TOAA 3EY5A 3FRMA 3IJ3A 1XE4A 1AMPA 4TWEA 5HMNA 2DXQA 1MJBA 4QVTA 4R8FA 1ARMA 2B3VA 4QC6A 3SHPA 2V8GA 4H2KA 4R57A 3C26A 1K4JA 4C7IA 2PJAA 2VQYA 1LRZA 3PBBA 3D3SA 3LWUA 3JVNA 4XNHB 2PIYA 2AFUA 4E0AA 5J8FA 3KZWA 3D8PA 4OP4A 4P4FA 2PVVA 3CZXA 4OC3A 2PQ8A 3EC4A 3PP9A 5G1ZA 3WABA 4A31A 4B6ZA 2C27A 3N7ZA 2BL1A 4OC2A 3VWDA 5F09A 2GLJA 4AB7A 4C2YA 6CPAA 2HQYA 5DWMA 4KVOE 1PU9A 4QUSA 1IB1E 4A95A 4M6HA 1PYTB 2Y0MA 2ZEPA 5G22A 5A27A 1XOVA 3WC5A 4MHYA 3D2PA 1M4LA 3TTHA 4R3LA 3VWEA 4II9A 3LD2A 2C6PA 3TO7A 2R1IA 4CPAA 1VHSA 2NSMA 4KUAA 4XNHC 3B3WA 5A28A 1S3ZA 1LCPA 1YLEA 4IUSA 3NE7A 3F0AA 1TF8A 1BPMA 3S9LA 3SJXA 4YRHA 2B5GA 1QSTA 4U5YA 2HUZA 4PXCA 4NJQA 4LX9A 3TO9A 3D67A 2PJ2A 3R9GA 1YW6A 3PBEA 4M3SA 3ZZIA 1IY7A 2ZEFA 1Z5RA 2V8VA 2AFZA 1RXTA 4UBRA 4A33A 4EWTA 1RO5A 4P4IA 1ELMP 1TKFA 4NSQA 2P6GA 3FF3A 4NGQA 4PK2A 4ZX9A 4DNCA 3DR8A 2B3UA 2F5IA 1CBXA 1NE9A 4YFJA 4CYPA 2REEA 1ZG8A 4FD6A 5F49A 3R9EA 4PSWA 2OOTA 4BINA 4KORA 1Y7EA 1CP6A 3GIUA 1GHEA 4NFRA 1DE4C 1XMTA 2GE3A 1Y9KA 4CYOA 1P0HA 5C82A 2PR8A 1WK4A 1JQGA 4F0XA 1QSOA 1YVKA 2Q4ZA 1TIQA 3B3TA 4MJ8A 1Z8TA 2F7VA 4UCNA 3S6KA 4DJLA 1EE3P 1S60A 4MFKA 5IB0A 2CY2A 2B58A 4CGLA
chains in the Genus database with same CATH topology
3EO4A 4HNXB 1S7KA 2Q4VA 4MBUA 3JUWA 2OH1A 3V8IA 4MFJA 2WPWA 4KOYA 4KOUA 4E2AA 4QB9A 4CGNA 5G21A 4B14A 1IYLA 3RYOA 4PK3A 4YGOA 3TT2A 2OB0A 3FIXA 4JJXA 1KZFA 2CY2A 4XPKA 3SXNA 2Q7BA 2ATRA 4B5PA 3G3SA 2ZW4A 4MY0A 2P0WA 2FT0A 3B8GA 1Q2CA 4HKFA 1KUXA 4UA3A 1UFHA 2PR1A 1B87A 1YGHA 5F46A 5JQ4A 1MJ9A 3CXPA 5F48A 4CRZB 5G20A 3IWGA 2GANA 3FYNA 3K9UA 2GIVA 3W6XA 3FNCA 4UCPA 2CNTA 1QSMA 1CM0A 1M4IA 4FD7A 4A30A 4MFZA 3P2HA 5AGEA 5IV0A 2B4DB 4KUBA 2G3TA 4RI1A 4AVAA 3IWEA 2ARHA 5AG4A 3QAHA 4U9ZA 1PUAA 4CAXA 2VZYA 2R98A 2PC1A 4B12A 1S7NA 5F47A 2AJ6A 4CAVA 3CXQA 2Q4YA 2PSWA 5GCNA 5IX3A 2P6EA 1XEBA 2CNSA 1R57A 1Y9WA 4UCMA 3FB3A 4HNWB 4KOXA 4H6UA 4UWJA 3F5BA 2G0BA 3DSBA 1KUYA 4AVCA 2JLMA 1M44A 2YGWA 1ON0A 4AG7A 1IYKA 4IF5A 4CGPA 3GY9A 3T90A 5DWNA 1L0CA 4KSAA 4R3KA 3DDDA 4MFQA 4XPDB 5AG5A 4F0YA 4CAEA 4E8OA 2FIWA 2Q0YA 2FE7A 4GS4A 4LUAA 4R9MA 3TE4A 2B4BA 4K30A 2JEVA 3R95A 2Q04A 3GKRA 3JTKA 3W91A 4A32A 1IICA 3QB8A 2ZW6A 4CGOA 5AG7A 4MFLA 3I9SA 3R9FA 1QSRA 4I49A 4XPDC 4Y49B 2Z3LA 2AE6A 4JLYA 4CGMA 4MI4A 2B5GB 4NEXA 3TO6A 2EVNA 2I79A 2FXFA 1S7LA 4L89A 4C68A 2Z11A 5EBVA 1Z9UA 3TFYA 2J8RA 2OZHA 3BJ7A 4B10A 2HV2A 1XIXA 3IU2A 4Y49C 2WSAA 4ZGYB 3CXSA 3TCVA 2VI7A 2Z3KA 1CJWA 1KUVA 1YR0A 2PDOA 2ZPAA 4J3GA 4DNCA 2YNCA 2CNMA 1IIDA 5C88A 4KZTA 2WPXA 1OZPA 4PV6A 4BBHA 2D4OA 2QMLA 3F8KA 2H5MA 3PZJA 5KTDA 4MY3A 4UFVA 2ZW5A 3OWCA 2BUEA 4CYNA 2PRBA 4XPLA 2OZUA 3I3GA 2Z10A 4B11A 3H5ZA 4KLVA 1YREA 4KOTA 4JXRA 4B5PB 1WWZA 1XF8A 2Z0ZA 2VEZA 4Q36A 2Z3OA 2O28A 4CRYB 3H4QA 3IGRA 3IU1A 2QECA 2J8NA 5H86A 1I1DA 2ZW7A 4JXQA 1YX0A 4KOSA 4AG9A 4CAFA 4CS0B 2Z3NA 1M4GA 1QSNA 3S6HA 5I0CA 2VXKA 3UY5A 4KS9A 5ISVA 3S6FA 2P6FA 3R96A 1I12A 2FL4A 3WR7A 3R1KA 4BMHA 1Q2DA 2G3AA 4Q38A 4CAWA 1P4NA 4OAEA 4FD5A 2NMTA 1S5KA 2REFA 2BSWA 5E96A 3ZJ0A 2FCKA 2JDCA 4B13A 1S7FA 1BO4A 4F6AA 3G8WA 5AG6A 4C7HA 2Z3PA 4UWIA 1M4DA 4UFXA 4M85A 1V0CA 2R7HA 2K5TA 4KVME 2VBQA 2QIRA 4KOVA 5EC4A 3A9LA 3EFAA 4RS2A 1U6MA 5BWAB 2ZXVA 1I21A 3D2MA 2JDDA 2IL4A 4ORFA 1BOBA 5FVJA 2Z3MA 3P2FA 5JPHA 1MJAA 3BJ8A 4U9YA 2FIAA 4HNYB 5HH1A 3FXTA 1Z4EA 4KVXA 4ONUA 5H84A 2WUUA 3DNSA 4L8AA 1Y7RA 4ZBGA 4C2XA 3BLNA 4MHDA 2I00A 3MGDA 1Q2YA 2RC4A 2VZZA 4B5OA 1VKCA 4KLWA 4R87A 2J8MA 1B6BA 2FSRA 2YNDA 4PSXA 2R8VA 1YK3A 4UFWA 1J4JA 1NMTA 4JWPA 5KTAA 2KCWA 3GYAA 2BEIA 4MFPA 3DR6A 5KTCA 2A4NA 1MK4A 2DPSA 4C2ZA 4H89A 4FD4A 2X7BA 2FS5A 3E0KA 2B4DA 4X5KA 4OADA 3TOBA 2OZGA 2Q44A 3S6GA 4AVBA 3EXNA 4NCZA 4H6ZA 3T9YA 4NF1A 4CYQA 1Z4RA 2EUIA 3LODA 4A2ZA 3FBUA 4QBJA 1M1DA 2D4PA 2YNCC 4JD6A 4OLLA 4KOWA 1SQHA 3W6SA 5J8CA 2DPTA 2YNEA 3SXOA 1N71A 1ZO0A 4EVYA 5CNPA 1YVOA 1FY7A 2CXAA 2OU2A 4KSFA 1NSLA 4NXYA 3PGPA 3TOAA 3EY5A 3FRMA 1XE4A 5HMNA 2DXQA 1MJBA 4QVTA 2B3VA 4QC6A 3SHPA 4R57A 3C26A 1K4JA 4C7IA 2VQYA 1LRZA 3D3SA 3JVNA 4XNHB 4E0AA 5J8FA 3D8PA 5G1ZA 2PQ8A 3EC4A 3PP9A 4A31A 2C27A 3N7ZA 2BL1A 3VWDA 4AB7A 4C2YA 2HQYA 5DWMA 4KVOE 1PU9A 4QUSA 1IB1E 4A95A 2Y0MA 5G22A 5A27A 3VWEA 3D2PA 3TTHA 4R3LA 4II9A 3LD2A 3TO7A 2R1IA 1VHSA 4KUAA 4XNHC 5A28A 1S3ZA 1YLEA 4IUSA 3NE7A 3F0AA 4YRHA 2B5GA 1QSTA 4U5YA 2HUZA 4LX9A 3TO9A 3R9GA 4M3SA 3ZZIA 1RXTA 4UBRA 4A33A 1RO5A 4PK2A 4NSQA 2P6GA 3DR8A 2B3UA 2F5IA 1NE9A 4YFJA 4CYPA 2REEA 4FD6A 5F49A 3R9EA 4PSWA 4KORA 1GHEA 1XMTA 2GE3A 1Y9KA 4CYOA 1P0HA 5C82A 2PR8A 1WK4A 4F0XA 1QSOA 1YVKA 1TIQA 4MJ8A 4UCNA 3S6KA 1S60A 4MFKA 5IB0A 3KKWA 2B58A 4CGLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EO4 A;  4HNX B;  1S7K A;  2Q4V A;  4MBU A;  3JUW A;  2OH1 A;  3V8I A;  2WPW A;  4KOY A;  4KOU A;  4E2A A;  4QB9 A;  1IYL A;  3RYO A;  4PK3 A;  4YGO A;  3TT2 A;  2OB0 A;  3FIX A;  4JJX A;  1KZF A;  2CY2 A;  4XPK A;  3SXN A;  2Q7B A;  2ATR A;  4B5P A;  3G3S A;  2ZW4 A;  4MY0 A;  2P0W A;  2FT0 A;  3B8G A;  1Q2C A;  4HKF A;  1KUX A;  4UA3 A;  1UFH A;  2PR1 A;  1B87 A;  1YGH A;  5F46 A;  5JQ4 A;  1MJ9 A;  3CXP A;  5F48 A;  4CRZ B;  3IWG A;  2GAN A;  3FYN A;  3K9U A;  2GIV A;  3W6X A;  3FNC A;  2CNT A;  1QSM A;  1CM0 A;  1M4I A;  4FD7 A;  3P2H A;  5IV0 A;  2B4D B;  4KUB A;  2G3T A;  4RI1 A;  4AVA A;  2ARH A;  3QAH A;  4U9Z A;  1PUA A;  4CAX A;  2VZY A;  2R98 A;  2PC1 A;  1S7N A;  5F47 A;  2AJ6 A;  4CAV A;  3CXQ A;  2Q4Y A;  2PSW A;  5GCN A;  5IX3 A;  2P6E A;  1XEB A;  2CNS A;  1R57 A;  1Y9W A;  3FB3 A;  4HNW B;  4KOX A;  4H6U A;  4UWJ A;  3F5B A;  2G0B A;  3DSB A;  1KUY A;  4AVC A;  2JLM A;  1M44 A;  1ON0 A;  4AG7 A;  1IYK A;  4IF5 A;  3GY9 A;  3T90 A;  5DWN A;  1L0C A;  4R3K A;  3DDD A;  4XPD B;  4F0Y A;  4E8O A;  2FIW A;  2Q0Y A;  2FE7 A;  4GS4 A;  4LUA A;  4R9M A;  3TE4 A;  2B4B A;  4K30 A;  2JEV A;  3R95 A;  2Q04 A;  3GKR A;  3W91 A;  1IIC A;  3QB8 A;  2ZW6 A;  3I9S A;  3R9F A;  1QSR A;  4I49 A;  4XPD C;  4Y49 B;  2AE6 A;  4JLY A;  4MI4 A;  2B5G B;  4NEX A;  3TO6 A;  2EVN A;  2I79 A;  2FXF A;  1S7L A;  4L89 A;  2Z11 A;  5EBV A;  1Z9U A;  3TFY A;  2J8R A;  2OZH A;  3BJ7 A;  2HV2 A;  1XIX A;  4Y49 C;  3CXS A;  3TCV A;  2VI7 A;  1CJW A;  1KUV A;  1YR0 A;  2PDO A;  2ZPA A;  4J3G A;  4DNC A;  2CNM A;  1IID A;  5C88 A;  4KZT A;  2WPX A;  1OZP A;  4PV6 A;  2D4O A;  2QML A;  3F8K A;  2H5M A;  3PZJ A;  5KTD A;  4MY3 A;  2ZW5 A;  3OWC A;  2BUE A;  2PRB A;  4XPL A;  2OZU A;  3I3G A;  2Z10 A;  4KLV A;  1YRE A;  4KOT A;  4JXR A;  4B5P B;  1WWZ A;  1XF8 A;  2Z0Z A;  2VEZ A;  2O28 A;  4CRY B;  3H4Q A;  3IGR A;  2QEC A;  2J8N A;  5H86 A;  1I1D A;  2ZW7 A;  4JXQ A;  1YX0 A;  4KOS A;  4AG9 A;  4CS0 B;  1M4G A;  1QSN A;  3S6H A;  5I0C A;  2VXK A;  3UY5 A;  5ISV A;  3S6F A;  2P6F A;  3R96 A;  1I12 A;  2FL4 A;  3WR7 A;  3R1K A;  4BMH A;  1Q2D A;  2G3A A;  4CAW A;  1P4N A;  4OAE A;  4FD5 A;  2NMT A;  1S5K A;  2REF A;  2BSW A;  5E96 A;  3ZJ0 A;  2FCK A;  2JDC A;  1S7F A;  1BO4 A;  4F6A A;  3G8W A;  4UWI A;  1M4D A;  4M85 A;  1V0C A;  2R7H A;  2K5T A;  4KVM E;  2VBQ A;  2QIR A;  4KOV A;  5EC4 A;  3EFA A;  4RS2 A;  1U6M A;  2ZXV A;  1I21 A;  3D2M A;  2JDD A;  2IL4 A;  4ORF A;  1BOB A;  5FVJ A;  3P2F A;  5JPH A;  1MJA A;  3BJ8 A;  4U9Y A;  2FIA A;  4HNY B;  5HH1 A;  3FXT A;  1Z4E A;  4KVX A;  4ONU A;  5H84 A;  3DNS A;  4L8A A;  1Y7R A;  4ZBG A;  3BLN A;  4MHD A;  2I00 A;  3MGD A;  1Q2Y A;  2RC4 A;  2VZZ A;  4B5O A;  1VKC A;  4KLW A;  4R87 A;  2J8M A;  1B6B A;  2FSR A;  4PSX A;  2R8V A;  1YK3 A;  1J4J A;  1NMT A;  4JWP A;  5KTA A;  2KCW A;  3GYA A;  2BEI A;  3DR6 A;  5KTC A;  2A4N A;  1MK4 A;  4H89 A;  4FD4 A;  2X7B A;  2FS5 A;  3E0K A;  2B4D A;  4X5K A;  4OAD A;  3TOB A;  2OZG A;  2Q44 A;  3S6G A;  4AVB A;  3EXN A;  4NCZ A;  4H6Z A;  3T9Y A;  4NF1 A;  1Z4R A;  2EUI A;  3LOD A;  4QBJ A;  3FBU A;  1M1D A;  2D4P A;  4JD6 A;  4OLL A;  4KOW A;  1SQH A;  3W6S A;  5J8C A;  3SXO A;  1N71 A;  4EVY A;  5CNP A;  1YVO A;  1FY7 A;  2OU2 A;  1NSL A;  4NXY A;  3PGP A;  3TOA A;  3EY5 A;  3FRM A;  1XE4 A;  5HMN A;  2DXQ A;  1MJB A;  4QVT A;  2B3V A;  4QC6 A;  3SHP A;  4R57 A;  3C26 A;  1K4J A;  2VQY A;  1LRZ A;  3D3S A;  3JVN A;  4XNH B;  4E0A A;  5J8F A;  3D8P A;  2PQ8 A;  3EC4 A;  3PP9 A;  2C27 A;  3N7Z A;  2BL1 A;  3VWD A;  4AB7 A;  2HQY A;  5DWM A;  4KVO E;  1PU9 A;  4QUS A;  1IB1 E;  2Y0M A;  3VWE A;  3D2P A;  3TTH A;  4R3L A;  4II9 A;  3LD2 A;  3TO7 A;  2R1I A;  1VHS A;  4KUA A;  4XNH C;  1S3Z A;  1YLE A;  4IUS A;  3NE7 A;  3F0A A;  4YRH A;  2B5G A;  1QST A;  4U5Y A;  2HUZ A;  4LX9 A;  3TO9 A;  3R9G A;  4M3S A;  3ZZI A;  1RXT A;  4UBR A;  1RO5 A;  4PK2 A;  4NSQ A;  2P6G A;  3DR8 A;  2B3U A;  2F5I A;  1NE9 A;  4YFJ A;  2REE A;  4FD6 A;  5F49 A;  3R9E A;  4PSW A;  4KOR A;  1GHE A;  1XMT A;  2GE3 A;  1Y9K A;  5C82 A;  1P0H A;  2PR8 A;  1WK4 A;  1QSO A;  1YVK A;  1TIQ A;  4MJ8 A;  3S6K A;  1S60 A;  5IB0 A;  3KKW A;  2B58 A; 
#chains in the Genus database with same CATH topology
 1IOI A;  3EO4 A;  2IMO A;  4HNX B;  2PJ9 A;  5CBM A;  1S7K A;  2PJB A;  2XEJ A;  2Q4V A;  2ZOF A;  4MBU A;  5THW A;  1XFO A;  4ZX8 A;  3D7D A;  3JUW A;  2OH1 A;  3V8I A;  4MFJ A;  2WPW A;  4KOY A;  4KOU A;  3KAS A;  4NGT A;  4QB9 A;  4CGN A;  4E2A A;  5HVG A;  5G21 A;  2BO9 A;  4B14 A;  5K8P A;  1IYL A;  3RYO A;  3KR4 A;  4PK3 A;  4K3N A;  2O53 A;  3VH9 A;  5IB9 A;  4YGO A;  3TT2 A;  2OB0 A;  3FIX A;  2PJ0 A;  4DYO A;  4JJX A;  3V7Z A;  1KZF A;  3PB4 X;  4XPK A;  3SXN A;  2Q7B A;  2ATR A;  3PB8 X;  4B5P A;  1DTD A;  1Z8L A;  3G3S A;  4ZY2 A;  2Q51 A;  2ZW4 A;  2GU2 A;  4MY0 A;  2ZOG A;  4PXD A;  7CPA A;  5J1Q A;  2P0W A;  2FT0 A;  4O23 A;  4G1P A;  2ABZ A;  3B8G A;  1Q2C A;  4HKF A;  4JYW A;  1KUX A;  2PCU A;  4UA3 A;  3PEI A;  1FT7 A;  2PJ8 A;  2CTC A;  1UFH A;  2PR1 A;  3RNZ A;  1B87 A;  1YGH A;  3B3V A;  3D7H A;  3WC7 A;  1MJ9 A;  3CXP A;  5F48 A;  4A38 A;  4CRZ B;  5F46 A;  5G20 A;  1XJO A;  5HXD A;  4OIW A;  3IWG A;  2GAN A;  3V38 A;  3FYN A;  1GYT A;  3K9U A;  2ZEH A;  3QNV A;  4M6G A;  2GIV A;  3W6X A;  1CP7 A;  3FNC A;  4UCP A;  2CNT A;  1QSM A;  1CM0 A;  4R6T A;  1M4I A;  2J9A A;  4FD7 A;  4A30 A;  4MFZ A;  3FED A;  3P2H A;  3CT9 A;  5AGE A;  3D68 A;  2B4D B;  5IV0 A;  4MXU A;  5LRG A;  4KUB A;  1Z8W A;  2G3T A;  4RI1 A;  4AVA A;  3IWE A;  4MHP A;  2ARH A;  5AG4 A;  4JZ0 A;  3QAH A;  1YME A;  4U9Z A;  1PUA A;  4CAX A;  2VZY A;  4X3R A;  4EME A;  2R98 A;  1BPN A;  2PC1 A;  3SJE A;  4B12 A;  4F8Z A;  4ZYQ A;  3PRT A;  4IK2 A;  5K8N A;  1S7N A;  1ZG7 A;  4OID A;  3FVL A;  5F47 A;  2AJ6 A;  3T8W A;  1Y0Y A;  4CAV A;  4OC5 A;  3CXQ A;  2Q4Y A;  4FUU A;  1OBR A;  1Q7L A;  2PSW A;  3QAY A;  5GCN A;  5IX3 A;  1LAN A;  2P6E A;  2CNS A;  1XEB A;  5JQ4 A;  1R57 A;  1Y9W A;  1VIX A;  4UCM A;  3FB3 A;  1LOK A;  3FH4 A;  4H6U A;  4HNW B;  3F5B A;  4KOX A;  4UWJ A;  4YU9 A;  4X2T A;  4MCQ A;  4Z65 A;  4MRI A;  2G0B A;  1CPS A;  3RO0 A;  2AFX A;  3DSB A;  1KUY A;  4AVC A;  2JLM A;  1M44 A;  1Y0R A;  2YGW A;  1ON0 A;  4AG7 A;  1IYK A;  4IF5 A;  4CGP A;  1Z8X A;  4ZY0 A;  4NGN A;  3GY9 A;  3IEH A;  5DWN A;  3T90 A;  1L0C A;  4KSA A;  5LYD A;  4R3K A;  3DDD A;  4MFQ A;  3BI1 A;  3H8F A;  4XPD B;  5AG5 A;  5K8O A;  4F0Y A;  2XEI A;  4CAE A;  5LYF A;  3DGV A;  4P6Y A;  2FIW A;  2Q0Y A;  2FE7 A;  4GS4 A;  4LUA A;  2CTB A;  4R9M A;  4E8O A;  4EFD A;  2O4H A;  2B4B A;  5JM6 A;  1PCA A;  4K30 A;  3K2K A;  2JEV A;  3R95 A;  4P45 A;  2Q04 A;  3GKR A;  2EBJ A;  3JTK A;  4LQG A;  3W91 A;  4A32 A;  3TE4 A;  1IIC A;  4LQ6 A;  3QB8 A;  3SJG A;  2CF4 A;  2ZW6 A;  4CGO A;  5AG7 A;  4MCP A;  2ZEM A;  4MFL A;  3I9S A;  1H8L A;  3SI2 A;  2OR4 A;  4WWV A;  3R9F A;  2ZEN A;  1QSR A;  4I49 A;  4OME A;  4XPD C;  4Y49 B;  2PE3 A;  2Z3L A;  2PJ1 A;  2AE6 A;  4X8I A;  3PB9 X;  4JLY A;  4NGS A;  4PXB A;  4CGM A;  4MI4 A;  3SI1 A;  2B5G B;  4NEX A;  3TO6 A;  4UEE A;  1YSJ A;  4NGP A;  3TC8 A;  3IWW A;  2EVN A;  3RZA A;  3BXM A;  4MHZ A;  3BI0 A;  2I79 A;  3ISX A;  2FXF A;  2HB6 A;  1S7L A;  4L89 A;  4C68 A;  2Z11 A;  2AFM A;  5EBV A;  1Z9U A;  2ZEG A;  3WC6 A;  4M6I A;  3TFY A;  2J8R A;  2OZH A;  3BJ7 A;  3B35 A;  3WT4 A;  2EWB A;  3CPA A;  4B10 A;  4FAI A;  2HV2 A;  4NJR A;  1XIX A;  3IU2 A;  4Y49 C;  2WSA A;  4ZGY B;  2IQ6 A;  3CXS A;  1QQ9 A;  3TCV A;  5LYL A;  2RB7 A;  2VI7 A;  2Z3K A;  1CJW A;  1KUV A;  1YR0 A;  4F9V A;  2PDO A;  1VGY A;  2ZPA A;  4J3G A;  4KSI A;  2YNC A;  3LAC A;  1JWQ A;  2CNM A;  1IID A;  4PPZ A;  5C88 A;  2QYV A;  4KZT A;  2WPX A;  3N5F A;  1OZP A;  4PV6 A;  4P4D A;  2I3C A;  4BBH A;  5HVH A;  2D4O A;  8CPA A;  3CPX A;  1IOF A;  2QML A;  3F8K A;  1X12 A;  2H5M A;  3PZJ A;  4NGR A;  4P44 A;  3VAR A;  5KTD A;  3ISZ A;  4ZI6 A;  1BAV A;  2POK A;  3L2N A;  2AFO A;  1YLO A;  2ODF A;  3D7G A;  4OC0 A;  4MY3 A;  2G9D A;  4UFV A;  2ZW5 A;  3B3S A;  3SI0 A;  1YQE A;  2ZEL A;  3OWC A;  2BUE A;  2XEG A;  4CYN A;  3MRU A;  2PRB A;  4DUK A;  1IGB A;  1ARL A;  4A37 A;  4OKO A;  4XPL A;  1UWY A;  1R43 A;  2OZU A;  4R76 A;  4FBE A;  3I3G A;  2WYR A;  2Z10 A;  3IFE A;  2PJ6 A;  2PJ4 A;  3H5Z A;  4B11 A;  1X10 A;  2DEA A;  2Q43 A;  4KLV A;  1HDU A;  1YRE A;  2NYQ A;  3KKW A;  4JXR A;  4KOT A;  1LFW A;  3KR5 A;  4B5P B;  1WWZ A;  4P4J A;  1XF8 A;  2WZN A;  2Z0Z A;  3H8G A;  1VHO A;  4P10 A;  1HEE A;  2VEZ A;  4Q36 A;  4R7M A;  2Z3O A;  1FNO A;  2O28 A;  3PB6 X;  4MMO A;  4CRY B;  3H4Q A;  3PB7 X;  1XRY A;  2EK8 A;  3IGR A;  3IU1 A;  2QEC A;  2J8N A;  1TXR A;  4MCR A;  2XEF A;  2BOA A;  5H86 A;  1I1D A;  2ZW7 A;  4W9Y A;  4JXQ A;  1YX0 A;  1F2P A;  3NH5 A;  4MHN A;  4KOS A;  4AG9 A;  4CAF A;  3GUX A;  1ZLH A;  4CS0 B;  2Z3N A;  1M4G A;  1QSN A;  3S6H A;  5I0C A;  4IAV A;  2VXK A;  3UY5 A;  1KWM A;  4KS9 A;  5ISV A;  3FMC A;  3S6F A;  1Z2L A;  2V77 A;  3D7F A;  3KQX A;  4ONW A;  2P6F A;  3R96 A;  1I12 A;  2FL4 A;  1XMB A;  3WR7 A;  3R1K A;  3PFO A;  2QVP A;  4BMH A;  1Q2D A;  2AFS A;  2PJC A;  3CDX A;  3RBU A;  2G3A A;  4Q38 A;  5I4M A;  1LAM A;  4CAW A;  1P4N A;  2JBJ A;  4OAE A;  4BD9 A;  2ANP A;  4FD5 A;  5CPA A;  2RFH A;  2NMT A;  2PJ3 A;  4OC4 A;  1S5K A;  2DF5 A;  2REF A;  2BSW A;  3NH4 A;  3GB0 A;  5E96 A;  1TKH A;  3IC1 A;  3ZJ0 A;  2FCK A;  2JDC A;  4B13 A;  1S7F A;  1BO4 A;  4F6A A;  4RUH A;  3G8W A;  2CIJ A;  4HPS A;  2EK9 A;  5AG6 A;  3SJF A;  4C7H A;  5LRK A;  2Z3P A;  4UWI A;  4GM5 A;  1M4D A;  3D66 A;  4UFX A;  4M85 A;  1V0C A;  1NSA A;  2R7H A;  2K5T A;  4KVM E;  2VBQ A;  3RAM A;  4PXE A;  2GRE A;  2ZED A;  1AUG A;  1TF9 A;  2GFQ A;  5ELY A;  2QIR A;  1TKJ A;  2C6G A;  4KOV A;  1ELL P;  2HC9 A;  3VAT A;  3D4U A;  5EC4 A;  3A9L A;  3EFA A;  5D8N A;  1HDQ A;  4NGM A;  4RS2 A;  5K8M A;  1U6M A;  5BWA B;  1CG2 A;  3TX8 A;  2ZXV A;  1I21 A;  3D2M A;  2JDD A;  2IL4 A;  3K9T A;  3NE8 A;  4F9U A;  3HLP A;  2C6C A;  3KQZ A;  1R3N A;  4ORF A;  1BOB A;  2VL1 A;  5FVJ A;  2Z3M A;  1IU8 A;  4TNU A;  3P2F A;  5JPH A;  1F57 A;  4UEF A;  1MJA A;  3BJ8 A;  4U9Y A;  2QJ8 A;  1AYE A;  2FIA A;  4HNY B;  5HH1 A;  3I1U A;  3MN8 A;  3FXT A;  3S9M A;  5D29 A;  3B2Y A;  3NA6 A;  2EO8 A;  1Z4E A;  4ZY1 A;  3DLJ A;  5EMI A;  4KVX A;  2JEW A;  3PFE A;  4ONU A;  5H84 A;  1LAP A;  2WUU A;  3DNS A;  4AXV A;  4L8A A;  1Y7R A;  4ZBG A;  3JRU A;  2IJZ A;  4C2X A;  2AFW A;  2PRQ A;  3LMS A;  3FJU A;  4OC1 A;  3BLN A;  3HUV A;  4MHD A;  4GXH A;  3KL9 A;  5JGF A;  2I00 A;  3MGD A;  1Q2Y A;  2RC4 A;  5HVF A;  2VZZ A;  4B5O A;  1VKC A;  2PJ5 A;  4P4B A;  2ZEO A;  1XBU A;  5DS0 A;  4KLW A;  4R87 A;  2GLF A;  2J8M A;  1ZG9 A;  1B6B A;  2BCO A;  2FSR A;  1RTQ A;  2FVG A;  4FWU A;  4PQA A;  2YND A;  4PSX A;  2R8V A;  1YK3 A;  2PVW A;  3KGQ A;  3KI9 A;  4UFW A;  2V8H A;  3H8E A;  1J4J A;  4UIB A;  1NMT A;  2PIZ A;  4JWP A;  3FX6 A;  5LRJ A;  5KTA A;  2KCW A;  3B3C A;  3GYA A;  4A94 A;  2BEI A;  4MFP A;  2Q7S A;  3DR6 A;  2ZEE A;  5KTC A;  2A4N A;  1MK4 A;  2DPS A;  4C2Z A;  4H89 A;  4FD4 A;  4Q7A A;  4IHM A;  4UF4 A;  2X7B A;  3KHZ A;  2FS5 A;  3E0K A;  2B4D A;  4X5K A;  3FEC A;  1YW4 A;  1CX8 A;  4OAD A;  3TOB A;  2OZG A;  2Q44 A;  2V8D A;  3S6G A;  4AVB A;  3EXN A;  4A39 A;  3B7I A;  2F8H A;  4NCZ A;  4H6Z A;  3T9Y A;  4NF1 A;  2C1C A;  4CYQ A;  1ZLI A;  1QMU A;  1Z4R A;  2EUI A;  3LOD A;  4A2Z A;  3FBU A;  3IO1 A;  4RN7 A;  1A2Z A;  4QBJ A;  1M1D A;  4UEZ A;  2D4P A;  2YNC C;  4JD6 A;  4OLL A;  4YWY A;  4KOW A;  3S9N A;  1SQH A;  4UIA A;  3NFZ A;  3W6S A;  3GLJ A;  3KHX A;  5LYI A;  1BLL E;  2PJ7 A;  2JBK A;  3BHX A;  4WJB A;  1F2O A;  5J8C A;  2DPT A;  1VHE A;  2YNE A;  4MCS A;  3SXO A;  1N71 A;  1ZO0 A;  4EVY A;  5JH9 A;  1CPX A;  3IIB A;  3NH8 A;  1YVO A;  1FY7 A;  5CNP A;  2CXA A;  2OU2 A;  4P4E A;  4KSF A;  1NSL A;  4NXY A;  3FEE A;  3PGP A;  3TOA A;  3EY5 A;  3FRM A;  3IJ3 A;  1XE4 A;  1AMP A;  4TWE A;  5HMN A;  2DXQ A;  1MJB A;  4QVT A;  4R8F A;  1ARM A;  2B3V A;  4QC6 A;  3SHP A;  2V8G A;  4H2K A;  4R57 A;  3C26 A;  1K4J A;  4C7I A;  2PJA A;  2VQY A;  1LRZ A;  3PBB A;  3D3S A;  3LWU A;  3JVN A;  4XNH B;  2PIY A;  2AFU A;  4E0A A;  5J8F A;  3KZW A;  3D8P A;  4OP4 A;  4P4F A;  2PVV A;  3CZX A;  4OC3 A;  2PQ8 A;  3EC4 A;  3PP9 A;  5G1Z A;  3WAB A;  4A31 A;  4B6Z A;  2C27 A;  3N7Z A;  2BL1 A;  4OC2 A;  3VWD A;  5F09 A;  2GLJ A;  4AB7 A;  4C2Y A;  6CPA A;  2HQY A;  5DWM A;  4KVO E;  1PU9 A;  4QUS A;  1IB1 E;  4A95 A;  4M6H A;  1PYT B;  2Y0M A;  2ZEP A;  5G22 A;  5A27 A;  1XOV A;  3WC5 A;  4MHY A;  3D2P A;  1M4L A;  3TTH A;  4R3L A;  3VWE A;  4II9 A;  3LD2 A;  2C6P A;  3TO7 A;  2R1I A;  4CPA A;  1VHS A;  2NSM A;  4KUA A;  4XNH C;  3B3W A;  5A28 A;  1S3Z A;  1LCP A;  1YLE A;  4IUS A;  3NE7 A;  3F0A A;  1TF8 A;  1BPM A;  3S9L A;  3SJX A;  4YRH A;  2B5G A;  1QST A;  4U5Y A;  2HUZ A;  4PXC A;  4NJQ A;  4LX9 A;  3TO9 A;  3D67 A;  2PJ2 A;  3R9G A;  1YW6 A;  3PBE A;  4M3S A;  3ZZI A;  1IY7 A;  2ZEF A;  1Z5R A;  2V8V A;  2AFZ A;  1RXT A;  4UBR A;  4A33 A;  4EWT A;  1RO5 A;  4P4I A;  1ELM P;  1TKF A;  4NSQ A;  2P6G A;  3FF3 A;  4NGQ A;  4PK2 A;  4ZX9 A;  4DNC A;  3DR8 A;  2B3U A;  2F5I A;  1CBX A;  1NE9 A;  4YFJ A;  4CYP A;  2REE A;  1ZG8 A;  4FD6 A;  5F49 A;  3R9E A;  4PSW A;  2OOT A;  4BIN A;  4KOR A;  1Y7E A;  1CP6 A;  3GIU A;  1GHE A;  4NFR A;  1DE4 C;  1XMT A;  2GE3 A;  1Y9K A;  4CYO A;  1P0H A;  5C82 A;  2PR8 A;  1WK4 A;  1JQG A;  4F0X A;  1QSO A;  1YVK A;  2Q4Z A;  1TIQ A;  3B3T A;  4MJ8 A;  1Z8T A;  2F7V A;  4UCN A;  3S6K A;  4DJL A;  1EE3 P;  1S60 A;  4MFK A;  5IB0 A;  2CY2 A;  2B58 A;  4CGL A; 
#chains in the Genus database with same CATH homology
 3EO4 A;  4HNX B;  1S7K A;  2Q4V A;  4MBU A;  3JUW A;  2OH1 A;  3V8I A;  4MFJ A;  2WPW A;  4KOY A;  4KOU A;  4E2A A;  4QB9 A;  4CGN A;  5G21 A;  4B14 A;  1IYL A;  3RYO A;  4PK3 A;  4YGO A;  3TT2 A;  2OB0 A;  3FIX A;  4JJX A;  1KZF A;  2CY2 A;  4XPK A;  3SXN A;  2Q7B A;  2ATR A;  4B5P A;  3G3S A;  2ZW4 A;  4MY0 A;  2P0W A;  2FT0 A;  3B8G A;  1Q2C A;  4HKF A;  1KUX A;  4UA3 A;  1UFH A;  2PR1 A;  1B87 A;  1YGH A;  5F46 A;  5JQ4 A;  1MJ9 A;  3CXP A;  5F48 A;  4CRZ B;  5G20 A;  3IWG A;  2GAN A;  3FYN A;  3K9U A;  2GIV A;  3W6X A;  3FNC A;  4UCP A;  2CNT A;  1QSM A;  1CM0 A;  1M4I A;  4FD7 A;  4A30 A;  4MFZ A;  3P2H A;  5AGE A;  5IV0 A;  2B4D B;  4KUB A;  2G3T A;  4RI1 A;  4AVA A;  3IWE A;  2ARH A;  5AG4 A;  3QAH A;  4U9Z A;  1PUA A;  4CAX A;  2VZY A;  2R98 A;  2PC1 A;  4B12 A;  1S7N A;  5F47 A;  2AJ6 A;  4CAV A;  3CXQ A;  2Q4Y A;  2PSW A;  5GCN A;  5IX3 A;  2P6E A;  1XEB A;  2CNS A;  1R57 A;  1Y9W A;  4UCM A;  3FB3 A;  4HNW B;  4KOX A;  4H6U A;  4UWJ A;  3F5B A;  2G0B A;  3DSB A;  1KUY A;  4AVC A;  2JLM A;  1M44 A;  2YGW A;  1ON0 A;  4AG7 A;  1IYK A;  4IF5 A;  4CGP A;  3GY9 A;  3T90 A;  5DWN A;  1L0C A;  4KSA A;  4R3K A;  3DDD A;  4MFQ A;  4XPD B;  5AG5 A;  4F0Y A;  4CAE A;  4E8O A;  2FIW A;  2Q0Y A;  2FE7 A;  4GS4 A;  4LUA A;  4R9M A;  3TE4 A;  2B4B A;  4K30 A;  2JEV A;  3R95 A;  2Q04 A;  3GKR A;  3JTK A;  3W91 A;  4A32 A;  1IIC A;  3QB8 A;  2ZW6 A;  4CGO A;  5AG7 A;  4MFL A;  3I9S A;  3R9F A;  1QSR A;  4I49 A;  4XPD C;  4Y49 B;  2Z3L A;  2AE6 A;  4JLY A;  4CGM A;  4MI4 A;  2B5G B;  4NEX A;  3TO6 A;  2EVN A;  2I79 A;  2FXF A;  1S7L A;  4L89 A;  4C68 A;  2Z11 A;  5EBV A;  1Z9U A;  3TFY A;  2J8R A;  2OZH A;  3BJ7 A;  4B10 A;  2HV2 A;  1XIX A;  3IU2 A;  4Y49 C;  2WSA A;  4ZGY B;  3CXS A;  3TCV A;  2VI7 A;  2Z3K A;  1CJW A;  1KUV A;  1YR0 A;  2PDO A;  2ZPA A;  4J3G A;  4DNC A;  2YNC A;  2CNM A;  1IID A;  5C88 A;  4KZT A;  2WPX A;  1OZP A;  4PV6 A;  4BBH A;  2D4O A;  2QML A;  3F8K A;  2H5M A;  3PZJ A;  5KTD A;  4MY3 A;  4UFV A;  2ZW5 A;  3OWC A;  2BUE A;  4CYN A;  2PRB A;  4XPL A;  2OZU A;  3I3G A;  2Z10 A;  4B11 A;  3H5Z A;  4KLV A;  1YRE A;  4KOT A;  4JXR A;  4B5P B;  1WWZ A;  1XF8 A;  2Z0Z A;  2VEZ A;  4Q36 A;  2Z3O A;  2O28 A;  4CRY B;  3H4Q A;  3IGR A;  3IU1 A;  2QEC A;  2J8N A;  5H86 A;  1I1D A;  2ZW7 A;  4JXQ A;  1YX0 A;  4KOS A;  4AG9 A;  4CAF A;  4CS0 B;  2Z3N A;  1M4G A;  1QSN A;  3S6H A;  5I0C A;  2VXK A;  3UY5 A;  4KS9 A;  5ISV A;  3S6F A;  2P6F A;  3R96 A;  1I12 A;  2FL4 A;  3WR7 A;  3R1K A;  4BMH A;  1Q2D A;  2G3A A;  4Q38 A;  4CAW A;  1P4N A;  4OAE A;  4FD5 A;  2NMT A;  1S5K A;  2REF A;  2BSW A;  5E96 A;  3ZJ0 A;  2FCK A;  2JDC A;  4B13 A;  1S7F A;  1BO4 A;  4F6A A;  3G8W A;  5AG6 A;  4C7H A;  2Z3P A;  4UWI A;  1M4D A;  4UFX A;  4M85 A;  1V0C A;  2R7H A;  2K5T A;  4KVM E;  2VBQ A;  2QIR A;  4KOV A;  5EC4 A;  3A9L A;  3EFA A;  4RS2 A;  1U6M A;  5BWA B;  2ZXV A;  1I21 A;  3D2M A;  2JDD A;  2IL4 A;  4ORF A;  1BOB A;  5FVJ A;  2Z3M A;  3P2F A;  5JPH A;  1MJA A;  3BJ8 A;  4U9Y A;  2FIA A;  4HNY B;  5HH1 A;  3FXT A;  1Z4E A;  4KVX A;  4ONU A;  5H84 A;  2WUU A;  3DNS A;  4L8A A;  1Y7R A;  4ZBG A;  4C2X A;  3BLN A;  4MHD A;  2I00 A;  3MGD A;  1Q2Y A;  2RC4 A;  2VZZ A;  4B5O A;  1VKC A;  4KLW A;  4R87 A;  2J8M A;  1B6B A;  2FSR A;  2YND A;  4PSX A;  2R8V A;  1YK3 A;  4UFW A;  1J4J A;  1NMT A;  4JWP A;  5KTA A;  2KCW A;  3GYA A;  2BEI A;  4MFP A;  3DR6 A;  5KTC A;  2A4N A;  1MK4 A;  2DPS A;  4C2Z A;  4H89 A;  4FD4 A;  2X7B A;  2FS5 A;  3E0K A;  2B4D A;  4X5K A;  4OAD A;  3TOB A;  2OZG A;  2Q44 A;  3S6G A;  4AVB A;  3EXN A;  4NCZ A;  4H6Z A;  3T9Y A;  4NF1 A;  4CYQ A;  1Z4R A;  2EUI A;  3LOD A;  4A2Z A;  3FBU A;  4QBJ A;  1M1D A;  2D4P A;  2YNC C;  4JD6 A;  4OLL A;  4KOW A;  1SQH A;  3W6S A;  5J8C A;  2DPT A;  2YNE A;  3SXO A;  1N71 A;  1ZO0 A;  4EVY A;  5CNP A;  1YVO A;  1FY7 A;  2CXA A;  2OU2 A;  4KSF A;  1NSL A;  4NXY A;  3PGP A;  3TOA A;  3EY5 A;  3FRM A;  1XE4 A;  5HMN A;  2DXQ A;  1MJB A;  4QVT A;  2B3V A;  4QC6 A;  3SHP A;  4R57 A;  3C26 A;  1K4J A;  4C7I A;  2VQY A;  1LRZ A;  3D3S A;  3JVN A;  4XNH B;  4E0A A;  5J8F A;  3D8P A;  5G1Z A;  2PQ8 A;  3EC4 A;  3PP9 A;  4A31 A;  2C27 A;  3N7Z A;  2BL1 A;  3VWD A;  4AB7 A;  4C2Y A;  2HQY A;  5DWM A;  4KVO E;  1PU9 A;  4QUS A;  1IB1 E;  4A95 A;  2Y0M A;  5G22 A;  5A27 A;  3VWE A;  3D2P A;  3TTH A;  4R3L A;  4II9 A;  3LD2 A;  3TO7 A;  2R1I A;  1VHS A;  4KUA A;  4XNH C;  5A28 A;  1S3Z A;  1YLE A;  4IUS A;  3NE7 A;  3F0A A;  4YRH A;  2B5G A;  1QST A;  4U5Y A;  2HUZ A;  4LX9 A;  3TO9 A;  3R9G A;  4M3S A;  3ZZI A;  1RXT A;  4UBR A;  4A33 A;  1RO5 A;  4PK2 A;  4NSQ A;  2P6G A;  3DR8 A;  2B3U A;  2F5I A;  1NE9 A;  4YFJ A;  4CYP A;  2REE A;  4FD6 A;  5F49 A;  3R9E A;  4PSW A;  4KOR A;  1GHE A;  1XMT A;  2GE3 A;  1Y9K A;  4CYO A;  1P0H A;  5C82 A;  2PR8 A;  1WK4 A;  4F0X A;  1QSO A;  1YVK A;  1TIQ A;  4MJ8 A;  4UCN A;  3S6K A;  1S60 A;  4MFK A;  5IB0 A;  3KKW A;  2B58 A;  4CGL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...