4CYPA

Leishmania major n-myristoyltransferase in complex with a pyrrolidine inhibitor.
Total Genus 123
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
123
sequence length
411
structure length
411
Chain Sequence
AHAFWSTQPVPQTEDETEKIVFAGPMDEPKTVADIPEEPYPIASTFEWWTPNMEAADDIHAIYELLRDNYVEDDDSMFRFNYSEEFLQWALCPPNYIPDWHVAVRRKADKKLLAFIAGVPVTLRMGTPKYMKVKAQEKGEGEEAAKYDEPRHICEINFLCVHKQLREKRLAPILIKEATRRVNRTNVWQAVYTAGVLLPTPYASGQYFHRSLNPEKLVEIRFSGIPAQYQKFQNPMAMLKRNYQLPSAPKNSGLREMKPSDVPQVRRILMNYLDSFDVGPVFSDAEISHYLLPRDGVVFTYVVENDKKVTDFFSFYRIPSTVIGNSNYNLLNAAYVHYYAATSIPLHQLILDLLIVAHSRGFDVCNMVEILDNRSFVEQLKFGAGDGHLRYYFYNWAYPKIKPSQVALVML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLYCYLPEPTIDE N-TETRADECANOYLTRANSFERASE
publication title Structure-Based Design of Potent and Selective Leishmania N- Myristoyltransferase Inhibitors.
pubmed doi rcsb
source organism Leishmania major
molecule tags Transferase
total genus 123
structure length 411
sequence length 411
ec nomenclature ec 2.3.1.97: Glycylpeptide N-tetradecanoyltransferase.
pdb deposition date 2014-04-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01233 NMT Myristoyl-CoA:protein N-myristoyltransferase, N-terminal domain
A PF02799 NMT_C Myristoyl-CoA:protein N-myristoyltransferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.170 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4cypA00
4UFWA 5G1ZA 2YNCA 4UFVA 4UCNA 5AGEA 2WSAA 5AG4A 5AG6A 5G21A 5AG7A 2YNCC 4CGPA 4CYQA 4B14A 4BBHA 3IU2A 4CGNA 4B13A 4B12A 4UFXA 5G22A 4CYOA 5AG5A 4C2XA 4A32A 4CAEA 5A28A 3IU1A 4B10A 4CAFA 4A2ZA 2WUUA 4C2YA 2YNDA 4CYNA 4CYPA 3H5ZA 4C2ZA 4CGLA 4B11A 4CGMA 4UCMA 4CGOA 4A30A 4A33A 5G20A 4C7IA 2YNEA 4C68A 3IWEA 4C7HA 5A27A 4UCPA 3JTKA 4A95A 4A31A
chains in the Genus database with same CATH superfamily
2Q4ZA 2B3VA 5HXDA 3S6GA 1YK3A 4JLYA 3CXSA 4MJ8A 4UA3A 3JRUA 2JDCA 3NE7A 1U6MA 2QMLA 4ORFA 3BJ8A 1IICA 1IYLA 1ZG7A 4CAFA 3RNZA 1WK4A 4CAVA 3B35A 5EC4A 3B3CA 3PP9A 3R9GA 2ZEDA 1I12A 3GUXA 4CGLA 3S6HA 3KQXA 4MBUA 2DXQA 4A94A 4CGMA 1S7LA 4PV6A 3D2MA 2EWBA 1CPSA 1MJBA 3S9MA 2B3UA 1L0CA 4JWPA 4E0AA 1YVOA 2ZEHA 2FIWA 2JLMA 4JYWA 4A95A 2KCWA 2GLJA 4M6HA 3DR8A 4BD9A 1YX0A 4UCNA 3IFEA 2IQ6A 4BMHA 4M6IA 3PB9X 4OC1A 4Y49B 5G21A 3NH5A 2BL1A 2XEJA 2PR8A 2J8NA 2YNCC 4CYQA 1YREA 1Z8WA 4II9A 2ANPA 2DPTA 4B5OA 3ZZIA 2CNTA 5DWMA 2B4DB 4FD4A 2AJ6A 3EFAA 3SHPA 2JEWA 2AFUA 4MY3A 4R7MA 5KTDA 5ELYA 2BUEA 1IOIA 1ARLA 4CRYB 1RO5A 4A39A 2Z11A 4P4EA 3WR7A 2ZENA 4UCMA 5I0CA 4AG9A 4P6YA 1Y0YA 1OBRA 3JTKA 5A28A 3NE8A 3B3SA 3D67A 2OR4A 3LWUA 4H6ZA 2AFWA 4M3SA 2EBJA 3D3SA 2Q4VA 4XPKA 3CZXA 3KL9A 4XNHB 3SXNA 1BOBA 4HNYB 5BWAB 4H89A 3K2KA 5G22A 1ELMP 3SI0A 3N7ZA 4GS4A 1LAPA 4MRIA 3MGDA 1XEBA 2POKA 2Q04A 1YLOA 3TOAA 3DLJA 5GCNA 1PUAA 4LQGA 3F5BA 4NGRA 2AFMA 4A37A 1XF8A 2Z10A 3D7FA 3S9NA 2ZW4A 4F6AA 5K8NA 3KHXA 3JVNA 4C7HA 3V7ZA 2ODFA 1CP7A 4OKOA 3PB4X 1UWYA 2EK9A 3SI1A 2FCKA 5AG6A 5LYDA 1DTDA 2B4DA 3RO0A 2Z3NA 1M1DA 4P10A 3FBUA 4BINA 4P4JA 5JQ4A 2Q43A 2R7HA 4B12A 1Y9WA 4EVYA 4PK3A 5CBMA 1YLEA 1WWZA 2I00A 8CPAA 1Z4RA 1S5KA 1Y0RA 2JBJA 3CDXA 3BI1A 4NCZA 4UEEA 5LRJA 3H8GA 4PXBA 3H5ZA 3IEHA 5F49A 2QECA 2ZXVA 1KUVA 3IGRA 1BPMA 3PRTA 3TO7A 3QAYA 2OB0A 2Z3MA 2EVNA 1A2ZA 5IB9A 3N5FA 2VQYA 4NJRA 4R9MA 1S7FA 3PEIA 3NFZA 1YMEA 1Z9UA 3H4QA 4R6TA 4EFDA 3DNSA 1VKCA 4MI4A 2PCUA 3A9LA 1J4JA 2Q4YA 1ON0A 4YFJA 2CF4A 4AVCA 3KR4A 3CXPA 2OZUA 3CXQA 4IUSA 1ARMA 4XPDB 4IAVA 3SXOA 5LYIA 3FX6A 4ONWA 1TKFA 1Y7RA 1Z4EA 2PJ5A 1XRYA 4X2TA 3D7GA 2GIVA 2XEIA 3FEEA 1Z5RA 3TX8A 1AYEA 2O53A 1BPNA 4R76A 4E8OA 1X10A 1VHSA 2NYQA 3QNVA 3KR5A 2HQYA 1XMTA 5ISVA 4FUUA 1TKJA 3VATA 2EO8A 2REFA 3WC5A 2Q0YA 4R3LA 4MFQA 4A33A 4AVBA 3WC7A 5JPHA 3EO4A 4NF1A 4OC0A 3VWEA 3QAHA 2AFOA 4UFWA 2F8HA 4K30A 1P0HA 1HDUA 1SQHA 3SJEA 1IY7A 3C26A 3VH9A 2PJ2A 5DWNA 1FNOA 3PFOA 3GLJA 2G3AA 3V38A 3D7HA 3ISZA 4P44A 4B14A 2PJCA 5F46A 2JDDA 1DE4C 1K4JA 4MHZA 4XPDC 3K9TA 4CYOA 1NE9A 1KUXA 1XOVA 3W6SA 1S60A 2J8MA 5LRKA 3B3TA 4B5PB 5EBVA 2IJZA 1PYTB 3FRMA 3FVLA 4CYNA 3FXTA 4TWEA 4CS0B 1AUGA 3DGVA 4OC5A 3SI2A 2FXFA 3EY5A 3PB6X 2JBKA 4H6UA 4IHMA 1M4LA 1F57A 2Z3PA 4C7IA 4F8ZA 3IWEA 4RUHA 3KZWA 2P6GA 2Y0MA 3FH4A 1IGBA 1XIXA 4F9UA 3KASA 2R98A 1VHEA 3KGQA 2V8HA 2PVVA 5E96A 3CPAA 3NA6A 5LYLA 2QJ8A 3DSBA 2RC4A 2AFZA 5FVJA 2ZEPA 1OZPA 2C6PA 4NGSA 1IU8A 4LQ6A 4XPLA 4OMEA 3GYAA 1Z2LA 3D7DA 3LODA 4CPAA 3E0KA 4PK2A 1CBXA 4MHYA 2WPWA 3PB8X 4KSAA 1EE3P 2ZOGA 2PRBA 3MN8A 3SJXA 3R96A 4KLWA 4WWVA 3GKRA 1YVKA 3LD2A 2FVGA 4OAEA 2A4NA 4NGPA 1IIDA 2VL1A 1QSMA 4B6ZA 4NXYA 1PU9A 2OU2A 4OC2A 1YSJA 4Z65A 1R57A 2BO9A 5G1ZA 1P4NA 1QMUA 2B5GB 2FSRA 2D4PA 3FNCA 4YWYA 2CTBA 2QYVA 3KHZA 4Y49C 2J9AA 3UY5A 1TF9A 1JQGA 2PDOA 4I49A 4B5PA 2XEFA 2P6FA 4IK2A 4AB7A 2FT0A 2VZYA 2G9DA 2PIYA 2V8GA 2ZW7A 3PBBA 3LMSA 4X3RA 1YQEA 4A32A 2RB7A 2OH1A 4ZY0A 4QBJA 4KS9A 2WYRA 1XBUA 4PSXA 4EMEA 3PBEA 2YNEA 3R1KA 4KOXA 3TTHA 4A38A 4NSQA 2AFXA 1LRZA 2PIZA 4UEFA 2DEAA 4KOSA 5THWA 2ZW6A 2NMTA 3I1UA 4UWIA 2VXKA 4XNHC 2PJ3A 2VI7A 2ATRA 5IB0A 4FBEA 2BCOA 3IU2A 1KWMA 4R8FA 1R43A 3H8FA 3RZAA 1R3NA 4HNXB 4NGTA 2BSWA 2DF5A 3CPXA 4AXVA 4CAEA 1XMBA 3BHXA 4P45A 2YNDA 2Q51A 5K8OA 1VHOA 5D29A 4DJLA 3PB7X 5F09A 1I1DA 2ZEGA 2CXAA 4L89A 4MCQA 4P4IA 1TXRA 1XJOA 2B5GA 1ZO0A 4AG7A 3IC1A 4R3KA 4U9ZA 3PZJA 2IL4A 1TIQA 3JUWA 3S6KA 5J8CA 4UIAA 4KZTA 2PJBA 4A31A 2CNSA 4F9VA 2CIJA 4UFVA 5IX3A 2ZEFA 2G0BA 4JD6A 3RYOA 4KOTA 1N71A 3R9EA 3VARA 2HUZA 4CGPA 3NH8A 2IMOA 4CGNA 2QIRA 4KUAA 1Z8XA 2CY2A 3SJFA 4P4FA 4C2XA 2VEZA 3FMCA 4HNWB 4EWTA 1TF8A 2NSMA 3S6FA 1Y7EA 3EXNA 3LACA 3K9UA 4KUBA 4ZX8A 3SJGA 4DUKA 4KOYA 3IWGA 2GE3A 2GU2A 1RXTA 4CGOA 3WABA 5G20A 1B87A 1Q2CA 2PR1A 2V8DA 1MK4A 4UEZA 2EK8A 2Z3OA 4GXHA 5JH9A 3B3VA 1KUYA 1YW6A 1NMTA 3W91A 4ZGYB 4X8IA 4Q38A 2VZZA 4OC4A 4U5YA 3I3GA 1F2OA 4Q7AA 2XEGA 3W6XA 1I21A 1ZG9A 2ARHA 5C82A 4MY0A 4BBHA 2F7VA 2Q7SA 4B13A 4UFXA 1LAMA 3NH4A 3IU1A 4M85A 4MFPA 2DPSA 4NGMA 4PXDA 4PPZA 4YRHA 3BI0A 2V8VA 1TKHA 3MRUA 4C2ZA 1FT7A 4DNCA 2YGWA 3B8GA 5IV0A 3FYNA 4RS2A 4B11A 4ZY1A 1M4IA 3D68A 4FD7A 3H8EA 2B4BA 4A30A 4MFZA 5HVFA 2ZPAA 5F47A 4UCPA 2PC1A 2GLFA 2PJ9A 3IIBA 3RAMA 3WT4A 2FIAA 1BAVA 1CG2A 4KVXA 4OLLA 2Z3KA 5J8FA 1Z8TA 1BLLE 2HB6A 4ONUA 4MFKA 3D2PA 4KSIA 1LANA 1IOFA 3B3WA 4OADA 2CTCA 2QVPA 4K3NA 4KOWA 4OP4A 2FS5A 2V77A 4OIDA 4P4DA 1M4GA 2Q44A 2Z3LA 5AG5A 4UF4A 4NGQA 3KKWA 5H84A 2AE6A 3PGPA 2WUUA 4A2ZA 4MHDA 2B58A 3B2YA 5C88A 3RBUA 4KSFA 4KORA 2PJ8A 2R8VA 1RTQA 3FF3A 4MMOA 5CPAA 5KTCA 5K8PA 1Q2DA 2ABZA 2K5TA 1XE4A 2ZW5A 2BOAA 2REEA 4UIBA 4MHNA 2C6CA 1M4DA 4U9YA 1FY7A 2ZEEA 4C68A 4WJBA 1NSAA 4AVAA 4MCRA 1YGHA 4J3GA 5K8MA 2WSAA 4QUSA 3HLPA 5JGFA 2Q7BA 3PFEA 1IB1E 1QSTA 5HVGA 1ELLP 4KOUA 4JZ0A 4NGNA 3T90A 2PQ8A 3IO1A 3KI9A 4P4BA 4GM5A 5H86A 3R95A 3KQZA 2FL4A 4G1PA 2HC9A 2O28A 1ZLIA 2AFSA 4OIWA 4B10A 4FAIA 7CPAA 3TOBA 2PJ1A 4KOVA 3D66A 4KVME 5I4MA 1KZFA 2PJ7A 4KLVA 4YU9A 4Q36A 1HEEA 3I9SA 4X5KA 5LYFA 1LOKA 1QSNA 3TFYA 1S7KA 3WC6A 3TO9A 2WPXA 4ZY2A 4CAWA 1Y9KA 4MFJA 5HMNA 2JEVA 2WZNA 4HKFA 1QQ9A 3OWCA 2PRQA 3ZJ0A 1H8LA 1YW4A 2D4OA 1S7NA 2YNCA 3FJUA 5AG4A 3DR6A 3G8WA 2C1CA 4L8AA 3BJ7A 1MJ9A 1X12A 4E2AA 2FE7A 4LX9A 3D4UA 3S9LA 3EC4A 1CP6A 4MXUA 4HPSA 1M44A 4MHPA 4PXCA 2PJ0A 2I79A 4DYOA 1QSRA 2O4HA 2PVWA 2Z0ZA 4R87A 3DDDA 3VWDA 1S3ZA 4ZYQA 2PJ4A 3T9YA 4C2YA 4W9YA 3TC8A 3GIUA 3P2FA 1ZG8A 1LFWA 2F5IA 4JXQA 1NSLA 4F0YA 2PJ6A 5J1QA 2OZHA 3L2NA 1BO4A 4NEXA 4QB9A 2G3TA 5EMIA 1IYKA 1XFOA 5A27A 1Z8LA 2PSWA 3TE4A 2ZEOA 2P6EA 4R57A 1HDQA 4JXRA 2ZEMA 3ISXA 1V0CA 2HV2A 5AGEA 3IWWA 4M6GA 4CAXA 1CJWA 4FD6A 2R1IA 4QVTA 1YR0A 3GB0A 4CRZB 4QC6A 4O23A 4UBRA 1B6BA 4ZBGA 4IF5A 2PJAA 4NJQA 4ZI6A 3F0AA 3TT2A 2RFHA 1JWQA 2GFQA 2X7BA 3IJ3A 4KVOE 3FB3A 1QSOA 1MJAA 3R9FA 6CPAA 2GANA 4PSWA 4JJXA 2OOTA 4TNUA 5F48A 3TO6A 4PXEA 2C27A 2BEIA 1GYTA 5JM6A 4FD5A 1VIXA 5LRGA 4FWUA 4NFRA 3B7IA 4MFLA 2ZELA 4RI1A 4UWJA 3TCVA 1CM0A 3T8WA 5DS0A 1PCAA 1AMPA 1GHEA 4MCSA 4YGOA 2I3CA 2C6GA 3BXMA 1UFHA 4LUAA 5AG7A 2ZOFA 1VGYA 1F2PA 1LCPA 3P2HA 3F8KA 1Q2YA 4F0XA 2P0WA 3FECA 4RN7A 3HUVA 3CT9A 3QB8A 5D8NA 4OC3A 4ZX9A 3V8IA 5KTAA 2GREA 3BLNA 2EUIA 3G3SA 4CYPA 4MCPA 2CNMA 4PQAA 2H5MA 3GY9A 3FIXA 1CX8A 2OZGA 5HVHA 5HH1A 2J8RA 3FEDA 1CPXA 3D8PA 4H2KA 2PE3A 1Q7LA 5CNPA 1ZLHA 2VBQA
chains in the Genus database with same CATH topology
2B3VA 3S6GA 1YK3A 4JLYA 3CXSA 4MJ8A 4UA3A 2JDCA 3NE7A 1U6MA 2QMLA 4ORFA 3BJ8A 1IICA 1IYLA 4CAFA 1WK4A 4CAVA 5EC4A 3R9GA 3PP9A 1I12A 4CGLA 4MBUA 2DXQA 4CGMA 1S7LA 4PV6A 3D2MA 1MJBA 2B3UA 1L0CA 4JWPA 4E0AA 1YVOA 2FIWA 2JLMA 4A95A 2KCWA 3DR8A 1YX0A 4UCNA 4BMHA 4Y49B 5G21A 2BL1A 2YNCC 2PR8A 2J8NA 4CYQA 1YREA 4II9A 2DPTA 4B5OA 3ZZIA 2CNTA 5DWMA 2B4DB 4FD4A 2AJ6A 3EFAA 3SHPA 4MY3A 5KTDA 2BUEA 4CRYB 1RO5A 2Z11A 3WR7A 4UCMA 5I0CA 4AG9A 3JTKA 5A28A 4H6ZA 4M3SA 3D3SA 2Q4VA 4XPKA 4XNHB 3SXNA 5BWAB 1BOBA 4HNYB 4H89A 5G22A 3N7ZA 4GS4A 3MGDA 1XEBA 2Q04A 3TOAA 5GCNA 1PUAA 3F5BA 1XF8A 2Z10A 2ZW4A 4F6AA 3JVNA 4C7HA 2FCKA 5AG6A 2B4DA 2Z3NA 1M1DA 5JQ4A 3FBUA 4EVYA 2R7HA 4B12A 1Y9WA 4PK3A 1YLEA 1WWZA 2I00A 1Z4RA 1S5KA 4NCZA 3H5ZA 5F49A 2QECA 2ZXVA 1KUVA 3IGRA 3TO7A 2OB0A 2Z3MA 2EVNA 2VQYA 4R9MA 1S7FA 1Z9UA 3H4QA 3DNSA 1VKCA 4MI4A 3A9LA 1J4JA 2Q4YA 1ON0A 4YFJA 4AVCA 3CXPA 2OZUA 3CXQA 4IUSA 4XPDB 3SXOA 1Y7RA 1Z4EA 2GIVA 4E8OA 1VHSA 2HQYA 1XMTA 5ISVA 4A33A 2REFA 5JPHA 2Q0YA 4R3LA 4MFQA 4AVBA 3EO4A 4NF1A 3VWEA 3QAHA 4UFWA 4K30A 1P0HA 1SQHA 3C26A 5DWNA 2G3AA 5F46A 4B14A 2JDDA 1K4JA 4XPDC 4CYOA 1NE9A 1KUXA 3W6SA 1S60A 2J8MA 4B5PB 5EBVA 3FRMA 4CYNA 3FXTA 4CS0B 2FXFA 3EY5A 4H6UA 4C7IA 2Z3PA 3IWEA 2P6GA 2Y0MA 1XIXA 2R98A 5E96A 3DSBA 2RC4A 5FVJA 1OZPA 4XPLA 3GYAA 3LODA 3E0KA 4PK2A 2WPWA 4KSAA 2PRBA 3R96A 4KLWA 3GKRA 1YVKA 3LD2A 4OAEA 2A4NA 1IIDA 1QSMA 4NXYA 1PU9A 2OU2A 1R57A 5G1ZA 1P4NA 2B5GB 2FSRA 2D4PA 3FNCA 4Y49C 3UY5A 2PDOA 4B5PA 4I49A 2P6FA 4AB7A 2FT0A 2VZYA 2ZW7A 4A32A 2OH1A 4QBJA 4KS9A 4PSXA 2YNEA 3R1KA 4KOXA 3TTHA 4NSQA 1LRZA 4KOSA 2ZW6A 2NMTA 4UWIA 2VXKA 4XNHC 2VI7A 2ATRA 5IB0A 3IU2A 4HNXB 2BSWA 4CAEA 2YNDA 1I1DA 2CXAA 4L89A 2B5GA 1ZO0A 4AG7A 4R3KA 4U9ZA 3PZJA 2IL4A 1TIQA 3JUWA 3S6KA 5J8CA 4KZTA 4A31A 2CNSA 4UFVA 5IX3A 2G0BA 4JD6A 3RYOA 4KOTA 1N71A 3R9EA 2HUZA 4CGPA 4CGNA 2QIRA 4KUAA 2CY2A 4C2XA 2VEZA 4HNWB 3S6FA 3EXNA 3K9UA 4KUBA 4KOYA 3IWGA 2GE3A 1RXTA 4CGOA 5G20A 1B87A 1Q2CA 2PR1A 1MK4A 2Z3OA 1KUYA 1NMTA 3W91A 4ZGYB 4Q38A 2VZZA 4U5YA 3I3GA 3W6XA 1I21A 2ARHA 5C82A 4MY0A 4BBHA 4B13A 4UFXA 3IU1A 4M85A 4MFPA 2DPSA 4YRHA 4C2ZA 4DNCA 2YGWA 3B8GA 5IV0A 3FYNA 4RS2A 4B11A 1M4IA 4FD7A 4A30A 2B4BA 4MFZA 2ZPAA 5F47A 4UCPA 2PC1A 5J8FA 2FIAA 4KVXA 4OLLA 2Z3KA 4ONUA 4MFKA 3D2PA 4OADA 4KOWA 2FS5A 1M4GA 2Q44A 2Z3LA 5AG5A 3KKWA 5H84A 2AE6A 3PGPA 2WUUA 4A2ZA 4MHDA 2B58A 5C88A 4KSFA 4KORA 2R8VA 5KTCA 1Q2DA 2K5TA 1XE4A 2ZW5A 2REEA 1M4DA 4U9YA 1FY7A 4C68A 4AVAA 1YGHA 4J3GA 2WSAA 4QUSA 2Q7BA 1IB1E 1QSTA 4KOUA 3T90A 2PQ8A 5H86A 3R95A 2FL4A 2O28A 4B10A 3TOBA 4KOVA 4KVME 1KZFA 4KLVA 4Q36A 4X5KA 3I9SA 3TFYA 1QSNA 1S7KA 3TO9A 2WPXA 4CAWA 1Y9KA 4MFJA 5HMNA 2JEVA 4HKFA 3OWCA 3ZJ0A 2D4OA 2YNCA 1S7NA 5AG4A 3DR6A 3G8WA 4L8AA 3BJ7A 1MJ9A 4E2AA 2FE7A 4LX9A 3EC4A 1M44A 2I79A 1QSRA 2Z0ZA 3VWDA 4R87A 3DDDA 1S3ZA 3T9YA 4C2YA 3P2FA 2F5IA 4JXQA 1NSLA 4F0YA 2OZHA 1BO4A 4NEXA 4QB9A 2G3TA 1IYKA 5A27A 3TE4A 2PSWA 2P6EA 4R57A 4JXRA 1V0CA 2HV2A 5AGEA 4CAXA 1CJWA 4FD6A 2R1IA 4QVTA 1YR0A 4CRZB 4QC6A 4UBRA 1B6BA 4ZBGA 4IF5A 3F0AA 3TT2A 2X7BA 4KVOE 3FB3A 1QSOA 1MJAA 3R9FA 2GANA 4PSWA 4JJXA 3TO6A 5F48A 2C27A 2BEIA 4FD5A 4MFLA 4RI1A 4UWJA 3TCVA 1CM0A 1GHEA 4YGOA 1UFHA 4LUAA 5AG7A 3P2HA 4F0XA 3F8KA 1Q2YA 2P0WA 3QB8A 3V8IA 5KTAA 3G3SA 3BLNA 2EUIA 4CYPA 2CNMA 3GY9A 2H5MA 3FIXA 2OZGA 5HH1A 2J8RA 3D8PA 5CNPA 3S6HA 2VBQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4UFW A;  5G1Z A;  2YNC A;  4UFV A;  4UCN A;  5AGE A;  2WSA A;  5AG4 A;  5AG6 A;  5G21 A;  5AG7 A;  2YNC C;  4CGP A;  4CYQ A;  4B14 A;  4BBH A;  3IU2 A;  4CGN A;  4B13 A;  4B12 A;  4UFX A;  5G22 A;  4CYO A;  5AG5 A;  4C2X A;  4A32 A;  4CAE A;  5A28 A;  3IU1 A;  4B10 A;  4CAF A;  4A2Z A;  2WUU A;  4C2Y A;  2YND A;  4CYN A;  4CYP A;  3H5Z A;  4C2Z A;  4CGL A;  4B11 A;  4CGM A;  4UCM A;  4CGO A;  4A30 A;  4A33 A;  5G20 A;  4C7I A;  2YNE A;  4C68 A;  3IWE A;  4C7H A;  5A27 A;  4UCP A;  3JTK A;  4A95 A;  4A31 A; 
#chains in the Genus database with same CATH topology
 2Q4Z A;  2B3V A;  5HXD A;  3S6G A;  1YK3 A;  4JLY A;  3CXS A;  4MJ8 A;  4UA3 A;  3JRU A;  2JDC A;  3NE7 A;  1U6M A;  2QML A;  4ORF A;  3BJ8 A;  1IIC A;  1IYL A;  1ZG7 A;  4CAF A;  3RNZ A;  1WK4 A;  4CAV A;  3B35 A;  5EC4 A;  3B3C A;  3PP9 A;  3R9G A;  2ZED A;  1I12 A;  3GUX A;  4CGL A;  3S6H A;  3KQX A;  4MBU A;  2DXQ A;  4A94 A;  4CGM A;  1S7L A;  4PV6 A;  3D2M A;  2EWB A;  1CPS A;  1MJB A;  3S9M A;  2B3U A;  1L0C A;  4JWP A;  4E0A A;  1YVO A;  2ZEH A;  2FIW A;  2JLM A;  4JYW A;  4A95 A;  2KCW A;  2GLJ A;  4M6H A;  3DR8 A;  4BD9 A;  1YX0 A;  4UCN A;  3IFE A;  2IQ6 A;  4BMH A;  4M6I A;  3PB9 X;  4OC1 A;  4Y49 B;  5G21 A;  3NH5 A;  2BL1 A;  2XEJ A;  2PR8 A;  2J8N A;  2YNC C;  4CYQ A;  1YRE A;  1Z8W A;  4II9 A;  2ANP A;  2DPT A;  4B5O A;  3ZZI A;  2CNT A;  5DWM A;  2B4D B;  4FD4 A;  2AJ6 A;  3EFA A;  3SHP A;  2JEW A;  2AFU A;  4MY3 A;  4R7M A;  5KTD A;  5ELY A;  2BUE A;  1IOI A;  1ARL A;  4CRY B;  1RO5 A;  4A39 A;  2Z11 A;  4P4E A;  3WR7 A;  2ZEN A;  4UCM A;  5I0C A;  4AG9 A;  4P6Y A;  1Y0Y A;  1OBR A;  3JTK A;  5A28 A;  3NE8 A;  3B3S A;  3D67 A;  2OR4 A;  3LWU A;  4H6Z A;  2AFW A;  4M3S A;  2EBJ A;  3D3S A;  2Q4V A;  4XPK A;  3CZX A;  3KL9 A;  4XNH B;  3SXN A;  1BOB A;  4HNY B;  5BWA B;  4H89 A;  3K2K A;  5G22 A;  1ELM P;  3SI0 A;  3N7Z A;  4GS4 A;  1LAP A;  4MRI A;  3MGD A;  1XEB A;  2POK A;  2Q04 A;  1YLO A;  3TOA A;  3DLJ A;  5GCN A;  1PUA A;  4LQG A;  3F5B A;  4NGR A;  2AFM A;  4A37 A;  1XF8 A;  2Z10 A;  3D7F A;  3S9N A;  2ZW4 A;  4F6A A;  5K8N A;  3KHX A;  3JVN A;  4C7H A;  3V7Z A;  2ODF A;  1CP7 A;  4OKO A;  3PB4 X;  1UWY A;  2EK9 A;  3SI1 A;  2FCK A;  5AG6 A;  5LYD A;  1DTD A;  2B4D A;  3RO0 A;  2Z3N A;  1M1D A;  4P10 A;  3FBU A;  4BIN A;  4P4J A;  5JQ4 A;  2Q43 A;  2R7H A;  4B12 A;  1Y9W A;  4EVY A;  4PK3 A;  5CBM A;  1YLE A;  1WWZ A;  2I00 A;  8CPA A;  1Z4R A;  1S5K A;  1Y0R A;  2JBJ A;  3CDX A;  3BI1 A;  4NCZ A;  4UEE A;  5LRJ A;  3H8G A;  4PXB A;  3H5Z A;  3IEH A;  5F49 A;  2QEC A;  2ZXV A;  1KUV A;  3IGR A;  1BPM A;  3PRT A;  3TO7 A;  3QAY A;  2OB0 A;  2Z3M A;  2EVN A;  1A2Z A;  5IB9 A;  3N5F A;  2VQY A;  4NJR A;  4R9M A;  1S7F A;  3PEI A;  3NFZ A;  1YME A;  1Z9U A;  3H4Q A;  4R6T A;  4EFD A;  3DNS A;  1VKC A;  4MI4 A;  2PCU A;  3A9L A;  1J4J A;  2Q4Y A;  1ON0 A;  4YFJ A;  2CF4 A;  4AVC A;  3KR4 A;  3CXP A;  2OZU A;  3CXQ A;  4IUS A;  1ARM A;  4XPD B;  4IAV A;  3SXO A;  5LYI A;  3FX6 A;  4ONW A;  1TKF A;  1Y7R A;  1Z4E A;  2PJ5 A;  1XRY A;  4X2T A;  3D7G A;  2GIV A;  2XEI A;  3FEE A;  1Z5R A;  3TX8 A;  1AYE A;  2O53 A;  1BPN A;  4R76 A;  4E8O A;  1X10 A;  1VHS A;  2NYQ A;  3QNV A;  3KR5 A;  2HQY A;  1XMT A;  5ISV A;  4FUU A;  1TKJ A;  3VAT A;  2EO8 A;  2REF A;  3WC5 A;  2Q0Y A;  4R3L A;  4MFQ A;  4A33 A;  4AVB A;  3WC7 A;  5JPH A;  3EO4 A;  4NF1 A;  4OC0 A;  3VWE A;  3QAH A;  2AFO A;  4UFW A;  2F8H A;  4K30 A;  1P0H A;  1HDU A;  1SQH A;  3SJE A;  1IY7 A;  3C26 A;  3VH9 A;  2PJ2 A;  5DWN A;  1FNO A;  3PFO A;  3GLJ A;  2G3A A;  3V38 A;  3D7H A;  3ISZ A;  4P44 A;  4B14 A;  2PJC A;  5F46 A;  2JDD A;  1DE4 C;  1K4J A;  4MHZ A;  4XPD C;  3K9T A;  4CYO A;  1NE9 A;  1KUX A;  1XOV A;  3W6S A;  1S60 A;  2J8M A;  5LRK A;  3B3T A;  4B5P B;  5EBV A;  2IJZ A;  1PYT B;  3FRM A;  3FVL A;  4CYN A;  3FXT A;  4TWE A;  4CS0 B;  1AUG A;  3DGV A;  4OC5 A;  3SI2 A;  2FXF A;  3EY5 A;  3PB6 X;  2JBK A;  4H6U A;  4IHM A;  1M4L A;  1F57 A;  2Z3P A;  4C7I A;  4F8Z A;  3IWE A;  4RUH A;  3KZW A;  2P6G A;  2Y0M A;  3FH4 A;  1IGB A;  1XIX A;  4F9U A;  3KAS A;  2R98 A;  1VHE A;  3KGQ A;  2V8H A;  2PVV A;  5E96 A;  3CPA A;  3NA6 A;  5LYL A;  2QJ8 A;  3DSB A;  2RC4 A;  2AFZ A;  5FVJ A;  2ZEP A;  1OZP A;  2C6P A;  4NGS A;  1IU8 A;  4LQ6 A;  4XPL A;  4OME A;  3GYA A;  1Z2L A;  3D7D A;  3LOD A;  4CPA A;  3E0K A;  4PK2 A;  1CBX A;  4MHY A;  2WPW A;  3PB8 X;  4KSA A;  1EE3 P;  2ZOG A;  2PRB A;  3MN8 A;  3SJX A;  3R96 A;  4KLW A;  4WWV A;  3GKR A;  1YVK A;  3LD2 A;  2FVG A;  4OAE A;  2A4N A;  4NGP A;  1IID A;  2VL1 A;  1QSM A;  4B6Z A;  4NXY A;  1PU9 A;  2OU2 A;  4OC2 A;  1YSJ A;  4Z65 A;  1R57 A;  2BO9 A;  5G1Z A;  1P4N A;  1QMU A;  2B5G B;  2FSR A;  2D4P A;  3FNC A;  4YWY A;  2CTB A;  2QYV A;  3KHZ A;  4Y49 C;  2J9A A;  3UY5 A;  1TF9 A;  1JQG A;  2PDO A;  4I49 A;  4B5P A;  2XEF A;  2P6F A;  4IK2 A;  4AB7 A;  2FT0 A;  2VZY A;  2G9D A;  2PIY A;  2V8G A;  2ZW7 A;  3PBB A;  3LMS A;  4X3R A;  1YQE A;  4A32 A;  2RB7 A;  2OH1 A;  4ZY0 A;  4QBJ A;  4KS9 A;  2WYR A;  1XBU A;  4PSX A;  4EME A;  3PBE A;  2YNE A;  3R1K A;  4KOX A;  3TTH A;  4A38 A;  4NSQ A;  2AFX A;  1LRZ A;  2PIZ A;  4UEF A;  2DEA A;  4KOS A;  5THW A;  2ZW6 A;  2NMT A;  3I1U A;  4UWI A;  2VXK A;  4XNH C;  2PJ3 A;  2VI7 A;  2ATR A;  5IB0 A;  4FBE A;  2BCO A;  3IU2 A;  1KWM A;  4R8F A;  1R43 A;  3H8F A;  3RZA A;  1R3N A;  4HNX B;  4NGT A;  2BSW A;  2DF5 A;  3CPX A;  4AXV A;  4CAE A;  1XMB A;  3BHX A;  4P45 A;  2YND A;  2Q51 A;  5K8O A;  1VHO A;  5D29 A;  4DJL A;  3PB7 X;  5F09 A;  1I1D A;  2ZEG A;  2CXA A;  4L89 A;  4MCQ A;  4P4I A;  1TXR A;  1XJO A;  2B5G A;  1ZO0 A;  4AG7 A;  3IC1 A;  4R3K A;  4U9Z A;  3PZJ A;  2IL4 A;  1TIQ A;  3JUW A;  3S6K A;  5J8C A;  4UIA A;  4KZT A;  2PJB A;  4A31 A;  2CNS A;  4F9V A;  2CIJ A;  4UFV A;  5IX3 A;  2ZEF A;  2G0B A;  4JD6 A;  3RYO A;  4KOT A;  1N71 A;  3R9E A;  3VAR A;  2HUZ A;  4CGP A;  3NH8 A;  2IMO A;  4CGN A;  2QIR A;  4KUA A;  1Z8X A;  2CY2 A;  3SJF A;  4P4F A;  4C2X A;  2VEZ A;  3FMC A;  4HNW B;  4EWT A;  1TF8 A;  2NSM A;  3S6F A;  1Y7E A;  3EXN A;  3LAC A;  3K9U A;  4KUB A;  4ZX8 A;  3SJG A;  4DUK A;  4KOY A;  3IWG A;  2GE3 A;  2GU2 A;  1RXT A;  4CGO A;  3WAB A;  5G20 A;  1B87 A;  1Q2C A;  2PR1 A;  2V8D A;  1MK4 A;  4UEZ A;  2EK8 A;  2Z3O A;  4GXH A;  5JH9 A;  3B3V A;  1KUY A;  1YW6 A;  1NMT A;  3W91 A;  4ZGY B;  4X8I A;  4Q38 A;  2VZZ A;  4OC4 A;  4U5Y A;  3I3G A;  1F2O A;  4Q7A A;  2XEG A;  3W6X A;  1I21 A;  1ZG9 A;  2ARH A;  5C82 A;  4MY0 A;  4BBH A;  2F7V A;  2Q7S A;  4B13 A;  4UFX A;  1LAM A;  3NH4 A;  3IU1 A;  4M85 A;  4MFP A;  2DPS A;  4NGM A;  4PXD A;  4PPZ A;  4YRH A;  3BI0 A;  2V8V A;  1TKH A;  3MRU A;  4C2Z A;  1FT7 A;  4DNC A;  2YGW A;  3B8G A;  5IV0 A;  3FYN A;  4RS2 A;  4B11 A;  4ZY1 A;  1M4I A;  3D68 A;  4FD7 A;  3H8E A;  2B4B A;  4A30 A;  4MFZ A;  5HVF A;  2ZPA A;  5F47 A;  4UCP A;  2PC1 A;  2GLF A;  2PJ9 A;  3IIB A;  3RAM A;  3WT4 A;  2FIA A;  1BAV A;  1CG2 A;  4KVX A;  4OLL A;  2Z3K A;  5J8F A;  1Z8T A;  1BLL E;  2HB6 A;  4ONU A;  4MFK A;  3D2P A;  4KSI A;  1LAN A;  1IOF A;  3B3W A;  4OAD A;  2CTC A;  2QVP A;  4K3N A;  4KOW A;  4OP4 A;  2FS5 A;  2V77 A;  4OID A;  4P4D A;  1M4G A;  2Q44 A;  2Z3L A;  5AG5 A;  4UF4 A;  4NGQ A;  3KKW A;  5H84 A;  2AE6 A;  3PGP A;  2WUU A;  4A2Z A;  4MHD A;  2B58 A;  3B2Y A;  5C88 A;  3RBU A;  4KSF A;  4KOR A;  2PJ8 A;  2R8V A;  1RTQ A;  3FF3 A;  4MMO A;  5CPA A;  5KTC A;  5K8P A;  1Q2D A;  2ABZ A;  2K5T A;  1XE4 A;  2ZW5 A;  2BOA A;  2REE A;  4UIB A;  4MHN A;  2C6C A;  1M4D A;  4U9Y A;  1FY7 A;  2ZEE A;  4C68 A;  4WJB A;  1NSA A;  4AVA A;  4MCR A;  1YGH A;  4J3G A;  5K8M A;  2WSA A;  4QUS A;  3HLP A;  5JGF A;  2Q7B A;  3PFE A;  1IB1 E;  1QST A;  5HVG A;  1ELL P;  4KOU A;  4JZ0 A;  4NGN A;  3T90 A;  2PQ8 A;  3IO1 A;  3KI9 A;  4P4B A;  4GM5 A;  5H86 A;  3R95 A;  3KQZ A;  2FL4 A;  4G1P A;  2HC9 A;  2O28 A;  1ZLI A;  2AFS A;  4OIW A;  4B10 A;  4FAI A;  7CPA A;  3TOB A;  2PJ1 A;  4KOV A;  3D66 A;  4KVM E;  5I4M A;  1KZF A;  2PJ7 A;  4KLV A;  4YU9 A;  4Q36 A;  1HEE A;  3I9S A;  4X5K A;  5LYF A;  1LOK A;  1QSN A;  3TFY A;  1S7K A;  3WC6 A;  3TO9 A;  2WPX A;  4ZY2 A;  4CAW A;  1Y9K A;  4MFJ A;  5HMN A;  2JEV A;  2WZN A;  4HKF A;  1QQ9 A;  3OWC A;  2PRQ A;  3ZJ0 A;  1H8L A;  1YW4 A;  2D4O A;  1S7N A;  2YNC A;  3FJU A;  5AG4 A;  3DR6 A;  3G8W A;  2C1C A;  4L8A A;  3BJ7 A;  1MJ9 A;  1X12 A;  4E2A A;  2FE7 A;  4LX9 A;  3D4U A;  3S9L A;  3EC4 A;  1CP6 A;  4MXU A;  4HPS A;  1M44 A;  4MHP A;  4PXC A;  2PJ0 A;  2I79 A;  4DYO A;  1QSR A;  2O4H A;  2PVW A;  2Z0Z A;  4R87 A;  3DDD A;  3VWD A;  1S3Z A;  4ZYQ A;  2PJ4 A;  3T9Y A;  4C2Y A;  4W9Y A;  3TC8 A;  3GIU A;  3P2F A;  1ZG8 A;  1LFW A;  2F5I A;  4JXQ A;  1NSL A;  4F0Y A;  2PJ6 A;  5J1Q A;  2OZH A;  3L2N A;  1BO4 A;  4NEX A;  4QB9 A;  2G3T A;  5EMI A;  1IYK A;  1XFO A;  5A27 A;  1Z8L A;  2PSW A;  3TE4 A;  2ZEO A;  2P6E A;  4R57 A;  1HDQ A;  4JXR A;  2ZEM A;  3ISX A;  1V0C A;  2HV2 A;  5AGE A;  3IWW A;  4M6G A;  4CAX A;  1CJW A;  4FD6 A;  2R1I A;  4QVT A;  1YR0 A;  3GB0 A;  4CRZ B;  4QC6 A;  4O23 A;  4UBR A;  1B6B A;  4ZBG A;  4IF5 A;  2PJA A;  4NJQ A;  4ZI6 A;  3F0A A;  3TT2 A;  2RFH A;  1JWQ A;  2GFQ A;  2X7B A;  3IJ3 A;  4KVO E;  3FB3 A;  1QSO A;  1MJA A;  3R9F A;  6CPA A;  2GAN A;  4PSW A;  4JJX A;  2OOT A;  4TNU A;  5F48 A;  3TO6 A;  4PXE A;  2C27 A;  2BEI A;  1GYT A;  5JM6 A;  4FD5 A;  1VIX A;  5LRG A;  4FWU A;  4NFR A;  3B7I A;  4MFL A;  2ZEL A;  4RI1 A;  4UWJ A;  3TCV A;  1CM0 A;  3T8W A;  5DS0 A;  1PCA A;  1AMP A;  1GHE A;  4MCS A;  4YGO A;  2I3C A;  2C6G A;  3BXM A;  1UFH A;  4LUA A;  5AG7 A;  2ZOF A;  1VGY A;  1F2P A;  1LCP A;  3P2H A;  3F8K A;  1Q2Y A;  4F0X A;  2P0W A;  3FEC A;  4RN7 A;  3HUV A;  3CT9 A;  3QB8 A;  5D8N A;  4OC3 A;  4ZX9 A;  3V8I A;  5KTA A;  2GRE A;  3BLN A;  2EUI A;  3G3S A;  4CYP A;  4MCP A;  2CNM A;  4PQA A;  2H5M A;  3GY9 A;  3FIX A;  1CX8 A;  2OZG A;  5HVH A;  5HH1 A;  2J8R A;  3FED A;  1CPX A;  3D8P A;  4H2K A;  2PE3 A;  1Q7L A;  5CNP A;  1ZLH A;  2VBQ A; 
#chains in the Genus database with same CATH homology
 2B3V A;  3S6G A;  1YK3 A;  4JLY A;  3CXS A;  4MJ8 A;  4UA3 A;  2JDC A;  3NE7 A;  1U6M A;  2QML A;  4ORF A;  3BJ8 A;  1IIC A;  1IYL A;  4CAF A;  1WK4 A;  4CAV A;  5EC4 A;  3R9G A;  3PP9 A;  1I12 A;  4CGL A;  4MBU A;  2DXQ A;  4CGM A;  1S7L A;  4PV6 A;  3D2M A;  1MJB A;  2B3U A;  1L0C A;  4JWP A;  4E0A A;  1YVO A;  2FIW A;  2JLM A;  4A95 A;  2KCW A;  3DR8 A;  1YX0 A;  4UCN A;  4BMH A;  4Y49 B;  5G21 A;  2BL1 A;  2YNC C;  2PR8 A;  2J8N A;  4CYQ A;  1YRE A;  4II9 A;  2DPT A;  4B5O A;  3ZZI A;  2CNT A;  5DWM A;  2B4D B;  4FD4 A;  2AJ6 A;  3EFA A;  3SHP A;  4MY3 A;  5KTD A;  2BUE A;  4CRY B;  1RO5 A;  2Z11 A;  3WR7 A;  4UCM A;  5I0C A;  4AG9 A;  3JTK A;  5A28 A;  4H6Z A;  4M3S A;  3D3S A;  2Q4V A;  4XPK A;  4XNH B;  3SXN A;  5BWA B;  1BOB A;  4HNY B;  4H89 A;  5G22 A;  3N7Z A;  4GS4 A;  3MGD A;  1XEB A;  2Q04 A;  3TOA A;  5GCN A;  1PUA A;  3F5B A;  1XF8 A;  2Z10 A;  2ZW4 A;  4F6A A;  3JVN A;  4C7H A;  2FCK A;  5AG6 A;  2B4D A;  2Z3N A;  1M1D A;  5JQ4 A;  3FBU A;  4EVY A;  2R7H A;  4B12 A;  1Y9W A;  4PK3 A;  1YLE A;  1WWZ A;  2I00 A;  1Z4R A;  1S5K A;  4NCZ A;  3H5Z A;  5F49 A;  2QEC A;  2ZXV A;  1KUV A;  3IGR A;  3TO7 A;  2OB0 A;  2Z3M A;  2EVN A;  2VQY A;  4R9M A;  1S7F A;  1Z9U A;  3H4Q A;  3DNS A;  1VKC A;  4MI4 A;  3A9L A;  1J4J A;  2Q4Y A;  1ON0 A;  4YFJ A;  4AVC A;  3CXP A;  2OZU A;  3CXQ A;  4IUS A;  4XPD B;  3SXO A;  1Y7R A;  1Z4E A;  2GIV A;  4E8O A;  1VHS A;  2HQY A;  1XMT A;  5ISV A;  4A33 A;  2REF A;  5JPH A;  2Q0Y A;  4R3L A;  4MFQ A;  4AVB A;  3EO4 A;  4NF1 A;  3VWE A;  3QAH A;  4UFW A;  4K30 A;  1P0H A;  1SQH A;  3C26 A;  5DWN A;  2G3A A;  5F46 A;  4B14 A;  2JDD A;  1K4J A;  4XPD C;  4CYO A;  1NE9 A;  1KUX A;  3W6S A;  1S60 A;  2J8M A;  4B5P B;  5EBV A;  3FRM A;  4CYN A;  3FXT A;  4CS0 B;  2FXF A;  3EY5 A;  4H6U A;  4C7I A;  2Z3P A;  3IWE A;  2P6G A;  2Y0M A;  1XIX A;  2R98 A;  5E96 A;  3DSB A;  2RC4 A;  5FVJ A;  1OZP A;  4XPL A;  3GYA A;  3LOD A;  3E0K A;  4PK2 A;  2WPW A;  4KSA A;  2PRB A;  3R96 A;  4KLW A;  3GKR A;  1YVK A;  3LD2 A;  4OAE A;  2A4N A;  1IID A;  1QSM A;  4NXY A;  1PU9 A;  2OU2 A;  1R57 A;  5G1Z A;  1P4N A;  2B5G B;  2FSR A;  2D4P A;  3FNC A;  4Y49 C;  3UY5 A;  2PDO A;  4B5P A;  4I49 A;  2P6F A;  4AB7 A;  2FT0 A;  2VZY A;  2ZW7 A;  4A32 A;  2OH1 A;  4QBJ A;  4KS9 A;  4PSX A;  2YNE A;  3R1K A;  4KOX A;  3TTH A;  4NSQ A;  1LRZ A;  4KOS A;  2ZW6 A;  2NMT A;  4UWI A;  2VXK A;  4XNH C;  2VI7 A;  2ATR A;  5IB0 A;  3IU2 A;  4HNX B;  2BSW A;  4CAE A;  2YND A;  1I1D A;  2CXA A;  4L89 A;  2B5G A;  1ZO0 A;  4AG7 A;  4R3K A;  4U9Z A;  3PZJ A;  2IL4 A;  1TIQ A;  3JUW A;  3S6K A;  5J8C A;  4KZT A;  4A31 A;  2CNS A;  4UFV A;  5IX3 A;  2G0B A;  4JD6 A;  3RYO A;  4KOT A;  1N71 A;  3R9E A;  2HUZ A;  4CGP A;  4CGN A;  2QIR A;  4KUA A;  2CY2 A;  4C2X A;  2VEZ A;  4HNW B;  3S6F A;  3EXN A;  3K9U A;  4KUB A;  4KOY A;  3IWG A;  2GE3 A;  1RXT A;  4CGO A;  5G20 A;  1B87 A;  1Q2C A;  2PR1 A;  1MK4 A;  2Z3O A;  1KUY A;  1NMT A;  3W91 A;  4ZGY B;  4Q38 A;  2VZZ A;  4U5Y A;  3I3G A;  3W6X A;  1I21 A;  2ARH A;  5C82 A;  4MY0 A;  4BBH A;  4B13 A;  4UFX A;  3IU1 A;  4M85 A;  4MFP A;  2DPS A;  4YRH A;  4C2Z A;  4DNC A;  2YGW A;  3B8G A;  5IV0 A;  3FYN A;  4RS2 A;  4B11 A;  1M4I A;  4FD7 A;  4A30 A;  2B4B A;  4MFZ A;  2ZPA A;  5F47 A;  4UCP A;  2PC1 A;  5J8F A;  2FIA A;  4KVX A;  4OLL A;  2Z3K A;  4ONU A;  4MFK A;  3D2P A;  4OAD A;  4KOW A;  2FS5 A;  1M4G A;  2Q44 A;  2Z3L A;  5AG5 A;  3KKW A;  5H84 A;  2AE6 A;  3PGP A;  2WUU A;  4A2Z A;  4MHD A;  2B58 A;  5C88 A;  4KSF A;  4KOR A;  2R8V A;  5KTC A;  1Q2D A;  2K5T A;  1XE4 A;  2ZW5 A;  2REE A;  1M4D A;  4U9Y A;  1FY7 A;  4C68 A;  4AVA A;  1YGH A;  4J3G A;  2WSA A;  4QUS A;  2Q7B A;  1IB1 E;  1QST A;  4KOU A;  3T90 A;  2PQ8 A;  5H86 A;  3R95 A;  2FL4 A;  2O28 A;  4B10 A;  3TOB A;  4KOV A;  4KVM E;  1KZF A;  4KLV A;  4Q36 A;  4X5K A;  3I9S A;  3TFY A;  1QSN A;  1S7K A;  3TO9 A;  2WPX A;  4CAW A;  1Y9K A;  4MFJ A;  5HMN A;  2JEV A;  4HKF A;  3OWC A;  3ZJ0 A;  2D4O A;  2YNC A;  1S7N A;  5AG4 A;  3DR6 A;  3G8W A;  4L8A A;  3BJ7 A;  1MJ9 A;  4E2A A;  2FE7 A;  4LX9 A;  3EC4 A;  1M44 A;  2I79 A;  1QSR A;  2Z0Z A;  3VWD A;  4R87 A;  3DDD A;  1S3Z A;  3T9Y A;  4C2Y A;  3P2F A;  2F5I A;  4JXQ A;  1NSL A;  4F0Y A;  2OZH A;  1BO4 A;  4NEX A;  4QB9 A;  2G3T A;  1IYK A;  5A27 A;  3TE4 A;  2PSW A;  2P6E A;  4R57 A;  4JXR A;  1V0C A;  2HV2 A;  5AGE A;  4CAX A;  1CJW A;  4FD6 A;  2R1I A;  4QVT A;  1YR0 A;  4CRZ B;  4QC6 A;  4UBR A;  1B6B A;  4ZBG A;  4IF5 A;  3F0A A;  3TT2 A;  2X7B A;  4KVO E;  3FB3 A;  1QSO A;  1MJA A;  3R9F A;  2GAN A;  4PSW A;  4JJX A;  3TO6 A;  5F48 A;  2C27 A;  2BEI A;  4FD5 A;  4MFL A;  4RI1 A;  4UWJ A;  3TCV A;  1CM0 A;  1GHE A;  4YGO A;  1UFH A;  4LUA A;  5AG7 A;  3P2H A;  4F0X A;  3F8K A;  1Q2Y A;  2P0W A;  3QB8 A;  3V8I A;  5KTA A;  3G3S A;  3BLN A;  2EUI A;  4CYP A;  2CNM A;  3GY9 A;  2H5M A;  3FIX A;  2OZG A;  5HH1 A;  2J8R A;  3D8P A;  5CNP A;  3S6H A;  2VBQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...