1S7FA

Riml- ribosomal l7/l12 alpha-n-protein acetyltransferase crystal form i (apo)
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
184
structure length
181
Chain Sequence
GLVPRGSHMVEIIPVSTTLELRAADESHVPALHQLVLKNKAWLQQSLDWPTSQEETRKHVQGNILLHQRGYAKMYLIFCQNEMAGVLSFNAIEPINKAAYIGYWLDESFQGQGIMSQSLQALMTHYARRGDIRRFVIKCRVDNQASNAVARRNHFTLEGCMKQAEYLNGDYHDVNMYARII
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords acetyl transferase
publication title A novel dimeric structure of the RimL Nalpha-acetyltransferase from Salmonella typhimurium.
pubmed doi rcsb
source organism Salmonella typhimurium
molecule tags Transferase
total genus 57
structure length 181
sequence length 184
ec nomenclature ec 2.3.1.-:
pdb deposition date 2004-01-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13302 Acetyltransf_3 Acetyltransferase (GNAT) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 1s7fA00
4JD6A 4F0YA 4XPDC 2I00A 5J8CA 3P2FA 3BJ8A 3EFAA 3KKWA 5C82A 3UY5A 4R9MA 4UWJA 4GS4A 3TOBA 5KTAA 4MI4A 1QSOA 5CNPA 1WWZA 5EBVA 1YLEA 5IX3A 5JPHA 4NCZA 2FCKA 1KUVA 4XPKA 2PR1A 3GY9A 4UBRA 4L8AA 2VXKA 3I3GA 1GHEA 1KZFA 4KVXA 3CXSA 4F6AA 5F47A 3FNCA 5E96A 5IB0A 3S6HA 3R9GA 5KTDA 2BL1A 1QSNA 3TFYA 4U9ZA 3I9SA 1Q2DA 1IYKA 2FL4A 3QAHA 2PDOA 4E2AA 1R57A 3TT2A 4II9A 2QECA 1Y9KA 1FY7A 1UFHA 4KLVA 4KOSA 2PC1A 4KOXA 4KZTA 5DWMA 4NF1A 4IUSA 2FE7A 4U9YA 4JWPA 2ZW5A 4B5OA 3S6KA 3VWEA 2X7BA 4QB9A 3W6SA 4E0AA 1KUXA 5C88A 4JXQA 4Y49B 3VWDA 3EY5A 4KOYA 2B4BA 1XMTA 2R1IA 2Y0MA 3SXOA 2J8RA 2B58A 3T9YA 2FS5A 4YGOA 4OLLA 2KCWA 2R7HA 2WPWA 2B3VA 4DNCA 1NMTA 3JUWA 2PQ8A 4LUAA 4FD4A 1S7NA 1U6MA 1YGHA 4JXRA 1V0CA 1YREA 4OADA 4AVCA 4MY3A 3ZJ0A 2P6FA 4MHDA 2R98A 2B4DB 2CNMA 2O28A 1M4IA 2OH1A 4R3KA 4EVYA 2ZXVA 1VKCA 2Q7BA 1Q2YA 2NMTA 3BLNA 4KOVA 3GKRA 1N71A 3PZJA 2FXFA 3RYOA 1M1DA 3TO9A 2ATRA 2VZZA 4KORA 2ZPAA 3R1KA 1S7KA 4AG9A 5F49A 1I1DA 4XNHB 3FBUA 3F5BA 2AJ6A 1NE9A 2JDDA 1MJ9A 5KTCA 3TE4A 4HNYB 2GE3A 3FRMA 4PK2A 3TOAA 1M44A 4ONUA 4I49A 3DR6A 4MBUA 4R57A 3FYNA 4NEXA 2J8MA 1SQHA 2D4PA 1Y7RA 1TIQA 5ISVA 1S5KA 2PRBA 2G3AA 2B3UA 4CRYB 4X5KA 1S3ZA 5I0CA 4PV6A 2R8VA 4HNXB 4RI1A 1P0HA 1M4GA 4PK3A 2QIRA 2REEA 3C26A 3DR8A 2AE6A 4AVBA 4JJXA 1QSMA 4CAVA 3GYAA 2GANA 5FVJA 1S60A 1I21A 2VEZA 3SXNA 2CNTA 1Q2CA 1Z4RA 4AVAA 3EC4A 2Q44A 2G3TA 3WR7A 3D2PA 4KVOE 4CS0B 4QUSA 1M4DA 4Y49C 3LD2A 3EO4A 1CM0A 5DWNA 2OU2A 5HH1A 1B6BA 1Z4EA 2I79A 2P6GA 4AB7A 1VHSA 4J3GA 2JLMA 3IWGA 3FXTA 4U5YA 2BSWA 3FB3A 4CAWA 2FIWA 1IIDA 5H84A 4JLYA 2EUIA 1YR0A 4MY0A 2Q4YA 1PU9A 1YK3A 5H86A 2DXQA 3P2HA 2FT0A 4UA3A 1XIXA 4PSWA 4ZBGA 1CJWA 1KUYA 5IV0A 2H5MA 2VI7A 4FD6A 3D2MA 1RXTA 3D3SA 3H4QA 2OZGA 4YRHA 5HMNA 3W6XA 5EC4A 3CXPA 2P6EA 4KUAA 1I12A 3TO7A 3DDDA 2K5TA 2Z0ZA 2D4OA 4XPDB 4OAEA 1PUAA 1S7LA 1LRZA 2HV2A 3DNSA 1K4JA 2F5IA 1XEBA 1IICA 3F0AA 3E0KA 4XNHC 4M85A 4HNWB 2VZYA 1YX0A 3FIXA 1RO5A 4LX9A 3DSBA 2QMLA 1OZPA 3NE7A 1MJBA 4IF5A 2HUZA 4B5PB 4R87A 2OZUA 4KOTA 3S6FA 2OB0A 4YFJA 3PGPA 2B5GB 4FD7A 1MK4A 2A4NA 1ON0A 4R3LA 3K9UA 3QB8A 3D8PA 4FD5A 2PR8A 2B4DA 3CXQA 2BEIA 4QBJA 2CNSA 1YVOA 4MJ8A 1P4NA 4NXYA 4E8OA 4AG7A 1XE4A 4KOUA 2VQYA 2P0WA 2ZW4A 3MGDA 1IYLA 3G8WA 4BMHA 1NSLA 2VBQA 1B87A 4QVTA 3EXNA 4XPLA 2JEVA 2HQYA 1MJAA 3R96A 3TCVA 2GIVA 4RS2A 2J8NA 3T90A 3R9EA 3IGRA 3PP9A 2Q04A 3BJ7A 1Y9WA 3TO6A 3W91A 2REFA 3SHPA 1WK4A 4B5PA 1J4JA 4CRZB 2OZHA 2B5GA 4KUBA 4K30A 1XF8A 2WPXA 2G0BA 2PSWA 5F48A 2FIAA 2Z10A 3G3SA 2IL4A 1Z9UA 3B8GA 2JDCA 4QC6A 3R9FA 2C27A 2RC4A 5F46A 3S6GA 2CY2A 4KVME 2Z11A 3LODA 4H6UA 3V8IA 3ZZIA 2Q0YA 4L89A 4ORFA 3F8KA 4H89A 1IB1E 3OWCA 1BOBA 4M3SA 4UWIA 3TTHA 1S7FA 1QSRA 4KLWA 1BO4A 3R95A 2BUEA 2FSRA 4H6ZA 2ARHA 4NSQA 1L0CA 1QSTA 4CAXA 2EVNA 3N7ZA 3JVNA 4KOWA 2Q4VA 5GCNA 4PSXA 5J8FA 4HKFA 2ZW6A 1YVKA 5JQ4A 2ZW7A
chains in the Genus database with same CATH superfamily
4JD6A 4UCNA 2Q4ZA 4FUUA 2GLJA 4F0YA 4WJBA 4XPDC 2I00A 1TF9A 4OP4A 5J8CA 3P2FA 3BJ8A 3EFAA 3KKWA 5C82A 3UY5A 4R9MA 4UCPA 1CP6A 2PJ0A 3D4UA 2NSMA 2BOAA 2YGWA 2ZELA 4MCPA 4R8FA 4UWJA 3ISXA 3IC1A 4GS4A 4P6YA 3T8WA 1IY7A 2O53A 3TOBA 4YWYA 5KTAA 4NGMA 3H8GA 3CPXA 4MI4A 2HB6A 3IU1A 4F9VA 3SI1A 1Z5RA 2Z3LA 1QSOA 4C7HA 4ONWA 2C6GA 5HVHA 1BAVA 1VIXA 5CNPA 1WWZA 2FVGA 4A32A 5EBVA 1YLEA 1NSAA 1Z8WA 4EFDA 5IX3A 5JPHA 4NCZA 3PB8X 1F2PA 1ZG7A 2OOTA 4A31A 2FCKA 2ODFA 1KUVA 2XEIA 3D67A 4XPKA 2PR1A 3QAYA 3NH8A 3GY9A 3HUVA 4UBRA 2EK9A 2WSAA 3S9MA 2VL1A 4UIAA 4A37A 5EMIA 2ZEHA 3D7DA 4OC5A 3D7GA 4L8AA 1Y7EA 2JBJA 2VXKA 3B3CA 3FX6A 5AGEA 4ZI6A 3I3GA 1GHEA 1KZFA 4X8IA 4KVXA 2G9DA 3CXSA 4F6AA 3SJEA 1GYTA 2JEWA 5LRJA 5F47A 2BO9A 2I3CA 3FNCA 2PVWA 5E96A 2Q7SA 1LAPA 5IB0A 2JBKA 3PFOA 3S6HA 2IQ6A 5DS0A 3R9GA 3VARA 5KTDA 1ELMP 2BL1A 1QSNA 1LFWA 3TFYA 2Z3PA 1YLOA 2AFUA 1ZLHA 2CTCA 4U9ZA 3BHXA 2DF5A 2F8HA 4OC1A 3I9SA 1Q2DA 5HVFA 5THWA 1XJOA 1IYKA 2FL4A 3QAHA 5LYLA 3KR5A 2PDOA 2PCUA 4KSFA 4E2AA 4EVYA 1R57A 2PJ6A 4DJLA 4EWTA 2PE3A 3TT2A 4II9A 2QECA 1Q7LA 1Y9KA 1FY7A 1Z8XA 2ZEDA 2C1CA 1UFHA 3NE8A 3RZAA 3SJXA 4KLVA 1BPMA 4KOSA 2PC1A 4CGOA 1H8LA 4KOXA 3KQXA 3SI2A 5AG5A 2QVPA 4KZTA 5DWMA 1TXRA 4NF1A 4NGRA 4P4FA 3D7HA 3L2NA 4IUSA 2FE7A 4U9YA 4JWPA 4FWUA 2ZW5A 4UIBA 4UEFA 1OBRA 2ABZA 4A38A 4B5OA 1HDQA 3S6KA 2EWBA 4ZY2A 3VWEA 2X7BA 3QNVA 4QB9A 3W6SA 4E0AA 2PJ7A 1KUXA 3FVLA 5C88A 4NGQA 1PCAA 4JXQA 4Y49B 3VWDA 3EY5A 4KOYA 2WZNA 2B4BA 3I1UA 1XMTA 2R1IA 4WWVA 4OC4A 2Y0MA 3SXOA 2J8RA 2B58A 3B7IA 3T9YA 2FS5A 4YGOA 4P4EA 1HDUA 3BI0A 4OLLA 2KCWA 2R7HA 4KSAA 4AXVA 4B10A 2WPWA 1ZG8A 2B3VA 1ZG9A 3DLJA 5JM6A 4DNCA 3BI1A 4CYPA 4CGLA 1YW4A 1NMTA 3JUWA 5LRGA 2PQ8A 4X2TA 3IFEA 1VHEA 4LUAA 4MFKA 4MHZA 1JWQA 1AMPA 4FD4A 4C7IA 4LQ6A 1S7NA 4PXBA 1U6MA 1YGHA 4JXRA 2ZEEA 1V0CA 1YREA 4OADA 4BBHA 1LCPA 4AVCA 4MHPA 2PJBA 4UCMA 3SJFA 3PEIA 4MY3A 3FF3A 1IOIA 3ZJ0A 2P6FA 1LAMA 2V8HA 1R3NA 4Z65A 4MHDA 2R98A 2B4DB 2CNMA 2V8GA 2O28A 4P4JA 1M4IA 3RBUA 1Z2LA 4A30A 5LRKA 2AFOA 2QYVA 2V8VA 3RNZA 1UWYA 4R76A 2OH1A 3B3VA 4R3KA 4YU9A 2ZXVA 2PVVA 1XMBA 4A2ZA 2CXAA 1VKCA 2ZEOA 4PQAA 6CPAA 4C68A 4K3NA 4OMEA 4X3RA 2Q7BA 1Q2YA 2NMTA 2YNCA 3BLNA 4KOVA 3GB0A 3GKRA 4HPSA 1N71A 4R7MA 4C2XA 2Q51A 2FXFA 3PZJA 3WC5A 2V8DA 3B3SA 3NFZA 3RYOA 1M1DA 4ZX9A 3TO9A 5K8OA 4M6HA 2ZEFA 2ATRA 2VZZA 4KORA 4NFRA 4BD9A 3B35A 2ZPAA 3R1KA 1XOVA 1S7KA 4AG9A 4NGTA 5F49A 1I1DA 4XNHB 2J9AA 3FBUA 3F5BA 1TKFA 2AJ6A 1NE9A 2JDDA 3HLPA 4MXUA 4G1PA 1MJ9A 5KTCA 3TE4A 4HNYB 5A28A 2GE3A 2CTBA 5CBMA 3FRMA 4PK2A 2AFXA 3CT9A 3TOAA 1IOFA 1M44A 1VGYA 4MFPA 4ONUA 4OKOA 4I49A 1DTDA 3DR6A 4MHYA 5ELYA 3BXMA 4H2KA 4MBUA 2QJ8A 1AUGA 4R57A 4UEZA 3FYNA 1CX8A 5G21A 2O4HA 2J8MA 4NEXA 1SQHA 2D4PA 4OC2A 4OIDA 3ISZA 3S9LA 1CPSA 4A33A 4A39A 1Y7RA 3H8FA 1TIQA 4P4DA 5ISVA 1S5KA 5D29A 2PRBA 2G3AA 2B3UA 3B3TA 4CRYB 4X5KA 1S3ZA 1BLLE 5I0CA 4ZY0A 1ARMA 4PV6A 2EBJA 2R8VA 4HNXB 4MFZA 4A95A 4C2YA 4RI1A 1P0HA 4JZ0A 1M4GA 1XRYA 3IIBA 2AFMA 4UFVA 1XFOA 7CPAA 2IMOA 4PK3A 3KHZA 2QIRA 4CPAA 4NGSA 2REEA 4W9YA 2DEAA 3C26A 2YNEA 3DR8A 4CYNA 2AE6A 4AVBA 4JJXA 1F57A 1QSMA 2ANPA 2PJ2A 3SJGA 1ELLP 3WT4A 4CAVA 4EMEA 3GYAA 1FT7A 1ARLA 2GANA 5FVJA 3RO0A 1S60A 2GREA 3D66A 1QQ9A 1ZLIA 1CPXA 1I21A 2VEZA 4M6IA 2PRQA 4MMOA 2CNTA 4TWEA 3SXNA 1Q2CA 1YMEA 4B6ZA 1Z4RA 1R43A 3PB9X 4AVAA 3EC4A 5IB9A 2Q44A 2YNCC 2WUUA 2G3TA 3WR7A 3KI9A 3D2PA 4MFJA 2RFHA 4Q36A 5D8NA 1TF8A 3H8EA 2EO8A 4KVOE 5K8MA 2XEGA 3NH5A 4UFXA 2C6CA 4CS0B 4QUSA 1M4DA 3KGQA 2CIJA 4UEEA 1YQEA 3EO4A 3LD2A 1CM0A 4Y49C 2AFZA 5DWNA 3IU2A 5I4MA 2OU2A 5HH1A 2PIYA 3TX8A 3KASA 1B6BA 1Z4EA 3LWUA 1VHOA 2I79A 4GM5A 3GLJA 3PBBA 1X10A 2P6GA 3RAMA 4AB7A 3KQZA 4CGPA 2ZOGA 1VHSA 4O23A 4J3GA 4ZX8A 3WC6A 2JLMA 4DUKA 5J1QA 3IWGA 3FXTA 4U5YA 4RN7A 2BSWA 4NGNA 4CGNA 5JGFA 3IWEA 3FB3A 4MFLA 4CAWA 2FIWA 4NJRA 4B12A 1AYEA 4CYQA 1IIDA 5H84A 4JLYA 2EUIA 4P4BA 1YR0A 4GXHA 3NA6A 4MY0A 2Q4YA 3S9NA 3D68A 4CAEA 1PU9A 1YK3A 5H86A 2AFWA 2XEFA 2DXQA 4CYOA 3P2HA 4RUHA 5AG6A 4KSIA 2FT0A 4UA3A 1XIXA 4F8ZA 4PSWA 4ZBGA 1CJWA 1KUYA 3WABA 3PRTA 4B11A 5IV0A 2H5MA 2VI7A 4FD6A 4MHNA 3D2MA 4P45A 1RXTA 1Y0YA 2PJ3A 4ZY1A 3D3SA 1YW6A 3H4QA 2V77A 2OZGA 1YSJA 4YRHA 3VH9A 4UF4A 4NGPA 5HMNA 3W6XA 5CPAA 5EC4A 3CXPA 2P6EA 4LQGA 3H5ZA 4KUAA 1I12A 2PJ5A 3TO7A 3DDDA 3IWWA 5K8PA 3B2YA 4M6GA 2K5TA 2Z0ZA 2F7VA 2D4OA 2DPTA 3PB6X 3IEHA 4XPDB 3FMCA 4OAEA 3PB4X 1PUAA 5AG7A 4PXDA 3VATA 3GIUA 1S7LA 3FJUA 1LRZA 2HV2A 3DNSA 1K4JA 2CF4A 2F5IA 4F9UA 1XEBA 1IICA 2Z3OA 3F0AA 3E0KA 4XNHC 4OC3A 3N5FA 4OIWA 3JTKA 4M85A 2C6PA 2ZEGA 1RTQA 1Z8LA 4HNWB 3IO1A 2VZYA 1YX0A 3FIXA 1RO5A 4LX9A 1TKJA 4IAVA 4PXCA 1LOKA 3DSBA 2QMLA 1OZPA 3FECA 3MN8A 3NE7A 1MJBA 4IF5A 4FBEA 3K2KA 2HUZA 4B5PB 3SI0A 4R87A 2OZUA 5HXDA 4KOTA 4PPZA 3S6FA 3V38A 2OB0A 3KR4A 4YFJA 1LANA 3IJ3A 3PB7X 3PGPA 5G22A 2B5GB 3DGVA 5LYIA 4MCQA 4Q7AA 2ZEMA 4FD7A 5LYDA 3MRUA 1MK4A 2HC9A 2A4NA 1X12A 1ON0A 4R3LA 3TC8A 3K9UA 3QB8A 3B3WA 3CDXA 3D8PA 4P10A 5BWAB 1HEEA 4FD5A 2DPSA 4MCSA 2PR8A 2B4DA 3CXQA 4TNUA 1M4LA 2BEIA 4NJQA 1ZO0A 3FEEA 4QBJA 5F09A 2CNSA 1YVOA 4MRIA 4MJ8A 1IGBA 4P4IA 2AFSA 3FEDA 5A27A 2NYQA 2XEJA 1DE4C 1JQGA 1P4NA 2PJ4A 4NXYA 4IHMA 4Q38A 1IU8A 1TKHA 4E8OA 2PJ1A 4JYWA 4AG7A 1XE4A 3KHXA 4KOUA 2VQYA 2P0WA 3PBEA 2GFQA 2ZW4A 3MGDA 1IYLA 5LYFA 3G8WA 4BMHA 1NSLA 2VBQA 1B87A 4QVTA 3EXNA 4XPLA 2JEVA 1QMUA 2HQYA 1MJAA 2RB7A 5AG4A 3R96A 3TCVA 4ZGYB 3D7FA 2GIVA 4RS2A 2J8NA 3T90A 2ZOFA 3IGRA 3R9EA 4R6TA 2Z3MA 5HVGA 3PP9A 2EK8A 4CAFA 4DYOA 2Q04A 4PXEA 1EE3P 1Y0RA 3CPAA 3BJ7A 1Y9WA 2YNDA 2PJAA 3TO6A 2POKA 3W91A 2REFA 3SHPA 1WK4A 4B5PA 4BINA 4B14A 5K8NA 1BPNA 1FNOA 1J4JA 4CRZB 2OZHA 4C2ZA 2B5GA 4KUBA 1PYTB 1KWMA 1XF8A 4IK2A 4K30A 4ZYQA 2WPXA 4KS9A 2G0BA 2PJ9A 2PSWA 5F48A 5JH9A 2FIAA 2Z3KA 2Z10A 3G3SA 4MFQA 2OR4A 5G1ZA 2IL4A 1Z9UA 1CBXA 3B8GA 3CZXA 2JDCA 3GUXA 4QC6A 3R9FA 2C27A 1A2ZA 2Q43A 2RC4A 5F46A 3S6GA 2CY2A 2ZEPA 4KVME 2Z11A 1F2OA 2GU2A 2Z3NA 1Z8TA 3FH4A 3K9TA 3LODA 4H6UA 3NH4A 3V8IA 3ZZIA 2Q0YA 4L89A 3WC7A 3PFEA 4ORFA 2PIZA 3F8KA 3JRUA 4H89A 1IB1E 2PJ8A 2ZENA 3OWCA 1BOBA 4M3SA 3KZWA 4UWIA 1S7FA 1QSRA 2PJCA 3TTHA 4A94A 4KLWA 1BO4A 4MCRA 2GLFA 3R95A 3V7ZA 2BUEA 2FSRA 4H6ZA 2ARHA 4NSQA 1L0CA 1QSTA 4B13A 1CG2A 4CAXA 4FAIA 3KL9A 4F0XA 2BCOA 2EVNA 3N7ZA 3JVNA 4CGMA 8CPAA 2IJZA 4KOWA 3LMSA 2Q4VA 4OC0A 1CP7A 2WYRA 4UFWA 5GCNA 4P44A 3A9LA 4PSXA 5G20A 4HKFA 5J8FA 2ZW6A 3LACA 1YVKA 5JQ4A 1XBUA 2ZW7A
chains in the Genus database with same CATH topology
4JD6A 4UCNA 4F0YA 4XPDC 2I00A 5J8CA 3P2FA 3BJ8A 3EFAA 3KKWA 5C82A 3UY5A 4R9MA 4UCPA 2YGWA 4UWJA 4GS4A 3TOBA 5KTAA 4MI4A 3IU1A 2Z3LA 4C7HA 1QSOA 5CNPA 1WWZA 4A32A 5EBVA 1YLEA 5IX3A 5JPHA 4NCZA 4A31A 2FCKA 1KUVA 4XPKA 2PR1A 3GY9A 4UBRA 2WSAA 4L8AA 5AGEA 2VXKA 3I3GA 1GHEA 1KZFA 4KVXA 3CXSA 4F6AA 5F47A 3FNCA 5E96A 5IB0A 3S6HA 3R9GA 5KTDA 2BL1A 1QSNA 3TFYA 2Z3PA 4U9ZA 3I9SA 1Q2DA 1IYKA 2FL4A 3QAHA 2PDOA 4KSFA 4E2AA 1R57A 3TT2A 4II9A 2QECA 1Y9KA 1FY7A 1UFHA 4KLVA 4KOSA 2PC1A 4CGOA 4KOXA 5AG5A 4KZTA 5DWMA 4NF1A 4IUSA 2FE7A 4U9YA 4JWPA 2ZW5A 4B5OA 3S6KA 3VWEA 2X7BA 4QB9A 3W6SA 4E0AA 1KUXA 5C88A 4JXQA 4Y49B 3VWDA 3EY5A 4KOYA 2B4BA 1XMTA 2R1IA 2Y0MA 3SXOA 2J8RA 2B58A 3T9YA 2FS5A 4YGOA 4OLLA 2KCWA 2R7HA 4KSAA 4B10A 2WPWA 2B3VA 4DNCA 4CYPA 4CGLA 1NMTA 3JUWA 2PQ8A 4LUAA 4MFKA 4FD4A 4C7IA 1S7NA 1U6MA 1YGHA 4JXRA 4BBHA 1V0CA 1YREA 4OADA 4AVCA 4UCMA 4MY3A 3ZJ0A 2P6FA 4MHDA 2R98A 2B4DB 2CNMA 2O28A 1M4IA 4A30A 2OH1A 4R3KA 4EVYA 2ZXVA 4A2ZA 2CXAA 1VKCA 4C68A 2Q7BA 1Q2YA 2NMTA 2YNCA 3BLNA 4KOVA 3GKRA 1N71A 4C2XA 3PZJA 2FXFA 3RYOA 1M1DA 3TO9A 2ATRA 2VZZA 4KORA 2ZPAA 3R1KA 1S7KA 4AG9A 5F49A 1I1DA 4XNHB 3FBUA 3F5BA 2AJ6A 1NE9A 2JDDA 1MJ9A 5KTCA 3TE4A 4HNYB 5A28A 2GE3A 3FRMA 4PK2A 3TOAA 1M44A 4MFPA 4ONUA 4I49A 3DR6A 4MBUA 4R57A 3FYNA 5G21A 4NEXA 2J8MA 1SQHA 2D4PA 4A33A 1Y7RA 1TIQA 5ISVA 1S5KA 2PRBA 2G3AA 2B3UA 4CRYB 4X5KA 1S3ZA 5I0CA 4PV6A 2R8VA 4HNXB 4MFZA 4A95A 4C2YA 4RI1A 1P0HA 1M4GA 4UFVA 4PK3A 2QIRA 2REEA 3C26A 2YNEA 3DR8A 4CYNA 2AE6A 4AVBA 4JJXA 1QSMA 4CAVA 3GYAA 2GANA 5FVJA 1S60A 1I21A 2VEZA 3SXNA 2CNTA 1Q2CA 1Z4RA 4AVAA 3EC4A 2Q44A 2YNCC 2WUUA 2G3TA 3WR7A 3D2PA 4MFJA 4Q36A 4KVOE 4UFXA 4CS0B 4QUSA 1M4DA 4Y49C 3LD2A 3EO4A 1CM0A 5DWNA 3IU2A 2OU2A 5HH1A 1B6BA 1Z4EA 2I79A 4CGPA 2P6GA 4AB7A 1VHSA 4J3GA 2JLMA 3IWGA 3FXTA 4U5YA 2BSWA 4CGNA 3IWEA 3FB3A 4MFLA 4CAWA 2FIWA 4B12A 4CYQA 1IIDA 5H84A 4JLYA 2EUIA 1YR0A 4MY0A 2Q4YA 4CAEA 1PU9A 1YK3A 5H86A 2DXQA 4CYOA 3P2HA 5AG6A 2FT0A 4UA3A 1XIXA 4PSWA 4ZBGA 1CJWA 1KUYA 4B11A 5IV0A 2H5MA 2VI7A 4FD6A 3D2MA 1RXTA 3D3SA 3H4QA 2OZGA 4YRHA 5HMNA 3W6XA 5EC4A 3CXPA 2P6EA 3H5ZA 4KUAA 1I12A 3TO7A 3DDDA 2K5TA 2Z0ZA 2D4OA 2DPTA 4XPDB 4OAEA 1PUAA 5AG7A 1S7LA 1LRZA 2HV2A 3DNSA 1K4JA 2F5IA 1XEBA 1IICA 2Z3OA 3F0AA 3E0KA 4XNHC 3JTKA 4M85A 4HNWB 2VZYA 1YX0A 3FIXA 1RO5A 4LX9A 3DSBA 2QMLA 1OZPA 3NE7A 1MJBA 4IF5A 2HUZA 4B5PB 4R87A 2OZUA 4KOTA 3S6FA 2OB0A 4YFJA 3PGPA 5G22A 2B5GB 4FD7A 1MK4A 2A4NA 1ON0A 4R3LA 3K9UA 3QB8A 5BWAB 3D8PA 4FD5A 2DPSA 2PR8A 2B4DA 3CXQA 2BEIA 1ZO0A 4QBJA 2CNSA 1YVOA 4MJ8A 5A27A 1P4NA 4NXYA 4Q38A 4E8OA 4AG7A 1XE4A 4KOUA 2VQYA 2P0WA 2ZW4A 3MGDA 1IYLA 3G8WA 4BMHA 1NSLA 2VBQA 1B87A 4QVTA 3EXNA 4XPLA 2JEVA 2HQYA 1MJAA 5AG4A 3R96A 3TCVA 4ZGYB 2GIVA 4RS2A 2J8NA 3T90A 3R9EA 3IGRA 2Z3MA 3PP9A 4CAFA 2Q04A 3BJ7A 1Y9WA 2YNDA 3TO6A 3W91A 2REFA 3SHPA 1WK4A 4B5PA 4B14A 1J4JA 4CRZB 2OZHA 4C2ZA 2B5GA 4KUBA 4K30A 1XF8A 2WPXA 4KS9A 2G0BA 2PSWA 5F48A 2FIAA 2Z3KA 2Z10A 3G3SA 4MFQA 5G1ZA 2IL4A 1Z9UA 3B8GA 2JDCA 4QC6A 3R9FA 2C27A 2RC4A 5F46A 3S6GA 2CY2A 4KVME 2Z11A 2Z3NA 3LODA 4H6UA 3V8IA 3ZZIA 2Q0YA 4L89A 4ORFA 3F8KA 4H89A 1IB1E 3OWCA 1BOBA 4M3SA 4UWIA 3TTHA 1S7FA 1QSRA 4KLWA 1BO4A 3R95A 2BUEA 2FSRA 4H6ZA 2ARHA 4NSQA 1L0CA 1QSTA 4B13A 4CAXA 4F0XA 2EVNA 3N7ZA 3JVNA 4CGMA 4KOWA 2Q4VA 4UFWA 5GCNA 5G20A 3A9LA 4PSXA 5J8FA 4HKFA 2ZW6A 1YVKA 5JQ4A 2ZW7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JD6 A;  4F0Y A;  4XPD C;  2I00 A;  5J8C A;  3P2F A;  3BJ8 A;  3EFA A;  3KKW A;  5C82 A;  3UY5 A;  4R9M A;  4UWJ A;  4GS4 A;  3TOB A;  5KTA A;  4MI4 A;  1QSO A;  5CNP A;  1WWZ A;  5EBV A;  1YLE A;  5IX3 A;  5JPH A;  4NCZ A;  2FCK A;  1KUV A;  4XPK A;  2PR1 A;  3GY9 A;  4UBR A;  4L8A A;  2VXK A;  3I3G A;  1GHE A;  1KZF A;  4KVX A;  3CXS A;  4F6A A;  5F47 A;  3FNC A;  5E96 A;  5IB0 A;  3S6H A;  3R9G A;  5KTD A;  2BL1 A;  1QSN A;  3TFY A;  4U9Z A;  3I9S A;  1Q2D A;  1IYK A;  2FL4 A;  3QAH A;  2PDO A;  4E2A A;  1R57 A;  3TT2 A;  4II9 A;  2QEC A;  1Y9K A;  1FY7 A;  1UFH A;  4KLV A;  4KOS A;  2PC1 A;  4KOX A;  4KZT A;  5DWM A;  4NF1 A;  4IUS A;  2FE7 A;  4U9Y A;  4JWP A;  2ZW5 A;  4B5O A;  3S6K A;  3VWE A;  2X7B A;  4QB9 A;  3W6S A;  4E0A A;  1KUX A;  5C88 A;  4JXQ A;  4Y49 B;  3VWD A;  3EY5 A;  4KOY A;  2B4B A;  1XMT A;  2R1I A;  2Y0M A;  3SXO A;  2J8R A;  2B58 A;  3T9Y A;  2FS5 A;  4YGO A;  4OLL A;  2KCW A;  2R7H A;  2WPW A;  2B3V A;  4DNC A;  1NMT A;  3JUW A;  2PQ8 A;  4LUA A;  4FD4 A;  1S7N A;  1U6M A;  1YGH A;  4JXR A;  1V0C A;  1YRE A;  4OAD A;  4AVC A;  4MY3 A;  3ZJ0 A;  2P6F A;  4MHD A;  2R98 A;  2B4D B;  2CNM A;  2O28 A;  1M4I A;  2OH1 A;  4R3K A;  4EVY A;  2ZXV A;  1VKC A;  2Q7B A;  1Q2Y A;  2NMT A;  3BLN A;  4KOV A;  3GKR A;  1N71 A;  3PZJ A;  2FXF A;  3RYO A;  1M1D A;  3TO9 A;  2ATR A;  2VZZ A;  4KOR A;  2ZPA A;  3R1K A;  1S7K A;  4AG9 A;  5F49 A;  1I1D A;  4XNH B;  3FBU A;  3F5B A;  2AJ6 A;  1NE9 A;  2JDD A;  1MJ9 A;  5KTC A;  3TE4 A;  4HNY B;  2GE3 A;  3FRM A;  4PK2 A;  3TOA A;  1M44 A;  4ONU A;  4I49 A;  3DR6 A;  4MBU A;  4R57 A;  3FYN A;  4NEX A;  2J8M A;  1SQH A;  2D4P A;  1Y7R A;  1TIQ A;  5ISV A;  1S5K A;  2PRB A;  2G3A A;  2B3U A;  4CRY B;  4X5K A;  1S3Z A;  5I0C A;  4PV6 A;  2R8V A;  4HNX B;  4RI1 A;  1P0H A;  1M4G A;  4PK3 A;  2QIR A;  2REE A;  3C26 A;  3DR8 A;  2AE6 A;  4AVB A;  4JJX A;  1QSM A;  4CAV A;  3GYA A;  2GAN A;  5FVJ A;  1S60 A;  1I21 A;  2VEZ A;  3SXN A;  2CNT A;  1Q2C A;  1Z4R A;  4AVA A;  3EC4 A;  2Q44 A;  2G3T A;  3WR7 A;  3D2P A;  4KVO E;  4CS0 B;  4QUS A;  1M4D A;  4Y49 C;  3LD2 A;  3EO4 A;  1CM0 A;  5DWN A;  2OU2 A;  5HH1 A;  1B6B A;  1Z4E A;  2I79 A;  2P6G A;  4AB7 A;  1VHS A;  4J3G A;  2JLM A;  3IWG A;  3FXT A;  4U5Y A;  2BSW A;  3FB3 A;  4CAW A;  2FIW A;  1IID A;  5H84 A;  4JLY A;  2EUI A;  1YR0 A;  4MY0 A;  2Q4Y A;  1PU9 A;  1YK3 A;  5H86 A;  2DXQ A;  3P2H A;  2FT0 A;  4UA3 A;  1XIX A;  4PSW A;  4ZBG A;  1CJW A;  1KUY A;  5IV0 A;  2H5M A;  2VI7 A;  4FD6 A;  3D2M A;  1RXT A;  3D3S A;  3H4Q A;  2OZG A;  4YRH A;  5HMN A;  3W6X A;  5EC4 A;  3CXP A;  2P6E A;  4KUA A;  1I12 A;  3TO7 A;  3DDD A;  2K5T A;  2Z0Z A;  2D4O A;  4XPD B;  4OAE A;  1PUA A;  1S7L A;  1LRZ A;  2HV2 A;  3DNS A;  1K4J A;  2F5I A;  1XEB A;  1IIC A;  3F0A A;  3E0K A;  4XNH C;  4M85 A;  4HNW B;  2VZY A;  1YX0 A;  3FIX A;  1RO5 A;  4LX9 A;  3DSB A;  2QML A;  1OZP A;  3NE7 A;  1MJB A;  4IF5 A;  2HUZ A;  4B5P B;  4R87 A;  2OZU A;  4KOT A;  3S6F A;  2OB0 A;  4YFJ A;  3PGP A;  2B5G B;  4FD7 A;  1MK4 A;  2A4N A;  1ON0 A;  4R3L A;  3K9U A;  3QB8 A;  3D8P A;  4FD5 A;  2PR8 A;  2B4D A;  3CXQ A;  2BEI A;  4QBJ A;  2CNS A;  1YVO A;  4MJ8 A;  1P4N A;  4NXY A;  4E8O A;  4AG7 A;  1XE4 A;  4KOU A;  2VQY A;  2P0W A;  2ZW4 A;  3MGD A;  1IYL A;  3G8W A;  4BMH A;  1NSL A;  2VBQ A;  1B87 A;  4QVT A;  3EXN A;  4XPL A;  2JEV A;  2HQY A;  1MJA A;  3R96 A;  3TCV A;  2GIV A;  4RS2 A;  2J8N A;  3T90 A;  3R9E A;  3IGR A;  3PP9 A;  2Q04 A;  3BJ7 A;  1Y9W A;  3TO6 A;  3W91 A;  2REF A;  3SHP A;  1WK4 A;  4B5P A;  1J4J A;  4CRZ B;  2OZH A;  2B5G A;  4KUB A;  4K30 A;  1XF8 A;  2WPX A;  2G0B A;  2PSW A;  5F48 A;  2FIA A;  2Z10 A;  3G3S A;  2IL4 A;  1Z9U A;  3B8G A;  2JDC A;  4QC6 A;  3R9F A;  2C27 A;  2RC4 A;  5F46 A;  3S6G A;  2CY2 A;  4KVM E;  2Z11 A;  3LOD A;  4H6U A;  3V8I A;  3ZZI A;  2Q0Y A;  4L89 A;  4ORF A;  3F8K A;  4H89 A;  1IB1 E;  3OWC A;  1BOB A;  4M3S A;  4UWI A;  3TTH A;  1S7F A;  1QSR A;  4KLW A;  1BO4 A;  3R95 A;  2BUE A;  2FSR A;  4H6Z A;  2ARH A;  4NSQ A;  1L0C A;  1QST A;  4CAX A;  2EVN A;  3N7Z A;  3JVN A;  4KOW A;  2Q4V A;  5GCN A;  4PSX A;  5J8F A;  4HKF A;  2ZW6 A;  1YVK A;  5JQ4 A;  2ZW7 A; 
#chains in the Genus database with same CATH topology
 4JD6 A;  4UCN A;  2Q4Z A;  4FUU A;  2GLJ A;  4F0Y A;  4WJB A;  4XPD C;  2I00 A;  1TF9 A;  4OP4 A;  5J8C A;  3P2F A;  3BJ8 A;  3EFA A;  3KKW A;  5C82 A;  3UY5 A;  4R9M A;  4UCP A;  1CP6 A;  2PJ0 A;  3D4U A;  2NSM A;  2BOA A;  2YGW A;  2ZEL A;  4MCP A;  4R8F A;  4UWJ A;  3ISX A;  3IC1 A;  4GS4 A;  4P6Y A;  3T8W A;  1IY7 A;  2O53 A;  3TOB A;  4YWY A;  5KTA A;  4NGM A;  3H8G A;  3CPX A;  4MI4 A;  2HB6 A;  3IU1 A;  4F9V A;  3SI1 A;  1Z5R A;  2Z3L A;  1QSO A;  4C7H A;  4ONW A;  2C6G A;  5HVH A;  1BAV A;  1VIX A;  5CNP A;  1WWZ A;  2FVG A;  4A32 A;  5EBV A;  1YLE A;  1NSA A;  1Z8W A;  4EFD A;  5IX3 A;  5JPH A;  4NCZ A;  3PB8 X;  1F2P A;  1ZG7 A;  2OOT A;  4A31 A;  2FCK A;  2ODF A;  1KUV A;  2XEI A;  3D67 A;  4XPK A;  2PR1 A;  3QAY A;  3NH8 A;  3GY9 A;  3HUV A;  4UBR A;  2EK9 A;  2WSA A;  3S9M A;  2VL1 A;  4UIA A;  4A37 A;  5EMI A;  2ZEH A;  3D7D A;  4OC5 A;  3D7G A;  4L8A A;  1Y7E A;  2JBJ A;  2VXK A;  3B3C A;  3FX6 A;  5AGE A;  4ZI6 A;  3I3G A;  1GHE A;  1KZF A;  4X8I A;  4KVX A;  2G9D A;  3CXS A;  4F6A A;  3SJE A;  1GYT A;  2JEW A;  5LRJ A;  5F47 A;  2BO9 A;  2I3C A;  3FNC A;  2PVW A;  5E96 A;  2Q7S A;  1LAP A;  5IB0 A;  2JBK A;  3PFO A;  3S6H A;  2IQ6 A;  5DS0 A;  3R9G A;  3VAR A;  5KTD A;  1ELM P;  2BL1 A;  1QSN A;  1LFW A;  3TFY A;  2Z3P A;  1YLO A;  2AFU A;  1ZLH A;  2CTC A;  4U9Z A;  3BHX A;  2DF5 A;  2F8H A;  4OC1 A;  3I9S A;  1Q2D A;  5HVF A;  5THW A;  1XJO A;  1IYK A;  2FL4 A;  3QAH A;  5LYL A;  3KR5 A;  2PDO A;  2PCU A;  4KSF A;  4E2A A;  4EVY A;  1R57 A;  2PJ6 A;  4DJL A;  4EWT A;  2PE3 A;  3TT2 A;  4II9 A;  2QEC A;  1Q7L A;  1Y9K A;  1FY7 A;  1Z8X A;  2ZED A;  2C1C A;  1UFH A;  3NE8 A;  3RZA A;  3SJX A;  4KLV A;  1BPM A;  4KOS A;  2PC1 A;  4CGO A;  1H8L A;  4KOX A;  3KQX A;  3SI2 A;  5AG5 A;  2QVP A;  4KZT A;  5DWM A;  1TXR A;  4NF1 A;  4NGR A;  4P4F A;  3D7H A;  3L2N A;  4IUS A;  2FE7 A;  4U9Y A;  4JWP A;  4FWU A;  2ZW5 A;  4UIB A;  4UEF A;  1OBR A;  2ABZ A;  4A38 A;  4B5O A;  1HDQ A;  3S6K A;  2EWB A;  4ZY2 A;  3VWE A;  2X7B A;  3QNV A;  4QB9 A;  3W6S A;  4E0A A;  2PJ7 A;  1KUX A;  3FVL A;  5C88 A;  4NGQ A;  1PCA A;  4JXQ A;  4Y49 B;  3VWD A;  3EY5 A;  4KOY A;  2WZN A;  2B4B A;  3I1U A;  1XMT A;  2R1I A;  4WWV A;  4OC4 A;  2Y0M A;  3SXO A;  2J8R A;  2B58 A;  3B7I A;  3T9Y A;  2FS5 A;  4YGO A;  4P4E A;  1HDU A;  3BI0 A;  4OLL A;  2KCW A;  2R7H A;  4KSA A;  4AXV A;  4B10 A;  2WPW A;  1ZG8 A;  2B3V A;  1ZG9 A;  3DLJ A;  5JM6 A;  4DNC A;  3BI1 A;  4CYP A;  4CGL A;  1YW4 A;  1NMT A;  3JUW A;  5LRG A;  2PQ8 A;  4X2T A;  3IFE A;  1VHE A;  4LUA A;  4MFK A;  4MHZ A;  1JWQ A;  1AMP A;  4FD4 A;  4C7I A;  4LQ6 A;  1S7N A;  4PXB A;  1U6M A;  1YGH A;  4JXR A;  2ZEE A;  1V0C A;  1YRE A;  4OAD A;  4BBH A;  1LCP A;  4AVC A;  4MHP A;  2PJB A;  4UCM A;  3SJF A;  3PEI A;  4MY3 A;  3FF3 A;  1IOI A;  3ZJ0 A;  2P6F A;  1LAM A;  2V8H A;  1R3N A;  4Z65 A;  4MHD A;  2R98 A;  2B4D B;  2CNM A;  2V8G A;  2O28 A;  4P4J A;  1M4I A;  3RBU A;  1Z2L A;  4A30 A;  5LRK A;  2AFO A;  2QYV A;  2V8V A;  3RNZ A;  1UWY A;  4R76 A;  2OH1 A;  3B3V A;  4R3K A;  4YU9 A;  2ZXV A;  2PVV A;  1XMB A;  4A2Z A;  2CXA A;  1VKC A;  2ZEO A;  4PQA A;  6CPA A;  4C68 A;  4K3N A;  4OME A;  4X3R A;  2Q7B A;  1Q2Y A;  2NMT A;  2YNC A;  3BLN A;  4KOV A;  3GB0 A;  3GKR A;  4HPS A;  1N71 A;  4R7M A;  4C2X A;  2Q51 A;  2FXF A;  3PZJ A;  3WC5 A;  2V8D A;  3B3S A;  3NFZ A;  3RYO A;  1M1D A;  4ZX9 A;  3TO9 A;  5K8O A;  4M6H A;  2ZEF A;  2ATR A;  2VZZ A;  4KOR A;  4NFR A;  4BD9 A;  3B35 A;  2ZPA A;  3R1K A;  1XOV A;  1S7K A;  4AG9 A;  4NGT A;  5F49 A;  1I1D A;  4XNH B;  2J9A A;  3FBU A;  3F5B A;  1TKF A;  2AJ6 A;  1NE9 A;  2JDD A;  3HLP A;  4MXU A;  4G1P A;  1MJ9 A;  5KTC A;  3TE4 A;  4HNY B;  5A28 A;  2GE3 A;  2CTB A;  5CBM A;  3FRM A;  4PK2 A;  2AFX A;  3CT9 A;  3TOA A;  1IOF A;  1M44 A;  1VGY A;  4MFP A;  4ONU A;  4OKO A;  4I49 A;  1DTD A;  3DR6 A;  4MHY A;  5ELY A;  3BXM A;  4H2K A;  4MBU A;  2QJ8 A;  1AUG A;  4R57 A;  4UEZ A;  3FYN A;  1CX8 A;  5G21 A;  2O4H A;  2J8M A;  4NEX A;  1SQH A;  2D4P A;  4OC2 A;  4OID A;  3ISZ A;  3S9L A;  1CPS A;  4A33 A;  4A39 A;  1Y7R A;  3H8F A;  1TIQ A;  4P4D A;  5ISV A;  1S5K A;  5D29 A;  2PRB A;  2G3A A;  2B3U A;  3B3T A;  4CRY B;  4X5K A;  1S3Z A;  1BLL E;  5I0C A;  4ZY0 A;  1ARM A;  4PV6 A;  2EBJ A;  2R8V A;  4HNX B;  4MFZ A;  4A95 A;  4C2Y A;  4RI1 A;  1P0H A;  4JZ0 A;  1M4G A;  1XRY A;  3IIB A;  2AFM A;  4UFV A;  1XFO A;  7CPA A;  2IMO A;  4PK3 A;  3KHZ A;  2QIR A;  4CPA A;  4NGS A;  2REE A;  4W9Y A;  2DEA A;  3C26 A;  2YNE A;  3DR8 A;  4CYN A;  2AE6 A;  4AVB A;  4JJX A;  1F57 A;  1QSM A;  2ANP A;  2PJ2 A;  3SJG A;  1ELL P;  3WT4 A;  4CAV A;  4EME A;  3GYA A;  1FT7 A;  1ARL A;  2GAN A;  5FVJ A;  3RO0 A;  1S60 A;  2GRE A;  3D66 A;  1QQ9 A;  1ZLI A;  1CPX A;  1I21 A;  2VEZ A;  4M6I A;  2PRQ A;  4MMO A;  2CNT A;  4TWE A;  3SXN A;  1Q2C A;  1YME A;  4B6Z A;  1Z4R A;  1R43 A;  3PB9 X;  4AVA A;  3EC4 A;  5IB9 A;  2Q44 A;  2YNC C;  2WUU A;  2G3T A;  3WR7 A;  3KI9 A;  3D2P A;  4MFJ A;  2RFH A;  4Q36 A;  5D8N A;  1TF8 A;  3H8E A;  2EO8 A;  4KVO E;  5K8M A;  2XEG A;  3NH5 A;  4UFX A;  2C6C A;  4CS0 B;  4QUS A;  1M4D A;  3KGQ A;  2CIJ A;  4UEE A;  1YQE A;  3EO4 A;  3LD2 A;  1CM0 A;  4Y49 C;  2AFZ A;  5DWN A;  3IU2 A;  5I4M A;  2OU2 A;  5HH1 A;  2PIY A;  3TX8 A;  3KAS A;  1B6B A;  1Z4E A;  3LWU A;  1VHO A;  2I79 A;  4GM5 A;  3GLJ A;  3PBB A;  1X10 A;  2P6G A;  3RAM A;  4AB7 A;  3KQZ A;  4CGP A;  2ZOG A;  1VHS A;  4O23 A;  4J3G A;  4ZX8 A;  3WC6 A;  2JLM A;  4DUK A;  5J1Q A;  3IWG A;  3FXT A;  4U5Y A;  4RN7 A;  2BSW A;  4NGN A;  4CGN A;  5JGF A;  3IWE A;  3FB3 A;  4MFL A;  4CAW A;  2FIW A;  4NJR A;  4B12 A;  1AYE A;  4CYQ A;  1IID A;  5H84 A;  4JLY A;  2EUI A;  4P4B A;  1YR0 A;  4GXH A;  3NA6 A;  4MY0 A;  2Q4Y A;  3S9N A;  3D68 A;  4CAE A;  1PU9 A;  1YK3 A;  5H86 A;  2AFW A;  2XEF A;  2DXQ A;  4CYO A;  3P2H A;  4RUH A;  5AG6 A;  4KSI A;  2FT0 A;  4UA3 A;  1XIX A;  4F8Z A;  4PSW A;  4ZBG A;  1CJW A;  1KUY A;  3WAB A;  3PRT A;  4B11 A;  5IV0 A;  2H5M A;  2VI7 A;  4FD6 A;  4MHN A;  3D2M A;  4P45 A;  1RXT A;  1Y0Y A;  2PJ3 A;  4ZY1 A;  3D3S A;  1YW6 A;  3H4Q A;  2V77 A;  2OZG A;  1YSJ A;  4YRH A;  3VH9 A;  4UF4 A;  4NGP A;  5HMN A;  3W6X A;  5CPA A;  5EC4 A;  3CXP A;  2P6E A;  4LQG A;  3H5Z A;  4KUA A;  1I12 A;  2PJ5 A;  3TO7 A;  3DDD A;  3IWW A;  5K8P A;  3B2Y A;  4M6G A;  2K5T A;  2Z0Z A;  2F7V A;  2D4O A;  2DPT A;  3PB6 X;  3IEH A;  4XPD B;  3FMC A;  4OAE A;  3PB4 X;  1PUA A;  5AG7 A;  4PXD A;  3VAT A;  3GIU A;  1S7L A;  3FJU A;  1LRZ A;  2HV2 A;  3DNS A;  1K4J A;  2CF4 A;  2F5I A;  4F9U A;  1XEB A;  1IIC A;  2Z3O A;  3F0A A;  3E0K A;  4XNH C;  4OC3 A;  3N5F A;  4OIW A;  3JTK A;  4M85 A;  2C6P A;  2ZEG A;  1RTQ A;  1Z8L A;  4HNW B;  3IO1 A;  2VZY A;  1YX0 A;  3FIX A;  1RO5 A;  4LX9 A;  1TKJ A;  4IAV A;  4PXC A;  1LOK A;  3DSB A;  2QML A;  1OZP A;  3FEC A;  3MN8 A;  3NE7 A;  1MJB A;  4IF5 A;  4FBE A;  3K2K A;  2HUZ A;  4B5P B;  3SI0 A;  4R87 A;  2OZU A;  5HXD A;  4KOT A;  4PPZ A;  3S6F A;  3V38 A;  2OB0 A;  3KR4 A;  4YFJ A;  1LAN A;  3IJ3 A;  3PB7 X;  3PGP A;  5G22 A;  2B5G B;  3DGV A;  5LYI A;  4MCQ A;  4Q7A A;  2ZEM A;  4FD7 A;  5LYD A;  3MRU A;  1MK4 A;  2HC9 A;  2A4N A;  1X12 A;  1ON0 A;  4R3L A;  3TC8 A;  3K9U A;  3QB8 A;  3B3W A;  3CDX A;  3D8P A;  4P10 A;  5BWA B;  1HEE A;  4FD5 A;  2DPS A;  4MCS A;  2PR8 A;  2B4D A;  3CXQ A;  4TNU A;  1M4L A;  2BEI A;  4NJQ A;  1ZO0 A;  3FEE A;  4QBJ A;  5F09 A;  2CNS A;  1YVO A;  4MRI A;  4MJ8 A;  1IGB A;  4P4I A;  2AFS A;  3FED A;  5A27 A;  2NYQ A;  2XEJ A;  1DE4 C;  1JQG A;  1P4N A;  2PJ4 A;  4NXY A;  4IHM A;  4Q38 A;  1IU8 A;  1TKH A;  4E8O A;  2PJ1 A;  4JYW A;  4AG7 A;  1XE4 A;  3KHX A;  4KOU A;  2VQY A;  2P0W A;  3PBE A;  2GFQ A;  2ZW4 A;  3MGD A;  1IYL A;  5LYF A;  3G8W A;  4BMH A;  1NSL A;  2VBQ A;  1B87 A;  4QVT A;  3EXN A;  4XPL A;  2JEV A;  1QMU A;  2HQY A;  1MJA A;  2RB7 A;  5AG4 A;  3R96 A;  3TCV A;  4ZGY B;  3D7F A;  2GIV A;  4RS2 A;  2J8N A;  3T90 A;  2ZOF A;  3IGR A;  3R9E A;  4R6T A;  2Z3M A;  5HVG A;  3PP9 A;  2EK8 A;  4CAF A;  4DYO A;  2Q04 A;  4PXE A;  1EE3 P;  1Y0R A;  3CPA A;  3BJ7 A;  1Y9W A;  2YND A;  2PJA A;  3TO6 A;  2POK A;  3W91 A;  2REF A;  3SHP A;  1WK4 A;  4B5P A;  4BIN A;  4B14 A;  5K8N A;  1BPN A;  1FNO A;  1J4J A;  4CRZ B;  2OZH A;  4C2Z A;  2B5G A;  4KUB A;  1PYT B;  1KWM A;  1XF8 A;  4IK2 A;  4K30 A;  4ZYQ A;  2WPX A;  4KS9 A;  2G0B A;  2PJ9 A;  2PSW A;  5F48 A;  5JH9 A;  2FIA A;  2Z3K A;  2Z10 A;  3G3S A;  4MFQ A;  2OR4 A;  5G1Z A;  2IL4 A;  1Z9U A;  1CBX A;  3B8G A;  3CZX A;  2JDC A;  3GUX A;  4QC6 A;  3R9F A;  2C27 A;  1A2Z A;  2Q43 A;  2RC4 A;  5F46 A;  3S6G A;  2CY2 A;  2ZEP A;  4KVM E;  2Z11 A;  1F2O A;  2GU2 A;  2Z3N A;  1Z8T A;  3FH4 A;  3K9T A;  3LOD A;  4H6U A;  3NH4 A;  3V8I A;  3ZZI A;  2Q0Y A;  4L89 A;  3WC7 A;  3PFE A;  4ORF A;  2PIZ A;  3F8K A;  3JRU A;  4H89 A;  1IB1 E;  2PJ8 A;  2ZEN A;  3OWC A;  1BOB A;  4M3S A;  3KZW A;  4UWI A;  1S7F A;  1QSR A;  2PJC A;  3TTH A;  4A94 A;  4KLW A;  1BO4 A;  4MCR A;  2GLF A;  3R95 A;  3V7Z A;  2BUE A;  2FSR A;  4H6Z A;  2ARH A;  4NSQ A;  1L0C A;  1QST A;  4B13 A;  1CG2 A;  4CAX A;  4FAI A;  3KL9 A;  4F0X A;  2BCO A;  2EVN A;  3N7Z A;  3JVN A;  4CGM A;  8CPA A;  2IJZ A;  4KOW A;  3LMS A;  2Q4V A;  4OC0 A;  1CP7 A;  2WYR A;  4UFW A;  5GCN A;  4P44 A;  3A9L A;  4PSX A;  5G20 A;  4HKF A;  5J8F A;  2ZW6 A;  3LAC A;  1YVK A;  5JQ4 A;  1XBU A;  2ZW7 A; 
#chains in the Genus database with same CATH homology
 4JD6 A;  4UCN A;  4F0Y A;  4XPD C;  2I00 A;  5J8C A;  3P2F A;  3BJ8 A;  3EFA A;  3KKW A;  5C82 A;  3UY5 A;  4R9M A;  4UCP A;  2YGW A;  4UWJ A;  4GS4 A;  3TOB A;  5KTA A;  4MI4 A;  3IU1 A;  2Z3L A;  4C7H A;  1QSO A;  5CNP A;  1WWZ A;  4A32 A;  5EBV A;  1YLE A;  5IX3 A;  5JPH A;  4NCZ A;  4A31 A;  2FCK A;  1KUV A;  4XPK A;  2PR1 A;  3GY9 A;  4UBR A;  2WSA A;  4L8A A;  5AGE A;  2VXK A;  3I3G A;  1GHE A;  1KZF A;  4KVX A;  3CXS A;  4F6A A;  5F47 A;  3FNC A;  5E96 A;  5IB0 A;  3S6H A;  3R9G A;  5KTD A;  2BL1 A;  1QSN A;  3TFY A;  2Z3P A;  4U9Z A;  3I9S A;  1Q2D A;  1IYK A;  2FL4 A;  3QAH A;  2PDO A;  4KSF A;  4E2A A;  1R57 A;  3TT2 A;  4II9 A;  2QEC A;  1Y9K A;  1FY7 A;  1UFH A;  4KLV A;  4KOS A;  2PC1 A;  4CGO A;  4KOX A;  5AG5 A;  4KZT A;  5DWM A;  4NF1 A;  4IUS A;  2FE7 A;  4U9Y A;  4JWP A;  2ZW5 A;  4B5O A;  3S6K A;  3VWE A;  2X7B A;  4QB9 A;  3W6S A;  4E0A A;  1KUX A;  5C88 A;  4JXQ A;  4Y49 B;  3VWD A;  3EY5 A;  4KOY A;  2B4B A;  1XMT A;  2R1I A;  2Y0M A;  3SXO A;  2J8R A;  2B58 A;  3T9Y A;  2FS5 A;  4YGO A;  4OLL A;  2KCW A;  2R7H A;  4KSA A;  4B10 A;  2WPW A;  2B3V A;  4DNC A;  4CYP A;  4CGL A;  1NMT A;  3JUW A;  2PQ8 A;  4LUA A;  4MFK A;  4FD4 A;  4C7I A;  1S7N A;  1U6M A;  1YGH A;  4JXR A;  4BBH A;  1V0C A;  1YRE A;  4OAD A;  4AVC A;  4UCM A;  4MY3 A;  3ZJ0 A;  2P6F A;  4MHD A;  2R98 A;  2B4D B;  2CNM A;  2O28 A;  1M4I A;  4A30 A;  2OH1 A;  4R3K A;  4EVY A;  2ZXV A;  4A2Z A;  2CXA A;  1VKC A;  4C68 A;  2Q7B A;  1Q2Y A;  2NMT A;  2YNC A;  3BLN A;  4KOV A;  3GKR A;  1N71 A;  4C2X A;  3PZJ A;  2FXF A;  3RYO A;  1M1D A;  3TO9 A;  2ATR A;  2VZZ A;  4KOR A;  2ZPA A;  3R1K A;  1S7K A;  4AG9 A;  5F49 A;  1I1D A;  4XNH B;  3FBU A;  3F5B A;  2AJ6 A;  1NE9 A;  2JDD A;  1MJ9 A;  5KTC A;  3TE4 A;  4HNY B;  5A28 A;  2GE3 A;  3FRM A;  4PK2 A;  3TOA A;  1M44 A;  4MFP A;  4ONU A;  4I49 A;  3DR6 A;  4MBU A;  4R57 A;  3FYN A;  5G21 A;  4NEX A;  2J8M A;  1SQH A;  2D4P A;  4A33 A;  1Y7R A;  1TIQ A;  5ISV A;  1S5K A;  2PRB A;  2G3A A;  2B3U A;  4CRY B;  4X5K A;  1S3Z A;  5I0C A;  4PV6 A;  2R8V A;  4HNX B;  4MFZ A;  4A95 A;  4C2Y A;  4RI1 A;  1P0H A;  1M4G A;  4UFV A;  4PK3 A;  2QIR A;  2REE A;  3C26 A;  2YNE A;  3DR8 A;  4CYN A;  2AE6 A;  4AVB A;  4JJX A;  1QSM A;  4CAV A;  3GYA A;  2GAN A;  5FVJ A;  1S60 A;  1I21 A;  2VEZ A;  3SXN A;  2CNT A;  1Q2C A;  1Z4R A;  4AVA A;  3EC4 A;  2Q44 A;  2YNC C;  2WUU A;  2G3T A;  3WR7 A;  3D2P A;  4MFJ A;  4Q36 A;  4KVO E;  4UFX A;  4CS0 B;  4QUS A;  1M4D A;  4Y49 C;  3LD2 A;  3EO4 A;  1CM0 A;  5DWN A;  3IU2 A;  2OU2 A;  5HH1 A;  1B6B A;  1Z4E A;  2I79 A;  4CGP A;  2P6G A;  4AB7 A;  1VHS A;  4J3G A;  2JLM A;  3IWG A;  3FXT A;  4U5Y A;  2BSW A;  4CGN A;  3IWE A;  3FB3 A;  4MFL A;  4CAW A;  2FIW A;  4B12 A;  4CYQ A;  1IID A;  5H84 A;  4JLY A;  2EUI A;  1YR0 A;  4MY0 A;  2Q4Y A;  4CAE A;  1PU9 A;  1YK3 A;  5H86 A;  2DXQ A;  4CYO A;  3P2H A;  5AG6 A;  2FT0 A;  4UA3 A;  1XIX A;  4PSW A;  4ZBG A;  1CJW A;  1KUY A;  4B11 A;  5IV0 A;  2H5M A;  2VI7 A;  4FD6 A;  3D2M A;  1RXT A;  3D3S A;  3H4Q A;  2OZG A;  4YRH A;  5HMN A;  3W6X A;  5EC4 A;  3CXP A;  2P6E A;  3H5Z A;  4KUA A;  1I12 A;  3TO7 A;  3DDD A;  2K5T A;  2Z0Z A;  2D4O A;  2DPT A;  4XPD B;  4OAE A;  1PUA A;  5AG7 A;  1S7L A;  1LRZ A;  2HV2 A;  3DNS A;  1K4J A;  2F5I A;  1XEB A;  1IIC A;  2Z3O A;  3F0A A;  3E0K A;  4XNH C;  3JTK A;  4M85 A;  4HNW B;  2VZY A;  1YX0 A;  3FIX A;  1RO5 A;  4LX9 A;  3DSB A;  2QML A;  1OZP A;  3NE7 A;  1MJB A;  4IF5 A;  2HUZ A;  4B5P B;  4R87 A;  2OZU A;  4KOT A;  3S6F A;  2OB0 A;  4YFJ A;  3PGP A;  5G22 A;  2B5G B;  4FD7 A;  1MK4 A;  2A4N A;  1ON0 A;  4R3L A;  3K9U A;  3QB8 A;  5BWA B;  3D8P A;  4FD5 A;  2DPS A;  2PR8 A;  2B4D A;  3CXQ A;  2BEI A;  1ZO0 A;  4QBJ A;  2CNS A;  1YVO A;  4MJ8 A;  5A27 A;  1P4N A;  4NXY A;  4Q38 A;  4E8O A;  4AG7 A;  1XE4 A;  4KOU A;  2VQY A;  2P0W A;  2ZW4 A;  3MGD A;  1IYL A;  3G8W A;  4BMH A;  1NSL A;  2VBQ A;  1B87 A;  4QVT A;  3EXN A;  4XPL A;  2JEV A;  2HQY A;  1MJA A;  5AG4 A;  3R96 A;  3TCV A;  4ZGY B;  2GIV A;  4RS2 A;  2J8N A;  3T90 A;  3R9E A;  3IGR A;  2Z3M A;  3PP9 A;  4CAF A;  2Q04 A;  3BJ7 A;  1Y9W A;  2YND A;  3TO6 A;  3W91 A;  2REF A;  3SHP A;  1WK4 A;  4B5P A;  4B14 A;  1J4J A;  4CRZ B;  2OZH A;  4C2Z A;  2B5G A;  4KUB A;  4K30 A;  1XF8 A;  2WPX A;  4KS9 A;  2G0B A;  2PSW A;  5F48 A;  2FIA A;  2Z3K A;  2Z10 A;  3G3S A;  4MFQ A;  5G1Z A;  2IL4 A;  1Z9U A;  3B8G A;  2JDC A;  4QC6 A;  3R9F A;  2C27 A;  2RC4 A;  5F46 A;  3S6G A;  2CY2 A;  4KVM E;  2Z11 A;  2Z3N A;  3LOD A;  4H6U A;  3V8I A;  3ZZI A;  2Q0Y A;  4L89 A;  4ORF A;  3F8K A;  4H89 A;  1IB1 E;  3OWC A;  1BOB A;  4M3S A;  4UWI A;  3TTH A;  1S7F A;  1QSR A;  4KLW A;  1BO4 A;  3R95 A;  2BUE A;  2FSR A;  4H6Z A;  2ARH A;  4NSQ A;  1L0C A;  1QST A;  4B13 A;  4CAX A;  4F0X A;  2EVN A;  3N7Z A;  3JVN A;  4CGM A;  4KOW A;  2Q4V A;  4UFW A;  5GCN A;  5G20 A;  3A9L A;  4PSX A;  5J8F A;  4HKF A;  2ZW6 A;  1YVK A;  5JQ4 A;  2ZW7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...