1S7FA

Riml- ribosomal l7/l12 alpha-n-protein acetyltransferase crystal form i (apo)
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
184
structure length
181
Chain Sequence
GLVPRGSHMVEIIPVSTTLELRAADESHVPALHQLVLKNKAWLQQSLDWPTSQEETRKHVQGNILLHQRGYAKMYLIFCQNEMAGVLSFNAIEPINKAAYIGYWLDESFQGQGIMSQSLQALMTHYARRGDIRRFVIKCRVDNQASNAVARRNHFTLEGCMKQAEYLNGDYHDVNMYARII
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords acetyl transferase
publication title A novel dimeric structure of the RimL Nalpha-acetyltransferase from Salmonella typhimurium.
pubmed doi rcsb
source organism Salmonella typhimurium
total genus 57
structure length 181
sequence length 184
ec nomenclature ec 2.3.1.-:
pdb deposition date 2004-01-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13302 Acetyltransf_3 Acetyltransferase (GNAT) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 1s7fA00
3GY9A 3CXSA 5C82A 2Z0ZA 2J8RA 2CNTA 2R8VA 3R96A 4XPDC 2FL4A 4B5OA 1BOBA 4FD7A 4KOWA 2ATRA 5KTCA 4LX9A 3W6XA 1M4GA 3CXQA 1K4JA 4KVXA 4PV6A 4R57A 1S7KA 1P4NA 1S3ZA 5EBVA 1J4JA 3S6FA 1Y9WA 2FCKA 3TT2A 4AG7A 5F46A 1KZFA 3I3GA 4E0AA 5FVJA 3VWEA 2VZYA 1V0CA 3OWCA 2Z11A 3FRMA 3P2FA 4QBJA 1ON0A 2PRBA 4UWJA 2IL4A 1TIQA 1IICA 1CM0A 1M1DA 5C88A 2B4DB 4HNWB 5JQ4A 2ZW4A 2Z10A 3D8PA 2R98A 3EC4A 1XE4A 4R87A 2Q04A 3EO4A 4M3SA 4XNHB 3PZJA 4KLWA 2WPXA 4ZBGA 2JDCA 4IF5A 3QAHA 4CAVA 5IX3A 2G3TA 1YGHA 1SQHA 3PGPA 2AJ6A 4KZTA 4PSXA 3TOBA 1PU9A 4Y49B 1KUVA 2P6EA 1Z4RA 2Q4VA 2ZW5A 5HMNA 3V8IA 4R3KA 3C26A 2Q44A 4R9MA 3T90A 4PK2A 4DNCA 1Q2DA 4J3GA 4OLLA 1IYLA 3TO6A 4AVBA 2D4OA 4UBRA 2KCWA 2GANA 3BJ7A 4AB7A 1YREA 4X5KA 1IYKA 3TO7A 3H4QA 4M85A 4KVOE 3R1KA 3WR7A 2FSRA 2D4PA 4YGOA 1B87A 4KOYA 1OZPA 3BJ8A 4QUSA 1QSOA 2FIWA 2B4BA 3S6HA 4NF1A 4NEXA 3W91A 2FXFA 1YX0A 3DDDA 2FT0A 3D3SA 4MY0A 1YVKA 4F0YA 4E2AA 2OB0A 1YK3A 4CRYB 2OZHA 3BLNA 4GS4A 2NMTA 4QC6A 5JPHA 2REEA 1N71A 2VBQA 4R3LA 3I9SA 3KKWA 3LODA 1NSLA 4FD5A 1QSRA 4KLVA 3F8KA 1NMTA 2GE3A 1M4DA 4H6ZA 1CJWA 1S60A 1Q2CA 4HNYB 3P2HA 4FD6A 4QB9A 5DWMA 4MI4A 4B5PB 3FBUA 1MJAA 2P6GA 4KOXA 2Q4YA 3R95A 2WPWA 3F5BA 4L8AA 2QECA 2F5IA 4L89A 2K5TA 1S7FA 4H6UA 4MJ8A 4YFJA 5J8FA 3E0KA 5IB0A 1Z9UA 4UWIA 3TOAA 2BUEA 2BL1A 4AG9A 4KVME 5H86A 3G8WA 1Y7RA 2OH1A 1S7NA 2A4NA 3TTHA 2ZXVA 4U9ZA 4CRZB 2FS5A 1QSTA 1I21A 1RO5A 3IGRA 3S6GA 1FY7A 2Y0MA 3R9FA 4HNXB 2OZUA 3D2MA 2OU2A 1KUYA 3FB3A 1RXTA 2G0BA 5F49A 2P0WA 4FD4A 3CXPA 3G3SA 3DR6A 5EC4A 1S5KA 2QIRA 3TE4A 4KORA 3B8GA 2HQYA 1IB1E 5KTAA 2EUIA 1B6BA 4RI1A 2J8MA 1MJ9A 2OZGA 3JVNA 4LUAA 3UY5A 2I00A 3JUWA 1Q2YA 2AE6A 2FE7A 4B5PA 1YR0A 3F0AA 2O28A 1P0HA 1IIDA 3FIXA 4U9YA 1XMTA 2CY2A 1XF8A 1WWZA 4JXQA 1VKCA 2PR1A 2RC4A 4OAEA 4MHDA 2VQYA 2ZW6A 4II9A 1L0CA 1LRZA 4XNHC 5CNPA 3IWGA 4QVTA 2PR8A 2VI7A 3FYNA 2Q7BA 5F47A 1M4IA 1U6MA 2VXKA 4NXYA 4Y49C 2FIAA 4KOSA 4CS0B 3VWDA 2QMLA 2C27A 2P6FA 5I0CA 1QSNA 1VHSA 1UFHA 2VZZA 3T9YA 2CNMA 3TO9A 3GYAA 4MY3A 2VEZA 2ARHA 2I79A 3DR8A 2BEIA 4IUSA 4KOUA 3RYOA 1GHEA 1I1DA 2JEVA 4U5YA 1MJBA 5DWNA 2HV2A 4H89A 4AVCA 4XPLA 3SHPA 3QB8A 3SXOA 4YRHA 5IV0A 2PSWA 4JD6A 3EY5A 3W6SA 4RS2A 3EFAA 4JWPA 2ZW7A 3GKRA 4OADA 2HUZA 4I49A 1Z4EA 4ORFA 2B5GB 4EVYA 2ZPAA 4F6AA 5H84A 3PP9A 5ISVA 1Y9KA 5J8CA 3SXNA 1MK4A 2PQ8A 4KOVA 1NE9A 5HH1A 2EVNA 3NE7A 2R1IA 4ONUA 2B3UA 1XEBA 1S7LA 2H5MA 2JDDA 3DNSA 2BSWA 4KOTA 2J8NA 4XPKA 2R7HA 4JLYA 2X7BA 3FXTA 2PDOA 4XPDB 4AVAA 3R9GA 5GCNA 4PSWA 1WK4A 4NCZA 3TCVA 4CAXA 5KTDA 5E96A 2Q0YA 4KUBA 2PC1A 3FNCA 3MGDA 3S6KA 1I12A 3TFYA 3DSBA 1QSMA 2DXQA 4E8OA 4PK3A 3ZJ0A 4HKFA 5F48A 2GIVA 2REFA 3D2PA 3LD2A 2G3AA 1BO4A 3EXNA 4JXRA 3K9UA 1R57A 1PUAA 1M44A 1YLEA 4CAWA 2B58A 1KUXA 3N7ZA 4BMHA 1YVOA 4NSQA 3ZZIA 4KUAA 2B5GA 2CNSA 2JLMA 2B3VA 3R9EA 2B4DA 4UA3A 4MBUA 1XIXA 4JJXA 4K30A
chains in the Genus database with same CATH superfamily
3GY9A 4A2ZA 3CXSA 2F8HA 2BCOA 1UWYA 5C82A 2Z0ZA 3KZWA 5LYLA 2J8RA 2CNTA 3I1UA 3FH4A 4PXDA 3KHZA 4MFLA 2R8VA 3QAYA 4X8IA 3RBUA 4B14A 2Z3OA 3R96A 3WC6A 3KASA 5A28A 4XPDC 2FL4A 4MXUA 1BOBA 4FD7A 4KOWA 4B5OA 2PJ7A 2OR4A 2ATRA 5KTCA 4LX9A 3W6XA 1M4GA 3CXQA 3FEEA 2EBJA 1K4JA 2NSMA 2V8VA 2V77A 5LYIA 3FX6A 4A94A 1YSJA 1Z5RA 4KVXA 3IO1A 4PV6A 4R57A 1S7KA 4P6YA 1P4NA 1S3ZA 2CTCA 2PVWA 1J4JA 4UCPA 5EBVA 1Y9WA 3S6FA 2Q51A 3WT4A 1EE3P 2ZEFA 1ZLHA 2AFXA 2FCKA 3TT2A 4AG7A 2FVGA 3FMCA 5F46A 1KZFA 1VIXA 2Z3PA 3I3GA 4NGPA 5FVJA 4E0AA 3VWEA 4ZY0A 1R43A 2VZYA 5AG5A 5AG7A 4A32A 2PJ2A 3NA6A 1V0CA 4IHMA 3OWCA 3CDXA 4C7HA 2Z11A 4NJQA 3FRMA 4UEEA 3P2FA 4QBJA 5LRKA 1ON0A 2PRBA 4UWJA 3WC5A 2IL4A 3B7IA 4FUUA 2AFUA 1FT7A 1TIQA 1IICA 1CM0A 4R6TA 1QQ9A 1M1DA 5C88A 2B4DB 4HNWB 5JQ4A 2ZW4A 2Z10A 3KQZA 4PPZA 3D8PA 5DS0A 2RB7A 3B3TA 5G20A 2R98A 3D67A 4ONWA 3KHXA 2GLFA 3EC4A 3KQXA 4K3NA 4P44A 4RUHA 1TKHA 3T8WA 1XE4A 4R87A 4A31A 2Q04A 4NGTA 3EO4A 4M3SA 1IGBA 4XNHB 3PZJA 4C2YA 2EO8A 2WPXA 3B3CA 4KLWA 4ZBGA 3RAMA 2JDCA 2PJ6A 4F9VA 4IF5A 2F7VA 2PCUA 3B2YA 2PJ3A 4Q36A 3CT9A 3QAHA 4CAVA 5IX3A 2G3TA 2Q7SA 1YGHA 1SQHA 3PGPA 2AJ6A 4KZTA 2JEWA 3N5FA 4MFZA 3MN8A 2IQ6A 4PSXA 1PU9A 3TOBA 5J1QA 4Y49B 2PJAA 1KUVA 2P6EA 1Z4RA 2QJ8A 4EMEA 2Q4VA 2ZW5A 4MHPA 3PB7X 5HMNA 3SI2A 3V8IA 3IFEA 4F0XA 5HVHA 1KWMA 4R3KA 3C26A 3PEIA 3IWEA 2Q44A 3BXMA 4R9MA 4FWUA 3T90A 4PK2A 4H2KA 4M6GA 4CYPA 4DNCA 1Q2DA 4J3GA 4OLLA 1IYLA 4OC1A 4PXBA 3TO6A 4AVBA 4RN7A 2O4HA 3NH5A 2D4OA 3TC8A 4UBRA 3V38A 2KCWA 2GANA 3BJ7A 4AB7A 1CP6A 4M6HA 2PJ5A 3BHXA 3VARA 2WUUA 3PB9X 1YREA 2V8GA 4X5KA 1IYKA 3GLJA 1DE4C 3TO7A 3H4QA 1JQGA 1ZG7A 4M85A 4MCPA 2ZEDA 1LCPA 5THWA 4A30A 1Z8TA 4KVOE 1PCAA 3DGVA 3R1KA 4UCNA 4PXEA 3WABA 3H8FA 4MFJA 3WR7A 2XEGA 3KR5A 1ZG8A 2FSRA 2D4PA 4YGOA 3PB4X 4P10A 5HXDA 2CF4A 3B3WA 4CGPA 5D29A 1B87A 3IWWA 4CYNA 3ISXA 2ZOFA 4KOYA 2DPSA 5AG4A 1OZPA 2RFHA 3BJ8A 4UIBA 4CPAA 4P4IA 4QUSA 1QSOA 2FIWA 2WYRA 2B4BA 3S6HA 4UFWA 4NF1A 3SI1A 4DYOA 4P4EA 2ZEMA 4NEXA 3W91A 2Z3NA 2EK8A 2FXFA 3PRTA 1YX0A 3JRUA 3DDDA 2FT0A 2QVPA 3D3SA 1YVKA 4LQGA 4MY0A 4E2AA 4F0YA 2OB0A 3D4UA 4P4JA 2ZENA 1YK3A 4CRYB 4A33A 2OZHA 3H8EA 3BLNA 3HUVA 4GS4A 2NMTA 4QC6A 4A95A 3PB6X 1X10A 5JPHA 1ZO0A 2HC9A 4M6IA 2REEA 1N71A 2VBQA 4R3LA 3I9SA 4NFRA 2ZEGA 4NGQA 1IOFA 1YMEA 3KKWA 3KL9A 3LODA 3WC7A 1M4LA 1NSLA 2QYVA 2Z3MA 4FD5A 1QSRA 4KLVA 3F8KA 5AG6A 3H8GA 5CBMA 1NMTA 4A38A 4R76A 2AFOA 4TNUA 2GE3A 1Z8XA 5HVFA 1M4DA 4H6ZA 5K8PA 1CJWA 4UFXA 1S60A 1ELMP 4R7MA 1Q2CA 4HNYB 4MRIA 1RTQA 3P2HA 4DUKA 1CPXA 4FD6A 3V7ZA 4QB9A 2AFSA 5DWMA 4MI4A 4B5PB 5LYFA 3FBUA 4HPSA 1MJAA 1F57A 1CG2A 2C6CA 2P6GA 1FNOA 2Q4YA 2Q4ZA 4KOXA 4P4DA 3R95A 4CGOA 3CZXA 2WPWA 3JTKA 1X12A 3F5BA 4L8AA 4X2TA 2QECA 3NFZA 4KS9A 1XFOA 2F5IA 3FF3A 4L89A 2K5TA 1S7FA 3RZAA 3NH8A 3IJ3A 4KSFA 1LAMA 2ODFA 4H6UA 4MFKA 4MJ8A 4WWVA 4O23A 4OC5A 3S9MA 1TXRA 4A39A 4Q7AA 4YFJA 2IMOA 3E0KA 5J8FA 3PBEA 1CX8A 4CYOA 5IB0A 4B10A 1Z9UA 4UWIA 4EWTA 1ZLIA 3TOAA 1HEEA 2BUEA 2BL1A 4AG9A 4KVME 5H86A 4BD9A 3G8WA 1Y7RA 4UCMA 2OH1A 5G1ZA 4CGNA 4NJRA 4DJLA 1S7NA 2YNCA 2A4NA 5AGEA 3TTHA 2ZXVA 4U9ZA 3S9LA 4CRZB 2CTBA 4NGSA 4Z65A 2FS5A 1QSTA 1I21A 1RO5A 2WSAA 3IGRA 4OP4A 3S6GA 4UIAA 1FY7A 5K8NA 2GREA 4R8FA 3PB8X 2Y0MA 3PFOA 4Q38A 3R9FA 5EMIA 1Y0YA 4HNXB 3KGQA 2OZUA 3D2MA 4B11A 2OU2A 1KUYA 1Z8WA 3D7HA 3FB3A 2ZEPA 1RXTA 2G0BA 5F49A 2YNEA 1NSAA 5A27A 2P0WA 4FD4A 3CXPA 3D7GA 3G3SA 3DR6A 4NGRA 2ZOGA 5EC4A 4LQ6A 1Y7EA 3RNZA 1S5KA 2QIRA 4FAIA 4ZGYB 3TE4A 4ZX8A 5JH9A 4KORA 3B8GA 2JBKA 2HQYA 3LWUA 1IB1E 4TWEA 5KTAA 3B35A 5BWAB 5LRJA 1VHEA 3IU1A 2EUIA 1B6BA 2CXAA 2J8MA 4OC4A 4RI1A 2OZGA 1MJ9A 3JVNA 4LUAA 3K9TA 3KR4A 2CIJA 1XMBA 4YWYA 2I00A 2PIYA 3UY5A 1TF8A 1Q2YA 3JUWA 2AE6A 2FE7A 3VATA 5JM6A 1Z8LA 5IB9A 5K8OA 1HDQA 3LMSA 4C2XA 4F9UA 4B5PA 1YR0A 2PIZA 3F0AA 4UEFA 2O28A 4B6ZA 1P0HA 2G9DA 2PJ9A 1LFWA 3IIBA 1IIDA 3FIXA 3VH9A 5I4MA 4U9YA 1XMTA 2CY2A 4K30A 1XOVA 1WWZA 4CYQA 2Z3KA 1ELLP 1AUGA 2VL1A 3IEHA 2ZEHA 1IU8A 1VKCA 4JXQA 3HLPA 7CPAA 1DTDA 4ZI6A 2PR1A 1VGYA 4KSIA 2RC4A 4OAEA 3A9LA 4MHDA 4C68A 2VQYA 2ZW6A 4II9A 1L0CA 1LRZA 4XNHC 5CNPA 2HB6A 1ARMA 2I3CA 4MFQA 4MCQA 2DPTA 3IWGA 4UF4A 4QVTA 4GXHA 2ZEOA 3QNVA 4UFVA 2PR8A 2VI7A 3FYNA 2Q7BA 5F47A 1M4IA 1VHOA 1U6MA 2VXKA 2XEJA 5G22A 4NXYA 1LANA 4Y49C 2FIAA 4KOSA 4FBEA 4X3RA 3BI1A 3PFEA 2QMLA 2C27A 3VWDA 4CS0B 2P6FA 5I0CA 2O53A 3K2KA 1QSNA 1UFHA 1VHSA 1LAPA 1CBXA 2CNMA 2VZZA 4OIWA 2PE3A 3T9YA 3GYAA 3TO9A 2ZELA 3NH4A 3B3SA 3KI9A 4MFPA 1Y0RA 3RO0A 4OMEA 3IC1A 3S9NA 4MY3A 3H5ZA 3PBBA 5JGFA 2VEZA 2ARHA 2WZNA 2I79A 2Q43A 3DR8A 4OC2A 6CPAA 2BEIA 4IUSA 4KOUA 1PYTB 2V8DA 1YQEA 3GIUA 3RYOA 4CAEA 1ZG9A 1GHEA 4AXVA 1I1DA 2XEFA 1H8LA 5ELYA 2JEVA 4U5YA 4ZY2A 5F09A 4C2ZA 5LRGA 1AYEA 1MJBA 2AFMA 5HVGA 4YU9A 1AMPA 4PXCA 5DWNA 2HV2A 4H89A 4WJBA 4AVCA 2BOAA 4CGLA 4XPLA 3SHPA 3QB8A 3SXOA 4YRHA 1CPSA 2PRQA 5IV0A 2PSWA 4JD6A 3EY5A 1ARLA 3W6SA 2AFZA 3MRUA 4RS2A 3EFAA 4JWPA 2ZW7A 3GKRA 4MHYA 1QMUA 4OADA 5K8MA 3B3VA 2HUZA 4I49A 1Z4EA 2POKA 3IU2A 2YNCC 4ORFA 5D8NA 2B5GB 2GU2A 4EVYA 4C7IA 2ZPAA 2J9AA 3D7FA 3GB0A 5H84A 4F6AA 3PP9A 2EK9A 5ISVA 1BAVA 1Y9KA 2Z3LA 3SJFA 5J8CA 2PJCA 2XEIA 3SXNA 1MK4A 2PQ8A 2PVVA 4KOVA 4P45A 3ISZA 4ZX9A 4NGNA 4A37A 1NE9A 1HDUA 2GFQA 5HH1A 2YGWA 3SJEA 3TX8A 2EVNA 4OC0A 1TKJA 1JWQA 2R1IA 3NE7A 4ONUA 1R3NA 2JBJA 2B3UA 1XEBA 2PJ8A 4MHNA 1S7LA 4MCRA 2YNDA 1YW6A 2H5MA 2JDDA 3DNSA 3CPXA 3FEDA 2BSWA 3FVLA 4KOTA 2J8NA 2ZEEA 4XPKA 2R7HA 4JLYA 2X7BA 3FECA 3FXTA 2PDOA 3L2NA 3BI0A 4XPDB 1Z2LA 4AVAA 1IY7A 4MCSA 2ANPA 2C1CA 1LOKA 4B13A 3GUXA 2PJ4A 3R9GA 1BPMA 5GCNA 2GLJA 1OBRA 4IAVA 4PSWA 1WK4A 1CP7A 4IK2A 4NCZA 3CPAA 3TCVA 4B12A 4CAXA 4F8ZA 5KTDA 2NYQA 1TF9A 5E96A 4UEZA 2Q0YA 4KUBA 2PC1A 3FNCA 3MGDA 3SJXA 3S6KA 1I12A 4PQAA 2OOTA 8CPAA 1Q7LA 3NE8A 4P4FA 4JZ0A 2ABZA 3SJGA 2C6PA 3FJUA 4KSAA 4BBHA 1YW4A 3DSBA 3TFYA 1QSMA 2DXQA 2AFWA 4P4BA 4OKOA 5CPAA 1F2OA 3LACA 4E8OA 2PJ0A 1XBUA 2IJZA 4G1PA 4PK3A 4HKFA 5F48A 1IOIA 2GIVA 3ZJ0A 4ZYQA 1GYTA 5G21A 4OC3A 1YLOA 4EFDA 1F2PA 2REFA 3D2PA 4MMOA 3LD2A 3DLJA 2G3AA 1BO4A 3EXNA 4JXRA 3K9UA 1R57A 3D68A 1PUAA 1M44A 1YLEA 2DF5A 2PJ1A 4CAWA 4ZY1A 2B58A 2BO9A 1KUXA 4NGMA 1A2ZA 3SI0A 4MHZA 4BINA 1XJOA 2V8HA 3D66A 3N7ZA 4GM5A 4BMHA 3D7DA 1YVOA 4W9YA 4NSQA 3ZZIA 1TKFA 4KUAA 4OIDA 2B5GA 2CNSA 4CGMA 2DEAA 1BLLE 2JLMA 2B3VA 2EWBA 3R9EA 2B4DA 4CAFA 1XRYA 4UA3A 4MBUA 2PJBA 5LYDA 4JYWA 1XIXA 4JJXA 1BPNA 1XF8A 2C6GA
chains in the Genus database with same CATH topology
3GY9A 4A2ZA 3CXSA 5C82A 2Z0ZA 2J8RA 2CNTA 4MFLA 2R8VA 4B14A 2Z3OA 3R96A 5A28A 4XPDC 2FL4A 4B5OA 1BOBA 4FD7A 4KOWA 2ATRA 5KTCA 4LX9A 3W6XA 1M4GA 3CXQA 1K4JA 4KVXA 4PV6A 4R57A 1S7KA 1P4NA 1S3ZA 5EBVA 4UCPA 1J4JA 3S6FA 1Y9WA 2FCKA 3TT2A 4AG7A 5F46A 1KZFA 2Z3PA 3I3GA 4E0AA 5FVJA 3VWEA 5AG5A 2VZYA 5AG7A 4A32A 1V0CA 3OWCA 4C7HA 2Z11A 3FRMA 3P2FA 4QBJA 1ON0A 2PRBA 4UWJA 2IL4A 1TIQA 1IICA 1CM0A 1M1DA 5C88A 2B4DB 4HNWB 5JQ4A 2ZW4A 2Z10A 3D8PA 5G20A 2R98A 3EC4A 1XE4A 4R87A 4A31A 2Q04A 3EO4A 4M3SA 4XNHB 3PZJA 4C2YA 4KLWA 2WPXA 4ZBGA 2JDCA 4IF5A 4Q36A 3QAHA 4CAVA 5IX3A 2G3TA 1YGHA 1SQHA 3PGPA 2AJ6A 4KZTA 4MFZA 4PSXA 3TOBA 1PU9A 4Y49B 1KUVA 2P6EA 1Z4RA 2Q4VA 2ZW5A 5HMNA 3V8IA 4F0XA 4R3KA 3C26A 3IWEA 2Q44A 4R9MA 3T90A 4PK2A 4CYPA 4DNCA 1Q2DA 4J3GA 4OLLA 1IYLA 3TO6A 4AVBA 2D4OA 4UBRA 2KCWA 2GANA 3BJ7A 4AB7A 2WUUA 1YREA 4X5KA 1IYKA 3TO7A 3H4QA 4M85A 4A30A 4KVOE 3R1KA 4UCNA 4MFJA 3WR7A 2FSRA 2D4PA 4YGOA 4CGPA 1B87A 4CYNA 4KOYA 2DPSA 5AG4A 1OZPA 3BJ8A 4QUSA 1QSOA 2FIWA 2B4BA 3S6HA 4UFWA 4NF1A 4NEXA 3W91A 2Z3NA 2FXFA 1YX0A 3DDDA 2FT0A 3D3SA 4MY0A 1YVKA 4F0YA 4E2AA 2OB0A 1YK3A 4CRYB 4A33A 2OZHA 3BLNA 4GS4A 2NMTA 4QC6A 4A95A 5JPHA 1ZO0A 2REEA 1N71A 2VBQA 4R3LA 3I9SA 3KKWA 3LODA 1NSLA 2Z3MA 4FD5A 1QSRA 4KLVA 3F8KA 5AG6A 1NMTA 2GE3A 1M4DA 4H6ZA 1CJWA 4UFXA 1S60A 1Q2CA 4HNYB 3P2HA 4FD6A 4QB9A 5DWMA 4MI4A 4B5PB 3FBUA 1MJAA 2P6GA 4KOXA 2Q4YA 3R95A 4CGOA 3JTKA 2WPWA 3F5BA 4L8AA 2QECA 4KS9A 2F5IA 4L89A 2K5TA 1S7FA 4KSFA 4H6UA 4MFKA 4MJ8A 4YFJA 5J8FA 3E0KA 5IB0A 4CYOA 4B10A 1Z9UA 4UWIA 3TOAA 2BUEA 2BL1A 4AG9A 4KVME 5H86A 3G8WA 1Y7RA 4UCMA 2OH1A 5G1ZA 4CGNA 1S7NA 2YNCA 2A4NA 5AGEA 3TTHA 2ZXVA 4U9ZA 4CRZB 2FS5A 1QSTA 1I21A 1RO5A 2WSAA 3IGRA 3S6GA 1FY7A 2Y0MA 4Q38A 3R9FA 4HNXB 2OZUA 3D2MA 4B11A 2OU2A 1KUYA 3FB3A 1RXTA 2G0BA 5F49A 2YNEA 5A27A 2P0WA 4FD4A 3CXPA 3G3SA 3DR6A 5EC4A 1S5KA 2QIRA 4ZGYB 3TE4A 4KORA 3B8GA 2HQYA 1IB1E 5KTAA 5BWAB 3IU1A 2EUIA 1B6BA 2CXAA 2J8MA 4RI1A 1MJ9A 2OZGA 3JVNA 4LUAA 3UY5A 2I00A 3JUWA 1Q2YA 2AE6A 2FE7A 4C2XA 4B5PA 1YR0A 3F0AA 2O28A 1P0HA 1IIDA 3FIXA 4U9YA 1XMTA 2CY2A 4K30A 1WWZA 4CYQA 2Z3KA 4JXQA 1VKCA 2PR1A 2RC4A 4OAEA 3A9LA 4MHDA 4C68A 2VQYA 2ZW6A 4II9A 1L0CA 1LRZA 4XNHC 5CNPA 4MFQA 2DPTA 3IWGA 4QVTA 4UFVA 2PR8A 2VI7A 3FYNA 2Q7BA 5F47A 1M4IA 1U6MA 2VXKA 5G22A 4NXYA 4Y49C 2FIAA 4KOSA 4CS0B 3VWDA 2QMLA 2C27A 2P6FA 5I0CA 1QSNA 1VHSA 1UFHA 2VZZA 3T9YA 2CNMA 3TO9A 3GYAA 4MFPA 4MY3A 3H5ZA 2VEZA 2ARHA 2I79A 3DR8A 2BEIA 4IUSA 4KOUA 3RYOA 4CAEA 1GHEA 1I1DA 2JEVA 4U5YA 4C2ZA 1MJBA 5DWNA 2HV2A 4H89A 4AVCA 4CGLA 4XPLA 3SHPA 3QB8A 3SXOA 4YRHA 5IV0A 2PSWA 4JD6A 3EY5A 3W6SA 4RS2A 3EFAA 4JWPA 2ZW7A 3GKRA 4OADA 2HUZA 4I49A 1Z4EA 3IU2A 2YNCC 4ORFA 2B5GB 4EVYA 4C7IA 2ZPAA 4F6AA 5H84A 3PP9A 5ISVA 1Y9KA 2Z3LA 5J8CA 3SXNA 1MK4A 2PQ8A 4KOVA 1NE9A 5HH1A 2YGWA 2EVNA 3NE7A 2R1IA 4ONUA 2B3UA 1XEBA 1S7LA 2YNDA 2H5MA 2JDDA 3DNSA 2BSWA 4KOTA 2J8NA 4XPKA 2R7HA 4JLYA 2X7BA 3FXTA 2PDOA 4XPDB 4AVAA 4B13A 3R9GA 5GCNA 4PSWA 1WK4A 4B12A 4NCZA 3TCVA 4CAXA 5KTDA 5E96A 2Q0YA 4KUBA 2PC1A 3FNCA 3MGDA 3S6KA 1I12A 4BBHA 3TFYA 4KSAA 3DSBA 1QSMA 2DXQA 4E8OA 4PK3A 3ZJ0A 4HKFA 5F48A 2GIVA 5G21A 2REFA 3D2PA 3LD2A 2G3AA 1BO4A 3EXNA 4JXRA 3K9UA 1R57A 1PUAA 1M44A 1YLEA 4CAWA 2B58A 1KUXA 3N7ZA 4BMHA 1YVOA 4NSQA 3ZZIA 4KUAA 2B5GA 2CNSA 4CGMA 2JLMA 2B3VA 3R9EA 2B4DA 4CAFA 4UA3A 4MBUA 1XIXA 4JJXA 1XF8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GY9 A;  3CXS A;  5C82 A;  2Z0Z A;  2J8R A;  2CNT A;  2R8V A;  3R96 A;  4XPD C;  2FL4 A;  4B5O A;  1BOB A;  4FD7 A;  4KOW A;  2ATR A;  5KTC A;  4LX9 A;  3W6X A;  1M4G A;  3CXQ A;  1K4J A;  4KVX A;  4PV6 A;  4R57 A;  1S7K A;  1P4N A;  1S3Z A;  5EBV A;  1J4J A;  3S6F A;  1Y9W A;  2FCK A;  3TT2 A;  4AG7 A;  5F46 A;  1KZF A;  3I3G A;  4E0A A;  5FVJ A;  3VWE A;  2VZY A;  1V0C A;  3OWC A;  2Z11 A;  3FRM A;  3P2F A;  4QBJ A;  1ON0 A;  2PRB A;  4UWJ A;  2IL4 A;  1TIQ A;  1IIC A;  1CM0 A;  1M1D A;  5C88 A;  2B4D B;  4HNW B;  5JQ4 A;  2ZW4 A;  2Z10 A;  3D8P A;  2R98 A;  3EC4 A;  1XE4 A;  4R87 A;  2Q04 A;  3EO4 A;  4M3S A;  4XNH B;  3PZJ A;  4KLW A;  2WPX A;  4ZBG A;  2JDC A;  4IF5 A;  3QAH A;  4CAV A;  5IX3 A;  2G3T A;  1YGH A;  1SQH A;  3PGP A;  2AJ6 A;  4KZT A;  4PSX A;  3TOB A;  1PU9 A;  4Y49 B;  1KUV A;  2P6E A;  1Z4R A;  2Q4V A;  2ZW5 A;  5HMN A;  3V8I A;  4R3K A;  3C26 A;  2Q44 A;  4R9M A;  3T90 A;  4PK2 A;  4DNC A;  1Q2D A;  4J3G A;  4OLL A;  1IYL A;  3TO6 A;  4AVB A;  2D4O A;  4UBR A;  2KCW A;  2GAN A;  3BJ7 A;  4AB7 A;  1YRE A;  4X5K A;  1IYK A;  3TO7 A;  3H4Q A;  4M85 A;  4KVO E;  3R1K A;  3WR7 A;  2FSR A;  2D4P A;  4YGO A;  1B87 A;  4KOY A;  1OZP A;  3BJ8 A;  4QUS A;  1QSO A;  2FIW A;  2B4B A;  3S6H A;  4NF1 A;  4NEX A;  3W91 A;  2FXF A;  1YX0 A;  3DDD A;  2FT0 A;  3D3S A;  4MY0 A;  1YVK A;  4F0Y A;  4E2A A;  2OB0 A;  1YK3 A;  4CRY B;  2OZH A;  3BLN A;  4GS4 A;  2NMT A;  4QC6 A;  5JPH A;  2REE A;  1N71 A;  2VBQ A;  4R3L A;  3I9S A;  3KKW A;  3LOD A;  1NSL A;  4FD5 A;  1QSR A;  4KLV A;  3F8K A;  1NMT A;  2GE3 A;  1M4D A;  4H6Z A;  1CJW A;  1S60 A;  1Q2C A;  4HNY B;  3P2H A;  4FD6 A;  4QB9 A;  5DWM A;  4MI4 A;  4B5P B;  3FBU A;  1MJA A;  2P6G A;  4KOX A;  2Q4Y A;  3R95 A;  2WPW A;  3F5B A;  4L8A A;  2QEC A;  2F5I A;  4L89 A;  2K5T A;  1S7F A;  4H6U A;  4MJ8 A;  4YFJ A;  5J8F A;  3E0K A;  5IB0 A;  1Z9U A;  4UWI A;  3TOA A;  2BUE A;  2BL1 A;  4AG9 A;  4KVM E;  5H86 A;  3G8W A;  1Y7R A;  2OH1 A;  1S7N A;  2A4N A;  3TTH A;  2ZXV A;  4U9Z A;  4CRZ B;  2FS5 A;  1QST A;  1I21 A;  1RO5 A;  3IGR A;  3S6G A;  1FY7 A;  2Y0M A;  3R9F A;  4HNX B;  2OZU A;  3D2M A;  2OU2 A;  1KUY A;  3FB3 A;  1RXT A;  2G0B A;  5F49 A;  2P0W A;  4FD4 A;  3CXP A;  3G3S A;  3DR6 A;  5EC4 A;  1S5K A;  2QIR A;  3TE4 A;  4KOR A;  3B8G A;  2HQY A;  1IB1 E;  5KTA A;  2EUI A;  1B6B A;  4RI1 A;  2J8M A;  1MJ9 A;  2OZG A;  3JVN A;  4LUA A;  3UY5 A;  2I00 A;  3JUW A;  1Q2Y A;  2AE6 A;  2FE7 A;  4B5P A;  1YR0 A;  3F0A A;  2O28 A;  1P0H A;  1IID A;  3FIX A;  4U9Y A;  1XMT A;  2CY2 A;  1XF8 A;  1WWZ A;  4JXQ A;  1VKC A;  2PR1 A;  2RC4 A;  4OAE A;  4MHD A;  2VQY A;  2ZW6 A;  4II9 A;  1L0C A;  1LRZ A;  4XNH C;  5CNP A;  3IWG A;  4QVT A;  2PR8 A;  2VI7 A;  3FYN A;  2Q7B A;  5F47 A;  1M4I A;  1U6M A;  2VXK A;  4NXY A;  4Y49 C;  2FIA A;  4KOS A;  4CS0 B;  3VWD A;  2QML A;  2C27 A;  2P6F A;  5I0C A;  1QSN A;  1VHS A;  1UFH A;  2VZZ A;  3T9Y A;  2CNM A;  3TO9 A;  3GYA A;  4MY3 A;  2VEZ A;  2ARH A;  2I79 A;  3DR8 A;  2BEI A;  4IUS A;  4KOU A;  3RYO A;  1GHE A;  1I1D A;  2JEV A;  4U5Y A;  1MJB A;  5DWN A;  2HV2 A;  4H89 A;  4AVC A;  4XPL A;  3SHP A;  3QB8 A;  3SXO A;  4YRH A;  5IV0 A;  2PSW A;  4JD6 A;  3EY5 A;  3W6S A;  4RS2 A;  3EFA A;  4JWP A;  2ZW7 A;  3GKR A;  4OAD A;  2HUZ A;  4I49 A;  1Z4E A;  4ORF A;  2B5G B;  4EVY A;  2ZPA A;  4F6A A;  5H84 A;  3PP9 A;  5ISV A;  1Y9K A;  5J8C A;  3SXN A;  1MK4 A;  2PQ8 A;  4KOV A;  1NE9 A;  5HH1 A;  2EVN A;  3NE7 A;  2R1I A;  4ONU A;  2B3U A;  1XEB A;  1S7L A;  2H5M A;  2JDD A;  3DNS A;  2BSW A;  4KOT A;  2J8N A;  4XPK A;  2R7H A;  4JLY A;  2X7B A;  3FXT A;  2PDO A;  4XPD B;  4AVA A;  3R9G A;  5GCN A;  4PSW A;  1WK4 A;  4NCZ A;  3TCV A;  4CAX A;  5KTD A;  5E96 A;  2Q0Y A;  4KUB A;  2PC1 A;  3FNC A;  3MGD A;  3S6K A;  1I12 A;  3TFY A;  3DSB A;  1QSM A;  2DXQ A;  4E8O A;  4PK3 A;  3ZJ0 A;  4HKF A;  5F48 A;  2GIV A;  2REF A;  3D2P A;  3LD2 A;  2G3A A;  1BO4 A;  3EXN A;  4JXR A;  3K9U A;  1R57 A;  1PUA A;  1M44 A;  1YLE A;  4CAW A;  2B58 A;  1KUX A;  3N7Z A;  4BMH A;  1YVO A;  4NSQ A;  3ZZI A;  4KUA A;  2B5G A;  2CNS A;  2JLM A;  2B3V A;  3R9E A;  2B4D A;  4UA3 A;  4MBU A;  1XIX A;  4JJX A;  4K30 A; 
#chains in the Genus database with same CATH topology
 3GY9 A;  4A2Z A;  3CXS A;  2F8H A;  2BCO A;  1UWY A;  5C82 A;  2Z0Z A;  3KZW A;  5LYL A;  2J8R A;  2CNT A;  3I1U A;  3FH4 A;  4PXD A;  3KHZ A;  4MFL A;  2R8V A;  3QAY A;  4X8I A;  3RBU A;  4B14 A;  2Z3O A;  3R96 A;  3WC6 A;  3KAS A;  5A28 A;  4XPD C;  2FL4 A;  4MXU A;  1BOB A;  4FD7 A;  4KOW A;  4B5O A;  2PJ7 A;  2OR4 A;  2ATR A;  5KTC A;  4LX9 A;  3W6X A;  1M4G A;  3CXQ A;  3FEE A;  2EBJ A;  1K4J A;  2NSM A;  2V8V A;  2V77 A;  5LYI A;  3FX6 A;  4A94 A;  1YSJ A;  1Z5R A;  4KVX A;  3IO1 A;  4PV6 A;  4R57 A;  1S7K A;  4P6Y A;  1P4N A;  1S3Z A;  2CTC A;  2PVW A;  1J4J A;  4UCP A;  5EBV A;  1Y9W A;  3S6F A;  2Q51 A;  3WT4 A;  1EE3 P;  2ZEF A;  1ZLH A;  2AFX A;  2FCK A;  3TT2 A;  4AG7 A;  2FVG A;  3FMC A;  5F46 A;  1KZF A;  1VIX A;  2Z3P A;  3I3G A;  4NGP A;  5FVJ A;  4E0A A;  3VWE A;  4ZY0 A;  1R43 A;  2VZY A;  5AG5 A;  5AG7 A;  4A32 A;  2PJ2 A;  3NA6 A;  1V0C A;  4IHM A;  3OWC A;  3CDX A;  4C7H A;  2Z11 A;  4NJQ A;  3FRM A;  4UEE A;  3P2F A;  4QBJ A;  5LRK A;  1ON0 A;  2PRB A;  4UWJ A;  3WC5 A;  2IL4 A;  3B7I A;  4FUU A;  2AFU A;  1FT7 A;  1TIQ A;  1IIC A;  1CM0 A;  4R6T A;  1QQ9 A;  1M1D A;  5C88 A;  2B4D B;  4HNW B;  5JQ4 A;  2ZW4 A;  2Z10 A;  3KQZ A;  4PPZ A;  3D8P A;  5DS0 A;  2RB7 A;  3B3T A;  5G20 A;  2R98 A;  3D67 A;  4ONW A;  3KHX A;  2GLF A;  3EC4 A;  3KQX A;  4K3N A;  4P44 A;  4RUH A;  1TKH A;  3T8W A;  1XE4 A;  4R87 A;  4A31 A;  2Q04 A;  4NGT A;  3EO4 A;  4M3S A;  1IGB A;  4XNH B;  3PZJ A;  4C2Y A;  2EO8 A;  2WPX A;  3B3C A;  4KLW A;  4ZBG A;  3RAM A;  2JDC A;  2PJ6 A;  4F9V A;  4IF5 A;  2F7V A;  2PCU A;  3B2Y A;  2PJ3 A;  4Q36 A;  3CT9 A;  3QAH A;  4CAV A;  5IX3 A;  2G3T A;  2Q7S A;  1YGH A;  1SQH A;  3PGP A;  2AJ6 A;  4KZT A;  2JEW A;  3N5F A;  4MFZ A;  3MN8 A;  2IQ6 A;  4PSX A;  1PU9 A;  3TOB A;  5J1Q A;  4Y49 B;  2PJA A;  1KUV A;  2P6E A;  1Z4R A;  2QJ8 A;  4EME A;  2Q4V A;  2ZW5 A;  4MHP A;  3PB7 X;  5HMN A;  3SI2 A;  3V8I A;  3IFE A;  4F0X A;  5HVH A;  1KWM A;  4R3K A;  3C26 A;  3PEI A;  3IWE A;  2Q44 A;  3BXM A;  4R9M A;  4FWU A;  3T90 A;  4PK2 A;  4H2K A;  4M6G A;  4CYP A;  4DNC A;  1Q2D A;  4J3G A;  4OLL A;  1IYL A;  4OC1 A;  4PXB A;  3TO6 A;  4AVB A;  4RN7 A;  2O4H A;  3NH5 A;  2D4O A;  3TC8 A;  4UBR A;  3V38 A;  2KCW A;  2GAN A;  3BJ7 A;  4AB7 A;  1CP6 A;  4M6H A;  2PJ5 A;  3BHX A;  3VAR A;  2WUU A;  3PB9 X;  1YRE A;  2V8G A;  4X5K A;  1IYK A;  3GLJ A;  1DE4 C;  3TO7 A;  3H4Q A;  1JQG A;  1ZG7 A;  4M85 A;  4MCP A;  2ZED A;  1LCP A;  5THW A;  4A30 A;  1Z8T A;  4KVO E;  1PCA A;  3DGV A;  3R1K A;  4UCN A;  4PXE A;  3WAB A;  3H8F A;  4MFJ A;  3WR7 A;  2XEG A;  3KR5 A;  1ZG8 A;  2FSR A;  2D4P A;  4YGO A;  3PB4 X;  4P10 A;  5HXD A;  2CF4 A;  3B3W A;  4CGP A;  5D29 A;  1B87 A;  3IWW A;  4CYN A;  3ISX A;  2ZOF A;  4KOY A;  2DPS A;  5AG4 A;  1OZP A;  2RFH A;  3BJ8 A;  4UIB A;  4CPA A;  4P4I A;  4QUS A;  1QSO A;  2FIW A;  2WYR A;  2B4B A;  3S6H A;  4UFW A;  4NF1 A;  3SI1 A;  4DYO A;  4P4E A;  2ZEM A;  4NEX A;  3W91 A;  2Z3N A;  2EK8 A;  2FXF A;  3PRT A;  1YX0 A;  3JRU A;  3DDD A;  2FT0 A;  2QVP A;  3D3S A;  1YVK A;  4LQG A;  4MY0 A;  4E2A A;  4F0Y A;  2OB0 A;  3D4U A;  4P4J A;  2ZEN A;  1YK3 A;  4CRY B;  4A33 A;  2OZH A;  3H8E A;  3BLN A;  3HUV A;  4GS4 A;  2NMT A;  4QC6 A;  4A95 A;  3PB6 X;  1X10 A;  5JPH A;  1ZO0 A;  2HC9 A;  4M6I A;  2REE A;  1N71 A;  2VBQ A;  4R3L A;  3I9S A;  4NFR A;  2ZEG A;  4NGQ A;  1IOF A;  1YME A;  3KKW A;  3KL9 A;  3LOD A;  3WC7 A;  1M4L A;  1NSL A;  2QYV A;  2Z3M A;  4FD5 A;  1QSR A;  4KLV A;  3F8K A;  5AG6 A;  3H8G A;  5CBM A;  1NMT A;  4A38 A;  4R76 A;  2AFO A;  4TNU A;  2GE3 A;  1Z8X A;  5HVF A;  1M4D A;  4H6Z A;  5K8P A;  1CJW A;  4UFX A;  1S60 A;  1ELM P;  4R7M A;  1Q2C A;  4HNY B;  4MRI A;  1RTQ A;  3P2H A;  4DUK A;  1CPX A;  4FD6 A;  3V7Z A;  4QB9 A;  2AFS A;  5DWM A;  4MI4 A;  4B5P B;  5LYF A;  3FBU A;  4HPS A;  1MJA A;  1F57 A;  1CG2 A;  2C6C A;  2P6G A;  1FNO A;  2Q4Y A;  2Q4Z A;  4KOX A;  4P4D A;  3R95 A;  4CGO A;  3CZX A;  2WPW A;  3JTK A;  1X12 A;  3F5B A;  4L8A A;  4X2T A;  2QEC A;  3NFZ A;  4KS9 A;  1XFO A;  2F5I A;  3FF3 A;  4L89 A;  2K5T A;  1S7F A;  3RZA A;  3NH8 A;  3IJ3 A;  4KSF A;  1LAM A;  2ODF A;  4H6U A;  4MFK A;  4MJ8 A;  4WWV A;  4O23 A;  4OC5 A;  3S9M A;  1TXR A;  4A39 A;  4Q7A A;  4YFJ A;  2IMO A;  3E0K A;  5J8F A;  3PBE A;  1CX8 A;  4CYO A;  5IB0 A;  4B10 A;  1Z9U A;  4UWI A;  4EWT A;  1ZLI A;  3TOA A;  1HEE A;  2BUE A;  2BL1 A;  4AG9 A;  4KVM E;  5H86 A;  4BD9 A;  3G8W A;  1Y7R A;  4UCM A;  2OH1 A;  5G1Z A;  4CGN A;  4NJR A;  4DJL A;  1S7N A;  2YNC A;  2A4N A;  5AGE A;  3TTH A;  2ZXV A;  4U9Z A;  3S9L A;  4CRZ B;  2CTB A;  4NGS A;  4Z65 A;  2FS5 A;  1QST A;  1I21 A;  1RO5 A;  2WSA A;  3IGR A;  4OP4 A;  3S6G A;  4UIA A;  1FY7 A;  5K8N A;  2GRE A;  4R8F A;  3PB8 X;  2Y0M A;  3PFO A;  4Q38 A;  3R9F A;  5EMI A;  1Y0Y A;  4HNX B;  3KGQ A;  2OZU A;  3D2M A;  4B11 A;  2OU2 A;  1KUY A;  1Z8W A;  3D7H A;  3FB3 A;  2ZEP A;  1RXT A;  2G0B A;  5F49 A;  2YNE A;  1NSA A;  5A27 A;  2P0W A;  4FD4 A;  3CXP A;  3D7G A;  3G3S A;  3DR6 A;  4NGR A;  2ZOG A;  5EC4 A;  4LQ6 A;  1Y7E A;  3RNZ A;  1S5K A;  2QIR A;  4FAI A;  4ZGY B;  3TE4 A;  4ZX8 A;  5JH9 A;  4KOR A;  3B8G A;  2JBK A;  2HQY A;  3LWU A;  1IB1 E;  4TWE A;  5KTA A;  3B35 A;  5BWA B;  5LRJ A;  1VHE A;  3IU1 A;  2EUI A;  1B6B A;  2CXA A;  2J8M A;  4OC4 A;  4RI1 A;  2OZG A;  1MJ9 A;  3JVN A;  4LUA A;  3K9T A;  3KR4 A;  2CIJ A;  1XMB A;  4YWY A;  2I00 A;  2PIY A;  3UY5 A;  1TF8 A;  1Q2Y A;  3JUW A;  2AE6 A;  2FE7 A;  3VAT A;  5JM6 A;  1Z8L A;  5IB9 A;  5K8O A;  1HDQ A;  3LMS A;  4C2X A;  4F9U A;  4B5P A;  1YR0 A;  2PIZ A;  3F0A A;  4UEF A;  2O28 A;  4B6Z A;  1P0H A;  2G9D A;  2PJ9 A;  1LFW A;  3IIB A;  1IID A;  3FIX A;  3VH9 A;  5I4M A;  4U9Y A;  1XMT A;  2CY2 A;  4K30 A;  1XOV A;  1WWZ A;  4CYQ A;  2Z3K A;  1ELL P;  1AUG A;  2VL1 A;  3IEH A;  2ZEH A;  1IU8 A;  1VKC A;  4JXQ A;  3HLP A;  7CPA A;  1DTD A;  4ZI6 A;  2PR1 A;  1VGY A;  4KSI A;  2RC4 A;  4OAE A;  3A9L A;  4MHD A;  4C68 A;  2VQY A;  2ZW6 A;  4II9 A;  1L0C A;  1LRZ A;  4XNH C;  5CNP A;  2HB6 A;  1ARM A;  2I3C A;  4MFQ A;  4MCQ A;  2DPT A;  3IWG A;  4UF4 A;  4QVT A;  4GXH A;  2ZEO A;  3QNV A;  4UFV A;  2PR8 A;  2VI7 A;  3FYN A;  2Q7B A;  5F47 A;  1M4I A;  1VHO A;  1U6M A;  2VXK A;  2XEJ A;  5G22 A;  4NXY A;  1LAN A;  4Y49 C;  2FIA A;  4KOS A;  4FBE A;  4X3R A;  3BI1 A;  3PFE A;  2QML A;  2C27 A;  3VWD A;  4CS0 B;  2P6F A;  5I0C A;  2O53 A;  3K2K A;  1QSN A;  1UFH A;  1VHS A;  1LAP A;  1CBX A;  2CNM A;  2VZZ A;  4OIW A;  2PE3 A;  3T9Y A;  3GYA A;  3TO9 A;  2ZEL A;  3NH4 A;  3B3S A;  3KI9 A;  4MFP A;  1Y0R A;  3RO0 A;  4OME A;  3IC1 A;  3S9N A;  4MY3 A;  3H5Z A;  3PBB A;  5JGF A;  2VEZ A;  2ARH A;  2WZN A;  2I79 A;  2Q43 A;  3DR8 A;  4OC2 A;  6CPA A;  2BEI A;  4IUS A;  4KOU A;  1PYT B;  2V8D A;  1YQE A;  3GIU A;  3RYO A;  4CAE A;  1ZG9 A;  1GHE A;  4AXV A;  1I1D A;  2XEF A;  1H8L A;  5ELY A;  2JEV A;  4U5Y A;  4ZY2 A;  5F09 A;  4C2Z A;  5LRG A;  1AYE A;  1MJB A;  2AFM A;  5HVG A;  4YU9 A;  1AMP A;  4PXC A;  5DWN A;  2HV2 A;  4H89 A;  4WJB A;  4AVC A;  2BOA A;  4CGL A;  4XPL A;  3SHP A;  3QB8 A;  3SXO A;  4YRH A;  1CPS A;  2PRQ A;  5IV0 A;  2PSW A;  4JD6 A;  3EY5 A;  1ARL A;  3W6S A;  2AFZ A;  3MRU A;  4RS2 A;  3EFA A;  4JWP A;  2ZW7 A;  3GKR A;  4MHY A;  1QMU A;  4OAD A;  5K8M A;  3B3V A;  2HUZ A;  4I49 A;  1Z4E A;  2POK A;  3IU2 A;  2YNC C;  4ORF A;  5D8N A;  2B5G B;  2GU2 A;  4EVY A;  4C7I A;  2ZPA A;  2J9A A;  3D7F A;  3GB0 A;  5H84 A;  4F6A A;  3PP9 A;  2EK9 A;  5ISV A;  1BAV A;  1Y9K A;  2Z3L A;  3SJF A;  5J8C A;  2PJC A;  2XEI A;  3SXN A;  1MK4 A;  2PQ8 A;  2PVV A;  4KOV A;  4P45 A;  3ISZ A;  4ZX9 A;  4NGN A;  4A37 A;  1NE9 A;  1HDU A;  2GFQ A;  5HH1 A;  2YGW A;  3SJE A;  3TX8 A;  2EVN A;  4OC0 A;  1TKJ A;  1JWQ A;  2R1I A;  3NE7 A;  4ONU A;  1R3N A;  2JBJ A;  2B3U A;  1XEB A;  2PJ8 A;  4MHN A;  1S7L A;  4MCR A;  2YND A;  1YW6 A;  2H5M A;  2JDD A;  3DNS A;  3CPX A;  3FED A;  2BSW A;  3FVL A;  4KOT A;  2J8N A;  2ZEE A;  4XPK A;  2R7H A;  4JLY A;  2X7B A;  3FEC A;  3FXT A;  2PDO A;  3L2N A;  3BI0 A;  4XPD B;  1Z2L A;  4AVA A;  1IY7 A;  4MCS A;  2ANP A;  2C1C A;  1LOK A;  4B13 A;  3GUX A;  2PJ4 A;  3R9G A;  1BPM A;  5GCN A;  2GLJ A;  1OBR A;  4IAV A;  4PSW A;  1WK4 A;  1CP7 A;  4IK2 A;  4NCZ A;  3CPA A;  3TCV A;  4B12 A;  4CAX A;  4F8Z A;  5KTD A;  2NYQ A;  1TF9 A;  5E96 A;  4UEZ A;  2Q0Y A;  4KUB A;  2PC1 A;  3FNC A;  3MGD A;  3SJX A;  3S6K A;  1I12 A;  4PQA A;  2OOT A;  8CPA A;  1Q7L A;  3NE8 A;  4P4F A;  4JZ0 A;  2ABZ A;  3SJG A;  2C6P A;  3FJU A;  4KSA A;  4BBH A;  1YW4 A;  3DSB A;  3TFY A;  1QSM A;  2DXQ A;  2AFW A;  4P4B A;  4OKO A;  5CPA A;  1F2O A;  3LAC A;  4E8O A;  2PJ0 A;  1XBU A;  2IJZ A;  4G1P A;  4PK3 A;  4HKF A;  5F48 A;  1IOI A;  2GIV A;  3ZJ0 A;  4ZYQ A;  1GYT A;  5G21 A;  4OC3 A;  1YLO A;  4EFD A;  1F2P A;  2REF A;  3D2P A;  4MMO A;  3LD2 A;  3DLJ A;  2G3A A;  1BO4 A;  3EXN A;  4JXR A;  3K9U A;  1R57 A;  3D68 A;  1PUA A;  1M44 A;  1YLE A;  2DF5 A;  2PJ1 A;  4CAW A;  4ZY1 A;  2B58 A;  2BO9 A;  1KUX A;  4NGM A;  1A2Z A;  3SI0 A;  4MHZ A;  4BIN A;  1XJO A;  2V8H A;  3D66 A;  3N7Z A;  4GM5 A;  4BMH A;  3D7D A;  1YVO A;  4W9Y A;  4NSQ A;  3ZZI A;  1TKF A;  4KUA A;  4OID A;  2B5G A;  2CNS A;  4CGM A;  2DEA A;  1BLL E;  2JLM A;  2B3V A;  2EWB A;  3R9E A;  2B4D A;  4CAF A;  1XRY A;  4UA3 A;  4MBU A;  2PJB A;  5LYD A;  4JYW A;  1XIX A;  4JJX A;  1BPN A;  1XF8 A;  2C6G A; 
#chains in the Genus database with same CATH homology
 3GY9 A;  4A2Z A;  3CXS A;  5C82 A;  2Z0Z A;  2J8R A;  2CNT A;  4MFL A;  2R8V A;  4B14 A;  2Z3O A;  3R96 A;  5A28 A;  4XPD C;  2FL4 A;  4B5O A;  1BOB A;  4FD7 A;  4KOW A;  2ATR A;  5KTC A;  4LX9 A;  3W6X A;  1M4G A;  3CXQ A;  1K4J A;  4KVX A;  4PV6 A;  4R57 A;  1S7K A;  1P4N A;  1S3Z A;  5EBV A;  4UCP A;  1J4J A;  3S6F A;  1Y9W A;  2FCK A;  3TT2 A;  4AG7 A;  5F46 A;  1KZF A;  2Z3P A;  3I3G A;  4E0A A;  5FVJ A;  3VWE A;  5AG5 A;  2VZY A;  5AG7 A;  4A32 A;  1V0C A;  3OWC A;  4C7H A;  2Z11 A;  3FRM A;  3P2F A;  4QBJ A;  1ON0 A;  2PRB A;  4UWJ A;  2IL4 A;  1TIQ A;  1IIC A;  1CM0 A;  1M1D A;  5C88 A;  2B4D B;  4HNW B;  5JQ4 A;  2ZW4 A;  2Z10 A;  3D8P A;  5G20 A;  2R98 A;  3EC4 A;  1XE4 A;  4R87 A;  4A31 A;  2Q04 A;  3EO4 A;  4M3S A;  4XNH B;  3PZJ A;  4C2Y A;  4KLW A;  2WPX A;  4ZBG A;  2JDC A;  4IF5 A;  4Q36 A;  3QAH A;  4CAV A;  5IX3 A;  2G3T A;  1YGH A;  1SQH A;  3PGP A;  2AJ6 A;  4KZT A;  4MFZ A;  4PSX A;  3TOB A;  1PU9 A;  4Y49 B;  1KUV A;  2P6E A;  1Z4R A;  2Q4V A;  2ZW5 A;  5HMN A;  3V8I A;  4F0X A;  4R3K A;  3C26 A;  3IWE A;  2Q44 A;  4R9M A;  3T90 A;  4PK2 A;  4CYP A;  4DNC A;  1Q2D A;  4J3G A;  4OLL A;  1IYL A;  3TO6 A;  4AVB A;  2D4O A;  4UBR A;  2KCW A;  2GAN A;  3BJ7 A;  4AB7 A;  2WUU A;  1YRE A;  4X5K A;  1IYK A;  3TO7 A;  3H4Q A;  4M85 A;  4A30 A;  4KVO E;  3R1K A;  4UCN A;  4MFJ A;  3WR7 A;  2FSR A;  2D4P A;  4YGO A;  4CGP A;  1B87 A;  4CYN A;  4KOY A;  2DPS A;  5AG4 A;  1OZP A;  3BJ8 A;  4QUS A;  1QSO A;  2FIW A;  2B4B A;  3S6H A;  4UFW A;  4NF1 A;  4NEX A;  3W91 A;  2Z3N A;  2FXF A;  1YX0 A;  3DDD A;  2FT0 A;  3D3S A;  4MY0 A;  1YVK A;  4F0Y A;  4E2A A;  2OB0 A;  1YK3 A;  4CRY B;  4A33 A;  2OZH A;  3BLN A;  4GS4 A;  2NMT A;  4QC6 A;  4A95 A;  5JPH A;  1ZO0 A;  2REE A;  1N71 A;  2VBQ A;  4R3L A;  3I9S A;  3KKW A;  3LOD A;  1NSL A;  2Z3M A;  4FD5 A;  1QSR A;  4KLV A;  3F8K A;  5AG6 A;  1NMT A;  2GE3 A;  1M4D A;  4H6Z A;  1CJW A;  4UFX A;  1S60 A;  1Q2C A;  4HNY B;  3P2H A;  4FD6 A;  4QB9 A;  5DWM A;  4MI4 A;  4B5P B;  3FBU A;  1MJA A;  2P6G A;  4KOX A;  2Q4Y A;  3R95 A;  4CGO A;  3JTK A;  2WPW A;  3F5B A;  4L8A A;  2QEC A;  4KS9 A;  2F5I A;  4L89 A;  2K5T A;  1S7F A;  4KSF A;  4H6U A;  4MFK A;  4MJ8 A;  4YFJ A;  5J8F A;  3E0K A;  5IB0 A;  4CYO A;  4B10 A;  1Z9U A;  4UWI A;  3TOA A;  2BUE A;  2BL1 A;  4AG9 A;  4KVM E;  5H86 A;  3G8W A;  1Y7R A;  4UCM A;  2OH1 A;  5G1Z A;  4CGN A;  1S7N A;  2YNC A;  2A4N A;  5AGE A;  3TTH A;  2ZXV A;  4U9Z A;  4CRZ B;  2FS5 A;  1QST A;  1I21 A;  1RO5 A;  2WSA A;  3IGR A;  3S6G A;  1FY7 A;  2Y0M A;  4Q38 A;  3R9F A;  4HNX B;  2OZU A;  3D2M A;  4B11 A;  2OU2 A;  1KUY A;  3FB3 A;  1RXT A;  2G0B A;  5F49 A;  2YNE A;  5A27 A;  2P0W A;  4FD4 A;  3CXP A;  3G3S A;  3DR6 A;  5EC4 A;  1S5K A;  2QIR A;  4ZGY B;  3TE4 A;  4KOR A;  3B8G A;  2HQY A;  1IB1 E;  5KTA A;  5BWA B;  3IU1 A;  2EUI A;  1B6B A;  2CXA A;  2J8M A;  4RI1 A;  1MJ9 A;  2OZG A;  3JVN A;  4LUA A;  3UY5 A;  2I00 A;  3JUW A;  1Q2Y A;  2AE6 A;  2FE7 A;  4C2X A;  4B5P A;  1YR0 A;  3F0A A;  2O28 A;  1P0H A;  1IID A;  3FIX A;  4U9Y A;  1XMT A;  2CY2 A;  4K30 A;  1WWZ A;  4CYQ A;  2Z3K A;  4JXQ A;  1VKC A;  2PR1 A;  2RC4 A;  4OAE A;  3A9L A;  4MHD A;  4C68 A;  2VQY A;  2ZW6 A;  4II9 A;  1L0C A;  1LRZ A;  4XNH C;  5CNP A;  4MFQ A;  2DPT A;  3IWG A;  4QVT A;  4UFV A;  2PR8 A;  2VI7 A;  3FYN A;  2Q7B A;  5F47 A;  1M4I A;  1U6M A;  2VXK A;  5G22 A;  4NXY A;  4Y49 C;  2FIA A;  4KOS A;  4CS0 B;  3VWD A;  2QML A;  2C27 A;  2P6F A;  5I0C A;  1QSN A;  1VHS A;  1UFH A;  2VZZ A;  3T9Y A;  2CNM A;  3TO9 A;  3GYA A;  4MFP A;  4MY3 A;  3H5Z A;  2VEZ A;  2ARH A;  2I79 A;  3DR8 A;  2BEI A;  4IUS A;  4KOU A;  3RYO A;  4CAE A;  1GHE A;  1I1D A;  2JEV A;  4U5Y A;  4C2Z A;  1MJB A;  5DWN A;  2HV2 A;  4H89 A;  4AVC A;  4CGL A;  4XPL A;  3SHP A;  3QB8 A;  3SXO A;  4YRH A;  5IV0 A;  2PSW A;  4JD6 A;  3EY5 A;  3W6S A;  4RS2 A;  3EFA A;  4JWP A;  2ZW7 A;  3GKR A;  4OAD A;  2HUZ A;  4I49 A;  1Z4E A;  3IU2 A;  2YNC C;  4ORF A;  2B5G B;  4EVY A;  4C7I A;  2ZPA A;  4F6A A;  5H84 A;  3PP9 A;  5ISV A;  1Y9K A;  2Z3L A;  5J8C A;  3SXN A;  1MK4 A;  2PQ8 A;  4KOV A;  1NE9 A;  5HH1 A;  2YGW A;  2EVN A;  3NE7 A;  2R1I A;  4ONU A;  2B3U A;  1XEB A;  1S7L A;  2YND A;  2H5M A;  2JDD A;  3DNS A;  2BSW A;  4KOT A;  2J8N A;  4XPK A;  2R7H A;  4JLY A;  2X7B A;  3FXT A;  2PDO A;  4XPD B;  4AVA A;  4B13 A;  3R9G A;  5GCN A;  4PSW A;  1WK4 A;  4B12 A;  4NCZ A;  3TCV A;  4CAX A;  5KTD A;  5E96 A;  2Q0Y A;  4KUB A;  2PC1 A;  3FNC A;  3MGD A;  3S6K A;  1I12 A;  4BBH A;  3TFY A;  4KSA A;  3DSB A;  1QSM A;  2DXQ A;  4E8O A;  4PK3 A;  3ZJ0 A;  4HKF A;  5F48 A;  2GIV A;  5G21 A;  2REF A;  3D2P A;  3LD2 A;  2G3A A;  1BO4 A;  3EXN A;  4JXR A;  3K9U A;  1R57 A;  1PUA A;  1M44 A;  1YLE A;  4CAW A;  2B58 A;  1KUX A;  3N7Z A;  4BMH A;  1YVO A;  4NSQ A;  3ZZI A;  4KUA A;  2B5G A;  2CNS A;  4CGM A;  2JLM A;  2B3V A;  3R9E A;  2B4D A;  4CAF A;  4UA3 A;  4MBU A;  1XIX A;  4JJX A;  1XF8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...