2PR1A

Crystal structure of the bacillus subtilis n-acetyltransferase ylbp protein in complex with coenzyme-a
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
152
structure length
152
Chain Sequence
b'MTKVERLLINYKTLEEFKKFKEYGIQELSMLEELQDNIIENDSTSPFYGIYFGDKLVARMSLYQVNGKSNPYFDNRQDYLELWKLEVLPGYQNRGYGRALVEFAKSFKMPIRTNPRMKSAEFWNKMNFKTVKYDMARDKGEDPLIWHPDMDR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized N-acetyltransferase ylbP
publication title Crystal structure of the Bacillus subtilis N-acetyltransferase YlbP protein in complex with Coenzyme-A.
rcsb
source organism Bacillus subtilis
molecule tags Transferase
total genus 42
structure length 152
sequence length 152
chains with identical sequence B
ec nomenclature ec 2.3.1.-:
pdb deposition date 2007-05-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 2pr1A00
1YK3A 2GIVA 3EY5A 5F48A 1MK4A 1KUYA 4H89A 1YVKA 3FNCA 5DWMA 2G3AA 3ZZIA 3TO7A 5I0CA 1XF8A 4JJXA 3PZJA 5IX3A 2VQYA 2H5MA 2VZYA 3FXTA 3TT2A 4AG7A 3CXPA 3PGPA 3S6GA 4JLYA 1IICA 4H6ZA 2FCKA 4KLWA 3T90A 4CRYB 2R1IA 3UY5A 2FE7A 5KTDA 3F0AA 5F46A 3BJ8A 1IYLA 1Q2CA 2CNTA 4JXRA 2B58A 3D3SA 4KOWA 4PSXA 3F5BA 2ARHA 3NE7A 4HNWB 4AG9A 2VBQA 2K5TA 2VI7A 1YR0A 1M44A 3VWEA 1S5KA 4QC6A 4OAEA 2CNMA 2F5IA 1Z9UA 5CNPA 3TO9A 3WR7A 3DDDA 2AE6A 1SQHA 4IF5A 3KKWA 4FD4A 1UFHA 1VHSA 4QBJA 3LD2A 2FIWA 1Z4RA 3GYAA 4RI1A 4KVXA 4E2AA 2ZW7A 2B4DA 1M4IA 2J8NA 3P2FA 3JUWA 2GANA 3R96A 4MY3A 1S7LA 2EUIA 5EC4A 4H6UA 2Z11A 1CM0A 3S6HA 3VWDA 2Z10A 2BEIA 4LX9A 4NSQA 2OH1A 1QSTA 1J4JA 4YGOA 2PSWA 2JDCA 4KOVA 5HH1A 3S6KA 4R3KA 4E0AA 2RC4A 1IB1E 1P0HA 4YFJA 2Z0ZA 3T9YA 4PV6A 1IIDA 2PQ8A 2HQYA 1KUVA 3FB3A 3R1KA 3GY9A 1ON0A 1NSLA 4HKFA 1Y9WA 5JPHA 5H84A 2VEZA 1B6BA 5F49A 2G0BA 2B4BA 3I3GA 3TO6A 4IUSA 1U6MA 4PK2A 4LUAA 1XMTA 5J8FA 4F0YA 4MJ8A 4AVBA 3EFAA 2Q7BA 2PC1A 4EVYA 4U5YA 3SXOA 2OB0A 1RO5A 1XE4A 2EVNA 1BO4A 1VKCA 4KVME 2FIAA 2REFA 2OZGA 4ZBGA 4XPKA 2QECA 1B87A 4PSWA 2OZUA 1P4NA 5KTAA 2VZZA 4M3SA 3TOBA 3FYNA 3DNSA 1MJAA 1YREA 3S6FA 5DWNA 1L0CA 1WWZA 4XPDC 1RXTA 4UWJA 1NE9A 4XNHB 4CAXA 3EO4A 5J8CA 1Q2YA 1YGHA 3IGRA 2BSWA 1XEBA 4NCZA 1YVOA 5H86A 4QUSA 3TTHA 4CAWA 1I12A 3FIXA 3LODA 1Y9KA 4B5PA 1FY7A 2A4NA 4MBUA 1IYKA 2D4PA 3E0KA 1CJWA 4KORA 4R9MA 4X5KA 1XIXA 2FXFA 1I1DA 4NF1A 4XNHC 4PK3A 4F6AA 2Q4VA 2QIRA 3I9SA 4AVCA 1QSNA 2KCWA 3FRMA 2ZXVA 3CXQA 3D2MA 3DR8A 4II9A 3W91A 3K9UA 1V0CA 4UWIA 1WK4A 2PDOA 2I79A 3IWGA 2QMLA 3TCVA 2JEVA 3QAHA 1KUXA 4CAVA 2R7HA 1K4JA 4ORFA 3TOAA 5E96A 1Q2DA 4L8AA 4E8OA 1QSRA 2ATRA 3FBUA 2B5GB 3R9GA 5GCNA 4M85A 1BOBA 4JD6A 2PR8A 2FS5A 5C88A 2G3TA 3TFYA 2Q44A 2PRBA 4KOTA 4DNCA 3DR6A 4J3GA 2ZPAA 2J8MA 1Z4EA 2NMTA 4FD7A 5ISVA 2FSRA 3SXNA 4KOXA 3DSBA 1MJ9A 3QB8A 4XPDB 4KVOE 2PR1A 4MI4A 4QVTA 2ZW5A 1Y7RA 4L89A 5EBVA 5JQ4A 4KLVA 1PU9A 4K30A 1N71A 2CNSA 1QSOA 2GE3A 3D8PA 1S7NA 2R8VA 4U9ZA 1TIQA 2D4OA 2J8RA 1I21A 4Y49B 4YRHA 3BJ7A 3EC4A 5HMNA 4AVAA 3C26A 4KOUA 3MGDA 3TE4A 3G8WA 2FT0A 1YX0A 2P6GA 2FL4A 3OWCA 4HNXB 4AB7A 4CS0B 4KZTA 3G3SA 4R87A 4B5OA 4B5PB 5IB0A 4HNYB 4R3LA 3H4QA 3R9EA 1R57A 1PUAA 2ZW4A 4ONUA 4MHDA 5C82A 2P6FA 2CY2A 4OADA 2HUZA 1S3ZA 2ZW6A 4QB9A 4FD6A 3P2HA 4GS4A 2B4DB 3W6SA 2VXKA 2P6EA 5KTCA 2BUEA 2Y0MA 4JXQA 2JLMA 1M1DA 3R9FA 4NXYA 4Y49C 2AJ6A 2OU2A 2WPXA 2R98A 3EXNA 4KOSA 2IL4A 4U9YA 1M4DA 3D2PA 2B3VA 1S60A 2Q04A 1NMTA 2HV2A 2Q0YA 5IV0A 1MJBA 3BLNA 2OZHA 2P0WA 1QSMA 1KZFA 1YLEA 2Q4YA 3B8GA 1LRZA 2REEA 2BL1A 4RS2A 3N7ZA 2B3UA 2O28A 3JVNA 4NEXA 4BMHA 2JDDA 1OZPA 4KOYA 3W6XA 4I49A 4JWPA 4FD5A 2I00A 3GKRA 1M4GA 4KUAA 2DXQA 1GHEA 3F8KA 2X7BA 2C27A 3R95A 5FVJA 4MY0A 3SHPA 3PP9A 4OLLA 3CXSA 4KUBA 3V8IA 1S7FA 4XPLA 4R57A 5F47A 2WPWA 3RYOA 4CRZB 4UBRA 2B5GA 3ZJ0A 1S7KA 4UA3A
chains in the Genus database with same CATH superfamily
1YK3A 4NGQA 2GIVA 3EY5A 2DPSA 4OC3A 5F48A 1MK4A 1KUYA 4H89A 1YVKA 3FNCA 3D67A 4UCPA 5DWMA 2G3AA 3ZZIA 3TO7A 8CPAA 2ZOFA 1TKJA 5I0CA 1QMUA 1XF8A 2NYQA 3KHZA 4JJXA 4OIWA 1HDQA 4A95A 1TXRA 3DGVA 3PZJA 2QJ8A 5IX3A 2VQYA 2H5MA 2VZYA 3FXTA 3TT2A 4AG7A 5A27A 3CXPA 3PGPA 4B14A 1TF8A 2Q51A 3S6GA 4JLYA 1IICA 2AFSA 4UFXA 5J1QA 2BO9A 4H6ZA 3FF3A 2FCKA 5LYIA 3IFEA 2PVWA 2Z3KA 3K2KA 3TX8A 4KLWA 1ELLP 3I1UA 3PB7X 2ODFA 3BXMA 2PJ4A 3T90A 2R1IA 4CRYB 1H8LA 3UY5A 1Y0YA 3S9MA 1TF9A 1CBXA 2FE7A 5KTDA 2Z3PA 1ZLIA 2C6GA 3F0AA 4C2YA 5JH9A 5F46A 2CIJA 2PJ6A 3BJ8A 1IYLA 2EWBA 1Q2CA 2CNTA 2Q7SA 4JXRA 2B58A 3BI1A 3KHXA 1FNOA 3D3SA 1YSJA 4KOWA 1YLOA 4PSXA 3F5BA 2ARHA 3NE7A 4Q36A 4CGNA 4HNWB 3IJ3A 2EBJA 4AG9A 2VBQA 2VL1A 2K5TA 2VI7A 3A9LA 4CYNA 1YR0A 1M44A 1XJOA 3VWEA 3LMSA 2PJ9A 4F8ZA 2BOAA 1IY7A 1S5KA 4QC6A 2OR4A 3KQXA 4CPAA 4OAEA 2CNMA 3FVLA 2PJ1A 2F5IA 1Z9UA 2Z3NA 4GXHA 4F0XA 5CNPA 3D66A 3TO9A 3WR7A 3DDDA 2AE6A 4MFLA 1SQHA 2PJAA 4IF5A 3KKWA 2V8GA 4FD4A 5DS0A 3NH5A 4A33A 4B6ZA 1UFHA 4X2TA 4PPZA 1VHSA 4QBJA 3LD2A 5K8MA 3PBEA 2FIWA 1Z4RA 1DTDA 3GYAA 3KR5A 5K8NA 4RI1A 4KVXA 4E2AA 2ZW7A 4NGSA 2B4DA 3LACA 1M4IA 4UFWA 2J8NA 4KSIA 4PXCA 1HDUA 3IEHA 3PB6X 2XEIA 3P2FA 2XEGA 3JUWA 1CG2A 3SJXA 2GANA 3R96A 4MFPA 4MY3A 3NH4A 4TNUA 5K8PA 1S7LA 2IJZA 3RNZA 2EUIA 3B2YA 5EC4A 5LRKA 2AFWA 4H6UA 4Q38A 4OKOA 2AFZA 2ANPA 2AFMA 2PE3A 2Z11A 1CM0A 3KZWA 1Z8XA 3PFOA 3S6HA 1CX8A 3VWDA 4K3NA 3VH9A 2WUUA 2YNDA 2Z10A 4ZI6A 4F9VA 2BEIA 4LX9A 4NSQA 4R7MA 3H8FA 4A31A 4A30A 3QAYA 2OH1A 4A2ZA 1QSTA 1J4JA 3SJEA 4YGOA 3B3VA 5EMIA 2PSWA 2JDCA 5A28A 2Q43A 4Z65A 2YNCC 2IQ6A 3ISZA 4KOVA 4NFRA 5HH1A 3S6KA 2YNEA 4R3KA 1XOVA 4E0AA 2RC4A 1IB1E 1P0HA 2ZEGA 2Z0ZA 4YFJA 3T9YA 1XMBA 3NE8A 4PV6A 1IIDA 4G1PA 5THWA 1JWQA 1YW6A 1LAMA 2PQ8A 3NH8A 2HQYA 1BPNA 4FBEA 3KGQA 1KUVA 3FB3A 1ZO0A 4JYWA 3R1KA 3B3TA 5F09A 4OC4A 3GY9A 1ON0A 1NSLA 4HKFA 4BD9A 1Y9WA 3IIBA 2O4HA 4MFQA 5JPHA 5H84A 2VEZA 2ZENA 4MXUA 5G20A 1B6BA 1RTQA 5F49A 2G0BA 2B4BA 3SJFA 3I3GA 1YQEA 4PQAA 3TO6A 2V77A 1HEEA 4IUSA 4MRIA 1U6MA 4PK2A 2F8HA 4LUAA 4YU9A 4A94A 1XMTA 1F2OA 1LFWA 2CF4A 2DF5A 4C7IA 2ZEHA 4CGLA 4F0YA 5J8FA 3B35A 3JRUA 2YGWA 4MJ8A 4AVBA 1XBUA 3EFAA 2Q7BA 2PC1A 4B11A 2WYRA 4EVYA 1X10A 4U5YA 4C2XA 2XEJA 1BAVA 3D7DA 3PB8X 2OB0A 3SXOA 3NA6A 1RO5A 1XE4A 3H8GA 2PCUA 1Z8WA 2EVNA 2JBKA 1BO4A 3N5FA 3S9NA 1VKCA 2FIAA 4KVME 2REFA 2OZGA 2PVVA 2WZNA 2QECA 3D7GA 4XPKA 4ZBGA 1B87A 4MFZA 4PSWA 3VARA 4BINA 3IU1A 2OZUA 3WABA 1P4NA 2ZEDA 5KTAA 1IOIA 2VZZA 4M3SA 3RZAA 3TOBA 3B3SA 3FYNA 1AUGA 5HXDA 2PJ8A 1LAPA 1ZG9A 3DNSA 1MJAA 1YREA 3PEIA 4NGRA 3S6FA 3D68A 4P4JA 4NJRA 5DWNA 1L0CA 4DYOA 1WWZA 2CXAA 4CGPA 2ZEEA 2GREA 1EE3P 4XPDC 1RXTA 2O53A 4R6TA 1YMEA 4UWJA 3WT4A 3FECA 1NE9A 3BHXA 4JZ0A 4XNHB 4CAXA 2ZOGA 4P4FA 4C7HA 2AFXA 3EO4A 4P44A 3T8WA 5CBMA 4P4IA 4A38A 5J8CA 3HUVA 1Q2YA 1CP7A 1Q7LA 4MFKA 4EWTA 1VHOA 1YGHA 3IGRA 2BSWA 1XEBA 4NCZA 1YVOA 5H86A 4EMEA 5LRJA 4QUSA 3CPAA 4UIAA 3TTHA 5LYFA 1Z8LA 3VATA 1DE4C 1VHEA 4CAWA 4ZY0A 1F2PA 3L2NA 3FMCA 1I12A 1ZLHA 3FIXA 4OC1A 3LODA 1Y9KA 1ZG7A 4MCSA 2FVGA 5G1ZA 4B5PA 4MFJA 4UFVA 3GIUA 2AFOA 1FY7A 2A4NA 2GFQA 3B3CA 2PJ7A 1JQGA 2F7VA 4P45A 5AG5A 2Q4ZA 4MBUA 4PXDA 1CPXA 1IYKA 2POKA 3NFZA 4P6YA 2D4PA 3E0KA 4CAEA 2RB7A 1CJWA 4KORA 4R9MA 4UF4A 3RBUA 3LWUA 5HVHA 1IOFA 4X5KA 2PJ3A 2ZEMA 1XIXA 2FXFA 1I1DA 3HLPA 4NF1A 4XNHC 4PK3A 4O23A 2Q4VA 2QIRA 4R8FA 4MCPA 4F6AA 3I9SA 4AVCA 1QSNA 3RAMA 4IK2A 4WWVA 2KCWA 3FRMA 2ZXVA 2WSAA 3CXQA 3D2MA 3DR8A 4HPSA 5LYLA 3S9LA 4II9A 2V8DA 3W91A 2QVPA 3K9UA 1V0CA 4UWIA 2PJCA 5JGFA 1WK4A 2BCOA 2PDOA 2Z3MA 3GUXA 2DEAA 2I79A 3IWGA 2QMLA 5LRGA 3TCVA 4ZY1A 2JEVA 5D8NA 4A37A 3GB0A 3PFEA 3QAHA 1KUXA 4CAVA 2C6PA 2R7HA 1K4JA 4ORFA 3TOAA 4M6HA 5E96A 1Q2DA 4L8AA 3D7FA 4LQGA 4E8OA 4B12A 1QSRA 4KSAA 3BI0A 1A2ZA 2YNCA 1UWYA 1OBRA 2ATRA 3TC8A 3FBUA 1FT7A 2EK9A 2B5GB 1ARMA 5GCNA 3R9GA 1ZG8A 4DJLA 5I4MA 2PJBA 4M85A 3RO0A 1BOBA 3CDXA 4JD6A 2PR8A 4ZGYB 1ELMP 2FS5A 4B13A 4C2ZA 5C88A 4YWYA 2G3TA 4AXVA 3TFYA 2Q44A 2PRBA 4B10A 1AYEA 5IB9A 2IMOA 4KOTA 2QYVA 4Q7AA 4DNCA 3DR6A 5G22A 3FJUA 4MHNA 4X8IA 4J3GA 2ZPAA 2J8MA 1Z4EA 4UEEA 2NMTA 4FD7A 1R43A 4NGTA 5ISVA 2FSRA 3SXNA 4KOXA 1GYTA 4M6IA 3DSBA 1MJ9A 5G21A 1KWMA 3QB8A 1AMPA 4XPDB 2GLJA 4KVOE 2ZEOA 2PR1A 4MI4A 4QVTA 2ZW5A 3IWWA 2ZEFA 1Y7RA 4L89A 5EBVA 1BLLE 5JQ4A 3PRTA 4KLVA 2C6CA 4X3RA 1PU9A 4K30A 1F57A 1Z5RA 5CPAA 4EFDA 5HVFA 3KQZA 1N71A 3SJGA 2CNSA 1QSOA 2GE3A 3D8PA 3KR4A 4ZX8A 1S7NA 1Y7EA 3KASA 1PCAA 2R8VA 5AG6A 3IU2A 2CTCA 4U9ZA 4FAIA 1TIQA 2D4OA 4MCQA 2J8RA 2JEWA 1I21A 3JTKA 4RUHA 4Y49B 2EK8A 4YRHA 2Z3LA 3BJ7A 3EC4A 1QQ9A 5HMNA 4AVAA 2JBJA 3C26A 4KOUA 5AG7A 3MGDA 4A39A 3G8WA 2FT0A 1YX0A 2P6GA 4C68A 3TE4A 5AG4A 5AGEA 3PB4X 4W9YA 2FL4A 2AFUA 3OWCA 4HNXB 4AB7A 3V7ZA 2ZELA 3SI1A 4CS0B 4KZTA 3G3SA 4R87A 4B5OA 4OIDA 4B5PB 5IB0A 4HNYB 4OC5A 4R3LA 3H4QA 3R9EA 5JM6A 1R57A 4P4BA 4IHMA 1PUAA 2ZW4A 4ONUA 3KI9A 4MHDA 5C82A 2P6FA 2CY2A 1CPSA 4OADA 2HUZA 1S3ZA 2PIZA 2ZW6A 4QB9A 2GLFA 4FD6A 3P2HA 4GS4A 2B4DB 4TWEA 3W6SA 1Z2LA 2VXKA 4GM5A 2P6EA 5KTCA 2BUEA 4CAFA 4CYQA 2Y0MA 4JXQA 2JLMA 2PJ0A 1M1DA 1PYTB 1XRYA 2G9DA 3FX6A 3QNVA 2AJ6A 4NXYA 4Y49C 4LQ6A 3R9FA 5ELYA 2OU2A 4OC0A 3DLJA 5LYDA 4FUUA 2WPXA 4ZY2A 2R98A 3EXNA 4FWUA 3FEEA 2V8VA 1M4LA 4KOSA 1LOKA 4PXBA 2IL4A 2PIYA 4CGMA 3IO1A 2C1CA 4P4DA 4U9YA 1LANA 1M4DA 4WJBA 3D2PA 4CYPA 2NSMA 2B3VA 4ZYQA 4RN7A 1R3NA 4NJQA 2CTBA 4MHYA 1S60A 3KL9A 4IAVA 1X12A 1XFOA 1ARLA 2HC9A 3WC6A 2Q04A 3D7HA 4CYOA 1BPMA 1NMTA 2HV2A 4OC2A 2Q0YA 5IV0A 4P10A 1MJBA 2PJ5A 3MN8A 1LCPA 2PJ2A 3FEDA 3BLNA 2OZHA 3B7IA 3IWEA 2P0WA 4UEFA 1QSMA 1KZFA 2RFHA 4DUKA 1YLEA 4NGNA 3CPXA 4ONWA 4UCNA 1NSAA 2Q4YA 3B8GA 4R76A 2EO8A 1LRZA 2REEA 2BL1A 4RS2A 3WC5A 2V8HA 2B3UA 1TKHA 3N7ZA 3PB9X 4PXEA 4A32A 4CGOA 4M6GA 3H5ZA 2OOTA 4OP4A 2ABZA 2O28A 3JVNA 4NEXA 4BMHA 4KSFA 4MHZA 2JDDA 4MHPA 1OZPA 2PRQA 4KOYA 3CZXA 5D29A 3W6XA 3CT9A 4I49A 3FH4A 4JWPA 4OMEA 7CPAA 1TKFA 4FD5A 4UCMA 2DPTA 2I00A 3D4UA 3GKRA 4NGMA 1M4GA 5K8OA 3H8EA 4KUAA 2DXQA 1GHEA 3V38A 3F8KA 1IU8A 2X7BA 6CPAA 2C27A 3IC1A 2Z3OA 3GLJA 3R95A 4BBHA 2XEFA 5FVJA 2GU2A 4ZX9A 5BWAB 1CP6A 4MY0A 4UIBA 3SI0A 4NGPA 3SHPA 3PP9A 4OLLA 3CXSA 4MCRA 4KUBA 1Y0RA 4P4EA 3V8IA 4H2KA 2J9AA 1VIXA 4F9UA 1S7FA 2HB6A 4KS9A 4XPLA 4R57A 5F47A 2I3CA 3ISXA 3PBBA 3K9TA 2WPWA 1IGBA 3B3WA 3RYOA 4CRZB 5HVGA 4UBRA 2B5GA 2ZEPA 3MRUA 3WC7A 3ZJ0A 3SI2A 1VGYA 1YW4A 4UEZA 4MMOA 1Z8TA 1S7KA 4UA3A
chains in the Genus database with same CATH topology
1YK3A 2GIVA 3EY5A 2DPSA 5F48A 1MK4A 1KUYA 4H89A 1YVKA 3FNCA 4UCPA 5DWMA 2G3AA 3ZZIA 3TO7A 5I0CA 1XF8A 4JJXA 4A95A 3PZJA 5IX3A 2VQYA 2H5MA 2VZYA 3FXTA 3TT2A 4AG7A 5A27A 3CXPA 3PGPA 4B14A 3S6GA 4JLYA 1IICA 4UFXA 4H6ZA 2FCKA 2Z3KA 4KLWA 3T90A 4CRYB 2R1IA 3UY5A 2FE7A 5KTDA 2Z3PA 3F0AA 4C2YA 5F46A 3BJ8A 1IYLA 1Q2CA 2CNTA 4JXRA 2B58A 3D3SA 4KOWA 4PSXA 3F5BA 2ARHA 3NE7A 4Q36A 4CGNA 4HNWB 4AG9A 2VBQA 2K5TA 2VI7A 3A9LA 4CYNA 1YR0A 1M44A 3VWEA 1S5KA 4QC6A 4OAEA 2CNMA 2F5IA 1Z9UA 2Z3NA 4F0XA 5CNPA 3TO9A 3WR7A 3DDDA 2AE6A 4MFLA 1SQHA 4IF5A 3KKWA 4FD4A 4A33A 1UFHA 1VHSA 4QBJA 3LD2A 2FIWA 1Z4RA 3GYAA 4RI1A 4KVXA 4E2AA 2ZW7A 2B4DA 1M4IA 4UFWA 2J8NA 3P2FA 3JUWA 2GANA 3R96A 4MFPA 4MY3A 1S7LA 2EUIA 5EC4A 4H6UA 4Q38A 2Z11A 1CM0A 3S6HA 3VWDA 2WUUA 2YNDA 2Z10A 2BEIA 4LX9A 4NSQA 4A31A 4A30A 2OH1A 4A2ZA 1QSTA 1J4JA 4YGOA 2PSWA 2JDCA 5A28A 2YNCC 4KOVA 5HH1A 3S6KA 2YNEA 4R3KA 4E0AA 2RC4A 1IB1E 1P0HA 4YFJA 2Z0ZA 3T9YA 4PV6A 1IIDA 2PQ8A 2HQYA 1KUVA 3FB3A 1ZO0A 3R1KA 3GY9A 1ON0A 1NSLA 4HKFA 1Y9WA 4MFQA 5JPHA 5H84A 2VEZA 5G20A 1B6BA 5F49A 2G0BA 2B4BA 3I3GA 3TO6A 4IUSA 1U6MA 4PK2A 4LUAA 4CGLA 1XMTA 4C7IA 5J8FA 4F0YA 2YGWA 4MJ8A 4AVBA 3EFAA 2Q7BA 2PC1A 4B11A 4EVYA 4U5YA 4C2XA 3SXOA 2OB0A 1RO5A 1XE4A 2EVNA 1BO4A 1VKCA 2FIAA 4KVME 2REFA 2OZGA 4ZBGA 4XPKA 2QECA 4C2ZA 1B87A 4MFZA 4PSWA 3IU1A 2OZUA 1P4NA 5KTAA 2VZZA 4M3SA 3TOBA 3FYNA 3DNSA 1MJAA 1YREA 3S6FA 5DWNA 1L0CA 1WWZA 2CXAA 4CGPA 4XPDC 1RXTA 4UWJA 1NE9A 4XNHB 4CAXA 4C7HA 3EO4A 5J8CA 1Q2YA 4MFKA 1YGHA 3IGRA 2BSWA 1XEBA 4NCZA 1YVOA 5H86A 4QUSA 3TTHA 4CAWA 1I12A 3FIXA 3LODA 1Y9KA 4B5PA 5G1ZA 4MFJA 4UFVA 1FY7A 2A4NA 5AG5A 4MBUA 1IYKA 2D4PA 3E0KA 4CAEA 1CJWA 4KORA 4R9MA 4X5KA 1XIXA 2FXFA 1I1DA 4NF1A 4XNHC 4PK3A 4F6AA 2Q4VA 2QIRA 3I9SA 4AVCA 1QSNA 2KCWA 3FRMA 2ZXVA 2WSAA 3CXQA 3D2MA 3DR8A 4II9A 3W91A 3K9UA 1V0CA 4UWIA 1WK4A 2PDOA 2Z3MA 2I79A 3IWGA 2QMLA 3TCVA 2JEVA 3QAHA 1KUXA 4CAVA 2R7HA 1K4JA 4ORFA 3TOAA 5E96A 1Q2DA 4L8AA 4E8OA 4B12A 1QSRA 4KSAA 2YNCA 2ATRA 3FBUA 2B5GB 3R9GA 5GCNA 4M85A 1BOBA 4JD6A 2PR8A 4ZGYB 2FS5A 4B13A 5C88A 2G3TA 3TFYA 2Q44A 2PRBA 4B10A 4KOTA 4DNCA 3DR6A 5G22A 4J3GA 2ZPAA 2J8MA 1Z4EA 2NMTA 4FD7A 5ISVA 2FSRA 3SXNA 4KOXA 3DSBA 1MJ9A 5G21A 3QB8A 4XPDB 4KVOE 2PR1A 4MI4A 4QVTA 2ZW5A 1Y7RA 4L89A 5EBVA 5JQ4A 4KLVA 1PU9A 4K30A 1N71A 2CNSA 1QSOA 2GE3A 3D8PA 1S7NA 2R8VA 5AG6A 3IU2A 4U9ZA 1TIQA 2D4OA 2J8RA 1I21A 3JTKA 4Y49B 4YRHA 2Z3LA 3BJ7A 3EC4A 5HMNA 4AVAA 3C26A 4KOUA 5AG7A 3MGDA 3TE4A 3G8WA 2FT0A 1YX0A 2P6GA 4C68A 5AG4A 5AGEA 2FL4A 3OWCA 4HNXB 4AB7A 4CS0B 4KZTA 3G3SA 4R87A 4B5OA 4B5PB 5IB0A 4HNYB 4R3LA 3H4QA 3R9EA 1R57A 1PUAA 2ZW4A 4ONUA 4MHDA 5C82A 2P6FA 2CY2A 4OADA 2HUZA 1S3ZA 2ZW6A 4QB9A 4FD6A 4GS4A 3P2HA 2B4DB 3W6SA 2VXKA 2P6EA 5KTCA 2BUEA 4CAFA 4CYQA 2Y0MA 4JXQA 2JLMA 1M1DA 3R9FA 4NXYA 4Y49C 2AJ6A 2OU2A 2WPXA 2R98A 3EXNA 4KOSA 2IL4A 4CGMA 4U9YA 1M4DA 3D2PA 4CYPA 2B3VA 1S60A 2Q04A 4CYOA 1NMTA 2HV2A 2Q0YA 5IV0A 1MJBA 3BLNA 2OZHA 3IWEA 2P0WA 1QSMA 1KZFA 1YLEA 4UCNA 2Q4YA 3B8GA 1LRZA 2REEA 2BL1A 4RS2A 3N7ZA 2B3UA 4CGOA 4A32A 3H5ZA 2O28A 3JVNA 4NEXA 4BMHA 4KSFA 2JDDA 1OZPA 4KOYA 3W6XA 4I49A 4JWPA 4FD5A 4UCMA 2DPTA 2I00A 3GKRA 1M4GA 4KUAA 2DXQA 1GHEA 3F8KA 2X7BA 2C27A 2Z3OA 3R95A 4BBHA 5FVJA 5BWAB 4MY0A 3SHPA 3PP9A 4OLLA 3CXSA 4KUBA 3V8IA 1S7FA 4KS9A 4XPLA 4R57A 5F47A 2WPWA 3RYOA 4CRZB 4UBRA 2B5GA 3ZJ0A 1S7KA 4UA3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YK3 A;  2GIV A;  3EY5 A;  5F48 A;  1MK4 A;  1KUY A;  4H89 A;  1YVK A;  3FNC A;  5DWM A;  2G3A A;  3ZZI A;  3TO7 A;  5I0C A;  1XF8 A;  4JJX A;  3PZJ A;  5IX3 A;  2VQY A;  2H5M A;  2VZY A;  3FXT A;  3TT2 A;  4AG7 A;  3CXP A;  3PGP A;  3S6G A;  4JLY A;  1IIC A;  4H6Z A;  2FCK A;  4KLW A;  3T90 A;  4CRY B;  2R1I A;  3UY5 A;  2FE7 A;  5KTD A;  3F0A A;  5F46 A;  3BJ8 A;  1IYL A;  1Q2C A;  2CNT A;  4JXR A;  2B58 A;  3D3S A;  4KOW A;  4PSX A;  3F5B A;  2ARH A;  3NE7 A;  4HNW B;  4AG9 A;  2VBQ A;  2K5T A;  2VI7 A;  1YR0 A;  1M44 A;  3VWE A;  1S5K A;  4QC6 A;  4OAE A;  2CNM A;  2F5I A;  1Z9U A;  5CNP A;  3TO9 A;  3WR7 A;  3DDD A;  2AE6 A;  1SQH A;  4IF5 A;  3KKW A;  4FD4 A;  1UFH A;  1VHS A;  4QBJ A;  3LD2 A;  2FIW A;  1Z4R A;  3GYA A;  4RI1 A;  4KVX A;  4E2A A;  2ZW7 A;  2B4D A;  1M4I A;  2J8N A;  3P2F A;  3JUW A;  2GAN A;  3R96 A;  4MY3 A;  1S7L A;  2EUI A;  5EC4 A;  4H6U A;  2Z11 A;  1CM0 A;  3S6H A;  3VWD A;  2Z10 A;  2BEI A;  4LX9 A;  4NSQ A;  2OH1 A;  1QST A;  1J4J A;  4YGO A;  2PSW A;  2JDC A;  4KOV A;  5HH1 A;  3S6K A;  4R3K A;  4E0A A;  2RC4 A;  1IB1 E;  1P0H A;  4YFJ A;  2Z0Z A;  3T9Y A;  4PV6 A;  1IID A;  2PQ8 A;  2HQY A;  1KUV A;  3FB3 A;  3R1K A;  3GY9 A;  1ON0 A;  1NSL A;  4HKF A;  1Y9W A;  5JPH A;  5H84 A;  2VEZ A;  1B6B A;  5F49 A;  2G0B A;  2B4B A;  3I3G A;  3TO6 A;  4IUS A;  1U6M A;  4PK2 A;  4LUA A;  1XMT A;  5J8F A;  4F0Y A;  4MJ8 A;  4AVB A;  3EFA A;  2Q7B A;  2PC1 A;  4EVY A;  4U5Y A;  3SXO A;  2OB0 A;  1RO5 A;  1XE4 A;  2EVN A;  1BO4 A;  1VKC A;  4KVM E;  2FIA A;  2REF A;  2OZG A;  4ZBG A;  4XPK A;  2QEC A;  1B87 A;  4PSW A;  2OZU A;  1P4N A;  5KTA A;  2VZZ A;  4M3S A;  3TOB A;  3FYN A;  3DNS A;  1MJA A;  1YRE A;  3S6F A;  5DWN A;  1L0C A;  1WWZ A;  4XPD C;  1RXT A;  4UWJ A;  1NE9 A;  4XNH B;  4CAX A;  3EO4 A;  5J8C A;  1Q2Y A;  1YGH A;  3IGR A;  2BSW A;  1XEB A;  4NCZ A;  1YVO A;  5H86 A;  4QUS A;  3TTH A;  4CAW A;  1I12 A;  3FIX A;  3LOD A;  1Y9K A;  4B5P A;  1FY7 A;  2A4N A;  4MBU A;  1IYK A;  2D4P A;  3E0K A;  1CJW A;  4KOR A;  4R9M A;  4X5K A;  1XIX A;  2FXF A;  1I1D A;  4NF1 A;  4XNH C;  4PK3 A;  4F6A A;  2Q4V A;  2QIR A;  3I9S A;  4AVC A;  1QSN A;  2KCW A;  3FRM A;  2ZXV A;  3CXQ A;  3D2M A;  3DR8 A;  4II9 A;  3W91 A;  3K9U A;  1V0C A;  4UWI A;  1WK4 A;  2PDO A;  2I79 A;  3IWG A;  2QML A;  3TCV A;  2JEV A;  3QAH A;  1KUX A;  4CAV A;  2R7H A;  1K4J A;  4ORF A;  3TOA A;  5E96 A;  1Q2D A;  4L8A A;  4E8O A;  1QSR A;  2ATR A;  3FBU A;  2B5G B;  3R9G A;  5GCN A;  4M85 A;  1BOB A;  4JD6 A;  2PR8 A;  2FS5 A;  5C88 A;  2G3T A;  3TFY A;  2Q44 A;  2PRB A;  4KOT A;  4DNC A;  3DR6 A;  4J3G A;  2ZPA A;  2J8M A;  1Z4E A;  2NMT A;  4FD7 A;  5ISV A;  2FSR A;  3SXN A;  4KOX A;  3DSB A;  1MJ9 A;  3QB8 A;  4XPD B;  4KVO E;  2PR1 A;  4MI4 A;  4QVT A;  2ZW5 A;  1Y7R A;  4L89 A;  5EBV A;  5JQ4 A;  4KLV A;  1PU9 A;  4K30 A;  1N71 A;  2CNS A;  1QSO A;  2GE3 A;  3D8P A;  1S7N A;  2R8V A;  4U9Z A;  1TIQ A;  2D4O A;  2J8R A;  1I21 A;  4Y49 B;  4YRH A;  3BJ7 A;  3EC4 A;  5HMN A;  4AVA A;  3C26 A;  4KOU A;  3MGD A;  3TE4 A;  3G8W A;  2FT0 A;  1YX0 A;  2P6G A;  2FL4 A;  3OWC A;  4HNX B;  4AB7 A;  4CS0 B;  4KZT A;  3G3S A;  4R87 A;  4B5O A;  4B5P B;  5IB0 A;  4HNY B;  4R3L A;  3H4Q A;  3R9E A;  1R57 A;  1PUA A;  2ZW4 A;  4ONU A;  4MHD A;  5C82 A;  2P6F A;  2CY2 A;  4OAD A;  2HUZ A;  1S3Z A;  2ZW6 A;  4QB9 A;  4FD6 A;  3P2H A;  4GS4 A;  2B4D B;  3W6S A;  2VXK A;  2P6E A;  5KTC A;  2BUE A;  2Y0M A;  4JXQ A;  2JLM A;  1M1D A;  3R9F A;  4NXY A;  4Y49 C;  2AJ6 A;  2OU2 A;  2WPX A;  2R98 A;  3EXN A;  4KOS A;  2IL4 A;  4U9Y A;  1M4D A;  3D2P A;  2B3V A;  1S60 A;  2Q04 A;  1NMT A;  2HV2 A;  2Q0Y A;  5IV0 A;  1MJB A;  3BLN A;  2OZH A;  2P0W A;  1QSM A;  1KZF A;  1YLE A;  2Q4Y A;  3B8G A;  1LRZ A;  2REE A;  2BL1 A;  4RS2 A;  3N7Z A;  2B3U A;  2O28 A;  3JVN A;  4NEX A;  4BMH A;  2JDD A;  1OZP A;  4KOY A;  3W6X A;  4I49 A;  4JWP A;  4FD5 A;  2I00 A;  3GKR A;  1M4G A;  4KUA A;  2DXQ A;  1GHE A;  3F8K A;  2X7B A;  2C27 A;  3R95 A;  5FVJ A;  4MY0 A;  3SHP A;  3PP9 A;  4OLL A;  3CXS A;  4KUB A;  3V8I A;  1S7F A;  4XPL A;  4R57 A;  5F47 A;  2WPW A;  3RYO A;  4CRZ B;  4UBR A;  2B5G A;  3ZJ0 A;  1S7K A;  4UA3 A; 
#chains in the Genus database with same CATH topology
 1YK3 A;  4NGQ A;  2GIV A;  3EY5 A;  2DPS A;  4OC3 A;  5F48 A;  1MK4 A;  1KUY A;  4H89 A;  1YVK A;  3FNC A;  3D67 A;  4UCP A;  5DWM A;  2G3A A;  3ZZI A;  3TO7 A;  8CPA A;  2ZOF A;  1TKJ A;  5I0C A;  1QMU A;  1XF8 A;  2NYQ A;  3KHZ A;  4JJX A;  4OIW A;  1HDQ A;  4A95 A;  1TXR A;  3DGV A;  3PZJ A;  2QJ8 A;  5IX3 A;  2VQY A;  2H5M A;  2VZY A;  3FXT A;  3TT2 A;  4AG7 A;  5A27 A;  3CXP A;  3PGP A;  4B14 A;  1TF8 A;  2Q51 A;  3S6G A;  4JLY A;  1IIC A;  2AFS A;  4UFX A;  5J1Q A;  2BO9 A;  4H6Z A;  3FF3 A;  2FCK A;  5LYI A;  3IFE A;  2PVW A;  2Z3K A;  3K2K A;  3TX8 A;  4KLW A;  1ELL P;  3I1U A;  3PB7 X;  2ODF A;  3BXM A;  2PJ4 A;  3T90 A;  2R1I A;  4CRY B;  1H8L A;  3UY5 A;  1Y0Y A;  3S9M A;  1TF9 A;  1CBX A;  2FE7 A;  5KTD A;  2Z3P A;  1ZLI A;  2C6G A;  3F0A A;  4C2Y A;  5JH9 A;  5F46 A;  2CIJ A;  2PJ6 A;  3BJ8 A;  1IYL A;  2EWB A;  1Q2C A;  2CNT A;  2Q7S A;  4JXR A;  2B58 A;  3BI1 A;  3KHX A;  1FNO A;  3D3S A;  1YSJ A;  4KOW A;  1YLO A;  4PSX A;  3F5B A;  2ARH A;  3NE7 A;  4Q36 A;  4CGN A;  4HNW B;  3IJ3 A;  2EBJ A;  4AG9 A;  2VBQ A;  2VL1 A;  2K5T A;  2VI7 A;  3A9L A;  4CYN A;  1YR0 A;  1M44 A;  1XJO A;  3VWE A;  3LMS A;  2PJ9 A;  4F8Z A;  2BOA A;  1IY7 A;  1S5K A;  4QC6 A;  2OR4 A;  3KQX A;  4CPA A;  4OAE A;  2CNM A;  3FVL A;  2PJ1 A;  2F5I A;  1Z9U A;  2Z3N A;  4GXH A;  4F0X A;  5CNP A;  3D66 A;  3TO9 A;  3WR7 A;  3DDD A;  2AE6 A;  4MFL A;  1SQH A;  2PJA A;  4IF5 A;  3KKW A;  2V8G A;  4FD4 A;  5DS0 A;  3NH5 A;  4A33 A;  4B6Z A;  1UFH A;  4X2T A;  4PPZ A;  1VHS A;  4QBJ A;  3LD2 A;  5K8M A;  3PBE A;  2FIW A;  1Z4R A;  1DTD A;  3GYA A;  3KR5 A;  5K8N A;  4RI1 A;  4KVX A;  4E2A A;  2ZW7 A;  4NGS A;  2B4D A;  3LAC A;  1M4I A;  4UFW A;  2J8N A;  4KSI A;  4PXC A;  1HDU A;  3IEH A;  3PB6 X;  2XEI A;  3P2F A;  2XEG A;  3JUW A;  1CG2 A;  3SJX A;  2GAN A;  3R96 A;  4MFP A;  4MY3 A;  3NH4 A;  4TNU A;  5K8P A;  1S7L A;  2IJZ A;  3RNZ A;  2EUI A;  3B2Y A;  5EC4 A;  5LRK A;  2AFW A;  4H6U A;  4Q38 A;  4OKO A;  2AFZ A;  2ANP A;  2AFM A;  2PE3 A;  2Z11 A;  1CM0 A;  3KZW A;  1Z8X A;  3PFO A;  3S6H A;  1CX8 A;  3VWD A;  4K3N A;  3VH9 A;  2WUU A;  2YND A;  2Z10 A;  4ZI6 A;  4F9V A;  2BEI A;  4LX9 A;  4NSQ A;  4R7M A;  3H8F A;  4A31 A;  4A30 A;  3QAY A;  2OH1 A;  4A2Z A;  1QST A;  1J4J A;  3SJE A;  4YGO A;  3B3V A;  5EMI A;  2PSW A;  2JDC A;  5A28 A;  2Q43 A;  4Z65 A;  2YNC C;  2IQ6 A;  3ISZ A;  4KOV A;  4NFR A;  5HH1 A;  3S6K A;  2YNE A;  4R3K A;  1XOV A;  4E0A A;  2RC4 A;  1IB1 E;  1P0H A;  2ZEG A;  2Z0Z A;  4YFJ A;  3T9Y A;  1XMB A;  3NE8 A;  4PV6 A;  1IID A;  4G1P A;  5THW A;  1JWQ A;  1YW6 A;  1LAM A;  2PQ8 A;  3NH8 A;  2HQY A;  1BPN A;  4FBE A;  3KGQ A;  1KUV A;  3FB3 A;  1ZO0 A;  4JYW A;  3R1K A;  3B3T A;  5F09 A;  4OC4 A;  3GY9 A;  1ON0 A;  1NSL A;  4HKF A;  4BD9 A;  1Y9W A;  3IIB A;  2O4H A;  4MFQ A;  5JPH A;  5H84 A;  2VEZ A;  2ZEN A;  4MXU A;  5G20 A;  1B6B A;  1RTQ A;  5F49 A;  2G0B A;  2B4B A;  3SJF A;  3I3G A;  1YQE A;  4PQA A;  3TO6 A;  2V77 A;  1HEE A;  4IUS A;  4MRI A;  1U6M A;  4PK2 A;  2F8H A;  4LUA A;  4YU9 A;  4A94 A;  1XMT A;  1F2O A;  1LFW A;  2CF4 A;  2DF5 A;  4C7I A;  2ZEH A;  4CGL A;  4F0Y A;  5J8F A;  3B35 A;  3JRU A;  2YGW A;  4MJ8 A;  4AVB A;  1XBU A;  3EFA A;  2Q7B A;  2PC1 A;  4B11 A;  2WYR A;  4EVY A;  1X10 A;  4U5Y A;  4C2X A;  2XEJ A;  1BAV A;  3D7D A;  3PB8 X;  2OB0 A;  3SXO A;  3NA6 A;  1RO5 A;  1XE4 A;  3H8G A;  2PCU A;  1Z8W A;  2EVN A;  2JBK A;  1BO4 A;  3N5F A;  3S9N A;  1VKC A;  2FIA A;  4KVM E;  2REF A;  2OZG A;  2PVV A;  2WZN A;  2QEC A;  3D7G A;  4XPK A;  4ZBG A;  1B87 A;  4MFZ A;  4PSW A;  3VAR A;  4BIN A;  3IU1 A;  2OZU A;  3WAB A;  1P4N A;  2ZED A;  5KTA A;  1IOI A;  2VZZ A;  4M3S A;  3RZA A;  3TOB A;  3B3S A;  3FYN A;  1AUG A;  5HXD A;  2PJ8 A;  1LAP A;  1ZG9 A;  3DNS A;  1MJA A;  1YRE A;  3PEI A;  4NGR A;  3S6F A;  3D68 A;  4P4J A;  4NJR A;  5DWN A;  1L0C A;  4DYO A;  1WWZ A;  2CXA A;  4CGP A;  2ZEE A;  2GRE A;  1EE3 P;  4XPD C;  1RXT A;  2O53 A;  4R6T A;  1YME A;  4UWJ A;  3WT4 A;  3FEC A;  1NE9 A;  3BHX A;  4JZ0 A;  4XNH B;  4CAX A;  2ZOG A;  4P4F A;  4C7H A;  2AFX A;  3EO4 A;  4P44 A;  3T8W A;  5CBM A;  4P4I A;  4A38 A;  5J8C A;  3HUV A;  1Q2Y A;  1CP7 A;  1Q7L A;  4MFK A;  4EWT A;  1VHO A;  1YGH A;  3IGR A;  2BSW A;  1XEB A;  4NCZ A;  1YVO A;  5H86 A;  4EME A;  5LRJ A;  4QUS A;  3CPA A;  4UIA A;  3TTH A;  5LYF A;  1Z8L A;  3VAT A;  1DE4 C;  1VHE A;  4CAW A;  4ZY0 A;  1F2P A;  3L2N A;  3FMC A;  1I12 A;  1ZLH A;  3FIX A;  4OC1 A;  3LOD A;  1Y9K A;  1ZG7 A;  4MCS A;  2FVG A;  5G1Z A;  4B5P A;  4MFJ A;  4UFV A;  3GIU A;  2AFO A;  1FY7 A;  2A4N A;  2GFQ A;  3B3C A;  2PJ7 A;  1JQG A;  2F7V A;  4P45 A;  5AG5 A;  2Q4Z A;  4MBU A;  4PXD A;  1CPX A;  1IYK A;  2POK A;  3NFZ A;  4P6Y A;  2D4P A;  3E0K A;  4CAE A;  2RB7 A;  1CJW A;  4KOR A;  4R9M A;  4UF4 A;  3RBU A;  3LWU A;  5HVH A;  1IOF A;  4X5K A;  2PJ3 A;  2ZEM A;  1XIX A;  2FXF A;  1I1D A;  3HLP A;  4NF1 A;  4XNH C;  4PK3 A;  4O23 A;  2Q4V A;  2QIR A;  4R8F A;  4MCP A;  4F6A A;  3I9S A;  4AVC A;  1QSN A;  3RAM A;  4IK2 A;  4WWV A;  2KCW A;  3FRM A;  2ZXV A;  2WSA A;  3CXQ A;  3D2M A;  3DR8 A;  4HPS A;  5LYL A;  3S9L A;  4II9 A;  2V8D A;  3W91 A;  2QVP A;  3K9U A;  1V0C A;  4UWI A;  2PJC A;  5JGF A;  1WK4 A;  2BCO A;  2PDO A;  2Z3M A;  3GUX A;  2DEA A;  2I79 A;  3IWG A;  2QML A;  5LRG A;  3TCV A;  4ZY1 A;  2JEV A;  5D8N A;  4A37 A;  3GB0 A;  3PFE A;  3QAH A;  1KUX A;  4CAV A;  2C6P A;  2R7H A;  1K4J A;  4ORF A;  3TOA A;  4M6H A;  5E96 A;  1Q2D A;  4L8A A;  3D7F A;  4LQG A;  4E8O A;  4B12 A;  1QSR A;  4KSA A;  3BI0 A;  1A2Z A;  2YNC A;  1UWY A;  1OBR A;  2ATR A;  3TC8 A;  3FBU A;  1FT7 A;  2EK9 A;  2B5G B;  1ARM A;  5GCN A;  3R9G A;  1ZG8 A;  4DJL A;  5I4M A;  2PJB A;  4M85 A;  3RO0 A;  1BOB A;  3CDX A;  4JD6 A;  2PR8 A;  4ZGY B;  1ELM P;  2FS5 A;  4B13 A;  4C2Z A;  5C88 A;  4YWY A;  2G3T A;  4AXV A;  3TFY A;  2Q44 A;  2PRB A;  4B10 A;  1AYE A;  5IB9 A;  2IMO A;  4KOT A;  2QYV A;  4Q7A A;  4DNC A;  3DR6 A;  5G22 A;  3FJU A;  4MHN A;  4X8I A;  4J3G A;  2ZPA A;  2J8M A;  1Z4E A;  4UEE A;  2NMT A;  4FD7 A;  1R43 A;  4NGT A;  5ISV A;  2FSR A;  3SXN A;  4KOX A;  1GYT A;  4M6I A;  3DSB A;  1MJ9 A;  5G21 A;  1KWM A;  3QB8 A;  1AMP A;  4XPD B;  2GLJ A;  4KVO E;  2ZEO A;  2PR1 A;  4MI4 A;  4QVT A;  2ZW5 A;  3IWW A;  2ZEF A;  1Y7R A;  4L89 A;  5EBV A;  1BLL E;  5JQ4 A;  3PRT A;  4KLV A;  2C6C A;  4X3R A;  1PU9 A;  4K30 A;  1F57 A;  1Z5R A;  5CPA A;  4EFD A;  5HVF A;  3KQZ A;  1N71 A;  3SJG A;  2CNS A;  1QSO A;  2GE3 A;  3D8P A;  3KR4 A;  4ZX8 A;  1S7N A;  1Y7E A;  3KAS A;  1PCA A;  2R8V A;  5AG6 A;  3IU2 A;  2CTC A;  4U9Z A;  4FAI A;  1TIQ A;  2D4O A;  4MCQ A;  2J8R A;  2JEW A;  1I21 A;  3JTK A;  4RUH A;  4Y49 B;  2EK8 A;  4YRH A;  2Z3L A;  3BJ7 A;  3EC4 A;  1QQ9 A;  5HMN A;  4AVA A;  2JBJ A;  3C26 A;  4KOU A;  5AG7 A;  3MGD A;  4A39 A;  3G8W A;  2FT0 A;  1YX0 A;  2P6G A;  4C68 A;  3TE4 A;  5AG4 A;  5AGE A;  3PB4 X;  4W9Y A;  2FL4 A;  2AFU A;  3OWC A;  4HNX B;  4AB7 A;  3V7Z A;  2ZEL A;  3SI1 A;  4CS0 B;  4KZT A;  3G3S A;  4R87 A;  4B5O A;  4OID A;  4B5P B;  5IB0 A;  4HNY B;  4OC5 A;  4R3L A;  3H4Q A;  3R9E A;  5JM6 A;  1R57 A;  4P4B A;  4IHM A;  1PUA A;  2ZW4 A;  4ONU A;  3KI9 A;  4MHD A;  5C82 A;  2P6F A;  2CY2 A;  1CPS A;  4OAD A;  2HUZ A;  1S3Z A;  2PIZ A;  2ZW6 A;  4QB9 A;  2GLF A;  4FD6 A;  3P2H A;  4GS4 A;  2B4D B;  4TWE A;  3W6S A;  1Z2L A;  2VXK A;  4GM5 A;  2P6E A;  5KTC A;  2BUE A;  4CAF A;  4CYQ A;  2Y0M A;  4JXQ A;  2JLM A;  2PJ0 A;  1M1D A;  1PYT B;  1XRY A;  2G9D A;  3FX6 A;  3QNV A;  2AJ6 A;  4NXY A;  4Y49 C;  4LQ6 A;  3R9F A;  5ELY A;  2OU2 A;  4OC0 A;  3DLJ A;  5LYD A;  4FUU A;  2WPX A;  4ZY2 A;  2R98 A;  3EXN A;  4FWU A;  3FEE A;  2V8V A;  1M4L A;  4KOS A;  1LOK A;  4PXB A;  2IL4 A;  2PIY A;  4CGM A;  3IO1 A;  2C1C A;  4P4D A;  4U9Y A;  1LAN A;  1M4D A;  4WJB A;  3D2P A;  4CYP A;  2NSM A;  2B3V A;  4ZYQ A;  4RN7 A;  1R3N A;  4NJQ A;  2CTB A;  4MHY A;  1S60 A;  3KL9 A;  4IAV A;  1X12 A;  1XFO A;  1ARL A;  2HC9 A;  3WC6 A;  2Q04 A;  3D7H A;  4CYO A;  1BPM A;  1NMT A;  2HV2 A;  4OC2 A;  2Q0Y A;  5IV0 A;  4P10 A;  1MJB A;  2PJ5 A;  3MN8 A;  1LCP A;  2PJ2 A;  3FED A;  3BLN A;  2OZH A;  3B7I A;  3IWE A;  2P0W A;  4UEF A;  1QSM A;  1KZF A;  2RFH A;  4DUK A;  1YLE A;  4NGN A;  3CPX A;  4ONW A;  4UCN A;  1NSA A;  2Q4Y A;  3B8G A;  4R76 A;  2EO8 A;  1LRZ A;  2REE A;  2BL1 A;  4RS2 A;  3WC5 A;  2V8H A;  2B3U A;  1TKH A;  3N7Z A;  3PB9 X;  4PXE A;  4A32 A;  4CGO A;  4M6G A;  3H5Z A;  2OOT A;  4OP4 A;  2ABZ A;  2O28 A;  3JVN A;  4NEX A;  4BMH A;  4KSF A;  4MHZ A;  2JDD A;  4MHP A;  1OZP A;  2PRQ A;  4KOY A;  3CZX A;  5D29 A;  3W6X A;  3CT9 A;  4I49 A;  3FH4 A;  4JWP A;  4OME A;  7CPA A;  1TKF A;  4FD5 A;  4UCM A;  2DPT A;  2I00 A;  3D4U A;  3GKR A;  4NGM A;  1M4G A;  5K8O A;  3H8E A;  4KUA A;  2DXQ A;  1GHE A;  3V38 A;  3F8K A;  1IU8 A;  2X7B A;  6CPA A;  2C27 A;  3IC1 A;  2Z3O A;  3GLJ A;  3R95 A;  4BBH A;  2XEF A;  5FVJ A;  2GU2 A;  4ZX9 A;  5BWA B;  1CP6 A;  4MY0 A;  4UIB A;  3SI0 A;  4NGP A;  3SHP A;  3PP9 A;  4OLL A;  3CXS A;  4MCR A;  4KUB A;  1Y0R A;  4P4E A;  3V8I A;  4H2K A;  2J9A A;  1VIX A;  4F9U A;  1S7F A;  2HB6 A;  4KS9 A;  4XPL A;  4R57 A;  5F47 A;  2I3C A;  3ISX A;  3PBB A;  3K9T A;  2WPW A;  1IGB A;  3B3W A;  3RYO A;  4CRZ B;  5HVG A;  4UBR A;  2B5G A;  2ZEP A;  3MRU A;  3WC7 A;  3ZJ0 A;  3SI2 A;  1VGY A;  1YW4 A;  4UEZ A;  4MMO A;  1Z8T A;  1S7K A;  4UA3 A; 
#chains in the Genus database with same CATH homology
 1YK3 A;  2GIV A;  3EY5 A;  2DPS A;  5F48 A;  1MK4 A;  1KUY A;  4H89 A;  1YVK A;  3FNC A;  4UCP A;  5DWM A;  2G3A A;  3ZZI A;  3TO7 A;  5I0C A;  1XF8 A;  4JJX A;  4A95 A;  3PZJ A;  5IX3 A;  2VQY A;  2H5M A;  2VZY A;  3FXT A;  3TT2 A;  4AG7 A;  5A27 A;  3CXP A;  3PGP A;  4B14 A;  3S6G A;  4JLY A;  1IIC A;  4UFX A;  4H6Z A;  2FCK A;  2Z3K A;  4KLW A;  3T90 A;  4CRY B;  2R1I A;  3UY5 A;  2FE7 A;  5KTD A;  2Z3P A;  3F0A A;  4C2Y A;  5F46 A;  3BJ8 A;  1IYL A;  1Q2C A;  2CNT A;  4JXR A;  2B58 A;  3D3S A;  4KOW A;  4PSX A;  3F5B A;  2ARH A;  3NE7 A;  4Q36 A;  4CGN A;  4HNW B;  4AG9 A;  2VBQ A;  2K5T A;  2VI7 A;  3A9L A;  4CYN A;  1YR0 A;  1M44 A;  3VWE A;  1S5K A;  4QC6 A;  4OAE A;  2CNM A;  2F5I A;  1Z9U A;  2Z3N A;  4F0X A;  5CNP A;  3TO9 A;  3WR7 A;  3DDD A;  2AE6 A;  4MFL A;  1SQH A;  4IF5 A;  3KKW A;  4FD4 A;  4A33 A;  1UFH A;  1VHS A;  4QBJ A;  3LD2 A;  2FIW A;  1Z4R A;  3GYA A;  4RI1 A;  4KVX A;  4E2A A;  2ZW7 A;  2B4D A;  1M4I A;  4UFW A;  2J8N A;  3P2F A;  3JUW A;  2GAN A;  3R96 A;  4MFP A;  4MY3 A;  1S7L A;  2EUI A;  5EC4 A;  4H6U A;  4Q38 A;  2Z11 A;  1CM0 A;  3S6H A;  3VWD A;  2WUU A;  2YND A;  2Z10 A;  2BEI A;  4LX9 A;  4NSQ A;  4A31 A;  4A30 A;  2OH1 A;  4A2Z A;  1QST A;  1J4J A;  4YGO A;  2PSW A;  2JDC A;  5A28 A;  2YNC C;  4KOV A;  5HH1 A;  3S6K A;  2YNE A;  4R3K A;  4E0A A;  2RC4 A;  1IB1 E;  1P0H A;  4YFJ A;  2Z0Z A;  3T9Y A;  4PV6 A;  1IID A;  2PQ8 A;  2HQY A;  1KUV A;  3FB3 A;  1ZO0 A;  3R1K A;  3GY9 A;  1ON0 A;  1NSL A;  4HKF A;  1Y9W A;  4MFQ A;  5JPH A;  5H84 A;  2VEZ A;  5G20 A;  1B6B A;  5F49 A;  2G0B A;  2B4B A;  3I3G A;  3TO6 A;  4IUS A;  1U6M A;  4PK2 A;  4LUA A;  4CGL A;  1XMT A;  4C7I A;  5J8F A;  4F0Y A;  2YGW A;  4MJ8 A;  4AVB A;  3EFA A;  2Q7B A;  2PC1 A;  4B11 A;  4EVY A;  4U5Y A;  4C2X A;  3SXO A;  2OB0 A;  1RO5 A;  1XE4 A;  2EVN A;  1BO4 A;  1VKC A;  2FIA A;  4KVM E;  2REF A;  2OZG A;  4ZBG A;  4XPK A;  2QEC A;  4C2Z A;  1B87 A;  4MFZ A;  4PSW A;  3IU1 A;  2OZU A;  1P4N A;  5KTA A;  2VZZ A;  4M3S A;  3TOB A;  3FYN A;  3DNS A;  1MJA A;  1YRE A;  3S6F A;  5DWN A;  1L0C A;  1WWZ A;  2CXA A;  4CGP A;  4XPD C;  1RXT A;  4UWJ A;  1NE9 A;  4XNH B;  4CAX A;  4C7H A;  3EO4 A;  5J8C A;  1Q2Y A;  4MFK A;  1YGH A;  3IGR A;  2BSW A;  1XEB A;  4NCZ A;  1YVO A;  5H86 A;  4QUS A;  3TTH A;  4CAW A;  1I12 A;  3FIX A;  3LOD A;  1Y9K A;  4B5P A;  5G1Z A;  4MFJ A;  4UFV A;  1FY7 A;  2A4N A;  5AG5 A;  4MBU A;  1IYK A;  2D4P A;  3E0K A;  4CAE A;  1CJW A;  4KOR A;  4R9M A;  4X5K A;  1XIX A;  2FXF A;  1I1D A;  4NF1 A;  4XNH C;  4PK3 A;  4F6A A;  2Q4V A;  2QIR A;  3I9S A;  4AVC A;  1QSN A;  2KCW A;  3FRM A;  2ZXV A;  2WSA A;  3CXQ A;  3D2M A;  3DR8 A;  4II9 A;  3W91 A;  3K9U A;  1V0C A;  4UWI A;  1WK4 A;  2PDO A;  2Z3M A;  2I79 A;  3IWG A;  2QML A;  3TCV A;  2JEV A;  3QAH A;  1KUX A;  4CAV A;  2R7H A;  1K4J A;  4ORF A;  3TOA A;  5E96 A;  1Q2D A;  4L8A A;  4E8O A;  4B12 A;  1QSR A;  4KSA A;  2YNC A;  2ATR A;  3FBU A;  2B5G B;  3R9G A;  5GCN A;  4M85 A;  1BOB A;  4JD6 A;  2PR8 A;  4ZGY B;  2FS5 A;  4B13 A;  5C88 A;  2G3T A;  3TFY A;  2Q44 A;  2PRB A;  4B10 A;  4KOT A;  4DNC A;  3DR6 A;  5G22 A;  4J3G A;  2ZPA A;  2J8M A;  1Z4E A;  2NMT A;  4FD7 A;  5ISV A;  2FSR A;  3SXN A;  4KOX A;  3DSB A;  1MJ9 A;  5G21 A;  3QB8 A;  4XPD B;  4KVO E;  2PR1 A;  4MI4 A;  4QVT A;  2ZW5 A;  1Y7R A;  4L89 A;  5EBV A;  5JQ4 A;  4KLV A;  1PU9 A;  4K30 A;  1N71 A;  2CNS A;  1QSO A;  2GE3 A;  3D8P A;  1S7N A;  2R8V A;  5AG6 A;  3IU2 A;  4U9Z A;  1TIQ A;  2D4O A;  2J8R A;  1I21 A;  3JTK A;  4Y49 B;  4YRH A;  2Z3L A;  3BJ7 A;  3EC4 A;  5HMN A;  4AVA A;  3C26 A;  4KOU A;  5AG7 A;  3MGD A;  3TE4 A;  3G8W A;  2FT0 A;  1YX0 A;  2P6G A;  4C68 A;  5AG4 A;  5AGE A;  2FL4 A;  3OWC A;  4HNX B;  4AB7 A;  4CS0 B;  4KZT A;  3G3S A;  4R87 A;  4B5O A;  4B5P B;  5IB0 A;  4HNY B;  4R3L A;  3H4Q A;  3R9E A;  1R57 A;  1PUA A;  2ZW4 A;  4ONU A;  4MHD A;  5C82 A;  2P6F A;  2CY2 A;  4OAD A;  2HUZ A;  1S3Z A;  2ZW6 A;  4QB9 A;  4FD6 A;  4GS4 A;  3P2H A;  2B4D B;  3W6S A;  2VXK A;  2P6E A;  5KTC A;  2BUE A;  4CAF A;  4CYQ A;  2Y0M A;  4JXQ A;  2JLM A;  1M1D A;  3R9F A;  4NXY A;  4Y49 C;  2AJ6 A;  2OU2 A;  2WPX A;  2R98 A;  3EXN A;  4KOS A;  2IL4 A;  4CGM A;  4U9Y A;  1M4D A;  3D2P A;  4CYP A;  2B3V A;  1S60 A;  2Q04 A;  4CYO A;  1NMT A;  2HV2 A;  2Q0Y A;  5IV0 A;  1MJB A;  3BLN A;  2OZH A;  3IWE A;  2P0W A;  1QSM A;  1KZF A;  1YLE A;  4UCN A;  2Q4Y A;  3B8G A;  1LRZ A;  2REE A;  2BL1 A;  4RS2 A;  3N7Z A;  2B3U A;  4CGO A;  4A32 A;  3H5Z A;  2O28 A;  3JVN A;  4NEX A;  4BMH A;  4KSF A;  2JDD A;  1OZP A;  4KOY A;  3W6X A;  4I49 A;  4JWP A;  4FD5 A;  4UCM A;  2DPT A;  2I00 A;  3GKR A;  1M4G A;  4KUA A;  2DXQ A;  1GHE A;  3F8K A;  2X7B A;  2C27 A;  2Z3O A;  3R95 A;  4BBH A;  5FVJ A;  5BWA B;  4MY0 A;  3SHP A;  3PP9 A;  4OLL A;  3CXS A;  4KUB A;  3V8I A;  1S7F A;  4KS9 A;  4XPL A;  4R57 A;  5F47 A;  2WPW A;  3RYO A;  4CRZ B;  4UBR A;  2B5G A;  3ZJ0 A;  1S7K A;  4UA3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...