1S7FA

Riml- ribosomal l7/l12 alpha-n-protein acetyltransferase crystal form i (apo)
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
184
structure length
181
Chain Sequence
GLVPRGSHMVEIIPVSTTLELRAADESHVPALHQLVLKNKAWLQQSLDWPTSQEETRKHVQGNILLHQRGYAKMYLIFCQNEMAGVLSFNAIEPINKAAYIGYWLDESFQGQGIMSQSLQALMTHYARRGDIRRFVIKCRVDNQASNAVARRNHFTLEGCMKQAEYLNGDYHDVNMYARII
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A novel dimeric structure of the RimL Nalpha-acetyltransferase from Salmonella typhimurium.
pubmed doi rcsb
source organism Salmonella typhimurium
molecule tags Transferase
molecule keywords acetyl transferase
total genus 57
structure length 181
sequence length 184
ec nomenclature ec 2.3.1.-:
pdb deposition date 2004-01-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13302 Acetyltransf_3 Acetyltransferase (GNAT) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 1s7fA00
3DNSA 1KUYA 4KOXA 1XEBA 3LODA 3ZZIA 5KTDA 4KUBA 4HNXB 2VZYA 5KTCA 5DWNA 4CRZB 2PQ8A 3D3SA 3F0AA 4KOYA 2D4OA 1IYLA 2OZUA 2FT0A 4MY3A 3R95A 5F48A 5J8CA 1IYKA 3IGRA 2NMTA 3F8KA 4KVOE 3S6FA 2P0WA 3G8WA 2QMLA 2B4BA 1I12A 4MHDA 2Q4VA 3K9UA 3W91A 3R9EA 4BMHA 3S6KA 3S6HA 1TIQA 4QC6A 4XPDC 2PSWA 3EO4A 4AG9A 1YX0A 3OWCA 4MY0A 1IIDA 1FY7A 2ZPAA 2Z11A 4PV6A 3TOBA 3I3GA 4K30A 3T90A 4KVME 1BOBA 2Z0ZA 3R9GA 3CXQA 3LD2A 4OADA 3NE7A 5FVJA 2FCKA 4E8OA 1KZFA 4AVAA 5JPHA 1KUVA 1YR0A 2B4DA 2RC4A 4NCZA 1S7KA 2AJ6A 4JD6A 1WWZA 4LUAA 2I79A 5EBVA 5F49A 1MK4A 4H6UA 4Y49C 1RO5A 2I00A 4FD4A 3TTHA 4J3GA 4JXRA 1NSLA 1R57A 4DNCA 4M85A 2PR1A 3TFYA 1PU9A 3TCVA 4PSXA 1P4NA 2G3AA 2X7BA 3D8PA 5DWMA 2P6EA 5E96A 1XE4A 4I49A 4XPLA 1J4JA 3S6GA 4CAWA 3B8GA 1NE9A 3TT2A 2Q7BA 2Q4YA 3EY5A 1XIXA 5F47A 4H6ZA 1CJWA 3EFAA 4X5KA 1YLEA 1YK3A 3ZJ0A 2BUEA 3I9SA 2J8MA 4B5PB 1Y7RA 2ZW4A 3FNCA 1QSRA 5HH1A 4PK2A 1VHSA 4IUSA 3TE4A 3H4QA 3TO6A 2GIVA 2REEA 4KVXA 1I1DA 3W6SA 2ZW5A 2JDCA 2J8NA 1GHEA 3IWGA 3DR6A 1Z4EA 2CNMA 4QBJA 2JLMA 2R98A 4U9YA 4NF1A 1S3ZA 2KCWA 4CAVA 1YREA 4HKFA 2A4NA 1M4GA 5EC4A 3BJ8A 4XPKA 3D2PA 2B5GB 1S5KA 2AE6A 2BL1A 1M4IA 2ZW6A 1IICA 1S7NA 2JEVA 2R8VA 2R1IA 4E2AA 2EUIA 4IF5A 2B58A 2Q44A 4NEXA 3R96A 4L89A 1ON0A 4KUAA 2FSRA 1KUXA 1XF8A 1YVKA 2CNSA 3PP9A 4QB9A 4RS2A 3FB3A 3EXNA 2FXFA 3FBUA 1WK4A 4JXQA 4E0AA 2IL4A 2Y0MA 3QAHA 5GCNA 1YGHA 4PK3A 1M4DA 2C27A 3W6XA 3FRMA 4R57A 3N7ZA 5IX3A 4R3LA 2G3TA 1CM0A 1MJBA 5HMNA 1N71A 4UWIA 2Q0YA 2VBQA 4XPDB 3VWDA 4XNHC 4B5OA 3R1KA 4PSWA 2GANA 2VI7A 4NXYA 5C82A 3VWEA 2PC1A 2BEIA 4GS4A 4QVTA 3E0KA 3MGDA 1S7LA 3D2MA 2G0BA 3PZJA 3FYNA 3V8IA 2R7HA 4F0YA 4KZTA 1M1DA 1Y9KA 5JQ4A 4JWPA 4F6AA 3CXPA 3EC4A 1QSNA 1B6BA 2GE3A 4MI4A 2OB0A 2QIRA 3RYOA 4LX9A 5I0CA 3SXNA 3GYAA 3SHPA 1YVOA 3SXOA 2J8RA 3DR8A 1Q2CA 3QB8A 2B3UA 4ONUA 3TO7A 4KOTA 3BLNA 4KOWA 3JUWA 4CS0B 2Q04A 1M44A 1IB1E 5J8FA 3C26A 1MJ9A 2F5IA 1QSMA 2ARHA 4YGOA 4ZBGA 2ZXVA 1QSOA 3DDDA 2WPXA 2Z10A 4YRHA 1NMTA 2OZHA 2VXKA 2REFA 4FD5A 3UY5A 4R3KA 3CXSA 2PDOA 4AG7A 3TO9A 2O28A 3KKWA 3WR7A 4ORFA 5ISVA 4UBRA 4B5PA 4R9MA 4KLWA 3BJ7A 2OZGA 4RI1A 5H84A 2FIWA 4II9A 5KTAA 2FIAA 5IV0A 3R9FA 5C88A 4KLVA 2QECA 2FE7A 3FIXA 4CRYB 1S7FA 4L8AA 2OU2A 3TOAA 2VEZA 5F46A 2K5TA 1Q2DA 3G3SA 1Q2YA 3FXTA 1SQHA 1P0HA 4FD7A 4XNHB 3PGPA 4MJ8A 3F5BA 4JLYA 1Z4RA 2PR8A 3DSBA 4EVYA 2B3VA 1LRZA 3P2FA 2B5GA 2VZZA 1VKCA 2H5MA 3T9YA 1K4JA 4Y49B 4R87A 1PUAA 4OLLA 1UFHA 3JVNA 4U9ZA 2D4PA 2ZW7A 4NSQA 2PRBA 2CY2A 2VQYA 4AB7A 4YFJA 4KOUA 1U6MA 4AVCA 1OZPA 2HUZA 4U5YA 2B4DB 2HQYA 2FL4A 1L0CA 1I21A 4M3SA 2WPWA 5H86A 2JDDA 1S60A 1MJAA 2ATRA 4KOVA 3P2HA 1BO4A 4QUSA 2P6FA 4HNYB 4FD6A 4UA3A 1XMTA 4AVBA 1RXTA 5CNPA 4HNWB 2CNTA 2OH1A 4KOSA 1QSTA 2BSWA 4JJXA 2HV2A 2P6GA 1Y9WA 4H89A 1Z9UA 2FS5A 3GKRA 4OAEA 4MBUA 4CAXA 4UWJA 4KORA 1V0CA 1B87A 5IB0A 3GY9A 2EVNA 2DXQA
chains in the Genus database with same CATH superfamily
3DNSA 1KUYA 4C7HA 4P4DA 4PQAA 4W9YA 4PXCA 3IJ3A 4KOXA 4JZ0A 1XEBA 3LODA 2O53A 4IHMA 3ZZIA 3NH4A 4KUBA 3MRUA 4HNXB 4A94A 2VZYA 4UFVA 5KTCA 3NFZA 3KGQA 4GXHA 2POKA 1DE4C 1PCAA 5DWNA 4B14A 4CRZB 3ISZA 4FBEA 3BI1A 2PQ8A 3D3SA 3KQXA 2AFMA 3D68A 3F0AA 4KOYA 4UEZA 2D4OA 1IYLA 3PRTA 2OZUA 3ISXA 2FT0A 5K8MA 4MY3A 4NGQA 4C7IA 1CPXA 3R95A 4DJLA 5F48A 5J8CA 3PB6X 2PJ7A 1BPNA 1IYKA 3IEHA 3IGRA 4NGNA 3H8FA 2NMTA 2XEJA 2ZEDA 3F8KA 2AFZA 4KVOE 4UEEA 3S6FA 2P0WA 3G8WA 2PJ2A 4NGSA 4MFJA 2QMLA 2C1CA 2B4BA 4A32A 1I12A 4MHDA 2Q4VA 1AUGA 2GU2A 3K9UA 1LAPA 4PPZA 3CDXA 1XMBA 4G1PA 3W91A 3R9EA 4DUKA 4MRIA 4BMHA 2V77A 3S6KA 3S6HA 2YNCC 1TIQA 4QC6A 4XPDC 2PSWA 2C6PA 1VHEA 3EO4A 4AG9A 1YX0A 3OWCA 4MY0A 3H5ZA 2JBJA 4OKOA 3T8WA 1IIDA 4B10A 3PFOA 1FY7A 2ZPAA 7CPAA 2Z11A 3PB8X 4CGNA 4PV6A 2PJ0A 2ANPA 3TOBA 1IY7A 2WUUA 2ABZA 3I3GA 2Q51A 4K30A 3T90A 4KVME 4YWYA 1BOBA 3A9LA 2Z0ZA 1VGYA 3PB7X 3CXQA 4P4JA 3R9GA 1YLOA 3B7IA 1IOFA 3LD2A 5F09A 4OADA 3GB0A 3SI1A 1NSAA 3NE7A 1Z8XA 5ELYA 5FVJA 2OOTA 4B6ZA 4UCMA 2FCKA 3IWEA 4E8OA 4P10A 2ZOFA 1KZFA 1CX8A 4AVAA 5JPHA 1KUVA 2ZEOA 3HUVA 3JTKA 1YR0A 2B4DA 4KS9A 4KSAA 2RC4A 4NCZA 1S7KA 2AJ6A 5G20A 1HDQA 4JD6A 1WWZA 1XFOA 2G9DA 3L2NA 4LUAA 1ZG9A 2I79A 2Z3PA 5EBVA 5F49A 1IGBA 2PJ4A 1ARLA 1MK4A 1LANA 4H6UA 4Y49C 1RO5A 2I00A 4FD4A 3TTHA 1XOVA 4J3GA 1YQEA 3VH9A 4O23A 4B13A 4JXRA 1NSLA 4OC1A 4P45A 1TF8A 1R57A 4H2KA 2ZEMA 4NFRA 4DNCA 4M85A 1Z8WA 2PR1A 1KWMA 3TFYA 1PU9A 2QVPA 3TCVA 4PSXA 5D29A 1P4NA 2G3AA 2X7BA 3D8PA 3S9LA 4ZX8A 5DWMA 2P6EA 2JBKA 5G1ZA 5E96A 3BXMA 2PJBA 4EFDA 5G22A 1XE4A 2PJ1A 4I49A 1Q7LA 3VATA 4XPLA 1J4JA 3TC8A 4DYOA 4ZI6A 3S6GA 4P4BA 3B8GA 1BLLE 1NE9A 4CAWA 5AG4A 2ZEPA 3TT2A 1F2OA 1BAVA 2CXAA 2NYQA 3QAYA 3FVLA 4FWUA 4MFLA 2Q7BA 2RB7A 4OC2A 4P4EA 3LWUA 2F8HA 2Q4YA 2Z3KA 3B35A 3EY5A 1XIXA 4MMOA 5F47A 1HDUA 3PBBA 4H6ZA 1CJWA 3FMCA 3EFAA 4C2ZA 4X5KA 1ZLHA 1YLEA 1YK3A 1XBUA 4MCSA 2YNCA 3ZJ0A 3N5FA 2BUEA 2BO9A 3IIBA 2GLFA 1AMPA 3I9SA 4UIAA 2ZELA 4MFZA 4UF4A 2J8MA 4B5PB 1TKHA 1Y7RA 1ELMP 4A39A 2ZENA 4NGMA 2IMOA 2ZW4A 2Q7SA 4NGRA 2XEIA 3S9MA 2YGWA 2JEWA 3FNCA 1QSRA 4A30A 5HH1A 3DGVA 4BBHA 4MHNA 2Q43A 4PK2A 1VHSA 4IUSA 1JQGA 2PCUA 3TE4A 3H4QA 3TO6A 2HC9A 2GIVA 2REEA 4KVXA 2CTBA 1I1DA 3W6SA 1H8LA 5LYDA 4OP4A 3D7GA 4KSFA 3FECA 2ZW5A 5LYLA 1Y7EA 4GM5A 3FF3A 2JDCA 5LRGA 4LQGA 2J8NA 4B12A 4X3RA 1DTDA 1GHEA 3IWGA 3DR6A 1Z4EA 2GREA 2CNMA 2V8GA 3MN8A 1M4LA 5D8NA 1JWQA 4A95A 3NA6A 4QBJA 2JLMA 1TXRA 3GIUA 2R98A 4MFPA 3SJXA 4A38A 5A28A 4CYQA 4U9YA 4NF1A 4CGMA 4AXVA 1S3ZA 5J1QA 1A2ZA 4CYOA 2KCWA 4CAVA 1YREA 4HKFA 4P6YA 4UCPA 2A4NA 1M4GA 5AG7A 2Z3LA 4K3NA 1YSJA 3D4UA 5EC4A 3JRUA 3FH4A 3BJ8A 4XPKA 3D2PA 3I1UA 2XEGA 5HVGA 2B5GB 1XRYA 6CPAA 1S5KA 1VIXA 2WZNA 2AE6A 1BPMA 2QJ8A 4R8FA 2BL1A 4Q7AA 1M4IA 2DPSA 4MHZA 2ZW6A 2GFQA 1IICA 4A37A 2CIJA 1S7NA 3PFEA 2JEVA 3KR5A 2R8VA 4ONWA 2R1IA 3SI2A 2C6CA 4HPSA 3PB9X 2F7VA 4E2AA 2EUIA 4IF5A 2B58A 4MHYA 2Q44A 5JM6A 4NEXA 3R96A 4L89A 1ON0A 2PRQA 5A27A 3KI9A 4F0XA 2V8VA 1R3NA 4PXEA 1YW6A 4Q36A 4KUAA 4RN7A 2HB6A 2PJAA 2FSRA 1KUXA 1XF8A 1YVKA 4LQ6A 3IO1A 2CNSA 3PP9A 1F2PA 1FNOA 4QB9A 4R7MA 4MHPA 3B3WA 5K8NA 1YMEA 1IU8A 2ZEEA 3H8GA 4UFXA 1ELLP 3FB3A 4RS2A 1QQ9A 3SI0A 3EXNA 2FXFA 3FBUA 1WK4A 4JXQA 3GUXA 3V38A 4NGPA 4E0AA 4WWVA 2IL4A 2Y0MA 3QAHA 3RO0A 3D67A 3PEIA 5GCNA 1YGHA 4PK3A 5HXDA 1M4DA 4PXDA 2C27A 4WJBA 2PE3A 3W6XA 4R6TA 4UFWA 3FRMA 4CAFA 2PJ5A 4R57A 4P4FA 1LCPA 4F9UA 3N7ZA 1ARMA 5IX3A 1X10A 2PJ6A 4R3LA 1HEEA 2G3TA 1CM0A 1MJBA 4ZY1A 5HMNA 1N71A 4OC0A 2Q0YA 4UWIA 2VBQA 4FUUA 4XPDB 3VWDA 4EWTA 1CBXA 1R43A 3IFEA 4XNHC 4B5OA 3R1KA 4PSWA 2GANA 2VI7A 4NXYA 5KTDA 2CF4A 3NH8A 1ZG8A 5C82A 1VHOA 3VWEA 4M6GA 2PC1A 2BEIA 1AYEA 3D7FA 4GS4A 3E0KA 4QVTA 3MGDA 1S7LA 4MCPA 3D2MA 2G0BA 3PZJA 4F9VA 2XEFA 3B2YA 3B3SA 3FYNA 2YNEA 5K8OA 2PIYA 3HLPA 4P44A 2VL1A 3V8IA 2EO8A 2R7HA 4UCNA 4F0YA 4KZTA 1RTQA 5BWAB 1M1DA 1Y9KA 4OC3A 5JQ4A 4JWPA 4F6AA 1YW4A 2C6GA 3CXPA 3EC4A 4TWEA 1QSNA 1B6BA 3VARA 5JGFA 2GE3A 4MI4A 4R76A 2OB0A 2QIRA 3RYOA 1CP7A 4LX9A 1TKFA 1Y0YA 3WC5A 5I0CA 3SXNA 3CPXA 2AFWA 2ZEHA 3GYAA 2ODFA 3SHPA 1YVOA 3SXOA 2J8RA 4ZY2A 3FEEA 3TX8A 3DR8A 4CGOA 1Q2CA 3QB8A 5I4MA 4UIBA 4NGTA 2B3UA 4ONUA 3TO7A 4KOTA 3BLNA 4KOWA 1IOIA 3JUWA 2OR4A 4CS0B 5HVHA 4MFQA 2Q04A 1M44A 1IB1E 5J8FA 4M6IA 3WC7A 5K8PA 4CYPA 3C26A 1MJ9A 2AFSA 2J9AA 1LAMA 5IB9A 2F5IA 1QSMA 3KASA 3RNZA 3LMSA 2ARHA 4MCQA 5LRKA 4YGOA 4ZBGA 2ZXVA 2RFHA 1QSOA 3CT9A 2Z10A 2WPXA 3DDDA 3PBEA 4YRHA 1NMTA 4ZGYB 2EK8A 2OZHA 2VXKA 3FJUA 4OC5A 3CPAA 1CP6A 4Z65A 2REFA 4FD5A 3KR4A 3UY5A 4R3KA 3CXSA 5JH9A 3KQZA 5EMIA 3SJFA 2PDOA 4AG7A 4C2XA 3TO9A 3KL9A 1OBRA 2O28A 4ZX9A 3H8EA 3K2KA 4UEFA 3KKWA 3NE8A 3WR7A 4A2ZA 2DPTA 4ORFA 3SJGA 3D7DA 1Z8TA 4OIWA 5ISVA 2IJZA 4UBRA 4A31A 2PJ9A 4B5PA 4R9MA 4KLWA 3BJ7A 2OZGA 3B3VA 5CPAA 2FVGA 2WSAA 4RI1A 5H84A 1F57A 3RZAA 2FIWA 4II9A 2PVWA 5KTAA 4EMEA 2FIAA 3B3TA 4OIDA 3R9FA 1ZO0A 1FT7A 4C68A 5C88A 5IV0A 4CAEA 4KLVA 2QECA 2Z3NA 2FE7A 3FIXA 4ZYQA 3FEDA 4B11A 4CRYB 2AFOA 1S7FA 4L8AA 2OU2A 4YU9A 3RBUA 3TOAA 2BOAA 1ZLIA 4NJQA 2Z3MA 1CPSA 2VEZA 4X8IA 2K5TA 5F46A 2EWBA 3PB4X 1Q2DA 3G3SA 3B3CA 1Q2YA 3KZWA 3FXTA 1SQHA 1P0HA 4FD7A 1EE3P 4XNHB 3PGPA 1GYTA 4MJ8A 4RUHA 2CTCA 3F5BA 4JLYA 4Q38A 2EK9A 1Z4RA 2PR8A 3DSBA 2PJ3A 3S9NA 4EVYA 2B3VA 2NSMA 1QMUA 2V8HA 3KHXA 1LRZA 3P2FA 3D7HA 5DS0A 4CYNA 4MFKA 2B5GA 2VZZA 1VKCA 2H5MA 3KHZA 3GLJA 3T9YA 1X12A 5AG5A 1K4JA 5CBMA 4OMEA 4OC4A 4Y49B 2V8DA 2WYRA 5LYFA 1Z8LA 1CG2A 3CZXA 4R87A 1PUAA 4OLLA 4P4IA 1Z2LA 4IK2A 4ZY0A 8CPAA 1UFHA 3JVNA 1Y0RA 4U9ZA 5LRJA 2D4PA 2ZEFA 2ZW7A 3IU1A 1Z5RA 2ZOGA 4NSQA 2PRBA 2CY2A 2EBJA 2VQYA 3SJEA 4AB7A 5HVFA 3WABA 4YFJA 4CPAA 5AG6A 4KOUA 4M6HA 5THWA 1TF9A 3BI0A 1U6MA 4JYWA 4AVCA 1LFWA 2AFUA 2QYVA 1OZPA 3D66A 2O4HA 2HUZA 2IQ6A 2PVVA 2PJ8A 4U5YA 2B4DB 2HQYA 3IWWA 3NH5A 2FL4A 2PJCA 1L0CA 1I21A 4M3SA 2WPWA 2DEAA 2Z3OA 5AGEA 4C2YA 4BD9A 5H86A 3V7ZA 2JDDA 4KSIA 1S60A 2BCOA 1MJAA 2ATRA 3FX6A 4NJRA 2AFXA 4CGLA 4KOVA 3P2HA 1BO4A 4QUSA 1ZG7A 3DLJA 2P6FA 4HNYB 4FD6A 4UA3A 1XMTA 4AVBA 1RXTA 4FAIA 2PIZA 2YNDA 3RAMA 3QNVA 4TNUA 5CNPA 4MXUA 4HNWB 1XJOA 3IC1A 2CNTA 2OH1A 4KOSA 5LYIA 3BHXA 1QSTA 2BSWA 3WC6A 4IAVA 4CGPA 4JJXA 3WT4A 2HV2A 2P6GA 3K9TA 2I3CA 1Y9WA 4X2TA 1TKJA 4F8ZA 4H89A 1Z9UA 2FS5A 2GLJA 3GKRA 4OAEA 4MBUA 3IU2A 2Q4ZA 1UWYA 1LOKA 4MCRA 4UWJA 5G21A 4BINA 4KORA 1V0CA 4CAXA 2ZEGA 1PYTB 2DF5A 3LACA 4A33A 1B87A 4PXBA 5IB0A 3GY9A 2EVNA 2DXQA
chains in the Genus database with same CATH topology
3DNSA 1KUYA 4C7HA 4KOXA 1XEBA 3LODA 3ZZIA 5KTDA 4KUBA 4HNXB 2VZYA 4UFVA 5KTCA 4B14A 5DWNA 4CRZB 2PQ8A 3D3SA 3F0AA 4KOYA 2D4OA 1IYLA 2OZUA 2FT0A 4MY3A 4C7IA 3R95A 5F48A 5J8CA 1IYKA 3IGRA 2NMTA 3F8KA 4KVOE 3S6FA 2P0WA 3G8WA 4MFJA 2QMLA 2B4BA 4A32A 1I12A 4MHDA 2Q4VA 3K9UA 3W91A 3R9EA 4BMHA 3S6KA 3S6HA 2YNCC 1TIQA 4QC6A 4XPDC 2PSWA 3EO4A 4AG9A 1YX0A 3OWCA 4MY0A 3H5ZA 1IIDA 4B10A 1FY7A 2ZPAA 2Z11A 4CGNA 4PV6A 3TOBA 3I3GA 2WUUA 4K30A 3T90A 4KVME 1BOBA 3A9LA 2Z0ZA 3R9GA 3CXQA 3LD2A 4OADA 3NE7A 5FVJA 4UCMA 2FCKA 3IWEA 4E8OA 1KZFA 4AVAA 5JPHA 1KUVA 3JTKA 1YR0A 4KS9A 2B4DA 4KSAA 2RC4A 4NCZA 1S7KA 2AJ6A 5G20A 4JD6A 1WWZA 4LUAA 2I79A 2Z3PA 5EBVA 5F49A 1MK4A 4H6UA 4Y49C 1RO5A 2I00A 4FD4A 3TTHA 4J3GA 4B13A 4JXRA 1NSLA 1R57A 4DNCA 4M85A 2PR1A 3TFYA 1PU9A 3TCVA 4PSXA 1P4NA 2G3AA 2X7BA 3D8PA 5DWMA 2P6EA 5G1ZA 5E96A 5G22A 1XE4A 4I49A 4XPLA 1J4JA 3S6GA 4CAWA 3B8GA 5AG4A 1NE9A 3TT2A 2CXAA 4MFLA 2Q7BA 2Z3KA 2Q4YA 3EY5A 1XIXA 5F47A 4H6ZA 1CJWA 3EFAA 4C2ZA 4X5KA 1YLEA 1YK3A 2YNCA 3ZJ0A 2BUEA 3I9SA 4MFZA 2J8MA 4B5PB 1Y7RA 2ZW4A 2YGWA 3FNCA 1QSRA 4A30A 5HH1A 4BBHA 4PK2A 1VHSA 4IUSA 3TE4A 3H4QA 3TO6A 2GIVA 2REEA 4KVXA 1I1DA 3W6SA 4KSFA 2ZW5A 2JDCA 4B12A 2J8NA 1GHEA 3IWGA 3DR6A 1Z4EA 2CNMA 4A95A 4QBJA 2JLMA 2R98A 4MFPA 5A28A 4CYQA 4U9YA 4NF1A 4CGMA 1S3ZA 4CYOA 2KCWA 4CAVA 1YREA 4HKFA 4UCPA 2A4NA 1M4GA 5AG7A 2Z3LA 5EC4A 3BJ8A 4XPKA 3D2PA 2B5GB 1S5KA 2AE6A 2BL1A 1M4IA 2DPSA 2ZW6A 1IICA 1S7NA 2JEVA 2R8VA 2R1IA 4E2AA 2EUIA 4IF5A 2B58A 2Q44A 4NEXA 3R96A 4L89A 1ON0A 5A27A 4F0XA 4Q36A 4KUAA 2FSRA 1KUXA 1XF8A 1YVKA 2CNSA 3PP9A 4QB9A 4UFXA 4RS2A 3FB3A 3EXNA 2FXFA 3FBUA 1WK4A 4JXQA 4E0AA 2IL4A 2Y0MA 3QAHA 5GCNA 1YGHA 4PK3A 1M4DA 2C27A 3W6XA 4UFWA 3FRMA 4CAFA 4R57A 3N7ZA 5IX3A 4R3LA 2G3TA 1CM0A 1MJBA 5HMNA 1N71A 4UWIA 2Q0YA 2VBQA 4XPDB 3VWDA 4XNHC 4B5OA 3R1KA 4PSWA 2GANA 2VI7A 4NXYA 5C82A 3VWEA 2PC1A 2BEIA 4GS4A 4QVTA 3E0KA 3MGDA 1S7LA 3D2MA 2G0BA 3PZJA 3FYNA 2YNEA 3V8IA 2R7HA 4UCNA 4F0YA 4KZTA 5BWAB 1M1DA 1Y9KA 5JQ4A 4JWPA 4F6AA 3CXPA 3EC4A 1QSNA 1B6BA 2GE3A 4MI4A 2OB0A 2QIRA 3RYOA 4LX9A 5I0CA 3SXNA 3GYAA 3SHPA 1YVOA 3SXOA 2J8RA 3DR8A 4CGOA 1Q2CA 3QB8A 2B3UA 4ONUA 3TO7A 4KOTA 3BLNA 4KOWA 3JUWA 4CS0B 4MFQA 2Q04A 1M44A 1IB1E 5J8FA 4CYPA 3C26A 1MJ9A 2F5IA 1QSMA 2ARHA 4YGOA 4ZBGA 2ZXVA 1QSOA 3DDDA 2WPXA 2Z10A 4YRHA 4ZGYB 1NMTA 2OZHA 2VXKA 2REFA 4FD5A 3UY5A 4R3KA 3CXSA 2PDOA 4AG7A 4C2XA 3TO9A 2O28A 4A2ZA 3KKWA 3WR7A 2DPTA 4ORFA 5ISVA 4UBRA 4A31A 4B5PA 4R9MA 4KLWA 3BJ7A 2OZGA 2WSAA 4RI1A 5H84A 2FIWA 4II9A 5KTAA 2FIAA 5IV0A 3R9FA 1ZO0A 4C68A 5C88A 4CAEA 4KLVA 2QECA 2Z3NA 2FE7A 3FIXA 4B11A 4CRYB 1S7FA 4L8AA 2OU2A 3TOAA 2Z3MA 2VEZA 5F46A 2K5TA 1Q2DA 3G3SA 1Q2YA 3FXTA 1SQHA 1P0HA 4FD7A 4XNHB 3PGPA 4MJ8A 3F5BA 4JLYA 4Q38A 1Z4RA 2PR8A 3DSBA 4EVYA 2B3VA 1LRZA 3P2FA 4CYNA 4MFKA 2B5GA 2VZZA 1VKCA 2H5MA 3T9YA 5AG5A 1K4JA 4Y49B 4R87A 1PUAA 4OLLA 1UFHA 3JVNA 4U9ZA 2D4PA 2ZW7A 3IU1A 4NSQA 2PRBA 2CY2A 2VQYA 4AB7A 4YFJA 5AG6A 4KOUA 1U6MA 4AVCA 1OZPA 2HUZA 4U5YA 2B4DB 2HQYA 2FL4A 1L0CA 1I21A 4M3SA 2WPWA 2Z3OA 5AGEA 4C2YA 5H86A 2JDDA 1S60A 1MJAA 2ATRA 4CGLA 4KOVA 3P2HA 1BO4A 4QUSA 2P6FA 4HNYB 4FD6A 4UA3A 1XMTA 4AVBA 1RXTA 2YNDA 5CNPA 4HNWB 2CNTA 2OH1A 4KOSA 1QSTA 2BSWA 4CGPA 4JJXA 2HV2A 2P6GA 1Y9WA 4H89A 1Z9UA 2FS5A 3GKRA 4OAEA 4MBUA 3IU2A 5G21A 4CAXA 4UWJA 4KORA 1V0CA 4A33A 1B87A 5IB0A 3GY9A 2EVNA 2DXQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DNS A;  1KUY A;  4KOX A;  1XEB A;  3LOD A;  3ZZI A;  5KTD A;  4KUB A;  4HNX B;  2VZY A;  5KTC A;  5DWN A;  4CRZ B;  2PQ8 A;  3D3S A;  3F0A A;  4KOY A;  2D4O A;  1IYL A;  2OZU A;  2FT0 A;  4MY3 A;  3R95 A;  5F48 A;  5J8C A;  1IYK A;  3IGR A;  2NMT A;  3F8K A;  4KVO E;  3S6F A;  2P0W A;  3G8W A;  2QML A;  2B4B A;  1I12 A;  4MHD A;  2Q4V A;  3K9U A;  3W91 A;  3R9E A;  4BMH A;  3S6K A;  3S6H A;  1TIQ A;  4QC6 A;  4XPD C;  2PSW A;  3EO4 A;  4AG9 A;  1YX0 A;  3OWC A;  4MY0 A;  1IID A;  1FY7 A;  2ZPA A;  2Z11 A;  4PV6 A;  3TOB A;  3I3G A;  4K30 A;  3T90 A;  4KVM E;  1BOB A;  2Z0Z A;  3R9G A;  3CXQ A;  3LD2 A;  4OAD A;  3NE7 A;  5FVJ A;  2FCK A;  4E8O A;  1KZF A;  4AVA A;  5JPH A;  1KUV A;  1YR0 A;  2B4D A;  2RC4 A;  4NCZ A;  1S7K A;  2AJ6 A;  4JD6 A;  1WWZ A;  4LUA A;  2I79 A;  5EBV A;  5F49 A;  1MK4 A;  4H6U A;  4Y49 C;  1RO5 A;  2I00 A;  4FD4 A;  3TTH A;  4J3G A;  4JXR A;  1NSL A;  1R57 A;  4DNC A;  4M85 A;  2PR1 A;  3TFY A;  1PU9 A;  3TCV A;  4PSX A;  1P4N A;  2G3A A;  2X7B A;  3D8P A;  5DWM A;  2P6E A;  5E96 A;  1XE4 A;  4I49 A;  4XPL A;  1J4J A;  3S6G A;  4CAW A;  3B8G A;  1NE9 A;  3TT2 A;  2Q7B A;  2Q4Y A;  3EY5 A;  1XIX A;  5F47 A;  4H6Z A;  1CJW A;  3EFA A;  4X5K A;  1YLE A;  1YK3 A;  3ZJ0 A;  2BUE A;  3I9S A;  2J8M A;  4B5P B;  1Y7R A;  2ZW4 A;  3FNC A;  1QSR A;  5HH1 A;  4PK2 A;  1VHS A;  4IUS A;  3TE4 A;  3H4Q A;  3TO6 A;  2GIV A;  2REE A;  4KVX A;  1I1D A;  3W6S A;  2ZW5 A;  2JDC A;  2J8N A;  1GHE A;  3IWG A;  3DR6 A;  1Z4E A;  2CNM A;  4QBJ A;  2JLM A;  2R98 A;  4U9Y A;  4NF1 A;  1S3Z A;  2KCW A;  4CAV A;  1YRE A;  4HKF A;  2A4N A;  1M4G A;  5EC4 A;  3BJ8 A;  4XPK A;  3D2P A;  2B5G B;  1S5K A;  2AE6 A;  2BL1 A;  1M4I A;  2ZW6 A;  1IIC A;  1S7N A;  2JEV A;  2R8V A;  2R1I A;  4E2A A;  2EUI A;  4IF5 A;  2B58 A;  2Q44 A;  4NEX A;  3R96 A;  4L89 A;  1ON0 A;  4KUA A;  2FSR A;  1KUX A;  1XF8 A;  1YVK A;  2CNS A;  3PP9 A;  4QB9 A;  4RS2 A;  3FB3 A;  3EXN A;  2FXF A;  3FBU A;  1WK4 A;  4JXQ A;  4E0A A;  2IL4 A;  2Y0M A;  3QAH A;  5GCN A;  1YGH A;  4PK3 A;  1M4D A;  2C27 A;  3W6X A;  3FRM A;  4R57 A;  3N7Z A;  5IX3 A;  4R3L A;  2G3T A;  1CM0 A;  1MJB A;  5HMN A;  1N71 A;  4UWI A;  2Q0Y A;  2VBQ A;  4XPD B;  3VWD A;  4XNH C;  4B5O A;  3R1K A;  4PSW A;  2GAN A;  2VI7 A;  4NXY A;  5C82 A;  3VWE A;  2PC1 A;  2BEI A;  4GS4 A;  4QVT A;  3E0K A;  3MGD A;  1S7L A;  3D2M A;  2G0B A;  3PZJ A;  3FYN A;  3V8I A;  2R7H A;  4F0Y A;  4KZT A;  1M1D A;  1Y9K A;  5JQ4 A;  4JWP A;  4F6A A;  3CXP A;  3EC4 A;  1QSN A;  1B6B A;  2GE3 A;  4MI4 A;  2OB0 A;  2QIR A;  3RYO A;  4LX9 A;  5I0C A;  3SXN A;  3GYA A;  3SHP A;  1YVO A;  3SXO A;  2J8R A;  3DR8 A;  1Q2C A;  3QB8 A;  2B3U A;  4ONU A;  3TO7 A;  4KOT A;  3BLN A;  4KOW A;  3JUW A;  4CS0 B;  2Q04 A;  1M44 A;  1IB1 E;  5J8F A;  3C26 A;  1MJ9 A;  2F5I A;  1QSM A;  2ARH A;  4YGO A;  4ZBG A;  2ZXV A;  1QSO A;  3DDD A;  2WPX A;  2Z10 A;  4YRH A;  1NMT A;  2OZH A;  2VXK A;  2REF A;  4FD5 A;  3UY5 A;  4R3K A;  3CXS A;  2PDO A;  4AG7 A;  3TO9 A;  2O28 A;  3KKW A;  3WR7 A;  4ORF A;  5ISV A;  4UBR A;  4B5P A;  4R9M A;  4KLW A;  3BJ7 A;  2OZG A;  4RI1 A;  5H84 A;  2FIW A;  4II9 A;  5KTA A;  2FIA A;  5IV0 A;  3R9F A;  5C88 A;  4KLV A;  2QEC A;  2FE7 A;  3FIX A;  4CRY B;  1S7F A;  4L8A A;  2OU2 A;  3TOA A;  2VEZ A;  5F46 A;  2K5T A;  1Q2D A;  3G3S A;  1Q2Y A;  3FXT A;  1SQH A;  1P0H A;  4FD7 A;  4XNH B;  3PGP A;  4MJ8 A;  3F5B A;  4JLY A;  1Z4R A;  2PR8 A;  3DSB A;  4EVY A;  2B3V A;  1LRZ A;  3P2F A;  2B5G A;  2VZZ A;  1VKC A;  2H5M A;  3T9Y A;  1K4J A;  4Y49 B;  4R87 A;  1PUA A;  4OLL A;  1UFH A;  3JVN A;  4U9Z A;  2D4P A;  2ZW7 A;  4NSQ A;  2PRB A;  2CY2 A;  2VQY A;  4AB7 A;  4YFJ A;  4KOU A;  1U6M A;  4AVC A;  1OZP A;  2HUZ A;  4U5Y A;  2B4D B;  2HQY A;  2FL4 A;  1L0C A;  1I21 A;  4M3S A;  2WPW A;  5H86 A;  2JDD A;  1S60 A;  1MJA A;  2ATR A;  4KOV A;  3P2H A;  1BO4 A;  4QUS A;  2P6F A;  4HNY B;  4FD6 A;  4UA3 A;  1XMT A;  4AVB A;  1RXT A;  5CNP A;  4HNW B;  2CNT A;  2OH1 A;  4KOS A;  1QST A;  2BSW A;  4JJX A;  2HV2 A;  2P6G A;  1Y9W A;  4H89 A;  1Z9U A;  2FS5 A;  3GKR A;  4OAE A;  4MBU A;  4CAX A;  4UWJ A;  4KOR A;  1V0C A;  1B87 A;  5IB0 A;  3GY9 A;  2EVN A;  2DXQ A; 
#chains in the Genus database with same CATH topology
 3DNS A;  1KUY A;  4C7H A;  4P4D A;  4PQA A;  4W9Y A;  4PXC A;  3IJ3 A;  4KOX A;  4JZ0 A;  1XEB A;  3LOD A;  2O53 A;  4IHM A;  3ZZI A;  3NH4 A;  4KUB A;  3MRU A;  4HNX B;  4A94 A;  2VZY A;  4UFV A;  5KTC A;  3NFZ A;  3KGQ A;  4GXH A;  2POK A;  1DE4 C;  1PCA A;  5DWN A;  4B14 A;  4CRZ B;  3ISZ A;  4FBE A;  3BI1 A;  2PQ8 A;  3D3S A;  3KQX A;  2AFM A;  3D68 A;  3F0A A;  4KOY A;  4UEZ A;  2D4O A;  1IYL A;  3PRT A;  2OZU A;  3ISX A;  2FT0 A;  5K8M A;  4MY3 A;  4NGQ A;  4C7I A;  1CPX A;  3R95 A;  4DJL A;  5F48 A;  5J8C A;  3PB6 X;  2PJ7 A;  1BPN A;  1IYK A;  3IEH A;  3IGR A;  4NGN A;  3H8F A;  2NMT A;  2XEJ A;  2ZED A;  3F8K A;  2AFZ A;  4KVO E;  4UEE A;  3S6F A;  2P0W A;  3G8W A;  2PJ2 A;  4NGS A;  4MFJ A;  2QML A;  2C1C A;  2B4B A;  4A32 A;  1I12 A;  4MHD A;  2Q4V A;  1AUG A;  2GU2 A;  3K9U A;  1LAP A;  4PPZ A;  3CDX A;  1XMB A;  4G1P A;  3W91 A;  3R9E A;  4DUK A;  4MRI A;  4BMH A;  2V77 A;  3S6K A;  3S6H A;  2YNC C;  1TIQ A;  4QC6 A;  4XPD C;  2PSW A;  2C6P A;  1VHE A;  3EO4 A;  4AG9 A;  1YX0 A;  3OWC A;  4MY0 A;  3H5Z A;  2JBJ A;  4OKO A;  3T8W A;  1IID A;  4B10 A;  3PFO A;  1FY7 A;  2ZPA A;  7CPA A;  2Z11 A;  3PB8 X;  4CGN A;  4PV6 A;  2PJ0 A;  2ANP A;  3TOB A;  1IY7 A;  2WUU A;  2ABZ A;  3I3G A;  2Q51 A;  4K30 A;  3T90 A;  4KVM E;  4YWY A;  1BOB A;  3A9L A;  2Z0Z A;  1VGY A;  3PB7 X;  3CXQ A;  4P4J A;  3R9G A;  1YLO A;  3B7I A;  1IOF A;  3LD2 A;  5F09 A;  4OAD A;  3GB0 A;  3SI1 A;  1NSA A;  3NE7 A;  1Z8X A;  5ELY A;  5FVJ A;  2OOT A;  4B6Z A;  4UCM A;  2FCK A;  3IWE A;  4E8O A;  4P10 A;  2ZOF A;  1KZF A;  1CX8 A;  4AVA A;  5JPH A;  1KUV A;  2ZEO A;  3HUV A;  3JTK A;  1YR0 A;  2B4D A;  4KS9 A;  4KSA A;  2RC4 A;  4NCZ A;  1S7K A;  2AJ6 A;  5G20 A;  1HDQ A;  4JD6 A;  1WWZ A;  1XFO A;  2G9D A;  3L2N A;  4LUA A;  1ZG9 A;  2I79 A;  2Z3P A;  5EBV A;  5F49 A;  1IGB A;  2PJ4 A;  1ARL A;  1MK4 A;  1LAN A;  4H6U A;  4Y49 C;  1RO5 A;  2I00 A;  4FD4 A;  3TTH A;  1XOV A;  4J3G A;  1YQE A;  3VH9 A;  4O23 A;  4B13 A;  4JXR A;  1NSL A;  4OC1 A;  4P45 A;  1TF8 A;  1R57 A;  4H2K A;  2ZEM A;  4NFR A;  4DNC A;  4M85 A;  1Z8W A;  2PR1 A;  1KWM A;  3TFY A;  1PU9 A;  2QVP A;  3TCV A;  4PSX A;  5D29 A;  1P4N A;  2G3A A;  2X7B A;  3D8P A;  3S9L A;  4ZX8 A;  5DWM A;  2P6E A;  2JBK A;  5G1Z A;  5E96 A;  3BXM A;  2PJB A;  4EFD A;  5G22 A;  1XE4 A;  2PJ1 A;  4I49 A;  1Q7L A;  3VAT A;  4XPL A;  1J4J A;  3TC8 A;  4DYO A;  4ZI6 A;  3S6G A;  4P4B A;  3B8G A;  1BLL E;  1NE9 A;  4CAW A;  5AG4 A;  2ZEP A;  3TT2 A;  1F2O A;  1BAV A;  2CXA A;  2NYQ A;  3QAY A;  3FVL A;  4FWU A;  4MFL A;  2Q7B A;  2RB7 A;  4OC2 A;  4P4E A;  3LWU A;  2F8H A;  2Q4Y A;  2Z3K A;  3B35 A;  3EY5 A;  1XIX A;  4MMO A;  5F47 A;  1HDU A;  3PBB A;  4H6Z A;  1CJW A;  3FMC A;  3EFA A;  4C2Z A;  4X5K A;  1ZLH A;  1YLE A;  1YK3 A;  1XBU A;  4MCS A;  2YNC A;  3ZJ0 A;  3N5F A;  2BUE A;  2BO9 A;  3IIB A;  2GLF A;  1AMP A;  3I9S A;  4UIA A;  2ZEL A;  4MFZ A;  4UF4 A;  2J8M A;  4B5P B;  1TKH A;  1Y7R A;  1ELM P;  4A39 A;  2ZEN A;  4NGM A;  2IMO A;  2ZW4 A;  2Q7S A;  4NGR A;  2XEI A;  3S9M A;  2YGW A;  2JEW A;  3FNC A;  1QSR A;  4A30 A;  5HH1 A;  3DGV A;  4BBH A;  4MHN A;  2Q43 A;  4PK2 A;  1VHS A;  4IUS A;  1JQG A;  2PCU A;  3TE4 A;  3H4Q A;  3TO6 A;  2HC9 A;  2GIV A;  2REE A;  4KVX A;  2CTB A;  1I1D A;  3W6S A;  1H8L A;  5LYD A;  4OP4 A;  3D7G A;  4KSF A;  3FEC A;  2ZW5 A;  5LYL A;  1Y7E A;  4GM5 A;  3FF3 A;  2JDC A;  5LRG A;  4LQG A;  2J8N A;  4B12 A;  4X3R A;  1DTD A;  1GHE A;  3IWG A;  3DR6 A;  1Z4E A;  2GRE A;  2CNM A;  2V8G A;  3MN8 A;  1M4L A;  5D8N A;  1JWQ A;  4A95 A;  3NA6 A;  4QBJ A;  2JLM A;  1TXR A;  3GIU A;  2R98 A;  4MFP A;  3SJX A;  4A38 A;  5A28 A;  4CYQ A;  4U9Y A;  4NF1 A;  4CGM A;  4AXV A;  1S3Z A;  5J1Q A;  1A2Z A;  4CYO A;  2KCW A;  4CAV A;  1YRE A;  4HKF A;  4P6Y A;  4UCP A;  2A4N A;  1M4G A;  5AG7 A;  2Z3L A;  4K3N A;  1YSJ A;  3D4U A;  5EC4 A;  3JRU A;  3FH4 A;  3BJ8 A;  4XPK A;  3D2P A;  3I1U A;  2XEG A;  5HVG A;  2B5G B;  1XRY A;  6CPA A;  1S5K A;  1VIX A;  2WZN A;  2AE6 A;  1BPM A;  2QJ8 A;  4R8F A;  2BL1 A;  4Q7A A;  1M4I A;  2DPS A;  4MHZ A;  2ZW6 A;  2GFQ A;  1IIC A;  4A37 A;  2CIJ A;  1S7N A;  3PFE A;  2JEV A;  3KR5 A;  2R8V A;  4ONW A;  2R1I A;  3SI2 A;  2C6C A;  4HPS A;  3PB9 X;  2F7V A;  4E2A A;  2EUI A;  4IF5 A;  2B58 A;  4MHY A;  2Q44 A;  5JM6 A;  4NEX A;  3R96 A;  4L89 A;  1ON0 A;  2PRQ A;  5A27 A;  3KI9 A;  4F0X A;  2V8V A;  1R3N A;  4PXE A;  1YW6 A;  4Q36 A;  4KUA A;  4RN7 A;  2HB6 A;  2PJA A;  2FSR A;  1KUX A;  1XF8 A;  1YVK A;  4LQ6 A;  3IO1 A;  2CNS A;  3PP9 A;  1F2P A;  1FNO A;  4QB9 A;  4R7M A;  4MHP A;  3B3W A;  5K8N A;  1YME A;  1IU8 A;  2ZEE A;  3H8G A;  4UFX A;  1ELL P;  3FB3 A;  4RS2 A;  1QQ9 A;  3SI0 A;  3EXN A;  2FXF A;  3FBU A;  1WK4 A;  4JXQ A;  3GUX A;  3V38 A;  4NGP A;  4E0A A;  4WWV A;  2IL4 A;  2Y0M A;  3QAH A;  3RO0 A;  3D67 A;  3PEI A;  5GCN A;  1YGH A;  4PK3 A;  5HXD A;  1M4D A;  4PXD A;  2C27 A;  4WJB A;  2PE3 A;  3W6X A;  4R6T A;  4UFW A;  3FRM A;  4CAF A;  2PJ5 A;  4R57 A;  4P4F A;  1LCP A;  4F9U A;  3N7Z A;  1ARM A;  5IX3 A;  1X10 A;  2PJ6 A;  4R3L A;  1HEE A;  2G3T A;  1CM0 A;  1MJB A;  4ZY1 A;  5HMN A;  1N71 A;  4OC0 A;  2Q0Y A;  4UWI A;  2VBQ A;  4FUU A;  4XPD B;  3VWD A;  4EWT A;  1CBX A;  1R43 A;  3IFE A;  4XNH C;  4B5O A;  3R1K A;  4PSW A;  2GAN A;  2VI7 A;  4NXY A;  5KTD A;  2CF4 A;  3NH8 A;  1ZG8 A;  5C82 A;  1VHO A;  3VWE A;  4M6G A;  2PC1 A;  2BEI A;  1AYE A;  3D7F A;  4GS4 A;  3E0K A;  4QVT A;  3MGD A;  1S7L A;  4MCP A;  3D2M A;  2G0B A;  3PZJ A;  4F9V A;  2XEF A;  3B2Y A;  3B3S A;  3FYN A;  2YNE A;  5K8O A;  2PIY A;  3HLP A;  4P44 A;  2VL1 A;  3V8I A;  2EO8 A;  2R7H A;  4UCN A;  4F0Y A;  4KZT A;  1RTQ A;  5BWA B;  1M1D A;  1Y9K A;  4OC3 A;  5JQ4 A;  4JWP A;  4F6A A;  1YW4 A;  2C6G A;  3CXP A;  3EC4 A;  4TWE A;  1QSN A;  1B6B A;  3VAR A;  5JGF A;  2GE3 A;  4MI4 A;  4R76 A;  2OB0 A;  2QIR A;  3RYO A;  1CP7 A;  4LX9 A;  1TKF A;  1Y0Y A;  3WC5 A;  5I0C A;  3SXN A;  3CPX A;  2AFW A;  2ZEH A;  3GYA A;  2ODF A;  3SHP A;  1YVO A;  3SXO A;  2J8R A;  4ZY2 A;  3FEE A;  3TX8 A;  3DR8 A;  4CGO A;  1Q2C A;  3QB8 A;  5I4M A;  4UIB A;  4NGT A;  2B3U A;  4ONU A;  3TO7 A;  4KOT A;  3BLN A;  4KOW A;  1IOI A;  3JUW A;  2OR4 A;  4CS0 B;  5HVH A;  4MFQ A;  2Q04 A;  1M44 A;  1IB1 E;  5J8F A;  4M6I A;  3WC7 A;  5K8P A;  4CYP A;  3C26 A;  1MJ9 A;  2AFS A;  2J9A A;  1LAM A;  5IB9 A;  2F5I A;  1QSM A;  3KAS A;  3RNZ A;  3LMS A;  2ARH A;  4MCQ A;  5LRK A;  4YGO A;  4ZBG A;  2ZXV A;  2RFH A;  1QSO A;  3CT9 A;  2Z10 A;  2WPX A;  3DDD A;  3PBE A;  4YRH A;  1NMT A;  4ZGY B;  2EK8 A;  2OZH A;  2VXK A;  3FJU A;  4OC5 A;  3CPA A;  1CP6 A;  4Z65 A;  2REF A;  4FD5 A;  3KR4 A;  3UY5 A;  4R3K A;  3CXS A;  5JH9 A;  3KQZ A;  5EMI A;  3SJF A;  2PDO A;  4AG7 A;  4C2X A;  3TO9 A;  3KL9 A;  1OBR A;  2O28 A;  4ZX9 A;  3H8E A;  3K2K A;  4UEF A;  3KKW A;  3NE8 A;  3WR7 A;  4A2Z A;  2DPT A;  4ORF A;  3SJG A;  3D7D A;  1Z8T A;  4OIW A;  5ISV A;  2IJZ A;  4UBR A;  4A31 A;  2PJ9 A;  4B5P A;  4R9M A;  4KLW A;  3BJ7 A;  2OZG A;  3B3V A;  5CPA A;  2FVG A;  2WSA A;  4RI1 A;  5H84 A;  1F57 A;  3RZA A;  2FIW A;  4II9 A;  2PVW A;  5KTA A;  4EME A;  2FIA A;  3B3T A;  4OID A;  3R9F A;  1ZO0 A;  1FT7 A;  4C68 A;  5C88 A;  5IV0 A;  4CAE A;  4KLV A;  2QEC A;  2Z3N A;  2FE7 A;  3FIX A;  4ZYQ A;  3FED A;  4B11 A;  4CRY B;  2AFO A;  1S7F A;  4L8A A;  2OU2 A;  4YU9 A;  3RBU A;  3TOA A;  2BOA A;  1ZLI A;  4NJQ A;  2Z3M A;  1CPS A;  2VEZ A;  4X8I A;  2K5T A;  5F46 A;  2EWB A;  3PB4 X;  1Q2D A;  3G3S A;  3B3C A;  1Q2Y A;  3KZW A;  3FXT A;  1SQH A;  1P0H A;  4FD7 A;  1EE3 P;  4XNH B;  3PGP A;  1GYT A;  4MJ8 A;  4RUH A;  2CTC A;  3F5B A;  4JLY A;  4Q38 A;  2EK9 A;  1Z4R A;  2PR8 A;  3DSB A;  2PJ3 A;  3S9N A;  4EVY A;  2B3V A;  2NSM A;  1QMU A;  2V8H A;  3KHX A;  1LRZ A;  3P2F A;  3D7H A;  5DS0 A;  4CYN A;  4MFK A;  2B5G A;  2VZZ A;  1VKC A;  2H5M A;  3KHZ A;  3GLJ A;  3T9Y A;  1X12 A;  5AG5 A;  1K4J A;  5CBM A;  4OME A;  4OC4 A;  4Y49 B;  2V8D A;  2WYR A;  5LYF A;  1Z8L A;  1CG2 A;  3CZX A;  4R87 A;  1PUA A;  4OLL A;  4P4I A;  1Z2L A;  4IK2 A;  4ZY0 A;  8CPA A;  1UFH A;  3JVN A;  1Y0R A;  4U9Z A;  5LRJ A;  2D4P A;  2ZEF A;  2ZW7 A;  3IU1 A;  1Z5R A;  2ZOG A;  4NSQ A;  2PRB A;  2CY2 A;  2EBJ A;  2VQY A;  3SJE A;  4AB7 A;  5HVF A;  3WAB A;  4YFJ A;  4CPA A;  5AG6 A;  4KOU A;  4M6H A;  5THW A;  1TF9 A;  3BI0 A;  1U6M A;  4JYW A;  4AVC A;  1LFW A;  2AFU A;  2QYV A;  1OZP A;  3D66 A;  2O4H A;  2HUZ A;  2IQ6 A;  2PVV A;  2PJ8 A;  4U5Y A;  2B4D B;  2HQY A;  3IWW A;  3NH5 A;  2FL4 A;  2PJC A;  1L0C A;  1I21 A;  4M3S A;  2WPW A;  2DEA A;  2Z3O A;  5AGE A;  4C2Y A;  4BD9 A;  5H86 A;  3V7Z A;  2JDD A;  4KSI A;  1S60 A;  2BCO A;  1MJA A;  2ATR A;  3FX6 A;  4NJR A;  2AFX A;  4CGL A;  4KOV A;  3P2H A;  1BO4 A;  4QUS A;  1ZG7 A;  3DLJ A;  2P6F A;  4HNY B;  4FD6 A;  4UA3 A;  1XMT A;  4AVB A;  1RXT A;  4FAI A;  2PIZ A;  2YND A;  3RAM A;  3QNV A;  4TNU A;  5CNP A;  4MXU A;  4HNW B;  1XJO A;  3IC1 A;  2CNT A;  2OH1 A;  4KOS A;  5LYI A;  3BHX A;  1QST A;  2BSW A;  3WC6 A;  4IAV A;  4CGP A;  4JJX A;  3WT4 A;  2HV2 A;  2P6G A;  3K9T A;  2I3C A;  1Y9W A;  4X2T A;  1TKJ A;  4F8Z A;  4H89 A;  1Z9U A;  2FS5 A;  2GLJ A;  3GKR A;  4OAE A;  4MBU A;  3IU2 A;  2Q4Z A;  1UWY A;  1LOK A;  4MCR A;  4UWJ A;  5G21 A;  4BIN A;  4KOR A;  1V0C A;  4CAX A;  2ZEG A;  1PYT B;  2DF5 A;  3LAC A;  4A33 A;  1B87 A;  4PXB A;  5IB0 A;  3GY9 A;  2EVN A;  2DXQ A; 
#chains in the Genus database with same CATH homology
 3DNS A;  1KUY A;  4C7H A;  4KOX A;  1XEB A;  3LOD A;  3ZZI A;  5KTD A;  4KUB A;  4HNX B;  2VZY A;  4UFV A;  5KTC A;  4B14 A;  5DWN A;  4CRZ B;  2PQ8 A;  3D3S A;  3F0A A;  4KOY A;  2D4O A;  1IYL A;  2OZU A;  2FT0 A;  4MY3 A;  4C7I A;  3R95 A;  5F48 A;  5J8C A;  1IYK A;  3IGR A;  2NMT A;  3F8K A;  4KVO E;  3S6F A;  2P0W A;  3G8W A;  4MFJ A;  2QML A;  2B4B A;  4A32 A;  1I12 A;  4MHD A;  2Q4V A;  3K9U A;  3W91 A;  3R9E A;  4BMH A;  3S6K A;  3S6H A;  2YNC C;  1TIQ A;  4QC6 A;  4XPD C;  2PSW A;  3EO4 A;  4AG9 A;  1YX0 A;  3OWC A;  4MY0 A;  3H5Z A;  1IID A;  4B10 A;  1FY7 A;  2ZPA A;  2Z11 A;  4CGN A;  4PV6 A;  3TOB A;  3I3G A;  2WUU A;  4K30 A;  3T90 A;  4KVM E;  1BOB A;  3A9L A;  2Z0Z A;  3R9G A;  3CXQ A;  3LD2 A;  4OAD A;  3NE7 A;  5FVJ A;  4UCM A;  2FCK A;  3IWE A;  4E8O A;  1KZF A;  4AVA A;  5JPH A;  1KUV A;  3JTK A;  1YR0 A;  4KS9 A;  2B4D A;  4KSA A;  2RC4 A;  4NCZ A;  1S7K A;  2AJ6 A;  5G20 A;  4JD6 A;  1WWZ A;  4LUA A;  2I79 A;  2Z3P A;  5EBV A;  5F49 A;  1MK4 A;  4H6U A;  4Y49 C;  1RO5 A;  2I00 A;  4FD4 A;  3TTH A;  4J3G A;  4B13 A;  4JXR A;  1NSL A;  1R57 A;  4DNC A;  4M85 A;  2PR1 A;  3TFY A;  1PU9 A;  3TCV A;  4PSX A;  1P4N A;  2G3A A;  2X7B A;  3D8P A;  5DWM A;  2P6E A;  5G1Z A;  5E96 A;  5G22 A;  1XE4 A;  4I49 A;  4XPL A;  1J4J A;  3S6G A;  4CAW A;  3B8G A;  5AG4 A;  1NE9 A;  3TT2 A;  2CXA A;  4MFL A;  2Q7B A;  2Z3K A;  2Q4Y A;  3EY5 A;  1XIX A;  5F47 A;  4H6Z A;  1CJW A;  3EFA A;  4C2Z A;  4X5K A;  1YLE A;  1YK3 A;  2YNC A;  3ZJ0 A;  2BUE A;  3I9S A;  4MFZ A;  2J8M A;  4B5P B;  1Y7R A;  2ZW4 A;  2YGW A;  3FNC A;  1QSR A;  4A30 A;  5HH1 A;  4BBH A;  4PK2 A;  1VHS A;  4IUS A;  3TE4 A;  3H4Q A;  3TO6 A;  2GIV A;  2REE A;  4KVX A;  1I1D A;  3W6S A;  4KSF A;  2ZW5 A;  2JDC A;  4B12 A;  2J8N A;  1GHE A;  3IWG A;  3DR6 A;  1Z4E A;  2CNM A;  4A95 A;  4QBJ A;  2JLM A;  2R98 A;  4MFP A;  5A28 A;  4CYQ A;  4U9Y A;  4NF1 A;  4CGM A;  1S3Z A;  4CYO A;  2KCW A;  4CAV A;  1YRE A;  4HKF A;  4UCP A;  2A4N A;  1M4G A;  5AG7 A;  2Z3L A;  5EC4 A;  3BJ8 A;  4XPK A;  3D2P A;  2B5G B;  1S5K A;  2AE6 A;  2BL1 A;  1M4I A;  2DPS A;  2ZW6 A;  1IIC A;  1S7N A;  2JEV A;  2R8V A;  2R1I A;  4E2A A;  2EUI A;  4IF5 A;  2B58 A;  2Q44 A;  4NEX A;  3R96 A;  4L89 A;  1ON0 A;  5A27 A;  4F0X A;  4Q36 A;  4KUA A;  2FSR A;  1KUX A;  1XF8 A;  1YVK A;  2CNS A;  3PP9 A;  4QB9 A;  4UFX A;  4RS2 A;  3FB3 A;  3EXN A;  2FXF A;  3FBU A;  1WK4 A;  4JXQ A;  4E0A A;  2IL4 A;  2Y0M A;  3QAH A;  5GCN A;  1YGH A;  4PK3 A;  1M4D A;  2C27 A;  3W6X A;  4UFW A;  3FRM A;  4CAF A;  4R57 A;  3N7Z A;  5IX3 A;  4R3L A;  2G3T A;  1CM0 A;  1MJB A;  5HMN A;  1N71 A;  4UWI A;  2Q0Y A;  2VBQ A;  4XPD B;  3VWD A;  4XNH C;  4B5O A;  3R1K A;  4PSW A;  2GAN A;  2VI7 A;  4NXY A;  5C82 A;  3VWE A;  2PC1 A;  2BEI A;  4GS4 A;  4QVT A;  3E0K A;  3MGD A;  1S7L A;  3D2M A;  2G0B A;  3PZJ A;  3FYN A;  2YNE A;  3V8I A;  2R7H A;  4UCN A;  4F0Y A;  4KZT A;  5BWA B;  1M1D A;  1Y9K A;  5JQ4 A;  4JWP A;  4F6A A;  3CXP A;  3EC4 A;  1QSN A;  1B6B A;  2GE3 A;  4MI4 A;  2OB0 A;  2QIR A;  3RYO A;  4LX9 A;  5I0C A;  3SXN A;  3GYA A;  3SHP A;  1YVO A;  3SXO A;  2J8R A;  3DR8 A;  4CGO A;  1Q2C A;  3QB8 A;  2B3U A;  4ONU A;  3TO7 A;  4KOT A;  3BLN A;  4KOW A;  3JUW A;  4CS0 B;  4MFQ A;  2Q04 A;  1M44 A;  1IB1 E;  5J8F A;  4CYP A;  3C26 A;  1MJ9 A;  2F5I A;  1QSM A;  2ARH A;  4YGO A;  4ZBG A;  2ZXV A;  1QSO A;  3DDD A;  2WPX A;  2Z10 A;  4YRH A;  4ZGY B;  1NMT A;  2OZH A;  2VXK A;  2REF A;  4FD5 A;  3UY5 A;  4R3K A;  3CXS A;  2PDO A;  4AG7 A;  4C2X A;  3TO9 A;  2O28 A;  4A2Z A;  3KKW A;  3WR7 A;  2DPT A;  4ORF A;  5ISV A;  4UBR A;  4A31 A;  4B5P A;  4R9M A;  4KLW A;  3BJ7 A;  2OZG A;  2WSA A;  4RI1 A;  5H84 A;  2FIW A;  4II9 A;  5KTA A;  2FIA A;  5IV0 A;  3R9F A;  1ZO0 A;  4C68 A;  5C88 A;  4CAE A;  4KLV A;  2QEC A;  2Z3N A;  2FE7 A;  3FIX A;  4B11 A;  4CRY B;  1S7F A;  4L8A A;  2OU2 A;  3TOA A;  2Z3M A;  2VEZ A;  5F46 A;  2K5T A;  1Q2D A;  3G3S A;  1Q2Y A;  3FXT A;  1SQH A;  1P0H A;  4FD7 A;  4XNH B;  3PGP A;  4MJ8 A;  3F5B A;  4JLY A;  4Q38 A;  1Z4R A;  2PR8 A;  3DSB A;  4EVY A;  2B3V A;  1LRZ A;  3P2F A;  4CYN A;  4MFK A;  2B5G A;  2VZZ A;  1VKC A;  2H5M A;  3T9Y A;  5AG5 A;  1K4J A;  4Y49 B;  4R87 A;  1PUA A;  4OLL A;  1UFH A;  3JVN A;  4U9Z A;  2D4P A;  2ZW7 A;  3IU1 A;  4NSQ A;  2PRB A;  2CY2 A;  2VQY A;  4AB7 A;  4YFJ A;  5AG6 A;  4KOU A;  1U6M A;  4AVC A;  1OZP A;  2HUZ A;  4U5Y A;  2B4D B;  2HQY A;  2FL4 A;  1L0C A;  1I21 A;  4M3S A;  2WPW A;  2Z3O A;  5AGE A;  4C2Y A;  5H86 A;  2JDD A;  1S60 A;  1MJA A;  2ATR A;  4CGL A;  4KOV A;  3P2H A;  1BO4 A;  4QUS A;  2P6F A;  4HNY B;  4FD6 A;  4UA3 A;  1XMT A;  4AVB A;  1RXT A;  2YND A;  5CNP A;  4HNW B;  2CNT A;  2OH1 A;  4KOS A;  1QST A;  2BSW A;  4CGP A;  4JJX A;  2HV2 A;  2P6G A;  1Y9W A;  4H89 A;  1Z9U A;  2FS5 A;  3GKR A;  4OAE A;  4MBU A;  3IU2 A;  5G21 A;  4CAX A;  4UWJ A;  4KOR A;  1V0C A;  4A33 A;  1B87 A;  5IB0 A;  3GY9 A;  2EVN A;  2DXQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...