4CYPA

Leishmania major n-myristoyltransferase in complex with a pyrrolidine inhibitor.
Total Genus 123
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
123
sequence length
411
structure length
411
Chain Sequence
AHAFWSTQPVPQTEDETEKIVFAGPMDEPKTVADIPEEPYPIASTFEWWTPNMEAADDIHAIYELLRDNYVEDDDSMFRFNYSEEFLQWALCPPNYIPDWHVAVRRKADKKLLAFIAGVPVTLRMGTPKYMKVKAQEKGEGEEAAKYDEPRHICEINFLCVHKQLREKRLAPILIKEATRRVNRTNVWQAVYTAGVLLPTPYASGQYFHRSLNPEKLVEIRFSGIPAQYQKFQNPMAMLKRNYQLPSAPKNSGLREMKPSDVPQVRRILMNYLDSFDVGPVFSDAEISHYLLPRDGVVFTYVVENDKKVTDFFSFYRIPSTVIGNSNYNLLNAAYVHYYAATSIPLHQLILDLLIVAHSRGFDVCNMVEILDNRSFVEQLKFGAGDGHLRYYFYNWAYPKIKPSQVALVML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords GLYCYLPEPTIDE N-TETRADECANOYLTRANSFERASE
publication title Structure-Based Design of Potent and Selective Leishmania N- Myristoyltransferase Inhibitors.
pubmed doi rcsb
source organism Leishmania major
total genus 123
structure length 411
sequence length 411
ec nomenclature ec 2.3.1.97: Glycylpeptide N-tetradecanoyltransferase.
pdb deposition date 2014-04-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01233 NMT Myristoyl-CoA:protein N-myristoyltransferase, N-terminal domain
A PF02799 NMT_C Myristoyl-CoA:protein N-myristoyltransferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.170 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4cypA00
5A28A 5A27A 4CYNA 4CGNA 4UFXA 4C68A 2YNEA 4A95A 4C2XA 4CGMA 4C7HA 5AG6A 4CGLA 4UFWA 2YNDA 4A33A 5AGEA 4CGPA 4CGOA 5G21A 5G22A 4C7IA 4UCNA 4C2YA 4UFVA 3IWEA 4A30A 4CAFA 2WUUA 2WSAA 4B13A 5AG5A 2YNCA 4UCMA 4A2ZA 5G1ZA 4BBHA 4CAEA 4UCPA 4CYPA 5AG4A 4A31A 4B12A 2YNCC 3H5ZA 3JTKA 5AG7A 4A32A 4CYOA 3IU1A 5G20A 4B10A 4B11A 3IU2A 4CYQA 4C2ZA 4B14A
chains in the Genus database with same CATH superfamily
1YREA 2ZEPA 5CPAA 1TF8A 2OR4A 1FT7A 1HDQA 2QVPA 2ZW7A 3IGRA 4OIDA 4ONUA 4PQAA 4UIBA 2PR8A 2YNDA 5EMIA 2J8NA 4YFJA 2IQ6A 3TC8A 3KZWA 4OAEA 4WJBA 1VHEA 2Y0MA 4NGRA 4XNHC 1YMEA 1M44A 1FNOA 1ELLP 1Q2YA 3RAMA 5J8FA 4OLLA 2WSAA 4YGOA 1ON0A 5AG5A 4HPSA 5LYIA 2K5TA 3RZAA 1F2PA 3GIUA 1YGHA 4MY3A 4UCPA 5F46A 2AFWA 1SQHA 3I3GA 4TWEA 2JBKA 4MFKA 1Z8LA 5AG7A 4A32A 5CBMA 2AJ6A 3L2NA 3CXQA 4MXUA 1A2ZA 1DTDA 3BHXA 3K9TA 3QAYA 2A4NA 4PV6A 4ZX8A 4NFRA 3FXTA 4B6ZA 1YVKA 3B3CA 3R9FA 3IWWA 2ZOGA 2ARHA 4QUSA 4CGPA 3JRUA 3TT2A 2ODFA 3FNCA 1XMBA 4ONWA 1KUVA 4XPLA 4CS0B 4P4JA 3LODA 3GUXA 1N71A 3KL9A 1S7LA 4OP4A 1HEEA 4A39A 4UCMA 1MJAA 1MJBA 4R57A 1VHOA 2PVVA 2PJ5A 4DJLA 4OC3A 4H89A 4MI4A 2YNCC 2EWBA 3PBBA 2P0WA 4R87A 2CNSA 2IJZA 4BMHA 2QJ8A 2EVNA 4RUHA 1I21A 2VI7A 1NSAA 2VZYA 4C2XA 2CNTA 3C26A 1R43A 2R7HA 3S6GA 3PB4X 5G21A 2O53A 4OC2A 4CPAA 2AFZA 2ZENA 3D7FA 1Z2LA 1PUAA 3W6SA 4FD7A 5HXDA 4RN7A 2ZW4A 4F8ZA 4PSXA 4A30A 1S7KA 1PCAA 2B3UA 2EBJA 4P45A 2ZELA 3IC1A 5C82A 3G8WA 4NXYA 4KUAA 4JZ0A 2C6CA 2JDCA 2BEIA 1VGYA 4KSFA 1AUGA 4LUAA 1ELMP 2C27A 4CAVA 2AE6A 1IGBA 4NGMA 4B11A 2ZPAA 4F9VA 2GE3A 4HNWB 4PXDA 2YNEA 3K2KA 2HV2A 3TO9A 3B3SA 1XBUA 4M6GA 2VXKA 5LRKA 5AGEA 1QSRA 3TE4A 2ZW5A 3PB7X 3NH4A 2QECA 4MCQA 1Y0YA 1KWMA 4FWUA 5JPHA 1WWZA 4XPDB 1TKFA 2GREA 2IMOA 3TO6A 2GLFA 3BJ8A 3NE8A 5LYDA 2GU2A 1ZG9A 2ZOFA 2B3VA 1CPSA 3BLNA 3TOAA 3VWEA 4NCZA 2R98A 3W6XA 3PB9X 2G0BA 4A31A 3N7ZA 4YRHA 1LCPA 3SJGA 2BL1A 4P4BA 3TO7A 3PEIA 3V7ZA 3IU1A 4H6ZA 2V8HA 4MCSA 1Y0RA 4HKFA 5JQ4A 1YW4A 2FCKA 2Z0ZA 4AVAA 2Q7BA 4CYNA 1HDUA 1IOFA 3OWCA 3SJEA 2C6PA 5LYFA 1Q7LA 3S9LA 1J4JA 1JWQA 1Q2CA 1AMPA 1QSOA 3UY5A 2RB7A 5IB0A 4OADA 4CGOA 1VHSA 2WPWA 3SHPA 2Q4VA 4F6AA 1YR0A 2EO8A 1XFOA 2ZEOA 3P2HA 4M3SA 4FAIA 4UFVA 1TKJA 1BLLE 1L0CA 2PVWA 5DWNA 1S3ZA 3SXOA 4B13A 3EXNA 1YLEA 2Z3OA 3B3TA 2XEFA 4IUSA 4QVTA 3SI2A 4F0YA 5K8NA 1XJOA 2VQYA 5AG4A 2P6FA 3LMSA 2CTBA 1YSJA 3KQXA 4AVBA 7CPAA 1CM0A 5H86A 4B5PB 4CAXA 2Q51A 4FUUA 4MBUA 2G3TA 4NGNA 1CP6A 4UWIA 2O28A 1P0HA 2RC4A 3EC4A 5EC4A 5J1QA 5G22A 5K8OA 4Y49B 5HVFA 1V0CA 4ZX9A 5F48A 1F2OA 2EUIA 4DNCA 1YLOA 3IWEA 3EFAA 6CPAA 1H8LA 2FVGA 5K8MA 3B7IA 2I00A 4QC6A 3FECA 1GYTA 2J9AA 4RI1A 4X3RA 1M4LA 1NE9A 5ELYA 3VARA 1Y7RA 2Z3NA 1PU9A 1QQ9A 4P4DA 2Z3LA 4CAEA 1IYKA 1OBRA 4P4FA 3DNSA 4IHMA 4R8FA 5ISVA 3R9GA 5IV0A 1LANA 5E96A 2FIWA 1TIQA 4KSAA 4BD9A 3PP9A 4C2ZA 4KSIA 2P6EA 3LACA 3VH9A 5DS0A 4UFXA 4C68A 3KHZA 2OZGA 2CF4A 4C7HA 1UFHA 4R3LA 2ZEGA 3W91A 5KTAA 4DUKA 1XEBA 2OU2A 4I49A 3CT9A 4QB9A 3IFEA 2DPSA 4Q36A 2CIJA 1Q2DA 1XIXA 1TF9A 1ZG8A 2VEZA 2ZEMA 4B5OA 2CNMA 4Q7AA 4A37A 2G3AA 2C1CA 2NSMA 4OMEA 2GIVA 2OB0A 4AB7A 1CBXA 3PZJA 1XOVA 1QMUA 4GM5A 4PXEA 4B12A 4KZTA 4MHPA 1R57A 2PJCA 3FB3A 3IEHA 4B5PA 3HLPA 2J8RA 2PJ1A 4NJRA 3SXNA 3TCVA 3D67A 3TX8A 4P44A 5F47A 5K8PA 1QSMA 1XF8A 2Q44A 3H8GA 3DSBA 4CGLA 3FIXA 4YU9A 4F9UA 4R3KA 2P6GA 2H5MA 1X12A 1Z8TA 4KOUA 3IWGA 4KOSA 3S6HA 2ZEFA 5LYLA 5LRJA 1B87A 4X8IA 4II9A 1Y7EA 1MK4A 4CYPA 4JYWA 5GCNA 1QSNA 1LOKA 2NMTA 4NF1A 3H5ZA 1F57A 2REFA 2VBQA 3ISXA 1BAVA 4B10A 2QIRA 2PIZA 4CGMA 2BOAA 1TKHA 2CTCA 2PQ8A 3WR7A 4CRZB 2FT0A 2Z3PA 2QYVA 4KVME 2PJ4A 4JLYA 4UFWA 2Z10A 4P4EA 1IU8A 5I0CA 3RNZA 1IICA 2JLMA 3D8PA 3IO1A 5H84A 3KHXA 3BJ7A 4MMOA 4NGQA 4YWYA 3WT4A 2G9DA 2POKA 3LD2A 4UA3A 1ZLIA 3KR5A 4AG7A 1M4GA 1VKCA 4MFLA 3G3SA 4MJ8A 2R8VA 5HVGA 1Y9WA 4A38A 3B35A 3I1UA 2XEIA 4K3NA 3H8FA 3DR8A 3R95A 1Z4EA 4KOYA 2IL4A 1IYLA 2F7VA 4OIWA 3HUVA 3F5BA 4L89A 3B2YA 5CNPA 4KVXA 4OC0A 4MFZA 3PB8X 4ZY2A 3D3SA 4KOWA 4XNHB 4C7IA 2WYRA 4R6TA 2XEJA 4FD6A 1Z5RA 4NGSA 1FY7A 2PJ0A 3K9UA 4Q38A 4EVYA 2AFXA 4GS4A 4MHYA 1PYTB 2PJ6A 4KOTA 2GFQA 2X7BA 2PDOA 1R3NA 1BO4A 4E0AA 5J8CA 3LWUA 1S7FA 2F8HA 3ZZIA 5F09A 1VIXA 3EO4A 2FSRA 3MGDA 4UWJA 5HVHA 2REEA 3PFOA 3DLJA 2B58A 4LQGA 4B14A 3TTHA 2HB6A 1CP7A 2F5IA 4CGNA 5A27A 1BPNA 2AFMA 3I9SA 2ANPA 2JEWA 5KTDA 4NGPA 3SJXA 1RO5A 2ZEEA 4UEEA 4MHDA 1X10A 1JQGA 4KLVA 1K4JA 2I3CA 1IB1E 3R9EA 3PB6X 4K30A 3TFYA 3D7GA 4M6IA 4MCRA 2ZW6A 4G1PA 1ARMA 3R96A 3V8IA 1XRYA 3GKRA 2CY2A 4PPZA 5HMNA 3PGPA 1ZLHA 3CXPA 4XPDC 5F49A 4FD5A 3FRMA 1KUXA 4KUBA 1YQEA 3BI0A 5FVJA 2PR1A 2O4HA 3KASA 2JBJA 3F8KA 3TOBA 4TNUA 1IIDA 1EE3P 4W9YA 3FEDA 2PJ8A 3H4QA 2RFHA 3RO0A 5C88A 2Q04A 4JD6A 3T9YA 2OZHA 4GXHA 1LFWA 3D4UA 1Z4RA 4IF5A 1KZFA 2FL4A 2Q4YA 5IB9A 2V8DA 3PBEA 2DF5A 2Q43A 3N5FA 3FMCA 4UCNA 4C2YA 1RXTA 4P6YA 1XE4A 2WPXA 3P2FA 4Z65A 4ZY1A 3FEEA 2PCUA 4CAFA 1S7NA 2J8MA 1YVOA 2BO9A 3NFZA 4HNYB 5BWAB 4PXCA 3VATA 3DDDA 1LRZA 1ZG7A 4WWVA 4M85A 2GLJA 4R9MA 3SI0A 2FXFA 1IY7A 3QAHA 1OZPA 3JTKA 3QNVA 4PK2A 1AYEA 3B8GA 4NJQA 4UEFA 5G20A 4CYQA 5A28A 4FBEA 2B4DB 2EK8A 3B3WA 3FVLA 4ORFA 1CX8A 4H6UA 5D29A 1YW6A 3S6FA 4A95A 3GY9A 1KUYA 2DXQA 2PJ9A 4OC4A 1P4NA 5AG6A 4JXQA 2EK9A 1WK4A 1TXRA 3CPAA 3S9NA 4NGTA 2R1IA 4ZY0A 4R76A 3CDXA 3FJUA 4Y49C 3WC7A 1S60A 3B3VA 3GYAA 2WUUA 4LX9A 3CXSA 4UEZA 4KOXA 2YNCA 2PSWA 5JM6A 5G1ZA 2BCOA 3JVNA 3VWDA 2PRQA 2JDDA 4EMEA 4IK2A 2Q7SA 3KGQA 2PRBA 8CPAA 4KLWA 2B4BA 4JXRA 4UBRA 4JJXA 4X5KA 2C6GA 2ZXVA 3GB0A 4MHNA 2I79A 3KKWA 1M4IA 1CPXA 2ATRA 3D7DA 2FIAA 2QMLA 4MFJA 4X2TA 3RBUA 1UWYA 2V77A 1MJ9A 4QBJA 2OH1A 5THWA 2PJ2A 4MFPA 2HC9A 4AXVA 2YGWA 3FF3A 4NSQA 2ABZA 2JEVA 4UIAA 3IJ3A 2FS5A 4ZYQA 4EWTA 5JH9A 4P4IA 1QSTA 3D2MA 3H8EA 2OOTA 4PK3A 2PC1A 4A2ZA 1M4DA 2B5GB 3PFEA 4E2AA 3F0AA 2BSWA 4MFQA 2PJBA 3BXMA 1YX0A 2Q0YA 3KI9A 4NEXA 2ZEHA 1XMTA 2BUEA 3IU2A 3T90A 3T8WA 3V38A 4U5YA 2B4DA 2PJ7A 3D7HA 3NA6A 2Z3MA 2D4PA 4MRIA 4E8OA 1BPMA 2V8VA 4A94A 3WC6A 3S9MA 3RYOA 3D2PA 4P10A 5KTCA 3DGVA 4CAWA 3PRTA 3WC5A 1I1DA 3CZXA 2PJ3A 2XEGA 1IOIA 2Z3KA 4FD4A 4LQ6A 1BOBA 1YK3A 5D8NA 1S5KA 4BINA 3JUWA 4L8AA 4M6HA 2AFSA 3FBUA 4RS2A 2WZNA 3FH4A 1U6MA 4F0XA 1NMTA 1RTQA 3CPXA 1LAMA 2DPTA 2GANA 2FE7A 3EY5A 4ZBGA 3ISZA 3FX6A 3IIBA 5I4MA 3A9LA 4U9ZA 2VL1A 3NH8A 4MCPA 1ZO0A 2HUZA 2V8GA 1CG2A 3MRUA 3NE7A 4J3GA 5IX3A 2D4OA 4KVOE 2VZZA 4XPKA 1CJWA 1Z9UA 2NYQA 2Q4ZA 5HH1A 3R1KA 3WABA 2Z11A 4OC5A 5EBVA 4HNXB 4MHZA 4CRYB 2AFOA 4KOVA 3MN8A 1Z8XA 2PIYA 2PJAA 1GHEA 3BI1A 1Y9KA 3GLJA 4OC1A 4PSWA 3S6KA 4A33A 4U9YA 4MY0A 1DE4C 2HQYA 4O23A 1M1DA 2AFUA 4KORA 4PXBA 4KS9A 1B6BA 1I12A 4EFDA 3ZJ0A 4AVCA 3D66A 3SI1A 4ZI6A 4R7MA 5LRGA 3DR6A 2DEAA 4JWPA 2PE3A 4IAVA 4AG9A 4OKOA 5DWMA 2B5GA 3KQZA 4UF4A 3D68A 1Z8WA 3SJFA 4ZGYB 1LAPA 2KCWA 2ZEDA 3KR4A 4BBHA 1ARLA 3NH5A 3FYNA 4CYOA 4H2KA 3E0KA 5JGFA 2OZUA 2CXAA 4DYOA 3QB8A 1NSLA
chains in the Genus database with same CATH topology
1YREA 2ZW7A 3IGRA 4ONUA 2PR8A 2YNDA 2J8NA 4YFJA 4OAEA 2Y0MA 4XNHC 1M44A 1Q2YA 5J8FA 4OLLA 2WSAA 4YGOA 1ON0A 5AG5A 2K5TA 1YGHA 4MY3A 4UCPA 5F46A 1SQHA 3I3GA 4MFKA 5AG7A 4A32A 2AJ6A 3CXQA 2A4NA 4PV6A 3FXTA 1YVKA 3R9FA 2ARHA 4QUSA 4CGPA 3TT2A 3FNCA 1KUVA 4XPLA 4CS0B 3LODA 1N71A 1S7LA 4UCMA 1MJAA 1MJBA 4R57A 4H89A 4MI4A 2YNCC 2P0WA 4R87A 2CNSA 4BMHA 2EVNA 1I21A 2VI7A 2VZYA 4C2XA 2CNTA 3C26A 2R7HA 3S6GA 5G21A 1PUAA 3W6SA 4FD7A 2ZW4A 4PSXA 4A30A 1S7KA 2B3UA 5C82A 3G8WA 4NXYA 4KUAA 2JDCA 2BEIA 4KSFA 4LUAA 2C27A 4CAVA 2AE6A 4B11A 2ZPAA 2GE3A 4HNWB 2YNEA 2HV2A 3TO9A 2VXKA 5AGEA 1QSRA 3TE4A 2ZW5A 2QECA 5JPHA 1WWZA 4XPDB 3TO6A 3BJ8A 3BLNA 3TOAA 2B3VA 3VWEA 4NCZA 2R98A 3W6XA 2G0BA 4A31A 3N7ZA 4YRHA 2BL1A 3TO7A 3IU1A 4H6ZA 5JQ4A 4HKFA 2FCKA 4AVAA 2Z0ZA 2Q7BA 4CYNA 3OWCA 1J4JA 1Q2CA 1QSOA 3UY5A 5IB0A 4OADA 4CGOA 1VHSA 2WPWA 3SHPA 2Q4VA 4F6AA 1YR0A 3P2HA 4M3SA 4UFVA 1L0CA 5DWNA 1S3ZA 3SXOA 4B13A 3EXNA 1YLEA 2Z3OA 4QVTA 4IUSA 4F0YA 5AG4A 2VQYA 2P6FA 4AVBA 1CM0A 5H86A 4B5PB 4CAXA 4MBUA 2G3TA 4UWIA 2O28A 1P0HA 2RC4A 3EC4A 5EC4A 5G22A 4Y49B 1V0CA 5F48A 2EUIA 4DNCA 3IWEA 3EFAA 4QC6A 2I00A 4RI1A 1NE9A 2Z3NA 1Y7RA 1PU9A 2Z3LA 4CAEA 1IYKA 3DNSA 5ISVA 3R9GA 5IV0A 5E96A 2FIWA 1TIQA 4KSAA 3PP9A 4C2ZA 2P6EA 4UFXA 4C68A 2OZGA 4C7HA 1UFHA 4R3LA 3W91A 5KTAA 1XEBA 2OU2A 4I49A 4QB9A 2DPSA 4Q36A 1Q2DA 1XIXA 2VEZA 4B5OA 2CNMA 2G3AA 4AB7A 2GIVA 2OB0A 3PZJA 4B12A 4KZTA 1R57A 3FB3A 4B5PA 2J8RA 3SXNA 3TCVA 5F47A 1QSMA 1XF8A 2Q44A 4CGLA 3DSBA 3FIXA 4R3KA 2P6GA 2H5MA 4KOUA 3IWGA 4KOSA 3S6HA 1B87A 4II9A 1MK4A 4CYPA 5GCNA 1QSNA 2NMTA 4NF1A 3H5ZA 2REFA 2VBQA 4B10A 2QIRA 4CGMA 3WR7A 2PQ8A 4CRZB 2FT0A 2Z3PA 4KVME 4JLYA 4UFWA 2Z10A 5I0CA 1IICA 2JLMA 3D8PA 5H84A 3BJ7A 3LD2A 4UA3A 4AG7A 1M4GA 1VKCA 4MFLA 3G3SA 4MJ8A 2R8VA 1Y9WA 3DR8A 3R95A 1Z4EA 4KOYA 2IL4A 1IYLA 3F5BA 4L89A 5CNPA 4KVXA 4MFZA 3D3SA 4KOWA 4XNHB 4C7IA 4FD6A 1FY7A 3K9UA 4Q38A 4EVYA 4GS4A 4KOTA 2X7BA 2PDOA 1BO4A 4E0AA 5J8CA 1S7FA 3ZZIA 3EO4A 2FSRA 3MGDA 4UWJA 2REEA 4B14A 2B58A 3TTHA 5A27A 2F5IA 4CGNA 3I9SA 5KTDA 1RO5A 4MHDA 4KLVA 1K4JA 1IB1E 3R9EA 4K30A 3TFYA 2ZW6A 3R96A 3V8IA 3GKRA 2CY2A 5HMNA 3PGPA 3CXPA 4XPDC 5F49A 4FD5A 3FRMA 1KUXA 4KUBA 5FVJA 2PR1A 3F8KA 3TOBA 1IIDA 3H4QA 5C88A 2Q04A 4JD6A 3T9YA 2OZHA 1Z4RA 4IF5A 1KZFA 2FL4A 2Q4YA 4UCNA 4C2YA 1RXTA 1XE4A 2WPXA 3P2FA 4CAFA 1S7NA 2J8MA 1YVOA 5BWAB 4HNYB 3DDDA 1LRZA 4M85A 4R9MA 2FXFA 3QAHA 1OZPA 3JTKA 4CYQA 4PK2A 3B8GA 5G20A 5A28A 2B4DB 4ORFA 4H6UA 3S6FA 4A95A 3GY9A 1KUYA 2DXQA 5AG6A 1P4NA 4JXQA 1WK4A 2R1IA 4Y49C 1S60A 3GYAA 4LX9A 2WUUA 3CXSA 4KOXA 2YNCA 2PSWA 5G1ZA 3JVNA 3VWDA 2JDDA 2PRBA 4KLWA 2B4BA 4JXRA 4UBRA 4JJXA 4X5KA 2ZXVA 2I79A 3KKWA 1M4IA 2ATRA 4CAWA 2FIAA 2QMLA 4MFJA 4QBJA 1MJ9A 2OH1A 4MFPA 2YGWA 4NSQA 2JEVA 2FS5A 1QSTA 3D2MA 4PK3A 2PC1A 4A2ZA 1M4DA 2B5GB 4E2AA 3F0AA 2BSWA 4MFQA 1YX0A 2Q0YA 4NEXA 3T90A 1XMTA 2BUEA 3IU2A 4U5YA 2B4DA 4E8OA 2Z3MA 2D4PA 5KTCA 3RYOA 3D2PA 1I1DA 2Z3KA 4FD4A 1BOBA 1YK3A 1S5KA 3JUWA 4L8AA 3FBUA 4RS2A 1U6MA 4F0XA 1NMTA 2DPTA 2GANA 3EY5A 2FE7A 4ZBGA 3A9LA 4U9ZA 1ZO0A 2HUZA 3NE7A 5IX3A 4J3GA 2D4OA 4KVOE 2VZZA 4XPKA 1CJWA 1Z9UA 5HH1A 3R1KA 2Z11A 5EBVA 4HNXB 4CRYB 4KOVA 4PSWA 3S6KA 1GHEA 1Y9KA 4A33A 4U9YA 4MY0A 2HQYA 1M1DA 4KORA 4KS9A 1B6BA 1I12A 3ZJ0A 4AVCA 3DR6A 4JWPA 4AG9A 5DWMA 2B5GA 4ZGYB 2KCWA 4BBHA 3FYNA 4CYOA 3E0KA 2OZUA 2CXAA 3QB8A 1NSLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5A28 A;  5A27 A;  4CYN A;  4CGN A;  4UFX A;  4C68 A;  2YNE A;  4A95 A;  4C2X A;  4CGM A;  4C7H A;  5AG6 A;  4CGL A;  4UFW A;  2YND A;  4A33 A;  5AGE A;  4CGP A;  4CGO A;  5G21 A;  5G22 A;  4C7I A;  4UCN A;  4C2Y A;  4UFV A;  3IWE A;  4A30 A;  4CAF A;  2WUU A;  2WSA A;  4B13 A;  5AG5 A;  2YNC A;  4UCM A;  4A2Z A;  5G1Z A;  4BBH A;  4CAE A;  4UCP A;  4CYP A;  5AG4 A;  4A31 A;  4B12 A;  2YNC C;  3H5Z A;  3JTK A;  5AG7 A;  4A32 A;  4CYO A;  3IU1 A;  5G20 A;  4B10 A;  4B11 A;  3IU2 A;  4CYQ A;  4C2Z A;  4B14 A; 
#chains in the Genus database with same CATH topology
 1YRE A;  2ZEP A;  5CPA A;  1TF8 A;  2OR4 A;  1FT7 A;  1HDQ A;  2QVP A;  2ZW7 A;  3IGR A;  4OID A;  4ONU A;  4PQA A;  4UIB A;  2PR8 A;  2YND A;  5EMI A;  2J8N A;  4YFJ A;  2IQ6 A;  3TC8 A;  3KZW A;  4OAE A;  4WJB A;  1VHE A;  2Y0M A;  4NGR A;  4XNH C;  1YME A;  1M44 A;  1FNO A;  1ELL P;  1Q2Y A;  3RAM A;  5J8F A;  4OLL A;  2WSA A;  4YGO A;  1ON0 A;  5AG5 A;  4HPS A;  5LYI A;  2K5T A;  3RZA A;  1F2P A;  3GIU A;  1YGH A;  4MY3 A;  4UCP A;  5F46 A;  2AFW A;  1SQH A;  3I3G A;  4TWE A;  2JBK A;  4MFK A;  1Z8L A;  5AG7 A;  4A32 A;  5CBM A;  2AJ6 A;  3L2N A;  3CXQ A;  4MXU A;  1A2Z A;  1DTD A;  3BHX A;  3K9T A;  3QAY A;  2A4N A;  4PV6 A;  4ZX8 A;  4NFR A;  3FXT A;  4B6Z A;  1YVK A;  3B3C A;  3R9F A;  3IWW A;  2ZOG A;  2ARH A;  4QUS A;  4CGP A;  3JRU A;  3TT2 A;  2ODF A;  3FNC A;  1XMB A;  4ONW A;  1KUV A;  4XPL A;  4CS0 B;  4P4J A;  3LOD A;  3GUX A;  1N71 A;  3KL9 A;  1S7L A;  4OP4 A;  1HEE A;  4A39 A;  4UCM A;  1MJA A;  1MJB A;  4R57 A;  1VHO A;  2PVV A;  2PJ5 A;  4DJL A;  4OC3 A;  4H89 A;  4MI4 A;  2YNC C;  2EWB A;  3PBB A;  2P0W A;  4R87 A;  2CNS A;  2IJZ A;  4BMH A;  2QJ8 A;  2EVN A;  4RUH A;  1I21 A;  2VI7 A;  1NSA A;  2VZY A;  4C2X A;  2CNT A;  3C26 A;  1R43 A;  2R7H A;  3S6G A;  3PB4 X;  5G21 A;  2O53 A;  4OC2 A;  4CPA A;  2AFZ A;  2ZEN A;  3D7F A;  1Z2L A;  1PUA A;  3W6S A;  4FD7 A;  5HXD A;  4RN7 A;  2ZW4 A;  4F8Z A;  4PSX A;  4A30 A;  1S7K A;  1PCA A;  2B3U A;  2EBJ A;  4P45 A;  2ZEL A;  3IC1 A;  5C82 A;  3G8W A;  4NXY A;  4KUA A;  4JZ0 A;  2C6C A;  2JDC A;  2BEI A;  1VGY A;  4KSF A;  1AUG A;  4LUA A;  1ELM P;  2C27 A;  4CAV A;  2AE6 A;  1IGB A;  4NGM A;  4B11 A;  2ZPA A;  4F9V A;  2GE3 A;  4HNW B;  4PXD A;  2YNE A;  3K2K A;  2HV2 A;  3TO9 A;  3B3S A;  1XBU A;  4M6G A;  2VXK A;  5LRK A;  5AGE A;  1QSR A;  3TE4 A;  2ZW5 A;  3PB7 X;  3NH4 A;  2QEC A;  4MCQ A;  1Y0Y A;  1KWM A;  4FWU A;  5JPH A;  1WWZ A;  4XPD B;  1TKF A;  2GRE A;  2IMO A;  3TO6 A;  2GLF A;  3BJ8 A;  3NE8 A;  5LYD A;  2GU2 A;  1ZG9 A;  2ZOF A;  2B3V A;  1CPS A;  3BLN A;  3TOA A;  3VWE A;  4NCZ A;  2R98 A;  3W6X A;  3PB9 X;  2G0B A;  4A31 A;  3N7Z A;  4YRH A;  1LCP A;  3SJG A;  2BL1 A;  4P4B A;  3TO7 A;  3PEI A;  3V7Z A;  3IU1 A;  4H6Z A;  2V8H A;  4MCS A;  1Y0R A;  4HKF A;  5JQ4 A;  1YW4 A;  2FCK A;  2Z0Z A;  4AVA A;  2Q7B A;  4CYN A;  1HDU A;  1IOF A;  3OWC A;  3SJE A;  2C6P A;  5LYF A;  1Q7L A;  3S9L A;  1J4J A;  1JWQ A;  1Q2C A;  1AMP A;  1QSO A;  3UY5 A;  2RB7 A;  5IB0 A;  4OAD A;  4CGO A;  1VHS A;  2WPW A;  3SHP A;  2Q4V A;  4F6A A;  1YR0 A;  2EO8 A;  1XFO A;  2ZEO A;  3P2H A;  4M3S A;  4FAI A;  4UFV A;  1TKJ A;  1BLL E;  1L0C A;  2PVW A;  5DWN A;  1S3Z A;  3SXO A;  4B13 A;  3EXN A;  1YLE A;  2Z3O A;  3B3T A;  2XEF A;  4IUS A;  4QVT A;  3SI2 A;  4F0Y A;  5K8N A;  1XJO A;  2VQY A;  5AG4 A;  2P6F A;  3LMS A;  2CTB A;  1YSJ A;  3KQX A;  4AVB A;  7CPA A;  1CM0 A;  5H86 A;  4B5P B;  4CAX A;  2Q51 A;  4FUU A;  4MBU A;  2G3T A;  4NGN A;  1CP6 A;  4UWI A;  2O28 A;  1P0H A;  2RC4 A;  3EC4 A;  5EC4 A;  5J1Q A;  5G22 A;  5K8O A;  4Y49 B;  5HVF A;  1V0C A;  4ZX9 A;  5F48 A;  1F2O A;  2EUI A;  4DNC A;  1YLO A;  3IWE A;  3EFA A;  6CPA A;  1H8L A;  2FVG A;  5K8M A;  3B7I A;  2I00 A;  4QC6 A;  3FEC A;  1GYT A;  2J9A A;  4RI1 A;  4X3R A;  1M4L A;  1NE9 A;  5ELY A;  3VAR A;  1Y7R A;  2Z3N A;  1PU9 A;  1QQ9 A;  4P4D A;  2Z3L A;  4CAE A;  1IYK A;  1OBR A;  4P4F A;  3DNS A;  4IHM A;  4R8F A;  5ISV A;  3R9G A;  5IV0 A;  1LAN A;  5E96 A;  2FIW A;  1TIQ A;  4KSA A;  4BD9 A;  3PP9 A;  4C2Z A;  4KSI A;  2P6E A;  3LAC A;  3VH9 A;  5DS0 A;  4UFX A;  4C68 A;  3KHZ A;  2OZG A;  2CF4 A;  4C7H A;  1UFH A;  4R3L A;  2ZEG A;  3W91 A;  5KTA A;  4DUK A;  1XEB A;  2OU2 A;  4I49 A;  3CT9 A;  4QB9 A;  3IFE A;  2DPS A;  4Q36 A;  2CIJ A;  1Q2D A;  1XIX A;  1TF9 A;  1ZG8 A;  2VEZ A;  2ZEM A;  4B5O A;  2CNM A;  4Q7A A;  4A37 A;  2G3A A;  2C1C A;  2NSM A;  4OME A;  2GIV A;  2OB0 A;  4AB7 A;  1CBX A;  3PZJ A;  1XOV A;  1QMU A;  4GM5 A;  4PXE A;  4B12 A;  4KZT A;  4MHP A;  1R57 A;  2PJC A;  3FB3 A;  3IEH A;  4B5P A;  3HLP A;  2J8R A;  2PJ1 A;  4NJR A;  3SXN A;  3TCV A;  3D67 A;  3TX8 A;  4P44 A;  5F47 A;  5K8P A;  1QSM A;  1XF8 A;  2Q44 A;  3H8G A;  3DSB A;  4CGL A;  3FIX A;  4YU9 A;  4F9U A;  4R3K A;  2P6G A;  2H5M A;  1X12 A;  1Z8T A;  4KOU A;  3IWG A;  4KOS A;  3S6H A;  2ZEF A;  5LYL A;  5LRJ A;  1B87 A;  4X8I A;  4II9 A;  1Y7E A;  1MK4 A;  4CYP A;  4JYW A;  5GCN A;  1QSN A;  1LOK A;  2NMT A;  4NF1 A;  3H5Z A;  1F57 A;  2REF A;  2VBQ A;  3ISX A;  1BAV A;  4B10 A;  2QIR A;  2PIZ A;  4CGM A;  2BOA A;  1TKH A;  2CTC A;  2PQ8 A;  3WR7 A;  4CRZ B;  2FT0 A;  2Z3P A;  2QYV A;  4KVM E;  2PJ4 A;  4JLY A;  4UFW A;  2Z10 A;  4P4E A;  1IU8 A;  5I0C A;  3RNZ A;  1IIC A;  2JLM A;  3D8P A;  3IO1 A;  5H84 A;  3KHX A;  3BJ7 A;  4MMO A;  4NGQ A;  4YWY A;  3WT4 A;  2G9D A;  2POK A;  3LD2 A;  4UA3 A;  1ZLI A;  3KR5 A;  4AG7 A;  1M4G A;  1VKC A;  4MFL A;  3G3S A;  4MJ8 A;  2R8V A;  5HVG A;  1Y9W A;  4A38 A;  3B35 A;  3I1U A;  2XEI A;  4K3N A;  3H8F A;  3DR8 A;  3R95 A;  1Z4E A;  4KOY A;  2IL4 A;  1IYL A;  2F7V A;  4OIW A;  3HUV A;  3F5B A;  4L89 A;  3B2Y A;  5CNP A;  4KVX A;  4OC0 A;  4MFZ A;  3PB8 X;  4ZY2 A;  3D3S A;  4KOW A;  4XNH B;  4C7I A;  2WYR A;  4R6T A;  2XEJ A;  4FD6 A;  1Z5R A;  4NGS A;  1FY7 A;  2PJ0 A;  3K9U A;  4Q38 A;  4EVY A;  2AFX A;  4GS4 A;  4MHY A;  1PYT B;  2PJ6 A;  4KOT A;  2GFQ A;  2X7B A;  2PDO A;  1R3N A;  1BO4 A;  4E0A A;  5J8C A;  3LWU A;  1S7F A;  2F8H A;  3ZZI A;  5F09 A;  1VIX A;  3EO4 A;  2FSR A;  3MGD A;  4UWJ A;  5HVH A;  2REE A;  3PFO A;  3DLJ A;  2B58 A;  4LQG A;  4B14 A;  3TTH A;  2HB6 A;  1CP7 A;  2F5I A;  4CGN A;  5A27 A;  1BPN A;  2AFM A;  3I9S A;  2ANP A;  2JEW A;  5KTD A;  4NGP A;  3SJX A;  1RO5 A;  2ZEE A;  4UEE A;  4MHD A;  1X10 A;  1JQG A;  4KLV A;  1K4J A;  2I3C A;  1IB1 E;  3R9E A;  3PB6 X;  4K30 A;  3TFY A;  3D7G A;  4M6I A;  4MCR A;  2ZW6 A;  4G1P A;  1ARM A;  3R96 A;  3V8I A;  1XRY A;  3GKR A;  2CY2 A;  4PPZ A;  5HMN A;  3PGP A;  1ZLH A;  3CXP A;  4XPD C;  5F49 A;  4FD5 A;  3FRM A;  1KUX A;  4KUB A;  1YQE A;  3BI0 A;  5FVJ A;  2PR1 A;  2O4H A;  3KAS A;  2JBJ A;  3F8K A;  3TOB A;  4TNU A;  1IID A;  1EE3 P;  4W9Y A;  3FED A;  2PJ8 A;  3H4Q A;  2RFH A;  3RO0 A;  5C88 A;  2Q04 A;  4JD6 A;  3T9Y A;  2OZH A;  4GXH A;  1LFW A;  3D4U A;  1Z4R A;  4IF5 A;  1KZF A;  2FL4 A;  2Q4Y A;  5IB9 A;  2V8D A;  3PBE A;  2DF5 A;  2Q43 A;  3N5F A;  3FMC A;  4UCN A;  4C2Y A;  1RXT A;  4P6Y A;  1XE4 A;  2WPX A;  3P2F A;  4Z65 A;  4ZY1 A;  3FEE A;  2PCU A;  4CAF A;  1S7N A;  2J8M A;  1YVO A;  2BO9 A;  3NFZ A;  4HNY B;  5BWA B;  4PXC A;  3VAT A;  3DDD A;  1LRZ A;  1ZG7 A;  4WWV A;  4M85 A;  2GLJ A;  4R9M A;  3SI0 A;  2FXF A;  1IY7 A;  3QAH A;  1OZP A;  3JTK A;  3QNV A;  4PK2 A;  1AYE A;  3B8G A;  4NJQ A;  4UEF A;  5G20 A;  4CYQ A;  5A28 A;  4FBE A;  2B4D B;  2EK8 A;  3B3W A;  3FVL A;  4ORF A;  1CX8 A;  4H6U A;  5D29 A;  1YW6 A;  3S6F A;  4A95 A;  3GY9 A;  1KUY A;  2DXQ A;  2PJ9 A;  4OC4 A;  1P4N A;  5AG6 A;  4JXQ A;  2EK9 A;  1WK4 A;  1TXR A;  3CPA A;  3S9N A;  4NGT A;  2R1I A;  4ZY0 A;  4R76 A;  3CDX A;  3FJU A;  4Y49 C;  3WC7 A;  1S60 A;  3B3V A;  3GYA A;  2WUU A;  4LX9 A;  3CXS A;  4UEZ A;  4KOX A;  2YNC A;  2PSW A;  5JM6 A;  5G1Z A;  2BCO A;  3JVN A;  3VWD A;  2PRQ A;  2JDD A;  4EME A;  4IK2 A;  2Q7S A;  3KGQ A;  2PRB A;  8CPA A;  4KLW A;  2B4B A;  4JXR A;  4UBR A;  4JJX A;  4X5K A;  2C6G A;  2ZXV A;  3GB0 A;  4MHN A;  2I79 A;  3KKW A;  1M4I A;  1CPX A;  2ATR A;  3D7D A;  2FIA A;  2QML A;  4MFJ A;  4X2T A;  3RBU A;  1UWY A;  2V77 A;  1MJ9 A;  4QBJ A;  2OH1 A;  5THW A;  2PJ2 A;  4MFP A;  2HC9 A;  4AXV A;  2YGW A;  3FF3 A;  4NSQ A;  2ABZ A;  2JEV A;  4UIA A;  3IJ3 A;  2FS5 A;  4ZYQ A;  4EWT A;  5JH9 A;  4P4I A;  1QST A;  3D2M A;  3H8E A;  2OOT A;  4PK3 A;  2PC1 A;  4A2Z A;  1M4D A;  2B5G B;  3PFE A;  4E2A A;  3F0A A;  2BSW A;  4MFQ A;  2PJB A;  3BXM A;  1YX0 A;  2Q0Y A;  3KI9 A;  4NEX A;  2ZEH A;  1XMT A;  2BUE A;  3IU2 A;  3T90 A;  3T8W A;  3V38 A;  4U5Y A;  2B4D A;  2PJ7 A;  3D7H A;  3NA6 A;  2Z3M A;  2D4P A;  4MRI A;  4E8O A;  1BPM A;  2V8V A;  4A94 A;  3WC6 A;  3S9M A;  3RYO A;  3D2P A;  4P10 A;  5KTC A;  3DGV A;  4CAW A;  3PRT A;  3WC5 A;  1I1D A;  3CZX A;  2PJ3 A;  2XEG A;  1IOI A;  2Z3K A;  4FD4 A;  4LQ6 A;  1BOB A;  1YK3 A;  5D8N A;  1S5K A;  4BIN A;  3JUW A;  4L8A A;  4M6H A;  2AFS A;  3FBU A;  4RS2 A;  2WZN A;  3FH4 A;  1U6M A;  4F0X A;  1NMT A;  1RTQ A;  3CPX A;  1LAM A;  2DPT A;  2GAN A;  2FE7 A;  3EY5 A;  4ZBG A;  3ISZ A;  3FX6 A;  3IIB A;  5I4M A;  3A9L A;  4U9Z A;  2VL1 A;  3NH8 A;  4MCP A;  1ZO0 A;  2HUZ A;  2V8G A;  1CG2 A;  3MRU A;  3NE7 A;  4J3G A;  5IX3 A;  2D4O A;  4KVO E;  2VZZ A;  4XPK A;  1CJW A;  1Z9U A;  2NYQ A;  2Q4Z A;  5HH1 A;  3R1K A;  3WAB A;  2Z11 A;  4OC5 A;  5EBV A;  4HNX B;  4MHZ A;  4CRY B;  2AFO A;  4KOV A;  3MN8 A;  1Z8X A;  2PIY A;  2PJA A;  1GHE A;  3BI1 A;  1Y9K A;  3GLJ A;  4OC1 A;  4PSW A;  3S6K A;  4A33 A;  4U9Y A;  4MY0 A;  1DE4 C;  2HQY A;  4O23 A;  1M1D A;  2AFU A;  4KOR A;  4PXB A;  4KS9 A;  1B6B A;  1I12 A;  4EFD A;  3ZJ0 A;  4AVC A;  3D66 A;  3SI1 A;  4ZI6 A;  4R7M A;  5LRG A;  3DR6 A;  2DEA A;  4JWP A;  2PE3 A;  4IAV A;  4AG9 A;  4OKO A;  5DWM A;  2B5G A;  3KQZ A;  4UF4 A;  3D68 A;  1Z8W A;  3SJF A;  4ZGY B;  1LAP A;  2KCW A;  2ZED A;  3KR4 A;  4BBH A;  1ARL A;  3NH5 A;  3FYN A;  4CYO A;  4H2K A;  3E0K A;  5JGF A;  2OZU A;  2CXA A;  4DYO A;  3QB8 A;  1NSL A; 
#chains in the Genus database with same CATH homology
 1YRE A;  2ZW7 A;  3IGR A;  4ONU A;  2PR8 A;  2YND A;  2J8N A;  4YFJ A;  4OAE A;  2Y0M A;  4XNH C;  1M44 A;  1Q2Y A;  5J8F A;  4OLL A;  2WSA A;  4YGO A;  1ON0 A;  5AG5 A;  2K5T A;  1YGH A;  4MY3 A;  4UCP A;  5F46 A;  1SQH A;  3I3G A;  4MFK A;  5AG7 A;  4A32 A;  2AJ6 A;  3CXQ A;  2A4N A;  4PV6 A;  3FXT A;  1YVK A;  3R9F A;  2ARH A;  4QUS A;  4CGP A;  3TT2 A;  3FNC A;  1KUV A;  4XPL A;  4CS0 B;  3LOD A;  1N71 A;  1S7L A;  4UCM A;  1MJA A;  1MJB A;  4R57 A;  4H89 A;  4MI4 A;  2YNC C;  2P0W A;  4R87 A;  2CNS A;  4BMH A;  2EVN A;  1I21 A;  2VI7 A;  2VZY A;  4C2X A;  2CNT A;  3C26 A;  2R7H A;  3S6G A;  5G21 A;  1PUA A;  3W6S A;  4FD7 A;  2ZW4 A;  4PSX A;  4A30 A;  1S7K A;  2B3U A;  5C82 A;  3G8W A;  4NXY A;  4KUA A;  2JDC A;  2BEI A;  4KSF A;  4LUA A;  2C27 A;  4CAV A;  2AE6 A;  4B11 A;  2ZPA A;  2GE3 A;  4HNW B;  2YNE A;  2HV2 A;  3TO9 A;  2VXK A;  5AGE A;  1QSR A;  3TE4 A;  2ZW5 A;  2QEC A;  5JPH A;  1WWZ A;  4XPD B;  3TO6 A;  3BJ8 A;  3BLN A;  3TOA A;  2B3V A;  3VWE A;  4NCZ A;  2R98 A;  3W6X A;  2G0B A;  4A31 A;  3N7Z A;  4YRH A;  2BL1 A;  3TO7 A;  3IU1 A;  4H6Z A;  5JQ4 A;  4HKF A;  2FCK A;  4AVA A;  2Z0Z A;  2Q7B A;  4CYN A;  3OWC A;  1J4J A;  1Q2C A;  1QSO A;  3UY5 A;  5IB0 A;  4OAD A;  4CGO A;  1VHS A;  2WPW A;  3SHP A;  2Q4V A;  4F6A A;  1YR0 A;  3P2H A;  4M3S A;  4UFV A;  1L0C A;  5DWN A;  1S3Z A;  3SXO A;  4B13 A;  3EXN A;  1YLE A;  2Z3O A;  4QVT A;  4IUS A;  4F0Y A;  5AG4 A;  2VQY A;  2P6F A;  4AVB A;  1CM0 A;  5H86 A;  4B5P B;  4CAX A;  4MBU A;  2G3T A;  4UWI A;  2O28 A;  1P0H A;  2RC4 A;  3EC4 A;  5EC4 A;  5G22 A;  4Y49 B;  1V0C A;  5F48 A;  2EUI A;  4DNC A;  3IWE A;  3EFA A;  4QC6 A;  2I00 A;  4RI1 A;  1NE9 A;  2Z3N A;  1Y7R A;  1PU9 A;  2Z3L A;  4CAE A;  1IYK A;  3DNS A;  5ISV A;  3R9G A;  5IV0 A;  5E96 A;  2FIW A;  1TIQ A;  4KSA A;  3PP9 A;  4C2Z A;  2P6E A;  4UFX A;  4C68 A;  2OZG A;  4C7H A;  1UFH A;  4R3L A;  3W91 A;  5KTA A;  1XEB A;  2OU2 A;  4I49 A;  4QB9 A;  2DPS A;  4Q36 A;  1Q2D A;  1XIX A;  2VEZ A;  4B5O A;  2CNM A;  2G3A A;  4AB7 A;  2GIV A;  2OB0 A;  3PZJ A;  4B12 A;  4KZT A;  1R57 A;  3FB3 A;  4B5P A;  2J8R A;  3SXN A;  3TCV A;  5F47 A;  1QSM A;  1XF8 A;  2Q44 A;  4CGL A;  3DSB A;  3FIX A;  4R3K A;  2P6G A;  2H5M A;  4KOU A;  3IWG A;  4KOS A;  3S6H A;  1B87 A;  4II9 A;  1MK4 A;  4CYP A;  5GCN A;  1QSN A;  2NMT A;  4NF1 A;  3H5Z A;  2REF A;  2VBQ A;  4B10 A;  2QIR A;  4CGM A;  3WR7 A;  2PQ8 A;  4CRZ B;  2FT0 A;  2Z3P A;  4KVM E;  4JLY A;  4UFW A;  2Z10 A;  5I0C A;  1IIC A;  2JLM A;  3D8P A;  5H84 A;  3BJ7 A;  3LD2 A;  4UA3 A;  4AG7 A;  1M4G A;  1VKC A;  4MFL A;  3G3S A;  4MJ8 A;  2R8V A;  1Y9W A;  3DR8 A;  3R95 A;  1Z4E A;  4KOY A;  2IL4 A;  1IYL A;  3F5B A;  4L89 A;  5CNP A;  4KVX A;  4MFZ A;  3D3S A;  4KOW A;  4XNH B;  4C7I A;  4FD6 A;  1FY7 A;  3K9U A;  4Q38 A;  4EVY A;  4GS4 A;  4KOT A;  2X7B A;  2PDO A;  1BO4 A;  4E0A A;  5J8C A;  1S7F A;  3ZZI A;  3EO4 A;  2FSR A;  3MGD A;  4UWJ A;  2REE A;  4B14 A;  2B58 A;  3TTH A;  5A27 A;  2F5I A;  4CGN A;  3I9S A;  5KTD A;  1RO5 A;  4MHD A;  4KLV A;  1K4J A;  1IB1 E;  3R9E A;  4K30 A;  3TFY A;  2ZW6 A;  3R96 A;  3V8I A;  3GKR A;  2CY2 A;  5HMN A;  3PGP A;  3CXP A;  4XPD C;  5F49 A;  4FD5 A;  3FRM A;  1KUX A;  4KUB A;  5FVJ A;  2PR1 A;  3F8K A;  3TOB A;  1IID A;  3H4Q A;  5C88 A;  2Q04 A;  4JD6 A;  3T9Y A;  2OZH A;  1Z4R A;  4IF5 A;  1KZF A;  2FL4 A;  2Q4Y A;  4UCN A;  4C2Y A;  1RXT A;  1XE4 A;  2WPX A;  3P2F A;  4CAF A;  1S7N A;  2J8M A;  1YVO A;  5BWA B;  4HNY B;  3DDD A;  1LRZ A;  4M85 A;  4R9M A;  2FXF A;  3QAH A;  1OZP A;  3JTK A;  4CYQ A;  4PK2 A;  3B8G A;  5G20 A;  5A28 A;  2B4D B;  4ORF A;  4H6U A;  3S6F A;  4A95 A;  3GY9 A;  1KUY A;  2DXQ A;  5AG6 A;  1P4N A;  4JXQ A;  1WK4 A;  2R1I A;  4Y49 C;  1S60 A;  3GYA A;  4LX9 A;  2WUU A;  3CXS A;  4KOX A;  2YNC A;  2PSW A;  5G1Z A;  3JVN A;  3VWD A;  2JDD A;  2PRB A;  4KLW A;  2B4B A;  4JXR A;  4UBR A;  4JJX A;  4X5K A;  2ZXV A;  2I79 A;  3KKW A;  1M4I A;  2ATR A;  4CAW A;  2FIA A;  2QML A;  4MFJ A;  4QBJ A;  1MJ9 A;  2OH1 A;  4MFP A;  2YGW A;  4NSQ A;  2JEV A;  2FS5 A;  1QST A;  3D2M A;  4PK3 A;  2PC1 A;  4A2Z A;  1M4D A;  2B5G B;  4E2A A;  3F0A A;  2BSW A;  4MFQ A;  1YX0 A;  2Q0Y A;  4NEX A;  3T90 A;  1XMT A;  2BUE A;  3IU2 A;  4U5Y A;  2B4D A;  4E8O A;  2Z3M A;  2D4P A;  5KTC A;  3RYO A;  3D2P A;  1I1D A;  2Z3K A;  4FD4 A;  1BOB A;  1YK3 A;  1S5K A;  3JUW A;  4L8A A;  3FBU A;  4RS2 A;  1U6M A;  4F0X A;  1NMT A;  2DPT A;  2GAN A;  3EY5 A;  2FE7 A;  4ZBG A;  3A9L A;  4U9Z A;  1ZO0 A;  2HUZ A;  3NE7 A;  5IX3 A;  4J3G A;  2D4O A;  4KVO E;  2VZZ A;  4XPK A;  1CJW A;  1Z9U A;  5HH1 A;  3R1K A;  2Z11 A;  5EBV A;  4HNX B;  4CRY B;  4KOV A;  4PSW A;  3S6K A;  1GHE A;  1Y9K A;  4A33 A;  4U9Y A;  4MY0 A;  2HQY A;  1M1D A;  4KOR A;  4KS9 A;  1B6B A;  1I12 A;  3ZJ0 A;  4AVC A;  3DR6 A;  4JWP A;  4AG9 A;  5DWM A;  2B5G A;  4ZGY B;  2KCW A;  4BBH A;  3FYN A;  4CYO A;  3E0K A;  2OZU A;  2CXA A;  3QB8 A;  1NSL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...