4PSWA

Crystal structure of histone acetyltransferase complex
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
316
structure length
316
Chain Sequence
DFKPETWTSSANEALRVSIVGENAVQFSPLFTYPIYGDSEKIYGYKDLIIHLAFDSVTFKPYVNVKYSAKLGDDNIVDVEKKLLSFLPKDDVIVRDEAKWVDCFAEERKTHNLSDVFEKVSEYSLNGEEFVVYKSSLVDDFARRMHRRVQIFSLLFIEAANYIDETDPSWQIYWLLNKKTKELIGFVTTYKYWHYLGAKSFDEDIDKKFRAKISQFLIFPPYQNKGHGSCLYEAIIQSWLEDKSITEITVEDPNEAFDDLRDRNDIQRLRKLGYDAVFQKHSDLSDEFLESSRKSLKLEERQFNRLVEMLLLLNNS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone acetyltransferase type B catalytic subunit
publication title Hat2p recognizes the histone H3 tail to specify the acetylation of the newly synthesized H3/H4 heterodimer by the Hat1p/Hat2p complex
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transferase
total genus 101
structure length 316
sequence length 316
ec nomenclature ec 2.3.1.48: Histone acetyltransferase.
pdb deposition date 2014-03-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
A PF10394 Hat1_N Histone acetyl transferase HAT1 N-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.390 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4pswA03
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4pswA02
3.90.360.10 Alpha Beta Alpha-Beta Complex Histone Acetyltransferase; domain 1 Histone acetyl transferase 1 (HAT1), N-terminal domain 4pswA01
1TIQA 1S7FA 5F47A 1I12A 5H84A 2WPWA 2G3TA 4AB7A 3DR6A 4PV6A 3LODA 3DR8A 1QSOA 4OAEA 4FD4A 2R7HA 4H89A 4ORFA 1V0CA 4L8AA 3FB3A 2G3AA 4FD6A 4XNHB 5KTAA 3FNCA 2FSRA 1BOBA 4BMHA 1Q2CA 4UA3A 4PSXA 4LX9A 1Q2YA 3VWDA 4IUSA 1M4DA 3JUWA 1YK3A 1B87A 4CRZB 1IICA 3B8GA 2IL4A 4OLLA 1QSMA 4YRHA 2P6GA 1XMTA 1UFHA 5HMNA 2B4BA 3QB8A 2VQYA 4JXRA 1WK4A 1KZFA 4HNWB 3SXNA 2VBQA 3TT2A 3P2HA 1Y9WA 4AG9A 4CAXA 4M3SA 2H5MA 2GE3A 3F8KA 4YFJA 3TOAA 4KORA 1YGHA 4JLYA 1QSRA 3T90A 2J8RA 3GKRA 2EUIA 1VKCA 2B5GB 2WPXA 4DNCA 4XPDB 4E0AA 3IGRA 3EO4A 1IB1E 1P4NA 3K9UA 4I49A 4J3GA 2PDOA 4QUSA 1PU9A 2Q04A 1RXTA 2B58A 4RI1A 3TO7A 2GANA 1J4JA 3ZJ0A 3T9YA 3NE7A 3TO9A 4AG7A 4L89A 1YVKA 4AVCA 1QSTA 2I79A 2Q0YA 1IIDA 2F5IA 1R57A 4E8OA 4CAWA 4JD6A 2OU2A 2VZZA 4JWPA 2HUZA 3G8WA 4B5PB 4R57A 1KUYA 4U9YA 2B3UA 1RO5A 3DSBA 3C26A 3EC4A 4X5KA 4XNHC 3S6HA 5GCNA 3SXOA 4EVYA 3E0KA 2REFA 2JDCA 2A4NA 1Q2DA 2ZW7A 3R96A 3W6XA 3BJ8A 4AVAA 3CXSA 4NCZA 4NEXA 1LRZA 4E2AA 5E96A 2JDDA 3FIXA 1M4IA 5HH1A 3S6FA 4KVOE 1QSNA 1OZPA 3GY9A 2QECA 1S5KA 4UWJA 4R3LA 3ZZIA 3R9FA 2ZW5A 3EXNA 1N71A 2K5TA 2R98A 3PP9A 4JJXA 2Z0ZA 5DWNA 3UY5A 2CNSA 2QIRA 3DDDA 1S60A 4UBRA 1M4GA 2R8VA 2FT0A 3FYNA 2BEIA 3H4QA 4KUBA 2FXFA 2ZW6A 4XPDC 1WWZA 2REEA 2D4PA 5H86A 2J8MA 2Q7BA 3PZJA 4QBJA 2FCKA 2BUEA 1YR0A 2ARHA 4AVBA 5IB0A 2OB0A 4QC6A 1CM0A 3QAHA 5ISVA 2EVNA 1XIXA 4ZBGA 2AE6A 3TCVA 2HV2A 3S6KA 2JEVA 4KOSA 1IYLA 2OH1A 2KCWA 2FS5A 1L0CA 2Z10A 1NMTA 4FD7A 2FIAA 3V8IA 2CNTA 4HNXB 3I9SA 1M44A 4HKFA 5EBVA 3JVNA 4QVTA 2PQ8A 5C88A 2ZW4A 3IWGA 5EC4A 4KOXA 3D2PA 2B4DA 2OZGA 4UWIA 4R3KA 2P0WA 2FIWA 5F46A 4MI4A 2PRBA 4LUAA 4Y49B 2VZYA 1P0HA 2B4DB 3N7ZA 4MBUA 5F48A 3TTHA 1S3ZA 3D8PA 3EFAA 4MY3A 3EY5A 1SQHA 4PK2A 2ZPAA 4CAVA 2Q44A 2RC4A 4KOTA 1YX0A 1Z4RA 1XEBA 2Q4VA 4B5OA 1VHSA 3R9GA 3I3GA 4NF1A 1NE9A 2Q4YA 1CJWA 2BL1A 5CNPA 2DXQA 3TOBA 1Y7RA 1PUAA 3DNSA 2JLMA 4KUAA 5J8CA 1Z9UA 4XPLA 2HQYA 4KOUA 4YGOA 4NSQA 3GYAA 2QMLA 4ONUA 2B3VA 1BO4A 4KZTA 2C27A 3MGDA 2BSWA 3BLNA 3LD2A 4JXQA 1YLEA 2FL4A 1Y9KA 4KVME 1K4JA 1ON0A 2O28A 3WR7A 3TE4A 4II9A 2P6FA 3P2FA 4R9MA 1S7LA 3SHPA 5FVJA 5JQ4A 3VWEA 2VXKA 5J8FA 4F6AA 1MJAA 3F0AA 1YREA 5IV0A 2GIVA 2PR1A 1I1DA 1MJ9A 2I00A 3RYOA 4XPKA 2PC1A 4MHDA 1XF8A 1S7KA 3KKWA 3CXPA 3R1KA 1B6BA 3F5BA 4K30A 1GHEA 2CY2A 4NXYA 4MY0A 1Z4EA 1U6MA 1IYKA 4KVXA 1KUVA 4RS2A 1NSLA 3CXQA 3TO6A 2ATRA 2R1IA 4PK3A 3S6GA 3TFYA 3BJ7A 3R9EA 4H6ZA 5DWMA 4CRYB 2VEZA 2PSWA 2B5GA 3W6SA 2Y0MA 4Y49C 2D4OA 4KOWA 5I0CA 4KLWA 4M85A 3R95A 4U9ZA 2G0BA 2OZHA 3G3SA 4R87A 1YVOA 4IF5A 1MK4A 2Z11A 4PSWA 3FBUA 4U5YA 2FE7A 2PR8A 2J8NA 3W91A 2ZXVA 2CNMA 4F0YA 5KTDA 4MJ8A 2VI7A 4KLVA 1MJBA 4OADA 1XE4A 2OZUA 4KOVA 2NMTA 1I21A 4KOYA 5KTCA 4CS0B 4GS4A 4FD5A 4B5PA 4HNYB 1M1DA 3D3SA 5IX3A 3FXTA 2P6EA 5JPHA 1S7NA 3FRMA 2AJ6A 1FY7A 3PGPA 4H6UA 3OWCA 4QB9A 5C82A 1KUXA 2X7BA 3D2MA 5F49A
chains in the Genus database with same CATH superfamily
1MMGA 1XSXA 2DDBA 3DU5A 1NK2P 2OTLI 1HW1A 1I12A 4LLLA 4EM2A 3OS1A 2RNGA 3CJRB 1C0WA 2GLFA 2ESHA 2WPWA 4AUXA 1LAPA 3TL4X 5L3FA 1BC7C 4OC5A 2DOAA 3GO5A 4A3JJ 1X1DA 4RMNA 3HL2A 1QSOA 2ZMEA 1HDDC 2MBFA 4FBEA 4FD4A 3K2ZA 5EG0B 5B3SH 3FB3A 2YNCA 2M4KA 2DODA 1JJ8C 2POKA 4QLCU 1Z8XA 3A01B 2GAUA 1B8IB 3JTKA 1BOBA 2EFQA 3HRSA 5DYMA 4Z65A 2Z99A 3BTIA 1ZG8A 4MCQA 3I3LA 2LK2A 4GM5A 5L3BA 1VQKI 3VWDA 3I55I 2E60A 3CQZJ 1AMPA 1B87A 3PBEA 4CRZB 4P4JA 2HYGD 4GRIA 1FOWA 4AVZA 1UFHA 4XLEA 1GYTA 2XB0X 3EUKL 1CPXA 1ODDA 3BTLA 4IO9F 4QSHA 4JXRA 4JX4A 1CX8A 3F6VA 3F22A 2AO9A 3W2VA 4MFQA 2F5CA 2GOMA 4PJLA 3JRGA 2QJ8A 2WSAA 2WAFA 2TDXA 4S0HB 4Y3OA 3SXNA 4HNWB 5CBMA 3MN8A 1K83J 5FGMA 3DV8A 4AG9A 1TQPA 2WB1N 5DTDA 4M3SA 4BL0B 4HRIA 4MFPA 3OMYA 3OYIA 2GE3A 4LMYA 2Z3YA 1CP6A 2DMUA 2Y0SN 4HAMA 5K7HA 2R93J 1YQEA 3F8KA 2COMA 4W1UA 1F5TA 4YFJA 2BW3A 3R6SA 3E6MA 3K1NA 4MIMA 4KORA 4A2ZA 5AONA 2CRGA 4XR6A 2LP0A 4HDUA 2O53A 2ZEHA 2PN6A 2H1KA 3T90A 2A68F 1ON1A 1CGPA 4PXCA 3KP7A 2HOTA 3M1CA 2R7WA 3AG1H 1TBXA 2R5ZB 2WPXA 1YOVB 2JSPA 4XPDB 1K6YA 3ASOH 3EO4A 4F9VA 2GREA 4HDVA 3K9UA 4I49A 2Q2EB 1AKHA 2IVMA 2YGWA 2K86A 4ZDLA 4NUBA 3WTUC 2EFNA 5GAGJ 3H0DA 1B72B 4C7HA 1KQ9A 1Q7LA 2LRDA 3S16J 2LKSA 2VBWA 1V5FA 1Z6RA 3QPTA 4A12A 2BVMA 5ICEA 2R4GA 4C3JJ 1RXTA 2IGNA 5DUKA 4EVIA 1MDMA 1N78A 2FE3A 2B58A 1I50J 3F3XA 1X58A 2MC4A 4F91B 5D4SA 5F6FA 2FA5A 3HOTA 1LVAA 1UJ8A 2F6CA 2LKXA 3LACA 3BCAA 4M3FA 3M8FA 1QZEA 2QVOA 4XRMA 3NE7A 2JQ7A 1YVKA 4AVCA 3PSFA 1HSJA 4LD5A 5EZHA 4LG0A 3U9GA 2Z9OA 2I79A 5D8NA 2CFOA 3AKZA 3PB4X 2W25A 4PXBA 3G3ZA 4XK4A 1MNEA 1IIDA 1YLOA 3KQXA 4OU0A 3HBLA 3BG9A 3TMOA 3ZR8X 4E8OA 2KZGA 1Y0NA 4CAWA 4YWYA 2NS8A 4NGRA 1R5HA 3K1MA 2IW5A 2M7AA 2IPQX 4HYEA 5H6RA 5HVQC 3FNCA 3G8WA 1MMAA 2F5VA 2OBPA 5AG7A 1OYIA 2DEAA 2XSJC 4AYBN 1FOYA 1KUYA 4U9YA 2B3UA 4L0YB 4XONA 2E2IJ 4XLCA 2TCTA 4QWQA 2GXAA 2FBKA 3I4NJ 3NH4A 4M9SA 2ETHA 2KQRA 5D6EA 3HG9A 3SXOA 2E5NA 4RLFA 3S14J 3BQYA 4AIKA 4Q48A 2GU2A 2PRQA 4C2YA 5A2QK 5EDNA 2DQLA 2WADA 3R4KA 3BJ8A 1YYVA 4E7IA 3I1UA 3CXSA 4FISA 1LRZA 3ZN0A 1D5YA 4E2AA 2DT7B 2VKDA 3ZQHA 1LNWA 2LLKA 5D5XB 2XPVA 2JDDA 2WAEA 1T2KA 3OL4A 3T8TA 4KVOE 3QU6A 2R3SA 1BPNA 2ZMEB 3DPLC 1S5KA 2W7NA 2ZEEA 4NGTA 2PVVA 3CJNA 4UWJA 3WU0A 4UHTA 2VPLA 3EXNA 4KDPA 2RDPA 3RZOJ 1N71A 1SC7A 3D4UA 3MD2A 4XKVA 1SMTA 2VXZA 3I53A 1ZG1A 3LSPA 5LRRA 4MCSA 3TKYA 3EUHC 4CAFA 1OYWA 2UV1A 2UUZA 3UNGC 5L3EA 1XBUA 4TV7A 1V5GA 1ONVA 2M30A 4DYRA 3SZTA 2YR2A 1GLNA 4IHMA 4UBRA 2Z3MA 3DEUA 2FT0A 1KU9A 3PBBA 3DBLB 1LKXA 1S9HA 3NAUA 2EH3A 1JJ6C 2ZSIB 2VOPA 2BEIA 4BJ6C 3H4QA 1YW9A 3Q5FA 2CFXA 3H1CA 1WWZA 4UV9A 5HS8A 3QPSA 1IY7A 2HOEA 1TW3A 3EDPA 1J2XA 2HFHA 4CDGA 2FJ1A 4QPOA 3F8MA 4C3HJ 5JH9A 3OIQA 2FCKA 5FKKA 2DO7A 3DLAA 2P6SA 3M4OJ 3SJMA 3CCLI 5IY5H 4QC6A 2Y0SA 3IWFA 3SFZA 5E20A 5ISVA 1QVUA 2HVSA 2AE6A 2BW3B 3OIPA 3S6KA 3TCVA 4BXUA 4P44A 3ZRGA 4H2KA 4KFCA 1U9OA 5F1RA 4MTDA 3B3WA 2V9KA 4Y13A 2JBJA 2KIQA 2OH1A 3FK7A 2QKLB 1GXPA 2Z3OA 5LYFA 4KJZA 1DPRA 2XDVA 3E6DA 1Y8QB 3HIFA 3ROUA 2HYFA 3OYNA 3C18A 4OIOF 4FD7A 3TX8A 4AWXB 1TKFA 1CBXA 4R8HA 1XJOA 2VN2A 2IA0A 3ESWB 5FD6A 3RCOA 1WJDA 1ORKA 1FEXA 3I9SA 2JUGA 1TLHB 1M44A 3CLQA 2K5CA 3SJEA 1V54H 1K7AA 3JVNA 1OQYA 5A2QZ 2VUMJ 2PQ8A 3T8WA 3JSPA 2XGEA 4BQNA 2ZW4A 3O8HA 4B10A 4A31A 3C1DA 1MDMB 2RV8A 2X85A 5EC4A 2A69F 3D2PA 1LJ9A 3TC8A 3LA3A 2CWEA 3RPUD 3U1DA 4BHPA 1LAMA 4ZJZA 4ZC3A 2FIWA 2D1VA 4EJWA 4MI4A 4MCPA 1BI0A 2YX7A 2PJ8A 1PCAA 1UFMA 2DYSH 3MKWB 2HEOA 1YO5C 2JWTA 2KHMA 1QHHD 4Y49B 3CCRI 1QZYA 2VZYA 4KMFA 4MBUA 2M8GX 4LG0B 4B44A 3D8PA 3RSNA 4D1QA 1L3LA 4D7NA 4XKCA 2EO8A 3OYJA 5AIQA 1A35A 4WXHA 3H8EA 5AG6A 1MBKA 5CJ9A 4EFDA 1R4NB 1EH6A 4WXCA 1A31A 1YX0A 1YJNI 1S7EA 1AYEA 5J1UA 2X4HA 2X9DA 4CCJA 2X0LA 3OY9A 1VQ4I 1YRNB 1SVLA 2GXGA 4GXOA 4IAVA 2YS9A 4BD9A 4ZYQA 4AYBA 3PRTA 1WQ2A 4A94A 4MFLA 3VH9A 4LJZF 3PFIA 2ZEOA 2Q4YA 2BL1A 5CNPA 3FVLA 4N4OB 4M3GA 1FYLA 3BLYA 2YPRA 3FEDA 5D5WB 5D5UB 4Y52J 2Q1ZB 1Y56A 4OOIA 5EEHA 5K8MA 3WGGA 2K27A 2XGCA 1ON2A 1PUAA 4E7HA 3GTJJ 4KSFA 3BG3A 1OCRH 3KP4A 5J8CA 4KS9A 4HF1A 1UG2A 4XPLA 3VPRA 4KOUA 4L9NA 4YGOA 3KP6A 1IV8A 1TWGJ 2QMLA 1TF9A 3HRUA 4RGSA 2ZELA 4C2TA 2E1CA 4L5IA 3HLPA 5E1WA 2C6GA 3P9CA 1FZPB 2PJ4A 1DU6A 1Z0XA 3KQZA 2HZDA 1YG2A 5AG5A 5HXDA 1U8RA 2BSWA 3CZ6A 3OR1C 3K7AJ 2FL4A 3M8JA 1Y9KA 3BJAA 2VQGA 2KFDA 1GV2A 3WE3A 3H8GA 2HXOA 2XEIA 3HRTA 4G8XA 1VHEA 4I98B 4KIGA 2P6FA 2FXAA 3P2FA 5ILSA 3I59A 2PVWA 1X4PA 2BXZA 2FX0A 2HYJA 2F5FA 3HYIA 3Q0VA 4J19A 3N4MA 5HOOA 2L7FP 2MD5A 3S1RJ 4NC8A 4GDFA 2LBFA 4CH7A 1MH3A 4NC6A 3V8KA 3CC2I 4LITA 2DFFA 2Z3NA 4F6AA 2ZJPF 2CU7A 2GIVA 2E2HJ 2BOAA 2GA1A 4II3A 5E79C 1I1DA 2PR1A 1MJ9A 2I00A 3RYOA 1KA8A 1BW5A 3GLJA 4HNUA 4KYWA 3FXMA 3HOZJ 3GLLA 1XCBA 3RJPA 4M73A 3S3OA 3ZMTA 3VATA 3AG4H 1AOYA 1TQMA 3F5BA 3FWEA 4K30A 4P4FA 5ICGA 4NXYA 2LC2A 1YX3A 1Z4EA 1HKQA 1L0OC 4IHYA 4ITVA 1IYKA 4KVXA 2AXLA 3N5FA 3TO6A 4DUKA 3MZYA 2R1IA 3NWSA 1ACIA 1X2NA 1XGOA 1KGSA 2X6OA 4HF2A 3H8FA 2K40A 4EM1A 4PK3A 3S6GA 1UHSA 3KLOA 4XM3A 1ZAOA 3DBRB 3GEZA 3BJ7A 3F8BA 4LK0F 2H8RA 2EBJA 5DWMA 3R9EA 2ZO4A 4J00A 4G6DA 2PSWA 2MLGA 5KAIC 2VI6A 1HC8A 3CCMI 2B5GA 4XLHA 2Y0MA 2DI3A 2QEXI 1P2FA 1TNSA 4UUTA 1BI3A 2P81A 1PUFA 1ETKA 3M07A 4KLWA 5LGTA 3T5XA 3U1KA 2AQEA 1YHQI 1I6XA 2VPRA 3CCJI 2X1EA 3E6BA 2R5YA 1FBSA 3HPGA 2TRTA 2XKOA 1LE8A 4CYPA 4IQJA 2MABA 3OWTA 4B12A 3H5AA 1KQ8A 2WUUA 2QM3A 4PSWA 3DKYA 3RDIA 4DGWB 1ETVA 1QMUA 3CP2A 2PEXA 2DPSA 4F55A 1P7IA 3F0CA 4LIUA 4A93J 4MQVA 3C7JA 3JAMZ 2EZKA 4FQGA 4RB1A 1RNLA 5JVGF 2V8GA 3D68A 4F0YA 3KP5A 3LSHA 2XAQA 4JP0A 4RAZA 2OR4A 5FROA 2I8DA 4NC7A 2DA6A 3HB9A 3V38A 3GTPJ 2CQQA 1IN8A 2CMPA 3SFIA 2ZC2A 3PNVA 3F9KA 2JPBA 2ID3A 4IZZA 1YITI 4M6YA 1HEEA 2DA2A 2G7UA 5D4RA 4UFVA 3SJFA 4E7KA 1UB9A 2DFEA 1T0FA 2AFXA 2HQ5A 3B02A 4C68A 2XPUA 4MMOA 1FIAA 5THWA 3FF5A 4U7BA 1X19A 4MQ9F 4II2A 1R7JA 4CCLA 4G9YA 5B1BH 3SDGA 2UWMA 1GHCA 1HOMA 3EETA 3PB7X 4HV5A 2PJ9A 4BDZA 4UVBA 4YFNF 3K2KA 1YIOA 4F92B 1BR1A 2IRFG 2Q0OA 3JRDA 1ETXA 1EA3A 2L0KA 4KN4X 1FY7A 5D8KB 1PP8F 3OWCA 1FJLA 2FD5A 2R0QC 4UEZA 3QAYA 2M45A 2X7BA 4BBRJ 1TIQA 4XICA 1FNOA 4QTRA 3HOUJ 2M4GA 2HPMA 3S8PA 3J7AO 3IAM2 2RNJA 1VNDA 1FNNA 2ME0A 2O3FA 3L2RA 2IS1A 3F23A 3SJXA 5EG0A 1FP2A 5FRNA 3LQQA 1H88C 2G3TA 2ZOGA 1TWFJ 4GGGA 3B35A 1TKJA 5GP9A 4AIJA 1MNMC 4HQEA 3RZAA 3AL0C 3PB9X 3D5LA 3H9JA 4OAEA 5HLHA 4OAYA 3A01A 1X2MA 2LREA 2NS0A 3HOWJ 3S1MJ 2FQ3A 1HBXG 2R7HA 2WYRA 4H89A 4ORFA 4W9YA 1MBEA 3E1SA 3S9LA 3K2AA 1ZKGA 4BXFA 4JOMA 2A61A 1CF7A 4UNOA 4ZH4F 1LCPA 3HPHA 4WJBA 1QA6A 2FSRA 5G1ZA 4BBSJ 2M5WA 4HQMA 4E6KG 3HRMA 3WABA 3ECHA 2H27A 4MRIA 4PSXA 1JWQA 5IT9K 4RGXA 4PJJA 4G7OF 4EWTA 3HKZN 1ERDA 1Q2YA 1M4DA 2DAOA 2PJ5A 3LMSA 5CLSA 3VYRB 3JUWA 1YK3A 5I4MA 6PAXA 3E7LA 5FB2A 5JI6A 3PSIA 1WH7A 3MN2A 5KK1A 1K4TA 2IL4A 4OLLA 3CZXA 3PL8A 2P6GA 4LQ6A 1XMTA 5GAHJ 2UXXA 3LFKA 3PNTA 4NQWB 3VODA 1X3ZB 2LTPA 4OMYA 2VQYA 2XB5A 3RKWA 4FETA 4MHZA 5ILVA 2HOAA 3BR0A 1JKQC 1VQLI 3ONQA 5HDGA 3P9IA 4M9ZA 2FRHA 4BHCA 2VBQA 2W24A 3ISZA 2DK5A 3J80Z 4N9IA 2HDCA 1BAVA 3L09A 2CV2A 4OIDA 3RIRA 3BDDA 3QPLA 3HDDA 5K7FA 1MMSA 2XEFA 3KASA 3F21A 4MEXF 4LK1F 2VONA 3OOPA 4Y15A 2OC6A 3GFIA 1REPC 2D5VA 1T33A 2W00A 2R5ZA 3S1NJ 2DLLA 4F7ZA 1NSAA 4IEJA 2WTEA 1R23A 2ECBA 3DU6A 3CDLA 2K9MA 1VGYA 4XSZF 1BI2A 2AFZA 2EUIA 1B72A 3G71I 3B7IA 3CPAA 1HW2A 2JZYA 4ZTJA 4PPZA 2B5GB 1KYWA 4EJVA 1BW6A 5E1XA 3ULQB 2X51A 1NG7A 1GUUA 1NG6A 1UZCA 2L4MA 2R5YB 1XSVA 3LWFA 5LD2C 4LLNA 4UUVA 2NVQJ 2HU9A 1BJAA 2EK5A 2FEZA 1X4OA 1PU9A 4XIDA 4OC1A 3I9V2 5FFZA 1RKTA 2EPFA 1JE8A 3E5XA 4RI1A 3CCQI 3MWMA 3TO7A 3K69A 3IP4B 2CV1A 5CVRA 4ZTFA 2Z3LA 2M9HA 2WV1A 4IOCF 3I0TA 1ZELA 3H5NA 2BOLA 4XNFA 2J9AA 4ONWA 3TO9A 2P6TA 1SFUA 4MHGA 1ZLHA 1D0YA 3MEXA 2NOJB 1E3PA 2GZWA 2W57A 3V4GA 3RAMA 2E36A 1ZH5A 2DU9A 2EFOA 3LSJA 1QSTA 4BKXA 2M3AA 2HXIA 4BDYA 3FXJA 5E8GA 4J01A 2V8HA 2N8GA 4UVAA 5FKLA 2H1LA 2CG4A 1YJ9I 2ELKA 2XGXA 1EV7A 4CGMA 2F5IA 2W84A 4CSWA 2IGOA 1U5TB 2VASA 3ZQQA 1OCPA 1XMAA 2ODFA 2EIJH 1FTTA 1PJRA 2XC7A 1Y8RB 3OSGA 3QRFF 3OYHA 5DM6F 3IU2A 4C7IA 1ZLKA 2HTJA 5IT9Z 3B6AA 4CAEA 1XDUA 3QOEA 5CPAA 2B63J 1ZG3A 3HXLA 3BI0A 5CPRB 4I0AA 5J6XA 3CDHA 1D0ZA 3SEQA 2CF4A 6CPAA 1RO5A 2CYYA 1RIOH 3DSBA 3C26A 4D9JA 3S6HA 3CF2A 4WF2A 1CG2A 4NGQA 4EVYA 3GTOJ 3FXQA 1ETWA 1R5ID 4IL6C 2VODA 2REFA 3E0KA 4E4HA 2ZEPA 3AFHA 4C2MJ 1ZRDA 1G3WA 1TNTA 1ELLP 2I10A 3JRUA 4IX7A 1Q2DA 4F9UA 2ZW7A 3F8CA 3W6XA 3DLJA 3ZCOA 4AVAA 2OTJI 2PMZN 4HOBA 5HVFA 1K4SA 1I5ZA 5IYDJ 5E96A 2DQRA 4RB0A 3FBNB 1ULYA 1V55H 4JX5A 2K3FA 2LYCA 3CO7C 2XEJA 3PO3J 1FOKA 3H9GA 1M4IA 3FIXA 3QQAA 1W7PD 3IC1A 5HH1A 2LOOA 1OCZH 1RESA 1F2PA 2VC1A 4M71A 1DTDA 1QSNA 4UY8I 4OIWA 2QECA 4U87A 4OC2A 5GTIC 2VKHA 1BC8C 5CVJA 3BROA 5DEQA 1Y39A 2VXDA 1W5SA 2ISYA 3ZZIA 3M7GA 5GAEJ 1CF7B 2FOWA 1HQCA 1USTA 4R8FA 3TW7A 3IU1A 2KL4A 3KX2A 1ELMP 2L01A 2HC9A 2IQ6A 4Q38A 3HKZA 3ABUA 3L2VA 3QWLA 3WGIA 1FC3A 3MQ0A 1HW5A 5IPAA 2A6HF 2DA1A 5GPCA 5G20A 3Q3SA 1QPIA 1WVRA 1FT7A 4NJQA 4P10A 1MW7A 2R8VA 4OIQF 3KYLA 1X1BA 3HOYJ 1TTYA 2E5ZA 1EH7A 3GZ6A 3P9KA 2F8HA 1HDUA 1TC3C 3FEEA 4KUBA 2ZW6A 1G59A 1CQTA 4JX6A 1E0EA 2DPTA 4XPDC 3BG6A 2REEA 5J3LA 2OA4A 3OL3A 3WTTC 2D4PA 4HX8A 4X1EA 2DA4A 2J8MA 2Q7BA 3IC7A 3PZJA 4P4EA 3TDZC 1T6SA 2KRHA 3FXKA 5HDNA 2O6GE 4F8ZA 1YR0A 2XPWA 1ENHA 2EZHA 2RVCA 3EYYA 2V6CA 1YX5A 1U78A 4BY1J 1MGTA 4XSXF 3KR4A 4PGHA 1XMBA 1IRFA 2ZB9A 2XROA 3LA7A 4EJTA 3JTHA 2ACJA 1JTXA 2DMNA 2EVNA 3QYBA 2A5YB 4FE7A 1RR8C 1XIXA 4CCNA 4ZBGA 1B4AA 2V8VA 4ON0A 5HVHA 5JLWA 4NGMA 3SJGA 2F4IA 4PFOA 2XAJA 2V9VA 1IYLA 2FMYA 2JN6A 1HLVA 2JMWA 2LH9A 1U3EM 3NH8A 2KPMA 3AG2H 2KCWA 2VBXA 2Z10A 2K02A 1E17A 2DN0A 3DKXA 5IYCJ 1ZO0A 2A05A 2M7BA 5JGFA 5F64A 2CNTA 3G73A 3PQKA 3R0JA 3IH2A 2PJ7A 3K4JA 3CJQB 3E5UA 2Y2ZA 5LGNA 4FUUA 3NFZA 2ZKZA 4EM0B 4IOAF 2DMTA 2XASA 4A3KJ 3IWGA 5IB9A 4L18B 1Z6TA 3ZQFA 3PQJA 2GLOA 4KOXA 4PJNA 2HDDA 2OZGA 4MO7A 4P4IA 4R3KA 4UWIA 4HLYA 1TL8A 3VSKA 2L9SA 1FLIA 3KP2A 2Q4ZA 1SD4A 4M3EA 3S2DJ 2IAIA 2HR3A 3ZMSA 4ZDOA 2PRBA 2VJIA 2E1NA 3G3SA 1BBYA 2HZTA 3TGNA 3OSFA 3GMEA 3I4MJ 2A6EF 3TTHA 1JI8A 1YW4A 2LY2A 1HKTA 2XGDA 1YRNA 1E2XA 2L9NA 3DTIA 3K70C 4S04A 4LIVA 5F0HA 1K6OA 2DOEA 3FXUA 1DUXC 5K8PA 4KMUX 4OIPF 2AQFA 1W1WE 4KOTA 2Q4VA 1MNDA 2H09A 1YS7A 1XEBA 4B5OA 3CCUI 3DPUA 3M8EA 2EIKH 2NAZA 1GVDA 5B1AH 2JA8J 5JLXA 1ZG9A 1MIJA 7CPAA 3QOPA 5CVUA 3ZN1A 2ZMEC 5E3MA 3FH4A 3CJTB 3SDBA 4CCOA 5BS6A 3P5JA 2YNCC 1P4XA 2EZIA 2KKOA 3ECOA 3LMMA 3JRAA 1R3NA 2XAUA 1E3OC 1Z7UA 3HM5A 2ZEFA 1D1CA 1O7FA 2PIZA 2EILH 2K7LA 1PYTB 3FXRA 3WC6A 2P4WA 1KWMA 5K8OA 3ZQLA 4BINA 1IXSB 2BBYA 2PMZA 5LHHA 2R7SA 2YU3A 3B73A 2BHZA 2L7KA 3I5UA 2CTBA 5ILUA 2A07F 3MKZA 2RQPA 2ANPA 3D7FA 3JW4A 5DD4A 2ZFUA 2B3VA 1WGXA 2IMOA 1B59A 2C27A 3IWWA 2VOOA 2K4BA 1FX7A 3F6OA 4G6QA 1GXQA 1ZG7A 1OKRA 2QQAA 4V2FA 4H0EA 4A32A 4CGNA 1VI0A 3DQVC 3WG9A 2BYVE 1W5TA 2FMLA 5DM7F 1ON0A 1Y0UA 2PIYA 2E7XA 4MFKA 3MKLA 3K0LA 3FMRA 4O3MA 5JHFA 1BN5A 2HTSA 2XAGA 2H6BA 2Z5UA 3MVPA 1R49A 2QBYA 1H9TA 5HDKA 5CKTA 1TWCJ 2O0YA 4X0GA 1YW8A 3VWEA 1IN5A 1R6RA 1T08B 4F0XA 4UCMA 2FBIA 1J5YA 3RTRA 2OQRA 2I3CA 5K8NA 4JZ0A 4R6TA 1MJAA 2E1MC 4BU2A 5LFAA 5IV0A 2P5KA 2KZVA 4BHBA 1DGRM 2W85A 4P6YA 2WC2A 2KJCA 1OFCX 4FASD 2QUFA 2HDWA 4MHDA 4JYWA 3KKWA 1TT0A 2NXNB 1ZGAA 2PLYA 5E1ZB 1GDTA 2JK3A 3LOCA 3HOXJ 4MY0A 1U6MA 1A04A 3I58A 1KUVA 4RS2A 1NSLA 2HGCA 1PUEE 2ATRA 1FBQA 3ABLH 2DMQA 4PCQA 4FT8A 1BPMA 1LDKB 4F52A 5FKNA 3V7SA 3CCSI 1IDYA 2LG4A 3EPZA 2VEZA 3PIPF 4YFKF 3CCVI 4B43A 5DS9A 2ZJQF 4I76A 1VF9A 4RM3A 3PFEA 5FKMA 1QNTA 3GFJA 2QQ8A 4Y49C 2D4OA 2VJ5A 4CGOA 1W36C 1XDSA 3EUAA 1LFBA 2PCUA 1DQUA 1XMKA 1LFUP 3H92A 3R95A 3V8JA 3MZ8A 4RUHA 4MXUA 4A3MJ 1XSDA 1BIAA 2IGKA 4R87A 1I6HJ 4X8IA 4LB5A 3HZJA 4IF5A 4YELA 5EMIA 3S32A 3PEIA 2Y69H 4NHJA 1BA5A 2Z11A 2FBHA 2R7QA 2IA2A 2BZTA 3KL9A 3WC5A 2KP6A 2R7XA 5F0FA 2FU4A 3PNYA 3LAPA 2PR8A 4X6AJ 2FSWA 2J8NA 3I54A 4UCPA 4ASNA 1Z9CA 4A6EA 2CNMA 4A3GJ 4B14A 4R7MA 1WH5A 2ECCA 5CYVA 2C6PA 1IUFA 2VI7A 1Z7LA 4D7MA 3IH3A 4HX4A 1MJBA 4YRVA 4CXFA 3DLLF 2ZEGA 4UF4A 2IBDA 1ZARA 4DOZA 2EV5A 4ETSA 3WT4A 4E7ZA 1HCRA 1SD6A 2FUG2 2OZUA 4KOVA 4BJTA 2JUCA 4XL9A 3B6CA 1X12A 1Z8LA 2NMTA 3S1QJ 4CYOA 2NS7A 1FYKA 1M1EB 3MAJA 1I21A 4D0PA 1ZQ3P 4A37A 4CS0B 2XF6A 1DP7P 3FHZA 4ZY0A 5LBQA 3VYUB 1QQIA 4FD5A 3M3YJ 4P4DA 1TXRA 1YLFA 4G12A 4FHTA 3RYPA 5LLQA 5FLXK 4FWUA 3KZZA 3L2QA 4IPAA 2RREA 5IX3A 3KFWX 2MA3A 3B3VA 3GUXA 5JPHA 2DFIA 4A3EJ 1OISA 1OBRA 1S7NA 5AG4A 4MFDA 4TNUA 3D67A 2DF5A 1IUYA 4ZY1A 4A0YA 1JT0A 5BMZA 1IRXA 1IXRC 2GBYA 1ZR4A 3PJRA 4QB9A 4R1HA 1KUXA 4ZYEA 4L0ZB 5G22A 3JAMK 4AC0A 3D2MA 4CYNA 2MFZA 2ZOFA 5F47A 4OAZA 4DQ2A 5E18F 5C4JJ 1IV6A 3JR9A 3DTKA 4B09A 3V8LA 3H5RA 3R0AA 3ZGKA 3DKWA 1IN4A 1TP4A 4IVNA 4MHNA 1WFXA 2XEGA 3RQ4A 4PJMA 4XRSA 4AB7A 3KZIC 3G1MA 3HEFA 4CYDA 3LODA 4PV6A 4RBOA 1APLC 3DR8A 5K5OA 3KZYA 5JHUA 2GWRA 4CZZA 1IU8A 3IJ3A 2Y48A 5LRJA 2WA0A 3RKQA 4L9VA 1V0CA 1Z67A 3A0HC 3DP7A 1WZ2A 1VQ7I 2CGPA 2G3AA 4FD6A 2QLZA 3C2HA 3J7ZI 4XNHB 1ZK8A 3JREA 5KTAA 3BR5A 4HNTA 1D3YA 1FP1D 5FLMJ 2DA5A 2DTZA 3K4KA 2VJJA 2B0LA 4XKBA 2B9SA 4MEYF 2C6CA 4MCRA 3S15J 3RPQA 1F2OA 3FF3A 4OMEA 3OIOA 5DV5A 2PG4A 3Q9SA 2PJRB 1Q2CA 4BMHA 4CGZA 1T98A 2V9PA 2VIXA 4G1PA 4LQGA 2K9SA 2QBYB 3KE2A 4MFJA 2QF7A 4NQWA 2EV6A 3DGVA 1IICA 2R7FA 3VARA 2NRAC 2CQXA 5HVGA 1QSMA 3CPXA 4EMSA 3HTUA 5EEAA 3VB2A 2QA4I 2FF4A 3FX3A 5BOXA 2NVXJ 2WBMA 4YRHA 1F1ZA 2PE3A 2DT5A 5LYIA 1K78B 1LANA 3QB8A 1FPQA 3CUQA 3GUDA 2HVRA 1YE9A 2HKXA 2K9LA 4KSAA 1SANA 2KDZA 4AIDA 5F1JA 1PYVA 1DDNA 3DEEA 4Y4RA 1KZFA 5FJ8J 4ESFA 2O5RA 3P2HA 2BEOA 2GOXB 4CAXA 5FLVA 2H5MA 1D0XA 1XGNA 4E7SA 4MFEA 2OD5A 2VT3A 1LDJA 2XVCA 2UZKA 4ZX8A 1JHHA 3TOAA 3K4CA 4KA4A 3O6BB 4ENNA 1H89C 1OCOH 3F8NA 1SMYF 4EGYA 1KU7A 3HSEA 3RPUA 1T56A 3VOEA 2HQRA 8CPAA 2J8RA 4ESJA 5FLXZ 3A1YA 3OYEA 3CC7I 4ENKA 3GF2A 4DJAA 4H4KC 1Z21A 3COAC 2YNEA 4CGLA 1VKCA 3KHXA 3DPTA 4OC4A 5KNLA 4ZYHA 2VBYA 1XN7A 3KEOA 5CQEA 5F27A 2PJ0A 3IGRA 4QPQA 4E0AA 1IB1E 2KJBA 1AHDP 4IF4A 3VYTB 3LSRA 3EYIA 4J3GA 5A27A 2PDOA 1UMQA 1DGWY 4ZDPA 2DFHA 3KYDB 2QQBA 4FX4A 3GZ5A 1BR2A 1JUPA 2RB7A 1MBFA 3G1LA 3V7CA 4HF0A 4HG2A 4JK1X 4D5FA 2DYRH 4GYGA 1AWCA 3S93A 3G2BA 2EBIA 2OF7A 1FTZA 1MD0A 2W82A 5M5XJ 1VQOI 2JJ7A 4A0XA 1J4JA 3J80K 1R9TJ 1VQ5I 1O3QA 2OPTA 3TDUC 4O23A 2R7OA 3ZMDA 4L89A 1Y1WJ 2STWA 4CYCA 1U5TA 2R7TA 5LRKA 4M3DA 2BY1A 2Q0YA 2CUFA 4PXEA 5LYLA 5F08A 4HSTA 5EYRA 1RR7A 3UR3C 1CP7A 4Q4ZF 1MMDA 5M5YJ 2JRMA 1IN6A 2KDOA 1R57A 3IWZA 3H3VK 1NH3A 1CPSA 1N25A 4HPQA 4NNJA 4L5EA 4O5VA 2ZCWA 3N05A 4FX0A 1H0MA 5CVIA 2BO9A 4N0BA 3FK6A 1B9MA 1Z3XA 3LFUA 2HUZA 4OP4A 2JRTA 2G0EA 4R57A 4G7ZF 2XF7A 4G94A 1I1GA 4ZX9A 1HKSA 4M6HA 1IG7A 4OKOA 3WHBA 1BJZA 4R76A 3EC4A 3TP3A 2CSOA 4LB6B 5L3CA 1ZREA 4I02A 2JDCA 2EA2A 5D6FA 3K9TA 4BE2A 4I0BA 4EQQA 4P55A 1IOIA 4Q36A 3C2GA 2L9VA 3DWLE 3R96A 1FWZA 3FBIB 2ESNA 3E0JB 4WWCA 4HBLA 4NEXA 4DJLA 4AD9A 1X1AA 4CCMA 2PX9A 4DYOA 2DDAA 1Y1VJ 4A3LJ 3ZP5A 1Z2LA 1LEAA 1Q1VA 4Z2YA 1I1SA 3DBHB 4XORA 5FRMA 3CC4I 1VIXA 2BY2A 3GCMA 2EK8A 4FCYA 5BNGA 3WGHA 3ML6A 2OOTA 3AAFA 1NK3P 1IGNA 2NYQA 3ZMUA 3W6JB 2EWBA 3J81K 1IJWC 1ZN2A 4A95A 1S29A 2K5TA 3PP9A 3FECA 2Z0ZA 3BOQA 2VE9A 4JJXA 2HS5A 2CNSA 4IHWA 2E71A 3IAS2 4NGSA 3UY5A 2QIRA 1QHGA 3K70D 3DDDA 3K4NA 1O3TA 5ICCA 1A6IA 5M5WJ 3DEWA 4G7HF 2Z3PA 4KT5C 1FOXA 2XUBA 4NJRA 4KISA 3NA6A 3CTAA 3FYNA 4Y17A 3RNZA 2PFBA 5IYBJ 4B8XA 2QSFX 1SVMA 5JFRA 2RFHA 2CQNA 1AA7A 1SFKA 2IS4A 3CUQB 3H3UA 5H6QA 3SQNA 2V1UA 1TWAJ 4A39A 2EWNA 1Z8TA 1EJ9A 2F48A 4QBJA 2M0CA 3HGGA 2CW8A 3MFKA 1XC5A 2BUEA 4PDKA 2EA4A 4AVBA 5IB0A 3BR2A 3IKVA 4KITB 2OB0A 1G3TA 1YIJI 4M6XA 2Q51A 3S9MA 3W6VA 1D1BA 4GXHA 5HNHA 2HI3A 3CMMA 2HV2A 4PGGA 3QP5A 1WSUA 2LSOA 2JEVA 3MKYB 3FXOA 4BUPA 1S7OA 3A0BC 3ZMVA 4BQQA 3K4BA 4MTEA 4C9YA 2VLAA 1JGGA 1YW7A 1XS9A 4GO1A 2CW7A 3WODF 2YNDA 4KIFA 3NH5A 1KONA 1H8AC 3PIOF 4LLGF 1TWHJ 1Z1DA 3SEZA 4ABZA 4P4BA 2HQNA 4M3BA 1LDDA 1NMTA 5J1QA 2QENA 5E3LA 2Y75A 1UHMA 1DP3A 2VQHA 1U5TC 3J7YJ 1QO0D 3IHUA 1Z77A 1T0FC 1TZLA 3W2WA 5K5RA 4DW6A 3I56I 1POGA 2WWYA 1IRZA 4HLXA 5EBVA 2M0MA 4QVTA 3HUVA 5HS9A 4WX9A 2AHQA 2ZJ2A 3BTJA 5C88A 4BYYA 4AM3A 3FMCA 1RPWA 3FMSA 3VSLA 3WC7A 1XGSA 1NTCA 1B9NA 2KIMA 5AIPA 3CP8A 1A5JA 2DOFA 1ETYA 3OYBA 5GADJ 3A02A 3BHXA 1WJ5A 1KU2A 2P0WA 2L9RA 4HSRA 3RO0A 2HWVA 3BJ6A 3HOSA 2CTCA 4L5JA 2CO5A 3CF5F 4PQAA 3IRRA 2CUEA 3ZQCA 1S6LA 3N7ZA 5F48A 4CYCB 2B4DB 2P5LC 3KI9A 3IH4A 3EFAA 4X3RA 1SFEA 1TQIA 2QYVA 1XX5A 3BR1A 5FKOA 1I3AA 3EY5A 1SQHA 3BP8A 3J81Z 3H3ZA 3UKGA 4PK2A 1MSEC 2ZPAA 2RC4A 3ERMA 2NVYJ 2A6TA 5LHGA 4OINF 1V5EA 1SD5A 1Z4RA 4ZYDA 3V7RA 4CUGA 1VHSA 2EJRA 4XOTA 1YJWI 2AS5F 4EJUA 2NSMA 3I3GA 2Y30A 4NF1A 4FE4A 3IRQA 2E2JJ 2QKMB 3BR3A 3BJOA 4U0VA 4A38A 4KIBA 2V77A 2PJ2A 1CJWA 1HA8A 3TOBA 3TW6A 2AFWA 4Q7AA 4ZY2A 1EH8A 1W36D 2ZXHA 3OOUA 5H2FC 4XLPF 2A5WA 4BBHA 3GXOA 3PFYA 1WJFA 1Y7RA 4DZJA 1MMNA 3IO1A 2CJJA 1XMXA 2O4HA 3V7ZA 2JA7J 3DNSA 3LQRA 4E70A 4KUAA 1WJCA 4JQFA 2Y9YA 2IJZA 1MBGA 1OMIA 5LEJA 2V79A 1KU3A 3DFGA 3JRHA 1VQ8I 1G2HA 3L2WA 1GV5A 2HQYA 2AFUA 2VL1A 3OYDA 4NFRA 2FNPA 2BVLA 5LHIA 2AFSA 3H35A 2PBIA 3GYAA 3WTVC 4LOCA 5E3NA 4NSQA 1XOVA 4ONUA 3L2UA 4B6ZA 2LFBA 3GFMA 4R79A 1VZ0A 3W6KB 3NQOA 1IN7A 1BO4A 4KZTA 3MGDA 4KICA 2EIMH 3MMYB 4EGZA 3KETA 3BLNA 1T8IA 3SZGA 1P6RA 3LD2A 4M6GA 1N75A 1V3FA 2KRCA 1A36A 4ZGYB 5ELYA 2VQCA 4KVME 3OYKA 1EKEA 4HA8A 4DYQA 4MLOA 3SI1A 3CESA 2JT1A 2L02A 2E34A 3IV5A 4BNCA 2LNBA 3LSTA 2O28A 3TE4A 1RUNA 4II9A 4DYCA 5D29A 1WI3A 3GB0A 1BIBA 2Z33A 3D66A 4RAYA 4R9MA 1BLLE 3P7NA 5ED4A 2HB6A 3SHPA 2JTVA 2XAHA 4BEHA 3GTGJ 2PJAA 2MH9A 4IJAA 4F3QA 3HGYA 4A3IJ 2NNYA 2FQ4A 2K85A 3QYFA 4UFWA 1YREA 3GVAA 3CT9A 2HPIA 5DD8A 3WTWC 3DTEA 1R1UA 2JVGA 4XPKA 2R7DA 3ELKA 4ZZLA 1JQGA 2DJNA 5IOZA 2GXBA 2KIFA 1XF8A 1R36A 4K2EA 4BQAA 2VE8A 1S7KA 2PJ6A 1LVKA 3KYCB 1D8JA 1U2WA 4PFPA 1B6BA 3CXPA 4IHXA 4A3BJ 5L3GA 1GHEA 1FMVA 3BZKA 2WZNA 4IRHA 1G8XA 3IWEA 3CXQA 2O03A 3EUHA 3WTYC 1W0TA 1R43A 4G6TB 4B4CA 1JUMA 2JBKA 1ZGWA 1P7JA 1FIPA 4RLQA 5EGOA 2CXAA 1MBJA 3KEQA 4UIAA 5A28A 2XRNA 1LEBA 4C2ZA 4LFUA 4PUSA 2YX4A 5DDGA 1A6QA 3D0SA 3GFLA 5BPDA 1HDQA 4CRYB 2G9WA 3L9FA 1FT9A 4YFXF 3D7GA 3QU3A 3W6SA 2BXYA 4IRGA 2A3SA 5GPAA 3GTQJ 1J75A 2ZFWA 2XRLA 3D5SC 3HC7A 2V1NA 3QYEA 3WU1B 4KOWA 5I0CA 4I7HA 2O8XA 2G0BA 4YIIA 2OZHA 3BWGA 2LMDA 2X48A 4HW0A 1O3SA 4NGPA 4ZYGA 3N97A 1MK4A 1LPQA 2EFPA 2X1CA 1STZA 3HUGB 3LNQA 4BJ5C 4UXNA 4U5YA 4BAYA 2FE7A 2RKHA 1P4WA 3LL7A 1JKOC 1SEUA 2LF7A 2KLOA 2LVSA 5FFXA 4IHTA 3W91A 4K3NA 1IAWA 5DUIA 3GIUA 3F8FA 1U6GA 3OYGA 5KTDA 3HOVJ 3H36A 4MJ8A 3W2AA 2MG4A 1DU0A 2K4JA 3FDYA 4EJOA 4KLVA 2COBA 2IP2A 1V4RA 2XV4S 1G3SA 3GTMJ 3CUOA 2OQGA 4UIBA 4OADA 4XQFA 4A0ZA 1ZGJA 2RQQA 3T8RA 4IK2A 3S9NA 3S2WA 5CQGA 1XG1A 2ZNZA 4Z6YA 1XPXA 2OUMA 4BE1A 4U0YA 3T1BA 4B3AA 4A69C 4AVPA 3IKTA 4NB5A 4KOYA 2VB6A 1OCCH 1NHAA 3WG7H 3MRUA 3Q0UA 3REOA 2OV7A 1D1AA 3BC8A 3JRCA 2F4MB 3FMQA 4A3DJ 1U0JA 1G3YA 1W7PA 1VHOA 4B5PA 4HNYB 2DT6A 2CQKA 3Q9VA 3D3SA 1FMWA 1Z3YA 1WKMA 3PB8X 1TKHA 3FRMA 3FZVA 3LA2A 3NEUA 2O7OA 4GCVA 3BY6A 4Y7NJ 4RB2C 1VQ9I 2DA7A 4WWVA 4JBAA 3NE8A 2R92J 5LRSA 4W97A 4YEJA 5HNFA 1BR4A 5D8LB 2R7ZJ 3KP3A 1S7FA 2K9NA 3K6GA 2Z16A 2DMPA 3CMYA 2CV0A 2PJ1A 5H84A 4OWRB 4I99C 2B7EA 1S8NA 2Y9ZA 2DPUA 3K10A 3A4CA 3L7WA 1E3HA 1WI9A 1EF4A 1X1PA 4ZYAA 3S2HJ 1VQ6I 1R5GA 3ABKH 5K1YA 5KHDA 3DR6A 3RQIA 3QPHA 3JCUC 5KAFC 4Y33A 2VC0A 1R71A 5LRGA 1IOFA 1XB4A 5LYDA 1XCVA 2YSRA 3ZOBA 1Y7EA 1WPKA 4RM2A 4L8AA 5JM6A 2L2OA 2IEKA 2QYOA 2PJRA 2Z2SB 2F4OB 5C3EJ 4MHPA 1XRYA 3DCFA 3DF8A 3LSIA 2W1OA 3TBIA 5DCFA 4B3XA 4A5NA 2EQRA 4RB3C 2GM4A 1FSEA 4IQ4A 1ZYRF 2XKPA 2QSGX 1XFOA 4N4NB 2FOKA 1ZHFA 2V7FA 3MCZA 2F5DA 5HS7A 4E7LA 4OC3A 4UA3A 4LX9A 5E3OA 5M3FJ 1FYMA 3FJUA 2ISZA 3GTLJ 3JTGA 2P8TA 4IUSA 1K78A 1H8LA 1U9NA 2H8WA 1S72I 4BEHB 2L7ZA 2PMUA 3GWZA 2M8EA 3VFZA 3B8GA 4BS9A 2D2WA 1SFXA 1O3RA 1I39A 1P4AA 4F93B 2O8KA 2NVTJ 5HMNA 2V4JC 4ZZDA 3GYHX 2B4BA 3TQNA 3H5ZA 3KGQA 4A5MA 1OYYA 2H6CA 1T95A 2H94A 1WK4A 2ZJRF 3D7DA 4BH9A 1RZ4A 2X6XA 2MW8A 4A6DA 1RETA 3DXJF 3FM5A 1F57A 4AU7A 2V26A 4KUMA 5TGTA 3CMAI 2VQLA 3TT2A 1Y9WA 3HSRA 4M74A 2CUJA 4A30A 1KZHA 2Q7SA 2AXTC 2IJLA 4O6JA 2MGQA 5BPIA 4UFXA 2QSHX 3L2CA 2P7VB 2IA1A 2WB1A 3ZQGA 1W0UA 4CPAA 3HHHA 2PMHA 1JHFA 1YGHA 1ZTRA 2Z1DA 3OR2C 1QSRA 4JLYA 1D8KA 5EGOB 2R7UA 3Q0WA 4L9JA 2JSCA 1QQ9A 4HNVA 4XN0A 1AU7A 1ITYA 1HXDA 2WV0A 4XBFA 3GKRA 4OC0A 3KLNA 3VYSB 3G1OA 2EFWA 5FO5A 4HPSA 3CDIA 1YTYA 4UCNA 4DNCA 1YQAA 4RN7A 4RA2A 3NRVA 4BQOA 2E1MB 1JGSA 2IGMA 2L7MP 1P4NA 4E7JA 2BY0A 3QP6A 2QQ9A 4B47A 4EATA 3CO6C 4ZI6A 2XSDC 2L54A 1XGMA 1Z05A 4DBRA 1U8BA 1ZLJA 2VT2A 1MZBA 2ID6A 4QUSA 4XLFA 3F72A 3BT9A 5J4YA 2LY1A 3FXLA 2Q04A 2HQAA 3H0GJ 3MZHA 3CCEI 3FM3A 1J59A 1FBUA 3G4SI 1AKHB 4WK8F 2Z3KA 3L1PA 3KPHA 1SAUA 3LSMA 5C44J 2VBZA 4M6VA 4I6ZA 2E35A 2KIUA 3WE2A 1Z8WA 2GANA 1O57A 1JKRC 3KHZA 3ZJ0A 5B5EC 5F04A 4DZPA 4QIWN 1IDZA 3T9YA 5EJCA 3PO2J 4AG7A 3E97A 2ZBKA 4RAGA 4WCGA 4YIFA 1YFHA 1T38A 1G6NA 3A03A 2LF8A 1SAXA 2J5PA 3ABMH 2M34A 3HJEA 5TJJA 4OIRF 2BCOA 1UG0A 2NOGA 4NGNA 1IO2A 4CA0A 4ENJA 4RGRA 2D45A 2MYSA 1PP7U 1VQPI 1G4DA 1ARMA 1JUSA 5TRDA 1SFOJ 1R1VA 3A9LA 3GZNB 4JD6A 1IW7F 2OJED 2OU2A 2KT0A 3WU2C 3U21A 2VZZA 4N9HA 4JWPA 4BY7J 3VDXA 1LQ1A 1R00A 1W7PB 3R60A 2LR8A 4P9UA 4B5PB 2JA2A 3B2YA 3GW2A 1IRGA 4KN7X 2XF5A 2WY8Q 4HV6A 3WTSC 3IUOA 1LUJB 5AGEA 2ELHA 1YW6A 2FVGA 1RUOA 5HLTA 2QCOA 2BGCA 4X5KA 4XNHC 4BXXJ 1RC9A 2WY7Q 3QODA 2O61A 5GCNA 4IHSA 2HVQA 1I27A 4M9XA 1IZ1A 1XTAA 4UUSA 2A4NA 3H9QA 2JPCA 3BQZA 3ZQIA 3ZQ7A 1A2ZA 4ESBA 1X3UA 1IXCA 2KMUA 5DCMA 4I2OA 3SHFA 2GLJA 1QVTA 4NCZA 2DXIA 3GX4X 1YS6A 1S7AA 3LWUA 1WJAA 2ZSHB 3A2KA 2BE5F 4A3FJ 4IXAA 2QZ8A 3JRIA 1K79A 2BY3A 3KIOA 3GTKJ 2NNNA 2ADUA 1RI7A 4UB6C 3S6FA 4PZJA 1OZPA 3O3KA 4CCKA 2Q43A 3OYAA 1UELB 3GY9A 1J7KA 4EMEA 1WJBA 1KQ0A 2GIZA 3K4MA 2G9DA 3FX6A 1Y6IA 2QGUA 4R3LA 1VFCA 1IF1A 1ZLIA 2ZW5A 1S3JA 3U2RA 3D5RC 4P9FA 3R9FA 4A33A 4CYQA 1JXSA 1WCMJ 3OV8A 5J1RA 1OJLA 4A2UA 2KISA 2R98A 5DWNA 1UWYA 2P5VA 1Q1HA 1Z5RA 4UEFA 1T39A 4B13A 3AG3H 1S60A 5GTHC 2PJBA 1M4GA 4Q47A 4MHYA 2XAFA 1M4LA 1LB2A 2O9LA 2OCCH 5EF6A 1X10A 1VTNC 3B3TA 3TP0A 4UEEA 4HZFA 2IT0A 1GVJA 2X6WA 3WHCA 2FXFA 3RKXA 1PVEA 4Q5SF 4C2XA 5F09A 2XHKA 2F2EA 3HSFA 5H86A 3HHGA 2DW4A 3B3SA 4TWEA 3K1PA 3E6CC 5J47A 2ARHA 3S3MA 1BI1A 2FNAA 2YUSA 2VKEA 4IRIA 2F5EA 2LDUA 4FTHA 1CM0A 4KNYA 3QAHA 1OR7A 3K4LA 2CS3A 3KZWA 1LFWA 3CCYA 5M3MJ 1BOAA 2JEWA 3JSOA 2WAQN 2ME6A 4KOSA 4B1RA 1HDPA 4XLAA 2IS6A 1QU3A 2FS5A 1L0CA 1QZZA 3C3WA 4AXVA 1BL0A 2YU9J 1JT6A 1OLTA 5HLIA 4P45A 4V19K 2ZEMA 2FIAA 4C3IJ 3V8IA 1DPUA 2K3PA 4U88A 4HNXB 5EEGA 4HKFA 4C30A 1R1TA 1XD7A 2OCEA 2GA2A 4HX7A 5BQTA 3D1NI 2PJPA 4YG2F 3RZDJ 2Q8KA 3VWBA 1HF0A 2ZXJA 1LOKA 4RGUA 4XLNF 4RAFA 3SI0A 3SI2A 1UCRA 2D1HA 2B4DA 5KVRA 4EV0A 2E7WA 2J5OA 3OYMA 5F46A 2EZLA 1O4XA 1LFPA 4FAIA 4LUAA 2R7VA 1FSHA 3CD6I 1I3QJ 1P0HA 3JRBA 1S3ZA 4P5OA 4MY3A 4BACA 2G7HA 3LSKA 1UAAA 2X6YA 4L9TA 3BG5A 3FKJA 4GFBA 2DTRA 4XN3A 2Q44A 4CHUA 2NYXA 4B11A 1SD7A 4CAVA 3FKIJ 3BG7A 2MLKA 3IL2A 4P96A 4RDUA 2BV6A 1F9NA 4XRFA 5IP7J 3ERED 2MD0A 2R7RA 1TF8A 2ZENA 3B3CA 3R9GA 5E17F 2OZ6A 1NE9A 2UXNA 5K7ZA 2CIJA 1TT5B 3IIBA 3C2BA 3LSGA 2V8DA 3CLOA 4NDLA 3HTSB 3NARA 4UB8C 3LAJA 2DXQA 3FIWA 1RTQA 2KRFA 1QPMA 1QBJA 4S05A 1GT0C 5FD5A 3BR6A 2VKVA 3ABTA 4X2TA 4UUSB 4YU9A 2VL8A 4EEFG 1VQNI 2JA6J 2IXSA 1B1BA 1R58A 2JLMA 5IP9J 2QWWA 4LG3A 5DCMB 3J7AY 1MSFC 3ZPLA 3BPXA 5D5VB 3PUBA 1Z9UA 2M87A 3WTXC 3BPVA 1UHWA 2C1CA 1VQMI 2DPDA 3CMEI 2ZNYA 1ETQA 3BXMA 2P7CB 4U7DA 5G21A 3WTZA 5EZGA 3CUQC 5IOYA 2IS2A 2MSYA 2L3DA 2GQQA 2MC3A 4ENMA 1W5CC 1X3WB 3NWTA 3W3CA 3I64A 1N77A 1MKMA 2HOSA 3RYRA 4IKFA 3KEYA 1Y0YA 4JXQA 1YLEA 1ZG5A 2LY9A 1DE4C 2DK8A 2HNHA 1B8IA 2JA5J 1J9IA 1K4JA 3ZMZA 4DIQA 1PDNC 4M72A 4PK4A 2LD5A 2AFMA 4WXDA 3PB6X 3WR7A 3FISA 1WWXA 3I71A 1IC8A 4LGWA 3OS0A 5F49A 1HSTA 1WHUA 2EV0A 4CZCA 1S7LA 3O2PE 2HKOA 3L00A 5FVJA 5JQ4A 3RKYA 4JYKA 2VXKA 5CVVA 3V42A 4XOPA 5J8FA 1ZRFA 3SYTA 5HODA 3I59B 1F43A 3F0AA 2ELJA 3IFEA 2RGVA 1OR7C 4GYIA 9ANTA 3PFOA 3JRFA 3AL0B 3OS2A 2I5UA 4MGRA 1P92A 5L3DA 2NVUB 1JKPC 4IHVA 1QRYA 2E19A 4I09A 5ERIA 2LBFB 5JR3A 4YIRX 2PC1A 2ZEDA 4UV8A 1EE3P 2V1XA 1J0RA 4U0WA 3I4PA 3KR5A 3T0YA 2X1DA 5IT3A 2W48A 1O7LA 3BCBA 3R1KA 1R4MB 2JVHA 4HEA2 4AIHA 5IP6A 2CY2A 2CH0A 1OPCA 2L5QA 3KCCA 5JVTA 5B66C 4M6IA 3PM1A 4BGDA 5LGUA 3RBUA 2LKPA 2M2EA 2BHYA 2E1OA 3E3VA 4KSIA 5K5QA 3QNVA 4DBQA 1BM9A 3TFYA 2WAQA 2DBBA 3M1EA 4H6ZA 2K9QA 3BTCA 2QVPA 2EB7A 1R22A 2MH2A 2L4AA 1K61A 4PXDA 2ICWG 3L2NA 5HLGA 1YI2I 1MH4A 3O8GA 1B6AA 1USSA 5F0CA 3R61A 2RAEA 2Q2EA 3HUGA 3ISXA 5J1YA 4M85A 4U9ZA 1W4MA 3PUFA 1YSJA 4OMZA 3IEHA 3CDXA 4UVCA 5C4XJ 3VEPA 1YVOA 2AFOA 3OYCA 4BE0A 3ASNH 1PUFB 4D5CA 3G6EI 1JTYA 4RS8A 1H9GA 4MNUA 4NBQA 3FBUA 2CQ7A 1TW2A 4ANJA 2CW0F 1LE8B 3SXYA 5BWAB 2OAZA 3M9AA 5LEKA 2M1BA 1YMEA 2ZXVA 2ZXWH 2F7VA 3BZCA 3SZPA 1WRJA 2V1DA 2C6YA 2EK9A 2PI0A 2DCEA 2Y31A 1OCTC 3GLXA 4KT6A 2DJIA 4XKWA 4B48A 2DA3A 5E8IA 5TISC 4CICA 1QGPA 1RKWA 2VJ4A 4XRSG 4CO8A 3ZXSA 4P1WA 5J4VA 1AUGA 4XMYA 3OYLA 1XE4A 4I01A 3S17J 2CUZA 2GFQA 4CGPA 1X1CA 5H20A 5KCMA 1ARLA 1WJEA 4A3CJ 3EQLF 5KTCA 1J09A 1ETOA 3OYFA 1RRJA 5ICFA 1KYZA 1ZRCA 1F4KA 4GS4A 4C2UA 5DS0A 5J40A 3ISPA 3BZ6A 4V2GA 2STTA 1M1DA 3BI1A 3FXTA 4MFZA 1MBHA 1S5LC 2W4SA 2P6EA 1Z91A 4PJ0C 2EINH 2XIGA 2PJ3A 3GBGA 1D5VA 1Y0RA 2ABZA 2AJ6A 2ZXIA 3RI4A 3TEDA 3FHNA 2RN7A 3PGPA 3E5QA 2PJCA 4H6UA 1F36A 3S3NA 2V6EA 5C82A 1SVOA 3X2QH 1ZR2A 1P9QC 1IGBA 3D7HA
chains in the Genus database with same CATH topology
1MMGA 1TIQA 4CYNA 3DU5A 1S7FA 2M4GA 2MFZA 3K6GA 2HPMA 5F47A 4OAZA 2Z16A 1I12A 2CV0A 5H84A 4OWRB 3S8PA 3DTKA 3OS1A 2RNGA 3CJRB 3IAM2 3K10A 3A4CA 2WPWA 3L2RA 3H5RA 3ZGKA 3TL4X 4ZYAA 2IS1A 2G3TA 5FRNA 1WFXA 2DOAA 3RQ4A 4PJMA 4AB7A 1X1DA 5KHDA 3DR6A 4PV6A 3LODA 4RMNA 4Y33A 3AL0C 3DR8A 3HL2A 1QSOA 3D5LA 3H9JA 4OAEA 4OAYA 2LREA 4FD4A 2WA0A 2R7HA 4H89A 4RM2A 4ORFA 1V0CA 4L8AA 2L2OA 3E1SA 2YNCA 2M4KA 2PJRA 3FB3A 4BXFA 2Z2SB 4JOMA 2G3AA 4FD6A 4XNHB 3C2HA 3LSIA 3HPHA 2W1OA 5KTAA 3TBIA 4HNTA 3K4KA 4B3XA 3FNCA 2VJJA 4XKBA 2FSRA 4IQ4A 3JTKA 5G1ZA 1BOBA 4N4NB 4E6KG 4BMHA 1Q2CA 4E7LA 4UA3A 2V7FA 2PJRB 4PSXA 4LX9A 4PJJA 3I3LA 2VIXA 1ERDA 1Q2YA 4IUSA 1M4DA 3VWDA 3VYRB 2E60A 3JUWA 1YK3A 4MFJA 1B87A 4CRZB 4BEHB 1IICA 3B8GA 2IL4A 4GRIA 3PSIA 4BS9A 4OLLA 1QSMA 4AVZA 3PL8A 4YRHA 4F93B 2P6GA 2WBMA 1UFHA 1XMTA 2V4JC 4XLEA 5HMNA 2B4BA 3QB8A 3EUKL 3PNTA 3H5ZA 2HVRA 4NQWB 2VQYA 4JXRA 1YE9A 1T95A 4FETA 2K9LA 1WK4A 4KSAA 3W2VA 4MFQA 2X6XA 1PYVA 2GOMA 4PJLA 2WSAA 2WAFA 3ONQA 3DEEA 4Y4RA 4Y3OA 1KZFA 4HNWB 3SXNA 4AU7A 2V26A 5TGTA 2VBQA 3TT2A 2VQLA 2O5RA 3P2HA 2GOXB 1Y9WA 4AG9A 4CAXA 4M3SA 2H5MA 2CUJA 4BL0B 4HRIA 1D0XA 4MFPA 4A30A 3OMYA 3OYIA 4E7SA 2GE3A 2CV2A 4UFXA 3F8KA 4YFJA 2WB1A 2BW3A 3TOAA 3K4CA 2OC6A 4KORA 1YGHA 4A2ZA 4XR6A 2Z1DA 2W00A 3OR2C 1QSRA 4JLYA 2R7UA 3T90A 4XN0A 2J8RA 3GKRA 3DU6A 3A1YA 3M1CA 2K9MA 3OYEA 2R7WA 3VYSB 2EUIA 4DJAA 4H4KC 1Z21A 2YNEA 4CGLA 4ZTJA 1VKCA 3DPTA 2B5GB 2WPXA 4UCNA 5KNLA 2JSPA 4XPDB 4DNCA 1K6YA 4E0AA 5CQEA 4BQOA 3EO4A 3IGRA 4QPQA 2E1MB 1IB1E 2IGMA 2X51A 1P4NA 3K9UA 4I49A 1NG7A 1NG6A 2Q2EB 3VYTB 4B47A 4EATA 4E7JA 2PDOA 2YGWA 4J3GA 4ZDLA 5A27A 4NUBA 1DGWY 4ZDPA 3H0DA 4DBRA 4C7HA 5LD2C 2HU9A 2LRDA 4QUSA 1BR2A 1X4OA 4XLFA 1V5FA 1PU9A 4HG2A 3I9V2 2LY1A 2BVMA 2Q04A 2HQAA 2R4GA 1RXTA 2IGNA 1N78A 2B58A 3S93A 2Z3KA 3G2BA 3LSMA 1SAUA 2MC4A 4F91B 4RI1A 3TO7A 2W82A 3HOTA 3IP4B 2CV1A 2GANA 4ZTFA 2F6CA 1J4JA 2Z3LA 3ZJ0A 3BCAA 1ZELA 3T9YA 3H5NA 2BOLA 4XNFA 3NE7A 3TO9A 2R7OA 4AG7A 4L89A 1D0YA 2NOJB 1YVKA 2R7TA 3PSFA 4AVCA 1QSTA 2I79A 2M3AA 2CFOA 3AKZA 4BDYA 4J01A 2Q0YA 4HSTA 3UR3C 1UG0A 1MNEA 1IIDA 4CGMA 4CA0A 2F5IA 2X7BA 3TFYA 1MMDA 2MYSA 4CSWA 2IGOA 2KDOA 2VASA 3TMOA 3ZR8X 1R57A 3ZQQA 4E8OA 4CAWA 4HPQA 1PJRA 4NNJA 2XC7A 3A9LA 4JD6A 3N05A 3OYHA 3IU2A 2OU2A 4C7IA 3U21A 4CAEA 2VZZA 4JWPA 3VDXA 1Z3XA 2M7AA 3LFUA 5HVQC 2HUZA 3G8WA 4B5PB 3QOEA 1MMAA 2F5VA 5AG7A 2JA2A 4R57A 3HXLA 2XF7A 2XSJC 5CPRB 1KUYA 2XF5A 2WY8Q 1D0ZA 3SEQA 2B3UA 4U9YA 1RO5A 4XONA 3IUOA 3DSBA 5AGEA 3C26A 3EC4A 4XLCA 5HLTA 4X5KA 4XNHC 4D9JA 3S6HA 3CF2A 2WY7Q 3QODA 2KQRA 5GCNA 3HG9A 3SXOA 2E5NA 4RLFA 4EVYA 3E0KA 2HVQA 2REFA 2JDCA 4E4HA 3AFHA 4BE2A 2A4NA 3H9QA 4C2YA 4Q36A 4IX7A 3C2GA 1Q2DA 2ZW7A 2WADA 3DWLE 2KMUA 3R96A 3W6XA 3BJ8A 3FBIB 4E7IA 4AVAA 3ZCOA 3CXSA 3E0JB 4NCZA 4NEXA 2DXIA 1LRZA 4E2AA 1WJAA 1X1AA 2DT7B 2ZSHB 2VKDA 4CCMA 5E96A 3A2KA 3FBNB 2LYCA 2JDDA 3FIXA 1M4IA 5HH1A 3H9GA 2WAEA 2LOOA 3S6FA 3OL4A 4KVOE 4XORA 1QSNA 1OZPA 5FRMA 4CCKA 3GY9A 3OYAA 1UELB 4U87A 2QECA 1WJBA 2VKHA 3DPLC 2W7NA 1S5KA 3K4MA 4UWJA 1Y6IA 2VXDA 4R3LA 3ZZIA 3R9FA 2ZW5A 4A33A 2VPLA 3D5RC 3EXNA 4CYQA 1N71A 4A95A 2K5TA 2KL4A 3MD2A 2R98A 3IU1A 2Z0ZA 3KX2A 3PP9A 4XKVA 2CNSA 2VXZA 4JJXA 3IAS2 5DWNA 4Q38A 3UY5A 3EUHC 2QIRA 3HKZA 1QHGA 2UV1A 2UUZA 3UNGC 3L2VA 3K70D 3K4NA 1V5GA 3DDDA 4B13A 1S60A 5G20A 1GLNA 1M4GA 2Z3PA 4UBRA 2Z3MA 1MW7A 4KISA 2FT0A 2R8VA 3KYLA 1X1BA 3FYNA 1LKXA 1S9HA 2E5ZA 2ZSIB 2BEIA 2X6WA 4BJ6C 3H4QA 4KUBA 1AA7A 1G59A 1SFKA 2IS4A 1E0EA 2DPTA 2FXFA 1WWZA 2ZW6A 4XPDC 3BG6A 2REEA 4C2XA 4CAFA 3OL3A 2D4PA 5H86A 4QPOA 2J8MA 2Q7BA 3PZJA 4QBJA 3OIQA 2KRHA 2CW8A 2FCKA 2BUEA 1YR0A 2ARHA 3DLAA 4AVBA 5IB0A 3S3MA 1YX5A 4KITB 2OB0A 4QC6A 2Y0SA 1CM0A 1D1BA 3QAHA 5ISVA 2EVNA 3QYBA 5HNHA 3K4LA 2CS3A 4CCNA 2HVSA 1XIXA 2BW3B 3CMMA 3OIPA 2AE6A 2HV2A 4ZBGA 3S6KA 3TCVA 2JEVA 3ZRGA 3MKYB 4BUPA 4BQQA 3K4BA 4C9YA 2VLAA 2F4IA 4PFOA 4KOSA 4CGNA 2CW7A 2YNDA 1IYLA 2V9KA 4XLAA 2OH1A 2LH9A 1KONA 2QKLB 2IS6A 1QU3A 2Z3OA 2KPMA 2KCWA 3SEZA 2FS5A 1L0CA 2Z10A 4KJZA 2XDVA 3OYNA 1NMTA 4FD7A 3DKXA 1OLTA 1ZO0A 2M7BA 2FIAA 3V8IA 1DP3A 2VQHA 2K3PA 3RCOA 2CNTA 1WJDA 3W2WA 1T0FC 1TZLA 3I9SA 4HNXB 2JUGA 3K4JA 1M44A 2K5CA 3CJQB 4HKFA 5EBVA 4C30A 3JVNA 2M0MA 4QVTA 2PQ8A 4BQNA 3VWBA 5C88A 2ZW4A 4B10A 3IWGA 4A31A 3VSLA 2X85A 5EC4A 4KOXA 4PJNA 3D2PA 3CP8A 2B4DA 2OZGA 4UWIA 4R3KA 3RPUD 3OYBA 3VSKA 1WJ5A 2P0WA 2L9SA 4ZC3A 4ZJZA 3OYMA 2FIWA 5F46A 4MI4A 4HSRA 3HOSA 1LFPA 3MKWB 4ZDOA 2PRBA 4JXQA 2KHMA 1QHHD 2VJIA 2R7VA 4LUAA 4Y49B 2VZYA 1P0HA 2B4DB 3N7ZA 4MBUA 5F48A 3TTHA 4B44A 1S3ZA 4P5OA 3D8PA 3EFAA 4MY3A 1JI8A 2LY2A 4BACA 3LSKA 3RSNA 4D1QA 2X6YA 2L9NA 3DTIA 1UAAA 4XKCA 3EY5A 3K70C 1SQHA 3FKJA 3OYJA 4PK2A 4LIVA 2ZPAA 5AG6A 4XN3A 2Q44A 2RC4A 4B11A 2A6TA 4CAVA 1V5EA 2AQFA 3BG7A 4KOTA 1YX0A 1MNDA 1XEBA 1Z4RA 2Q4VA 4B5OA 4CUGA 3OY9A 4CCJA 3DPUA 4XOTA 1VHSA 2MD0A 2R7RA 3R9GA 3I3GA 4NF1A 4AYBA 1NE9A 2QKMB 4MFLA 3LSGA 3SDBA 4CCOA 2Q4YA 1CJWA 2BL1A 3LMMA 2YNCC 5CNPA 4N4OB 1HA8A 2DXQA 3TOBA 2XAUA 3BLYA 2ZXHA 3OOUA 1W36D 4BBHA 2A5WA 1D1CA 3PFYA 2Q1ZB 1WJFA 1Y56A 1Y7RA 1MMNA 2VL8A 1PUAA 2IXSA 4E7HA 2JLMA 3DNSA 4KSFA 4LG3A 2PMZA 1WJCA 2R7SA 4JQFA 3J7AY 4KUAA 5J8CA 4KS9A 2L7KA 3PUBA 1Z9UA 3L2WA 4XPLA 2HQYA 3OYDA 3MKZA 4KOUA 4YGOA 2BVLA 3H35A 3GYAA 4NSQA 2QMLA 4ONUA 2ZFUA 3L2UA 4C2TA 4R79A 1VZ0A 2B3VA 5G21A 1BO4A 4KZTA 2IS2A 2C27A 3MGDA 2HZDA 3MMYB 5AG5A 3NWTA 3W3CA 1N77A 4IKFA 2BSWA 3CZ6A 3SZGA 3BLNA 3KEYA 1N75A 2KRCA 3DQVC 3OR1C 3M8JA 1Y9KA 1YLEA 2FL4A 4ZGYB 2VQCA 4KVME 2VQGA 3OYKA 2HNHA 4MLOA 1K4JA 3CESA 1ON0A 4MFKA 4DIQA 4PK4A 2O28A 3WR7A 3TE4A 5JHFA 4II9A 2P6FA 3P2FA 4R9MA 3OS0A 1X4PA 4CZCA 5CKTA 1S7LA 4X0GA 3SHPA 4BEHA 5FVJA 5HOOA 5JQ4A 3VWEA 1R6RA 4F0XA 4A32A 4NC8A 4UCMA 2LBFA 3RTRA 4F3QA 2VXKA 3V42A 4XOPA 4CH7A 5J8FA 4F6AA 4LITA 4BU2A 2E1MC 3SYTA 1MJAA 2Z3NA 3QYFA 3F0AA 2ELJA 5LFAA 1YREA 1OR7C 4UFWA 5IV0A 2GIVA 2KZVA 3AL0B 4II3A 3OS2A 2PR1A 2HPIA 1I1DA 1MJ9A 1DGRM 2I00A 3RYOA 3DTEA 2JVGA 4HNUA 2LBFB 4XPKA 2PC1A 4FASD 2HDWA 4MHDA 3S3OA 1XF8A 1S7KA 2X1DA 1TT0A 3KKWA 1LVKA 3BCBA 3CXPA 1B6BA 4PFPA 2JVHA 3F5BA 4HEA2 3R1KA 4K30A 1GHEA 2CY2A 1FMVA 2CH0A 1YX3A 2L5QA 2LC2A 4NXYA 4MY0A 1Z4EA 1U6MA 1IYKA 4KVXA 4ITVA 1G8XA 1KUVA 3IWEA 3CXQA 4RS2A 1NSLA 3TO6A 4BGDA 2ATRA 4G6TB 2R1IA 3NWSA 4RLQA 2CXAA 4PK3A 3S6GA 1LDKB 4DBQA 4F52A 5A28A 4XM3A 3BJ7A 4C2ZA 2WAQA 4PUSA 4H6ZA 5DWMA 2LG4A 3EPZA 3R9EA 4CRYB 2VEZA 4J00A 2PSWA 4B43A 4RM3A 2B5GA 4XLHA 2Y0MA 3W6SA 4Y49C 2D4OA 2VJ5A 4CGOA 1W36C 3D5SC 3EUAA 3HC7A 2V1NA 3QYEA 4KOWA 4KLWA 5I0CA 1DQUA 4M85A 3R95A 4U9ZA 2G0BA 2AQEA 2OZHA 3G3SA 2X1EA 3HPGA 4CYPA 2IGKA 4IQJA 4R87A 2MABA 1YVOA 3OWTA 4IF5A 4YELA 3H5AA 3S32A 3OYCA 4BE0A 1MK4A 4B12A 2X1CA 2WUUA 3HUGB 2Z11A 2R7QA 4PSWA 3DKYA 4DGWB 4BJ5C 3FBUA 4U5YA 3CP2A 2FE7A 4ANJA 2DPSA 3LL7A 2KP6A 2R7XA 4F55A 3PNYA 2KLOA 4LIUA 2PR8A 5BWAB 2J8NA 3W91A 4UCPA 2ZXVA 2CNMA 4B14A 3OYGA 4F0YA 5KTDA 4MJ8A 2VI7A 3W2AA 1Z7LA 2DCEA 3LSHA 3FDYA 5FROA 4KLVA 4KT6A 4YRVA 2DJIA 2I8DA 4NC7A 4XKWA 4B48A 1MJBA 2VJ4A 4OADA 3LD2A 4DOZA 4XQFA 3ZXSA 4P1WA 1XE4A 2CMPA 4XMYA 4E7ZA 3OYLA 2RQQA 2FUG2 3PNVA 3F9KA 2OZUA 4KOVA 2CUZA 4BJTA 4IZZA 5CQGA 4CGPA 4XL9A 2NMTA 4CYOA 1X1CA 5KCMA 2OUMA 4BE1A 4UFVA 1WJEA 4E7KA 1I21A 4KOYA 5KTCA 2VB6A 4C68A 4CS0B 1J09A 2XF6A 3OYFA 2OV7A 1D1AA 3BC8A 3VYUB 4U7BA 4GS4A 1X19A 4CCLA 4II2A 4C2UA 2UWMA 1U0JA 4FD5A 4B5PA 4BDZA 4HNYB 2DT6A 1M1DA 3D3SA 3L2QA 3FXTA 1FMWA 1Z3YA 1BR1A 2RREA 4F92B 4MFZA 5IX3A 2W4SA 2P6EA 5JPHA 3GBGA 1EA3A 1S7NA 3FRMA 2AJ6A 5AG4A 2ZXIA 3FHNA 1FY7A 3PGPA 4H6UA 3OWCA 1IRXA 3S3NA 2V6EA 3PJRA 4QB9A 4YEJA 5C82A 1KUXA 5G22A 5HNFA 1BR4A 1P9QC 3D2MA 5F49A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TIQ A;  1S7F A;  5F47 A;  1I12 A;  5H84 A;  2WPW A;  2G3T A;  4AB7 A;  3DR6 A;  4PV6 A;  3LOD A;  3DR8 A;  1QSO A;  4OAE A;  4FD4 A;  2R7H A;  4H89 A;  4ORF A;  1V0C A;  4L8A A;  3FB3 A;  2G3A A;  4FD6 A;  4XNH B;  5KTA A;  3FNC A;  2FSR A;  1BOB A;  4BMH A;  1Q2C A;  4UA3 A;  4PSX A;  4LX9 A;  1Q2Y A;  3VWD A;  4IUS A;  1M4D A;  3JUW A;  1YK3 A;  1B87 A;  4CRZ B;  1IIC A;  3B8G A;  2IL4 A;  4OLL A;  1QSM A;  4YRH A;  2P6G A;  1XMT A;  1UFH A;  5HMN A;  2B4B A;  3QB8 A;  2VQY A;  4JXR A;  1WK4 A;  1KZF A;  4HNW B;  3SXN A;  2VBQ A;  3TT2 A;  3P2H A;  1Y9W A;  4AG9 A;  4CAX A;  4M3S A;  2H5M A;  2GE3 A;  3F8K A;  4YFJ A;  3TOA A;  4KOR A;  1YGH A;  4JLY A;  1QSR A;  3T90 A;  2J8R A;  3GKR A;  2EUI A;  1VKC A;  2B5G B;  2WPX A;  4DNC A;  4XPD B;  4E0A A;  3IGR A;  3EO4 A;  1IB1 E;  1P4N A;  3K9U A;  4I49 A;  4J3G A;  2PDO A;  4QUS A;  1PU9 A;  2Q04 A;  1RXT A;  2B58 A;  4RI1 A;  3TO7 A;  2GAN A;  1J4J A;  3ZJ0 A;  3T9Y A;  3NE7 A;  3TO9 A;  4AG7 A;  4L89 A;  1YVK A;  4AVC A;  1QST A;  2I79 A;  2Q0Y A;  1IID A;  2F5I A;  1R57 A;  4E8O A;  4CAW A;  4JD6 A;  2OU2 A;  2VZZ A;  4JWP A;  2HUZ A;  3G8W A;  4B5P B;  4R57 A;  1KUY A;  4U9Y A;  2B3U A;  1RO5 A;  3DSB A;  3C26 A;  3EC4 A;  4X5K A;  4XNH C;  3S6H A;  5GCN A;  3SXO A;  4EVY A;  3E0K A;  2REF A;  2JDC A;  2A4N A;  1Q2D A;  2ZW7 A;  3R96 A;  3W6X A;  3BJ8 A;  4AVA A;  3CXS A;  4NCZ A;  4NEX A;  1LRZ A;  4E2A A;  5E96 A;  2JDD A;  3FIX A;  1M4I A;  5HH1 A;  3S6F A;  4KVO E;  1QSN A;  1OZP A;  3GY9 A;  2QEC A;  1S5K A;  4UWJ A;  4R3L A;  3ZZI A;  3R9F A;  2ZW5 A;  3EXN A;  1N71 A;  2K5T A;  2R98 A;  3PP9 A;  4JJX A;  2Z0Z A;  5DWN A;  3UY5 A;  2CNS A;  2QIR A;  3DDD A;  1S60 A;  4UBR A;  1M4G A;  2R8V A;  2FT0 A;  3FYN A;  2BEI A;  3H4Q A;  4KUB A;  2FXF A;  2ZW6 A;  4XPD C;  1WWZ A;  2REE A;  2D4P A;  5H86 A;  2J8M A;  2Q7B A;  3PZJ A;  4QBJ A;  2FCK A;  2BUE A;  1YR0 A;  2ARH A;  4AVB A;  5IB0 A;  2OB0 A;  4QC6 A;  1CM0 A;  3QAH A;  5ISV A;  2EVN A;  1XIX A;  4ZBG A;  2AE6 A;  3TCV A;  2HV2 A;  3S6K A;  2JEV A;  4KOS A;  1IYL A;  2OH1 A;  2KCW A;  2FS5 A;  1L0C A;  2Z10 A;  1NMT A;  4FD7 A;  2FIA A;  3V8I A;  2CNT A;  4HNX B;  3I9S A;  1M44 A;  4HKF A;  5EBV A;  3JVN A;  4QVT A;  2PQ8 A;  5C88 A;  2ZW4 A;  3IWG A;  5EC4 A;  4KOX A;  3D2P A;  2B4D A;  2OZG A;  4UWI A;  4R3K A;  2P0W A;  2FIW A;  5F46 A;  4MI4 A;  2PRB A;  4LUA A;  4Y49 B;  2VZY A;  1P0H A;  2B4D B;  3N7Z A;  4MBU A;  5F48 A;  3TTH A;  1S3Z A;  3D8P A;  3EFA A;  4MY3 A;  3EY5 A;  1SQH A;  4PK2 A;  2ZPA A;  4CAV A;  2Q44 A;  2RC4 A;  4KOT A;  1YX0 A;  1Z4R A;  1XEB A;  2Q4V A;  4B5O A;  1VHS A;  3R9G A;  3I3G A;  4NF1 A;  1NE9 A;  2Q4Y A;  1CJW A;  2BL1 A;  5CNP A;  2DXQ A;  3TOB A;  1Y7R A;  1PUA A;  3DNS A;  2JLM A;  4KUA A;  5J8C A;  1Z9U A;  4XPL A;  2HQY A;  4KOU A;  4YGO A;  4NSQ A;  3GYA A;  2QML A;  4ONU A;  2B3V A;  1BO4 A;  4KZT A;  2C27 A;  3MGD A;  2BSW A;  3BLN A;  3LD2 A;  4JXQ A;  1YLE A;  2FL4 A;  1Y9K A;  4KVM E;  1K4J A;  1ON0 A;  2O28 A;  3WR7 A;  3TE4 A;  4II9 A;  2P6F A;  3P2F A;  4R9M A;  1S7L A;  3SHP A;  5FVJ A;  5JQ4 A;  3VWE A;  2VXK A;  5J8F A;  4F6A A;  1MJA A;  3F0A A;  1YRE A;  5IV0 A;  2GIV A;  2PR1 A;  1I1D A;  1MJ9 A;  2I00 A;  3RYO A;  4XPK A;  2PC1 A;  4MHD A;  1XF8 A;  1S7K A;  3KKW A;  3CXP A;  3R1K A;  1B6B A;  3F5B A;  4K30 A;  1GHE A;  2CY2 A;  4NXY A;  4MY0 A;  1Z4E A;  1U6M A;  1IYK A;  4KVX A;  1KUV A;  4RS2 A;  1NSL A;  3CXQ A;  3TO6 A;  2ATR A;  2R1I A;  4PK3 A;  3S6G A;  3TFY A;  3BJ7 A;  3R9E A;  4H6Z A;  5DWM A;  4CRY B;  2VEZ A;  2PSW A;  2B5G A;  3W6S A;  2Y0M A;  4Y49 C;  2D4O A;  4KOW A;  5I0C A;  4KLW A;  4M85 A;  3R95 A;  4U9Z A;  2G0B A;  2OZH A;  3G3S A;  4R87 A;  1YVO A;  4IF5 A;  1MK4 A;  2Z11 A;  4PSW A;  3FBU A;  4U5Y A;  2FE7 A;  2PR8 A;  2J8N A;  3W91 A;  2ZXV A;  2CNM A;  4F0Y A;  5KTD A;  4MJ8 A;  2VI7 A;  4KLV A;  1MJB A;  4OAD A;  1XE4 A;  2OZU A;  4KOV A;  2NMT A;  1I21 A;  4KOY A;  5KTC A;  4CS0 B;  4GS4 A;  4FD5 A;  4B5P A;  4HNY B;  1M1D A;  3D3S A;  5IX3 A;  3FXT A;  2P6E A;  5JPH A;  1S7N A;  3FRM A;  2AJ6 A;  1FY7 A;  3PGP A;  4H6U A;  3OWC A;  4QB9 A;  5C82 A;  1KUX A;  2X7B A;  3D2M A;  5F49 A; 
#chains in the Genus database with same CATH topology
 1MMG A;  1XSX A;  2DDB A;  3DU5 A;  1NK2 P;  2OTL I;  1HW1 A;  1I12 A;  4LLL A;  4EM2 A;  3OS1 A;  2RNG A;  3CJR B;  1C0W A;  2GLF A;  2ESH A;  2WPW A;  4AUX A;  1LAP A;  3TL4 X;  5L3F A;  1BC7 C;  4OC5 A;  2DOA A;  3GO5 A;  4A3J J;  1X1D A;  4RMN A;  3HL2 A;  1QSO A;  2ZME A;  1HDD C;  2MBF A;  4FBE A;  4FD4 A;  3K2Z A;  5EG0 B;  5B3S H;  3FB3 A;  2YNC A;  2M4K A;  2DOD A;  1JJ8 C;  2POK A;  4QLC U;  1Z8X A;  3A01 B;  2GAU A;  1B8I B;  3JTK A;  1BOB A;  2EFQ A;  3HRS A;  5DYM A;  4Z65 A;  2Z99 A;  3BTI A;  1ZG8 A;  4MCQ A;  3I3L A;  2LK2 A;  4GM5 A;  5L3B A;  1VQK I;  3VWD A;  3I55 I;  2E60 A;  3CQZ J;  1AMP A;  1B87 A;  3PBE A;  4CRZ B;  4P4J A;  2HYG D;  4GRI A;  1FOW A;  4AVZ A;  1UFH A;  4XLE A;  1GYT A;  2XB0 X;  3EUK L;  1CPX A;  1ODD A;  3BTL A;  4IO9 F;  4QSH A;  4JXR A;  4JX4 A;  1CX8 A;  3F6V A;  3F22 A;  2AO9 A;  3W2V A;  4MFQ A;  2F5C A;  2GOM A;  4PJL A;  3JRG A;  2QJ8 A;  2WSA A;  2WAF A;  2TDX A;  4S0H B;  4Y3O A;  3SXN A;  4HNW B;  5CBM A;  3MN8 A;  1K83 J;  5FGM A;  3DV8 A;  4AG9 A;  1TQP A;  2WB1 N;  5DTD A;  4M3S A;  4BL0 B;  4HRI A;  4MFP A;  3OMY A;  3OYI A;  2GE3 A;  4LMY A;  2Z3Y A;  1CP6 A;  2DMU A;  2Y0S N;  4HAM A;  5K7H A;  2R93 J;  1YQE A;  3F8K A;  2COM A;  4W1U A;  1F5T A;  4YFJ A;  2BW3 A;  3R6S A;  3E6M A;  3K1N A;  4MIM A;  4KOR A;  4A2Z A;  5AON A;  2CRG A;  4XR6 A;  2LP0 A;  4HDU A;  2O53 A;  2ZEH A;  2PN6 A;  2H1K A;  3T90 A;  2A68 F;  1ON1 A;  1CGP A;  4PXC A;  3KP7 A;  2HOT A;  3M1C A;  2R7W A;  3AG1 H;  1TBX A;  2R5Z B;  2WPX A;  1YOV B;  2JSP A;  4XPD B;  1K6Y A;  3ASO H;  3EO4 A;  4F9V A;  2GRE A;  4HDV A;  3K9U A;  4I49 A;  2Q2E B;  1AKH A;  2IVM A;  2YGW A;  2K86 A;  4ZDL A;  4NUB A;  3WTU C;  2EFN A;  5GAG J;  3H0D A;  1B72 B;  4C7H A;  1KQ9 A;  1Q7L A;  2LRD A;  3S16 J;  2LKS A;  2VBW A;  1V5F A;  1Z6R A;  3QPT A;  4A12 A;  2BVM A;  5ICE A;  2R4G A;  4C3J J;  1RXT A;  2IGN A;  5DUK A;  4EVI A;  1MDM A;  1N78 A;  2FE3 A;  2B58 A;  1I50 J;  3F3X A;  1X58 A;  2MC4 A;  4F91 B;  5D4S A;  5F6F A;  2FA5 A;  3HOT A;  1LVA A;  1UJ8 A;  2F6C A;  2LKX A;  3LAC A;  3BCA A;  4M3F A;  3M8F A;  1QZE A;  2QVO A;  4XRM A;  3NE7 A;  2JQ7 A;  1YVK A;  4AVC A;  3PSF A;  1HSJ A;  4LD5 A;  5EZH A;  4LG0 A;  3U9G A;  2Z9O A;  2I79 A;  5D8N A;  2CFO A;  3AKZ A;  3PB4 X;  2W25 A;  4PXB A;  3G3Z A;  4XK4 A;  1MNE A;  1IID A;  1YLO A;  3KQX A;  4OU0 A;  3HBL A;  3BG9 A;  3TMO A;  3ZR8 X;  4E8O A;  2KZG A;  1Y0N A;  4CAW A;  4YWY A;  2NS8 A;  4NGR A;  1R5H A;  3K1M A;  2IW5 A;  2M7A A;  2IPQ X;  4HYE A;  5H6R A;  5HVQ C;  3FNC A;  3G8W A;  1MMA A;  2F5V A;  2OBP A;  5AG7 A;  1OYI A;  2DEA A;  2XSJ C;  4AYB N;  1FOY A;  1KUY A;  4U9Y A;  2B3U A;  4L0Y B;  4XON A;  2E2I J;  4XLC A;  2TCT A;  4QWQ A;  2GXA A;  2FBK A;  3I4N J;  3NH4 A;  4M9S A;  2ETH A;  2KQR A;  5D6E A;  3HG9 A;  3SXO A;  2E5N A;  4RLF A;  3S14 J;  3BQY A;  4AIK A;  4Q48 A;  2GU2 A;  2PRQ A;  4C2Y A;  5A2Q K;  5EDN A;  2DQL A;  2WAD A;  3R4K A;  3BJ8 A;  1YYV A;  4E7I A;  3I1U A;  3CXS A;  4FIS A;  1LRZ A;  3ZN0 A;  1D5Y A;  4E2A A;  2DT7 B;  2VKD A;  3ZQH A;  1LNW A;  2LLK A;  5D5X B;  2XPV A;  2JDD A;  2WAE A;  1T2K A;  3OL4 A;  3T8T A;  4KVO E;  3QU6 A;  2R3S A;  1BPN A;  2ZME B;  3DPL C;  1S5K A;  2W7N A;  2ZEE A;  4NGT A;  2PVV A;  3CJN A;  4UWJ A;  3WU0 A;  4UHT A;  2VPL A;  3EXN A;  4KDP A;  2RDP A;  3RZO J;  1N71 A;  1SC7 A;  3D4U A;  3MD2 A;  4XKV A;  1SMT A;  2VXZ A;  3I53 A;  1ZG1 A;  3LSP A;  5LRR A;  4MCS A;  3TKY A;  3EUH C;  4CAF A;  1OYW A;  2UV1 A;  2UUZ A;  3UNG C;  5L3E A;  1XBU A;  4TV7 A;  1V5G A;  1ONV A;  2M30 A;  4DYR A;  3SZT A;  2YR2 A;  1GLN A;  4IHM A;  4UBR A;  2Z3M A;  3DEU A;  2FT0 A;  1KU9 A;  3PBB A;  3DBL B;  1LKX A;  1S9H A;  3NAU A;  2EH3 A;  1JJ6 C;  2ZSI B;  2VOP A;  2BEI A;  4BJ6 C;  3H4Q A;  1YW9 A;  3Q5F A;  2CFX A;  3H1C A;  1WWZ A;  4UV9 A;  5HS8 A;  3QPS A;  1IY7 A;  2HOE A;  1TW3 A;  3EDP A;  1J2X A;  2HFH A;  4CDG A;  2FJ1 A;  4QPO A;  3F8M A;  4C3H J;  5JH9 A;  3OIQ A;  2FCK A;  5FKK A;  2DO7 A;  3DLA A;  2P6S A;  3M4O J;  3SJM A;  3CCL I;  5IY5 H;  4QC6 A;  2Y0S A;  3IWF A;  3SFZ A;  5E20 A;  5ISV A;  1QVU A;  2HVS A;  2AE6 A;  2BW3 B;  3OIP A;  3S6K A;  3TCV A;  4BXU A;  4P44 A;  3ZRG A;  4H2K A;  4KFC A;  1U9O A;  5F1R A;  4MTD A;  3B3W A;  2V9K A;  4Y13 A;  2JBJ A;  2KIQ A;  2OH1 A;  3FK7 A;  2QKL B;  1GXP A;  2Z3O A;  5LYF A;  4KJZ A;  1DPR A;  2XDV A;  3E6D A;  1Y8Q B;  3HIF A;  3ROU A;  2HYF A;  3OYN A;  3C18 A;  4OIO F;  4FD7 A;  3TX8 A;  4AWX B;  1TKF A;  1CBX A;  4R8H A;  1XJO A;  2VN2 A;  2IA0 A;  3ESW B;  5FD6 A;  3RCO A;  1WJD A;  1ORK A;  1FEX A;  3I9S A;  2JUG A;  1TLH B;  1M44 A;  3CLQ A;  2K5C A;  3SJE A;  1V54 H;  1K7A A;  3JVN A;  1OQY A;  5A2Q Z;  2VUM J;  2PQ8 A;  3T8W A;  3JSP A;  2XGE A;  4BQN A;  2ZW4 A;  3O8H A;  4B10 A;  4A31 A;  3C1D A;  1MDM B;  2RV8 A;  2X85 A;  5EC4 A;  2A69 F;  3D2P A;  1LJ9 A;  3TC8 A;  3LA3 A;  2CWE A;  3RPU D;  3U1D A;  4BHP A;  1LAM A;  4ZJZ A;  4ZC3 A;  2FIW A;  2D1V A;  4EJW A;  4MI4 A;  4MCP A;  1BI0 A;  2YX7 A;  2PJ8 A;  1PCA A;  1UFM A;  2DYS H;  3MKW B;  2HEO A;  1YO5 C;  2JWT A;  2KHM A;  1QHH D;  4Y49 B;  3CCR I;  1QZY A;  2VZY A;  4KMF A;  4MBU A;  2M8G X;  4LG0 B;  4B44 A;  3D8P A;  3RSN A;  4D1Q A;  1L3L A;  4D7N A;  4XKC A;  2EO8 A;  3OYJ A;  5AIQ A;  1A35 A;  4WXH A;  3H8E A;  5AG6 A;  1MBK A;  5CJ9 A;  4EFD A;  1R4N B;  1EH6 A;  4WXC A;  1A31 A;  1YX0 A;  1YJN I;  1S7E A;  1AYE A;  5J1U A;  2X4H A;  2X9D A;  4CCJ A;  2X0L A;  3OY9 A;  1VQ4 I;  1YRN B;  1SVL A;  2GXG A;  4GXO A;  4IAV A;  2YS9 A;  4BD9 A;  4ZYQ A;  4AYB A;  3PRT A;  1WQ2 A;  4A94 A;  4MFL A;  3VH9 A;  4LJZ F;  3PFI A;  2ZEO A;  2Q4Y A;  2BL1 A;  5CNP A;  3FVL A;  4N4O B;  4M3G A;  1FYL A;  3BLY A;  2YPR A;  3FED A;  5D5W B;  5D5U B;  4Y52 J;  2Q1Z B;  1Y56 A;  4OOI A;  5EEH A;  5K8M A;  3WGG A;  2K27 A;  2XGC A;  1ON2 A;  1PUA A;  4E7H A;  3GTJ J;  4KSF A;  3BG3 A;  1OCR H;  3KP4 A;  5J8C A;  4KS9 A;  4HF1 A;  1UG2 A;  4XPL A;  3VPR A;  4KOU A;  4L9N A;  4YGO A;  3KP6 A;  1IV8 A;  1TWG J;  2QML A;  1TF9 A;  3HRU A;  4RGS A;  2ZEL A;  4C2T A;  2E1C A;  4L5I A;  3HLP A;  5E1W A;  2C6G A;  3P9C A;  1FZP B;  2PJ4 A;  1DU6 A;  1Z0X A;  3KQZ A;  2HZD A;  1YG2 A;  5AG5 A;  5HXD A;  1U8R A;  2BSW A;  3CZ6 A;  3OR1 C;  3K7A J;  2FL4 A;  3M8J A;  1Y9K A;  3BJA A;  2VQG A;  2KFD A;  1GV2 A;  3WE3 A;  3H8G A;  2HXO A;  2XEI A;  3HRT A;  4G8X A;  1VHE A;  4I98 B;  4KIG A;  2P6F A;  2FXA A;  3P2F A;  5ILS A;  3I59 A;  2PVW A;  1X4P A;  2BXZ A;  2FX0 A;  2HYJ A;  2F5F A;  3HYI A;  3Q0V A;  4J19 A;  3N4M A;  5HOO A;  2L7F P;  2MD5 A;  3S1R J;  4NC8 A;  4GDF A;  2LBF A;  4CH7 A;  1MH3 A;  4NC6 A;  3V8K A;  3CC2 I;  4LIT A;  2DFF A;  2Z3N A;  4F6A A;  2ZJP F;  2CU7 A;  2GIV A;  2E2H J;  2BOA A;  2GA1 A;  4II3 A;  5E79 C;  1I1D A;  2PR1 A;  1MJ9 A;  2I00 A;  3RYO A;  1KA8 A;  1BW5 A;  3GLJ A;  4HNU A;  4KYW A;  3FXM A;  3HOZ J;  3GLL A;  1XCB A;  3RJP A;  4M73 A;  3S3O A;  3ZMT A;  3VAT A;  3AG4 H;  1AOY A;  1TQM A;  3F5B A;  3FWE A;  4K30 A;  4P4F A;  5ICG A;  4NXY A;  2LC2 A;  1YX3 A;  1Z4E A;  1HKQ A;  1L0O C;  4IHY A;  4ITV A;  1IYK A;  4KVX A;  2AXL A;  3N5F A;  3TO6 A;  4DUK A;  3MZY A;  2R1I A;  3NWS A;  1ACI A;  1X2N A;  1XGO A;  1KGS A;  2X6O A;  4HF2 A;  3H8F A;  2K40 A;  4EM1 A;  4PK3 A;  3S6G A;  1UHS A;  3KLO A;  4XM3 A;  1ZAO A;  3DBR B;  3GEZ A;  3BJ7 A;  3F8B A;  4LK0 F;  2H8R A;  2EBJ A;  5DWM A;  3R9E A;  2ZO4 A;  4J00 A;  4G6D A;  2PSW A;  2MLG A;  5KAI C;  2VI6 A;  1HC8 A;  3CCM I;  2B5G A;  4XLH A;  2Y0M A;  2DI3 A;  2QEX I;  1P2F A;  1TNS A;  4UUT A;  1BI3 A;  2P81 A;  1PUF A;  1ETK A;  3M07 A;  4KLW A;  5LGT A;  3T5X A;  3U1K A;  2AQE A;  1YHQ I;  1I6X A;  2VPR A;  3CCJ I;  2X1E A;  3E6B A;  2R5Y A;  1FBS A;  3HPG A;  2TRT A;  2XKO A;  1LE8 A;  4CYP A;  4IQJ A;  2MAB A;  3OWT A;  4B12 A;  3H5A A;  1KQ8 A;  2WUU A;  2QM3 A;  4PSW A;  3DKY A;  3RDI A;  4DGW B;  1ETV A;  1QMU A;  3CP2 A;  2PEX A;  2DPS A;  4F55 A;  1P7I A;  3F0C A;  4LIU A;  4A93 J;  4MQV A;  3C7J A;  3JAM Z;  2EZK A;  4FQG A;  4RB1 A;  1RNL A;  5JVG F;  2V8G A;  3D68 A;  4F0Y A;  3KP5 A;  3LSH A;  2XAQ A;  4JP0 A;  4RAZ A;  2OR4 A;  5FRO A;  2I8D A;  4NC7 A;  2DA6 A;  3HB9 A;  3V38 A;  3GTP J;  2CQQ A;  1IN8 A;  2CMP A;  3SFI A;  2ZC2 A;  3PNV A;  3F9K A;  2JPB A;  2ID3 A;  4IZZ A;  1YIT I;  4M6Y A;  1HEE A;  2DA2 A;  2G7U A;  5D4R A;  4UFV A;  3SJF A;  4E7K A;  1UB9 A;  2DFE A;  1T0F A;  2AFX A;  2HQ5 A;  3B02 A;  4C68 A;  2XPU A;  4MMO A;  1FIA A;  5THW A;  3FF5 A;  4U7B A;  1X19 A;  4MQ9 F;  4II2 A;  1R7J A;  4CCL A;  4G9Y A;  5B1B H;  3SDG A;  2UWM A;  1GHC A;  1HOM A;  3EET A;  3PB7 X;  4HV5 A;  2PJ9 A;  4BDZ A;  4UVB A;  4YFN F;  3K2K A;  1YIO A;  4F92 B;  1BR1 A;  2IRF G;  2Q0O A;  3JRD A;  1ETX A;  1EA3 A;  2L0K A;  4KN4 X;  1FY7 A;  5D8K B;  1PP8 F;  3OWC A;  1FJL A;  2FD5 A;  2R0Q C;  4UEZ A;  3QAY A;  2M45 A;  2X7B A;  4BBR J;  1TIQ A;  4XIC A;  1FNO A;  4QTR A;  3HOU J;  2M4G A;  2HPM A;  3S8P A;  3J7A O;  3IAM 2;  2RNJ A;  1VND A;  1FNN A;  2ME0 A;  2O3F A;  3L2R A;  2IS1 A;  3F23 A;  3SJX A;  5EG0 A;  1FP2 A;  5FRN A;  3LQQ A;  1H88 C;  2G3T A;  2ZOG A;  1TWF J;  4GGG A;  3B35 A;  1TKJ A;  5GP9 A;  4AIJ A;  1MNM C;  4HQE A;  3RZA A;  3AL0 C;  3PB9 X;  3D5L A;  3H9J A;  4OAE A;  5HLH A;  4OAY A;  3A01 A;  1X2M A;  2LRE A;  2NS0 A;  3HOW J;  3S1M J;  2FQ3 A;  1HBX G;  2R7H A;  2WYR A;  4H89 A;  4ORF A;  4W9Y A;  1MBE A;  3E1S A;  3S9L A;  3K2A A;  1ZKG A;  4BXF A;  4JOM A;  2A61 A;  1CF7 A;  4UNO A;  4ZH4 F;  1LCP A;  3HPH A;  4WJB A;  1QA6 A;  2FSR A;  5G1Z A;  4BBS J;  2M5W A;  4HQM A;  4E6K G;  3HRM A;  3WAB A;  3ECH A;  2H27 A;  4MRI A;  4PSX A;  1JWQ A;  5IT9 K;  4RGX A;  4PJJ A;  4G7O F;  4EWT A;  3HKZ N;  1ERD A;  1Q2Y A;  1M4D A;  2DAO A;  2PJ5 A;  3LMS A;  5CLS A;  3VYR B;  3JUW A;  1YK3 A;  5I4M A;  6PAX A;  3E7L A;  5FB2 A;  5JI6 A;  3PSI A;  1WH7 A;  3MN2 A;  5KK1 A;  1K4T A;  2IL4 A;  4OLL A;  3CZX A;  3PL8 A;  2P6G A;  4LQ6 A;  1XMT A;  5GAH J;  2UXX A;  3LFK A;  3PNT A;  4NQW B;  3VOD A;  1X3Z B;  2LTP A;  4OMY A;  2VQY A;  2XB5 A;  3RKW A;  4FET A;  4MHZ A;  5ILV A;  2HOA A;  3BR0 A;  1JKQ C;  1VQL I;  3ONQ A;  5HDG A;  3P9I A;  4M9Z A;  2FRH A;  4BHC A;  2VBQ A;  2W24 A;  3ISZ A;  2DK5 A;  3J80 Z;  4N9I A;  2HDC A;  1BAV A;  3L09 A;  2CV2 A;  4OID A;  3RIR A;  3BDD A;  3QPL A;  3HDD A;  5K7F A;  1MMS A;  2XEF A;  3KAS A;  3F21 A;  4MEX F;  4LK1 F;  2VON A;  3OOP A;  4Y15 A;  2OC6 A;  3GFI A;  1REP C;  2D5V A;  1T33 A;  2W00 A;  2R5Z A;  3S1N J;  2DLL A;  4F7Z A;  1NSA A;  4IEJ A;  2WTE A;  1R23 A;  2ECB A;  3DU6 A;  3CDL A;  2K9M A;  1VGY A;  4XSZ F;  1BI2 A;  2AFZ A;  2EUI A;  1B72 A;  3G71 I;  3B7I A;  3CPA A;  1HW2 A;  2JZY A;  4ZTJ A;  4PPZ A;  2B5G B;  1KYW A;  4EJV A;  1BW6 A;  5E1X A;  3ULQ B;  2X51 A;  1NG7 A;  1GUU A;  1NG6 A;  1UZC A;  2L4M A;  2R5Y B;  1XSV A;  3LWF A;  5LD2 C;  4LLN A;  4UUV A;  2NVQ J;  2HU9 A;  1BJA A;  2EK5 A;  2FEZ A;  1X4O A;  1PU9 A;  4XID A;  4OC1 A;  3I9V 2;  5FFZ A;  1RKT A;  2EPF A;  1JE8 A;  3E5X A;  4RI1 A;  3CCQ I;  3MWM A;  3TO7 A;  3K69 A;  3IP4 B;  2CV1 A;  5CVR A;  4ZTF A;  2Z3L A;  2M9H A;  2WV1 A;  4IOC F;  3I0T A;  1ZEL A;  3H5N A;  2BOL A;  4XNF A;  2J9A A;  4ONW A;  3TO9 A;  2P6T A;  1SFU A;  4MHG A;  1ZLH A;  1D0Y A;  3MEX A;  2NOJ B;  1E3P A;  2GZW A;  2W57 A;  3V4G A;  3RAM A;  2E36 A;  1ZH5 A;  2DU9 A;  2EFO A;  3LSJ A;  1QST A;  4BKX A;  2M3A A;  2HXI A;  4BDY A;  3FXJ A;  5E8G A;  4J01 A;  2V8H A;  2N8G A;  4UVA A;  5FKL A;  2H1L A;  2CG4 A;  1YJ9 I;  2ELK A;  2XGX A;  1EV7 A;  4CGM A;  2F5I A;  2W84 A;  4CSW A;  2IGO A;  1U5T B;  2VAS A;  3ZQQ A;  1OCP A;  1XMA A;  2ODF A;  2EIJ H;  1FTT A;  1PJR A;  2XC7 A;  1Y8R B;  3OSG A;  3QRF F;  3OYH A;  5DM6 F;  3IU2 A;  4C7I A;  1ZLK A;  2HTJ A;  5IT9 Z;  3B6A A;  4CAE A;  1XDU A;  3QOE A;  5CPA A;  2B63 J;  1ZG3 A;  3HXL A;  3BI0 A;  5CPR B;  4I0A A;  5J6X A;  3CDH A;  1D0Z A;  3SEQ A;  2CF4 A;  6CPA A;  1RO5 A;  2CYY A;  1RIO H;  3DSB A;  3C26 A;  4D9J A;  3S6H A;  3CF2 A;  4WF2 A;  1CG2 A;  4NGQ A;  4EVY A;  3GTO J;  3FXQ A;  1ETW A;  1R5I D;  4IL6 C;  2VOD A;  2REF A;  3E0K A;  4E4H A;  2ZEP A;  3AFH A;  4C2M J;  1ZRD A;  1G3W A;  1TNT A;  1ELL P;  2I10 A;  3JRU A;  4IX7 A;  1Q2D A;  4F9U A;  2ZW7 A;  3F8C A;  3W6X A;  3DLJ A;  3ZCO A;  4AVA A;  2OTJ I;  2PMZ N;  4HOB A;  5HVF A;  1K4S A;  1I5Z A;  5IYD J;  5E96 A;  2DQR A;  4RB0 A;  3FBN B;  1ULY A;  1V55 H;  4JX5 A;  2K3F A;  2LYC A;  3CO7 C;  2XEJ A;  3PO3 J;  1FOK A;  3H9G A;  1M4I A;  3FIX A;  3QQA A;  1W7P D;  3IC1 A;  5HH1 A;  2LOO A;  1OCZ H;  1RES A;  1F2P A;  2VC1 A;  4M71 A;  1DTD A;  1QSN A;  4UY8 I;  4OIW A;  2QEC A;  4U87 A;  4OC2 A;  5GTI C;  2VKH A;  1BC8 C;  5CVJ A;  3BRO A;  5DEQ A;  1Y39 A;  2VXD A;  1W5S A;  2ISY A;  3ZZI A;  3M7G A;  5GAE J;  1CF7 B;  2FOW A;  1HQC A;  1UST A;  4R8F A;  3TW7 A;  3IU1 A;  2KL4 A;  3KX2 A;  1ELM P;  2L01 A;  2HC9 A;  2IQ6 A;  4Q38 A;  3HKZ A;  3ABU A;  3L2V A;  3QWL A;  3WGI A;  1FC3 A;  3MQ0 A;  1HW5 A;  5IPA A;  2A6H F;  2DA1 A;  5GPC A;  5G20 A;  3Q3S A;  1QPI A;  1WVR A;  1FT7 A;  4NJQ A;  4P10 A;  1MW7 A;  2R8V A;  4OIQ F;  3KYL A;  1X1B A;  3HOY J;  1TTY A;  2E5Z A;  1EH7 A;  3GZ6 A;  3P9K A;  2F8H A;  1HDU A;  1TC3 C;  3FEE A;  4KUB A;  2ZW6 A;  1G59 A;  1CQT A;  4JX6 A;  1E0E A;  2DPT A;  4XPD C;  3BG6 A;  2REE A;  5J3L A;  2OA4 A;  3OL3 A;  3WTT C;  2D4P A;  4HX8 A;  4X1E A;  2DA4 A;  2J8M A;  2Q7B A;  3IC7 A;  3PZJ A;  4P4E A;  3TDZ C;  1T6S A;  2KRH A;  3FXK A;  5HDN A;  2O6G E;  4F8Z A;  1YR0 A;  2XPW A;  1ENH A;  2EZH A;  2RVC A;  3EYY A;  2V6C A;  1YX5 A;  1U78 A;  4BY1 J;  1MGT A;  4XSX F;  3KR4 A;  4PGH A;  1XMB A;  1IRF A;  2ZB9 A;  2XRO A;  3LA7 A;  4EJT A;  3JTH A;  2ACJ A;  1JTX A;  2DMN A;  2EVN A;  3QYB A;  2A5Y B;  4FE7 A;  1RR8 C;  1XIX A;  4CCN A;  4ZBG A;  1B4A A;  2V8V A;  4ON0 A;  5HVH A;  5JLW A;  4NGM A;  3SJG A;  2F4I A;  4PFO A;  2XAJ A;  2V9V A;  1IYL A;  2FMY A;  2JN6 A;  1HLV A;  2JMW A;  2LH9 A;  1U3E M;  3NH8 A;  2KPM A;  3AG2 H;  2KCW A;  2VBX A;  2Z10 A;  2K02 A;  1E17 A;  2DN0 A;  3DKX A;  5IYC J;  1ZO0 A;  2A05 A;  2M7B A;  5JGF A;  5F64 A;  2CNT A;  3G73 A;  3PQK A;  3R0J A;  3IH2 A;  2PJ7 A;  3K4J A;  3CJQ B;  3E5U A;  2Y2Z A;  5LGN A;  4FUU A;  3NFZ A;  2ZKZ A;  4EM0 B;  4IOA F;  2DMT A;  2XAS A;  4A3K J;  3IWG A;  5IB9 A;  4L18 B;  1Z6T A;  3ZQF A;  3PQJ A;  2GLO A;  4KOX A;  4PJN A;  2HDD A;  2OZG A;  4MO7 A;  4P4I A;  4R3K A;  4UWI A;  4HLY A;  1TL8 A;  3VSK A;  2L9S A;  1FLI A;  3KP2 A;  2Q4Z A;  1SD4 A;  4M3E A;  3S2D J;  2IAI A;  2HR3 A;  3ZMS A;  4ZDO A;  2PRB A;  2VJI A;  2E1N A;  3G3S A;  1BBY A;  2HZT A;  3TGN A;  3OSF A;  3GME A;  3I4M J;  2A6E F;  3TTH A;  1JI8 A;  1YW4 A;  2LY2 A;  1HKT A;  2XGD A;  1YRN A;  1E2X A;  2L9N A;  3DTI A;  3K70 C;  4S04 A;  4LIV A;  5F0H A;  1K6O A;  2DOE A;  3FXU A;  1DUX C;  5K8P A;  4KMU X;  4OIP F;  2AQF A;  1W1W E;  4KOT A;  2Q4V A;  1MND A;  2H09 A;  1YS7 A;  1XEB A;  4B5O A;  3CCU I;  3DPU A;  3M8E A;  2EIK H;  2NAZ A;  1GVD A;  5B1A H;  2JA8 J;  5JLX A;  1ZG9 A;  1MIJ A;  7CPA A;  3QOP A;  5CVU A;  3ZN1 A;  2ZME C;  5E3M A;  3FH4 A;  3CJT B;  3SDB A;  4CCO A;  5BS6 A;  3P5J A;  2YNC C;  1P4X A;  2EZI A;  2KKO A;  3ECO A;  3LMM A;  3JRA A;  1R3N A;  2XAU A;  1E3O C;  1Z7U A;  3HM5 A;  2ZEF A;  1D1C A;  1O7F A;  2PIZ A;  2EIL H;  2K7L A;  1PYT B;  3FXR A;  3WC6 A;  2P4W A;  1KWM A;  5K8O A;  3ZQL A;  4BIN A;  1IXS B;  2BBY A;  2PMZ A;  5LHH A;  2R7S A;  2YU3 A;  3B73 A;  2BHZ A;  2L7K A;  3I5U A;  2CTB A;  5ILU A;  2A07 F;  3MKZ A;  2RQP A;  2ANP A;  3D7F A;  3JW4 A;  5DD4 A;  2ZFU A;  2B3V A;  1WGX A;  2IMO A;  1B59 A;  2C27 A;  3IWW A;  2VOO A;  2K4B A;  1FX7 A;  3F6O A;  4G6Q A;  1GXQ A;  1ZG7 A;  1OKR A;  2QQA A;  4V2F A;  4H0E A;  4A32 A;  4CGN A;  1VI0 A;  3DQV C;  3WG9 A;  2BYV E;  1W5T A;  2FML A;  5DM7 F;  1ON0 A;  1Y0U A;  2PIY A;  2E7X A;  4MFK A;  3MKL A;  3K0L A;  3FMR A;  4O3M A;  5JHF A;  1BN5 A;  2HTS A;  2XAG A;  2H6B A;  2Z5U A;  3MVP A;  1R49 A;  2QBY A;  1H9T A;  5HDK A;  5CKT A;  1TWC J;  2O0Y A;  4X0G A;  1YW8 A;  3VWE A;  1IN5 A;  1R6R A;  1T08 B;  4F0X A;  4UCM A;  2FBI A;  1J5Y A;  3RTR A;  2OQR A;  2I3C A;  5K8N A;  4JZ0 A;  4R6T A;  1MJA A;  2E1M C;  4BU2 A;  5LFA A;  5IV0 A;  2P5K A;  2KZV A;  4BHB A;  1DGR M;  2W85 A;  4P6Y A;  2WC2 A;  2KJC A;  1OFC X;  4FAS D;  2QUF A;  2HDW A;  4MHD A;  4JYW A;  3KKW A;  1TT0 A;  2NXN B;  1ZGA A;  2PLY A;  5E1Z B;  1GDT A;  2JK3 A;  3LOC A;  3HOX J;  4MY0 A;  1U6M A;  1A04 A;  3I58 A;  1KUV A;  4RS2 A;  1NSL A;  2HGC A;  1PUE E;  2ATR A;  1FBQ A;  3ABL H;  2DMQ A;  4PCQ A;  4FT8 A;  1BPM A;  1LDK B;  4F52 A;  5FKN A;  3V7S A;  3CCS I;  1IDY A;  2LG4 A;  3EPZ A;  2VEZ A;  3PIP F;  4YFK F;  3CCV I;  4B43 A;  5DS9 A;  2ZJQ F;  4I76 A;  1VF9 A;  4RM3 A;  3PFE A;  5FKM A;  1QNT A;  3GFJ A;  2QQ8 A;  4Y49 C;  2D4O A;  2VJ5 A;  4CGO A;  1W36 C;  1XDS A;  3EUA A;  1LFB A;  2PCU A;  1DQU A;  1XMK A;  1LFU P;  3H92 A;  3R95 A;  3V8J A;  3MZ8 A;  4RUH A;  4MXU A;  4A3M J;  1XSD A;  1BIA A;  2IGK A;  4R87 A;  1I6H J;  4X8I A;  4LB5 A;  3HZJ A;  4IF5 A;  4YEL A;  5EMI A;  3S32 A;  3PEI A;  2Y69 H;  4NHJ A;  1BA5 A;  2Z11 A;  2FBH A;  2R7Q A;  2IA2 A;  2BZT A;  3KL9 A;  3WC5 A;  2KP6 A;  2R7X A;  5F0F A;  2FU4 A;  3PNY A;  3LAP A;  2PR8 A;  4X6A J;  2FSW A;  2J8N A;  3I54 A;  4UCP A;  4ASN A;  1Z9C A;  4A6E A;  2CNM A;  4A3G J;  4B14 A;  4R7M A;  1WH5 A;  2ECC A;  5CYV A;  2C6P A;  1IUF A;  2VI7 A;  1Z7L A;  4D7M A;  3IH3 A;  4HX4 A;  1MJB A;  4YRV A;  4CXF A;  3DLL F;  2ZEG A;  4UF4 A;  2IBD A;  1ZAR A;  4DOZ A;  2EV5 A;  4ETS A;  3WT4 A;  4E7Z A;  1HCR A;  1SD6 A;  2FUG 2;  2OZU A;  4KOV A;  4BJT A;  2JUC A;  4XL9 A;  3B6C A;  1X12 A;  1Z8L A;  2NMT A;  3S1Q J;  4CYO A;  2NS7 A;  1FYK A;  1M1E B;  3MAJ A;  1I21 A;  4D0P A;  1ZQ3 P;  4A37 A;  4CS0 B;  2XF6 A;  1DP7 P;  3FHZ A;  4ZY0 A;  5LBQ A;  3VYU B;  1QQI A;  4FD5 A;  3M3Y J;  4P4D A;  1TXR A;  1YLF A;  4G12 A;  4FHT A;  3RYP A;  5LLQ A;  5FLX K;  4FWU A;  3KZZ A;  3L2Q A;  4IPA A;  2RRE A;  5IX3 A;  3KFW X;  2MA3 A;  3B3V A;  3GUX A;  5JPH A;  2DFI A;  4A3E J;  1OIS A;  1OBR A;  1S7N A;  5AG4 A;  4MFD A;  4TNU A;  3D67 A;  2DF5 A;  1IUY A;  4ZY1 A;  4A0Y A;  1JT0 A;  5BMZ A;  1IRX A;  1IXR C;  2GBY A;  1ZR4 A;  3PJR A;  4QB9 A;  4R1H A;  1KUX A;  4ZYE A;  4L0Z B;  5G22 A;  3JAM K;  4AC0 A;  3D2M A;  4CYN A;  2MFZ A;  2ZOF A;  5F47 A;  4OAZ A;  4DQ2 A;  5E18 F;  5C4J J;  1IV6 A;  3JR9 A;  3DTK A;  4B09 A;  3V8L A;  3H5R A;  3R0A A;  3ZGK A;  3DKW A;  1IN4 A;  1TP4 A;  4IVN A;  4MHN A;  1WFX A;  2XEG A;  3RQ4 A;  4PJM A;  4XRS A;  4AB7 A;  3KZI C;  3G1M A;  3HEF A;  4CYD A;  3LOD A;  4PV6 A;  4RBO A;  1APL C;  3DR8 A;  5K5O A;  3KZY A;  5JHU A;  2GWR A;  4CZZ A;  1IU8 A;  3IJ3 A;  2Y48 A;  5LRJ A;  2WA0 A;  3RKQ A;  4L9V A;  1V0C A;  1Z67 A;  3A0H C;  3DP7 A;  1WZ2 A;  1VQ7 I;  2CGP A;  2G3A A;  4FD6 A;  2QLZ A;  3C2H A;  3J7Z I;  4XNH B;  1ZK8 A;  3JRE A;  5KTA A;  3BR5 A;  4HNT A;  1D3Y A;  1FP1 D;  5FLM J;  2DA5 A;  2DTZ A;  3K4K A;  2VJJ A;  2B0L A;  4XKB A;  2B9S A;  4MEY F;  2C6C A;  4MCR A;  3S15 J;  3RPQ A;  1F2O A;  3FF3 A;  4OME A;  3OIO A;  5DV5 A;  2PG4 A;  3Q9S A;  2PJR B;  1Q2C A;  4BMH A;  4CGZ A;  1T98 A;  2V9P A;  2VIX A;  4G1P A;  4LQG A;  2K9S A;  2QBY B;  3KE2 A;  4MFJ A;  2QF7 A;  4NQW A;  2EV6 A;  3DGV A;  1IIC A;  2R7F A;  3VAR A;  2NRA C;  2CQX A;  5HVG A;  1QSM A;  3CPX A;  4EMS A;  3HTU A;  5EEA A;  3VB2 A;  2QA4 I;  2FF4 A;  3FX3 A;  5BOX A;  2NVX J;  2WBM A;  4YRH A;  1F1Z A;  2PE3 A;  2DT5 A;  5LYI A;  1K78 B;  1LAN A;  3QB8 A;  1FPQ A;  3CUQ A;  3GUD A;  2HVR A;  1YE9 A;  2HKX A;  2K9L A;  4KSA A;  1SAN A;  2KDZ A;  4AID A;  5F1J A;  1PYV A;  1DDN A;  3DEE A;  4Y4R A;  1KZF A;  5FJ8 J;  4ESF A;  2O5R A;  3P2H A;  2BEO A;  2GOX B;  4CAX A;  5FLV A;  2H5M A;  1D0X A;  1XGN A;  4E7S A;  4MFE A;  2OD5 A;  2VT3 A;  1LDJ A;  2XVC A;  2UZK A;  4ZX8 A;  1JHH A;  3TOA A;  3K4C A;  4KA4 A;  3O6B B;  4ENN A;  1H89 C;  1OCO H;  3F8N A;  1SMY F;  4EGY A;  1KU7 A;  3HSE A;  3RPU A;  1T56 A;  3VOE A;  2HQR A;  8CPA A;  2J8R A;  4ESJ A;  5FLX Z;  3A1Y A;  3OYE A;  3CC7 I;  4ENK A;  3GF2 A;  4DJA A;  4H4K C;  1Z21 A;  3COA C;  2YNE A;  4CGL A;  1VKC A;  3KHX A;  3DPT A;  4OC4 A;  5KNL A;  4ZYH A;  2VBY A;  1XN7 A;  3KEO A;  5CQE A;  5F27 A;  2PJ0 A;  3IGR A;  4QPQ A;  4E0A A;  1IB1 E;  2KJB A;  1AHD P;  4IF4 A;  3VYT B;  3LSR A;  3EYI A;  4J3G A;  5A27 A;  2PDO A;  1UMQ A;  1DGW Y;  4ZDP A;  2DFH A;  3KYD B;  2QQB A;  4FX4 A;  3GZ5 A;  1BR2 A;  1JUP A;  2RB7 A;  1MBF A;  3G1L A;  3V7C A;  4HF0 A;  4HG2 A;  4JK1 X;  4D5F A;  2DYR H;  4GYG A;  1AWC A;  3S93 A;  3G2B A;  2EBI A;  2OF7 A;  1FTZ A;  1MD0 A;  2W82 A;  5M5X J;  1VQO I;  2JJ7 A;  4A0X A;  1J4J A;  3J80 K;  1R9T J;  1VQ5 I;  1O3Q A;  2OPT A;  3TDU C;  4O23 A;  2R7O A;  3ZMD A;  4L89 A;  1Y1W J;  2STW A;  4CYC A;  1U5T A;  2R7T A;  5LRK A;  4M3D A;  2BY1 A;  2Q0Y A;  2CUF A;  4PXE A;  5LYL A;  5F08 A;  4HST A;  5EYR A;  1RR7 A;  3UR3 C;  1CP7 A;  4Q4Z F;  1MMD A;  5M5Y J;  2JRM A;  1IN6 A;  2KDO A;  1R57 A;  3IWZ A;  3H3V K;  1NH3 A;  1CPS A;  1N25 A;  4HPQ A;  4NNJ A;  4L5E A;  4O5V A;  2ZCW A;  3N05 A;  4FX0 A;  1H0M A;  5CVI A;  2BO9 A;  4N0B A;  3FK6 A;  1B9M A;  1Z3X A;  3LFU A;  2HUZ A;  4OP4 A;  2JRT A;  2G0E A;  4R57 A;  4G7Z F;  2XF7 A;  4G94 A;  1I1G A;  4ZX9 A;  1HKS A;  4M6H A;  1IG7 A;  4OKO A;  3WHB A;  1BJZ A;  4R76 A;  3EC4 A;  3TP3 A;  2CSO A;  4LB6 B;  5L3C A;  1ZRE A;  4I02 A;  2JDC A;  2EA2 A;  5D6F A;  3K9T A;  4BE2 A;  4I0B A;  4EQQ A;  4P55 A;  1IOI A;  4Q36 A;  3C2G A;  2L9V A;  3DWL E;  3R96 A;  1FWZ A;  3FBI B;  2ESN A;  3E0J B;  4WWC A;  4HBL A;  4NEX A;  4DJL A;  4AD9 A;  1X1A A;  4CCM A;  2PX9 A;  4DYO A;  2DDA A;  1Y1V J;  4A3L J;  3ZP5 A;  1Z2L A;  1LEA A;  1Q1V A;  4Z2Y A;  1I1S A;  3DBH B;  4XOR A;  5FRM A;  3CC4 I;  1VIX A;  2BY2 A;  3GCM A;  2EK8 A;  4FCY A;  5BNG A;  3WGH A;  3ML6 A;  2OOT A;  3AAF A;  1NK3 P;  1IGN A;  2NYQ A;  3ZMU A;  3W6J B;  2EWB A;  3J81 K;  1IJW C;  1ZN2 A;  4A95 A;  1S29 A;  2K5T A;  3PP9 A;  3FEC A;  2Z0Z A;  3BOQ A;  2VE9 A;  4JJX A;  2HS5 A;  2CNS A;  4IHW A;  2E71 A;  3IAS 2;  4NGS A;  3UY5 A;  2QIR A;  1QHG A;  3K70 D;  3DDD A;  3K4N A;  1O3T A;  5ICC A;  1A6I A;  5M5W J;  3DEW A;  4G7H F;  2Z3P A;  4KT5 C;  1FOX A;  2XUB A;  4NJR A;  4KIS A;  3NA6 A;  3CTA A;  3FYN A;  4Y17 A;  3RNZ A;  2PFB A;  5IYB J;  4B8X A;  2QSF X;  1SVM A;  5JFR A;  2RFH A;  2CQN A;  1AA7 A;  1SFK A;  2IS4 A;  3CUQ B;  3H3U A;  5H6Q A;  3SQN A;  2V1U A;  1TWA J;  4A39 A;  2EWN A;  1Z8T A;  1EJ9 A;  2F48 A;  4QBJ A;  2M0C A;  3HGG A;  2CW8 A;  3MFK A;  1XC5 A;  2BUE A;  4PDK A;  2EA4 A;  4AVB A;  5IB0 A;  3BR2 A;  3IKV A;  4KIT B;  2OB0 A;  1G3T A;  1YIJ I;  4M6X A;  2Q51 A;  3S9M A;  3W6V A;  1D1B A;  4GXH A;  5HNH A;  2HI3 A;  3CMM A;  2HV2 A;  4PGG A;  3QP5 A;  1WSU A;  2LSO A;  2JEV A;  3MKY B;  3FXO A;  4BUP A;  1S7O A;  3A0B C;  3ZMV A;  4BQQ A;  3K4B A;  4MTE A;  4C9Y A;  2VLA A;  1JGG A;  1YW7 A;  1XS9 A;  4GO1 A;  2CW7 A;  3WOD F;  2YND A;  4KIF A;  3NH5 A;  1KON A;  1H8A C;  3PIO F;  4LLG F;  1TWH J;  1Z1D A;  3SEZ A;  4ABZ A;  4P4B A;  2HQN A;  4M3B A;  1LDD A;  1NMT A;  5J1Q A;  2QEN A;  5E3L A;  2Y75 A;  1UHM A;  1DP3 A;  2VQH A;  1U5T C;  3J7Y J;  1QO0 D;  3IHU A;  1Z77 A;  1T0F C;  1TZL A;  3W2W A;  5K5R A;  4DW6 A;  3I56 I;  1POG A;  2WWY A;  1IRZ A;  4HLX A;  5EBV A;  2M0M A;  4QVT A;  3HUV A;  5HS9 A;  4WX9 A;  2AHQ A;  2ZJ2 A;  3BTJ A;  5C88 A;  4BYY A;  4AM3 A;  3FMC A;  1RPW A;  3FMS A;  3VSL A;  3WC7 A;  1XGS A;  1NTC A;  1B9N A;  2KIM A;  5AIP A;  3CP8 A;  1A5J A;  2DOF A;  1ETY A;  3OYB A;  5GAD J;  3A02 A;  3BHX A;  1WJ5 A;  1KU2 A;  2P0W A;  2L9R A;  4HSR A;  3RO0 A;  2HWV A;  3BJ6 A;  3HOS A;  2CTC A;  4L5J A;  2CO5 A;  3CF5 F;  4PQA A;  3IRR A;  2CUE A;  3ZQC A;  1S6L A;  3N7Z A;  5F48 A;  4CYC B;  2B4D B;  2P5L C;  3KI9 A;  3IH4 A;  3EFA A;  4X3R A;  1SFE A;  1TQI A;  2QYV A;  1XX5 A;  3BR1 A;  5FKO A;  1I3A A;  3EY5 A;  1SQH A;  3BP8 A;  3J81 Z;  3H3Z A;  3UKG A;  4PK2 A;  1MSE C;  2ZPA A;  2RC4 A;  3ERM A;  2NVY J;  2A6T A;  5LHG A;  4OIN F;  1V5E A;  1SD5 A;  1Z4R A;  4ZYD A;  3V7R A;  4CUG A;  1VHS A;  2EJR A;  4XOT A;  1YJW I;  2AS5 F;  4EJU A;  2NSM A;  3I3G A;  2Y30 A;  4NF1 A;  4FE4 A;  3IRQ A;  2E2J J;  2QKM B;  3BR3 A;  3BJO A;  4U0V A;  4A38 A;  4KIB A;  2V77 A;  2PJ2 A;  1CJW A;  1HA8 A;  3TOB A;  3TW6 A;  2AFW A;  4Q7A A;  4ZY2 A;  1EH8 A;  1W36 D;  2ZXH A;  3OOU A;  5H2F C;  4XLP F;  2A5W A;  4BBH A;  3GXO A;  3PFY A;  1WJF A;  1Y7R A;  4DZJ A;  1MMN A;  3IO1 A;  2CJJ A;  1XMX A;  2O4H A;  3V7Z A;  2JA7 J;  3DNS A;  3LQR A;  4E70 A;  4KUA A;  1WJC A;  4JQF A;  2Y9Y A;  2IJZ A;  1MBG A;  1OMI A;  5LEJ A;  2V79 A;  1KU3 A;  3DFG A;  3JRH A;  1VQ8 I;  1G2H A;  3L2W A;  1GV5 A;  2HQY A;  2AFU A;  2VL1 A;  3OYD A;  4NFR A;  2FNP A;  2BVL A;  5LHI A;  2AFS A;  3H35 A;  2PBI A;  3GYA A;  3WTV C;  4LOC A;  5E3N A;  4NSQ A;  1XOV A;  4ONU A;  3L2U A;  4B6Z A;  2LFB A;  3GFM A;  4R79 A;  1VZ0 A;  3W6K B;  3NQO A;  1IN7 A;  1BO4 A;  4KZT A;  3MGD A;  4KIC A;  2EIM H;  3MMY B;  4EGZ A;  3KET A;  3BLN A;  1T8I A;  3SZG A;  1P6R A;  3LD2 A;  4M6G A;  1N75 A;  1V3F A;  2KRC A;  1A36 A;  4ZGY B;  5ELY A;  2VQC A;  4KVM E;  3OYK A;  1EKE A;  4HA8 A;  4DYQ A;  4MLO A;  3SI1 A;  3CES A;  2JT1 A;  2L02 A;  2E34 A;  3IV5 A;  4BNC A;  2LNB A;  3LST A;  2O28 A;  3TE4 A;  1RUN A;  4II9 A;  4DYC A;  5D29 A;  1WI3 A;  3GB0 A;  1BIB A;  2Z33 A;  3D66 A;  4RAY A;  4R9M A;  1BLL E;  3P7N A;  5ED4 A;  2HB6 A;  3SHP A;  2JTV A;  2XAH A;  4BEH A;  3GTG J;  2PJA A;  2MH9 A;  4IJA A;  4F3Q A;  3HGY A;  4A3I J;  2NNY A;  2FQ4 A;  2K85 A;  3QYF A;  4UFW A;  1YRE A;  3GVA A;  3CT9 A;  2HPI A;  5DD8 A;  3WTW C;  3DTE A;  1R1U A;  2JVG A;  4XPK A;  2R7D A;  3ELK A;  4ZZL A;  1JQG A;  2DJN A;  5IOZ A;  2GXB A;  2KIF A;  1XF8 A;  1R36 A;  4K2E A;  4BQA A;  2VE8 A;  1S7K A;  2PJ6 A;  1LVK A;  3KYC B;  1D8J A;  1U2W A;  4PFP A;  1B6B A;  3CXP A;  4IHX A;  4A3B J;  5L3G A;  1GHE A;  1FMV A;  3BZK A;  2WZN A;  4IRH A;  1G8X A;  3IWE A;  3CXQ A;  2O03 A;  3EUH A;  3WTY C;  1W0T A;  1R43 A;  4G6T B;  4B4C A;  1JUM A;  2JBK A;  1ZGW A;  1P7J A;  1FIP A;  4RLQ A;  5EGO A;  2CXA A;  1MBJ A;  3KEQ A;  4UIA A;  5A28 A;  2XRN A;  1LEB A;  4C2Z A;  4LFU A;  4PUS A;  2YX4 A;  5DDG A;  1A6Q A;  3D0S A;  3GFL A;  5BPD A;  1HDQ A;  4CRY B;  2G9W A;  3L9F A;  1FT9 A;  4YFX F;  3D7G A;  3QU3 A;  3W6S A;  2BXY A;  4IRG A;  2A3S A;  5GPA A;  3GTQ J;  1J75 A;  2ZFW A;  2XRL A;  3D5S C;  3HC7 A;  2V1N A;  3QYE A;  3WU1 B;  4KOW A;  5I0C A;  4I7H A;  2O8X A;  2G0B A;  4YII A;  2OZH A;  3BWG A;  2LMD A;  2X48 A;  4HW0 A;  1O3S A;  4NGP A;  4ZYG A;  3N97 A;  1MK4 A;  1LPQ A;  2EFP A;  2X1C A;  1STZ A;  3HUG B;  3LNQ A;  4BJ5 C;  4UXN A;  4U5Y A;  4BAY A;  2FE7 A;  2RKH A;  1P4W A;  3LL7 A;  1JKO C;  1SEU A;  2LF7 A;  2KLO A;  2LVS A;  5FFX A;  4IHT A;  3W91 A;  4K3N A;  1IAW A;  5DUI A;  3GIU A;  3F8F A;  1U6G A;  3OYG A;  5KTD A;  3HOV J;  3H36 A;  4MJ8 A;  3W2A A;  2MG4 A;  1DU0 A;  2K4J A;  3FDY A;  4EJO A;  4KLV A;  2COB A;  2IP2 A;  1V4R A;  2XV4 S;  1G3S A;  3GTM J;  3CUO A;  2OQG A;  4UIB A;  4OAD A;  4XQF A;  4A0Z A;  1ZGJ A;  2RQQ A;  3T8R A;  4IK2 A;  3S9N A;  3S2W A;  5CQG A;  1XG1 A;  2ZNZ A;  4Z6Y A;  1XPX A;  2OUM A;  4BE1 A;  4U0Y A;  3T1B A;  4B3A A;  4A69 C;  4AVP A;  3IKT A;  4NB5 A;  4KOY A;  2VB6 A;  1OCC H;  1NHA A;  3WG7 H;  3MRU A;  3Q0U A;  3REO A;  2OV7 A;  1D1A A;  3BC8 A;  3JRC A;  2F4M B;  3FMQ A;  4A3D J;  1U0J A;  1G3Y A;  1W7P A;  1VHO A;  4B5P A;  4HNY B;  2DT6 A;  2CQK A;  3Q9V A;  3D3S A;  1FMW A;  1Z3Y A;  1WKM A;  3PB8 X;  1TKH A;  3FRM A;  3FZV A;  3LA2 A;  3NEU A;  2O7O A;  4GCV A;  3BY6 A;  4Y7N J;  4RB2 C;  1VQ9 I;  2DA7 A;  4WWV A;  4JBA A;  3NE8 A;  2R92 J;  5LRS A;  4W97 A;  4YEJ A;  5HNF A;  1BR4 A;  5D8L B;  2R7Z J;  3KP3 A;  1S7F A;  2K9N A;  3K6G A;  2Z16 A;  2DMP A;  3CMY A;  2CV0 A;  2PJ1 A;  5H84 A;  4OWR B;  4I99 C;  2B7E A;  1S8N A;  2Y9Z A;  2DPU A;  3K10 A;  3A4C A;  3L7W A;  1E3H A;  1WI9 A;  1EF4 A;  1X1P A;  4ZYA A;  3S2H J;  1VQ6 I;  1R5G A;  3ABK H;  5K1Y A;  5KHD A;  3DR6 A;  3RQI A;  3QPH A;  3JCU C;  5KAF C;  4Y33 A;  2VC0 A;  1R71 A;  5LRG A;  1IOF A;  1XB4 A;  5LYD A;  1XCV A;  2YSR A;  3ZOB A;  1Y7E A;  1WPK A;  4RM2 A;  4L8A A;  5JM6 A;  2L2O A;  2IEK A;  2QYO A;  2PJR A;  2Z2S B;  2F4O B;  5C3E J;  4MHP A;  1XRY A;  3DCF A;  3DF8 A;  3LSI A;  2W1O A;  3TBI A;  5DCF A;  4B3X A;  4A5N A;  2EQR A;  4RB3 C;  2GM4 A;  1FSE A;  4IQ4 A;  1ZYR F;  2XKP A;  2QSG X;  1XFO A;  4N4N B;  2FOK A;  1ZHF A;  2V7F A;  3MCZ A;  2F5D A;  5HS7 A;  4E7L A;  4OC3 A;  4UA3 A;  4LX9 A;  5E3O A;  5M3F J;  1FYM A;  3FJU A;  2ISZ A;  3GTL J;  3JTG A;  2P8T A;  4IUS A;  1K78 A;  1H8L A;  1U9N A;  2H8W A;  1S72 I;  4BEH B;  2L7Z A;  2PMU A;  3GWZ A;  2M8E A;  3VFZ A;  3B8G A;  4BS9 A;  2D2W A;  1SFX A;  1O3R A;  1I39 A;  1P4A A;  4F93 B;  2O8K A;  2NVT J;  5HMN A;  2V4J C;  4ZZD A;  3GYH X;  2B4B A;  3TQN A;  3H5Z A;  3KGQ A;  4A5M A;  1OYY A;  2H6C A;  1T95 A;  2H94 A;  1WK4 A;  2ZJR F;  3D7D A;  4BH9 A;  1RZ4 A;  2X6X A;  2MW8 A;  4A6D A;  1RET A;  3DXJ F;  3FM5 A;  1F57 A;  4AU7 A;  2V26 A;  4KUM A;  5TGT A;  3CMA I;  2VQL A;  3TT2 A;  1Y9W A;  3HSR A;  4M74 A;  2CUJ A;  4A30 A;  1KZH A;  2Q7S A;  2AXT C;  2IJL A;  4O6J A;  2MGQ A;  5BPI A;  4UFX A;  2QSH X;  3L2C A;  2P7V B;  2IA1 A;  2WB1 A;  3ZQG A;  1W0U A;  4CPA A;  3HHH A;  2PMH A;  1JHF A;  1YGH A;  1ZTR A;  2Z1D A;  3OR2 C;  1QSR A;  4JLY A;  1D8K A;  5EGO B;  2R7U A;  3Q0W A;  4L9J A;  2JSC A;  1QQ9 A;  4HNV A;  4XN0 A;  1AU7 A;  1ITY A;  1HXD A;  2WV0 A;  4XBF A;  3GKR A;  4OC0 A;  3KLN A;  3VYS B;  3G1O A;  2EFW A;  5FO5 A;  4HPS A;  3CDI A;  1YTY A;  4UCN A;  4DNC A;  1YQA A;  4RN7 A;  4RA2 A;  3NRV A;  4BQO A;  2E1M B;  1JGS A;  2IGM A;  2L7M P;  1P4N A;  4E7J A;  2BY0 A;  3QP6 A;  2QQ9 A;  4B47 A;  4EAT A;  3CO6 C;  4ZI6 A;  2XSD C;  2L54 A;  1XGM A;  1Z05 A;  4DBR A;  1U8B A;  1ZLJ A;  2VT2 A;  1MZB A;  2ID6 A;  4QUS A;  4XLF A;  3F72 A;  3BT9 A;  5J4Y A;  2LY1 A;  3FXL A;  2Q04 A;  2HQA A;  3H0G J;  3MZH A;  3CCE I;  3FM3 A;  1J59 A;  1FBU A;  3G4S I;  1AKH B;  4WK8 F;  2Z3K A;  3L1P A;  3KPH A;  1SAU A;  3LSM A;  5C44 J;  2VBZ A;  4M6V A;  4I6Z A;  2E35 A;  2KIU A;  3WE2 A;  1Z8W A;  2GAN A;  1O57 A;  1JKR C;  3KHZ A;  3ZJ0 A;  5B5E C;  5F04 A;  4DZP A;  4QIW N;  1IDZ A;  3T9Y A;  5EJC A;  3PO2 J;  4AG7 A;  3E97 A;  2ZBK A;  4RAG A;  4WCG A;  4YIF A;  1YFH A;  1T38 A;  1G6N A;  3A03 A;  2LF8 A;  1SAX A;  2J5P A;  3ABM H;  2M34 A;  3HJE A;  5TJJ A;  4OIR F;  2BCO A;  1UG0 A;  2NOG A;  4NGN A;  1IO2 A;  4CA0 A;  4ENJ A;  4RGR A;  2D45 A;  2MYS A;  1PP7 U;  1VQP I;  1G4D A;  1ARM A;  1JUS A;  5TRD A;  1SFO J;  1R1V A;  3A9L A;  3GZN B;  4JD6 A;  1IW7 F;  2OJE D;  2OU2 A;  2KT0 A;  3WU2 C;  3U21 A;  2VZZ A;  4N9H A;  4JWP A;  4BY7 J;  3VDX A;  1LQ1 A;  1R00 A;  1W7P B;  3R60 A;  2LR8 A;  4P9U A;  4B5P B;  2JA2 A;  3B2Y A;  3GW2 A;  1IRG A;  4KN7 X;  2XF5 A;  2WY8 Q;  4HV6 A;  3WTS C;  3IUO A;  1LUJ B;  5AGE A;  2ELH A;  1YW6 A;  2FVG A;  1RUO A;  5HLT A;  2QCO A;  2BGC A;  4X5K A;  4XNH C;  4BXX J;  1RC9 A;  2WY7 Q;  3QOD A;  2O61 A;  5GCN A;  4IHS A;  2HVQ A;  1I27 A;  4M9X A;  1IZ1 A;  1XTA A;  4UUS A;  2A4N A;  3H9Q A;  2JPC A;  3BQZ A;  3ZQI A;  3ZQ7 A;  1A2Z A;  4ESB A;  1X3U A;  1IXC A;  2KMU A;  5DCM A;  4I2O A;  3SHF A;  2GLJ A;  1QVT A;  4NCZ A;  2DXI A;  3GX4 X;  1YS6 A;  1S7A A;  3LWU A;  1WJA A;  2ZSH B;  3A2K A;  2BE5 F;  4A3F J;  4IXA A;  2QZ8 A;  3JRI A;  1K79 A;  2BY3 A;  3KIO A;  3GTK J;  2NNN A;  2ADU A;  1RI7 A;  4UB6 C;  3S6F A;  4PZJ A;  1OZP A;  3O3K A;  4CCK A;  2Q43 A;  3OYA A;  1UEL B;  3GY9 A;  1J7K A;  4EME A;  1WJB A;  1KQ0 A;  2GIZ A;  3K4M A;  2G9D A;  3FX6 A;  1Y6I A;  2QGU A;  4R3L A;  1VFC A;  1IF1 A;  1ZLI A;  2ZW5 A;  1S3J A;  3U2R A;  3D5R C;  4P9F A;  3R9F A;  4A33 A;  4CYQ A;  1JXS A;  1WCM J;  3OV8 A;  5J1R A;  1OJL A;  4A2U A;  2KIS A;  2R98 A;  5DWN A;  1UWY A;  2P5V A;  1Q1H A;  1Z5R A;  4UEF A;  1T39 A;  4B13 A;  3AG3 H;  1S60 A;  5GTH C;  2PJB A;  1M4G A;  4Q47 A;  4MHY A;  2XAF A;  1M4L A;  1LB2 A;  2O9L A;  2OCC H;  5EF6 A;  1X10 A;  1VTN C;  3B3T A;  3TP0 A;  4UEE A;  4HZF A;  2IT0 A;  1GVJ A;  2X6W A;  3WHC A;  2FXF A;  3RKX A;  1PVE A;  4Q5S F;  4C2X A;  5F09 A;  2XHK A;  2F2E A;  3HSF A;  5H86 A;  3HHG A;  2DW4 A;  3B3S A;  4TWE A;  3K1P A;  3E6C C;  5J47 A;  2ARH A;  3S3M A;  1BI1 A;  2FNA A;  2YUS A;  2VKE A;  4IRI A;  2F5E A;  2LDU A;  4FTH A;  1CM0 A;  4KNY A;  3QAH A;  1OR7 A;  3K4L A;  2CS3 A;  3KZW A;  1LFW A;  3CCY A;  5M3M J;  1BOA A;  2JEW A;  3JSO A;  2WAQ N;  2ME6 A;  4KOS A;  4B1R A;  1HDP A;  4XLA A;  2IS6 A;  1QU3 A;  2FS5 A;  1L0C A;  1QZZ A;  3C3W A;  4AXV A;  1BL0 A;  2YU9 J;  1JT6 A;  1OLT A;  5HLI A;  4P45 A;  4V19 K;  2ZEM A;  2FIA A;  4C3I J;  3V8I A;  1DPU A;  2K3P A;  4U88 A;  4HNX B;  5EEG A;  4HKF A;  4C30 A;  1R1T A;  1XD7 A;  2OCE A;  2GA2 A;  4HX7 A;  5BQT A;  3D1N I;  2PJP A;  4YG2 F;  3RZD J;  2Q8K A;  3VWB A;  1HF0 A;  2ZXJ A;  1LOK A;  4RGU A;  4XLN F;  4RAF A;  3SI0 A;  3SI2 A;  1UCR A;  2D1H A;  2B4D A;  5KVR A;  4EV0 A;  2E7W A;  2J5O A;  3OYM A;  5F46 A;  2EZL A;  1O4X A;  1LFP A;  4FAI A;  4LUA A;  2R7V A;  1FSH A;  3CD6 I;  1I3Q J;  1P0H A;  3JRB A;  1S3Z A;  4P5O A;  4MY3 A;  4BAC A;  2G7H A;  3LSK A;  1UAA A;  2X6Y A;  4L9T A;  3BG5 A;  3FKJ A;  4GFB A;  2DTR A;  4XN3 A;  2Q44 A;  4CHU A;  2NYX A;  4B11 A;  1SD7 A;  4CAV A;  3FKI J;  3BG7 A;  2MLK A;  3IL2 A;  4P96 A;  4RDU A;  2BV6 A;  1F9N A;  4XRF A;  5IP7 J;  3ERE D;  2MD0 A;  2R7R A;  1TF8 A;  2ZEN A;  3B3C A;  3R9G A;  5E17 F;  2OZ6 A;  1NE9 A;  2UXN A;  5K7Z A;  2CIJ A;  1TT5 B;  3IIB A;  3C2B A;  3LSG A;  2V8D A;  3CLO A;  4NDL A;  3HTS B;  3NAR A;  4UB8 C;  3LAJ A;  2DXQ A;  3FIW A;  1RTQ A;  2KRF A;  1QPM A;  1QBJ A;  4S05 A;  1GT0 C;  5FD5 A;  3BR6 A;  2VKV A;  3ABT A;  4X2T A;  4UUS B;  4YU9 A;  2VL8 A;  4EEF G;  1VQN I;  2JA6 J;  2IXS A;  1B1B A;  1R58 A;  2JLM A;  5IP9 J;  2QWW A;  4LG3 A;  5DCM B;  3J7A Y;  1MSF C;  3ZPL A;  3BPX A;  5D5V B;  3PUB A;  1Z9U A;  2M87 A;  3WTX C;  3BPV A;  1UHW A;  2C1C A;  1VQM I;  2DPD A;  3CME I;  2ZNY A;  1ETQ A;  3BXM A;  2P7C B;  4U7D A;  5G21 A;  3WTZ A;  5EZG A;  3CUQ C;  5IOY A;  2IS2 A;  2MSY A;  2L3D A;  2GQQ A;  2MC3 A;  4ENM A;  1W5C C;  1X3W B;  3NWT A;  3W3C A;  3I64 A;  1N77 A;  1MKM A;  2HOS A;  3RYR A;  4IKF A;  3KEY A;  1Y0Y A;  4JXQ A;  1YLE A;  1ZG5 A;  2LY9 A;  1DE4 C;  2DK8 A;  2HNH A;  1B8I A;  2JA5 J;  1J9I A;  1K4J A;  3ZMZ A;  4DIQ A;  1PDN C;  4M72 A;  4PK4 A;  2LD5 A;  2AFM A;  4WXD A;  3PB6 X;  3WR7 A;  3FIS A;  1WWX A;  3I71 A;  1IC8 A;  4LGW A;  3OS0 A;  5F49 A;  1HST A;  1WHU A;  2EV0 A;  4CZC A;  1S7L A;  3O2P E;  2HKO A;  3L00 A;  5FVJ A;  5JQ4 A;  3RKY A;  4JYK A;  2VXK A;  5CVV A;  3V42 A;  4XOP A;  5J8F A;  1ZRF A;  3SYT A;  5HOD A;  3I59 B;  1F43 A;  3F0A A;  2ELJ A;  3IFE A;  2RGV A;  1OR7 C;  4GYI A;  9ANT A;  3PFO A;  3JRF A;  3AL0 B;  3OS2 A;  2I5U A;  4MGR A;  1P92 A;  5L3D A;  2NVU B;  1JKP C;  4IHV A;  1QRY A;  2E19 A;  4I09 A;  5ERI A;  2LBF B;  5JR3 A;  4YIR X;  2PC1 A;  2ZED A;  4UV8 A;  1EE3 P;  2V1X A;  1J0R A;  4U0W A;  3I4P A;  3KR5 A;  3T0Y A;  2X1D A;  5IT3 A;  2W48 A;  1O7L A;  3BCB A;  3R1K A;  1R4M B;  2JVH A;  4HEA 2;  4AIH A;  5IP6 A;  2CY2 A;  2CH0 A;  1OPC A;  2L5Q A;  3KCC A;  5JVT A;  5B66 C;  4M6I A;  3PM1 A;  4BGD A;  5LGU A;  3RBU A;  2LKP A;  2M2E A;  2BHY A;  2E1O A;  3E3V A;  4KSI A;  5K5Q A;  3QNV A;  4DBQ A;  1BM9 A;  3TFY A;  2WAQ A;  2DBB A;  3M1E A;  4H6Z A;  2K9Q A;  3BTC A;  2QVP A;  2EB7 A;  1R22 A;  2MH2 A;  2L4A A;  1K61 A;  4PXD A;  2ICW G;  3L2N A;  5HLG A;  1YI2 I;  1MH4 A;  3O8G A;  1B6A A;  1USS A;  5F0C A;  3R61 A;  2RAE A;  2Q2E A;  3HUG A;  3ISX A;  5J1Y A;  4M85 A;  4U9Z A;  1W4M A;  3PUF A;  1YSJ A;  4OMZ A;  3IEH A;  3CDX A;  4UVC A;  5C4X J;  3VEP A;  1YVO A;  2AFO A;  3OYC A;  4BE0 A;  3ASN H;  1PUF B;  4D5C A;  3G6E I;  1JTY A;  4RS8 A;  1H9G A;  4MNU A;  4NBQ A;  3FBU A;  2CQ7 A;  1TW2 A;  4ANJ A;  2CW0 F;  1LE8 B;  3SXY A;  5BWA B;  2OAZ A;  3M9A A;  5LEK A;  2M1B A;  1YME A;  2ZXV A;  2ZXW H;  2F7V A;  3BZC A;  3SZP A;  1WRJ A;  2V1D A;  2C6Y A;  2EK9 A;  2PI0 A;  2DCE A;  2Y31 A;  1OCT C;  3GLX A;  4KT6 A;  2DJI A;  4XKW A;  4B48 A;  2DA3 A;  5E8I A;  5TIS C;  4CIC A;  1QGP A;  1RKW A;  2VJ4 A;  4XRS G;  4CO8 A;  3ZXS A;  4P1W A;  5J4V A;  1AUG A;  4XMY A;  3OYL A;  1XE4 A;  4I01 A;  3S17 J;  2CUZ A;  2GFQ A;  4CGP A;  1X1C A;  5H20 A;  5KCM A;  1ARL A;  1WJE A;  4A3C J;  3EQL F;  5KTC A;  1J09 A;  1ETO A;  3OYF A;  1RRJ A;  5ICF A;  1KYZ A;  1ZRC A;  1F4K A;  4GS4 A;  4C2U A;  5DS0 A;  5J40 A;  3ISP A;  3BZ6 A;  4V2G A;  2STT A;  1M1D A;  3BI1 A;  3FXT A;  4MFZ A;  1MBH A;  1S5L C;  2W4S A;  2P6E A;  1Z91 A;  4PJ0 C;  2EIN H;  2XIG A;  2PJ3 A;  3GBG A;  1D5V A;  1Y0R A;  2ABZ A;  2AJ6 A;  2ZXI A;  3RI4 A;  3TED A;  3FHN A;  2RN7 A;  3PGP A;  3E5Q A;  2PJC A;  4H6U A;  1F36 A;  3S3N A;  2V6E A;  5C82 A;  1SVO A;  3X2Q H;  1ZR2 A;  1P9Q C;  1IGB A;  3D7H A; 
#chains in the Genus database with same CATH homology
 1MMG A;  1TIQ A;  4CYN A;  3DU5 A;  1S7F A;  2M4G A;  2MFZ A;  3K6G A;  2HPM A;  5F47 A;  4OAZ A;  2Z16 A;  1I12 A;  2CV0 A;  5H84 A;  4OWR B;  3S8P A;  3DTK A;  3OS1 A;  2RNG A;  3CJR B;  3IAM 2;  3K10 A;  3A4C A;  2WPW A;  3L2R A;  3H5R A;  3ZGK A;  3TL4 X;  4ZYA A;  2IS1 A;  2G3T A;  5FRN A;  1WFX A;  2DOA A;  3RQ4 A;  4PJM A;  4AB7 A;  1X1D A;  5KHD A;  3DR6 A;  4PV6 A;  3LOD A;  4RMN A;  4Y33 A;  3AL0 C;  3DR8 A;  3HL2 A;  1QSO A;  3D5L A;  3H9J A;  4OAE A;  4OAY A;  2LRE A;  4FD4 A;  2WA0 A;  2R7H A;  4H89 A;  4RM2 A;  4ORF A;  1V0C A;  4L8A A;  2L2O A;  3E1S A;  2YNC A;  2M4K A;  2PJR A;  3FB3 A;  4BXF A;  2Z2S B;  4JOM A;  2G3A A;  4FD6 A;  4XNH B;  3C2H A;  3LSI A;  3HPH A;  2W1O A;  5KTA A;  3TBI A;  4HNT A;  3K4K A;  4B3X A;  3FNC A;  2VJJ A;  4XKB A;  2FSR A;  4IQ4 A;  3JTK A;  5G1Z A;  1BOB A;  4N4N B;  4E6K G;  4BMH A;  1Q2C A;  4E7L A;  4UA3 A;  2V7F A;  2PJR B;  4PSX A;  4LX9 A;  4PJJ A;  3I3L A;  2VIX A;  1ERD A;  1Q2Y A;  4IUS A;  1M4D A;  3VWD A;  3VYR B;  2E60 A;  3JUW A;  1YK3 A;  4MFJ A;  1B87 A;  4CRZ B;  4BEH B;  1IIC A;  3B8G A;  2IL4 A;  4GRI A;  3PSI A;  4BS9 A;  4OLL A;  1QSM A;  4AVZ A;  3PL8 A;  4YRH A;  4F93 B;  2P6G A;  2WBM A;  1UFH A;  1XMT A;  2V4J C;  4XLE A;  5HMN A;  2B4B A;  3QB8 A;  3EUK L;  3PNT A;  3H5Z A;  2HVR A;  4NQW B;  2VQY A;  4JXR A;  1YE9 A;  1T95 A;  4FET A;  2K9L A;  1WK4 A;  4KSA A;  3W2V A;  4MFQ A;  2X6X A;  1PYV A;  2GOM A;  4PJL A;  2WSA A;  2WAF A;  3ONQ A;  3DEE A;  4Y4R A;  4Y3O A;  1KZF A;  4HNW B;  3SXN A;  4AU7 A;  2V26 A;  5TGT A;  2VBQ A;  3TT2 A;  2VQL A;  2O5R A;  3P2H A;  2GOX B;  1Y9W A;  4AG9 A;  4CAX A;  4M3S A;  2H5M A;  2CUJ A;  4BL0 B;  4HRI A;  1D0X A;  4MFP A;  4A30 A;  3OMY A;  3OYI A;  4E7S A;  2GE3 A;  2CV2 A;  4UFX A;  3F8K A;  4YFJ A;  2WB1 A;  2BW3 A;  3TOA A;  3K4C A;  2OC6 A;  4KOR A;  1YGH A;  4A2Z A;  4XR6 A;  2Z1D A;  2W00 A;  3OR2 C;  1QSR A;  4JLY A;  2R7U A;  3T90 A;  4XN0 A;  2J8R A;  3GKR A;  3DU6 A;  3A1Y A;  3M1C A;  2K9M A;  3OYE A;  2R7W A;  3VYS B;  2EUI A;  4DJA A;  4H4K C;  1Z21 A;  2YNE A;  4CGL A;  4ZTJ A;  1VKC A;  3DPT A;  2B5G B;  2WPX A;  4UCN A;  5KNL A;  2JSP A;  4XPD B;  4DNC A;  1K6Y A;  4E0A A;  5CQE A;  4BQO A;  3EO4 A;  3IGR A;  4QPQ A;  2E1M B;  1IB1 E;  2IGM A;  2X51 A;  1P4N A;  3K9U A;  4I49 A;  1NG7 A;  1NG6 A;  2Q2E B;  3VYT B;  4B47 A;  4EAT A;  4E7J A;  2PDO A;  2YGW A;  4J3G A;  4ZDL A;  5A27 A;  4NUB A;  1DGW Y;  4ZDP A;  3H0D A;  4DBR A;  4C7H A;  5LD2 C;  2HU9 A;  2LRD A;  4QUS A;  1BR2 A;  1X4O A;  4XLF A;  1V5F A;  1PU9 A;  4HG2 A;  3I9V 2;  2LY1 A;  2BVM A;  2Q04 A;  2HQA A;  2R4G A;  1RXT A;  2IGN A;  1N78 A;  2B58 A;  3S93 A;  2Z3K A;  3G2B A;  3LSM A;  1SAU A;  2MC4 A;  4F91 B;  4RI1 A;  3TO7 A;  2W82 A;  3HOT A;  3IP4 B;  2CV1 A;  2GAN A;  4ZTF A;  2F6C A;  1J4J A;  2Z3L A;  3ZJ0 A;  3BCA A;  1ZEL A;  3T9Y A;  3H5N A;  2BOL A;  4XNF A;  3NE7 A;  3TO9 A;  2R7O A;  4AG7 A;  4L89 A;  1D0Y A;  2NOJ B;  1YVK A;  2R7T A;  3PSF A;  4AVC A;  1QST A;  2I79 A;  2M3A A;  2CFO A;  3AKZ A;  4BDY A;  4J01 A;  2Q0Y A;  4HST A;  3UR3 C;  1UG0 A;  1MNE A;  1IID A;  4CGM A;  4CA0 A;  2F5I A;  2X7B A;  3TFY A;  1MMD A;  2MYS A;  4CSW A;  2IGO A;  2KDO A;  2VAS A;  3TMO A;  3ZR8 X;  1R57 A;  3ZQQ A;  4E8O A;  4CAW A;  4HPQ A;  1PJR A;  4NNJ A;  2XC7 A;  3A9L A;  4JD6 A;  3N05 A;  3OYH A;  3IU2 A;  2OU2 A;  4C7I A;  3U21 A;  4CAE A;  2VZZ A;  4JWP A;  3VDX A;  1Z3X A;  2M7A A;  3LFU A;  5HVQ C;  2HUZ A;  3G8W A;  4B5P B;  3QOE A;  1MMA A;  2F5V A;  5AG7 A;  2JA2 A;  4R57 A;  3HXL A;  2XF7 A;  2XSJ C;  5CPR B;  1KUY A;  2XF5 A;  2WY8 Q;  1D0Z A;  3SEQ A;  2B3U A;  4U9Y A;  1RO5 A;  4XON A;  3IUO A;  3DSB A;  5AGE A;  3C26 A;  3EC4 A;  4XLC A;  5HLT A;  4X5K A;  4XNH C;  4D9J A;  3S6H A;  3CF2 A;  2WY7 Q;  3QOD A;  2KQR A;  5GCN A;  3HG9 A;  3SXO A;  2E5N A;  4RLF A;  4EVY A;  3E0K A;  2HVQ A;  2REF A;  2JDC A;  4E4H A;  3AFH A;  4BE2 A;  2A4N A;  3H9Q A;  4C2Y A;  4Q36 A;  4IX7 A;  3C2G A;  1Q2D A;  2ZW7 A;  2WAD A;  3DWL E;  2KMU A;  3R96 A;  3W6X A;  3BJ8 A;  3FBI B;  4E7I A;  4AVA A;  3ZCO A;  3CXS A;  3E0J B;  4NCZ A;  4NEX A;  2DXI A;  1LRZ A;  4E2A A;  1WJA A;  1X1A A;  2DT7 B;  2ZSH B;  2VKD A;  4CCM A;  5E96 A;  3A2K A;  3FBN B;  2LYC A;  2JDD A;  3FIX A;  1M4I A;  5HH1 A;  3H9G A;  2WAE A;  2LOO A;  3S6F A;  3OL4 A;  4KVO E;  4XOR A;  1QSN A;  1OZP A;  5FRM A;  4CCK A;  3GY9 A;  3OYA A;  1UEL B;  4U87 A;  2QEC A;  1WJB A;  2VKH A;  3DPL C;  2W7N A;  1S5K A;  3K4M A;  4UWJ A;  1Y6I A;  2VXD A;  4R3L A;  3ZZI A;  3R9F A;  2ZW5 A;  4A33 A;  2VPL A;  3D5R C;  3EXN A;  4CYQ A;  1N71 A;  4A95 A;  2K5T A;  2KL4 A;  3MD2 A;  2R98 A;  3IU1 A;  2Z0Z A;  3KX2 A;  3PP9 A;  4XKV A;  2CNS A;  2VXZ A;  4JJX A;  3IAS 2;  5DWN A;  4Q38 A;  3UY5 A;  3EUH C;  2QIR A;  3HKZ A;  1QHG A;  2UV1 A;  2UUZ A;  3UNG C;  3L2V A;  3K70 D;  3K4N A;  1V5G A;  3DDD A;  4B13 A;  1S60 A;  5G20 A;  1GLN A;  1M4G A;  2Z3P A;  4UBR A;  2Z3M A;  1MW7 A;  4KIS A;  2FT0 A;  2R8V A;  3KYL A;  1X1B A;  3FYN A;  1LKX A;  1S9H A;  2E5Z A;  2ZSI B;  2BEI A;  2X6W A;  4BJ6 C;  3H4Q A;  4KUB A;  1AA7 A;  1G59 A;  1SFK A;  2IS4 A;  1E0E A;  2DPT A;  2FXF A;  1WWZ A;  2ZW6 A;  4XPD C;  3BG6 A;  2REE A;  4C2X A;  4CAF A;  3OL3 A;  2D4P A;  5H86 A;  4QPO A;  2J8M A;  2Q7B A;  3PZJ A;  4QBJ A;  3OIQ A;  2KRH A;  2CW8 A;  2FCK A;  2BUE A;  1YR0 A;  2ARH A;  3DLA A;  4AVB A;  5IB0 A;  3S3M A;  1YX5 A;  4KIT B;  2OB0 A;  4QC6 A;  2Y0S A;  1CM0 A;  1D1B A;  3QAH A;  5ISV A;  2EVN A;  3QYB A;  5HNH A;  3K4L A;  2CS3 A;  4CCN A;  2HVS A;  1XIX A;  2BW3 B;  3CMM A;  3OIP A;  2AE6 A;  2HV2 A;  4ZBG A;  3S6K A;  3TCV A;  2JEV A;  3ZRG A;  3MKY B;  4BUP A;  4BQQ A;  3K4B A;  4C9Y A;  2VLA A;  2F4I A;  4PFO A;  4KOS A;  4CGN A;  2CW7 A;  2YND A;  1IYL A;  2V9K A;  4XLA A;  2OH1 A;  2LH9 A;  1KON A;  2QKL B;  2IS6 A;  1QU3 A;  2Z3O A;  2KPM A;  2KCW A;  3SEZ A;  2FS5 A;  1L0C A;  2Z10 A;  4KJZ A;  2XDV A;  3OYN A;  1NMT A;  4FD7 A;  3DKX A;  1OLT A;  1ZO0 A;  2M7B A;  2FIA A;  3V8I A;  1DP3 A;  2VQH A;  2K3P A;  3RCO A;  2CNT A;  1WJD A;  3W2W A;  1T0F C;  1TZL A;  3I9S A;  4HNX B;  2JUG A;  3K4J A;  1M44 A;  2K5C A;  3CJQ B;  4HKF A;  5EBV A;  4C30 A;  3JVN A;  2M0M A;  4QVT A;  2PQ8 A;  4BQN A;  3VWB A;  5C88 A;  2ZW4 A;  4B10 A;  3IWG A;  4A31 A;  3VSL A;  2X85 A;  5EC4 A;  4KOX A;  4PJN A;  3D2P A;  3CP8 A;  2B4D A;  2OZG A;  4UWI A;  4R3K A;  3RPU D;  3OYB A;  3VSK A;  1WJ5 A;  2P0W A;  2L9S A;  4ZC3 A;  4ZJZ A;  3OYM A;  2FIW A;  5F46 A;  4MI4 A;  4HSR A;  3HOS A;  1LFP A;  3MKW B;  4ZDO A;  2PRB A;  4JXQ A;  2KHM A;  1QHH D;  2VJI A;  2R7V A;  4LUA A;  4Y49 B;  2VZY A;  1P0H A;  2B4D B;  3N7Z A;  4MBU A;  5F48 A;  3TTH A;  4B44 A;  1S3Z A;  4P5O A;  3D8P A;  3EFA A;  4MY3 A;  1JI8 A;  2LY2 A;  4BAC A;  3LSK A;  3RSN A;  4D1Q A;  2X6Y A;  2L9N A;  3DTI A;  1UAA A;  4XKC A;  3EY5 A;  3K70 C;  1SQH A;  3FKJ A;  3OYJ A;  4PK2 A;  4LIV A;  2ZPA A;  5AG6 A;  4XN3 A;  2Q44 A;  2RC4 A;  4B11 A;  2A6T A;  4CAV A;  1V5E A;  2AQF A;  3BG7 A;  4KOT A;  1YX0 A;  1MND A;  1XEB A;  1Z4R A;  2Q4V A;  4B5O A;  4CUG A;  3OY9 A;  4CCJ A;  3DPU A;  4XOT A;  1VHS A;  2MD0 A;  2R7R A;  3R9G A;  3I3G A;  4NF1 A;  4AYB A;  1NE9 A;  2QKM B;  4MFL A;  3LSG A;  3SDB A;  4CCO A;  2Q4Y A;  1CJW A;  2BL1 A;  3LMM A;  2YNC C;  5CNP A;  4N4O B;  1HA8 A;  2DXQ A;  3TOB A;  2XAU A;  3BLY A;  2ZXH A;  3OOU A;  1W36 D;  4BBH A;  2A5W A;  1D1C A;  3PFY A;  2Q1Z B;  1WJF A;  1Y56 A;  1Y7R A;  1MMN A;  2VL8 A;  1PUA A;  2IXS A;  4E7H A;  2JLM A;  3DNS A;  4KSF A;  4LG3 A;  2PMZ A;  1WJC A;  2R7S A;  4JQF A;  3J7A Y;  4KUA A;  5J8C A;  4KS9 A;  2L7K A;  3PUB A;  1Z9U A;  3L2W A;  4XPL A;  2HQY A;  3OYD A;  3MKZ A;  4KOU A;  4YGO A;  2BVL A;  3H35 A;  3GYA A;  4NSQ A;  2QML A;  4ONU A;  2ZFU A;  3L2U A;  4C2T A;  4R79 A;  1VZ0 A;  2B3V A;  5G21 A;  1BO4 A;  4KZT A;  2IS2 A;  2C27 A;  3MGD A;  2HZD A;  3MMY B;  5AG5 A;  3NWT A;  3W3C A;  1N77 A;  4IKF A;  2BSW A;  3CZ6 A;  3SZG A;  3BLN A;  3KEY A;  1N75 A;  2KRC A;  3DQV C;  3OR1 C;  3M8J A;  1Y9K A;  1YLE A;  2FL4 A;  4ZGY B;  2VQC A;  4KVM E;  2VQG A;  3OYK A;  2HNH A;  4MLO A;  1K4J A;  3CES A;  1ON0 A;  4MFK A;  4DIQ A;  4PK4 A;  2O28 A;  3WR7 A;  3TE4 A;  5JHF A;  4II9 A;  2P6F A;  3P2F A;  4R9M A;  3OS0 A;  1X4P A;  4CZC A;  5CKT A;  1S7L A;  4X0G A;  3SHP A;  4BEH A;  5FVJ A;  5HOO A;  5JQ4 A;  3VWE A;  1R6R A;  4F0X A;  4A32 A;  4NC8 A;  4UCM A;  2LBF A;  3RTR A;  4F3Q A;  2VXK A;  3V42 A;  4XOP A;  4CH7 A;  5J8F A;  4F6A A;  4LIT A;  4BU2 A;  2E1M C;  3SYT A;  1MJA A;  2Z3N A;  3QYF A;  3F0A A;  2ELJ A;  5LFA A;  1YRE A;  1OR7 C;  4UFW A;  5IV0 A;  2GIV A;  2KZV A;  3AL0 B;  4II3 A;  3OS2 A;  2PR1 A;  2HPI A;  1I1D A;  1MJ9 A;  1DGR M;  2I00 A;  3RYO A;  3DTE A;  2JVG A;  4HNU A;  2LBF B;  4XPK A;  2PC1 A;  4FAS D;  2HDW A;  4MHD A;  3S3O A;  1XF8 A;  1S7K A;  2X1D A;  1TT0 A;  3KKW A;  1LVK A;  3BCB A;  3CXP A;  1B6B A;  4PFP A;  2JVH A;  3F5B A;  4HEA 2;  3R1K A;  4K30 A;  1GHE A;  2CY2 A;  1FMV A;  2CH0 A;  1YX3 A;  2L5Q A;  2LC2 A;  4NXY A;  4MY0 A;  1Z4E A;  1U6M A;  1IYK A;  4KVX A;  4ITV A;  1G8X A;  1KUV A;  3IWE A;  3CXQ A;  4RS2 A;  1NSL A;  3TO6 A;  4BGD A;  2ATR A;  4G6T B;  2R1I A;  3NWS A;  4RLQ A;  2CXA A;  4PK3 A;  3S6G A;  1LDK B;  4DBQ A;  4F52 A;  5A28 A;  4XM3 A;  3BJ7 A;  4C2Z A;  2WAQ A;  4PUS A;  4H6Z A;  5DWM A;  2LG4 A;  3EPZ A;  3R9E A;  4CRY B;  2VEZ A;  4J00 A;  2PSW A;  4B43 A;  4RM3 A;  2B5G A;  4XLH A;  2Y0M A;  3W6S A;  4Y49 C;  2D4O A;  2VJ5 A;  4CGO A;  1W36 C;  3D5S C;  3EUA A;  3HC7 A;  2V1N A;  3QYE A;  4KOW A;  4KLW A;  5I0C A;  1DQU A;  4M85 A;  3R95 A;  4U9Z A;  2G0B A;  2AQE A;  2OZH A;  3G3S A;  2X1E A;  3HPG A;  4CYP A;  2IGK A;  4IQJ A;  4R87 A;  2MAB A;  1YVO A;  3OWT A;  4IF5 A;  4YEL A;  3H5A A;  3S32 A;  3OYC A;  4BE0 A;  1MK4 A;  4B12 A;  2X1C A;  2WUU A;  3HUG B;  2Z11 A;  2R7Q A;  4PSW A;  3DKY A;  4DGW B;  4BJ5 C;  3FBU A;  4U5Y A;  3CP2 A;  2FE7 A;  4ANJ A;  2DPS A;  3LL7 A;  2KP6 A;  2R7X A;  4F55 A;  3PNY A;  2KLO A;  4LIU A;  2PR8 A;  5BWA B;  2J8N A;  3W91 A;  4UCP A;  2ZXV A;  2CNM A;  4B14 A;  3OYG A;  4F0Y A;  5KTD A;  4MJ8 A;  2VI7 A;  3W2A A;  1Z7L A;  2DCE A;  3LSH A;  3FDY A;  5FRO A;  4KLV A;  4KT6 A;  4YRV A;  2DJI A;  2I8D A;  4NC7 A;  4XKW A;  4B48 A;  1MJB A;  2VJ4 A;  4OAD A;  3LD2 A;  4DOZ A;  4XQF A;  3ZXS A;  4P1W A;  1XE4 A;  2CMP A;  4XMY A;  4E7Z A;  3OYL A;  2RQQ A;  2FUG 2;  3PNV A;  3F9K A;  2OZU A;  4KOV A;  2CUZ A;  4BJT A;  4IZZ A;  5CQG A;  4CGP A;  4XL9 A;  2NMT A;  4CYO A;  1X1C A;  5KCM A;  2OUM A;  4BE1 A;  4UFV A;  1WJE A;  4E7K A;  1I21 A;  4KOY A;  5KTC A;  2VB6 A;  4C68 A;  4CS0 B;  1J09 A;  2XF6 A;  3OYF A;  2OV7 A;  1D1A A;  3BC8 A;  3VYU B;  4U7B A;  4GS4 A;  1X19 A;  4CCL A;  4II2 A;  4C2U A;  2UWM A;  1U0J A;  4FD5 A;  4B5P A;  4BDZ A;  4HNY B;  2DT6 A;  1M1D A;  3D3S A;  3L2Q A;  3FXT A;  1FMW A;  1Z3Y A;  1BR1 A;  2RRE A;  4F92 B;  4MFZ A;  5IX3 A;  2W4S A;  2P6E A;  5JPH A;  3GBG A;  1EA3 A;  1S7N A;  3FRM A;  2AJ6 A;  5AG4 A;  2ZXI A;  3FHN A;  1FY7 A;  3PGP A;  4H6U A;  3OWC A;  1IRX A;  3S3N A;  2V6E A;  3PJR A;  4QB9 A;  4YEJ A;  5C82 A;  1KUX A;  5G22 A;  5HNF A;  1BR4 A;  1P9Q C;  3D2M A;  5F49 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...