4CYPA

Leishmania major n-myristoyltransferase in complex with a pyrrolidine inhibitor.
Total Genus 123
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
123
sequence length
411
structure length
411
Chain Sequence
b'AHAFWSTQPVPQTEDETEKIVFAGPMDEPKTVADIPEEPYPIASTFEWWTPNMEAADDIHAIYELLRDNYVEDDDSMFRFNYSEEFLQWALCPPNYIPDWHVAVRRKADKKLLAFIAGVPVTLRMGTPKYMKVKAQEKGEGEEAAKYDEPRHICEINFLCVHKQLREKRLAPILIKEATRRVNRTNVWQAVYTAGVLLPTPYASGQYFHRSLNPEKLVEIRFSGIPAQYQKFQNPMAMLKRNYQLPSAPKNSGLREMKPSDVPQVRRILMNYLDSFDVGPVFSDAEISHYLLPRDGVVFTYVVENDKKVTDFFSFYRIPSTVIGNSNYNLLNAAYVHYYAATSIPLHQLILDLLIVAHSRGFDVCNMVEILDNRSFVEQLKFGAGDGHLRYYFYNWAYPKIKPSQVALVML'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLYCYLPEPTIDE N-TETRADECANOYLTRANSFERASE
publication title Structure-Based Design of Potent and Selective Leishmania N- Myristoyltransferase Inhibitors.
pubmed doi rcsb
source organism Leishmania major
molecule tags Transferase
total genus 123
structure length 411
sequence length 411
ec nomenclature ec 2.3.1.97: Glycylpeptide N-tetradecanoyltransferase.
pdb deposition date 2014-04-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01233 NMT Myristoyl-CoA:protein N-myristoyltransferase, N-terminal domain
A PF02799 NMT_C Myristoyl-CoA:protein N-myristoyltransferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.170 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4cypA00
4CYNA 4CYPA 3IU2A 4C2ZA 4CGMA 4UCPA 3IU1A 4B11A 5G21A 5A28A 4A30A 4C7HA 4C2XA 4C2YA 4CGPA 4C7IA 2YNCA 4CGNA 5G22A 4A33A 4UCNA 3IWEA 4B13A 4UFXA 4A2ZA 3JTKA 4UFVA 4CAFA 4UFWA 5AG4A 5AGEA 2YNDA 2YNCC 4B10A 3H5ZA 4CGLA 5A27A 4BBHA 4A32A 4A31A 5AG7A 4C68A 4CGOA 4CYQA 4CAEA 2WUUA 5AG5A 5G20A 5G1ZA 2WSAA 4B14A 2YNEA 4UCMA 4A95A 5AG6A 4CYOA 4B12A
chains in the Genus database with same CATH superfamily
4FD6A 5EC4A 2Z3LA 1JWQA 2C6CA 1H8LA 4R87A 3RZAA 4EWTA 3D3SA 3LACA 1XMTA 2I3CA 4KVOE 4Y49C 3S6FA 5IB9A 3PB6X 3KI9A 4IF5A 1HDQA 1ON0A 4Q7AA 3SI2A 2P0WA 5HMNA 3FBUA 2JDDA 4J3GA 3B3TA 2QMLA 5EMIA 4OIWA 4NGPA 1BOBA 1TKFA 1LAPA 3LD2A 2XEGA 2BCOA 2V8GA 4MBUA 2K5TA 4CAEA 3W6SA 5AG5A 4AB7A 1Z9UA 3B3SA 4ZX9A 4BD9A 2B58A 2OR4A 5F09A 2R98A 2F5IA 3SXOA 2OH1A 1LRZA 3TE4A 1HEEA 3SJGA 4M3SA 4UA3A 5LYLA 4P4BA 2FSRA 4Y49B 2V8HA 4C7HA 2PC1A 4Z65A 5J8CA 4KOTA 3ZZIA 5KTDA 8CPAA 3EC4A 3D2MA 1PYTB 4DYOA 3G3SA 1XBUA 1M4LA 2PJ2A 1R3NA 3KASA 4EVYA 1NSAA 1XF8A 4MHDA 4RUHA 5CNPA 1CP7A 3MN8A 3R9FA 3WC5A 5AG7A 1S60A 3A9LA 4PXBA 4CAXA 2WUUA 1BPNA 1TF9A 5G20A 3D7GA 1WWZA 2PJ3A 4P10A 1NE9A 3BLNA 3CXPA 3ISXA 1CX8A 2PSWA 4UF4A 3H8GA 3LODA 3H8FA 4UIBA 2HUZA 4DUKA 3T8WA 3NFZA 2JLMA 1CP6A 2PRBA 5IB0A 2Q4VA 1QSRA 3IJ3A 4MHNA 4C7IA 2AFZA 2ZXVA 2GLJA 4PV6A 3GY9A 4ZBGA 3TO6A 1Y7RA 4F0YA 5JH9A 4A39A 1P4NA 3F8KA 1CJWA 4NEXA 2FT0A 2HB6A 2DEAA 3DDDA 4NXYA 4WJBA 2V77A 2Q4ZA 3TX8A 1ZG7A 1RTQA 2Z3KA 4L8AA 5GCNA 3JVNA 3SJXA 5F46A 4F8ZA 4X5KA 4GS4A 3K2KA 3I1UA 1EE3P 3PGPA 1YGHA 4WWVA 1L0CA 3CPXA 4I49A 1M44A 4CS0B 5C82A 2ZEDA 1Y7EA 5JM6A 4Q36A 4UEEA 2OZGA 3B8GA 4A38A 4GXHA 2JBKA 2POKA 3B3VA 4W9YA 2I79A 3TOBA 4F9VA 5LRJA 4JZ0A 3RO0A 3PEIA 3UY5A 1NMTA 1WK4A 1YX0A 3FEDA 3V38A 4A33A 4B5PA 4ZI6A 1PU9A 3OWCA 2VZYA 1B6BA 1X12A 2Q43A 4U9ZA 4JXRA 4MCSA 4P4DA 1FNOA 3IWGA 5AGEA 4NGSA 5CPAA 1Q7LA 4BINA 2QYVA 3GYAA 4QBJA 3GIUA 2PQ8A 3KR4A 4PXCA 4UBRA 2D4PA 4YU9A 3B35A 2NSMA 4RI1A 4NFRA 1YLOA 2CNTA 3R9EA 4P4EA 4A95A 5J8FA 3T9YA 5AG6A 4H2KA 4RN7A 5IV0A 2A4NA 4OC0A 5J1QA 1OZPA 4BMHA 5A28A 1XRYA 1PUAA 3VARA 2REFA 4NSQA 1BO4A 1YVOA 4JXQA 4IHMA 1Z8XA 1KUXA 2F7VA 2DF5A 6CPAA 1KWMA 3CXQA 4HNYB 4UCNA 2QECA 1YSJA 4JD6A 1M4DA 2Z3MA 3R95A 2EO8A 3IEHA 3P2FA 5AG4A 5CBMA 3S9LA 2ZEOA 3F0AA 3TFYA 2QVPA 3R1KA 4UIAA 4B5OA 3D66A 4LX9A 1XOVA 4CGOA 1ZLHA 3S9MA 1IGBA 3HUVA 4CPAA 3FH4A 3PB4X 5E96A 3FMCA 3S6HA 4AVCA 4R57A 5LRGA 2HC9A 2EVNA 4JYWA 1GHEA 4ZY2A 3V8IA 4CAWA 2PJBA 4YGOA 2ZW6A 3T90A 4UCPA 1MJ9A 4B11A 4G1PA 3G8WA 3TO7A 1Z4RA 3KGQA 5HVHA 3PFEA 1Y9WA 2IMOA 2GLFA 1ELMP 2Q44A 1S7NA 2PVWA 4XNHB 3DGVA 2QJ8A 4CRYB 3JTKA 3FIXA 4L89A 1LANA 1LAMA 4TWEA 3SXNA 1IYLA 2AFWA 5A27A 5I0CA 2OB0A 2PJ5A 1QSOA 1XFOA 2CNSA 4RS2A 4P4JA 2BUEA 1ELLP 3PBBA 4M6IA 2AFSA 2J8MA 1XIXA 2CF4A 3L2NA 2ZENA 4KUAA 4AG9A 5LYFA 4KVXA 1XMBA 3DSBA 4KVME 3B3CA 3TOAA 2XEFA 3H4QA 3D67A 5K8OA 5G21A 2IJZA 3I9SA 2H5MA 3VWEA 1IICA 2FIAA 4C2XA 3B7IA 1FT7A 2GU2A 4NJRA 3S6GA 1HDUA 4P4FA 1CG2A 2VQYA 1TKHA 3FYNA 1VIXA 2KCWA 5HVFA 1IOIA 5K8MA 1Q2CA 2IQ6A 4X3RA 3CT9A 4KS9A 4F9UA 5F48A 2PJCA 4MFKA 4MCQA 4UEZA 4K30A 3D2PA 2PJ7A 4DNCA 2Q04A 2ZW5A 5DS0A 3PZJA 4K3NA 4C68A 4ONWA 4KSFA 4YFJA 4MXUA 2Q51A 2FIWA 3EO4A 3RBUA 2CTBA 4MI4A 3IC1A 4MY0A 3VWDA 3WT4A 5DWNA 5BWAB 1Z2LA 1Q2YA 4ZY1A 1CBXA 2PR8A 2O4HA 3GKRA 3D68A 5ELYA 2GREA 1CPSA 4QC6A 2EUIA 1R57A 4ZGYB 3TCVA 3FRMA 2VZZA 3IGRA 2B4DB 2G3TA 5FVJA 1K4JA 4XPDC 1F2PA 3D4UA 4MRIA 5G22A 2GE3A 4OC2A 4B13A 4UFXA 4IAVA 4A94A 2CXAA 4UFWA 1RO5A 2ZOFA 4ONUA 1S7FA 2REEA 4DJLA 3MGDA 4A31A 1IYKA 3LMSA 5H86A 2Z3OA 2G0BA 1UFHA 2R8VA 1VKCA 3NE8A 2Z0ZA 4JJXA 4OMEA 4F0XA 1QSMA 5THWA 4HNXB 2CIJA 1V0CA 2RB7A 2PJ6A 1M4GA 1I1DA 2J8RA 4OLLA 4C2ZA 5KTAA 2ABZA 1S5KA 4AXVA 1LCPA 3D7DA 4CRZB 2DPSA 3BI1A 3WABA 5D29A 1QSTA 4KOWA 2O53A 2EWBA 4NGTA 2BO9A 2XEJA 3FVLA 4X2TA 2ATRA 2J9AA 4A2ZA 4CAFA 3HLPA 4PSXA 2PJ0A 1X10A 4NGRA 4PXDA 2BSWA 4R6TA 2IL4A 2NMTA 2FL4A 2XEIA 3ISZA 3SJFA 1YR0A 2PDOA 1BAVA 4LQGA 1TXRA 5LRKA 2J8NA 1IY7A 3KQXA 3DLJA 3NA6A 3NH4A 3BXMA 1ZG9A 1KUYA 4CYNA 4NJQA 3IU2A 1ZG8A 4EMEA 5JQ4A 2YGWA 5JPHA 3IIBA 4FD4A 2BOAA 3FF3A 2PIYA 1I12A 1F2OA 2Z10A 2VXKA 3EXNA 2I00A 3H8EA 3N7ZA 4KSAA 3TC8A 3IWEA 4NGNA 1BPMA 1ARMA 1LFWA 2ZW4A 5F49A 2PIZA 4P45A 4M6GA 2HQYA 2ZOGA 2AFXA 4B10A 4CGLA 2F8HA 2PJAA 4A32A 1J4JA 5HXDA 4A37A 1TKJA 4KOYA 4II9A 4H6ZA 2EK9A 4Q38A 3RNZA 4XPLA 3LWUA 2YNEA 3FX6A 2P6EA 2C6PA 4ZX8A 3C26A 2JDCA 4OKOA 3FNCA 3K9UA 3NH8A 3NH5A 1MK4A 3V7ZA 3IU1A 1IIDA 4LQ6A 4R3LA 1MJBA 3CPAA 4OIDA 1XJOA 2ZEHA 3IFEA 4R8FA 4FUUA 3IO1A 4A30A 4HPSA 3D7FA 2P6FA 1TF8A 4CGPA 2YNCA 4KORA 3R9GA 5HVGA 1IB1E 3PFOA 2BEIA 2B5GB 2FXFA 3D7HA 4MFJA 1CPXA 2C6GA 4KZTA 2G3AA 2ZELA 2GIVA 5LYDA 2O28A 4JLYA 1AYEA 1VHOA 1YLEA 2HV2A 4R76A 2AFOA 1IU8A 5DWMA 2Q0YA 2WSAA 2R7HA 2Y0MA 1YVKA 2Q7SA 4B14A 4UCMA 3BJ8A 1I21A 2OOTA 4UWJA 1Y9KA 3QAYA 4NGMA 4B12A 3W6XA 3GB0A 1P0HA 3KQZA 5K8PA 1Y0YA 1JQGA 4OADA 3B2YA 4GM5A 5C88A 2B3VA 3CDXA 2ANPA 3QAHA 4ORFA 2ARHA 3IWWA 4QVTA 3R96A 4P4IA 2RFHA 4KOVA 4MMOA 2AE6A 4FAIA 3RYOA 4UFVA 4YWYA 4U9YA 2DXQA 1CM0A 4B5PB 2PRQA 1YQEA 5EBVA 2VBQA 3PP9A 3KR5A 4BBHA 5K8NA 2ZEMA 4QUSA 4B6ZA 4ZY0A 1QMUA 3FECA 4HKFA 4R7MA 1SQHA 4P44A 2FVGA 3WR7A 1VHSA 2Z3PA 4MFLA 5G1ZA 2RC4A 4KUBA 2ZEEA 1AUGA 3PB7X 4O23A 1AMPA 2EBJA 2VL1A 4ZYQA 3TT2A 1QSNA 2WYRA 1XE4A 3EFAA 4R9MA 3SI1A 4YRHA 4NF1A 1BLLE 1XEBA 4E8OA 4C2YA 4H89A 4NCZA 1M1DA 3GLJA 1Z5RA 3QB8A 3ZJ0A 2PJ4A 3S9NA 3P2HA 2OU2A 2P6GA 1Y0RA 4IUSA 3FEEA 3S6KA 3KZWA 2ZEPA 4KOXA 2V8DA 4OC3A 3EY5A 4PSWA 2YNCC 3F5BA 4FD7A 3GUXA 5I4MA 3SHPA 3SI0A 2PJ9A 7CPAA 4PK2A 5H84A 3RAMA 4FD5A 4PK3A 2ZPAA 1YW4A 4JWPA 1DTDA 2GFQA 3BJ7A 2BL1A 1UWYA 4KOUA 4CYPA 3E0KA 4CGMA 3QNVA 2JEWA 2FCKA 1YW6A 2ZEGA 1S7LA 5HH1A 3NE7A 4PXEA 1Q2DA 3FB3A 2R1IA 4XPDB 4AVBA 2JEVA 2Q7BA 1B87A 2B5GA 4R3KA 1Z8TA 2B3UA 4QB9A 4LUAA 4E0AA 5IX3A 3DR8A 4MHYA 1LOKA 4UWIA 3H5ZA 2FS5A 2VI7A 3PRTA 4MY3A 1KUVA 2WZNA 4IK2A 4CYQA 4E2AA 1ARLA 4X8IA 1GYTA 3N5FA 5ISVA 1F57A 2Q4YA 2WPWA 2AFUA 2D4OA 3VH9A 1M4IA 2QIRA 3VATA 1U6MA 3DNSA 3JUWA 2WPXA 2AJ6A 2OZHA 3B3WA 4HNWB 1IOFA 2EK8A 2PJ1A 2X7BA 3D8PA 1YREA 4OAEA 4OC4A 4F6AA 2Z11A 4M85A 4M6HA 1NSLA 4FWUA 4OP4A 4TNUA 4OC5A 2FE7A 3CXSA 4XPKA 2CNMA 5D8NA 3WC6A 3TO9A 1KZFA 3KHZA 4MFZA 4PPZA 1FY7A 1ZLIA 2ODFA 2ZEFA 4MCPA 4CAVA 3W91A 3DR6A 1Z8WA 3MRUA 4MFPA 1VGYA 1Z8LA 1PCAA 3JRUA 4EFDA 2JBJA 3BHXA 1VHEA 1YK3A 4KLVA 4KOSA 3PBEA 4UEFA 3SJEA 2PVVA 4FBEA 1Z4EA 5JGFA 2PE3A 4MHPA 4PQAA 4AG7A 2DPTA 3KL9A 1YMEA 1S3ZA 4MCRA 5F47A 1N71A 4H6UA 2Z3NA 2B4DA 2OZUA 1DE4C 4P6YA 2C1CA 4U5YA 3FXTA 1OBRA 1TIQA 3TTHA 1QQ9A 2AFMA 2GANA 3K9TA 2PR1A 5LYIA 5KTCA 4CGNA 1A2ZA 3FJUA 4MJ8A 4XNHC 4AVAA 2PCUA 3BI0A 2G9DA 2YNDA 2V8VA 4MHZA 2CTCA 1MJAA 4OC1A 2PJ8A 4KSIA 3PB8X 1RXTA 3CZXA 4MFQA 1ZO0A 3PB9X 2VEZA 2B4BA 2ZW7A 3KHXA 4KLWA 3I3GA 4NGQA 1R43A 3WC7A 2C27A 1S7KA 2CY2A 3KKWA 4CYOA 2NYQA
chains in the Genus database with same CATH topology
4FD6A 5EC4A 2Z3LA 4R87A 3D3SA 1XMTA 4KVOE 4Y49C 3S6FA 4IF5A 1ON0A 2P0WA 5HMNA 3FBUA 2JDDA 4J3GA 2QMLA 1BOBA 3LD2A 4MBUA 2K5TA 4CAEA 3W6SA 5AG5A 4AB7A 1Z9UA 2B58A 2R98A 2F5IA 3SXOA 2OH1A 1LRZA 3TE4A 4M3SA 4UA3A 2FSRA 4Y49B 4C7HA 2PC1A 5J8CA 4KOTA 3ZZIA 5KTDA 3EC4A 3D2MA 3G3SA 4EVYA 1XF8A 4MHDA 5CNPA 3R9FA 5AG7A 1S60A 3A9LA 4CAXA 2WUUA 5G20A 1WWZA 1NE9A 3BLNA 3CXPA 2PSWA 3LODA 2HUZA 2JLMA 5IB0A 2PRBA 2Q4VA 1QSRA 4C7IA 2ZXVA 4PV6A 4ZBGA 4F0YA 3GY9A 3TO6A 1Y7RA 1P4NA 3F8KA 1CJWA 4NEXA 2FT0A 3DDDA 4NXYA 2Z3KA 4L8AA 5GCNA 5F46A 3JVNA 4X5KA 4GS4A 3PGPA 1YGHA 1L0CA 4I49A 1M44A 4CS0B 5C82A 4Q36A 2OZGA 3B8GA 2I79A 3TOBA 3UY5A 1NMTA 1WK4A 1YX0A 4A33A 4B5PA 1PU9A 3OWCA 2VZYA 1B6BA 4U9ZA 4JXRA 5AGEA 3IWGA 3GYAA 4QBJA 2PQ8A 4UBRA 2D4PA 4RI1A 3R9EA 2CNTA 4A95A 5J8FA 3T9YA 5AG6A 5IV0A 2A4NA 1OZPA 4BMHA 5A28A 1PUAA 2REFA 4NSQA 1BO4A 1YVOA 4JXQA 1KUXA 3CXQA 4HNYB 4UCNA 2QECA 4JD6A 1M4DA 2Z3MA 3R95A 5AG4A 3P2FA 3F0AA 3TFYA 3R1KA 4B5OA 4LX9A 4CGOA 5E96A 3S6HA 4AVCA 4R57A 2EVNA 1GHEA 3V8IA 4CAWA 4YGOA 2ZW6A 3T90A 4UCPA 1MJ9A 4B11A 3G8WA 3TO7A 1Z4RA 1Y9WA 2Q44A 1S7NA 4XNHB 4CRYB 3JTKA 3FIXA 4L89A 3SXNA 1IYLA 5I0CA 5A27A 2OB0A 1QSOA 2CNSA 4RS2A 2BUEA 2J8MA 1XIXA 4KUAA 4AG9A 4KVXA 3DSBA 4KVME 3TOAA 3H4QA 5G21A 3I9SA 2H5MA 3VWEA 1IICA 2FIAA 4C2XA 3S6GA 2VQYA 3FYNA 2KCWA 1Q2CA 4KS9A 5F48A 4DNCA 4MFKA 4K30A 3D2PA 2Q04A 2ZW5A 3PZJA 4C68A 4KSFA 4YFJA 2FIWA 3EO4A 4MI4A 3VWDA 4MY0A 5DWNA 5BWAB 1Q2YA 2PR8A 3GKRA 4ZGYB 4QC6A 2EUIA 1R57A 3TCVA 3FRMA 2VZZA 3IGRA 2B4DB 2G3TA 5FVJA 1K4JA 4XPDC 5G22A 2GE3A 4B13A 4UFXA 2CXAA 4UFWA 1RO5A 4ONUA 1S7FA 2REEA 3MGDA 4A31A 1IYKA 5H86A 2Z3OA 2G0BA 1UFHA 2R8VA 1VKCA 2Z0ZA 4JJXA 4F0XA 1QSMA 4HNXB 1V0CA 1M4GA 1I1DA 2J8RA 4OLLA 4C2ZA 5KTAA 1S5KA 4CRZB 2DPSA 1QSTA 4KOWA 2ATRA 4A2ZA 4CAFA 4PSXA 2BSWA 2IL4A 2NMTA 2FL4A 1YR0A 2PDOA 2J8NA 1KUYA 4CYNA 5JQ4A 3IU2A 2YGWA 5JPHA 4FD4A 1I12A 3EXNA 2Z10A 2VXKA 3N7ZA 2I00A 4KSAA 3IWEA 2ZW4A 5F49A 2HQYA 4B10A 4CGLA 4A32A 1J4JA 4KOYA 4II9A 4H6ZA 4Q38A 4XPLA 2YNEA 2P6EA 3C26A 2JDCA 3FNCA 3K9UA 1MK4A 3IU1A 1IIDA 4R3LA 1MJBA 4A30A 2P6FA 4CGPA 2YNCA 4KORA 3R9GA 1IB1E 2BEIA 2B5GB 2FXFA 4MFJA 4KZTA 2G3AA 2GIVA 2O28A 4JLYA 1YLEA 2HV2A 5DWMA 2Q0YA 2WSAA 2R7HA 2Y0MA 1YVKA 4B14A 4UCMA 3BJ8A 1I21A 4UWJA 1Y9KA 4B12A 3W6XA 1P0HA 4OADA 5C88A 2B3VA 3QAHA 4ORFA 2ARHA 4QVTA 3R96A 4KOVA 2AE6A 3RYOA 4UFVA 4U9YA 2DXQA 1CM0A 4B5PB 5EBVA 2VBQA 3PP9A 4BBHA 4QUSA 4HKFA 1SQHA 3WR7A 1VHSA 2Z3PA 4MFLA 5G1ZA 2RC4A 4KUBA 3TT2A 1QSNA 3EFAA 1XE4A 4R9MA 4YRHA 4NF1A 1XEBA 4E8OA 4C2YA 4H89A 4NCZA 1M1DA 3QB8A 3ZJ0A 3P2HA 2OU2A 2P6GA 4IUSA 3S6KA 4KOXA 3EY5A 4PSWA 2YNCC 3F5BA 4FD7A 3SHPA 4PK2A 5H84A 4FD5A 4PK3A 2ZPAA 4JWPA 3BJ7A 2BL1A 4KOUA 4CYPA 3E0KA 4CGMA 2FCKA 1S7LA 5HH1A 3NE7A 1Q2DA 3FB3A 2R1IA 4XPDB 4AVBA 2JEVA 2Q7BA 1B87A 2B5GA 4R3KA 2B3UA 4QB9A 4LUAA 4E0AA 5IX3A 3DR8A 4UWIA 3H5ZA 2FS5A 2VI7A 4MY3A 1KUVA 4CYQA 4E2AA 5ISVA 2Q4YA 2WPWA 2D4OA 1M4IA 2QIRA 1U6MA 3DNSA 3JUWA 2WPXA 2AJ6A 2OZHA 4HNWB 4OAEA 4F6AA 2X7BA 3D8PA 1YREA 2Z11A 4M85A 1NSLA 2FE7A 3CXSA 4XPKA 2CNMA 3TO9A 1KZFA 4MFZA 1FY7A 4CAVA 3W91A 3DR6A 4MFPA 4KLVA 1YK3A 4KOSA 1Z4EA 4AG7A 2DPTA 1S3ZA 5F47A 1N71A 4H6UA 2Z3NA 2B4DA 2OZUA 4U5YA 3FXTA 3TTHA 1TIQA 2GANA 2PR1A 5KTCA 4CGNA 4MJ8A 4XNHC 4AVAA 2YNDA 1MJAA 1RXTA 4MFQA 1ZO0A 2VEZA 2B4BA 2ZW7A 4KLWA 3I3GA 2C27A 1S7KA 2CY2A 3KKWA 4CYOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CYN A;  4CYP A;  3IU2 A;  4C2Z A;  4CGM A;  4UCP A;  3IU1 A;  4B11 A;  5G21 A;  5A28 A;  4A30 A;  4C7H A;  4C2X A;  4C2Y A;  4CGP A;  4C7I A;  2YNC A;  4CGN A;  5G22 A;  4A33 A;  4UCN A;  3IWE A;  4B13 A;  4UFX A;  4A2Z A;  3JTK A;  4UFV A;  4CAF A;  4UFW A;  5AG4 A;  5AGE A;  2YND A;  2YNC C;  4B10 A;  3H5Z A;  4CGL A;  5A27 A;  4BBH A;  4A32 A;  4A31 A;  5AG7 A;  4C68 A;  4CGO A;  4CYQ A;  4CAE A;  2WUU A;  5AG5 A;  5G20 A;  5G1Z A;  2WSA A;  4B14 A;  2YNE A;  4UCM A;  4A95 A;  5AG6 A;  4CYO A;  4B12 A; 
#chains in the Genus database with same CATH topology
 4FD6 A;  5EC4 A;  2Z3L A;  1JWQ A;  2C6C A;  1H8L A;  4R87 A;  3RZA A;  4EWT A;  3D3S A;  3LAC A;  1XMT A;  2I3C A;  4KVO E;  4Y49 C;  3S6F A;  5IB9 A;  3PB6 X;  3KI9 A;  4IF5 A;  1HDQ A;  1ON0 A;  4Q7A A;  3SI2 A;  2P0W A;  5HMN A;  3FBU A;  2JDD A;  4J3G A;  3B3T A;  2QML A;  5EMI A;  4OIW A;  4NGP A;  1BOB A;  1TKF A;  1LAP A;  3LD2 A;  2XEG A;  2BCO A;  2V8G A;  4MBU A;  2K5T A;  4CAE A;  3W6S A;  5AG5 A;  4AB7 A;  1Z9U A;  3B3S A;  4ZX9 A;  4BD9 A;  2B58 A;  2OR4 A;  5F09 A;  2R98 A;  2F5I A;  3SXO A;  2OH1 A;  1LRZ A;  3TE4 A;  1HEE A;  3SJG A;  4M3S A;  4UA3 A;  5LYL A;  4P4B A;  2FSR A;  4Y49 B;  2V8H A;  4C7H A;  2PC1 A;  4Z65 A;  5J8C A;  4KOT A;  3ZZI A;  5KTD A;  8CPA A;  3EC4 A;  3D2M A;  1PYT B;  4DYO A;  3G3S A;  1XBU A;  1M4L A;  2PJ2 A;  1R3N A;  3KAS A;  4EVY A;  1NSA A;  1XF8 A;  4MHD A;  4RUH A;  5CNP A;  1CP7 A;  3MN8 A;  3R9F A;  3WC5 A;  5AG7 A;  1S60 A;  3A9L A;  4PXB A;  4CAX A;  2WUU A;  1BPN A;  1TF9 A;  5G20 A;  3D7G A;  1WWZ A;  2PJ3 A;  4P10 A;  1NE9 A;  3BLN A;  3CXP A;  3ISX A;  1CX8 A;  2PSW A;  4UF4 A;  3H8G A;  3LOD A;  3H8F A;  4UIB A;  2HUZ A;  4DUK A;  3T8W A;  3NFZ A;  2JLM A;  1CP6 A;  2PRB A;  5IB0 A;  2Q4V A;  1QSR A;  3IJ3 A;  4MHN A;  4C7I A;  2AFZ A;  2ZXV A;  2GLJ A;  4PV6 A;  3GY9 A;  4ZBG A;  3TO6 A;  1Y7R A;  4F0Y A;  5JH9 A;  4A39 A;  1P4N A;  3F8K A;  1CJW A;  4NEX A;  2FT0 A;  2HB6 A;  2DEA A;  3DDD A;  4NXY A;  4WJB A;  2V77 A;  2Q4Z A;  3TX8 A;  1ZG7 A;  1RTQ A;  2Z3K A;  4L8A A;  5GCN A;  3JVN A;  3SJX A;  5F46 A;  4F8Z A;  4X5K A;  4GS4 A;  3K2K A;  3I1U A;  1EE3 P;  3PGP A;  1YGH A;  4WWV A;  1L0C A;  3CPX A;  4I49 A;  1M44 A;  4CS0 B;  5C82 A;  2ZED A;  1Y7E A;  5JM6 A;  4Q36 A;  4UEE A;  2OZG A;  3B8G A;  4A38 A;  4GXH A;  2JBK A;  2POK A;  3B3V A;  4W9Y A;  2I79 A;  3TOB A;  4F9V A;  5LRJ A;  4JZ0 A;  3RO0 A;  3PEI A;  3UY5 A;  1NMT A;  1WK4 A;  1YX0 A;  3FED A;  3V38 A;  4A33 A;  4B5P A;  4ZI6 A;  1PU9 A;  3OWC A;  2VZY A;  1B6B A;  1X12 A;  2Q43 A;  4U9Z A;  4JXR A;  4MCS A;  4P4D A;  1FNO A;  3IWG A;  5AGE A;  4NGS A;  5CPA A;  1Q7L A;  4BIN A;  2QYV A;  3GYA A;  4QBJ A;  3GIU A;  2PQ8 A;  3KR4 A;  4PXC A;  4UBR A;  2D4P A;  4YU9 A;  3B35 A;  2NSM A;  4RI1 A;  4NFR A;  1YLO A;  2CNT A;  3R9E A;  4P4E A;  4A95 A;  5J8F A;  3T9Y A;  5AG6 A;  4H2K A;  4RN7 A;  5IV0 A;  2A4N A;  4OC0 A;  5J1Q A;  1OZP A;  4BMH A;  5A28 A;  1XRY A;  1PUA A;  3VAR A;  2REF A;  4NSQ A;  1BO4 A;  1YVO A;  4JXQ A;  4IHM A;  1Z8X A;  1KUX A;  2F7V A;  2DF5 A;  6CPA A;  1KWM A;  3CXQ A;  4HNY B;  4UCN A;  2QEC A;  1YSJ A;  4JD6 A;  1M4D A;  2Z3M A;  3R95 A;  2EO8 A;  3IEH A;  3P2F A;  5AG4 A;  5CBM A;  3S9L A;  2ZEO A;  3F0A A;  3TFY A;  2QVP A;  3R1K A;  4UIA A;  4B5O A;  3D66 A;  4LX9 A;  1XOV A;  4CGO A;  1ZLH A;  3S9M A;  1IGB A;  3HUV A;  4CPA A;  3FH4 A;  3PB4 X;  5E96 A;  3FMC A;  3S6H A;  4AVC A;  4R57 A;  5LRG A;  2HC9 A;  2EVN A;  4JYW A;  1GHE A;  4ZY2 A;  3V8I A;  4CAW A;  2PJB A;  4YGO A;  2ZW6 A;  3T90 A;  4UCP A;  1MJ9 A;  4B11 A;  4G1P A;  3G8W A;  3TO7 A;  1Z4R A;  3KGQ A;  5HVH A;  3PFE A;  1Y9W A;  2IMO A;  2GLF A;  1ELM P;  2Q44 A;  1S7N A;  2PVW A;  4XNH B;  3DGV A;  2QJ8 A;  4CRY B;  3JTK A;  3FIX A;  4L89 A;  1LAN A;  1LAM A;  4TWE A;  3SXN A;  1IYL A;  2AFW A;  5A27 A;  5I0C A;  2OB0 A;  2PJ5 A;  1QSO A;  1XFO A;  2CNS A;  4RS2 A;  4P4J A;  2BUE A;  1ELL P;  3PBB A;  4M6I A;  2AFS A;  2J8M A;  1XIX A;  2CF4 A;  3L2N A;  2ZEN A;  4KUA A;  4AG9 A;  5LYF A;  4KVX A;  1XMB A;  3DSB A;  4KVM E;  3B3C A;  3TOA A;  2XEF A;  3H4Q A;  3D67 A;  5K8O A;  5G21 A;  2IJZ A;  3I9S A;  2H5M A;  3VWE A;  1IIC A;  2FIA A;  4C2X A;  3B7I A;  1FT7 A;  2GU2 A;  4NJR A;  3S6G A;  1HDU A;  4P4F A;  1CG2 A;  2VQY A;  1TKH A;  3FYN A;  1VIX A;  2KCW A;  5HVF A;  1IOI A;  5K8M A;  1Q2C A;  2IQ6 A;  4X3R A;  3CT9 A;  4KS9 A;  4F9U A;  5F48 A;  2PJC A;  4MFK A;  4MCQ A;  4UEZ A;  4K30 A;  3D2P A;  2PJ7 A;  4DNC A;  2Q04 A;  2ZW5 A;  5DS0 A;  3PZJ A;  4K3N A;  4C68 A;  4ONW A;  4KSF A;  4YFJ A;  4MXU A;  2Q51 A;  2FIW A;  3EO4 A;  3RBU A;  2CTB A;  4MI4 A;  3IC1 A;  4MY0 A;  3VWD A;  3WT4 A;  5DWN A;  5BWA B;  1Z2L A;  1Q2Y A;  4ZY1 A;  1CBX A;  2PR8 A;  2O4H A;  3GKR A;  3D68 A;  5ELY A;  2GRE A;  1CPS A;  4QC6 A;  2EUI A;  1R57 A;  4ZGY B;  3TCV A;  3FRM A;  2VZZ A;  3IGR A;  2B4D B;  2G3T A;  5FVJ A;  1K4J A;  4XPD C;  1F2P A;  3D4U A;  4MRI A;  5G22 A;  2GE3 A;  4OC2 A;  4B13 A;  4UFX A;  4IAV A;  4A94 A;  2CXA A;  4UFW A;  1RO5 A;  2ZOF A;  4ONU A;  1S7F A;  2REE A;  4DJL A;  3MGD A;  4A31 A;  1IYK A;  3LMS A;  5H86 A;  2Z3O A;  2G0B A;  1UFH A;  2R8V A;  1VKC A;  3NE8 A;  2Z0Z A;  4JJX A;  4OME A;  4F0X A;  1QSM A;  5THW A;  4HNX B;  2CIJ A;  1V0C A;  2RB7 A;  2PJ6 A;  1M4G A;  1I1D A;  2J8R A;  4OLL A;  4C2Z A;  5KTA A;  2ABZ A;  1S5K A;  4AXV A;  1LCP A;  3D7D A;  4CRZ B;  2DPS A;  3BI1 A;  3WAB A;  5D29 A;  1QST A;  4KOW A;  2O53 A;  2EWB A;  4NGT A;  2BO9 A;  2XEJ A;  3FVL A;  4X2T A;  2ATR A;  2J9A A;  4A2Z A;  4CAF A;  3HLP A;  4PSX A;  2PJ0 A;  1X10 A;  4NGR A;  4PXD A;  2BSW A;  4R6T A;  2IL4 A;  2NMT A;  2FL4 A;  2XEI A;  3ISZ A;  3SJF A;  1YR0 A;  2PDO A;  1BAV A;  4LQG A;  1TXR A;  5LRK A;  2J8N A;  1IY7 A;  3KQX A;  3DLJ A;  3NA6 A;  3NH4 A;  3BXM A;  1ZG9 A;  1KUY A;  4CYN A;  4NJQ A;  3IU2 A;  1ZG8 A;  4EME A;  5JQ4 A;  2YGW A;  5JPH A;  3IIB A;  4FD4 A;  2BOA A;  3FF3 A;  2PIY A;  1I12 A;  1F2O A;  2Z10 A;  2VXK A;  3EXN A;  2I00 A;  3H8E A;  3N7Z A;  4KSA A;  3TC8 A;  3IWE A;  4NGN A;  1BPM A;  1ARM A;  1LFW A;  2ZW4 A;  5F49 A;  2PIZ A;  4P45 A;  4M6G A;  2HQY A;  2ZOG A;  2AFX A;  4B10 A;  4CGL A;  2F8H A;  2PJA A;  4A32 A;  1J4J A;  5HXD A;  4A37 A;  1TKJ A;  4KOY A;  4II9 A;  4H6Z A;  2EK9 A;  4Q38 A;  3RNZ A;  4XPL A;  3LWU A;  2YNE A;  3FX6 A;  2P6E A;  2C6P A;  4ZX8 A;  3C26 A;  2JDC A;  4OKO A;  3FNC A;  3K9U A;  3NH8 A;  3NH5 A;  1MK4 A;  3V7Z A;  3IU1 A;  1IID A;  4LQ6 A;  4R3L A;  1MJB A;  3CPA A;  4OID A;  1XJO A;  2ZEH A;  3IFE A;  4R8F A;  4FUU A;  3IO1 A;  4A30 A;  4HPS A;  3D7F A;  2P6F A;  1TF8 A;  4CGP A;  2YNC A;  4KOR A;  3R9G A;  5HVG A;  1IB1 E;  3PFO A;  2BEI A;  2B5G B;  2FXF A;  3D7H A;  4MFJ A;  1CPX A;  2C6G A;  4KZT A;  2G3A A;  2ZEL A;  2GIV A;  5LYD A;  2O28 A;  4JLY A;  1AYE A;  1VHO A;  1YLE A;  2HV2 A;  4R76 A;  2AFO A;  1IU8 A;  5DWM A;  2Q0Y A;  2WSA A;  2R7H A;  2Y0M A;  1YVK A;  2Q7S A;  4B14 A;  4UCM A;  3BJ8 A;  1I21 A;  2OOT A;  4UWJ A;  1Y9K A;  3QAY A;  4NGM A;  4B12 A;  3W6X A;  3GB0 A;  1P0H A;  3KQZ A;  5K8P A;  1Y0Y A;  1JQG A;  4OAD A;  3B2Y A;  4GM5 A;  5C88 A;  2B3V A;  3CDX A;  2ANP A;  3QAH A;  4ORF A;  2ARH A;  3IWW A;  4QVT A;  3R96 A;  4P4I A;  2RFH A;  4KOV A;  4MMO A;  2AE6 A;  4FAI A;  3RYO A;  4UFV A;  4YWY A;  4U9Y A;  2DXQ A;  1CM0 A;  4B5P B;  2PRQ A;  1YQE A;  5EBV A;  2VBQ A;  3PP9 A;  3KR5 A;  4BBH A;  5K8N A;  2ZEM A;  4QUS A;  4B6Z A;  4ZY0 A;  1QMU A;  3FEC A;  4HKF A;  4R7M A;  1SQH A;  4P44 A;  2FVG A;  3WR7 A;  1VHS A;  2Z3P A;  4MFL A;  5G1Z A;  2RC4 A;  4KUB A;  2ZEE A;  1AUG A;  3PB7 X;  4O23 A;  1AMP A;  2EBJ A;  2VL1 A;  4ZYQ A;  3TT2 A;  1QSN A;  2WYR A;  1XE4 A;  3EFA A;  4R9M A;  3SI1 A;  4YRH A;  4NF1 A;  1BLL E;  1XEB A;  4E8O A;  4C2Y A;  4H89 A;  4NCZ A;  1M1D A;  3GLJ A;  1Z5R A;  3QB8 A;  3ZJ0 A;  2PJ4 A;  3S9N A;  3P2H A;  2OU2 A;  2P6G A;  1Y0R A;  4IUS A;  3FEE A;  3S6K A;  3KZW A;  2ZEP A;  4KOX A;  2V8D A;  4OC3 A;  3EY5 A;  4PSW A;  2YNC C;  3F5B A;  4FD7 A;  3GUX A;  5I4M A;  3SHP A;  3SI0 A;  2PJ9 A;  7CPA A;  4PK2 A;  5H84 A;  3RAM A;  4FD5 A;  4PK3 A;  2ZPA A;  1YW4 A;  4JWP A;  1DTD A;  2GFQ A;  3BJ7 A;  2BL1 A;  1UWY A;  4KOU A;  4CYP A;  3E0K A;  4CGM A;  3QNV A;  2JEW A;  2FCK A;  1YW6 A;  2ZEG A;  1S7L A;  5HH1 A;  3NE7 A;  4PXE A;  1Q2D A;  3FB3 A;  2R1I A;  4XPD B;  4AVB A;  2JEV A;  2Q7B A;  1B87 A;  2B5G A;  4R3K A;  1Z8T A;  2B3U A;  4QB9 A;  4LUA A;  4E0A A;  5IX3 A;  3DR8 A;  4MHY A;  1LOK A;  4UWI A;  3H5Z A;  2FS5 A;  2VI7 A;  3PRT A;  4MY3 A;  1KUV A;  2WZN A;  4IK2 A;  4CYQ A;  4E2A A;  1ARL A;  4X8I A;  1GYT A;  3N5F A;  5ISV A;  1F57 A;  2Q4Y A;  2WPW A;  2AFU A;  2D4O A;  3VH9 A;  1M4I A;  2QIR A;  3VAT A;  1U6M A;  3DNS A;  3JUW A;  2WPX A;  2AJ6 A;  2OZH A;  3B3W A;  4HNW B;  1IOF A;  2EK8 A;  2PJ1 A;  2X7B A;  3D8P A;  1YRE A;  4OAE A;  4OC4 A;  4F6A A;  2Z11 A;  4M85 A;  4M6H A;  1NSL A;  4FWU A;  4OP4 A;  4TNU A;  4OC5 A;  2FE7 A;  3CXS A;  4XPK A;  2CNM A;  5D8N A;  3WC6 A;  3TO9 A;  1KZF A;  3KHZ A;  4MFZ A;  4PPZ A;  1FY7 A;  1ZLI A;  2ODF A;  2ZEF A;  4MCP A;  4CAV A;  3W91 A;  3DR6 A;  1Z8W A;  3MRU A;  4MFP A;  1VGY A;  1Z8L A;  1PCA A;  3JRU A;  4EFD A;  2JBJ A;  3BHX A;  1VHE A;  1YK3 A;  4KLV A;  4KOS A;  3PBE A;  4UEF A;  3SJE A;  2PVV A;  4FBE A;  1Z4E A;  5JGF A;  2PE3 A;  4MHP A;  4PQA A;  4AG7 A;  2DPT A;  3KL9 A;  1YME A;  1S3Z A;  4MCR A;  5F47 A;  1N71 A;  4H6U A;  2Z3N A;  2B4D A;  2OZU A;  1DE4 C;  4P6Y A;  2C1C A;  4U5Y A;  3FXT A;  1OBR A;  1TIQ A;  3TTH A;  1QQ9 A;  2AFM A;  2GAN A;  3K9T A;  2PR1 A;  5LYI A;  5KTC A;  4CGN A;  1A2Z A;  3FJU A;  4MJ8 A;  4XNH C;  4AVA A;  2PCU A;  3BI0 A;  2G9D A;  2YND A;  2V8V A;  4MHZ A;  2CTC A;  1MJA A;  4OC1 A;  2PJ8 A;  4KSI A;  3PB8 X;  1RXT A;  3CZX A;  4MFQ A;  1ZO0 A;  3PB9 X;  2VEZ A;  2B4B A;  2ZW7 A;  3KHX A;  4KLW A;  3I3G A;  4NGQ A;  1R43 A;  3WC7 A;  2C27 A;  1S7K A;  2CY2 A;  3KKW A;  4CYO A;  2NYQ A; 
#chains in the Genus database with same CATH homology
 4FD6 A;  5EC4 A;  2Z3L A;  4R87 A;  3D3S A;  1XMT A;  4KVO E;  4Y49 C;  3S6F A;  4IF5 A;  1ON0 A;  2P0W A;  5HMN A;  3FBU A;  2JDD A;  4J3G A;  2QML A;  1BOB A;  3LD2 A;  4MBU A;  2K5T A;  4CAE A;  3W6S A;  5AG5 A;  4AB7 A;  1Z9U A;  2B58 A;  2R98 A;  2F5I A;  3SXO A;  2OH1 A;  1LRZ A;  3TE4 A;  4M3S A;  4UA3 A;  2FSR A;  4Y49 B;  4C7H A;  2PC1 A;  5J8C A;  4KOT A;  3ZZI A;  5KTD A;  3EC4 A;  3D2M A;  3G3S A;  4EVY A;  1XF8 A;  4MHD A;  5CNP A;  3R9F A;  5AG7 A;  1S60 A;  3A9L A;  4CAX A;  2WUU A;  5G20 A;  1WWZ A;  1NE9 A;  3BLN A;  3CXP A;  2PSW A;  3LOD A;  2HUZ A;  2JLM A;  5IB0 A;  2PRB A;  2Q4V A;  1QSR A;  4C7I A;  2ZXV A;  4PV6 A;  4ZBG A;  4F0Y A;  3GY9 A;  3TO6 A;  1Y7R A;  1P4N A;  3F8K A;  1CJW A;  4NEX A;  2FT0 A;  3DDD A;  4NXY A;  2Z3K A;  4L8A A;  5GCN A;  5F46 A;  3JVN A;  4X5K A;  4GS4 A;  3PGP A;  1YGH A;  1L0C A;  4I49 A;  1M44 A;  4CS0 B;  5C82 A;  4Q36 A;  2OZG A;  3B8G A;  2I79 A;  3TOB A;  3UY5 A;  1NMT A;  1WK4 A;  1YX0 A;  4A33 A;  4B5P A;  1PU9 A;  3OWC A;  2VZY A;  1B6B A;  4U9Z A;  4JXR A;  5AGE A;  3IWG A;  3GYA A;  4QBJ A;  2PQ8 A;  4UBR A;  2D4P A;  4RI1 A;  3R9E A;  2CNT A;  4A95 A;  5J8F A;  3T9Y A;  5AG6 A;  5IV0 A;  2A4N A;  1OZP A;  4BMH A;  5A28 A;  1PUA A;  2REF A;  4NSQ A;  1BO4 A;  1YVO A;  4JXQ A;  1KUX A;  3CXQ A;  4HNY B;  4UCN A;  2QEC A;  4JD6 A;  1M4D A;  2Z3M A;  3R95 A;  5AG4 A;  3P2F A;  3F0A A;  3TFY A;  3R1K A;  4B5O A;  4LX9 A;  4CGO A;  5E96 A;  3S6H A;  4AVC A;  4R57 A;  2EVN A;  1GHE A;  3V8I A;  4CAW A;  4YGO A;  2ZW6 A;  3T90 A;  4UCP A;  1MJ9 A;  4B11 A;  3G8W A;  3TO7 A;  1Z4R A;  1Y9W A;  2Q44 A;  1S7N A;  4XNH B;  4CRY B;  3JTK A;  3FIX A;  4L89 A;  3SXN A;  1IYL A;  5I0C A;  5A27 A;  2OB0 A;  1QSO A;  2CNS A;  4RS2 A;  2BUE A;  2J8M A;  1XIX A;  4KUA A;  4AG9 A;  4KVX A;  3DSB A;  4KVM E;  3TOA A;  3H4Q A;  5G21 A;  3I9S A;  2H5M A;  3VWE A;  1IIC A;  2FIA A;  4C2X A;  3S6G A;  2VQY A;  3FYN A;  2KCW A;  1Q2C A;  4KS9 A;  5F48 A;  4DNC A;  4MFK A;  4K30 A;  3D2P A;  2Q04 A;  2ZW5 A;  3PZJ A;  4C68 A;  4KSF A;  4YFJ A;  2FIW A;  3EO4 A;  4MI4 A;  3VWD A;  4MY0 A;  5DWN A;  5BWA B;  1Q2Y A;  2PR8 A;  3GKR A;  4ZGY B;  4QC6 A;  2EUI A;  1R57 A;  3TCV A;  3FRM A;  2VZZ A;  3IGR A;  2B4D B;  2G3T A;  5FVJ A;  1K4J A;  4XPD C;  5G22 A;  2GE3 A;  4B13 A;  4UFX A;  2CXA A;  4UFW A;  1RO5 A;  4ONU A;  1S7F A;  2REE A;  3MGD A;  4A31 A;  1IYK A;  5H86 A;  2Z3O A;  2G0B A;  1UFH A;  2R8V A;  1VKC A;  2Z0Z A;  4JJX A;  4F0X A;  1QSM A;  4HNX B;  1V0C A;  1M4G A;  1I1D A;  2J8R A;  4OLL A;  4C2Z A;  5KTA A;  1S5K A;  4CRZ B;  2DPS A;  1QST A;  4KOW A;  2ATR A;  4A2Z A;  4CAF A;  4PSX A;  2BSW A;  2IL4 A;  2NMT A;  2FL4 A;  1YR0 A;  2PDO A;  2J8N A;  1KUY A;  4CYN A;  5JQ4 A;  3IU2 A;  2YGW A;  5JPH A;  4FD4 A;  1I12 A;  3EXN A;  2Z10 A;  2VXK A;  3N7Z A;  2I00 A;  4KSA A;  3IWE A;  2ZW4 A;  5F49 A;  2HQY A;  4B10 A;  4CGL A;  4A32 A;  1J4J A;  4KOY A;  4II9 A;  4H6Z A;  4Q38 A;  4XPL A;  2YNE A;  2P6E A;  3C26 A;  2JDC A;  3FNC A;  3K9U A;  1MK4 A;  3IU1 A;  1IID A;  4R3L A;  1MJB A;  4A30 A;  2P6F A;  4CGP A;  2YNC A;  4KOR A;  3R9G A;  1IB1 E;  2BEI A;  2B5G B;  2FXF A;  4MFJ A;  4KZT A;  2G3A A;  2GIV A;  2O28 A;  4JLY A;  1YLE A;  2HV2 A;  5DWM A;  2Q0Y A;  2WSA A;  2R7H A;  2Y0M A;  1YVK A;  4B14 A;  4UCM A;  3BJ8 A;  1I21 A;  4UWJ A;  1Y9K A;  4B12 A;  3W6X A;  1P0H A;  4OAD A;  5C88 A;  2B3V A;  3QAH A;  4ORF A;  2ARH A;  4QVT A;  3R96 A;  4KOV A;  2AE6 A;  3RYO A;  4UFV A;  4U9Y A;  2DXQ A;  1CM0 A;  4B5P B;  5EBV A;  2VBQ A;  3PP9 A;  4BBH A;  4QUS A;  4HKF A;  1SQH A;  3WR7 A;  1VHS A;  2Z3P A;  4MFL A;  5G1Z A;  2RC4 A;  4KUB A;  3TT2 A;  1QSN A;  3EFA A;  1XE4 A;  4R9M A;  4YRH A;  4NF1 A;  1XEB A;  4E8O A;  4C2Y A;  4H89 A;  4NCZ A;  1M1D A;  3QB8 A;  3ZJ0 A;  3P2H A;  2OU2 A;  2P6G A;  4IUS A;  3S6K A;  4KOX A;  3EY5 A;  4PSW A;  2YNC C;  3F5B A;  4FD7 A;  3SHP A;  4PK2 A;  5H84 A;  4FD5 A;  4PK3 A;  2ZPA A;  4JWP A;  3BJ7 A;  2BL1 A;  4KOU A;  4CYP A;  3E0K A;  4CGM A;  2FCK A;  1S7L A;  5HH1 A;  3NE7 A;  1Q2D A;  3FB3 A;  2R1I A;  4XPD B;  4AVB A;  2JEV A;  2Q7B A;  1B87 A;  2B5G A;  4R3K A;  2B3U A;  4QB9 A;  4LUA A;  4E0A A;  5IX3 A;  3DR8 A;  4UWI A;  3H5Z A;  2FS5 A;  2VI7 A;  4MY3 A;  1KUV A;  4CYQ A;  4E2A A;  5ISV A;  2Q4Y A;  2WPW A;  2D4O A;  1M4I A;  2QIR A;  1U6M A;  3DNS A;  3JUW A;  2WPX A;  2AJ6 A;  2OZH A;  4HNW B;  4OAE A;  4F6A A;  2X7B A;  3D8P A;  1YRE A;  2Z11 A;  4M85 A;  1NSL A;  2FE7 A;  3CXS A;  4XPK A;  2CNM A;  3TO9 A;  1KZF A;  4MFZ A;  1FY7 A;  4CAV A;  3W91 A;  3DR6 A;  4MFP A;  4KLV A;  1YK3 A;  4KOS A;  1Z4E A;  4AG7 A;  2DPT A;  1S3Z A;  5F47 A;  1N71 A;  4H6U A;  2Z3N A;  2B4D A;  2OZU A;  4U5Y A;  3FXT A;  3TTH A;  1TIQ A;  2GAN A;  2PR1 A;  5KTC A;  4CGN A;  4MJ8 A;  4XNH C;  4AVA A;  2YND A;  1MJA A;  1RXT A;  4MFQ A;  1ZO0 A;  2VEZ A;  2B4B A;  2ZW7 A;  4KLW A;  3I3G A;  2C27 A;  1S7K A;  2CY2 A;  3KKW A;  4CYO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...