4CYPA

Leishmania major n-myristoyltransferase in complex with a pyrrolidine inhibitor.
Total Genus 123
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
123
sequence length
411
structure length
411
Chain Sequence
AHAFWSTQPVPQTEDETEKIVFAGPMDEPKTVADIPEEPYPIASTFEWWTPNMEAADDIHAIYELLRDNYVEDDDSMFRFNYSEEFLQWALCPPNYIPDWHVAVRRKADKKLLAFIAGVPVTLRMGTPKYMKVKAQEKGEGEEAAKYDEPRHICEINFLCVHKQLREKRLAPILIKEATRRVNRTNVWQAVYTAGVLLPTPYASGQYFHRSLNPEKLVEIRFSGIPAQYQKFQNPMAMLKRNYQLPSAPKNSGLREMKPSDVPQVRRILMNYLDSFDVGPVFSDAEISHYLLPRDGVVFTYVVENDKKVTDFFSFYRIPSTVIGNSNYNLLNAAYVHYYAATSIPLHQLILDLLIVAHSRGFDVCNMVEILDNRSFVEQLKFGAGDGHLRYYFYNWAYPKIKPSQVALVML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLYCYLPEPTIDE N-TETRADECANOYLTRANSFERASE
publication title Structure-Based Design of Potent and Selective Leishmania N- Myristoyltransferase Inhibitors.
pubmed doi rcsb
source organism Leishmania major
molecule tags Transferase
total genus 123
structure length 411
sequence length 411
ec nomenclature ec 2.3.1.97: Glycylpeptide N-tetradecanoyltransferase.
pdb deposition date 2014-04-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01233 NMT Myristoyl-CoA:protein N-myristoyltransferase, N-terminal domain
A PF02799 NMT_C Myristoyl-CoA:protein N-myristoyltransferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.170 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4cypA00
4A95A 4C2XA 4CGMA 5AG6A 5A28A 3IU2A 4UFWA 4CAEA 5A27A 5G22A 2YNDA 4CYPA 3IU1A 2YNCA 4CGOA 4UCPA 5AG4A 4CAFA 4C2ZA 4A33A 4B11A 4CGLA 3IWEA 4UFXA 2YNEA 4CGNA 5AG5A 5G1ZA 4B10A 5G20A 4B13A 4CYQA 4BBHA 4C7IA 2WSAA 4A32A 4CYNA 4B14A 4A2ZA 2YNCC 4CYOA 3H5ZA 4C7HA 3JTKA 4CGPA 4UCNA 5G21A 4C2YA 5AGEA 2WUUA 4B12A 4A30A 5AG7A 4A31A 4C68A 4UCMA 4UFVA
chains in the Genus database with same CATH superfamily
1QSMA 2EO8A 3GUXA 4IHMA 4Y49B 4C2XA 5J1QA 1I21A 5K8MA 2F8HA 1S60A 2ZOFA 3MN8A 4QB9A 4XPDC 1QSTA 4U9ZA 3S9NA 2H5MA 2CTCA 4AXVA 1CPSA 5E96A 4PK2A 2XEIA 1DTDA 1KZFA 4NGMA 4XPKA 2ZXVA 1NSAA 5AG5A 2ZENA 2EWBA 2G3TA 3EO4A 4P44A 4R57A 5LYIA 4KUBA 4OLLA 1S7LA 4JWPA 3OWCA 4B12A 3FRMA 3BI1A 5I4MA 5K8NA 1ZG8A 1GYTA 4QBJA 1I1DA 3B3TA 4KOYA 3RAMA 3UY5A 1WWZA 3PGPA 4PK3A 4P4EA 2BO9A 3S6KA 1Y0YA 2PJ6A 1YVKA 1IOFA 4UFWA 1YREA 2P6FA 2RC4A 2YNDA 3TO6A 2PJ4A 4ZYQA 5CNPA 3DNSA 3PFEA 2CNTA 3MRUA 1R57A 2Q04A 1AMPA 3W6SA 5JGFA 5HVHA 4I49A 1LANA 4R3KA 4NGPA 4OKOA 2QIRA 3F8KA 4MJ8A 4HNXB 3WC7A 1OZPA 1IICA 4MHZA 3K9UA 1J4JA 1CBXA 1QSNA 3LD2A 2B3UA 1Z9UA 4KOUA 4MHYA 4QC6A 5IX3A 3R9FA 3ISZA 3G8WA 1L0CA 2FXFA 2Q51A 4M3SA 2EK9A 2WZNA 3HUVA 3NFZA 4AG7A 1YLEA 1IB1E 2B4DA 4OC1A 1PU9A 4CAFA 1KUXA 1CX8A 1MJAA 1PCAA 1VKCA 2PSWA 4AVAA 3TE4A 5D8NA 2RFHA 3EY5A 3KGQA 4Q36A 5HMNA 2HC9A 2ZEMA 4MFPA 4KVXA 4MCPA 5K8OA 3LODA 4MY0A 2GREA 4CYQA 1BPMA 3WC5A 4C7IA 3NH8A 1I12A 1Z8TA 4MCRA 3KQZA 4E8OA 3PB8X 3QAHA 2AFMA 3S6GA 1M4LA 4OC2A 1EE3P 1JWQA 3R96A 5G21A 1ZLHA 3VH9A 2VQYA 4MRIA 4NSQA 3TOBA 2PJ5A 4A30A 2D4PA 5AG7A 4A31A 3D7HA 2PC1A 4UEEA 3FB3A 4KOSA 4KOTA 1VIXA 4EWTA 3S9MA 1ZG9A 3JVNA 3SXOA 3ZZIA 5A28A 3D8PA 1WK4A 1MK4A 1TKJA 2OH1A 4Q7AA 1VHSA 1CPXA 3FX6A 3BLNA 2B4BA 3CPAA 1YK3A 3EFAA 4OIDA 4OMEA 4X8IA 4C2ZA 2CIJA 4LQGA 2AFXA 4R9MA 5C88A 3D7DA 4GM5A 2I79A 2Y0MA 5KTCA 2F7VA 1KUVA 1TF8A 1ZLIA 4A2ZA 4P10A 5LRGA 4R3LA 4LX9A 4H89A 4FD7A 4NEXA 4DNCA 3FNCA 1IGBA 1CP7A 2ARHA 2I3CA 3N7ZA 2FE7A 3SI0A 4Y49C 4MHNA 3WR7A 1UFHA 3I9SA 2J9AA 3IWWA 3QB8A 3SI2A 3NA6A 2FT0A 4UCMA 1M4GA 4ZY2A 4A95A 3NE8A 1F2OA 1HDUA 2B3VA 3IU2A 3SJXA 4ORFA 1QMUA 2C27A 2FCKA 2CNSA 2O28A 4MFZA 2PIYA 4OAEA 2GLJA 2PQ8A 4JD6A 4RN7A 2DXQA 2PDOA 3D67A 4F8ZA 2PR1A 2ZW6A 3W6XA 3CZXA 3FYNA 1Z4EA 5JM6A 4R7MA 3DR8A 4IAVA 3H4QA 3MGDA 1LAPA 4TWEA 3R1KA 5GCNA 5LYDA 2FIAA 4UCNA 4C2YA 1YW4A 5IB9A 3TO7A 1GHEA 4PSWA 4DYOA 2ZPAA 3HLPA 1B6BA 1BAVA 3KI9A 4LQ6A 3PBBA 1S5KA 1QQ9A 2ODFA 3T8WA 2PJ7A 4ONWA 1SQHA 1XE4A 1HEEA 1Z5RA 4A39A 2ZEDA 4CAEA 4WWVA 3IIBA 1JQGA 1YMEA 4DUKA 1ELMP 2CF4A 3FEEA 3KQXA 2Z0ZA 3FH4A 5HVGA 2JDCA 3IWEA 2Z11A 4UWIA 3TCVA 2EVNA 4IF5A 4CGNA 2Q4YA 2REEA 2WPWA 2OR4A 3RYOA 3FBUA 6CPAA 3D66A 1S3ZA 2Z3MA 2ZW4A 4AG9A 3VWEA 3SXNA 2KCWA 4M6IA 3V8IA 3CXPA 2OU2A 4KSFA 1Y0RA 3B35A 3IC1A 5AGEA 5EBVA 5CPAA 1LRZA 2OZUA 4C68A 2PJ9A 2WPXA 3WC6A 4AVBA 2VL1A 3GY9A 3BJ7A 2Z3PA 2VXKA 1RXTA 1AUGA 5EMIA 3S6HA 2Q4ZA 2OB0A 5G22A 3G3SA 4FUUA 2JDDA 2C6CA 4P6YA 2J8MA 2CXAA 1A2ZA 3PBEA 2AFUA 5I0CA 1IYKA 2GFQA 4MXUA 4ZI6A 3S6FA 4UFXA 2JLMA 4M85A 1CG2A 2JEVA 3CXQA 3NE7A 3CDXA 2IL4A 2BOAA 2G9DA 2V77A 3KKWA 2C6PA 2VZYA 4ZBGA 2ZW7A 3H8FA 3NH4A 4PSXA 4P45A 1S7KA 1P0HA 2CY2A 2PJ1A 4UBRA 4A94A 1M4DA 2RB7A 2B58A 3KL9A 4JXQA 4KOWA 4NGTA 4E0AA 3ISXA 2P0WA 2V8DA 4MMOA 3KR4A 4RI1A 4FBEA 5DWNA 4L89A 3VWDA 3B3VA 1XRYA 3GB0A 3BXMA 2NYQA 2JBJA 3F5BA 2ZEPA 3D3SA 2ZEFA 1Y9KA 2HV2A 7CPAA 4NJQA 5AG4A 2JEWA 4ZX8A 4B11A 1BPNA 1XEBA 2YNEA 3PRTA 4YWYA 2VZZA 5HVFA 4B10A 4B5PA 4CAWA 3SHPA 5J8FA 2AFOA 4CYNA 4MFLA 4CRZB 2BEIA 2PJ2A 3KHXA 3B7IA 5K8PA 4EVYA 4F9UA 1LFWA 3SI1A 3VATA 2BSWA 2Q7BA 4HNYB 4LUAA 2Q0YA 3EXNA 4L8AA 1BLLE 4FD4A 4NFRA 1Z8LA 3R9GA 4RUHA 2C1CA 3DDDA 2NMTA 4CGMA 3CPXA 3EC4A 3GIUA 3TFYA 4PXBA 3TX8A 1ON0A 2R8VA 3PB4X 4JZ0A 3PB6X 1M44A 4R6TA 1Q2CA 4NCZA 3T90A 4IK2A 4B5PB 3SJEA 3R9EA 1Z2LA 1OBRA 2EBJA 1XF8A 4M6HA 4NGNA 4K30A 1Q7LA 4GS4A 4OC3A 5BWAB 4PV6A 4BD9A 4MCSA 1Q2YA 4MFJA 4BBHA 4FD5A 2Q44A 2V8GA 3FJUA 3F0AA 3PB7X 4O23A 1M1DA 2J8RA 2GU2A 2YNCC 2AE6A 5IB0A 4GXHA 2V8HA 1IU8A 4PQAA 4UEZA 3IJ3A 4JYWA 2AFSA 2PE3A 1QSOA 3DR6A 5F46A 3FECA 4NJRA 1FNOA 5H84A 4CS0B 1ELLP 4JXRA 4H6ZA 1LAMA 5HH1A 2QYVA 3A9LA 3FIXA 3IFEA 5DS0A 3E0KA 4CRYB 3B3SA 3PFOA 4EMEA 1R43A 3ZJ0A 4HNWB 5LYLA 2YNCA 3DLJA 4PXEA 3PB9X 1YGHA 2K5TA 2C6GA 2Z10A 2B5GB 4A33A 4AVCA 3I1UA 4H2KA 3B8GA 3PP9A 1XIXA 3GYAA 4MI4A 5IV0A 1LCPA 2ZEHA 2DF5A 3D2MA 4OC0A 2D4OA 3FVLA 2VBQA 2XEJA 5F49A 4CYOA 5F47A 1Y7EA 4C7HA 3N5FA 2X7BA 1YR0A 1UWYA 1YQEA 1ARLA 1X12A 2GLFA 5LRKA 1FT7A 4B6ZA 2POKA 2YGWA 3KASA 4NGRA 4OC4A 3KHZA 1V0CA 3IWGA 4MY3A 5H86A 3R95A 3V38A 3PZJA 1NE9A 4KVOE 1M4IA 2HB6A 2ZEGA 4H6UA 4W9YA 2PIZA 1XMBA 4CYPA 4PPZA 2JBKA 3NH5A 1XBUA 4YRHA 4A37A 4PXDA 1TXRA 4MFQA 1TKHA 3FXTA 1NMTA 2CTBA 4NGSA 5EC4A 4QUSA 5G1ZA 2BUEA 2ZW5A 3K9TA 5KTDA 5CBMA 4A32A 3PEIA 1BOBA 1CJWA 1XOVA 4EFDA 4WJBA 1IOIA 1ARMA 2PRBA 2REFA 3D68A 3TOAA 4UF4A 2Z3NA 3FEDA 3TC8A 2QECA 1VHOA 4M6GA 2DPSA 4CAXA 4YU9A 3WT4A 1RO5A 3B2YA 1TKFA 1Y9WA 3H8GA 5LYFA 3TTHA 1P4NA 4R8FA 1U6MA 2IQ6A 1KUYA 4U9YA 3IGRA 4BMHA 4QVTA 4UCPA 3RO0A 2PJ0A 1HDQA 1YW6A 1PYTB 4CGLA 3CXSA 3BI0A 3D4UA 2DEAA 3KZWA 1KWMA 4X3RA 3LMSA 1YLOA 1S7FA 4R76A 4U5YA 4ZX9A 2OZGA 2PVWA 2ZOGA 5F09A 1Q2DA 4P4BA 1H8LA 3GKRA 4XNHB 2DPTA 2XEFA 1VGYA 3QNVA 3W91A 2Z3LA 4Z65A 1BO4A 1PUAA 4J3GA 2EUIA 4MHPA 1F57A 2XEGA 1XMTA 3SJGA 4BINA 4MCQA 2BCOA 4B5OA 1F2PA 2PJ3A 3D7FA 2G3AA 3VARA 2QVPA 4G1PA 2PJBA 5JH9A 2FL4A 5JQ4A 1LOKA 4XPDB 2PRQA 2Q43A 3C26A 4F6AA 4NF1A 4OC5A 1XFOA 3WABA 4KZTA 4OP4A 4B14A 4E2AA 4RS2A 3RZAA 5HXDA 2Q7SA 2PVVA 5JPHA 3JTKA 4ZY1A 2QMLA 1IIDA 1DE4C 2PCUA 4UWJA 1XJOA 2Z3KA 4P4DA 2F5IA 4KOVA 4X5KA 1Y7RA 3JUWA 3TT2A 4FWUA 2HQYA 2FIWA 2ZEOA 3JRUA 3P2FA 1MJ9A 1Z4RA 2BL1A 4OADA 3RNZA 5J8CA 2CNMA 2PJ8A 2Z3OA 2QJ8A 5A27A 3IO1A 1AYEA 2R7HA 2V8VA 3IU1A 2EK8A 4P4JA 5LRJA 4JJXA 2PJCA 1Z8XA 3DSBA 3LWUA 3BHXA 4KORA 1B87A 1S7NA 5D29A 5THWA 4DJLA 2G0BA 5ISVA 5G20A 2GE3A 2OZHA 1Z8WA 4NXYA 4R87A 4UIBA 4UEFA 3KR5A 4PXCA 2R1IA 3V7ZA 3TO9A 2B5GA 2WYRA 3H5ZA 2NSMA 4NGQA 5DWMA 5ELYA 4A38A 2WUUA 4YFJA 2B4DB 3GLJA 3D2PA 4KOXA 2HUZA 2PR8A 2IMOA 1NSLA 3T9YA 2O53A 1ZG7A 2ATRA 1CP6A 4KLVA 2P6EA 3CT9A 4KLWA 4MBUA 1CM0A 4UA3A 1TF9A 4CGOA 2ZEEA 4F9VA 1RTQA 2OOTA 3H8EA 2AJ6A 2P6GA 1R3NA 1N71A 3P2HA 4P4IA 2J8NA 1MJBA 4B13A 5KTAA 2ABZA 4KS9A 2WSAA 2A4NA 2IJZA 3RBUA 1TIQA 3B3WA 2ZELA 4KVME 4CAVA 3I3GA 4ONUA 4ZY0A 3B3CA 3L2NA 5FVJA 2GANA 4FD6A 2ANPA 3LACA 3BJ8A 4CGPA 4F0XA 1VHEA 1X10A 4ZGYB 1YX0A 1ZO0A 2PJAA 4HKFA 4KUAA 2I00A 1IYLA 3SJFA 4F0YA 2FVGA 1FY7A 3DGVA 3FMCA 3FF3A 4JLYA 3K2KA 2GIVA 5C82A 4TNUA 5AG6A 8CPAA 2FSRA 4IUSA 5F48A 4CPAA 2O4HA 4X2TA 4FAIA 4OIWA 4P4FA 4MHDA 3QAYA 4II9A 4YGOA 2VEZA 3IEHA 2VI7A 1YSJA 2FS5A 2AFZA 4HPSA 4XPLA 2R98A 2Q4VA 1QSRA 4Q38A 3S9LA 4XNHC 4UIAA 4KSIA 3D7GA 4AB7A 4K3NA 1IY7A 1K4JA 2AFWA 4UFVA 1YVOA 4MFKA 4KSAA
chains in the Genus database with same CATH topology
1QSMA 4Y49B 4C2XA 1I21A 1S60A 4QB9A 4XPDC 1QSTA 4U9ZA 2H5MA 5E96A 4PK2A 1KZFA 4XPKA 2ZXVA 5AG5A 2G3TA 3EO4A 4R57A 4KUBA 4OLLA 1S7LA 4JWPA 3OWCA 4B12A 3FRMA 4QBJA 1I1DA 4KOYA 3UY5A 1WWZA 3PGPA 4PK3A 3S6KA 1YVKA 4UFWA 3TO6A 1YREA 2P6FA 2RC4A 2YNDA 5CNPA 3DNSA 2CNTA 1R57A 2Q04A 3W6SA 4I49A 4R3KA 2QIRA 3F8KA 4MJ8A 4HNXB 1OZPA 1IICA 3K9UA 1J4JA 1QSNA 3LD2A 2B3UA 1Z9UA 4KOUA 4QC6A 5IX3A 3R9FA 3G8WA 1L0CA 2FXFA 4M3SA 4AG7A 1YLEA 1IB1E 2B4DA 1PU9A 4CAFA 1KUXA 1VKCA 1MJAA 2PSWA 4AVAA 3TE4A 3EY5A 5HMNA 4Q36A 4MFPA 4KVXA 3LODA 4MY0A 4CYQA 4C7IA 1I12A 4E8OA 3QAHA 3S6GA 3R96A 5G21A 2VQYA 4NSQA 3TOBA 4A30A 2D4PA 5AG7A 4A31A 2PC1A 3FB3A 4KOSA 4KOTA 3JVNA 3SXOA 3ZZIA 5A28A 3D8PA 1WK4A 1MK4A 2OH1A 1VHSA 3BLNA 2B4BA 1YK3A 3EFAA 4C2ZA 4R9MA 5C88A 2I79A 2Y0MA 5KTCA 1KUVA 4A2ZA 4DNCA 4R3LA 4LX9A 4H89A 4FD7A 4NEXA 3FNCA 2ARHA 3N7ZA 2FE7A 4Y49C 3WR7A 1UFHA 3I9SA 3QB8A 2FT0A 4UCMA 1M4GA 4A95A 2B3VA 3IU2A 4ORFA 2C27A 2FCKA 2CNSA 2O28A 4MFZA 4OAEA 2PQ8A 4JD6A 2DXQA 2PDOA 2PR1A 2ZW6A 3W6XA 3FYNA 1Z4EA 3DR8A 3H4QA 3MGDA 3R1KA 5GCNA 2FIAA 4UCNA 4C2YA 3TO7A 1GHEA 4PSWA 2ZPAA 1B6BA 1S5KA 1SQHA 1XE4A 4CAEA 2JDCA 3IWEA 2Z11A 4UWIA 3TCVA 2EVNA 4IF5A 4CGNA 2Q4YA 2REEA 2WPWA 3RYOA 3FBUA 1S3ZA 2Z3MA 2ZW4A 4AG9A 3VWEA 3SXNA 2KCWA 3V8IA 3CXPA 2OU2A 4KSFA 5AGEA 5EBVA 1LRZA 2OZUA 4C68A 2WPXA 4AVBA 3GY9A 3BJ7A 2Z3PA 2VXKA 1RXTA 3S6HA 2OB0A 5G22A 3G3SA 2JDDA 2J8MA 2CXAA 5I0CA 1IYKA 3S6FA 4UFXA 2JLMA 4M85A 3NE7A 2JEVA 3CXQA 2IL4A 3KKWA 2VZYA 4ZBGA 2ZW7A 4PSXA 1S7KA 1P0HA 2CY2A 4UBRA 1M4DA 4JXQA 2B58A 4KOWA 4E0AA 2P0WA 4RI1A 5DWNA 4L89A 3VWDA 3F5BA 3D3SA 1Y9KA 2HV2A 5AG4A 1YVOA 4B11A 1XEBA 2YNEA 4B5PA 2VZZA 4B10A 5J8FA 4CAWA 3SHPA 4CYNA 4MFLA 4CRZB 2BEIA 4EVYA 2BSWA 2Q7BA 4HNYB 4LUAA 2Q0YA 3EXNA 4L8AA 4FD4A 3R9GA 3DDDA 2NMTA 4CGMA 3EC4A 3TFYA 1ON0A 2R8VA 3T90A 1M44A 4B5PB 1Q2CA 4NCZA 3R9EA 1XF8A 4K30A 4GS4A 5BWAB 4PV6A 1Q2YA 4MFJA 4BBHA 4FD5A 2Q44A 3F0AA 1M1DA 2J8RA 2YNCC 2AE6A 5IB0A 1QSOA 3DR6A 5F46A 4CS0B 5H84A 4JXRA 4H6ZA 5HH1A 3A9LA 3FIXA 4CRYB 3E0KA 3ZJ0A 4HNWB 2YNCA 1YGHA 2K5TA 2Z10A 4AVCA 2B5GB 4A33A 3B8GA 3PP9A 1XIXA 3GYAA 4MI4A 5IV0A 3D2MA 2D4OA 2VBQA 5F49A 4CYOA 5F47A 4C7HA 2X7BA 1YR0A 2YGWA 1V0CA 3IWGA 4MY3A 5H86A 3R95A 3PZJA 1NE9A 4KVOE 1M4IA 4H6UA 4CYPA 4YRHA 4MFQA 3FXTA 1NMTA 5EC4A 4QUSA 5G1ZA 2BUEA 2ZW5A 5KTDA 4A32A 1BOBA 1CJWA 2REFA 2PRBA 3TOAA 2Z3NA 2QECA 4CAXA 2DPSA 1RO5A 1Y9WA 3TTHA 1P4NA 1U6MA 1KUYA 4U9YA 3IGRA 4BMHA 4QVTA 4UCPA 4CGLA 3CXSA 1S7FA 4U5YA 2OZGA 1Q2DA 3GKRA 4XNHB 2DPTA 3W91A 2Z3LA 1BO4A 1PUAA 4J3GA 2EUIA 1XMTA 4B5OA 2G3AA 5JQ4A 2FL4A 4XPDB 3C26A 4F6AA 4NF1A 4KZTA 4B14A 4E2AA 4RS2A 5JPHA 3JTKA 2QMLA 1IIDA 4UWJA 2Z3KA 2F5IA 4KOVA 4X5KA 1Y7RA 3JUWA 3TT2A 2HQYA 2FIWA 3P2FA 4OADA 1MJ9A 1Z4RA 2BL1A 5J8CA 2CNMA 2Z3OA 5A27A 2R7HA 3IU1A 4JJXA 3DSBA 4KORA 1B87A 1S7NA 2G0BA 5ISVA 5G20A 2GE3A 2OZHA 4NXYA 4R87A 2R1IA 3TO9A 2B5GA 3H5ZA 5DWMA 2WUUA 4YFJA 2B4DB 3D2PA 4KOXA 2HUZA 2PR8A 3T9YA 1NSLA 2ATRA 4KLVA 2P6EA 4KLWA 4MBUA 1CM0A 4UA3A 4CGOA 2AJ6A 2P6GA 3P2HA 1N71A 2J8NA 1MJBA 4B13A 5KTAA 4KS9A 2WSAA 2A4NA 1TIQA 4KVME 4CAVA 3I3GA 4ONUA 5FVJA 2GANA 4FD6A 4CGPA 4F0XA 3BJ8A 4ZGYB 1YX0A 1ZO0A 4HKFA 4KUAA 2I00A 1IYLA 4F0YA 5C82A 1FY7A 4JLYA 2GIVA 5AG6A 2FSRA 4IUSA 5F48A 4MHDA 4II9A 4YGOA 2VEZA 2VI7A 2FS5A 4XPLA 2R98A 2Q4VA 1QSRA 4Q38A 4XNHC 4AB7A 1K4JA 4UFVA 2Z0ZA 4MFKA 4KSAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A95 A;  4C2X A;  4CGM A;  5AG6 A;  5A28 A;  3IU2 A;  4UFW A;  4CAE A;  5A27 A;  5G22 A;  2YND A;  4CYP A;  3IU1 A;  2YNC A;  4CGO A;  4UCP A;  5AG4 A;  4CAF A;  4C2Z A;  4A33 A;  4B11 A;  4CGL A;  3IWE A;  4UFX A;  2YNE A;  4CGN A;  5AG5 A;  5G1Z A;  4B10 A;  5G20 A;  4B13 A;  4CYQ A;  4BBH A;  4C7I A;  2WSA A;  4A32 A;  4CYN A;  4B14 A;  4A2Z A;  2YNC C;  4CYO A;  3H5Z A;  4C7H A;  3JTK A;  4CGP A;  4UCN A;  5G21 A;  4C2Y A;  5AGE A;  2WUU A;  4B12 A;  4A30 A;  5AG7 A;  4A31 A;  4C68 A;  4UCM A;  4UFV A; 
#chains in the Genus database with same CATH topology
 1QSM A;  2EO8 A;  3GUX A;  4IHM A;  4Y49 B;  4C2X A;  5J1Q A;  1I21 A;  5K8M A;  2F8H A;  1S60 A;  2ZOF A;  3MN8 A;  4QB9 A;  4XPD C;  1QST A;  4U9Z A;  3S9N A;  2H5M A;  2CTC A;  4AXV A;  1CPS A;  5E96 A;  4PK2 A;  2XEI A;  1DTD A;  1KZF A;  4NGM A;  4XPK A;  2ZXV A;  1NSA A;  5AG5 A;  2ZEN A;  2EWB A;  2G3T A;  3EO4 A;  4P44 A;  4R57 A;  5LYI A;  4KUB A;  4OLL A;  1S7L A;  4JWP A;  3OWC A;  4B12 A;  3FRM A;  3BI1 A;  5I4M A;  5K8N A;  1ZG8 A;  1GYT A;  4QBJ A;  1I1D A;  3B3T A;  4KOY A;  3RAM A;  3UY5 A;  1WWZ A;  3PGP A;  4PK3 A;  4P4E A;  2BO9 A;  3S6K A;  1Y0Y A;  2PJ6 A;  1YVK A;  1IOF A;  4UFW A;  1YRE A;  2P6F A;  2RC4 A;  2YND A;  3TO6 A;  2PJ4 A;  4ZYQ A;  5CNP A;  3DNS A;  3PFE A;  2CNT A;  3MRU A;  1R57 A;  2Q04 A;  1AMP A;  3W6S A;  5JGF A;  5HVH A;  4I49 A;  1LAN A;  4R3K A;  4NGP A;  4OKO A;  2QIR A;  3F8K A;  4MJ8 A;  4HNX B;  3WC7 A;  1OZP A;  1IIC A;  4MHZ A;  3K9U A;  1J4J A;  1CBX A;  1QSN A;  3LD2 A;  2B3U A;  1Z9U A;  4KOU A;  4MHY A;  4QC6 A;  5IX3 A;  3R9F A;  3ISZ A;  3G8W A;  1L0C A;  2FXF A;  2Q51 A;  4M3S A;  2EK9 A;  2WZN A;  3HUV A;  3NFZ A;  4AG7 A;  1YLE A;  1IB1 E;  2B4D A;  4OC1 A;  1PU9 A;  4CAF A;  1KUX A;  1CX8 A;  1MJA A;  1PCA A;  1VKC A;  2PSW A;  4AVA A;  3TE4 A;  5D8N A;  2RFH A;  3EY5 A;  3KGQ A;  4Q36 A;  5HMN A;  2HC9 A;  2ZEM A;  4MFP A;  4KVX A;  4MCP A;  5K8O A;  3LOD A;  4MY0 A;  2GRE A;  4CYQ A;  1BPM A;  3WC5 A;  4C7I A;  3NH8 A;  1I12 A;  1Z8T A;  4MCR A;  3KQZ A;  4E8O A;  3PB8 X;  3QAH A;  2AFM A;  3S6G A;  1M4L A;  4OC2 A;  1EE3 P;  1JWQ A;  3R96 A;  5G21 A;  1ZLH A;  3VH9 A;  2VQY A;  4MRI A;  4NSQ A;  3TOB A;  2PJ5 A;  4A30 A;  2D4P A;  5AG7 A;  4A31 A;  3D7H A;  2PC1 A;  4UEE A;  3FB3 A;  4KOS A;  4KOT A;  1VIX A;  4EWT A;  3S9M A;  1ZG9 A;  3JVN A;  3SXO A;  3ZZI A;  5A28 A;  3D8P A;  1WK4 A;  1MK4 A;  1TKJ A;  2OH1 A;  4Q7A A;  1VHS A;  1CPX A;  3FX6 A;  3BLN A;  2B4B A;  3CPA A;  1YK3 A;  3EFA A;  4OID A;  4OME A;  4X8I A;  4C2Z A;  2CIJ A;  4LQG A;  2AFX A;  4R9M A;  5C88 A;  3D7D A;  4GM5 A;  2I79 A;  2Y0M A;  5KTC A;  2F7V A;  1KUV A;  1TF8 A;  1ZLI A;  4A2Z A;  4P10 A;  5LRG A;  4R3L A;  4LX9 A;  4H89 A;  4FD7 A;  4NEX A;  4DNC A;  3FNC A;  1IGB A;  1CP7 A;  2ARH A;  2I3C A;  3N7Z A;  2FE7 A;  3SI0 A;  4Y49 C;  4MHN A;  3WR7 A;  1UFH A;  3I9S A;  2J9A A;  3IWW A;  3QB8 A;  3SI2 A;  3NA6 A;  2FT0 A;  4UCM A;  1M4G A;  4ZY2 A;  4A95 A;  3NE8 A;  1F2O A;  1HDU A;  2B3V A;  3IU2 A;  3SJX A;  4ORF A;  1QMU A;  2C27 A;  2FCK A;  2CNS A;  2O28 A;  4MFZ A;  2PIY A;  4OAE A;  2GLJ A;  2PQ8 A;  4JD6 A;  4RN7 A;  2DXQ A;  2PDO A;  3D67 A;  4F8Z A;  2PR1 A;  2ZW6 A;  3W6X A;  3CZX A;  3FYN A;  1Z4E A;  5JM6 A;  4R7M A;  3DR8 A;  4IAV A;  3H4Q A;  3MGD A;  1LAP A;  4TWE A;  3R1K A;  5GCN A;  5LYD A;  2FIA A;  4UCN A;  4C2Y A;  1YW4 A;  5IB9 A;  3TO7 A;  1GHE A;  4PSW A;  4DYO A;  2ZPA A;  3HLP A;  1B6B A;  1BAV A;  3KI9 A;  4LQ6 A;  3PBB A;  1S5K A;  1QQ9 A;  2ODF A;  3T8W A;  2PJ7 A;  4ONW A;  1SQH A;  1XE4 A;  1HEE A;  1Z5R A;  4A39 A;  2ZED A;  4CAE A;  4WWV A;  3IIB A;  1JQG A;  1YME A;  4DUK A;  1ELM P;  2CF4 A;  3FEE A;  3KQX A;  2Z0Z A;  3FH4 A;  5HVG A;  2JDC A;  3IWE A;  2Z11 A;  4UWI A;  3TCV A;  2EVN A;  4IF5 A;  4CGN A;  2Q4Y A;  2REE A;  2WPW A;  2OR4 A;  3RYO A;  3FBU A;  6CPA A;  3D66 A;  1S3Z A;  2Z3M A;  2ZW4 A;  4AG9 A;  3VWE A;  3SXN A;  2KCW A;  4M6I A;  3V8I A;  3CXP A;  2OU2 A;  4KSF A;  1Y0R A;  3B35 A;  3IC1 A;  5AGE A;  5EBV A;  5CPA A;  1LRZ A;  2OZU A;  4C68 A;  2PJ9 A;  2WPX A;  3WC6 A;  4AVB A;  2VL1 A;  3GY9 A;  3BJ7 A;  2Z3P A;  2VXK A;  1RXT A;  1AUG A;  5EMI A;  3S6H A;  2Q4Z A;  2OB0 A;  5G22 A;  3G3S A;  4FUU A;  2JDD A;  2C6C A;  4P6Y A;  2J8M A;  2CXA A;  1A2Z A;  3PBE A;  2AFU A;  5I0C A;  1IYK A;  2GFQ A;  4MXU A;  4ZI6 A;  3S6F A;  4UFX A;  2JLM A;  4M85 A;  1CG2 A;  2JEV A;  3CXQ A;  3NE7 A;  3CDX A;  2IL4 A;  2BOA A;  2G9D A;  2V77 A;  3KKW A;  2C6P A;  2VZY A;  4ZBG A;  2ZW7 A;  3H8F A;  3NH4 A;  4PSX A;  4P45 A;  1S7K A;  1P0H A;  2CY2 A;  2PJ1 A;  4UBR A;  4A94 A;  1M4D A;  2RB7 A;  2B58 A;  3KL9 A;  4JXQ A;  4KOW A;  4NGT A;  4E0A A;  3ISX A;  2P0W A;  2V8D A;  4MMO A;  3KR4 A;  4RI1 A;  4FBE A;  5DWN A;  4L89 A;  3VWD A;  3B3V A;  1XRY A;  3GB0 A;  3BXM A;  2NYQ A;  2JBJ A;  3F5B A;  2ZEP A;  3D3S A;  2ZEF A;  1Y9K A;  2HV2 A;  7CPA A;  4NJQ A;  5AG4 A;  2JEW A;  4ZX8 A;  4B11 A;  1BPN A;  1XEB A;  2YNE A;  3PRT A;  4YWY A;  2VZZ A;  5HVF A;  4B10 A;  4B5P A;  4CAW A;  3SHP A;  5J8F A;  2AFO A;  4CYN A;  4MFL A;  4CRZ B;  2BEI A;  2PJ2 A;  3KHX A;  3B7I A;  5K8P A;  4EVY A;  4F9U A;  1LFW A;  3SI1 A;  3VAT A;  2BSW A;  2Q7B A;  4HNY B;  4LUA A;  2Q0Y A;  3EXN A;  4L8A A;  1BLL E;  4FD4 A;  4NFR A;  1Z8L A;  3R9G A;  4RUH A;  2C1C A;  3DDD A;  2NMT A;  4CGM A;  3CPX A;  3EC4 A;  3GIU A;  3TFY A;  4PXB A;  3TX8 A;  1ON0 A;  2R8V A;  3PB4 X;  4JZ0 A;  3PB6 X;  1M44 A;  4R6T A;  1Q2C A;  4NCZ A;  3T90 A;  4IK2 A;  4B5P B;  3SJE A;  3R9E A;  1Z2L A;  1OBR A;  2EBJ A;  1XF8 A;  4M6H A;  4NGN A;  4K30 A;  1Q7L A;  4GS4 A;  4OC3 A;  5BWA B;  4PV6 A;  4BD9 A;  4MCS A;  1Q2Y A;  4MFJ A;  4BBH A;  4FD5 A;  2Q44 A;  2V8G A;  3FJU A;  3F0A A;  3PB7 X;  4O23 A;  1M1D A;  2J8R A;  2GU2 A;  2YNC C;  2AE6 A;  5IB0 A;  4GXH A;  2V8H A;  1IU8 A;  4PQA A;  4UEZ A;  3IJ3 A;  4JYW A;  2AFS A;  2PE3 A;  1QSO A;  3DR6 A;  5F46 A;  3FEC A;  4NJR A;  1FNO A;  5H84 A;  4CS0 B;  1ELL P;  4JXR A;  4H6Z A;  1LAM A;  5HH1 A;  2QYV A;  3A9L A;  3FIX A;  3IFE A;  5DS0 A;  3E0K A;  4CRY B;  3B3S A;  3PFO A;  4EME A;  1R43 A;  3ZJ0 A;  4HNW B;  5LYL A;  2YNC A;  3DLJ A;  4PXE A;  3PB9 X;  1YGH A;  2K5T A;  2C6G A;  2Z10 A;  2B5G B;  4A33 A;  4AVC A;  3I1U A;  4H2K A;  3B8G A;  3PP9 A;  1XIX A;  3GYA A;  4MI4 A;  5IV0 A;  1LCP A;  2ZEH A;  2DF5 A;  3D2M A;  4OC0 A;  2D4O A;  3FVL A;  2VBQ A;  2XEJ A;  5F49 A;  4CYO A;  5F47 A;  1Y7E A;  4C7H A;  3N5F A;  2X7B A;  1YR0 A;  1UWY A;  1YQE A;  1ARL A;  1X12 A;  2GLF A;  5LRK A;  1FT7 A;  4B6Z A;  2POK A;  2YGW A;  3KAS A;  4NGR A;  4OC4 A;  3KHZ A;  1V0C A;  3IWG A;  4MY3 A;  5H86 A;  3R95 A;  3V38 A;  3PZJ A;  1NE9 A;  4KVO E;  1M4I A;  2HB6 A;  2ZEG A;  4H6U A;  4W9Y A;  2PIZ A;  1XMB A;  4CYP A;  4PPZ A;  2JBK A;  3NH5 A;  1XBU A;  4YRH A;  4A37 A;  4PXD A;  1TXR A;  4MFQ A;  1TKH A;  3FXT A;  1NMT A;  2CTB A;  4NGS A;  5EC4 A;  4QUS A;  5G1Z A;  2BUE A;  2ZW5 A;  3K9T A;  5KTD A;  5CBM A;  4A32 A;  3PEI A;  1BOB A;  1CJW A;  1XOV A;  4EFD A;  4WJB A;  1IOI A;  1ARM A;  2PRB A;  2REF A;  3D68 A;  3TOA A;  4UF4 A;  2Z3N A;  3FED A;  3TC8 A;  2QEC A;  1VHO A;  4M6G A;  2DPS A;  4CAX A;  4YU9 A;  3WT4 A;  1RO5 A;  3B2Y A;  1TKF A;  1Y9W A;  3H8G A;  5LYF A;  3TTH A;  1P4N A;  4R8F A;  1U6M A;  2IQ6 A;  1KUY A;  4U9Y A;  3IGR A;  4BMH A;  4QVT A;  4UCP A;  3RO0 A;  2PJ0 A;  1HDQ A;  1YW6 A;  1PYT B;  4CGL A;  3CXS A;  3BI0 A;  3D4U A;  2DEA A;  3KZW A;  1KWM A;  4X3R A;  3LMS A;  1YLO A;  1S7F A;  4R76 A;  4U5Y A;  4ZX9 A;  2OZG A;  2PVW A;  2ZOG A;  5F09 A;  1Q2D A;  4P4B A;  1H8L A;  3GKR A;  4XNH B;  2DPT A;  2XEF A;  1VGY A;  3QNV A;  3W91 A;  2Z3L A;  4Z65 A;  1BO4 A;  1PUA A;  4J3G A;  2EUI A;  4MHP A;  1F57 A;  2XEG A;  1XMT A;  3SJG A;  4BIN A;  4MCQ A;  2BCO A;  4B5O A;  1F2P A;  2PJ3 A;  3D7F A;  2G3A A;  3VAR A;  2QVP A;  4G1P A;  2PJB A;  5JH9 A;  2FL4 A;  5JQ4 A;  1LOK A;  4XPD B;  2PRQ A;  2Q43 A;  3C26 A;  4F6A A;  4NF1 A;  4OC5 A;  1XFO A;  3WAB A;  4KZT A;  4OP4 A;  4B14 A;  4E2A A;  4RS2 A;  3RZA A;  5HXD A;  2Q7S A;  2PVV A;  5JPH A;  3JTK A;  4ZY1 A;  2QML A;  1IID A;  1DE4 C;  2PCU A;  4UWJ A;  1XJO A;  2Z3K A;  4P4D A;  2F5I A;  4KOV A;  4X5K A;  1Y7R A;  3JUW A;  3TT2 A;  4FWU A;  2HQY A;  2FIW A;  2ZEO A;  3JRU A;  3P2F A;  1MJ9 A;  1Z4R A;  2BL1 A;  4OAD A;  3RNZ A;  5J8C A;  2CNM A;  2PJ8 A;  2Z3O A;  2QJ8 A;  5A27 A;  3IO1 A;  1AYE A;  2R7H A;  2V8V A;  3IU1 A;  2EK8 A;  4P4J A;  5LRJ A;  4JJX A;  2PJC A;  1Z8X A;  3DSB A;  3LWU A;  3BHX A;  4KOR A;  1B87 A;  1S7N A;  5D29 A;  5THW A;  4DJL A;  2G0B A;  5ISV A;  5G20 A;  2GE3 A;  2OZH A;  1Z8W A;  4NXY A;  4R87 A;  4UIB A;  4UEF A;  3KR5 A;  4PXC A;  2R1I A;  3V7Z A;  3TO9 A;  2B5G A;  2WYR A;  3H5Z A;  2NSM A;  4NGQ A;  5DWM A;  5ELY A;  4A38 A;  2WUU A;  4YFJ A;  2B4D B;  3GLJ A;  3D2P A;  4KOX A;  2HUZ A;  2PR8 A;  2IMO A;  1NSL A;  3T9Y A;  2O53 A;  1ZG7 A;  2ATR A;  1CP6 A;  4KLV A;  2P6E A;  3CT9 A;  4KLW A;  4MBU A;  1CM0 A;  4UA3 A;  1TF9 A;  4CGO A;  2ZEE A;  4F9V A;  1RTQ A;  2OOT A;  3H8E A;  2AJ6 A;  2P6G A;  1R3N A;  1N71 A;  3P2H A;  4P4I A;  2J8N A;  1MJB A;  4B13 A;  5KTA A;  2ABZ A;  4KS9 A;  2WSA A;  2A4N A;  2IJZ A;  3RBU A;  1TIQ A;  3B3W A;  2ZEL A;  4KVM E;  4CAV A;  3I3G A;  4ONU A;  4ZY0 A;  3B3C A;  3L2N A;  5FVJ A;  2GAN A;  4FD6 A;  2ANP A;  3LAC A;  3BJ8 A;  4CGP A;  4F0X A;  1VHE A;  1X10 A;  4ZGY B;  1YX0 A;  1ZO0 A;  2PJA A;  4HKF A;  4KUA A;  2I00 A;  1IYL A;  3SJF A;  4F0Y A;  2FVG A;  1FY7 A;  3DGV A;  3FMC A;  3FF3 A;  4JLY A;  3K2K A;  2GIV A;  5C82 A;  4TNU A;  5AG6 A;  8CPA A;  2FSR A;  4IUS A;  5F48 A;  4CPA A;  2O4H A;  4X2T A;  4FAI A;  4OIW A;  4P4F A;  4MHD A;  3QAY A;  4II9 A;  4YGO A;  2VEZ A;  3IEH A;  2VI7 A;  1YSJ A;  2FS5 A;  2AFZ A;  4HPS A;  4XPL A;  2R98 A;  2Q4V A;  1QSR A;  4Q38 A;  3S9L A;  4XNH C;  4UIA A;  4KSI A;  3D7G A;  4AB7 A;  4K3N A;  1IY7 A;  1K4J A;  2AFW A;  4UFV A;  1YVO A;  4MFK A;  4KSA A; 
#chains in the Genus database with same CATH homology
 1QSM A;  4Y49 B;  4C2X A;  1I21 A;  1S60 A;  4QB9 A;  4XPD C;  1QST A;  4U9Z A;  2H5M A;  5E96 A;  4PK2 A;  1KZF A;  4XPK A;  2ZXV A;  5AG5 A;  2G3T A;  3EO4 A;  4R57 A;  4KUB A;  4OLL A;  1S7L A;  4JWP A;  3OWC A;  4B12 A;  3FRM A;  4QBJ A;  1I1D A;  4KOY A;  3UY5 A;  1WWZ A;  3PGP A;  4PK3 A;  3S6K A;  1YVK A;  4UFW A;  3TO6 A;  1YRE A;  2P6F A;  2RC4 A;  2YND A;  5CNP A;  3DNS A;  2CNT A;  1R57 A;  2Q04 A;  3W6S A;  4I49 A;  4R3K A;  2QIR A;  3F8K A;  4MJ8 A;  4HNX B;  1OZP A;  1IIC A;  3K9U A;  1J4J A;  1QSN A;  3LD2 A;  2B3U A;  1Z9U A;  4KOU A;  4QC6 A;  5IX3 A;  3R9F A;  3G8W A;  1L0C A;  2FXF A;  4M3S A;  4AG7 A;  1YLE A;  1IB1 E;  2B4D A;  1PU9 A;  4CAF A;  1KUX A;  1VKC A;  1MJA A;  2PSW A;  4AVA A;  3TE4 A;  3EY5 A;  5HMN A;  4Q36 A;  4MFP A;  4KVX A;  3LOD A;  4MY0 A;  4CYQ A;  4C7I A;  1I12 A;  4E8O A;  3QAH A;  3S6G A;  3R96 A;  5G21 A;  2VQY A;  4NSQ A;  3TOB A;  4A30 A;  2D4P A;  5AG7 A;  4A31 A;  2PC1 A;  3FB3 A;  4KOS A;  4KOT A;  3JVN A;  3SXO A;  3ZZI A;  5A28 A;  3D8P A;  1WK4 A;  1MK4 A;  2OH1 A;  1VHS A;  3BLN A;  2B4B A;  1YK3 A;  3EFA A;  4C2Z A;  4R9M A;  5C88 A;  2I79 A;  2Y0M A;  5KTC A;  1KUV A;  4A2Z A;  4DNC A;  4R3L A;  4LX9 A;  4H89 A;  4FD7 A;  4NEX A;  3FNC A;  2ARH A;  3N7Z A;  2FE7 A;  4Y49 C;  3WR7 A;  1UFH A;  3I9S A;  3QB8 A;  2FT0 A;  4UCM A;  1M4G A;  4A95 A;  2B3V A;  3IU2 A;  4ORF A;  2C27 A;  2FCK A;  2CNS A;  2O28 A;  4MFZ A;  4OAE A;  2PQ8 A;  4JD6 A;  2DXQ A;  2PDO A;  2PR1 A;  2ZW6 A;  3W6X A;  3FYN A;  1Z4E A;  3DR8 A;  3H4Q A;  3MGD A;  3R1K A;  5GCN A;  2FIA A;  4UCN A;  4C2Y A;  3TO7 A;  1GHE A;  4PSW A;  2ZPA A;  1B6B A;  1S5K A;  1SQH A;  1XE4 A;  4CAE A;  2JDC A;  3IWE A;  2Z11 A;  4UWI A;  3TCV A;  2EVN A;  4IF5 A;  4CGN A;  2Q4Y A;  2REE A;  2WPW A;  3RYO A;  3FBU A;  1S3Z A;  2Z3M A;  2ZW4 A;  4AG9 A;  3VWE A;  3SXN A;  2KCW A;  3V8I A;  3CXP A;  2OU2 A;  4KSF A;  5AGE A;  5EBV A;  1LRZ A;  2OZU A;  4C68 A;  2WPX A;  4AVB A;  3GY9 A;  3BJ7 A;  2Z3P A;  2VXK A;  1RXT A;  3S6H A;  2OB0 A;  5G22 A;  3G3S A;  2JDD A;  2J8M A;  2CXA A;  5I0C A;  1IYK A;  3S6F A;  4UFX A;  2JLM A;  4M85 A;  3NE7 A;  2JEV A;  3CXQ A;  2IL4 A;  3KKW A;  2VZY A;  4ZBG A;  2ZW7 A;  4PSX A;  1S7K A;  1P0H A;  2CY2 A;  4UBR A;  1M4D A;  4JXQ A;  2B58 A;  4KOW A;  4E0A A;  2P0W A;  4RI1 A;  5DWN A;  4L89 A;  3VWD A;  3F5B A;  3D3S A;  1Y9K A;  2HV2 A;  5AG4 A;  1YVO A;  4B11 A;  1XEB A;  2YNE A;  4B5P A;  2VZZ A;  4B10 A;  5J8F A;  4CAW A;  3SHP A;  4CYN A;  4MFL A;  4CRZ B;  2BEI A;  4EVY A;  2BSW A;  2Q7B A;  4HNY B;  4LUA A;  2Q0Y A;  3EXN A;  4L8A A;  4FD4 A;  3R9G A;  3DDD A;  2NMT A;  4CGM A;  3EC4 A;  3TFY A;  1ON0 A;  2R8V A;  3T90 A;  1M44 A;  4B5P B;  1Q2C A;  4NCZ A;  3R9E A;  1XF8 A;  4K30 A;  4GS4 A;  5BWA B;  4PV6 A;  1Q2Y A;  4MFJ A;  4BBH A;  4FD5 A;  2Q44 A;  3F0A A;  1M1D A;  2J8R A;  2YNC C;  2AE6 A;  5IB0 A;  1QSO A;  3DR6 A;  5F46 A;  4CS0 B;  5H84 A;  4JXR A;  4H6Z A;  5HH1 A;  3A9L A;  3FIX A;  4CRY B;  3E0K A;  3ZJ0 A;  4HNW B;  2YNC A;  1YGH A;  2K5T A;  2Z10 A;  4AVC A;  2B5G B;  4A33 A;  3B8G A;  3PP9 A;  1XIX A;  3GYA A;  4MI4 A;  5IV0 A;  3D2M A;  2D4O A;  2VBQ A;  5F49 A;  4CYO A;  5F47 A;  4C7H A;  2X7B A;  1YR0 A;  2YGW A;  1V0C A;  3IWG A;  4MY3 A;  5H86 A;  3R95 A;  3PZJ A;  1NE9 A;  4KVO E;  1M4I A;  4H6U A;  4CYP A;  4YRH A;  4MFQ A;  3FXT A;  1NMT A;  5EC4 A;  4QUS A;  5G1Z A;  2BUE A;  2ZW5 A;  5KTD A;  4A32 A;  1BOB A;  1CJW A;  2REF A;  2PRB A;  3TOA A;  2Z3N A;  2QEC A;  4CAX A;  2DPS A;  1RO5 A;  1Y9W A;  3TTH A;  1P4N A;  1U6M A;  1KUY A;  4U9Y A;  3IGR A;  4BMH A;  4QVT A;  4UCP A;  4CGL A;  3CXS A;  1S7F A;  4U5Y A;  2OZG A;  1Q2D A;  3GKR A;  4XNH B;  2DPT A;  3W91 A;  2Z3L A;  1BO4 A;  1PUA A;  4J3G A;  2EUI A;  1XMT A;  4B5O A;  2G3A A;  5JQ4 A;  2FL4 A;  4XPD B;  3C26 A;  4F6A A;  4NF1 A;  4KZT A;  4B14 A;  4E2A A;  4RS2 A;  5JPH A;  3JTK A;  2QML A;  1IID A;  4UWJ A;  2Z3K A;  2F5I A;  4KOV A;  4X5K A;  1Y7R A;  3JUW A;  3TT2 A;  2HQY A;  2FIW A;  3P2F A;  4OAD A;  1MJ9 A;  1Z4R A;  2BL1 A;  5J8C A;  2CNM A;  2Z3O A;  5A27 A;  2R7H A;  3IU1 A;  4JJX A;  3DSB A;  4KOR A;  1B87 A;  1S7N A;  2G0B A;  5ISV A;  5G20 A;  2GE3 A;  2OZH A;  4NXY A;  4R87 A;  2R1I A;  3TO9 A;  2B5G A;  3H5Z A;  5DWM A;  2WUU A;  4YFJ A;  2B4D B;  3D2P A;  4KOX A;  2HUZ A;  2PR8 A;  3T9Y A;  1NSL A;  2ATR A;  4KLV A;  2P6E A;  4KLW A;  4MBU A;  1CM0 A;  4UA3 A;  4CGO A;  2AJ6 A;  2P6G A;  3P2H A;  1N71 A;  2J8N A;  1MJB A;  4B13 A;  5KTA A;  4KS9 A;  2WSA A;  2A4N A;  1TIQ A;  4KVM E;  4CAV A;  3I3G A;  4ONU A;  5FVJ A;  2GAN A;  4FD6 A;  4CGP A;  4F0X A;  3BJ8 A;  4ZGY B;  1YX0 A;  1ZO0 A;  4HKF A;  4KUA A;  2I00 A;  1IYL A;  4F0Y A;  5C82 A;  1FY7 A;  4JLY A;  2GIV A;  5AG6 A;  2FSR A;  4IUS A;  5F48 A;  4MHD A;  4II9 A;  4YGO A;  2VEZ A;  2VI7 A;  2FS5 A;  4XPL A;  2R98 A;  2Q4V A;  1QSR A;  4Q38 A;  4XNH C;  4AB7 A;  1K4J A;  4UFV A;  2Z0Z A;  4MFK A;  4KSA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...