4PSWA

Crystal structure of histone acetyltransferase complex
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
316
structure length
316
Chain Sequence
DFKPETWTSSANEALRVSIVGENAVQFSPLFTYPIYGDSEKIYGYKDLIIHLAFDSVTFKPYVNVKYSAKLGDDNIVDVEKKLLSFLPKDDVIVRDEAKWVDCFAEERKTHNLSDVFEKVSEYSLNGEEFVVYKSSLVDDFARRMHRRVQIFSLLFIEAANYIDETDPSWQIYWLLNKKTKELIGFVTTYKYWHYLGAKSFDEDIDKKFRAKISQFLIFPPYQNKGHGSCLYEAIIQSWLEDKSITEITVEDPNEAFDDLRDRNDIQRLRKLGYDAVFQKHSDLSDEFLESSRKSLKLEERQFNRLVEMLLLLNNS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Hat2p recognizes the histone H3 tail to specify the acetylation of the newly synthesized H3/H4 heterodimer by the Hat1p/Hat2p complex
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transferase
molecule keywords Histone acetyltransferase type B catalytic subunit
total genus 101
structure length 316
sequence length 316
ec nomenclature ec 2.3.1.48: Histone acetyltransferase.
pdb deposition date 2014-03-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
A PF10394 Hat1_N Histone acetyl transferase HAT1 N-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.390 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4pswA03
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4pswA02
3.90.360.10 Alpha Beta Alpha-Beta Complex Histone Acetyltransferase; domain 1 Histone acetyl transferase 1 (HAT1), N-terminal domain 4pswA01
4U9ZA 2OU2A 4Y49C 4UA3A 3G8WA 4RS2A 2Q4VA 3P2FA 2HV2A 3R1KA 3I9SA 3S6GA 3T90A 3VWEA 2WPWA 2PR8A 4U9YA 3S6KA 4PV6A 3FYNA 1NE9A 5FVJA 1P0HA 2ATRA 3F5BA 4XPDB 3TTHA 1S5KA 4L8AA 4KZTA 3C26A 3F8KA 1Y9WA 2GE3A 3CXSA 3T9YA 4NSQA 2H5MA 2J8RA 5F49A 1MJ9A 1PU9A 2PC1A 2K5TA 2VXKA 3DDDA 4HNWB 5DWNA 3EY5A 1Q2DA 1MK4A 4ONUA 1YREA 4CS0B 2ZW4A 1Z9UA 1KUYA 2QIRA 1QSRA 3R95A 5GCNA 5IB0A 1FY7A 2OZGA 5ISVA 2KCWA 3EXNA 2FIWA 4XNHC 2B5GB 2Y0MA 4L89A 4R3KA 4LX9A 1M44A 4YFJA 3ZJ0A 2FCKA 1VKCA 3S6HA 2HQYA 5HH1A 3D8PA 2FIAA 3SHPA 4KOTA 3JVNA 3D2PA 3G3SA 2PRBA 2J8NA 3B8GA 1BOBA 1J4JA 4KUAA 2Z0ZA 5EC4A 1IIDA 1S7KA 2BEIA 3PZJA 4J3GA 5C88A 2D4OA 4IUSA 1S7NA 4ORFA 4FD7A 4IF5A 1NSLA 4KOWA 4KLWA 4CAWA 2QMLA 1XEBA 3BJ7A 2VBQA 4QC6A 2I79A 2Q7BA 1B6BA 3FBUA 4HNYB 4AVAA 4PSXA 4QBJA 2FS5A 1YX0A 2Q0YA 4AB7A 2P6GA 1B87A 2X7BA 4OAEA 2JDCA 3W6XA 1N71A 1KZFA 2P6EA 4NF1A 2R8VA 3W6SA 2WPXA 2F5IA 5HMNA 3SXNA 1QSTA 3DR6A 2VI7A 2CNSA 2ZXVA 3GKRA 1XF8A 1YVOA 3TO7A 1Y7RA 3IWGA 2G3AA 1U6MA 2PQ8A 4JWPA 1Q2YA 1L0CA 1S3ZA 4I49A 4AG9A 1QSNA 2B3VA 1CM0A 3TO9A 4U5YA 2CNTA 3CXQA 1K4JA 4AG7A 4KOUA 3S6FA 1LRZA 3EC4A 4JLYA 2FT0A 3TOAA 4KUBA 4R3LA 1I1DA 3IGRA 4II9A 3D2MA 4PK2A 3R9FA 3K9UA 1ON0A 3BLNA 1KUXA 2R7HA 3RYOA 3JUWA 5E96A 1VHSA 4PK3A 2J8MA 1I21A 3GYAA 1V0CA 3PGPA 4XNHB 1Z4RA 2D4PA 4JJXA 2PSWA 2R1IA 4KOYA 1S60A 2AJ6A 2B58A 4CRYB 3TT2A 2ARHA 3DNSA 1QSOA 4KVOE 4MY3A 1GHEA 1S7LA 3I3GA 2Q4YA 3TE4A 2GIVA 5J8CA 1XIXA 4XPKA 2QECA 2A4NA 4B5OA 4E0AA 4OADA 2B3UA 4MHDA 3FXTA 1YLEA 5KTDA 1RXTA 4NCZA 4H6ZA 4NEXA 1IYKA 2P6FA 4KOVA 1IB1E 1R57A 1P4NA 3QB8A 4HKFA 4KVME 4NXYA 2PR1A 3UY5A 4YRHA 4JXQA 1YK3A 4KOSA 4FD5A 2Q04A 5F47A 4E8OA 5J8FA 4CRZB 1Q2CA 1Y9KA 3EO4A 4KVXA 2FSRA 1UFHA 4QB9A 3LODA 4Y49B 1PUAA 4UWIA 2DXQA 1XMTA 3NE7A 4QUSA 4K30A 4PSWA 2G0BA 2OH1A 2REFA 1BO4A 2B4BA 2RC4A 5EBVA 2P0WA 3ZZIA 2CNMA 4MJ8A 2Q44A 1M1DA 3R9EA 4MBUA 4AVBA 3FNCA 2JDDA 3FRMA 5DWMA 2G3TA 2ZW5A 2B4DB 2FXFA 3EFAA 5F48A 4AVCA 2REEA 2EVNA 1MJAA 1XE4A 3PP9A 1WWZA 1KUVA 1QSMA 5F46A 2OB0A 2BSWA 4F6AA 2ZPAA 4MI4A 4H89A 3R9GA 2C27A 1I12A 1YVKA 4UBRA 3P2HA 3TOBA 1TIQA 4E2AA 2I00A 1RO5A 4R9MA 2Z11A 4CAXA 2VEZA 1M4GA 2AE6A 4CAVA 3CXPA 3D3SA 3TFYA 3FIXA 2OZUA 2R98A 4R57A 5KTAA 1IICA 4OLLA 4B5PB 3BJ8A 2HUZA 3H4QA 4H6UA 1YR0A 4MY0A 4ZBGA 4GS4A 2ZW6A 5KTCA 4JXRA 2VZYA 4EVYA 3OWCA 2JEVA 2FL4A 4LUAA 5H84A 4KOXA 1SQHA 4HNXB 2O28A 3SXOA 1OZPA 2GANA 2BUEA 4FD6A 2NMTA 4B5PA 1M4IA 3KKWA 5JQ4A 1M4DA 4M85A 1CJWA 4KORA 3W91A 5IX3A 3TCVA 3F0AA 4YGOA 2PDOA 3FB3A 5CNPA 4FD4A 3R96A 3WR7A 3GY9A 2EUIA 1S7FA 1MJBA 2VQYA 1NMTA 4QVTA 2B5GA 2JLMA 2IL4A 3VWDA 1YGHA 2VZZA 2Z10A 3DR8A 5I0CA 4R87A 5IV0A 2OZHA 5C82A 4XPLA 1IYLA 5H86A 3E0KA 4KLVA 4DNCA 5JPHA 3LD2A 3V8IA 4BMHA 2B4DA 4RI1A 4XPDC 3TO6A 4M3SA 3QAHA 2CY2A 4F0YA 3MGDA 4X5KA 1WK4A 2FE7A 4JD6A 3DSBA 1Z4EA 4UWJA 2BL1A 3N7ZA 2ZW7A
chains in the Genus database with same CATH superfamily
2R7WA 4KMFA 1ZKGA 4RN7A 2XV4S 2FNPA 2R7QA 4ITVA 1BL0A 2EWBA 2QGUA 4HNUA 3OYMA 1RUOA 1CP7A 4KMUX 4CXFA 2ZEPA 4RAYA 1OCPA 4IHSA 4HAMA 3K4BA 4BBRJ 2HV2A 4I0BA 1I5ZA 1X58A 4BAYA 3I9SA 5JVGF 4BQOA 5M5WJ 5CLSA 2BXZA 4NQWB 2AFXA 4FHTA 3VWEA 3BJOA 4FX0A 3NRVA 1DPUA 2ADUA 1SEUA 3IHUA 1H0MA 1LJ9A 3FYNA 4CCMA 5GADJ 1LVAA 2A6EF 2V1XA 5ICEA 5FVJA 3V8LA 4HBLA 1P0HA 2MFZA 5K8NA 4CZZA 1MDMA 4LB6B 3O8GA 3WTVC 1Z5RA 3D4UA 3F5BA 3H8GA 2OQGA 4L8AA 3I56I 1WJBA 1JXSA 3GTQJ 2X1CA 1KQ9A 3F8KA 2ZNZA 3HOUJ 2NRAC 2RB7A 2OAZA 4FQGA 2GE3A 4B6ZA 4ZDLA 2Q43A 5E1WA 2AFSA 4O3MA 3KQZA 2M0MA 1TLHB 1CQTA 3I54A 3T9YA 3RZDJ 3GTJJ 4Q5SF 3CDXA 3IU1A 1QZEA 5G21A 3C2BA 3GZ5A 2VXKA 2FE3A 3C7JA 1T95A 4IL6C 4IQJA 2ZFUA 2PRQA 3HRUA 4C3IJ 4Y33A 3EY5A 4HLYA 5HOOA 3FDYA 3QWLA 2DA7A 3IH2A 3FF3A 3LSKA 2HOAA 4UIAA 3SI1A 2FF4A 2E19A 4CYQA 1YREA 2EIMH 1JKPC 2DO7A 3FXJA 2FVGA 2ZW4A 2LBFB 4ESFA 2LG4A 2FRHA 1VQ5I 2NYQA 1XD7A 1VQLI 3F22A 1QSRA 2X9DA 5IB0A 1V3FA 2OZGA 2HC9A 2DEAA 5ISVA 4KIBA 2XAHA 3HLPA 1JTXA 2HVRA 3MEXA 4LITA 1BC7C 2GXAA 2HOSA 2Y30A 2BHZA 2KL4A 3CUQC 1RNLA 4XNHC 1QO0D 4RB1A 4A3IJ 4L89A 1IO2A 2RGVA 5L3FA 3BCAA 3IRRA 1MW7A 4C2TA 2L7MP 1IXSB 3N5FA 4UCMA 1HSJA 3LQRA 2EK8A 3PFIA 3BR1A 3VH9A 5EF6A 1IXCA 1STZA 3S6HA 3FJUA 4A3FJ 1Z8XA 2FNAA 3D8PA 1FP1D 3HOYJ 2LH9A 2XROA 4OIWA 3SHPA 2F5DA 2CV0A 4O6JA 1FT9A 2HYGD 5CVUA 4KOTA 2CUZA 4KITB 2O61A 3JVNA 2AXTC 2JPBA 4UB6C 1E3OC 3Q9VA 1VGYA 2PRBA 3BG6A 1TXRA 3OYAA 2BXYA 4BS9A 3IL2A 3F8FA 1J4JA 4KUAA 1ZK8A 1N75A 2DODA 5TJJA 2XB0X 3B73A 5E3NA 3B3WA 5EC4A 1H89C 1USTA 2HTSA 1JHFA 1KWMA 3PZJA 4LG0B 3L2NA 3SZPA 2GA2A 2R7VA 2QSHX 5AIPA 1QZYA 2WYRA 1IOIA 1AUGA 4CYPA 3A9LA 3AG4H 3B3CA 2NVTJ 1IDZA 2D4OA 2YUSA 1WCMJ 4E70A 2C6CA 5HXDA 3K6GA 4E7ZA 1S7NA 3WG9A 1Y6IA 3F23A 2B63J 5F08A 1ZG9A 1Z6TA 2VL8A 3KYDB 1ZN2A 4BGDA 3OY9A 3LSJA 5HNFA 1AYEA 2VE8A 4CYDA 2M3AA 4Z65A 2FOKA 5LGNA 3BQYA 4KLWA 5K7HA 3A03A 1WH7A 4ZYEA 2NNYA 1XEBA 4DJLA 5CVJA 5LHGA 3F21A 4HNVA 3PB4X 1GDTA 3DBLB 1X10A 3U2RA 2Q7BA 3FBUA 2OF7A 1U5TC 4IHXA 1V55H 1YW9A 3FBNB 1HKQA 1V5EA 2L9RA 3EETA 3KEOA 4BXFA 5A2QZ 1F57A 2JSCA 2KIFA 2IQ6A 2CGPA 1IUFA 2HYJA 5CPRB 2P6GA 2QKMB 3KIOA 1IAWA 4G1PA 3IU2A 4XKVA 1H88C 1Z8WA 4KT6A 3G73A 1ZREA 3W6XA 1U3EM 1MNDA 1KZFA 1N71A 3W2AA 1ETYA 2FU4A 1VF9A 4I99C 5HVHA 5K5RA 1FZPB 2JA5J 3W6SA 2HZDA 1LE8B 1RR7A 4OAYA 4NJQA 2WAEA 2Y2ZA 3SXNA 3FIWA 1VFCA 1KU3A 2ZXWH 2ZEHA 2Q8KA 1FLIA 2X1DA 3HSRA 3DR6A 4HF0A 1EH6A 3WU2C 4HSTA 2E36A 4E7LA 1IC8A 1ZGWA 2CNSA 2MD5A 3EDPA 4K3NA 4MCPA 1MMAA 5B1AH 1IGNA 3TO7A 4P4BA 5G20A 4XSZF 3RDIA 3IWGA 2WUUA 5E3OA 2G3AA 2J5PA 2XF5A 2ZXHA 2ME6A 4ENKA 3CUQB 3DBHB 1UZCA 4LFUA 4UUTA 1JGGA 4ZGYB 4ZY0A 3TO9A 4Y17A 4HOBA 3A0HC 2L0KA 4GM5A 4I0AA 1HDPA 5TRDA 2XEGA 3D1NI 4KOUA 2Z3KA 2VKHA 1MZBA 2XAUA 3FXKA 1I3QJ 2EB7A 2NS7A 2X0LA 5ICCA 3OL3A 4A2UA 2FT0A 4MFPA 1RPWA 2DYRH 1RUNA 4RB3C 5LEKA 2D2WA 4CCNA 1VQ4I 1I1DA 2DMQA 4BD9A 4CYNA 4II9A 2CQ7A 2EFPA 3QOPA 1HQCA 3K9UA 1ON0A 2CW0F 2MSYA 3PQJA 5KAIC 1YLOA 1KUXA 2PIYA 4XN3A 3BLNA 3IC1A 4FWUA 3M1EA 2R7HA 3S3NA 3RYOA 4OC3A 2L7ZA 2L7KA 2RAEA 3F0CA 2J8MA 3OV8A 4MGRA 3G71I 1JHHA 3H5NA 4P4JA 3GYHX 2QF7A 1I1SA 2BW3B 2VT3A 4UFWA 2IAIA 4HQMA 1S7AA 4S0HB 1W36C 1FMWA 1S60A 2ZJQF 3ZMVA 2YR2A 1D1AA 2HYFA 1BI2A 3G1LA 4KN7X 2Z9OA 3I59B 2DPTA 5E8IA 2JBKA 1QVUA 3TT2A 4DYCA 3DNSA 3BCBA 3RKXA 4OIQF 5LHHA 4R8HA 5IY5H 2FXAA 2HKXA 2KMUA 4UUSB 1D8JA 1QSOA 3J80Z 3CESA 4KT5C 2HR3A 4PXDA 2E7XA 2JRTA 4RM3A 1Z9CA 1GHEA 1S7LA 3GB0A 3BQZA 2PJ2A 4FE7A 5CVVA 2X6OA 2GFQA 2Z3LA 3OSFA 4KSAA 2VKDA 4ZYAA 4AM3A 1YW4A 2OR4A 4XOTA 2A4NA 3KHXA 3ASOH 4NC8A 1W0UA 2MC4A 4C9YA 4EJTA 3ZGKA 1WJCA 4U87A 3CCQI 1YRNA 1ULYA 2DAOA 3BP8A 5JLXA 1N77A 1KQ0A 1TF9A 4MHDA 5D6EA 3CPAA 5IYCJ 4B13A 2HQ5A 1RXTA 3BR2A 4NC6A 1Z67A 3KP3A 3KPHA 3R4KA 4D1QA 2F2EA 3TL4X 2O5RA 1FX7A 1LAPA 1IB1E 4CGOA 1J09A 4NXYA 5K8PA 2PR1A 1X12A 2Q4ZA 1BW5A 1F43A 2VXDA 4Q7AA 4IHMA 3JAMK 1BJAA 4JXQA 1J7KA 1D0YA 4FD5A 3V8JA 2Q04A 2X6YA 3HYIA 2QUFA 1R5ID 2DFEA 4UNOA 1Y9KA 4A3GJ 5IT9K 4Y3OA 2DLLA 3H9QA 2OJED 2UWMA 2ELJA 3QYBA 2Y75A 1UFHA 4MFKA 4A31A 1K83J 2Y69H 3P9CA 1MNMC 1PUAA 4IAVA 1GYTA 2DI3A 2DXQA 2H94A 2E1OA 2L2OA 2HB6A 3J7ZI 4H4KC 5KK1A 1EKEA 4BE1A 2G9DA 2ZEMA 1XTAA 4PSWA 4U7BA 3C2GA 4II2A 2G0BA 4B3XA 2KISA 3QYFA 2GOXB 1K61A 1CBXA 4Q36A 1P2FA 5KCMA 1TTYA 3CUOA 3IWFA 5EBVA 1IRFA 1XC5A 1R3NA 2ZOGA 2NVYJ 1QZZA 2GZWA 5JLWA 1LDJA 1M1DA 3R9EA 1XCBA 4JX6A 4YELA 1VQKI 3NH5A 4I7HA 2R4GA 4P1WA 4FX4A 5D8NA 4G94A 3FRMA 5AG6A 2CUJA 5DWMA 3MZ8A 1S5LC 4XKWA 1JJ8C 1F5TA 3BDDA 3CJNA 5K7FA 3JRBA 4Y52J 2VKVA 2ZW5A 3VEPA 2WA0A 3CF5F 1SVMA 5JHFA 2FXFA 2HTJA 5K8OA 1QRYA 4HF1A 1WH5A 3Q0VA 3M8JA 3JAMZ 2REEA 4KSFA 1I50J 2OCCH 3NH4A 2M87A 2NAZA 4WXDA 3NA6A 2LK2A 3ML6A 1WWZA 4OC5A 3HSEA 1WJDA 3IEHA 1MBKA 1UJ8A 3NE8A 4F6AA 3I5UA 5H20A 4MI4A 1XDSA 1CX8A 2V1UA 3VWBA 4H89A 3I53A 1LQ1A 3BXMA 3GXOA 3H8EA 1W7PB 2BVLA 2IW5A 3H1CA 2VPRA 1ARLA 1BJZA 5GAGJ 4XL9A 4MQ9F 5H6RA 4U0YA 1ZLJA 1XSDA 3IP4B 2RV8A 2R5ZB 1WZ2A 1D8KA 4MHZA 2DA2A 5C44J 5K1YA 3E6DA 1RO5A 4EATA 3WU0A 4YU9A 3DP7A 3GO5A 1XX5A 3E5QA 2R0QC 3F3XA 1K78A 1YLFA 2VEZA 1IV6A 4RB2C 2DDAA 3PO2J 4IZZA 4A3CJ 1M4GA 3BT9A 4P55A 4K2EA 1YI2I 1ARMA 3HOSA 3NWTA 3K4MA 2H6CA 1XPXA 1J9IA 4R57A 1Z21A 3IWZA 2YX4A 4RM2A 4OLLA 4B5PB 3MKWB 2LKXA 3JRFA 3WT4A 1PCAA 5I4MA 2M8EA 3W6VA 4E7JA 3BOQA 4B12A 1J59A 3S1MJ 3H5RA 1IXRC 1TWCJ 4FUUA 4AIKA 1DUXC 3LFUA 3D5LA 1UFMA 2HQAA 5HODA 1MKMA 3I64A 1QA6A 1R1UA 2V26A 3O3KA 2ZW6A 5AONA 3JRIA 3NARA 4BHPA 2IPQX 1FSHA 1YG2A 3HKZN 3E5XA 4AIJA 3KASA 4KOXA 2CUFA 4Q48A 2DFHA 1T0FA 1XRYA 1HF0A 1Y0UA 1ZTRA 1HA8A 2OUMA 5L3GA 4ETSA 1Y7EA 3TQNA 3I59A 4YIFA 1JI8A 3CDIA 2GANA 2DFFA 3E1SA 1LDDA 3PBBA 4BY1J 3L2RA 3VYRB 3VSKA 5E8GA 2WAQN 1M4IA 3KKWA 3JW4A 1LB2A 3E6MA 4M85A 1CJWA 5A28A 1G6NA 2M0CA 5DUKA 2OZ6A 3HL2A 4M3GA 1PDNC 3W91A 2M34A 3TCVA 1SMYF 3FISA 5F04A 3PJRA 4XR6A 2R5YA 1RTQA 1MSFC 2PDOA 3FB3A 4IJAA 2VASA 1MSEC 2DJIA 2LY2A 2VLAA 1MJBA 3IUOA 3SFIA 1NMTA 4AYBN 1ZLHA 2O9LA 2CXAA 2VQYA 4QVTA 2JLMA 1CG2A 3S17J 1ITYA 1YGHA 2LMDA 5I0CA 4IRGA 1Q1VA 1GVDA 4Y7NJ 3RKWA 5BWAB 2EPFA 1TKJA 4A33A 3KZWA 4XN0A 1FMVA 3K70D 4R1HA 2DOEA 2K9MA 4UVCA 4X0GA 5H86A 4CGLA 3GWZA 4IOCF 3LSIA 3HTSB 2IGNA 5FLVA 1ZAOA 1YIJI 2XAQA 3N97A 4ZI6A 1YQAA 2M4GA 3QP6A 4X1EA 4EQQA 4FE4A 3OS0A 1AWCA 2B4DA 2PJRB 4IOAF 1BR2A 3TO6A 3PEIA 1ETOA 2EH3A 2PMUA 1S7OA 3QU6A 4LK1F 3MRUA 4F8ZA 2EV5A 2DDBA 3DQVC 2NSMA 2MH2A 2VT2A 4ASNA 2H27A 4LLGF 4XKCA 3QPHA 3CC7I 2VL1A 1Z4EA 2DMTA 4P10A 2FMYA 1ZG3A 5FKMA 5FB2A 4UIBA 3Q0WA 2ICWG 3L2CA 1Y0NA 3ECOA 3P7NA 4YFNF 1TWHJ 1X1BA 3PNVA 4EJVA 1SFKA 4XLCA 1AHDP 2PJCA 2MLKA 3S15J 2KIQA 1U9OA 2XPUA 2DQLA 2P6SA 4FT8A 2EV6A 2V8HA 2X4HA 3CF2A 4RS2A 4YFXF 2ZBKA 3A4CA 1BPMA 1YIOA 2FQ4A 3R1KA 1XGSA 3T90A 5LRJA 4A0XA 4TWEA 2WPWA 4U9YA 1CF7A 4LQ6A 2RNJA 4PV6A 3RPQA 4R8FA 4RUHA 2AFMA 3IH4A 2KRFA 5CQGA 2PBIA 5LFAA 4OIOF 2E35A 4UB8C 1IW7F 1MH4A 1X1AA 3DFGA 1G2HA 2DOFA 3FXMA 2VBZA 3LSHA 1R1TA 5FGMA 3EYIA 2AFZA 4XPDB 2Y0SN 1YO5C 1P9QC 3IAM2 4KFCA 4E6KG 2VOPA 3I4NJ 4MRIA 5LYLA 2IXSA 5EMIA 1Q7LA 3A2KA 3BG7A 2DQRA 2HOTA 5ILUA 2HS5A 5L3BA 3A01A 4EMEA 3CJQB 3ELKA 2R7XA 3ZQFA 3D66A 1VHOA 2Q51A 4MHYA 3OYGA 5HS8A 5AG5A 4A39A 1BI1A 1X3ZB 2F5EA 3H36A 5EYRA 1PU9A 2K5TA 2PC1A 3OYJA 2K02A 4P44A 4NGSA 3DDDA 1YOVB 1ORKA 2JEWA 2QCOA 2HNHA 3K2ZA 3CP2A 1Q2DA 5EGOA 4CS0B 5DM6F 3FECA 3HC7A 5J47A 3MKLA 1TP4A 5DD4A 4KIFA 2RQQA 1RC9A 3I1UA 3B3VA 3PB7X 4OKOA 4ZC3A 3L1PA 3CCVI 2DW4A 3HHGA 4A3MJ 1FY7A 2F48A 2Q7SA 3O2PE 5E3LA 5ICFA 4AXVA 2WV0A 5FFXA 2KLOA 1N25A 2M4KA 1BPNA 2FIWA 2L02A 4GCVA 2DCEA 5EG0A 2LRDA 2Y0MA 4D7NA 2BOLA 1D3YA 3DKWA 5LLQA 3BG5A 2E2HJ 4UUVA 3FK7A 4G9YA 3D7FA 2BZTA 2DT7B 2KDOA 1X2NA 4PJ0C 3HRSA 2CUEA 5DEQA 5LEJA 4AVPA 1NK3P 1M44A 3BJAA 3F8MA 3ZJ0A 2R7DA 2VODA 4R79A 1B8IB 1VKCA 4BEHA 3CCEI 5FLMJ 2ECCA 3JSOA 3FXLA 2PJ8A 4XRFA 2KIMA 4LOCA 4CUGA 1FIAA 4MJ8A 1OR7C 3U1DA 1A36A 3S3OA 3S9MA 4V2FA 4DZJA 3TW6A 3OYLA 2P7VB 2XGCA 1B1BA 2UUZA 5F27A 3D2PA 4F92B 3G3SA 4G6TB 1G4DA 4L5IA 2VB6A 2LBFA 1EJ9A 3BPVA 1BOBA 1FIPA 3IAS2 2JA2A 2XHKA 3HOVJ 2H1LA 5CYVA 4N9HA 3FKJA 1HKSA 2L5QA 4Q38A 1WGXA 2BEIA 2FEZA 1J75A 3LA2A 2W4SA 4XBFA 3B35A 4C2YA 3BG3A 1WJ5A 1OR7A 2IJLA 2BO9A 2FQ3A 3OYFA 3ERMA 4UHTA 5ED4A 3K7AJ 5C88A 1X1CA 1W36D 5B3SH 4M3BA 4C3JJ 5IP6A 4M71A 1HSTA 2ZEDA 5LRKA 1ETVA 3CDHA 3ISPA 2DMUA 2E60A 1T39A 4Y13A 1CPXA 5HVGA 4JX5A 4C2ZA 4OAZA 2V8GA 2X85A 4YIRX 4UEEA 4CAWA 1LEAA 4QC6A 3VFZA 2BY2A 5DCMB 4X3RA 3DLAA 3QODA 5DD8A 4BE0A 2V4JC 5LD2C 3L2UA 1ETWA 1D0ZA 3GTLJ 3KHZA 2HDWA 2QENA 2EA2A 2P4WA 1UHSA 1WI9A 4QBJA 2QBYA 2QJ8A 2Y48A 5D5UB 2HQNA 2COMA 6CPAA 1OISA 4AB7A 3CCMI 4EFDA 1B87A 5F1JA 2O8XA 1IJWC 4UUSA 3HPGA 3S2DJ 3PQKA 5EEAA 2ZOFA 4OAEA 1MGTA 1J2XA 2V9KA 3E0JB 3DF8A 4I6ZA 2HEOA 4LD5A 5HDKA 1SD7A 3ZPLA 2ESHA 2DK8A 2O3FA 2OTLI 3B6CA 1LEBA 2P6EA 2GLOA 1S29A 4B3AA 2R8VA 2BHYA 2NOJB 2F5IA 4UF4A 4GGGA 2HPMA 3OYDA 3K4NA 3OS1A 1QSTA 4LG3A 3UKGA 1XS9A 1U8BA 5FKLA 3K10A 2ZXVA 1B9MA 2UXXA 2EK5A 3PIOF 1YSJA 2DPSA 3I4PA 3S2WA 1TBXA 1Y7RA 3D67A 3WE3A 1FC3A 1R4MB 4PXEA 1A35A 2V7FA 3FHNA 2G0EA 2K85A 4EGYA 3CPXA 4JWPA 5FO5A 4C2MJ 1FTTA 4PJNA 1O57A 2STTA 1RIOH 4F91B 3G2BA 4CSWA 4IO9F 3AG3H 4MHGA 4BKXA 4ZZLA 3ZQCA 4B09A 4DBQA 1OLTA 1K4JA 4HX8A 1IY7A 4PGHA 3WC6A 2E1MC 3F6VA 4A3KJ 4JZ0A 5AG7A 1KA8A 3HBLA 2O4HA 1TT0A 3CLQA 4OMEA 4AIDA 4NFRA 2KFDA 4R3LA 4F3QA 3IGRA 5D5VB 3W3CA 3CTAA 1KONA 3D2MA 2PJ5A 1W5TA 1Z6RA 3ABKH 4HW0A 4IX7A 4PK2A 4A3BJ 3W2WA 1IF1A 1JUPA 5BS6A 5E96A 1VHSA 1P7IA 2MBFA 2KJCA 4XLEA 2CYYA 4A2ZA 5F1RA 2DU9A 1I21A 3GYAA 1V0CA 3PGPA 4XNHB 1X3UA 3MZYA 4IHYA 1G8XA 3PB6X 4JJXA 1XMXA 2ACJA 4JK1X 3L00A 2K4JA 1WJFA 3CO7C 2R1IA 1D1CA 4MO7A 4UV9A 5D8LB 4XLNF 2BW3A 1BBYA 2AJ6A 3WABA 3FXQA 2B58A 1JT6A 2LNBA 1GLNA 3DPTA 3K4JA 2E2JJ 4CA0A 4OMYA 3CZXA 3A1YA 2KT0A 3F8NA 4LMYA 2YGWA 1DGWY 4LIUA 4EJWA 3TKYA 1MMGA 4BJ5C 3E3VA 1FNOA 1AMPA 1W7PA 3ABMH 3K4CA 1IN4A 2YNEA 2HPIA 2Q4YA 2V8DA 2ME0A 5BQTA 5GAHJ 4I2OA 2PMZA 3WGHA 5ILSA 4XPKA 1OKRA 2FX0A 1DGRM 3RBUA 1P7JA 2VBYA 4XONA 4CYCB 4OADA 4E0AA 1N78A 2B3UA 4TV7A 3RZOJ 3TDZC 3KLOA 2LDUA 3FXRA 3UNGC 1YLEA 1MMSA 1TQPA 3G1MA 2GA1A 5HS7A 5FKKA 3BY6A 4H6ZA 3IWWA 2XDVA 4HPSA 4CYOA 5F0HA 3KR5A 3P5JA 3PM1A 1A31A 2B0LA 1Z7LA 2WADA 5H2FC 3QP5A 3FM3A 1BW6A 1D1BA 4U88A 5HNHA 4CCJA 5F47A 2K3PA 2BOAA 4A6EA 1ELMP 3JSPA 5ICGA 4CCKA 1JKQC 2LC2A 4CRZB 2UZKA 1Q2CA 3V38A 4EJOA 4HDVA 3EO4A 2HDCA 2FSRA 5G1ZA 4E7KA 4E7IA 4QB9A 2CQNA 2WSAA 1YW8A 2ZEFA 1OQYA 3AFHA 2E5NA 2HZTA 4CHUA 3LWUA 2VC1A 5J6XA 3NE7A 1WSUA 4PCQA 4ONWA 3J80K 2KPMA 1I39A 1VNDA 4GYGA 4N4NB 3WHCA 4GDFA 4P4FA 5K8MA 3MZHA 4M6VA 4LGWA 3S1QJ 1OCZH 4WXHA 3ZMDA 2ABZA 3MN8A 3Q0UA 1VQ8I 3H3VK 3L7WA 2HFHA 1HW2A 1BO4A 1TW2A 1P6RA 1WVRA 3P9IA 3ABTA 3PSFA 3MKYB 4JOMA 2PMHA 3FZVA 4DYQA 4RBOA 3GZNB 1BI0A 2LREA 1UELB 3QOEA 3AAFA 1HEEA 1PVEA 1VHEA 5TGTA 4BJTA 3SI2A 1Y1VJ 3FNCA 2JDDA 3K4KA 1W1WE 3IV5A 1RI7A 3T5XA 1DQUA 1W5CC 2B4DB 2RKHA 5BOXA 3OOPA 2PI0A 2P5KA 3WTYC 1K6YA 1R4NB 3KP5A 3OOUA 1HW5A 1S8NA 4KUMA 3ZMUA 3VB2A 3A0BC 3DKYA 4PUSA 3G6EI 3FMCA 3JRGA 3RZAA 1QSMA 2OB0A 3EUKL 4KJZA 1SANA 2ODFA 3HKZA 3ZMZA 2IRFG 4IRIA 2CFXA 2I8DA 2RQPA 3PSIA 4A5MA 4OIDA 2ZEEA 3R9GA 3KEYA 2C27A 3RNZA 2DA5A 4XLPF 5IT3A 1U5TB 2M30A 4A12A 1I12A 3IWEA 2QQBA 1XG1A 2I3CA 4UBRA 2P81A 2CU7A 1IN8A 4AVZA 1TIQA 2CTCA 1F36A 4E2AA 2BEOA 4R9MA 2Z11A 4CAXA 2VUMJ 3K1PA 3V4GA 4ZX8A 5JFRA 3OR2C 3HUGB 2P5VA 3DPUA 4HEA2 2GXBA 1XGOA 2LF7A 4CZCA 4XLHA 1ZRCA 1PUFA 1OCCH 1Z05A 2NVUB 4ENMA 1LAMA 2OV7A 2D45A 1MDMB 1W4MA 2K9NA 1H8LA 3VYUB 1TL8A 1SD4A 4OIPF 3S14J 2E5ZA 3ZMTA 1IU8A 1FBSA 2EFOA 3CP8A 1ETXA 2UV1A 3RSNA 2OZUA 3RIRA 1M4LA 2WV1A 2R98A 3VYTB 2PLYA 4N4OB 1FYMA 2AHQA 1IICA 3K2KA 4DUKA 3ESWB 3NWSA 2AFUA 2HUZA 1J5YA 3H4QA 5HLGA 5AIQA 3V7ZA 2M9HA 1P4XA 4H2KA 4IXAA 3HPHA 3LNQA 5C4XJ 3HOTA 2UXNA 1OMIA 1YQEA 2IS6A 4L9NA 3C1DA 3I71A 5HVQC 1FOYA 3S16J 5FKOA 4GS4A 4S05A 4WCGA 1ON1A 2XUBA 3GBGA 3MVPA 4G8XA 1WPKA 4PGGA 1GT0C 2VZYA 4MHPA 5B66C 1NK2P 4NGMA 3PB9X 4XSXF 1F2PA 3DPLC 1SQHA 2BV6A 2OQRA 2XGDA 1X19A 4IVNA 1SFXA 3DLLF 2DA3A 4U7DA 2TRTA 1PP7U 1O3SA 5DUIA 2E71A 4EMSA 3R6SA 4EVIA 4B48A 3OYBA 4C3HJ 1HDUA 4MCSA 4OOIA 3SXOA 2I10A 3TC8A 2EA4A 1OZPA 4MFJA 4LJZF 4JQFA 2BUEA 3JRUA 3M8EA 3REOA 2I5UA 1FBUA 5LYIA 3CCLI 3OYKA 5JQ4A 3A02A 3WC7A 3TP0A 2JZYA 1PUEE 4PJMA 2W24A 2MH9A 1R22A 2W25A 3MAJA 4J01A 4ZZDA 3QPSA 1NH3A 3SJMA 3SJGA 1G3WA 1FEXA 4F7ZA 1IN5A 3R0AA 3GY9A 3CCJI 2EUIA 3KYCB 3WTZA 1AU7A 4O5VA 3L9FA 5GTHC 3KCCA 4M6XA 4IEJA 4CGNA 2ID3A 5D6FA 4PQAA 1WKMA 5F64A 4NGPA 2JSPA 2DT5A 4BXUA 2EZIA 4R87A 3ULQB 3FM5A 2JA8J 3OR1C 3GTGJ 3KP4A 1TC3C 2C6GA 1DU6A 5DCMA 3I4MJ 2D1VA 3FXUA 3K2AA 4OMZA 4D5CA 1Y0RA 1IN6A 1JGSA 4FCYA 1O3QA 3WE2A 2XKPA 4RAZA 1R49A 1JKRC 3HIFA 4MFEA 4RGSA 5CVIA 4UEZA 3LD2A 3V8IA 5J4YA 1OJLA 2X6XA 1KU7A 2FBKA 4IQ4A 2A5YB 5J1RA 3IIBA 2M7BA 4MTDA 1T98A 4MIMA 4UY8I 1R58A 4F0YA 3MGDA 4P96A 3MFKA 3BR0A 1WK4A 2AXLA 2AQFA 3HJEA 3FMRA 1ELLP 2R7OA 3DSBA 4A32A 1B8IA 5FKNA 2JJ7A 1WRJA 3CO6C 4W1UA 2BL1A 3NEUA 3GLJA 1KYWA 3HDDA 1QPIA 3IO1A 3KP2A 2VI6A 2CMPA 1ON2A 1S72I 2DFIA 5JHUA 5E17F 4F9VA 4MFLA 5JM6A 2OU2A 1XSXA 4XORA 2V6EA 4C68A 2RREA 3CLOA 1A6QA 4D9JA 2PJ7A 2L4MA 4M9XA 4BUPA 4E4HA 3CMMA 3CJTB 3MQ0A 1LFUP 2QSGX 3FEDA 1P92A 4G6QA 4C2XA 1XOVA 3D0SA 2PIZA 2Q4VA 4HYEA 2W1OA 2Q2EA 2QYOA 2KP6A 4Z2YA 4P9UA 5IT9Z 4UFXA 5DTDA 1E3PA 3HZJA 2ESNA 4BXXJ 4UEFA 2CRGA 3HTUA 2L01A 3OSGA 3TMOA 3UR3C 1A6IA 1VQOI 1K79A 4GFBA 3L2VA 1T08B 3ASNH 2ISZA 1TQIA 2DA6A 3ECHA 3WU1B 3S1RJ 2L4AA 2VOOA 2PJ1A 2WY7Q 4MLOA 3LMMA 4KZTA 4IPAA 3C26A 2WBMA 3RO0A 4KIGA 3IRQA 1OCRH 1Y56A 4PJLA 1SAXA 3G1OA 4ZTFA 3KEQA 1FBQA 2X1EA 1U78A 2VQCA 1FNNA 2MG4A 2NYXA 2V1NA 2R7RA 1H9GA 1T38A 1EH8A 2IGMA 4ON0A 2NVQJ 4NSQA 5F49A 3KLNA 4JYWA 2C6YA 3ERED 5DWNA 3DEWA 1MMDA 1JJ6C 2W82A 4IRHA 1F1ZA 2M8GX 1MK4A 4ONUA 1U2WA 2CFOA 4ABZA 5A2QK 1S3JA 1XB4A 5EDNA 1BR4A 4UV8A 1UCRA 4AWXB 1Z8TA 3F9KA 5B1BH 2QIRA 5LYFA 2M45A 3R95A 1EV7A 5GCNA 4AIHA 3IH3A 4MXUA 2CO5A 1APLC 2JQ7A 3LA3A 3S2HJ 2F6CA 2Z2SB 3EXNA 3GTKJ 3WTTC 2FUG2 3DEEA 4AC0A 2B5GB 4MFQA 5CQEA 1J0RA 4R3KA 4HDUA 3SJEA 5DDGA 4OC4A 4RGRA 1B6AA 4LX9A 4YFJA 3QPTA 1EH7A 4B43A 3B3TA 2KZGA 1FJLA 3S32A 2FCKA 2H09A 2M5WA 2XEFA 4OP4A 1AKHA 2Z5UA 2CTBA 4CICA 2FIAA 3HSFA 5LYDA 1YJNI 4CGMA 1M1EB 5AGEA 2OPTA 1KQ8A 4D5FA 2E1CA 2QVPA 3HXLA 2DTZA 5F0FA 3B8GA 2VONA 1ZQ3P 3X2QH 5F0CA 1MBGA 3FXOA 2HI3A 1ODDA 3DU5A 4WX9A 3RI4A 2D1HA 1W5SA 1SFUA 3GTMJ 4G7OF 1S7KA 2XEIA 1BAVA 4A0YA 4ZYGA 3PBEA 4OC2A 4PZJA 1JUMA 2O8KA 5LRSA 4A93J 3JCUC 2J9AA 1USSA 4L0ZB 4GXOA 2MABA 3B2YA 3GW2A 1YX5A 3LSPA 1DP7P 2QQ9A 2ZC2A 3Q5FA 4ORFA 1FYLA 2NVXJ 2DA4A 4FD7A 4IF5A 3COAC 3TGNA 3LSTA 4DGWB 2A05A 2DPDA 1MBFA 2DBBA 2QMLA 3M4OJ 2VBQA 2ZNYA 2XIGA 3LAPA 2LP0A 3D5SC 2HVSA 1NHAA 2I79A 2F4IA 3CMEI 1LFPA 5E79C 3HG9A 2JA7J 4AVAA 2AFOA 2Q1ZB 5EZGA 4U0VA 2ID6A 3ZCOA 1IOFA 1HDDC 4ZTJA 2B7EA 3DTKA 3EUHA 4M9ZA 3JTKA 1B4AA 4WK8F 4F0XA 1SC7A 5IP9J 5FLXZ 4KYWA 2OTJI 2AQEA 3S9NA 5ERIA 3RTRA 2JDCA 2R5YB 4P4IA 3QQAA 2XRLA 4BQQA 5EG0B 1YTYA 3R61A 3GEZA 4BINA 4NF1A 1ZRDA 1Y0YA 1Y8QB 2XF7A 1BIBA 2WPXA 5F6FA 1YHQI 2GU2A 1RESA 3NH8A 5GAEJ 4JX4A 2CIJA 2VI7A 4NHJA 2EINH 4EV0A 1ZGAA 3PUBA 4S04A 3GKRA 1XF8A 1JUSA 4A0ZA 1YVOA 1PYVA 1G3YA 3GCMA 1OYYA 3FF5A 3K69A 1TWAJ 5FRMA 1O7FA 4MFDA 2QKLB 4ZYHA 1Q2YA 1S3ZA 4I49A 1QSNA 4TNUA 1GV2A 4L0YB 4M72A 4KA4A 2B3VA 2VBXA 2CNTA 5IB9A 3AG2H 2CQXA 1I6XA 2POKA 2LY1A 1SD6A 1FP2A 3BR3A 2RFHA 2ZSHB 2LLKA 4MTEA 1ZGJA 2HXIA 3BC8A 3MMYB 3BTJA 4FISA 3WG7H 3PFOA 1LRZA 1XGMA 3EC4A 4JLYA 3S6FA 3L09A 1BN5A 4ZYQA 3PUFA 3TOAA 2PJRA 4L9JA 1CPSA 2FJ1A 3ZOBA 3K4LA 2IS4A 1KYZA 4CCLA 3D7HA 1HLVA 2QZ8A 4EM0B 2LSOA 3U1KA 3S8PA 2ZJRF 1FYKA 3SFZA 4DYOA 1QVTA 3TW7A 1E2XA 1JQGA 3DU6A 3B02A 3S1NJ 3GFIA 3TDUC 3OYHA 4R6TA 4PK3A 2IMOA 4X8IA 2QQAA 2EILH 1Z4RA 2E7WA 3HUVA 2YX7A 3IKVA 4YEJA 4RDUA 5HVFA 4KOYA 2JK3A 1FOKA 1Z91A 4FAIA 2CW8A 2V6CA 4EJUA 3BR6A 4XRMA 2ARHA 2O7OA 4ZJZA 4IHTA 1H9TA 2A68F 1QHGA 1ZYRF 2IA0A 4A3LJ 3ISZA 1R7JA 1B59A 4LG0A 3GFJA 4EM2A 4A5NA 4KVOE 4MY3A 1MNEA 2NS0A 4NGNA 4ZX9A 4KISA 3B7IA 2KRCA 3KE2A 2W84A 2PJBA 1I1GA 2BCOA 1UG0A 5J8CA 4B11A 3CCYA 3WTSC 5BNGA 4M6HA 1AKHB 1JWQA 1VIXA 1T6SA 1UB9A 4WXCA 4BH9A 6PAXA 4AUXA 3VATA 2HGCA 1R5HA 3U9GA 3KP7A 3M8FA 4PXBA 4NGQA 5KTDA 4RB0A 1TQMA 4P5OA 3RPUA 4NCZA 2WY8Q 5A27A 3I55I 1EA3A 3SHFA 5B5EC 2WWYA 1F2OA 4KOVA 1XN7A 2VE9A 4II3A 1IRGA 3CT9A 3QB8A 4KVME 4ZDPA 2KZVA 2PJ6A 3LFKA 3UY5A 4ZH4F 1VQPI 5FRNA 4EM1A 4KOSA 5ELYA 2GXGA 2R7FA 2DMPA 2EWNA 3SYTA 4E8OA 5J8FA 1ACIA 1U9NA 2QBYB 3GTOJ 5JR3A 2EFWA 4FTHA 3L2WA 4KVXA 1SVLA 1W7PD 1ZRFA 4MHNA 3LODA 4CAFA 4NB5A 4Y49B 4M74A 1Z3XA 4Z6YA 4E7HA 2XAGA 4BDYA 3D7DA 2R93J 4D7MA 1XMTA 3FWEA 4NDLA 1WJAA 2QYVA 3RAMA 1UG2A 3GUXA 3PRTA 4PDKA 4QUSA 3HOZJ 4L9TA 1MH3A 2YPRA 1REPC 3GFLA 4PJJA 3H3ZA 4I09A 2OH1A 4CGPA 1RETA 3TEDA 3T8TA 1QPMA 3BHXA 2LKSA 2B4BA 3K9TA 4A3JJ 2TDXA 3ZQ7A 3GZ6A 1ETKA 3K1MA 4QPOA 4GYIA 1K4SA 4ZDOA 2PN6A 2CF4A 4ZY2A 3MKZA 2LF8A 1X1DA 5DS9A 5ILVA 2KJBA 3RKYA 1G3TA 1YE9A 2KQRA 2XSJC 4F52A 1D5VA 1YS6A 3U21A 4FASD 2WB1A 4NBQA 3EPZA 1T56A 4ESJA 2ZEOA 4DZPA 2G3TA 1K6OA 5HLTA 4HX7A 3EFAA 2O6GE 1LDKB 5HS9A 3QRFF 2B9SA 4BHBA 5K5QA 2QSFX 3PP9A 3F8BA 2O03A 2EFQA 2XPWA 4MEXF 2HXOA 1KUVA 5F46A 2EZHA 3ZMSA 2BBYA 3E7LA 1NTCA 3T0YA 2LVSA 2CWEA 2JVHA 4D0PA 3DTEA 2ZKZA 1VQMI 1QBJA 5KAFC 4ZYDA 4CYCA 2GLJA 2EV0A 2L3DA 5FD6A 3SJXA 4NJRA 5E3MA 3WC5A 1XSVA 2LY9A 1TW3A 1BIAA 1MMNA 2L9NA 3KP6A 2K40A 2A3SA 3I3LA 2VJ5A 4CAEA 1LOKA 3R0JA 3DXJF 3TP3A 2XGEA 2F7VA 1GXQA 4PFPA 2I00A 4HNTA 5LBQA 2EBJA 1O4XA 3JRCA 2GM4A 1A04A 2XEJA 2E34A 3KR4A 3SI0A 4X6AJ 4OC1A 2VJIA 2DTRA 3K0LA 1K4TA 3ZXSA 2Z3MA 3OIOA 2AE6A 4CAVA 2M2EA 1IRXA 3OS2A 2CSOA 1YW7A 5M5YJ 1R71A 3TFYA 1QQIA 3H5ZA 1IZ1A 4A6DA 3GVAA 1P4AA 4A69C 3BTCA 3OYNA 2PJ0A 2F8HA 2Z33A 1YX3A 1B9NA 3ZN1A 2EO8A 3BJ8A 4HZFA 4Q4ZF 4BY7J 1QQ9A 4O23A 1QU3A 2F5CA 3BI1A 4H6UA 3JRAA 3KZIC 1IG7A 3M3YJ 4MY0A 4ZBGA 1UHMA 1DE4C 1QHHD 2Y0SA 3PB8X 2HU9A 4Q47A 5KTCA 5JGFA 4JXRA 4KSIA 2QWWA 4F9UA 2ISYA 2JEVA 1XCVA 4LUAA 4BQAA 5CBMA 1L3LA 1I6HJ 3ZRGA 1LCPA 3PFEA 2JPCA 3JTGA 5GTIC 1Y8RB 3M07A 4XK4A 3FHZA 4GXHA 3HUGA 4HNXB 5AG4A 3Q3SA 4RGXA 1NG6A 3IJ3A 3GIUA 2O28A 2L9SA 4V19K 3WGIA 1AA7A 3ZN0A 2KKOA 2LR8A 4B14A 3NQOA 2VXZA 4HX4A 2VC0A 2BY0A 5J40A 4B4CA 5DM7F 4B5PA 3OYIA 4BBSJ 2PFBA 1R6RA 2K86A 2JMWA 4B47A 1G59A 1A5JA 1ZG7A 1YJ9I 2CQKA 4KORA 2QM3A 3OIQA 1FT7A 4A94A 1WWXA 4KDPA 2ZELA 1WQ2A 3A01B 4JP0A 1O3RA 3WTXC 3JRHA 3WR7A 1NSAA 3I9V2 3R60A 1S7FA 3W2VA 4HG2A 4I98B 4QIWN 5IYDJ 2B5GA 2HQRA 3VWDA 2VZZA 2Z10A 3HM5A 2OOTA 5E20A 1ENHA 1OFCX 2DYSH 4HSRA 1PJRA 3H9JA 3G4SI 4XPLA 5C82A 1KU2A 1IYLA 3HRTA 4RAFA 1FSEA 1CF7B 2CV2A 3EYYA 1D0XA 4XLAA 3MN2A 3QU3A 3SQNA 2ZMEB 2W7NA 4OC0A 4EEFG 1P4WA 1TNSA 1HKTA 5JPHA 1GUUA 4BMHA 3KYLA 1LPQA 4M9SA 1OBRA 2K5CA 2YNCC 3P9KA 4P4DA 4RI1A 4XPDC 5D29A 1CP6A 3JREA 2FMLA 2MYSA 1ZR2A 4M3SA 3QAHA 5CJ9A 4M6GA 3I58A 2CY2A 2Y31A 2EBIA 4X5KA 4MQVA 1SVOA 4CPAA 3DCFA 4MCRA 3FBIB 4N0BA 3RJPA 1HOMA 5LRRA 4JD6A 4R76A 3ZQQA 5IOZA 2ZCWA 1T2KA 4UFVA 2A07F 2P7CB 3BG9A 1T0FC 1HXDA 3LOCA 3FH4A 3N7ZA 1R43A 3KI9A 4H0EA 2Z3PA 1QMUA 4QWQA 4XKBA 4J00A 4BACA 1JE8A 1UAAA 2STWA 2BGCA 2JN6A 4U9ZA 5J1QA 3E5UA 3KFWX 2MGQA 1FOXA 1S7EA 3LQQA 4M73A 1HC8A 1KGSA 2ZO4A 1UMQA 3H0DA 3NFZA 4Y49C 5CKTA 5EJCA 1O3TA 2L54A 1Y1WJ 5HLIA 2V77A 4NGTA 3CDLA 1JKOC 3KQXA 2WAQA 1RRJA 4UA3A 2LTPA 4MEYF 2VIXA 2R7ZJ 3G8WA 3P2FA 4BL0B 5D5XB 4V2GA 2N8GA 2BE5F 2R3SA 2WC2A 1HDQA 3S6GA 3CQZJ 2JUCA 2NS8A 4L5JA 5EEHA 2XSDC 3IKTA 2XPVA 2V8VA 2JT1A 2PR8A 2R7TA 4M3DA 4WWCA 1XGNA 2EIKH 3S6KA 2GBYA 2RVCA 2OA4A 3MCZA 1NE9A 2GLFA 8CPAA 2ATRA 1VZ0A 3E6BA 1IV8A 3QPLA 1BLLE 3TTHA 3SEZA 1S5KA 4ENNA 2XAJA 5E18F 4R7MA 5H6QA 1Y9WA 1I3AA 3VSLA 3M7GA 2XB5A 1D5YA 4LK0F 3CXSA 4MMOA 3GLLA 1BR1A 2A6TA 4X2TA 4I02A 2H5MA 1F9NA 2J8RA 1MJ9A 2F4MB 5M3MJ 1EF4A 3H92A 5E1XA 4HNWB 3CUQA 2W00A 3G3ZA 2QQ8A 3JR9A 3LSMA 1HBXG 4RLFA 1E3HA 3MWMA 2LYCA 2JTVA 2R7SA 1NG7A 2KHMA 2ZMEA 1Z9UA 1DPRA 1KUYA 3EQLF 1JTYA 5G22A 2LFBA 3SXYA 2DOAA 1LE8A 1RZ4A 2JRMA 2ETHA 2QA4I 2KCWA 1MBEA 3BPXA 4WF2A 2FA5A 1U5TA 3D68A 4AYBA 3DTIA 5LRGA 3ONQA 2YS9A 5BPDA 2EZKA 3FX3A 1YS7A 2NOGA 1TKHA 2Z16A 3TX8A 3F6OA 4YG2F 3EUHC 1X1PA 3J7AO 2CJJA 2DN0A 2E1NA 1TT5B 2FSWA 2A5WA 2O0YA 2DF5A 1YRNB 2K27A 4IK2A 4HQEA 3CC2I 5FLXK 3HHHA 4LB5A 2HQYA 1SMTA 5HH1A 3FEEA 3BI0A 1O7LA 3LAJA 2IS2A 4NGRA 1AOYA 5EGOB 2IEKA 5K7ZA 3JTHA 4LIVA 1Z2LA 4CGZA 1H8AC 2EJRA 4IF4A 5IYBJ 4ESBA 2X6WA 4NQWA 5J1YA 1XMAA 2GREA 2G7UA 2H8WA 3BLYA 3HOWJ 1IN7A 4AD9A 3F72A 4OIRF 2ZSIB 5J4VA 5D4RA 2J8NA 3OYEA 3EUAA 1Y39A 2IA2A 4HRIA 2DT6A 2Z0ZA 4L5EA 2MW8A 1IIDA 2FD5A 4XOPA 4OWRB 1Z8LA 1OYWA 2V1DA 1HW1A 2ZFWA 1IDYA 3VOEA 4J3GA 4C30A 3CJRB 3CC4I 1FOWA 1QNTA 3V42A 2HKOA 2WAFA 4IUSA 3FMSA 2HVQA 2VJJA 3RQIA 4C7IA 5LGUA 2H8RA 2JA6J 1Z77A 2DK5A 2IT0A 2W57A 4HA8A 1ZR4A 2DMNA 2GAUA 3OYCA 2ELKA 2IBDA 1NSLA 3BROA 4A3DJ 3J7AY 4KOWA 5DCFA 5DS0A 2DA1A 2KRHA 1U8RA 1BOAA 2NNNA 3BJ7A 3PL8A 4QPQA 4BYYA 3SEQA 2CH0A 5E1ZB 1A2ZA 1B6BA 4RS8A 2PJ3A 4HNYB 2FBIA 1DDNA 1YMEA 3B6AA 3HGGA 3N05A 4PSXA 2YNCA 1V5FA 1ONVA 2Z99A 3BZ6A 2K7LA 3VPRA 5GPCA 1YX0A 2FS5A 1RKWA 2AO9A 2Q0YA 1WI3A 1LVKA 5FROA 3KX2A 3RYPA 4U0WA 4I01A 3RQ4A 2JBJA 2X7BA 4DQ2A 1KZHA 5D8KB 2MD0A 4A30A 5FJ8J 2J5OA 1Z7UA 3PIPF 2VPLA 3ZQLA 3W6JB 5F09A 4WWVA 1VQ6I 3PNYA 5D4SA 1QGPA 3KZYA 2GWRA 2Z3OA 5HMNA 4YFKF 4KNYA 3E6CC 2K3FA 3AL0C 5THWA 3OIPA 1E0EA 1R1VA 3FMQA 3ISXA 2JUGA 3H8FA 1FWZA 3OL4A 2ELHA 4ENJA 1LFWA 4HPQA 1R00A 4W9YA 5J1UA 4CH7A 4B1RA 3BWGA 4XM3A 4AU7A 1CGPA 4BDZA 1U6MA 2PQ8A 3V7SA 1LKXA 1WHUA 3OWTA 1XBUA 3KL9A 1PP8F 2JVGA 2XAFA 2Q2EB 1L0CA 1DTDA 3K70C 4ANJA 4AG9A 1V54H 5L3DA 1SD5A 1OYIA 1CM0A 3GTPJ 4U5YA 2K4BA 3CD6I 3SZGA 3CXQA 2C1CA 3VYSB 2AFWA 1XMBA 3S3MA 1YYVA 3LACA 4AG7A 2VN2A 1GV5A 2A6HF 2CS3A 3WGGA 3MD2A 4CCOA 3LSRA 1L0OC 1U0JA 4EGZA 2IGKA 3V7CA 4GO1A 4IKFA 4KUBA 2Z3YA 2C6PA 3ZQGA 1MBJA 5DYMA 2Y9YA 5HDNA 2BYVE 2IP2A 2TCTA 2F5VA 2G7HA 2K9LA 4L18B 1V5GA 1B72B 3R9FA 5KVRA 3AL0B 5JVTA 3QAYA 4J19A 3IC7A 2QLZA 3JUWA 4KN4X 3GX4X 2E1MB 2R5ZA 3ZQIA 2ZEGA 3M9AA 5FD5A 2FBHA 1E17A 2D4PA 2PSWA 1OCOH 4UCPA 3W6KB 3CCRI 1V4RA 4LLLA 3TBIA 1XFOA 1Z0XA 4BEHB 2O53A 1XJOA 3B3SA 3BTIA 4Y15A 4XQFA 4CRYB 1RR8C 3QNVA 1Q1HA 1TZLA 5C3EJ 1FPQA 3LWFA 2EIJH 4ZY1A 1ZO0A 1VQ7I 3HB9A 3KZZA 3WODF 5JI6A 4YWYA 1GVJA 3H3UA 3M1CA 3CZ6A 2LD5A 4HF2A 4WJBA 2VQGA 4XNFA 3DLJA 4L9VA 3I3GA 3K1NA 3S9LA 2L7FP 2MC3A 4KS9A 1ZG8A 2EFNA 2MA3A 3BR5A 3TE4A 2GIVA 1SAUA 2RN7A 1XIXA 2QECA 2D5VA 2Z1DA 3T1BA 4B5OA 1MBHA 1VI0A 2L9VA 4BNCA 4DIQA 2RDPA 3H9GA 3FXTA 2VQHA 1S6LA 4QTRA 3VARA 1SFEA 5D5WB 3PNTA 2F4OB 3LSGA 2PVWA 2Q0OA 3FKIJ 2PJAA 4N9IA 4NEXA 1IYKA 1ZELA 4G6DA 2P6FA 1R57A 1U6GA 1P4NA 2CNMA 2OCEA 2BY3A 3D5RC 3CMAI 4HKFA 2AS5F 3C3WA 1K78B 2COBA 4YRHA 4DW6A 1YK3A 3FX6A 1LNWA 2OD5A 4G7ZF 3RKQA 5J3LA 3AG1H 5LHIA 5LGTA 3ZP5A 2Y9ZA 1T33A 2W48A 3GMEA 3CCUI 4B10A 1BI3A 3DKXA 4XLFA 4BQNA 5IP7J 4CDGA 4UWIA 1TWFJ 2DJNA 2H1KA 3ABUA 3ABLH 1R23A 1LUJB 4K30A 4OINF 1XMKA 2ZJPF 2XVCA 2ZJ2A 1PYTB 4BBHA 2WZNA 2REFA 1RKTA 1TWGJ 4BJ6C 1IGBA 1IRZA 5JH9A 3H35A 4CO8A 1TKFA 3H0GJ 2ANPA 1R36A 2RC4A 3GUDA 1F4KA 1FTZA 2P0WA 4P9FA 1LANA 4P45A 2M7AA 3QYEA 3O8HA 1UWYA 2V9PA 3ZZIA 2CV1A 2RNGA 4RA2A 5KHDA 4UXNA 5L3EA 3LL7A 2R7UA 3RCOA 2BVMA 2A69F 2CW7A 2Q44A 4NC7A 2OC6A 1TNTA 4G7HF 4MBUA 4AVBA 4YIIA 4XRSA 2WB1N 4DYRA 2XF6A 3HOXJ 1ZH5A 3PFYA 1SFOJ 3N4MA 2XRNA 3KGQA 5F48A 1WFXA 4AVCA 2P6TA 2YSRA 2V9VA 4DBRA 2EK9A 3L2QA 2EVNA 4A37A 2ZXJA 1MJAA 1XE4A 4XRSG 2PJ9A 2H6BA 4HLXA 1DP3A 1ETQA 2VBWA 4EWTA 1HCRA 4P6YA 4KICA 3CMYA 1X4PA 1BM9A 4LLNA 2BSWA 2BY1A 2ZPAA 2EZLA 4UVBA 3J81K 2ZB9A 7CPAA 3WHBA 2GIZA 2MLGA 2W85A 3DBRB 4RMNA 4BHCA 2XKOA 3LA7A 3RPUD 5L3CA 1OCTC 4JBAA 4UCNA 1K7AA 3GLXA 1YVKA 2IGOA 3P2HA 3JRDA 1DU0A 1YITI 2HOEA 3TOBA 4FBEA 3RYRA 1X2MA 5C4JJ 1UHWA 4LQGA 4GRIA 2KDZA 2KIUA 1LFBA 3KETA 2PVVA 3ZR8X 2PMZN 4C7HA 1S9HA 3S93A 4MFZA 2PCUA 4G12A 3DEUA 4IHWA 1ZG5A 3ZQHA 4HV5A 1VTNC 3SDGA 1KU9A 4F55A 2YU9J 1VQNI 2PJ4A 4XICA 3CXPA 3D3SA 4RGUA 5M3FJ 4P4EA 3FIXA 1BC8C 4A95A 4PPZA 2LOOA 4PK4A 1YW6A 5KTAA 4DOZA 2M1BA 1R9TJ 3SJFA 1OPCA 3ROUA 3DGVA 1C0WA 4BE2A 4RAGA 1YR0A 1GHCA 2QVOA 3WTUC 1B72A 1ZLKA 2PG4A 3DV8A 3VODA 2OBPA 1T8IA 3J7YJ 1R5GA 3J81Z 4B8XA 3CCSI 1G3SA 2VKEA 4M3EA 2VQLA 2EQRA 2ECBA 5BPIA 3I0TA 4M6IA 4EVYA 3OWCA 2HDDA 2FL4A 5H84A 2ZENA 2NXNB 3VDXA 1PUFB 2DXIA 2IJZA 5HDGA 2XASA 2GQQA 4A3EJ 4MCQA 1IUYA 1WJEA 4YRVA 4HV6A 2A61A 4RLQA 1MD0A 1POGA 4OU0A 2K9SA 1Z3YA 4PXCA 2P8TA 5GPAA 2NMTA 4FD6A 2VJ4A 1ZARA 4M6YA 4B44A 5BMZA 2G9WA 3E97A 5TISC 2P5LC 2X48A 1MIJA 2XGXA 4E7SA 2E2IJ 2Z3NA 1M4DA 1W0TA 2YU3A 5KNLA 3HEFA 2XC7A 3HRMA 4C2UA 3BZCA 3O6BB 5IX3A 3T8RA 4QLCU 2PJPA 2IVMA 4DJAA 3Q9SA 1BA5A 3BJ6A 4UVAA 4QSHA 3F0AA 3IFEA 5CPAA 4YGOA 5CNPA 3C2HA 4PFOA 4FD4A 3R96A 1Z1DA 2K9QA 4NUBA 2DPUA 1I27A 4A38A 5FFZA 2WTEA 2PX9A 3GF2A 2HWVA 4M3FA 4W97A 3AKZA 2IL4A 2ZXIA 3DR8A 2X51A 1X4OA 2CG4A 3LMSA 5GP9A 2QEXI 5IV0A 2IA1A 3H5AA 1ZG1A 3SZTA 5K5OA 2OZHA 3T8WA 4BU2A 5DV5A 3WTWC 1YFHA 3PO3J 1ERDA 4XIDA 3C18A 2F5FA 4FETA 3E0KA 2LKPA 5EZHA 4KLVA 4DNCA 5CVRA 2R92J 3SDBA 1YJWI 3F8CA 4MNUA 1JT0A 3BZKA 5IOYA 4JYKA 2PEXA 2JWTA 1GXPA 5IPAA 4NNJA 1VQ9I 3D7GA 2PE3A 2CQQA 1TF8A 4IHVA 2IS1A 1ZLIA 3BTLA 2V79A 5EEGA 2GOMA 3V8KA 1X3WB 3HGYA 5M5XJ 9ANTA 3V7RA 2FE7A 2FOWA 3FK6A 1XDUA 1ZHFA 3DWLE 4I76A 4Y4RA 2ZMEC 4F93B 5HLHA 1EE3P 4UWJA 4XMYA 2YNDA 3OMYA 3GFMA 3NAUA 2ZW7A 3FVLA
chains in the Genus database with same CATH topology
4XKBA 2R7WA 4J00A 4BACA 1UAAA 4U9ZA 4MFLA 1X1BA 3PNVA 2V6EA 4XORA 2OU2A 1SFKA 4XLCA 4C68A 2RREA 2R7QA 4ITVA 4D9JA 4HNUA 3OYMA 3H0DA 4E4HA 4BUPA 5CKTA 4Y49C 3CMMA 5IV0A 3CF2A 4UA3A 2WAQA 4C2XA 3K4BA 3G8WA 4RS2A 2VIXA 2Q4VA 3P2FA 3A4CA 2HV2A 2W1OA 4BL0B 2KP6A 3R1KA 3I9SA 4UFXA 3S6GA 3T90A 4BQOA 3VWEA 4NQWB 2WPWA 2PR8A 4U9YA 2R7TA 3S6KA 3TMOA 4PV6A 3UR3C 3FYNA 4CCMA 1NE9A 5LFAA 5CQGA 5FVJA 3L2VA 1P0HA 2MFZA 1X1AA 2ATRA 1VZ0A 3LSHA 3F5BA 4XPDB 2WY7Q 3TTHA 3SEZA 1S5KA 4L8AA 1P9QC 3IAM2 4AVBA 4E6KG 1WJBA 4MLOA 3LMMA 4KZTA 2IXSA 2X1CA 3C26A 2WBMA 3A2KA 3F8KA 3BG7A 1Y56A 4PJLA 1Y9WA 4ZTFA 3VSLA 2GE3A 2X1EA 3CJQB 4ZDLA 2VQCA 2V1NA 2R7RA 3CXSA 2R7XA 2M0MA 1BR1A 2A6TA 2IGMA 3T9YA 3OYGA 5AG5A 4NSQA 2H5MA 2J8RA 3IU1A 5F49A 1MJ9A 1PU9A 2PC1A 2K5TA 2VXKA 5G21A 3OYJA 1T95A 4IQJA 2ZFUA 3DDDA 4Y33A 4HNWB 5DWNA 3EY5A 1MMDA 5HOOA 3FDYA 2W00A 2HNHA 2W82A 3LSKA 1Q2DA 3CP2A 1MK4A 3LSMA 4RLFA 4ONUA 1YREA 4CYQA 2LYCA 4CS0B 2CFOA 2R7SA 1NG7A 3HC7A 2ZW4A 2KHMA 2LBFB 2LG4A 1BR4A 1Z9UA 2RQQA 3F9KA 4ZC3A 1KUYA 2QIRA 1QSRA 3R95A 5GCNA 5G22A 5IB0A 1FY7A 2DOAA 2OZGA 5ISVA 4C7HA 2HVRA 2F6CA 2KLOA 2Z2SB 4LITA 2M4KA 2KCWA 2KL4A 3EXNA 4AYBA 3DEEA 3DTIA 2FUG2 2DCEA 3ONQA 2LRDA 2B5GB 5CQEA 2BOLA 2FIWA 2Y0MA 4L89A 4R3KA 2Z16A 3BCAA 1MW7A 4C2TA 2DT7B 2KDOA 3EUHC 4UCMA 4LX9A 1M44A 4YFJA 2A5WA 3ZJ0A 4B43A 3S32A 4R79A 2FCKA 1VKCA 4BEHA 3S6HA 2HQYA 5HH1A 3D8PA 4CRYB 4CUGA 2FIAA 4MJ8A 1OR7C 2LH9A 2IS2A 3S3OA 3SHPA 4CGMA 2CV0A 4KOTA 4LIVA 5AGEA 3OYLA 2CUZA 4KITB 2UUZA 3JVNA 3D2PA 3HXLA 4F92B 2X6WA 3G3SA 3BLYA 4G6TB 2PRBA 2J8NA 3BG6A 2VB6A 2LBFA 2ZSIB 3OYAA 4BS9A 1BOBA 3EUAA 3IAS2 3OYEA 3B8GA 2JA2A 1J4JA 4HRIA 2DT6A 2Z0ZA 4KUAA 1N75A 3DU5A 3FKJA 5EC4A 2L5QA 1IIDA 1S7KA 4Q38A 2BEIA 4XOPA 4OWRB 3PZJA 2R7VA 2W4SA 4J3GA 4C2YA 1WJ5A 4C30A 3CJRB 3OYFA 3A9LA 4CYPA 3V42A 2MABA 1YX5A 5C88A 2WAFA 1X1CA 1W36D 2D4OA 4IUSA 2HVQA 2VJJA 3K6GA 4E7ZA 4C7IA 1S7NA 4ORFA 1Y6IA 2E60A 4FD7A 2VL8A 4IF5A 4BGDA 3OY9A 5HNFA 4DGWB 3OYCA 4C2ZA 2M3AA 1NSLA 4KOWA 4OAZA 3J7AY 4KLWA 2KRHA 2X85A 2QMLA 1XEBA 3BJ7A 3PL8A 2VBQA 4QPQA 4CAWA 3SEQA 4QC6A 3D5SC 2HVSA 2CH0A 3DLAA 3QODA 4BE0A 2V4JC 5LD2C 3L2UA 2F4IA 1D0ZA 2I79A 2HDWA 1LFPA 1B6BA 3FBUA 3HG9A 4HNYB 2Q7BA 4AVAA 2Q1ZB 3FBNB 3ZCOA 3N05A 4PSXA 2YNCA 1V5EA 4BXFA 4QBJA 1V5FA 4ZTJA 2FS5A 3DTKA 1YX0A 2Q0YA 3JTKA 3R9EA 4F0XA 1LVKA 4AB7A 5CPRB 5FROA 2P6GA 2AQEA 3KX2A 2QKMB 3RQ4A 1B87A 3HPGA 2X7BA 4XKVA 4OAEA 3E0JB 2V9KA 4KT6A 3RTRA 2JDCA 2MD0A 3W6XA 1N71A 1MNDA 1KZFA 4A30A 3W2AA 2P6EA 4BQQA 4NF1A 2VPLA 2R8VA 2XF7A 3W6SA 2WPXA 2NOJB 3PNYA 2F5IA 2HZDA 4OAYA 2Z3OA 2HPMA 3OYDA 5HMNA 2WAEA 3K4NA 3SXNA 3AL0C 3OIPA 3OS1A 1QSTA 1E0EA 2X1DA 4LG3A 2VI7A 3DR6A 4HSTA 2JUGA 4E7LA 3K10A 2CNSA 3PUBA 2ZXVA 3GKRA 1XF8A 3OL4A 4HPQA 1MMAA 1YVOA 2DPSA 5G20A 3TO7A 1Y7RA 4CH7A 3IWGA 1PYVA 4XM3A 4AU7A 2G3AA 4BDZA 1U6MA 2PQ8A 2WUUA 1LKXA 2XF5A 2V7FA 2ZXHA 3FHNA 3OWTA 5FRMA 2JVGA 1Q2YA 2Q2EB 2QKLB 1L0CA 1S3ZA 3K70C 4ANJA 4I49A 1QSNA 4JWPA 4AG9A 4PJNA 2B3VA 4ZGYB 1CM0A 3TO9A 4F91B 4U5YA 3G2BA 4CSWA 2CNTA 3SZGA 3CXQA 1K4JA 2LY1A 1OLTA 3VYSB 4DBQA 3S3MA 4AG7A 2ZSHB 4KOUA 3MMYB 2E1MC 3BC8A 2CS3A 2XAUA 2VKHA 3MD2A 4CCOA 1LRZA 1U0JA 3EC4A 4JLYA 3S6FA 1TT0A 3OL3A 2IGKA 2FT0A 4MFPA 4IKFA 3TOAA 2PJRA 4KUBA 4R3LA 4CCNA 4F3QA 3K4LA 2IS4A 4CCLA 3W3CA 1I1DA 3IGRA 2F5VA 4CYNA 4II9A 2K9LA 1KONA 3D2MA 4PK2A 1V5GA 4IX7A 3S8PA 3AL0B 1ON0A 3BLNA 3K9UA 3R9FA 1KUXA 4XN3A 3W2WA 2R7HA 3S3NA 3DU6A 3JUWA 5E96A 3RYOA 1VHSA 2L7KA 3OYHA 4XLEA 2E1MB 2J8MA 4PK3A 4A2ZA 1I21A 3GYAA 1V0CA 3PGPA 4XNHB 3H5NA 1Z4RA 2BW3B 1G8XA 2D4PA 4JJXA 4UFWA 2PSWA 4YEJA 4UCPA 1WJFA 1W36C 1FMWA 1D1CA 1S60A 2R1IA 4KOYA 2BW3A 3TBIA 2CW8A 4BEHB 1D1AA 2AJ6A 2B58A 2DPTA 1GLNA 3DPTA 3K4JA 4XQFA 2ARHA 3TT2A 3DNSA 3BCBA 4CA0A 4ZJZA 1TZLA 3A1YA 2KMUA 1QSOA 1ZO0A 2YGWA 3CESA 1QHGA 1DGWY 4LIUA 4KVOE 1MMGA 4BJ5C 4MY3A 3M1CA 1MNEA 4RM3A 3CZ6A 1GHEA 1S7LA 2VQGA 4XNFA 4KISA 3I3GA 3K4CA 2KRCA 2YNEA 4KS9A 2HPIA 2Q4YA 1UG0A 2Z3LA 3TE4A 2GIVA 4KSAA 1SAUA 4B11A 2VKDA 4ZYAA 5J8CA 2PMZA 1XIXA 2QECA 4XPKA 4XOTA 2A4NA 1DGRM 4NC8A 2Z1DA 2MC4A 4C9YA 4XONA 4B5OA 3ZGKA 4OADA 4E0AA 1N78A 1WJCA 2B3UA 4U87A 4DIQA 4MHDA 1N77A 3H9GA 3FXTA 2VQHA 3UNGC 1YLEA 1RXTA 4B13A 5AG7A 5KTDA 4P5OA 4NCZA 3PNTA 2WY8Q 3LSGA 4D1QA 5A27A 4CYOA 4H6ZA 3TL4X 2XDVA 2O5RA 1EA3A 1ZELA 1IYKA 2P6FA 4NEXA 1IB1E 1R57A 4KOVA 1P4NA 4CGOA 1Z7LA 1J09A 4II3A 2WADA 3D5RC 3QB8A 4HKFA 4KVME 4NXYA 2PR1A 4ZDPA 2KZVA 3UY5A 2VXDA 4YRHA 1D1BA 5FRNA 1YK3A 4JXQA 5HNHA 4KOSA 1D0YA 4CCJA 2Q04A 2K3PA 2X6YA 4FD5A 3SYTA 5F47A 4E8OA 5J8FA 4CCKA 2LC2A 4CRZB 1Q2CA 1Y9KA 4Y3OA 3H9QA 3EO4A 2Z3KA 3L2WA 2UWMA 4KVXA 2FSRA 2ELJA 3QYBA 4E7KA 4E7IA 1UFHA 4QB9A 3LODA 5G1ZA 4CAFA 4Y49B 2WSAA 1Z3XA 4MFKA 4A31A 3DKXA 4XLFA 4BQNA 4E7HA 1PUAA 4BDYA 4B10A 4UWIA 3AFHA 2E5NA 2DXQA 1XMTA 1WJAA 2L2OA 3NE7A 4H4KC 4QUSA 4BE1A 4K30A 4PSWA 2KPMA 4U7BA 3C2GA 4II2A 4N4NB 2G0BA 4PJJA 4BBHA 4B3XA 3QYFA 2OH1A 2GOXB 2REFA 4CGPA 4BJ6C 3H35A 4Q36A 1BO4A 2B4BA 4MFQA 5KCMA 2RC4A 5EBVA 2P0WA 2M7AA 3QYEA 3PSFA 3MKYB 4JOMA 4QPOA 2CV1A 4ZDOA 2CNMA 2RNGA 5KHDA 2LREA 1UELB 3QOEA 3MKZA 3LL7A 2R7UA 3RCOA 2BVMA 2CW7A 4YELA 1X1DA 4NC7A 2OC6A 5TGTA 4BJTA 4MBUA 1YE9A 2KQRA 2XSJC 2R4GA 4P1WA 4F52A 2JDDA 3FNCA 3K4KA 2CUJA 2XF6A 2WB1A 4XKWA 3EPZA 3U21A 4FASD 3FRMA 1DQUA 2G3TA 5DWMA 3PFYA 2ZW5A 2B4DB 2WA0A 5JHFA 5HLTA 2FXFA 3EFAA 5F48A 1WFXA 1LDKB 1K6YA 3OOUA 4AVCA 2REEA 3M8JA 4DBRA 4KSFA 3L2QA 2EVNA 1MJAA 3DKYA 1XE4A 3PP9A 1WWZA 4PUSA 1DP3A 1KUVA 1WJDA 1QSMA 2OB0A 1X4PA 2BSWA 5F46A 4F6AA 3EUKL 4KJZA 2ZPAA 2JVHA 3DTEA 3HKZA 4MI4A 4H89A 3VWBA 2I8DA 3PSIA 3R9GA 2BVLA 3KEYA 4RMNA 2C27A 3RPUD 4XL9A 4UCNA 1MMNA 2L9NA 1I12A 3IWEA 3I3LA 1YVKA 2VJ5A 2IGOA 4UBRA 3P2HA 4CAEA 4AVZA 3TOBA 3IP4B 1TIQA 4E2AA 4PFPA 2I00A 4HNTA 1RO5A 4EATA 4GRIA 2Z11A 4R9MA 5AG6A 4CAXA 2VEZA 3OR2C 3HUGB 3ZR8X 3DPUA 2VJIA 4HEA2 1S9HA 3S93A 4CZCA 4IZZA 1M4GA 4XLHA 4MFZA 3ZXSA 2Z3MA 2AE6A 4CAVA 2OV7A 1IRXA 3OS2A 4F55A 3CXPA 3D3SA 3VYUB 3TFYA 3HOSA 2E5ZA 3H5ZA 3NWTA 3CP8A 3K4MA 2UV1A 3RSNA 2OZUA 3FIXA 3OYNA 2R98A 3IU2A 3VYTB 4A95A 2LOOA 1YX3A 4PK4A 4N4OB 4R57A 1Z21A 1IICA 4DOZA 4RM2A 4OLLA 4B5PB 3MKWB 3BJ8A 3NWSA 2HUZA 3H4QA 4E7JA 4B12A 3HPHA 1QU3A 3H5RA 4BE2A 3HOTA 1YR0A 4H6UA 3LFUA 2IS6A 3D5LA 2HQAA 4MY0A 4ZBGA 5HVQC 1QHHD 2V26A 2Y0SA 4GS4A 2HU9A 2ZW6A 5KTCA 3GBGA 1M1DA 4JXRA 2VQLA 2VZYA 4XNHC 4EVYA 3OWCA 2JEVA 2FL4A 4LUAA 5H84A 4KOXA 3ZRGA 3DPLC 1SQHA 3VDXA 1X19A 2DXIA 4HNXB 5AG4A 1NG6A 4B48A 3OYBA 2O28A 2L9SA 1HA8A 1WJEA 2OUMA 4YRVA 3SXOA 1AA7A 4RLQA 1OZPA 1JI8A 4MFJA 4B14A 2GANA 1Z3YA 2VXZA 4JQFA 3E1SA 2BUEA 4FD6A 2NMTA 4B5PA 3OYIA 2VJ4A 3L2RA 3VYRB 1R6RA 3VSKA 4B44A 1M4IA 3KKWA 1G59A 4B47A 3OYKA 4E7SA 2Z3NA 5JQ4A 3ZZIA 1M4DA 4M85A 1CJWA 5KNLA 2XC7A 4KORA 5A28A 4PJMA 4C2UA 3HL2A 3W91A 3OIQA 5IX3A 3TCVA 4DJAA 4J01A 3PJRA 4XR6A 3F0AA 4YGOA 2PDOA 3FB3A 5CNPA 3C2HA 4PFOA 2VASA 4FD4A 2DJIA 2LY2A 3R96A 3WR7A 2VLAA 3I9V2 3GY9A 2EUIA 4NUBA 1S7FA 3IUOA 4HG2A 3W2VA 1MJBA 1NMTA 2VQYA 2CXAA 4QVTA 4CGNA 2B5GA 2JLMA 2IL4A 3AKZA 2Q44A 3VWDA 2ZXIA 1YGHA 2X51A 2VZZA 2Z10A 3DR8A 1X4OA 5I0CA 5KTAA 2JSPA 5BWAB 4R87A 4A33A 4HSRA 1PJRA 3H5AA 3OR1C 1FMVA 3H9JA 4XN0A 3K70D 2OZHA 4XPLA 4BU2A 1IYLA 5C82A 2K9MA 4X0GA 5H86A 2CV2A 1ERDA 4CGLA 1D0XA 3LSIA 4FETA 4XLAA 3E0KA 2IGNA 4KLVA 4DNCA 2W7NA 2M4GA 3SDBA 3OS0A 5JPHA 3LD2A 3V8IA 4BMHA 2X6XA 3KYLA 2YNCC 2B4DA 2K5CA 4RI1A 2PJRB 1BR2A 4IQ4A 4XPDC 4NNJA 3TO6A 2M7BA 2MYSA 4M3SA 2IS1A 3QAHA 2CY2A 4F0YA 2GOMA 3MGDA 4X5KA 1WK4A 3DQVC 2AQFA 3FBIB 2R7OA 2FE7A 4XKCA 3DSBA 4JD6A 4UFVA 3ZQQA 3DWLE 4F93B 1Z4EA 4Y4RA 4UWJA 4A32A 2BL1A 4XMYA 1T0FC 3OMYA 2YNDA 3N7ZA 2ZW7A 2CMPA 2Z3PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4U9Z A;  2OU2 A;  4Y49 C;  4UA3 A;  3G8W A;  4RS2 A;  2Q4V A;  3P2F A;  2HV2 A;  3R1K A;  3I9S A;  3S6G A;  3T90 A;  3VWE A;  2WPW A;  2PR8 A;  4U9Y A;  3S6K A;  4PV6 A;  3FYN A;  1NE9 A;  5FVJ A;  1P0H A;  2ATR A;  3F5B A;  4XPD B;  3TTH A;  1S5K A;  4L8A A;  4KZT A;  3C26 A;  3F8K A;  1Y9W A;  2GE3 A;  3CXS A;  3T9Y A;  4NSQ A;  2H5M A;  2J8R A;  5F49 A;  1MJ9 A;  1PU9 A;  2PC1 A;  2K5T A;  2VXK A;  3DDD A;  4HNW B;  5DWN A;  3EY5 A;  1Q2D A;  1MK4 A;  4ONU A;  1YRE A;  4CS0 B;  2ZW4 A;  1Z9U A;  1KUY A;  2QIR A;  1QSR A;  3R95 A;  5GCN A;  5IB0 A;  1FY7 A;  2OZG A;  5ISV A;  2KCW A;  3EXN A;  2FIW A;  4XNH C;  2B5G B;  2Y0M A;  4L89 A;  4R3K A;  4LX9 A;  1M44 A;  4YFJ A;  3ZJ0 A;  2FCK A;  1VKC A;  3S6H A;  2HQY A;  5HH1 A;  3D8P A;  2FIA A;  3SHP A;  4KOT A;  3JVN A;  3D2P A;  3G3S A;  2PRB A;  2J8N A;  3B8G A;  1BOB A;  1J4J A;  4KUA A;  2Z0Z A;  5EC4 A;  1IID A;  1S7K A;  2BEI A;  3PZJ A;  4J3G A;  5C88 A;  2D4O A;  4IUS A;  1S7N A;  4ORF A;  4FD7 A;  4IF5 A;  1NSL A;  4KOW A;  4KLW A;  4CAW A;  2QML A;  1XEB A;  3BJ7 A;  2VBQ A;  4QC6 A;  2I79 A;  2Q7B A;  1B6B A;  3FBU A;  4HNY B;  4AVA A;  4PSX A;  4QBJ A;  2FS5 A;  1YX0 A;  2Q0Y A;  4AB7 A;  2P6G A;  1B87 A;  2X7B A;  4OAE A;  2JDC A;  3W6X A;  1N71 A;  1KZF A;  2P6E A;  4NF1 A;  2R8V A;  3W6S A;  2WPX A;  2F5I A;  5HMN A;  3SXN A;  1QST A;  3DR6 A;  2VI7 A;  2CNS A;  2ZXV A;  3GKR A;  1XF8 A;  1YVO A;  3TO7 A;  1Y7R A;  3IWG A;  2G3A A;  1U6M A;  2PQ8 A;  4JWP A;  1Q2Y A;  1L0C A;  1S3Z A;  4I49 A;  4AG9 A;  1QSN A;  2B3V A;  1CM0 A;  3TO9 A;  4U5Y A;  2CNT A;  3CXQ A;  1K4J A;  4AG7 A;  4KOU A;  3S6F A;  1LRZ A;  3EC4 A;  4JLY A;  2FT0 A;  3TOA A;  4KUB A;  4R3L A;  1I1D A;  3IGR A;  4II9 A;  3D2M A;  4PK2 A;  3R9F A;  3K9U A;  1ON0 A;  3BLN A;  1KUX A;  2R7H A;  3RYO A;  3JUW A;  5E96 A;  1VHS A;  4PK3 A;  2J8M A;  1I21 A;  3GYA A;  1V0C A;  3PGP A;  4XNH B;  1Z4R A;  2D4P A;  4JJX A;  2PSW A;  2R1I A;  4KOY A;  1S60 A;  2AJ6 A;  2B58 A;  4CRY B;  3TT2 A;  2ARH A;  3DNS A;  1QSO A;  4KVO E;  4MY3 A;  1GHE A;  1S7L A;  3I3G A;  2Q4Y A;  3TE4 A;  2GIV A;  5J8C A;  1XIX A;  4XPK A;  2QEC A;  2A4N A;  4B5O A;  4E0A A;  4OAD A;  2B3U A;  4MHD A;  3FXT A;  1YLE A;  5KTD A;  1RXT A;  4NCZ A;  4H6Z A;  4NEX A;  1IYK A;  2P6F A;  4KOV A;  1IB1 E;  1R57 A;  1P4N A;  3QB8 A;  4HKF A;  4KVM E;  4NXY A;  2PR1 A;  3UY5 A;  4YRH A;  4JXQ A;  1YK3 A;  4KOS A;  4FD5 A;  2Q04 A;  5F47 A;  4E8O A;  5J8F A;  4CRZ B;  1Q2C A;  1Y9K A;  3EO4 A;  4KVX A;  2FSR A;  1UFH A;  4QB9 A;  3LOD A;  4Y49 B;  1PUA A;  4UWI A;  2DXQ A;  1XMT A;  3NE7 A;  4QUS A;  4K30 A;  4PSW A;  2G0B A;  2OH1 A;  2REF A;  1BO4 A;  2B4B A;  2RC4 A;  5EBV A;  2P0W A;  3ZZI A;  2CNM A;  4MJ8 A;  2Q44 A;  1M1D A;  3R9E A;  4MBU A;  4AVB A;  3FNC A;  2JDD A;  3FRM A;  5DWM A;  2G3T A;  2ZW5 A;  2B4D B;  2FXF A;  3EFA A;  5F48 A;  4AVC A;  2REE A;  2EVN A;  1MJA A;  1XE4 A;  3PP9 A;  1WWZ A;  1KUV A;  1QSM A;  5F46 A;  2OB0 A;  2BSW A;  4F6A A;  2ZPA A;  4MI4 A;  4H89 A;  3R9G A;  2C27 A;  1I12 A;  1YVK A;  4UBR A;  3P2H A;  3TOB A;  1TIQ A;  4E2A A;  2I00 A;  1RO5 A;  4R9M A;  2Z11 A;  4CAX A;  2VEZ A;  1M4G A;  2AE6 A;  4CAV A;  3CXP A;  3D3S A;  3TFY A;  3FIX A;  2OZU A;  2R98 A;  4R57 A;  5KTA A;  1IIC A;  4OLL A;  4B5P B;  3BJ8 A;  2HUZ A;  3H4Q A;  4H6U A;  1YR0 A;  4MY0 A;  4ZBG A;  4GS4 A;  2ZW6 A;  5KTC A;  4JXR A;  2VZY A;  4EVY A;  3OWC A;  2JEV A;  2FL4 A;  4LUA A;  5H84 A;  4KOX A;  1SQH A;  4HNX B;  2O28 A;  3SXO A;  1OZP A;  2GAN A;  2BUE A;  4FD6 A;  2NMT A;  4B5P A;  1M4I A;  3KKW A;  5JQ4 A;  1M4D A;  4M85 A;  1CJW A;  4KOR A;  3W91 A;  5IX3 A;  3TCV A;  3F0A A;  4YGO A;  2PDO A;  3FB3 A;  5CNP A;  4FD4 A;  3R96 A;  3WR7 A;  3GY9 A;  2EUI A;  1S7F A;  1MJB A;  2VQY A;  1NMT A;  4QVT A;  2B5G A;  2JLM A;  2IL4 A;  3VWD A;  1YGH A;  2VZZ A;  2Z10 A;  3DR8 A;  5I0C A;  4R87 A;  5IV0 A;  2OZH A;  5C82 A;  4XPL A;  1IYL A;  5H86 A;  3E0K A;  4KLV A;  4DNC A;  5JPH A;  3LD2 A;  3V8I A;  4BMH A;  2B4D A;  4RI1 A;  4XPD C;  3TO6 A;  4M3S A;  3QAH A;  2CY2 A;  4F0Y A;  3MGD A;  4X5K A;  1WK4 A;  2FE7 A;  4JD6 A;  3DSB A;  1Z4E A;  4UWJ A;  2BL1 A;  3N7Z A;  2ZW7 A; 
#chains in the Genus database with same CATH topology
 2R7W A;  4KMF A;  1ZKG A;  4RN7 A;  2XV4 S;  2FNP A;  2R7Q A;  4ITV A;  1BL0 A;  2EWB A;  2QGU A;  4HNU A;  3OYM A;  1RUO A;  1CP7 A;  4KMU X;  4CXF A;  2ZEP A;  4RAY A;  1OCP A;  4IHS A;  4HAM A;  3K4B A;  4BBR J;  2HV2 A;  4I0B A;  1I5Z A;  1X58 A;  4BAY A;  3I9S A;  5JVG F;  4BQO A;  5M5W J;  5CLS A;  2BXZ A;  4NQW B;  2AFX A;  4FHT A;  3VWE A;  3BJO A;  4FX0 A;  3NRV A;  1DPU A;  2ADU A;  1SEU A;  3IHU A;  1H0M A;  1LJ9 A;  3FYN A;  4CCM A;  5GAD J;  1LVA A;  2A6E F;  2V1X A;  5ICE A;  5FVJ A;  3V8L A;  4HBL A;  1P0H A;  2MFZ A;  5K8N A;  4CZZ A;  1MDM A;  4LB6 B;  3O8G A;  3WTV C;  1Z5R A;  3D4U A;  3F5B A;  3H8G A;  2OQG A;  4L8A A;  3I56 I;  1WJB A;  1JXS A;  3GTQ J;  2X1C A;  1KQ9 A;  3F8K A;  2ZNZ A;  3HOU J;  2NRA C;  2RB7 A;  2OAZ A;  4FQG A;  2GE3 A;  4B6Z A;  4ZDL A;  2Q43 A;  5E1W A;  2AFS A;  4O3M A;  3KQZ A;  2M0M A;  1TLH B;  1CQT A;  3I54 A;  3T9Y A;  3RZD J;  3GTJ J;  4Q5S F;  3CDX A;  3IU1 A;  1QZE A;  5G21 A;  3C2B A;  3GZ5 A;  2VXK A;  2FE3 A;  3C7J A;  1T95 A;  4IL6 C;  4IQJ A;  2ZFU A;  2PRQ A;  3HRU A;  4C3I J;  4Y33 A;  3EY5 A;  4HLY A;  5HOO A;  3FDY A;  3QWL A;  2DA7 A;  3IH2 A;  3FF3 A;  3LSK A;  2HOA A;  4UIA A;  3SI1 A;  2FF4 A;  2E19 A;  4CYQ A;  1YRE A;  2EIM H;  1JKP C;  2DO7 A;  3FXJ A;  2FVG A;  2ZW4 A;  2LBF B;  4ESF A;  2LG4 A;  2FRH A;  1VQ5 I;  2NYQ A;  1XD7 A;  1VQL I;  3F22 A;  1QSR A;  2X9D A;  5IB0 A;  1V3F A;  2OZG A;  2HC9 A;  2DEA A;  5ISV A;  4KIB A;  2XAH A;  3HLP A;  1JTX A;  2HVR A;  3MEX A;  4LIT A;  1BC7 C;  2GXA A;  2HOS A;  2Y30 A;  2BHZ A;  2KL4 A;  3CUQ C;  1RNL A;  4XNH C;  1QO0 D;  4RB1 A;  4A3I J;  4L89 A;  1IO2 A;  2RGV A;  5L3F A;  3BCA A;  3IRR A;  1MW7 A;  4C2T A;  2L7M P;  1IXS B;  3N5F A;  4UCM A;  1HSJ A;  3LQR A;  2EK8 A;  3PFI A;  3BR1 A;  3VH9 A;  5EF6 A;  1IXC A;  1STZ A;  3S6H A;  3FJU A;  4A3F J;  1Z8X A;  2FNA A;  3D8P A;  1FP1 D;  3HOY J;  2LH9 A;  2XRO A;  4OIW A;  3SHP A;  2F5D A;  2CV0 A;  4O6J A;  1FT9 A;  2HYG D;  5CVU A;  4KOT A;  2CUZ A;  4KIT B;  2O61 A;  3JVN A;  2AXT C;  2JPB A;  4UB6 C;  1E3O C;  3Q9V A;  1VGY A;  2PRB A;  3BG6 A;  1TXR A;  3OYA A;  2BXY A;  4BS9 A;  3IL2 A;  3F8F A;  1J4J A;  4KUA A;  1ZK8 A;  1N75 A;  2DOD A;  5TJJ A;  2XB0 X;  3B73 A;  5E3N A;  3B3W A;  5EC4 A;  1H89 C;  1UST A;  2HTS A;  1JHF A;  1KWM A;  3PZJ A;  4LG0 B;  3L2N A;  3SZP A;  2GA2 A;  2R7V A;  2QSH X;  5AIP A;  1QZY A;  2WYR A;  1IOI A;  1AUG A;  4CYP A;  3A9L A;  3AG4 H;  3B3C A;  2NVT J;  1IDZ A;  2D4O A;  2YUS A;  1WCM J;  4E70 A;  2C6C A;  5HXD A;  3K6G A;  4E7Z A;  1S7N A;  3WG9 A;  1Y6I A;  3F23 A;  2B63 J;  5F08 A;  1ZG9 A;  1Z6T A;  2VL8 A;  3KYD B;  1ZN2 A;  4BGD A;  3OY9 A;  3LSJ A;  5HNF A;  1AYE A;  2VE8 A;  4CYD A;  2M3A A;  4Z65 A;  2FOK A;  5LGN A;  3BQY A;  4KLW A;  5K7H A;  3A03 A;  1WH7 A;  4ZYE A;  2NNY A;  1XEB A;  4DJL A;  5CVJ A;  5LHG A;  3F21 A;  4HNV A;  3PB4 X;  1GDT A;  3DBL B;  1X10 A;  3U2R A;  2Q7B A;  3FBU A;  2OF7 A;  1U5T C;  4IHX A;  1V55 H;  1YW9 A;  3FBN B;  1HKQ A;  1V5E A;  2L9R A;  3EET A;  3KEO A;  4BXF A;  5A2Q Z;  1F57 A;  2JSC A;  2KIF A;  2IQ6 A;  2CGP A;  1IUF A;  2HYJ A;  5CPR B;  2P6G A;  2QKM B;  3KIO A;  1IAW A;  4G1P A;  3IU2 A;  4XKV A;  1H88 C;  1Z8W A;  4KT6 A;  3G73 A;  1ZRE A;  3W6X A;  1U3E M;  1MND A;  1KZF A;  1N71 A;  3W2A A;  1ETY A;  2FU4 A;  1VF9 A;  4I99 C;  5HVH A;  5K5R A;  1FZP B;  2JA5 J;  3W6S A;  2HZD A;  1LE8 B;  1RR7 A;  4OAY A;  4NJQ A;  2WAE A;  2Y2Z A;  3SXN A;  3FIW A;  1VFC A;  1KU3 A;  2ZXW H;  2ZEH A;  2Q8K A;  1FLI A;  2X1D A;  3HSR A;  3DR6 A;  4HF0 A;  1EH6 A;  3WU2 C;  4HST A;  2E36 A;  4E7L A;  1IC8 A;  1ZGW A;  2CNS A;  2MD5 A;  3EDP A;  4K3N A;  4MCP A;  1MMA A;  5B1A H;  1IGN A;  3TO7 A;  4P4B A;  5G20 A;  4XSZ F;  3RDI A;  3IWG A;  2WUU A;  5E3O A;  2G3A A;  2J5P A;  2XF5 A;  2ZXH A;  2ME6 A;  4ENK A;  3CUQ B;  3DBH B;  1UZC A;  4LFU A;  4UUT A;  1JGG A;  4ZGY B;  4ZY0 A;  3TO9 A;  4Y17 A;  4HOB A;  3A0H C;  2L0K A;  4GM5 A;  4I0A A;  1HDP A;  5TRD A;  2XEG A;  3D1N I;  4KOU A;  2Z3K A;  2VKH A;  1MZB A;  2XAU A;  3FXK A;  1I3Q J;  2EB7 A;  2NS7 A;  2X0L A;  5ICC A;  3OL3 A;  4A2U A;  2FT0 A;  4MFP A;  1RPW A;  2DYR H;  1RUN A;  4RB3 C;  5LEK A;  2D2W A;  4CCN A;  1VQ4 I;  1I1D A;  2DMQ A;  4BD9 A;  4CYN A;  4II9 A;  2CQ7 A;  2EFP A;  3QOP A;  1HQC A;  3K9U A;  1ON0 A;  2CW0 F;  2MSY A;  3PQJ A;  5KAI C;  1YLO A;  1KUX A;  2PIY A;  4XN3 A;  3BLN A;  3IC1 A;  4FWU A;  3M1E A;  2R7H A;  3S3N A;  3RYO A;  4OC3 A;  2L7Z A;  2L7K A;  2RAE A;  3F0C A;  2J8M A;  3OV8 A;  4MGR A;  3G71 I;  1JHH A;  3H5N A;  4P4J A;  3GYH X;  2QF7 A;  1I1S A;  2BW3 B;  2VT3 A;  4UFW A;  2IAI A;  4HQM A;  1S7A A;  4S0H B;  1W36 C;  1FMW A;  1S60 A;  2ZJQ F;  3ZMV A;  2YR2 A;  1D1A A;  2HYF A;  1BI2 A;  3G1L A;  4KN7 X;  2Z9O A;  3I59 B;  2DPT A;  5E8I A;  2JBK A;  1QVU A;  3TT2 A;  4DYC A;  3DNS A;  3BCB A;  3RKX A;  4OIQ F;  5LHH A;  4R8H A;  5IY5 H;  2FXA A;  2HKX A;  2KMU A;  4UUS B;  1D8J A;  1QSO A;  3J80 Z;  3CES A;  4KT5 C;  2HR3 A;  4PXD A;  2E7X A;  2JRT A;  4RM3 A;  1Z9C A;  1GHE A;  1S7L A;  3GB0 A;  3BQZ A;  2PJ2 A;  4FE7 A;  5CVV A;  2X6O A;  2GFQ A;  2Z3L A;  3OSF A;  4KSA A;  2VKD A;  4ZYA A;  4AM3 A;  1YW4 A;  2OR4 A;  4XOT A;  2A4N A;  3KHX A;  3ASO H;  4NC8 A;  1W0U A;  2MC4 A;  4C9Y A;  4EJT A;  3ZGK A;  1WJC A;  4U87 A;  3CCQ I;  1YRN A;  1ULY A;  2DAO A;  3BP8 A;  5JLX A;  1N77 A;  1KQ0 A;  1TF9 A;  4MHD A;  5D6E A;  3CPA A;  5IYC J;  4B13 A;  2HQ5 A;  1RXT A;  3BR2 A;  4NC6 A;  1Z67 A;  3KP3 A;  3KPH A;  3R4K A;  4D1Q A;  2F2E A;  3TL4 X;  2O5R A;  1FX7 A;  1LAP A;  1IB1 E;  4CGO A;  1J09 A;  4NXY A;  5K8P A;  2PR1 A;  1X12 A;  2Q4Z A;  1BW5 A;  1F43 A;  2VXD A;  4Q7A A;  4IHM A;  3JAM K;  1BJA A;  4JXQ A;  1J7K A;  1D0Y A;  4FD5 A;  3V8J A;  2Q04 A;  2X6Y A;  3HYI A;  2QUF A;  1R5I D;  2DFE A;  4UNO A;  1Y9K A;  4A3G J;  5IT9 K;  4Y3O A;  2DLL A;  3H9Q A;  2OJE D;  2UWM A;  2ELJ A;  3QYB A;  2Y75 A;  1UFH A;  4MFK A;  4A31 A;  1K83 J;  2Y69 H;  3P9C A;  1MNM C;  1PUA A;  4IAV A;  1GYT A;  2DI3 A;  2DXQ A;  2H94 A;  2E1O A;  2L2O A;  2HB6 A;  3J7Z I;  4H4K C;  5KK1 A;  1EKE A;  4BE1 A;  2G9D A;  2ZEM A;  1XTA A;  4PSW A;  4U7B A;  3C2G A;  4II2 A;  2G0B A;  4B3X A;  2KIS A;  3QYF A;  2GOX B;  1K61 A;  1CBX A;  4Q36 A;  1P2F A;  5KCM A;  1TTY A;  3CUO A;  3IWF A;  5EBV A;  1IRF A;  1XC5 A;  1R3N A;  2ZOG A;  2NVY J;  1QZZ A;  2GZW A;  5JLW A;  1LDJ A;  1M1D A;  3R9E A;  1XCB A;  4JX6 A;  4YEL A;  1VQK I;  3NH5 A;  4I7H A;  2R4G A;  4P1W A;  4FX4 A;  5D8N A;  4G94 A;  3FRM A;  5AG6 A;  2CUJ A;  5DWM A;  3MZ8 A;  1S5L C;  4XKW A;  1JJ8 C;  1F5T A;  3BDD A;  3CJN A;  5K7F A;  3JRB A;  4Y52 J;  2VKV A;  2ZW5 A;  3VEP A;  2WA0 A;  3CF5 F;  1SVM A;  5JHF A;  2FXF A;  2HTJ A;  5K8O A;  1QRY A;  4HF1 A;  1WH5 A;  3Q0V A;  3M8J A;  3JAM Z;  2REE A;  4KSF A;  1I50 J;  2OCC H;  3NH4 A;  2M87 A;  2NAZ A;  4WXD A;  3NA6 A;  2LK2 A;  3ML6 A;  1WWZ A;  4OC5 A;  3HSE A;  1WJD A;  3IEH A;  1MBK A;  1UJ8 A;  3NE8 A;  4F6A A;  3I5U A;  5H20 A;  4MI4 A;  1XDS A;  1CX8 A;  2V1U A;  3VWB A;  4H89 A;  3I53 A;  1LQ1 A;  3BXM A;  3GXO A;  3H8E A;  1W7P B;  2BVL A;  2IW5 A;  3H1C A;  2VPR A;  1ARL A;  1BJZ A;  5GAG J;  4XL9 A;  4MQ9 F;  5H6R A;  4U0Y A;  1ZLJ A;  1XSD A;  3IP4 B;  2RV8 A;  2R5Z B;  1WZ2 A;  1D8K A;  4MHZ A;  2DA2 A;  5C44 J;  5K1Y A;  3E6D A;  1RO5 A;  4EAT A;  3WU0 A;  4YU9 A;  3DP7 A;  3GO5 A;  1XX5 A;  3E5Q A;  2R0Q C;  3F3X A;  1K78 A;  1YLF A;  2VEZ A;  1IV6 A;  4RB2 C;  2DDA A;  3PO2 J;  4IZZ A;  4A3C J;  1M4G A;  3BT9 A;  4P55 A;  4K2E A;  1YI2 I;  1ARM A;  3HOS A;  3NWT A;  3K4M A;  2H6C A;  1XPX A;  1J9I A;  4R57 A;  1Z21 A;  3IWZ A;  2YX4 A;  4RM2 A;  4OLL A;  4B5P B;  3MKW B;  2LKX A;  3JRF A;  3WT4 A;  1PCA A;  5I4M A;  2M8E A;  3W6V A;  4E7J A;  3BOQ A;  4B12 A;  1J59 A;  3S1M J;  3H5R A;  1IXR C;  1TWC J;  4FUU A;  4AIK A;  1DUX C;  3LFU A;  3D5L A;  1UFM A;  2HQA A;  5HOD A;  1MKM A;  3I64 A;  1QA6 A;  1R1U A;  2V26 A;  3O3K A;  2ZW6 A;  5AON A;  3JRI A;  3NAR A;  4BHP A;  2IPQ X;  1FSH A;  1YG2 A;  3HKZ N;  3E5X A;  4AIJ A;  3KAS A;  4KOX A;  2CUF A;  4Q48 A;  2DFH A;  1T0F A;  1XRY A;  1HF0 A;  1Y0U A;  1ZTR A;  1HA8 A;  2OUM A;  5L3G A;  4ETS A;  1Y7E A;  3TQN A;  3I59 A;  4YIF A;  1JI8 A;  3CDI A;  2GAN A;  2DFF A;  3E1S A;  1LDD A;  3PBB A;  4BY1 J;  3L2R A;  3VYR B;  3VSK A;  5E8G A;  2WAQ N;  1M4I A;  3KKW A;  3JW4 A;  1LB2 A;  3E6M A;  4M85 A;  1CJW A;  5A28 A;  1G6N A;  2M0C A;  5DUK A;  2OZ6 A;  3HL2 A;  4M3G A;  1PDN C;  3W91 A;  2M34 A;  3TCV A;  1SMY F;  3FIS A;  5F04 A;  3PJR A;  4XR6 A;  2R5Y A;  1RTQ A;  1MSF C;  2PDO A;  3FB3 A;  4IJA A;  2VAS A;  1MSE C;  2DJI A;  2LY2 A;  2VLA A;  1MJB A;  3IUO A;  3SFI A;  1NMT A;  4AYB N;  1ZLH A;  2O9L A;  2CXA A;  2VQY A;  4QVT A;  2JLM A;  1CG2 A;  3S17 J;  1ITY A;  1YGH A;  2LMD A;  5I0C A;  4IRG A;  1Q1V A;  1GVD A;  4Y7N J;  3RKW A;  5BWA B;  2EPF A;  1TKJ A;  4A33 A;  3KZW A;  4XN0 A;  1FMV A;  3K70 D;  4R1H A;  2DOE A;  2K9M A;  4UVC A;  4X0G A;  5H86 A;  4CGL A;  3GWZ A;  4IOC F;  3LSI A;  3HTS B;  2IGN A;  5FLV A;  1ZAO A;  1YIJ I;  2XAQ A;  3N97 A;  4ZI6 A;  1YQA A;  2M4G A;  3QP6 A;  4X1E A;  4EQQ A;  4FE4 A;  3OS0 A;  1AWC A;  2B4D A;  2PJR B;  4IOA F;  1BR2 A;  3TO6 A;  3PEI A;  1ETO A;  2EH3 A;  2PMU A;  1S7O A;  3QU6 A;  4LK1 F;  3MRU A;  4F8Z A;  2EV5 A;  2DDB A;  3DQV C;  2NSM A;  2MH2 A;  2VT2 A;  4ASN A;  2H27 A;  4LLG F;  4XKC A;  3QPH A;  3CC7 I;  2VL1 A;  1Z4E A;  2DMT A;  4P10 A;  2FMY A;  1ZG3 A;  5FKM A;  5FB2 A;  4UIB A;  3Q0W A;  2ICW G;  3L2C A;  1Y0N A;  3ECO A;  3P7N A;  4YFN F;  1TWH J;  1X1B A;  3PNV A;  4EJV A;  1SFK A;  4XLC A;  1AHD P;  2PJC A;  2MLK A;  3S15 J;  2KIQ A;  1U9O A;  2XPU A;  2DQL A;  2P6S A;  4FT8 A;  2EV6 A;  2V8H A;  2X4H A;  3CF2 A;  4RS2 A;  4YFX F;  2ZBK A;  3A4C A;  1BPM A;  1YIO A;  2FQ4 A;  3R1K A;  1XGS A;  3T90 A;  5LRJ A;  4A0X A;  4TWE A;  2WPW A;  4U9Y A;  1CF7 A;  4LQ6 A;  2RNJ A;  4PV6 A;  3RPQ A;  4R8F A;  4RUH A;  2AFM A;  3IH4 A;  2KRF A;  5CQG A;  2PBI A;  5LFA A;  4OIO F;  2E35 A;  4UB8 C;  1IW7 F;  1MH4 A;  1X1A A;  3DFG A;  1G2H A;  2DOF A;  3FXM A;  2VBZ A;  3LSH A;  1R1T A;  5FGM A;  3EYI A;  2AFZ A;  4XPD B;  2Y0S N;  1YO5 C;  1P9Q C;  3IAM 2;  4KFC A;  4E6K G;  2VOP A;  3I4N J;  4MRI A;  5LYL A;  2IXS A;  5EMI A;  1Q7L A;  3A2K A;  3BG7 A;  2DQR A;  2HOT A;  5ILU A;  2HS5 A;  5L3B A;  3A01 A;  4EME A;  3CJQ B;  3ELK A;  2R7X A;  3ZQF A;  3D66 A;  1VHO A;  2Q51 A;  4MHY A;  3OYG A;  5HS8 A;  5AG5 A;  4A39 A;  1BI1 A;  1X3Z B;  2F5E A;  3H36 A;  5EYR A;  1PU9 A;  2K5T A;  2PC1 A;  3OYJ A;  2K02 A;  4P44 A;  4NGS A;  3DDD A;  1YOV B;  1ORK A;  2JEW A;  2QCO A;  2HNH A;  3K2Z A;  3CP2 A;  1Q2D A;  5EGO A;  4CS0 B;  5DM6 F;  3FEC A;  3HC7 A;  5J47 A;  3MKL A;  1TP4 A;  5DD4 A;  4KIF A;  2RQQ A;  1RC9 A;  3I1U A;  3B3V A;  3PB7 X;  4OKO A;  4ZC3 A;  3L1P A;  3CCV I;  2DW4 A;  3HHG A;  4A3M J;  1FY7 A;  2F48 A;  2Q7S A;  3O2P E;  5E3L A;  5ICF A;  4AXV A;  2WV0 A;  5FFX A;  2KLO A;  1N25 A;  2M4K A;  1BPN A;  2FIW A;  2L02 A;  4GCV A;  2DCE A;  5EG0 A;  2LRD A;  2Y0M A;  4D7N A;  2BOL A;  1D3Y A;  3DKW A;  5LLQ A;  3BG5 A;  2E2H J;  4UUV A;  3FK7 A;  4G9Y A;  3D7F A;  2BZT A;  2DT7 B;  2KDO A;  1X2N A;  4PJ0 C;  3HRS A;  2CUE A;  5DEQ A;  5LEJ A;  4AVP A;  1NK3 P;  1M44 A;  3BJA A;  3F8M A;  3ZJ0 A;  2R7D A;  2VOD A;  4R79 A;  1B8I B;  1VKC A;  4BEH A;  3CCE I;  5FLM J;  2ECC A;  3JSO A;  3FXL A;  2PJ8 A;  4XRF A;  2KIM A;  4LOC A;  4CUG A;  1FIA A;  4MJ8 A;  1OR7 C;  3U1D A;  1A36 A;  3S3O A;  3S9M A;  4V2F A;  4DZJ A;  3TW6 A;  3OYL A;  2P7V B;  2XGC A;  1B1B A;  2UUZ A;  5F27 A;  3D2P A;  4F92 B;  3G3S A;  4G6T B;  1G4D A;  4L5I A;  2VB6 A;  2LBF A;  1EJ9 A;  3BPV A;  1BOB A;  1FIP A;  3IAS 2;  2JA2 A;  2XHK A;  3HOV J;  2H1L A;  5CYV A;  4N9H A;  3FKJ A;  1HKS A;  2L5Q A;  4Q38 A;  1WGX A;  2BEI A;  2FEZ A;  1J75 A;  3LA2 A;  2W4S A;  4XBF A;  3B35 A;  4C2Y A;  3BG3 A;  1WJ5 A;  1OR7 A;  2IJL A;  2BO9 A;  2FQ3 A;  3OYF A;  3ERM A;  4UHT A;  5ED4 A;  3K7A J;  5C88 A;  1X1C A;  1W36 D;  5B3S H;  4M3B A;  4C3J J;  5IP6 A;  4M71 A;  1HST A;  2ZED A;  5LRK A;  1ETV A;  3CDH A;  3ISP A;  2DMU A;  2E60 A;  1T39 A;  4Y13 A;  1CPX A;  5HVG A;  4JX5 A;  4C2Z A;  4OAZ A;  2V8G A;  2X85 A;  4YIR X;  4UEE A;  4CAW A;  1LEA A;  4QC6 A;  3VFZ A;  2BY2 A;  5DCM B;  4X3R A;  3DLA A;  3QOD A;  5DD8 A;  4BE0 A;  2V4J C;  5LD2 C;  3L2U A;  1ETW A;  1D0Z A;  3GTL J;  3KHZ A;  2HDW A;  2QEN A;  2EA2 A;  2P4W A;  1UHS A;  1WI9 A;  4QBJ A;  2QBY A;  2QJ8 A;  2Y48 A;  5D5U B;  2HQN A;  2COM A;  6CPA A;  1OIS A;  4AB7 A;  3CCM I;  4EFD A;  1B87 A;  5F1J A;  2O8X A;  1IJW C;  4UUS A;  3HPG A;  3S2D J;  3PQK A;  5EEA A;  2ZOF A;  4OAE A;  1MGT A;  1J2X A;  2V9K A;  3E0J B;  3DF8 A;  4I6Z A;  2HEO A;  4LD5 A;  5HDK A;  1SD7 A;  3ZPL A;  2ESH A;  2DK8 A;  2O3F A;  2OTL I;  3B6C A;  1LEB A;  2P6E A;  2GLO A;  1S29 A;  4B3A A;  2R8V A;  2BHY A;  2NOJ B;  2F5I A;  4UF4 A;  4GGG A;  2HPM A;  3OYD A;  3K4N A;  3OS1 A;  1QST A;  4LG3 A;  3UKG A;  1XS9 A;  1U8B A;  5FKL A;  3K10 A;  2ZXV A;  1B9M A;  2UXX A;  2EK5 A;  3PIO F;  1YSJ A;  2DPS A;  3I4P A;  3S2W A;  1TBX A;  1Y7R A;  3D67 A;  3WE3 A;  1FC3 A;  1R4M B;  4PXE A;  1A35 A;  2V7F A;  3FHN A;  2G0E A;  2K85 A;  4EGY A;  3CPX A;  4JWP A;  5FO5 A;  4C2M J;  1FTT A;  4PJN A;  1O57 A;  2STT A;  1RIO H;  4F91 B;  3G2B A;  4CSW A;  4IO9 F;  3AG3 H;  4MHG A;  4BKX A;  4ZZL A;  3ZQC A;  4B09 A;  4DBQ A;  1OLT A;  1K4J A;  4HX8 A;  1IY7 A;  4PGH A;  3WC6 A;  2E1M C;  3F6V A;  4A3K J;  4JZ0 A;  5AG7 A;  1KA8 A;  3HBL A;  2O4H A;  1TT0 A;  3CLQ A;  4OME A;  4AID A;  4NFR A;  2KFD A;  4R3L A;  4F3Q A;  3IGR A;  5D5V B;  3W3C A;  3CTA A;  1KON A;  3D2M A;  2PJ5 A;  1W5T A;  1Z6R A;  3ABK H;  4HW0 A;  4IX7 A;  4PK2 A;  4A3B J;  3W2W A;  1IF1 A;  1JUP A;  5BS6 A;  5E96 A;  1VHS A;  1P7I A;  2MBF A;  2KJC A;  4XLE A;  2CYY A;  4A2Z A;  5F1R A;  2DU9 A;  1I21 A;  3GYA A;  1V0C A;  3PGP A;  4XNH B;  1X3U A;  3MZY A;  4IHY A;  1G8X A;  3PB6 X;  4JJX A;  1XMX A;  2ACJ A;  4JK1 X;  3L00 A;  2K4J A;  1WJF A;  3CO7 C;  2R1I A;  1D1C A;  4MO7 A;  4UV9 A;  5D8L B;  4XLN F;  2BW3 A;  1BBY A;  2AJ6 A;  3WAB A;  3FXQ A;  2B58 A;  1JT6 A;  2LNB A;  1GLN A;  3DPT A;  3K4J A;  2E2J J;  4CA0 A;  4OMY A;  3CZX A;  3A1Y A;  2KT0 A;  3F8N A;  4LMY A;  2YGW A;  1DGW Y;  4LIU A;  4EJW A;  3TKY A;  1MMG A;  4BJ5 C;  3E3V A;  1FNO A;  1AMP A;  1W7P A;  3ABM H;  3K4C A;  1IN4 A;  2YNE A;  2HPI A;  2Q4Y A;  2V8D A;  2ME0 A;  5BQT A;  5GAH J;  4I2O A;  2PMZ A;  3WGH A;  5ILS A;  4XPK A;  1OKR A;  2FX0 A;  1DGR M;  3RBU A;  1P7J A;  2VBY A;  4XON A;  4CYC B;  4OAD A;  4E0A A;  1N78 A;  2B3U A;  4TV7 A;  3RZO J;  3TDZ C;  3KLO A;  2LDU A;  3FXR A;  3UNG C;  1YLE A;  1MMS A;  1TQP A;  3G1M A;  2GA1 A;  5HS7 A;  5FKK A;  3BY6 A;  4H6Z A;  3IWW A;  2XDV A;  4HPS A;  4CYO A;  5F0H A;  3KR5 A;  3P5J A;  3PM1 A;  1A31 A;  2B0L A;  1Z7L A;  2WAD A;  5H2F C;  3QP5 A;  3FM3 A;  1BW6 A;  1D1B A;  4U88 A;  5HNH A;  4CCJ A;  5F47 A;  2K3P A;  2BOA A;  4A6E A;  1ELM P;  3JSP A;  5ICG A;  4CCK A;  1JKQ C;  2LC2 A;  4CRZ B;  2UZK A;  1Q2C A;  3V38 A;  4EJO A;  4HDV A;  3EO4 A;  2HDC A;  2FSR A;  5G1Z A;  4E7K A;  4E7I A;  4QB9 A;  2CQN A;  2WSA A;  1YW8 A;  2ZEF A;  1OQY A;  3AFH A;  2E5N A;  2HZT A;  4CHU A;  3LWU A;  2VC1 A;  5J6X A;  3NE7 A;  1WSU A;  4PCQ A;  4ONW A;  3J80 K;  2KPM A;  1I39 A;  1VND A;  4GYG A;  4N4N B;  3WHC A;  4GDF A;  4P4F A;  5K8M A;  3MZH A;  4M6V A;  4LGW A;  3S1Q J;  1OCZ H;  4WXH A;  3ZMD A;  2ABZ A;  3MN8 A;  3Q0U A;  1VQ8 I;  3H3V K;  3L7W A;  2HFH A;  1HW2 A;  1BO4 A;  1TW2 A;  1P6R A;  1WVR A;  3P9I A;  3ABT A;  3PSF A;  3MKY B;  4JOM A;  2PMH A;  3FZV A;  4DYQ A;  4RBO A;  3GZN B;  1BI0 A;  2LRE A;  1UEL B;  3QOE A;  3AAF A;  1HEE A;  1PVE A;  1VHE A;  5TGT A;  4BJT A;  3SI2 A;  1Y1V J;  3FNC A;  2JDD A;  3K4K A;  1W1W E;  3IV5 A;  1RI7 A;  3T5X A;  1DQU A;  1W5C C;  2B4D B;  2RKH A;  5BOX A;  3OOP A;  2PI0 A;  2P5K A;  3WTY C;  1K6Y A;  1R4N B;  3KP5 A;  3OOU A;  1HW5 A;  1S8N A;  4KUM A;  3ZMU A;  3VB2 A;  3A0B C;  3DKY A;  4PUS A;  3G6E I;  3FMC A;  3JRG A;  3RZA A;  1QSM A;  2OB0 A;  3EUK L;  4KJZ A;  1SAN A;  2ODF A;  3HKZ A;  3ZMZ A;  2IRF G;  4IRI A;  2CFX A;  2I8D A;  2RQP A;  3PSI A;  4A5M A;  4OID A;  2ZEE A;  3R9G A;  3KEY A;  2C27 A;  3RNZ A;  2DA5 A;  4XLP F;  5IT3 A;  1U5T B;  2M30 A;  4A12 A;  1I12 A;  3IWE A;  2QQB A;  1XG1 A;  2I3C A;  4UBR A;  2P81 A;  2CU7 A;  1IN8 A;  4AVZ A;  1TIQ A;  2CTC A;  1F36 A;  4E2A A;  2BEO A;  4R9M A;  2Z11 A;  4CAX A;  2VUM J;  3K1P A;  3V4G A;  4ZX8 A;  5JFR A;  3OR2 C;  3HUG B;  2P5V A;  3DPU A;  4HEA 2;  2GXB A;  1XGO A;  2LF7 A;  4CZC A;  4XLH A;  1ZRC A;  1PUF A;  1OCC H;  1Z05 A;  2NVU B;  4ENM A;  1LAM A;  2OV7 A;  2D45 A;  1MDM B;  1W4M A;  2K9N A;  1H8L A;  3VYU B;  1TL8 A;  1SD4 A;  4OIP F;  3S14 J;  2E5Z A;  3ZMT A;  1IU8 A;  1FBS A;  2EFO A;  3CP8 A;  1ETX A;  2UV1 A;  3RSN A;  2OZU A;  3RIR A;  1M4L A;  2WV1 A;  2R98 A;  3VYT B;  2PLY A;  4N4O B;  1FYM A;  2AHQ A;  1IIC A;  3K2K A;  4DUK A;  3ESW B;  3NWS A;  2AFU A;  2HUZ A;  1J5Y A;  3H4Q A;  5HLG A;  5AIQ A;  3V7Z A;  2M9H A;  1P4X A;  4H2K A;  4IXA A;  3HPH A;  3LNQ A;  5C4X J;  3HOT A;  2UXN A;  1OMI A;  1YQE A;  2IS6 A;  4L9N A;  3C1D A;  3I71 A;  5HVQ C;  1FOY A;  3S16 J;  5FKO A;  4GS4 A;  4S05 A;  4WCG A;  1ON1 A;  2XUB A;  3GBG A;  3MVP A;  4G8X A;  1WPK A;  4PGG A;  1GT0 C;  2VZY A;  4MHP A;  5B66 C;  1NK2 P;  4NGM A;  3PB9 X;  4XSX F;  1F2P A;  3DPL C;  1SQH A;  2BV6 A;  2OQR A;  2XGD A;  1X19 A;  4IVN A;  1SFX A;  3DLL F;  2DA3 A;  4U7D A;  2TRT A;  1PP7 U;  1O3S A;  5DUI A;  2E71 A;  4EMS A;  3R6S A;  4EVI A;  4B48 A;  3OYB A;  4C3H J;  1HDU A;  4MCS A;  4OOI A;  3SXO A;  2I10 A;  3TC8 A;  2EA4 A;  1OZP A;  4MFJ A;  4LJZ F;  4JQF A;  2BUE A;  3JRU A;  3M8E A;  3REO A;  2I5U A;  1FBU A;  5LYI A;  3CCL I;  3OYK A;  5JQ4 A;  3A02 A;  3WC7 A;  3TP0 A;  2JZY A;  1PUE E;  4PJM A;  2W24 A;  2MH9 A;  1R22 A;  2W25 A;  3MAJ A;  4J01 A;  4ZZD A;  3QPS A;  1NH3 A;  3SJM A;  3SJG A;  1G3W A;  1FEX A;  4F7Z A;  1IN5 A;  3R0A A;  3GY9 A;  3CCJ I;  2EUI A;  3KYC B;  3WTZ A;  1AU7 A;  4O5V A;  3L9F A;  5GTH C;  3KCC A;  4M6X A;  4IEJ A;  4CGN A;  2ID3 A;  5D6F A;  4PQA A;  1WKM A;  5F64 A;  4NGP A;  2JSP A;  2DT5 A;  4BXU A;  2EZI A;  4R87 A;  3ULQ B;  3FM5 A;  2JA8 J;  3OR1 C;  3GTG J;  3KP4 A;  1TC3 C;  2C6G A;  1DU6 A;  5DCM A;  3I4M J;  2D1V A;  3FXU A;  3K2A A;  4OMZ A;  4D5C A;  1Y0R A;  1IN6 A;  1JGS A;  4FCY A;  1O3Q A;  3WE2 A;  2XKP A;  4RAZ A;  1R49 A;  1JKR C;  3HIF A;  4MFE A;  4RGS A;  5CVI A;  4UEZ A;  3LD2 A;  3V8I A;  5J4Y A;  1OJL A;  2X6X A;  1KU7 A;  2FBK A;  4IQ4 A;  2A5Y B;  5J1R A;  3IIB A;  2M7B A;  4MTD A;  1T98 A;  4MIM A;  4UY8 I;  1R58 A;  4F0Y A;  3MGD A;  4P96 A;  3MFK A;  3BR0 A;  1WK4 A;  2AXL A;  2AQF A;  3HJE A;  3FMR A;  1ELL P;  2R7O A;  3DSB A;  4A32 A;  1B8I A;  5FKN A;  2JJ7 A;  1WRJ A;  3CO6 C;  4W1U A;  2BL1 A;  3NEU A;  3GLJ A;  1KYW A;  3HDD A;  1QPI A;  3IO1 A;  3KP2 A;  2VI6 A;  2CMP A;  1ON2 A;  1S72 I;  2DFI A;  5JHU A;  5E17 F;  4F9V A;  4MFL A;  5JM6 A;  2OU2 A;  1XSX A;  4XOR A;  2V6E A;  4C68 A;  2RRE A;  3CLO A;  1A6Q A;  4D9J A;  2PJ7 A;  2L4M A;  4M9X A;  4BUP A;  4E4H A;  3CMM A;  3CJT B;  3MQ0 A;  1LFU P;  2QSG X;  3FED A;  1P92 A;  4G6Q A;  4C2X A;  1XOV A;  3D0S A;  2PIZ A;  2Q4V A;  4HYE A;  2W1O A;  2Q2E A;  2QYO A;  2KP6 A;  4Z2Y A;  4P9U A;  5IT9 Z;  4UFX A;  5DTD A;  1E3P A;  3HZJ A;  2ESN A;  4BXX J;  4UEF A;  2CRG A;  3HTU A;  2L01 A;  3OSG A;  3TMO A;  3UR3 C;  1A6I A;  1VQO I;  1K79 A;  4GFB A;  3L2V A;  1T08 B;  3ASN H;  2ISZ A;  1TQI A;  2DA6 A;  3ECH A;  3WU1 B;  3S1R J;  2L4A A;  2VOO A;  2PJ1 A;  2WY7 Q;  4MLO A;  3LMM A;  4KZT A;  4IPA A;  3C26 A;  2WBM A;  3RO0 A;  4KIG A;  3IRQ A;  1OCR H;  1Y56 A;  4PJL A;  1SAX A;  3G1O A;  4ZTF A;  3KEQ A;  1FBQ A;  2X1E A;  1U78 A;  2VQC A;  1FNN A;  2MG4 A;  2NYX A;  2V1N A;  2R7R A;  1H9G A;  1T38 A;  1EH8 A;  2IGM A;  4ON0 A;  2NVQ J;  4NSQ A;  5F49 A;  3KLN A;  4JYW A;  2C6Y A;  3ERE D;  5DWN A;  3DEW A;  1MMD A;  1JJ6 C;  2W82 A;  4IRH A;  1F1Z A;  2M8G X;  1MK4 A;  4ONU A;  1U2W A;  2CFO A;  4ABZ A;  5A2Q K;  1S3J A;  1XB4 A;  5EDN A;  1BR4 A;  4UV8 A;  1UCR A;  4AWX B;  1Z8T A;  3F9K A;  5B1B H;  2QIR A;  5LYF A;  2M45 A;  3R95 A;  1EV7 A;  5GCN A;  4AIH A;  3IH3 A;  4MXU A;  2CO5 A;  1APL C;  2JQ7 A;  3LA3 A;  3S2H J;  2F6C A;  2Z2S B;  3EXN A;  3GTK J;  3WTT C;  2FUG 2;  3DEE A;  4AC0 A;  2B5G B;  4MFQ A;  5CQE A;  1J0R A;  4R3K A;  4HDU A;  3SJE A;  5DDG A;  4OC4 A;  4RGR A;  1B6A A;  4LX9 A;  4YFJ A;  3QPT A;  1EH7 A;  4B43 A;  3B3T A;  2KZG A;  1FJL A;  3S32 A;  2FCK A;  2H09 A;  2M5W A;  2XEF A;  4OP4 A;  1AKH A;  2Z5U A;  2CTB A;  4CIC A;  2FIA A;  3HSF A;  5LYD A;  1YJN I;  4CGM A;  1M1E B;  5AGE A;  2OPT A;  1KQ8 A;  4D5F A;  2E1C A;  2QVP A;  3HXL A;  2DTZ A;  5F0F A;  3B8G A;  2VON A;  1ZQ3 P;  3X2Q H;  5F0C A;  1MBG A;  3FXO A;  2HI3 A;  1ODD A;  3DU5 A;  4WX9 A;  3RI4 A;  2D1H A;  1W5S A;  1SFU A;  3GTM J;  4G7O F;  1S7K A;  2XEI A;  1BAV A;  4A0Y A;  4ZYG A;  3PBE A;  4OC2 A;  4PZJ A;  1JUM A;  2O8K A;  5LRS A;  4A93 J;  3JCU C;  2J9A A;  1USS A;  4L0Z B;  4GXO A;  2MAB A;  3B2Y A;  3GW2 A;  1YX5 A;  3LSP A;  1DP7 P;  2QQ9 A;  2ZC2 A;  3Q5F A;  4ORF A;  1FYL A;  2NVX J;  2DA4 A;  4FD7 A;  4IF5 A;  3COA C;  3TGN A;  3LST A;  4DGW B;  2A05 A;  2DPD A;  1MBF A;  2DBB A;  2QML A;  3M4O J;  2VBQ A;  2ZNY A;  2XIG A;  3LAP A;  2LP0 A;  3D5S C;  2HVS A;  1NHA A;  2I79 A;  2F4I A;  3CME I;  1LFP A;  5E79 C;  3HG9 A;  2JA7 J;  4AVA A;  2AFO A;  2Q1Z B;  5EZG A;  4U0V A;  2ID6 A;  3ZCO A;  1IOF A;  1HDD C;  4ZTJ A;  2B7E A;  3DTK A;  3EUH A;  4M9Z A;  3JTK A;  1B4A A;  4WK8 F;  4F0X A;  1SC7 A;  5IP9 J;  5FLX Z;  4KYW A;  2OTJ I;  2AQE A;  3S9N A;  5ERI A;  3RTR A;  2JDC A;  2R5Y B;  4P4I A;  3QQA A;  2XRL A;  4BQQ A;  5EG0 B;  1YTY A;  3R61 A;  3GEZ A;  4BIN A;  4NF1 A;  1ZRD A;  1Y0Y A;  1Y8Q B;  2XF7 A;  1BIB A;  2WPX A;  5F6F A;  1YHQ I;  2GU2 A;  1RES A;  3NH8 A;  5GAE J;  4JX4 A;  2CIJ A;  2VI7 A;  4NHJ A;  2EIN H;  4EV0 A;  1ZGA A;  3PUB A;  4S04 A;  3GKR A;  1XF8 A;  1JUS A;  4A0Z A;  1YVO A;  1PYV A;  1G3Y A;  3GCM A;  1OYY A;  3FF5 A;  3K69 A;  1TWA J;  5FRM A;  1O7F A;  4MFD A;  2QKL B;  4ZYH A;  1Q2Y A;  1S3Z A;  4I49 A;  1QSN A;  4TNU A;  1GV2 A;  4L0Y B;  4M72 A;  4KA4 A;  2B3V A;  2VBX A;  2CNT A;  5IB9 A;  3AG2 H;  2CQX A;  1I6X A;  2POK A;  2LY1 A;  1SD6 A;  1FP2 A;  3BR3 A;  2RFH A;  2ZSH B;  2LLK A;  4MTE A;  1ZGJ A;  2HXI A;  3BC8 A;  3MMY B;  3BTJ A;  4FIS A;  3WG7 H;  3PFO A;  1LRZ A;  1XGM A;  3EC4 A;  4JLY A;  3S6F A;  3L09 A;  1BN5 A;  4ZYQ A;  3PUF A;  3TOA A;  2PJR A;  4L9J A;  1CPS A;  2FJ1 A;  3ZOB A;  3K4L A;  2IS4 A;  1KYZ A;  4CCL A;  3D7H A;  1HLV A;  2QZ8 A;  4EM0 B;  2LSO A;  3U1K A;  3S8P A;  2ZJR F;  1FYK A;  3SFZ A;  4DYO A;  1QVT A;  3TW7 A;  1E2X A;  1JQG A;  3DU6 A;  3B02 A;  3S1N J;  3GFI A;  3TDU C;  3OYH A;  4R6T A;  4PK3 A;  2IMO A;  4X8I A;  2QQA A;  2EIL H;  1Z4R A;  2E7W A;  3HUV A;  2YX7 A;  3IKV A;  4YEJ A;  4RDU A;  5HVF A;  4KOY A;  2JK3 A;  1FOK A;  1Z91 A;  4FAI A;  2CW8 A;  2V6C A;  4EJU A;  3BR6 A;  4XRM A;  2ARH A;  2O7O A;  4ZJZ A;  4IHT A;  1H9T A;  2A68 F;  1QHG A;  1ZYR F;  2IA0 A;  4A3L J;  3ISZ A;  1R7J A;  1B59 A;  4LG0 A;  3GFJ A;  4EM2 A;  4A5N A;  4KVO E;  4MY3 A;  1MNE A;  2NS0 A;  4NGN A;  4ZX9 A;  4KIS A;  3B7I A;  2KRC A;  3KE2 A;  2W84 A;  2PJB A;  1I1G A;  2BCO A;  1UG0 A;  5J8C A;  4B11 A;  3CCY A;  3WTS C;  5BNG A;  4M6H A;  1AKH B;  1JWQ A;  1VIX A;  1T6S A;  1UB9 A;  4WXC A;  4BH9 A;  6PAX A;  4AUX A;  3VAT A;  2HGC A;  1R5H A;  3U9G A;  3KP7 A;  3M8F A;  4PXB A;  4NGQ A;  5KTD A;  4RB0 A;  1TQM A;  4P5O A;  3RPU A;  4NCZ A;  2WY8 Q;  5A27 A;  3I55 I;  1EA3 A;  3SHF A;  5B5E C;  2WWY A;  1F2O A;  4KOV A;  1XN7 A;  2VE9 A;  4II3 A;  1IRG A;  3CT9 A;  3QB8 A;  4KVM E;  4ZDP A;  2KZV A;  2PJ6 A;  3LFK A;  3UY5 A;  4ZH4 F;  1VQP I;  5FRN A;  4EM1 A;  4KOS A;  5ELY A;  2GXG A;  2R7F A;  2DMP A;  2EWN A;  3SYT A;  4E8O A;  5J8F A;  1ACI A;  1U9N A;  2QBY B;  3GTO J;  5JR3 A;  2EFW A;  4FTH A;  3L2W A;  4KVX A;  1SVL A;  1W7P D;  1ZRF A;  4MHN A;  3LOD A;  4CAF A;  4NB5 A;  4Y49 B;  4M74 A;  1Z3X A;  4Z6Y A;  4E7H A;  2XAG A;  4BDY A;  3D7D A;  2R93 J;  4D7M A;  1XMT A;  3FWE A;  4NDL A;  1WJA A;  2QYV A;  3RAM A;  1UG2 A;  3GUX A;  3PRT A;  4PDK A;  4QUS A;  3HOZ J;  4L9T A;  1MH3 A;  2YPR A;  1REP C;  3GFL A;  4PJJ A;  3H3Z A;  4I09 A;  2OH1 A;  4CGP A;  1RET A;  3TED A;  3T8T A;  1QPM A;  3BHX A;  2LKS A;  2B4B A;  3K9T A;  4A3J J;  2TDX A;  3ZQ7 A;  3GZ6 A;  1ETK A;  3K1M A;  4QPO A;  4GYI A;  1K4S A;  4ZDO A;  2PN6 A;  2CF4 A;  4ZY2 A;  3MKZ A;  2LF8 A;  1X1D A;  5DS9 A;  5ILV A;  2KJB A;  3RKY A;  1G3T A;  1YE9 A;  2KQR A;  2XSJ C;  4F52 A;  1D5V A;  1YS6 A;  3U21 A;  4FAS D;  2WB1 A;  4NBQ A;  3EPZ A;  1T56 A;  4ESJ A;  2ZEO A;  4DZP A;  2G3T A;  1K6O A;  5HLT A;  4HX7 A;  3EFA A;  2O6G E;  1LDK B;  5HS9 A;  3QRF F;  2B9S A;  4BHB A;  5K5Q A;  2QSF X;  3PP9 A;  3F8B A;  2O03 A;  2EFQ A;  2XPW A;  4MEX F;  2HXO A;  1KUV A;  5F46 A;  2EZH A;  3ZMS A;  2BBY A;  3E7L A;  1NTC A;  3T0Y A;  2LVS A;  2CWE A;  2JVH A;  4D0P A;  3DTE A;  2ZKZ A;  1VQM I;  1QBJ A;  5KAF C;  4ZYD A;  4CYC A;  2GLJ A;  2EV0 A;  2L3D A;  5FD6 A;  3SJX A;  4NJR A;  5E3M A;  3WC5 A;  1XSV A;  2LY9 A;  1TW3 A;  1BIA A;  1MMN A;  2L9N A;  3KP6 A;  2K40 A;  2A3S A;  3I3L A;  2VJ5 A;  4CAE A;  1LOK A;  3R0J A;  3DXJ F;  3TP3 A;  2XGE A;  2F7V A;  1GXQ A;  4PFP A;  2I00 A;  4HNT A;  5LBQ A;  2EBJ A;  1O4X A;  3JRC A;  2GM4 A;  1A04 A;  2XEJ A;  2E34 A;  3KR4 A;  3SI0 A;  4X6A J;  4OC1 A;  2VJI A;  2DTR A;  3K0L A;  1K4T A;  3ZXS A;  2Z3M A;  3OIO A;  2AE6 A;  4CAV A;  2M2E A;  1IRX A;  3OS2 A;  2CSO A;  1YW7 A;  5M5Y J;  1R71 A;  3TFY A;  1QQI A;  3H5Z A;  1IZ1 A;  4A6D A;  3GVA A;  1P4A A;  4A69 C;  3BTC A;  3OYN A;  2PJ0 A;  2F8H A;  2Z33 A;  1YX3 A;  1B9N A;  3ZN1 A;  2EO8 A;  3BJ8 A;  4HZF A;  4Q4Z F;  4BY7 J;  1QQ9 A;  4O23 A;  1QU3 A;  2F5C A;  3BI1 A;  4H6U A;  3JRA A;  3KZI C;  1IG7 A;  3M3Y J;  4MY0 A;  4ZBG A;  1UHM A;  1DE4 C;  1QHH D;  2Y0S A;  3PB8 X;  2HU9 A;  4Q47 A;  5KTC A;  5JGF A;  4JXR A;  4KSI A;  2QWW A;  4F9U A;  2ISY A;  2JEV A;  1XCV A;  4LUA A;  4BQA A;  5CBM A;  1L3L A;  1I6H J;  3ZRG A;  1LCP A;  3PFE A;  2JPC A;  3JTG A;  5GTI C;  1Y8R B;  3M07 A;  4XK4 A;  3FHZ A;  4GXH A;  3HUG A;  4HNX B;  5AG4 A;  3Q3S A;  4RGX A;  1NG6 A;  3IJ3 A;  3GIU A;  2O28 A;  2L9S A;  4V19 K;  3WGI A;  1AA7 A;  3ZN0 A;  2KKO A;  2LR8 A;  4B14 A;  3NQO A;  2VXZ A;  4HX4 A;  2VC0 A;  2BY0 A;  5J40 A;  4B4C A;  5DM7 F;  4B5P A;  3OYI A;  4BBS J;  2PFB A;  1R6R A;  2K86 A;  2JMW A;  4B47 A;  1G59 A;  1A5J A;  1ZG7 A;  1YJ9 I;  2CQK A;  4KOR A;  2QM3 A;  3OIQ A;  1FT7 A;  4A94 A;  1WWX A;  4KDP A;  2ZEL A;  1WQ2 A;  3A01 B;  4JP0 A;  1O3R A;  3WTX C;  3JRH A;  3WR7 A;  1NSA A;  3I9V 2;  3R60 A;  1S7F A;  3W2V A;  4HG2 A;  4I98 B;  4QIW N;  5IYD J;  2B5G A;  2HQR A;  3VWD A;  2VZZ A;  2Z10 A;  3HM5 A;  2OOT A;  5E20 A;  1ENH A;  1OFC X;  2DYS H;  4HSR A;  1PJR A;  3H9J A;  3G4S I;  4XPL A;  5C82 A;  1KU2 A;  1IYL A;  3HRT A;  4RAF A;  1FSE A;  1CF7 B;  2CV2 A;  3EYY A;  1D0X A;  4XLA A;  3MN2 A;  3QU3 A;  3SQN A;  2ZME B;  2W7N A;  4OC0 A;  4EEF G;  1P4W A;  1TNS A;  1HKT A;  5JPH A;  1GUU A;  4BMH A;  3KYL A;  1LPQ A;  4M9S A;  1OBR A;  2K5C A;  2YNC C;  3P9K A;  4P4D A;  4RI1 A;  4XPD C;  5D29 A;  1CP6 A;  3JRE A;  2FML A;  2MYS A;  1ZR2 A;  4M3S A;  3QAH A;  5CJ9 A;  4M6G A;  3I58 A;  2CY2 A;  2Y31 A;  2EBI A;  4X5K A;  4MQV A;  1SVO A;  4CPA A;  3DCF A;  4MCR A;  3FBI B;  4N0B A;  3RJP A;  1HOM A;  5LRR A;  4JD6 A;  4R76 A;  3ZQQ A;  5IOZ A;  2ZCW A;  1T2K A;  4UFV A;  2A07 F;  2P7C B;  3BG9 A;  1T0F C;  1HXD A;  3LOC A;  3FH4 A;  3N7Z A;  1R43 A;  3KI9 A;  4H0E A;  2Z3P A;  1QMU A;  4QWQ A;  4XKB A;  4J00 A;  4BAC A;  1JE8 A;  1UAA A;  2STW A;  2BGC A;  2JN6 A;  4U9Z A;  5J1Q A;  3E5U A;  3KFW X;  2MGQ A;  1FOX A;  1S7E A;  3LQQ A;  4M73 A;  1HC8 A;  1KGS A;  2ZO4 A;  1UMQ A;  3H0D A;  3NFZ A;  4Y49 C;  5CKT A;  5EJC A;  1O3T A;  2L54 A;  1Y1W J;  5HLI A;  2V77 A;  4NGT A;  3CDL A;  1JKO C;  3KQX A;  2WAQ A;  1RRJ A;  4UA3 A;  2LTP A;  4MEY F;  2VIX A;  2R7Z J;  3G8W A;  3P2F A;  4BL0 B;  5D5X B;  4V2G A;  2N8G A;  2BE5 F;  2R3S A;  2WC2 A;  1HDQ A;  3S6G A;  3CQZ J;  2JUC A;  2NS8 A;  4L5J A;  5EEH A;  2XSD C;  3IKT A;  2XPV A;  2V8V A;  2JT1 A;  2PR8 A;  2R7T A;  4M3D A;  4WWC A;  1XGN A;  2EIK H;  3S6K A;  2GBY A;  2RVC A;  2OA4 A;  3MCZ A;  1NE9 A;  2GLF A;  8CPA A;  2ATR A;  1VZ0 A;  3E6B A;  1IV8 A;  3QPL A;  1BLL E;  3TTH A;  3SEZ A;  1S5K A;  4ENN A;  2XAJ A;  5E18 F;  4R7M A;  5H6Q A;  1Y9W A;  1I3A A;  3VSL A;  3M7G A;  2XB5 A;  1D5Y A;  4LK0 F;  3CXS A;  4MMO A;  3GLL A;  1BR1 A;  2A6T A;  4X2T A;  4I02 A;  2H5M A;  1F9N A;  2J8R A;  1MJ9 A;  2F4M B;  5M3M J;  1EF4 A;  3H92 A;  5E1X A;  4HNW B;  3CUQ A;  2W00 A;  3G3Z A;  2QQ8 A;  3JR9 A;  3LSM A;  1HBX G;  4RLF A;  1E3H A;  3MWM A;  2LYC A;  2JTV A;  2R7S A;  1NG7 A;  2KHM A;  2ZME A;  1Z9U A;  1DPR A;  1KUY A;  3EQL F;  1JTY A;  5G22 A;  2LFB A;  3SXY A;  2DOA A;  1LE8 A;  1RZ4 A;  2JRM A;  2ETH A;  2QA4 I;  2KCW A;  1MBE A;  3BPX A;  4WF2 A;  2FA5 A;  1U5T A;  3D68 A;  4AYB A;  3DTI A;  5LRG A;  3ONQ A;  2YS9 A;  5BPD A;  2EZK A;  3FX3 A;  1YS7 A;  2NOG A;  1TKH A;  2Z16 A;  3TX8 A;  3F6O A;  4YG2 F;  3EUH C;  1X1P A;  3J7A O;  2CJJ A;  2DN0 A;  2E1N A;  1TT5 B;  2FSW A;  2A5W A;  2O0Y A;  2DF5 A;  1YRN B;  2K27 A;  4IK2 A;  4HQE A;  3CC2 I;  5FLX K;  3HHH A;  4LB5 A;  2HQY A;  1SMT A;  5HH1 A;  3FEE A;  3BI0 A;  1O7L A;  3LAJ A;  2IS2 A;  4NGR A;  1AOY A;  5EGO B;  2IEK A;  5K7Z A;  3JTH A;  4LIV A;  1Z2L A;  4CGZ A;  1H8A C;  2EJR A;  4IF4 A;  5IYB J;  4ESB A;  2X6W A;  4NQW A;  5J1Y A;  1XMA A;  2GRE A;  2G7U A;  2H8W A;  3BLY A;  3HOW J;  1IN7 A;  4AD9 A;  3F72 A;  4OIR F;  2ZSI B;  5J4V A;  5D4R A;  2J8N A;  3OYE A;  3EUA A;  1Y39 A;  2IA2 A;  4HRI A;  2DT6 A;  2Z0Z A;  4L5E A;  2MW8 A;  1IID A;  2FD5 A;  4XOP A;  4OWR B;  1Z8L A;  1OYW A;  2V1D A;  1HW1 A;  2ZFW A;  1IDY A;  3VOE A;  4J3G A;  4C30 A;  3CJR B;  3CC4 I;  1FOW A;  1QNT A;  3V42 A;  2HKO A;  2WAF A;  4IUS A;  3FMS A;  2HVQ A;  2VJJ A;  3RQI A;  4C7I A;  5LGU A;  2H8R A;  2JA6 J;  1Z77 A;  2DK5 A;  2IT0 A;  2W57 A;  4HA8 A;  1ZR4 A;  2DMN A;  2GAU A;  3OYC A;  2ELK A;  2IBD A;  1NSL A;  3BRO A;  4A3D J;  3J7A Y;  4KOW A;  5DCF A;  5DS0 A;  2DA1 A;  2KRH A;  1U8R A;  1BOA A;  2NNN A;  3BJ7 A;  3PL8 A;  4QPQ A;  4BYY A;  3SEQ A;  2CH0 A;  5E1Z B;  1A2Z A;  1B6B A;  4RS8 A;  2PJ3 A;  4HNY B;  2FBI A;  1DDN A;  1YME A;  3B6A A;  3HGG A;  3N05 A;  4PSX A;  2YNC A;  1V5F A;  1ONV A;  2Z99 A;  3BZ6 A;  2K7L A;  3VPR A;  5GPC A;  1YX0 A;  2FS5 A;  1RKW A;  2AO9 A;  2Q0Y A;  1WI3 A;  1LVK A;  5FRO A;  3KX2 A;  3RYP A;  4U0W A;  4I01 A;  3RQ4 A;  2JBJ A;  2X7B A;  4DQ2 A;  1KZH A;  5D8K B;  2MD0 A;  4A30 A;  5FJ8 J;  2J5O A;  1Z7U A;  3PIP F;  2VPL A;  3ZQL A;  3W6J B;  5F09 A;  4WWV A;  1VQ6 I;  3PNY A;  5D4S A;  1QGP A;  3KZY A;  2GWR A;  2Z3O A;  5HMN A;  4YFK F;  4KNY A;  3E6C C;  2K3F A;  3AL0 C;  5THW A;  3OIP A;  1E0E A;  1R1V A;  3FMQ A;  3ISX A;  2JUG A;  3H8F A;  1FWZ A;  3OL4 A;  2ELH A;  4ENJ A;  1LFW A;  4HPQ A;  1R00 A;  4W9Y A;  5J1U A;  4CH7 A;  4B1R A;  3BWG A;  4XM3 A;  4AU7 A;  1CGP A;  4BDZ A;  1U6M A;  2PQ8 A;  3V7S A;  1LKX A;  1WHU A;  3OWT A;  1XBU A;  3KL9 A;  1PP8 F;  2JVG A;  2XAF A;  2Q2E B;  1L0C A;  1DTD A;  3K70 C;  4ANJ A;  4AG9 A;  1V54 H;  5L3D A;  1SD5 A;  1OYI A;  1CM0 A;  3GTP J;  4U5Y A;  2K4B A;  3CD6 I;  3SZG A;  3CXQ A;  2C1C A;  3VYS B;  2AFW A;  1XMB A;  3S3M A;  1YYV A;  3LAC A;  4AG7 A;  2VN2 A;  1GV5 A;  2A6H F;  2CS3 A;  3WGG A;  3MD2 A;  4CCO A;  3LSR A;  1L0O C;  1U0J A;  4EGZ A;  2IGK A;  3V7C A;  4GO1 A;  4IKF A;  4KUB A;  2Z3Y A;  2C6P A;  3ZQG A;  1MBJ A;  5DYM A;  2Y9Y A;  5HDN A;  2BYV E;  2IP2 A;  2TCT A;  2F5V A;  2G7H A;  2K9L A;  4L18 B;  1V5G A;  1B72 B;  3R9F A;  5KVR A;  3AL0 B;  5JVT A;  3QAY A;  4J19 A;  3IC7 A;  2QLZ A;  3JUW A;  4KN4 X;  3GX4 X;  2E1M B;  2R5Z A;  3ZQI A;  2ZEG A;  3M9A A;  5FD5 A;  2FBH A;  1E17 A;  2D4P A;  2PSW A;  1OCO H;  4UCP A;  3W6K B;  3CCR I;  1V4R A;  4LLL A;  3TBI A;  1XFO A;  1Z0X A;  4BEH B;  2O53 A;  1XJO A;  3B3S A;  3BTI A;  4Y15 A;  4XQF A;  4CRY B;  1RR8 C;  3QNV A;  1Q1H A;  1TZL A;  5C3E J;  1FPQ A;  3LWF A;  2EIJ H;  4ZY1 A;  1ZO0 A;  1VQ7 I;  3HB9 A;  3KZZ A;  3WOD F;  5JI6 A;  4YWY A;  1GVJ A;  3H3U A;  3M1C A;  3CZ6 A;  2LD5 A;  4HF2 A;  4WJB A;  2VQG A;  4XNF A;  3DLJ A;  4L9V A;  3I3G A;  3K1N A;  3S9L A;  2L7F P;  2MC3 A;  4KS9 A;  1ZG8 A;  2EFN A;  2MA3 A;  3BR5 A;  3TE4 A;  2GIV A;  1SAU A;  2RN7 A;  1XIX A;  2QEC A;  2D5V A;  2Z1D A;  3T1B A;  4B5O A;  1MBH A;  1VI0 A;  2L9V A;  4BNC A;  4DIQ A;  2RDP A;  3H9G A;  3FXT A;  2VQH A;  1S6L A;  4QTR A;  3VAR A;  1SFE A;  5D5W B;  3PNT A;  2F4O B;  3LSG A;  2PVW A;  2Q0O A;  3FKI J;  2PJA A;  4N9I A;  4NEX A;  1IYK A;  1ZEL A;  4G6D A;  2P6F A;  1R57 A;  1U6G A;  1P4N A;  2CNM A;  2OCE A;  2BY3 A;  3D5R C;  3CMA I;  4HKF A;  2AS5 F;  3C3W A;  1K78 B;  2COB A;  4YRH A;  4DW6 A;  1YK3 A;  3FX6 A;  1LNW A;  2OD5 A;  4G7Z F;  3RKQ A;  5J3L A;  3AG1 H;  5LHI A;  5LGT A;  3ZP5 A;  2Y9Z A;  1T33 A;  2W48 A;  3GME A;  3CCU I;  4B10 A;  1BI3 A;  3DKX A;  4XLF A;  4BQN A;  5IP7 J;  4CDG A;  4UWI A;  1TWF J;  2DJN A;  2H1K A;  3ABU A;  3ABL H;  1R23 A;  1LUJ B;  4K30 A;  4OIN F;  1XMK A;  2ZJP F;  2XVC A;  2ZJ2 A;  1PYT B;  4BBH A;  2WZN A;  2REF A;  1RKT A;  1TWG J;  4BJ6 C;  1IGB A;  1IRZ A;  5JH9 A;  3H35 A;  4CO8 A;  1TKF A;  3H0G J;  2ANP A;  1R36 A;  2RC4 A;  3GUD A;  1F4K A;  1FTZ A;  2P0W A;  4P9F A;  1LAN A;  4P45 A;  2M7A A;  3QYE A;  3O8H A;  1UWY A;  2V9P A;  3ZZI A;  2CV1 A;  2RNG A;  4RA2 A;  5KHD A;  4UXN A;  5L3E A;  3LL7 A;  2R7U A;  3RCO A;  2BVM A;  2A69 F;  2CW7 A;  2Q44 A;  4NC7 A;  2OC6 A;  1TNT A;  4G7H F;  4MBU A;  4AVB A;  4YII A;  4XRS A;  2WB1 N;  4DYR A;  2XF6 A;  3HOX J;  1ZH5 A;  3PFY A;  1SFO J;  3N4M A;  2XRN A;  3KGQ A;  5F48 A;  1WFX A;  4AVC A;  2P6T A;  2YSR A;  2V9V A;  4DBR A;  2EK9 A;  3L2Q A;  2EVN A;  4A37 A;  2ZXJ A;  1MJA A;  1XE4 A;  4XRS G;  2PJ9 A;  2H6B A;  4HLX A;  1DP3 A;  1ETQ A;  2VBW A;  4EWT A;  1HCR A;  4P6Y A;  4KIC A;  3CMY A;  1X4P A;  1BM9 A;  4LLN A;  2BSW A;  2BY1 A;  2ZPA A;  2EZL A;  4UVB A;  3J81 K;  2ZB9 A;  7CPA A;  3WHB A;  2GIZ A;  2MLG A;  2W85 A;  3DBR B;  4RMN A;  4BHC A;  2XKO A;  3LA7 A;  3RPU D;  5L3C A;  1OCT C;  4JBA A;  4UCN A;  1K7A A;  3GLX A;  1YVK A;  2IGO A;  3P2H A;  3JRD A;  1DU0 A;  1YIT I;  2HOE A;  3TOB A;  4FBE A;  3RYR A;  1X2M A;  5C4J J;  1UHW A;  4LQG A;  4GRI A;  2KDZ A;  2KIU A;  1LFB A;  3KET A;  2PVV A;  3ZR8 X;  2PMZ N;  4C7H A;  1S9H A;  3S93 A;  4MFZ A;  2PCU A;  4G12 A;  3DEU A;  4IHW A;  1ZG5 A;  3ZQH A;  4HV5 A;  1VTN C;  3SDG A;  1KU9 A;  4F55 A;  2YU9 J;  1VQN I;  2PJ4 A;  4XIC A;  3CXP A;  3D3S A;  4RGU A;  5M3F J;  4P4E A;  3FIX A;  1BC8 C;  4A95 A;  4PPZ A;  2LOO A;  4PK4 A;  1YW6 A;  5KTA A;  4DOZ A;  2M1B A;  1R9T J;  3SJF A;  1OPC A;  3ROU A;  3DGV A;  1C0W A;  4BE2 A;  4RAG A;  1YR0 A;  1GHC A;  2QVO A;  3WTU C;  1B72 A;  1ZLK A;  2PG4 A;  3DV8 A;  3VOD A;  2OBP A;  1T8I A;  3J7Y J;  1R5G A;  3J81 Z;  4B8X A;  3CCS I;  1G3S A;  2VKE A;  4M3E A;  2VQL A;  2EQR A;  2ECB A;  5BPI A;  3I0T A;  4M6I A;  4EVY A;  3OWC A;  2HDD A;  2FL4 A;  5H84 A;  2ZEN A;  2NXN B;  3VDX A;  1PUF B;  2DXI A;  2IJZ A;  5HDG A;  2XAS A;  2GQQ A;  4A3E J;  4MCQ A;  1IUY A;  1WJE A;  4YRV A;  4HV6 A;  2A61 A;  4RLQ A;  1MD0 A;  1POG A;  4OU0 A;  2K9S A;  1Z3Y A;  4PXC A;  2P8T A;  5GPA A;  2NMT A;  4FD6 A;  2VJ4 A;  1ZAR A;  4M6Y A;  4B44 A;  5BMZ A;  2G9W A;  3E97 A;  5TIS C;  2P5L C;  2X48 A;  1MIJ A;  2XGX A;  4E7S A;  2E2I J;  2Z3N A;  1M4D A;  1W0T A;  2YU3 A;  5KNL A;  3HEF A;  2XC7 A;  3HRM A;  4C2U A;  3BZC A;  3O6B B;  5IX3 A;  3T8R A;  4QLC U;  2PJP A;  2IVM A;  4DJA A;  3Q9S A;  1BA5 A;  3BJ6 A;  4UVA A;  4QSH A;  3F0A A;  3IFE A;  5CPA A;  4YGO A;  5CNP A;  3C2H A;  4PFO A;  4FD4 A;  3R96 A;  1Z1D A;  2K9Q A;  4NUB A;  2DPU A;  1I27 A;  4A38 A;  5FFZ A;  2WTE A;  2PX9 A;  3GF2 A;  2HWV A;  4M3F A;  4W97 A;  3AKZ A;  2IL4 A;  2ZXI A;  3DR8 A;  2X51 A;  1X4O A;  2CG4 A;  3LMS A;  5GP9 A;  2QEX I;  5IV0 A;  2IA1 A;  3H5A A;  1ZG1 A;  3SZT A;  5K5O A;  2OZH A;  3T8W A;  4BU2 A;  5DV5 A;  3WTW C;  1YFH A;  3PO3 J;  1ERD A;  4XID A;  3C18 A;  2F5F A;  4FET A;  3E0K A;  2LKP A;  5EZH A;  4KLV A;  4DNC A;  5CVR A;  2R92 J;  3SDB A;  1YJW I;  3F8C A;  4MNU A;  1JT0 A;  3BZK A;  5IOY A;  4JYK A;  2PEX A;  2JWT A;  1GXP A;  5IPA A;  4NNJ A;  1VQ9 I;  3D7G A;  2PE3 A;  2CQQ A;  1TF8 A;  4IHV A;  2IS1 A;  1ZLI A;  3BTL A;  2V79 A;  5EEG A;  2GOM A;  3V8K A;  1X3W B;  3HGY A;  5M5X J;  9ANT A;  3V7R A;  2FE7 A;  2FOW A;  3FK6 A;  1XDU A;  1ZHF A;  3DWL E;  4I76 A;  4Y4R A;  2ZME C;  4F93 B;  5HLH A;  1EE3 P;  4UWJ A;  4XMY A;  2YND A;  3OMY A;  3GFM A;  3NAU A;  2ZW7 A;  3FVL A; 
#chains in the Genus database with same CATH homology
 4XKB A;  2R7W A;  4J00 A;  4BAC A;  1UAA A;  4U9Z A;  4MFL A;  1X1B A;  3PNV A;  2V6E A;  4XOR A;  2OU2 A;  1SFK A;  4XLC A;  4C68 A;  2RRE A;  2R7Q A;  4ITV A;  4D9J A;  4HNU A;  3OYM A;  3H0D A;  4E4H A;  4BUP A;  5CKT A;  4Y49 C;  3CMM A;  5IV0 A;  3CF2 A;  4UA3 A;  2WAQ A;  4C2X A;  3K4B A;  3G8W A;  4RS2 A;  2VIX A;  2Q4V A;  3P2F A;  3A4C A;  2HV2 A;  2W1O A;  4BL0 B;  2KP6 A;  3R1K A;  3I9S A;  4UFX A;  3S6G A;  3T90 A;  4BQO A;  3VWE A;  4NQW B;  2WPW A;  2PR8 A;  4U9Y A;  2R7T A;  3S6K A;  3TMO A;  4PV6 A;  3UR3 C;  3FYN A;  4CCM A;  1NE9 A;  5LFA A;  5CQG A;  5FVJ A;  3L2V A;  1P0H A;  2MFZ A;  1X1A A;  2ATR A;  1VZ0 A;  3LSH A;  3F5B A;  4XPD B;  2WY7 Q;  3TTH A;  3SEZ A;  1S5K A;  4L8A A;  1P9Q C;  3IAM 2;  4AVB A;  4E6K G;  1WJB A;  4MLO A;  3LMM A;  4KZT A;  2IXS A;  2X1C A;  3C26 A;  2WBM A;  3A2K A;  3F8K A;  3BG7 A;  1Y56 A;  4PJL A;  1Y9W A;  4ZTF A;  3VSL A;  2GE3 A;  2X1E A;  3CJQ B;  4ZDL A;  2VQC A;  2V1N A;  2R7R A;  3CXS A;  2R7X A;  2M0M A;  1BR1 A;  2A6T A;  2IGM A;  3T9Y A;  3OYG A;  5AG5 A;  4NSQ A;  2H5M A;  2J8R A;  3IU1 A;  5F49 A;  1MJ9 A;  1PU9 A;  2PC1 A;  2K5T A;  2VXK A;  5G21 A;  3OYJ A;  1T95 A;  4IQJ A;  2ZFU A;  3DDD A;  4Y33 A;  4HNW B;  5DWN A;  3EY5 A;  1MMD A;  5HOO A;  3FDY A;  2W00 A;  2HNH A;  2W82 A;  3LSK A;  1Q2D A;  3CP2 A;  1MK4 A;  3LSM A;  4RLF A;  4ONU A;  1YRE A;  4CYQ A;  2LYC A;  4CS0 B;  2CFO A;  2R7S A;  1NG7 A;  3HC7 A;  2ZW4 A;  2KHM A;  2LBF B;  2LG4 A;  1BR4 A;  1Z9U A;  2RQQ A;  3F9K A;  4ZC3 A;  1KUY A;  2QIR A;  1QSR A;  3R95 A;  5GCN A;  5G22 A;  5IB0 A;  1FY7 A;  2DOA A;  2OZG A;  5ISV A;  4C7H A;  2HVR A;  2F6C A;  2KLO A;  2Z2S B;  4LIT A;  2M4K A;  2KCW A;  2KL4 A;  3EXN A;  4AYB A;  3DEE A;  3DTI A;  2FUG 2;  2DCE A;  3ONQ A;  2LRD A;  2B5G B;  5CQE A;  2BOL A;  2FIW A;  2Y0M A;  4L89 A;  4R3K A;  2Z16 A;  3BCA A;  1MW7 A;  4C2T A;  2DT7 B;  2KDO A;  3EUH C;  4UCM A;  4LX9 A;  1M44 A;  4YFJ A;  2A5W A;  3ZJ0 A;  4B43 A;  3S32 A;  4R79 A;  2FCK A;  1VKC A;  4BEH A;  3S6H A;  2HQY A;  5HH1 A;  3D8P A;  4CRY B;  4CUG A;  2FIA A;  4MJ8 A;  1OR7 C;  2LH9 A;  2IS2 A;  3S3O A;  3SHP A;  4CGM A;  2CV0 A;  4KOT A;  4LIV A;  5AGE A;  3OYL A;  2CUZ A;  4KIT B;  2UUZ A;  3JVN A;  3D2P A;  3HXL A;  4F92 B;  2X6W A;  3G3S A;  3BLY A;  4G6T B;  2PRB A;  2J8N A;  3BG6 A;  2VB6 A;  2LBF A;  2ZSI B;  3OYA A;  4BS9 A;  1BOB A;  3EUA A;  3IAS 2;  3OYE A;  3B8G A;  2JA2 A;  1J4J A;  4HRI A;  2DT6 A;  2Z0Z A;  4KUA A;  1N75 A;  3DU5 A;  3FKJ A;  5EC4 A;  2L5Q A;  1IID A;  1S7K A;  4Q38 A;  2BEI A;  4XOP A;  4OWR B;  3PZJ A;  2R7V A;  2W4S A;  4J3G A;  4C2Y A;  1WJ5 A;  4C30 A;  3CJR B;  3OYF A;  3A9L A;  4CYP A;  3V42 A;  2MAB A;  1YX5 A;  5C88 A;  2WAF A;  1X1C A;  1W36 D;  2D4O A;  4IUS A;  2HVQ A;  2VJJ A;  3K6G A;  4E7Z A;  4C7I A;  1S7N A;  4ORF A;  1Y6I A;  2E60 A;  4FD7 A;  2VL8 A;  4IF5 A;  4BGD A;  3OY9 A;  5HNF A;  4DGW B;  3OYC A;  4C2Z A;  2M3A A;  1NSL A;  4KOW A;  4OAZ A;  3J7A Y;  4KLW A;  2KRH A;  2X85 A;  2QML A;  1XEB A;  3BJ7 A;  3PL8 A;  2VBQ A;  4QPQ A;  4CAW A;  3SEQ A;  4QC6 A;  3D5S C;  2HVS A;  2CH0 A;  3DLA A;  3QOD A;  4BE0 A;  2V4J C;  5LD2 C;  3L2U A;  2F4I A;  1D0Z A;  2I79 A;  2HDW A;  1LFP A;  1B6B A;  3FBU A;  3HG9 A;  4HNY B;  2Q7B A;  4AVA A;  2Q1Z B;  3FBN B;  3ZCO A;  3N05 A;  4PSX A;  2YNC A;  1V5E A;  4BXF A;  4QBJ A;  1V5F A;  4ZTJ A;  2FS5 A;  3DTK A;  1YX0 A;  2Q0Y A;  3JTK A;  3R9E A;  4F0X A;  1LVK A;  4AB7 A;  5CPR B;  5FRO A;  2P6G A;  2AQE A;  3KX2 A;  2QKM B;  3RQ4 A;  1B87 A;  3HPG A;  2X7B A;  4XKV A;  4OAE A;  3E0J B;  2V9K A;  4KT6 A;  3RTR A;  2JDC A;  2MD0 A;  3W6X A;  1N71 A;  1MND A;  1KZF A;  4A30 A;  3W2A A;  2P6E A;  4BQQ A;  4NF1 A;  2VPL A;  2R8V A;  2XF7 A;  3W6S A;  2WPX A;  2NOJ B;  3PNY A;  2F5I A;  2HZD A;  4OAY A;  2Z3O A;  2HPM A;  3OYD A;  5HMN A;  2WAE A;  3K4N A;  3SXN A;  3AL0 C;  3OIP A;  3OS1 A;  1QST A;  1E0E A;  2X1D A;  4LG3 A;  2VI7 A;  3DR6 A;  4HST A;  2JUG A;  4E7L A;  3K10 A;  2CNS A;  3PUB A;  2ZXV A;  3GKR A;  1XF8 A;  3OL4 A;  4HPQ A;  1MMA A;  1YVO A;  2DPS A;  5G20 A;  3TO7 A;  1Y7R A;  4CH7 A;  3IWG A;  1PYV A;  4XM3 A;  4AU7 A;  2G3A A;  4BDZ A;  1U6M A;  2PQ8 A;  2WUU A;  1LKX A;  2XF5 A;  2V7F A;  2ZXH A;  3FHN A;  3OWT A;  5FRM A;  2JVG A;  1Q2Y A;  2Q2E B;  2QKL B;  1L0C A;  1S3Z A;  3K70 C;  4ANJ A;  4I49 A;  1QSN A;  4JWP A;  4AG9 A;  4PJN A;  2B3V A;  4ZGY B;  1CM0 A;  3TO9 A;  4F91 B;  4U5Y A;  3G2B A;  4CSW A;  2CNT A;  3SZG A;  3CXQ A;  1K4J A;  2LY1 A;  1OLT A;  3VYS B;  4DBQ A;  3S3M A;  4AG7 A;  2ZSH B;  4KOU A;  3MMY B;  2E1M C;  3BC8 A;  2CS3 A;  2XAU A;  2VKH A;  3MD2 A;  4CCO A;  1LRZ A;  1U0J A;  3EC4 A;  4JLY A;  3S6F A;  1TT0 A;  3OL3 A;  2IGK A;  2FT0 A;  4MFP A;  4IKF A;  3TOA A;  2PJR A;  4KUB A;  4R3L A;  4CCN A;  4F3Q A;  3K4L A;  2IS4 A;  4CCL A;  3W3C A;  1I1D A;  3IGR A;  2F5V A;  4CYN A;  4II9 A;  2K9L A;  1KON A;  3D2M A;  4PK2 A;  1V5G A;  4IX7 A;  3S8P A;  3AL0 B;  1ON0 A;  3BLN A;  3K9U A;  3R9F A;  1KUX A;  4XN3 A;  3W2W A;  2R7H A;  3S3N A;  3DU6 A;  3JUW A;  5E96 A;  3RYO A;  1VHS A;  2L7K A;  3OYH A;  4XLE A;  2E1M B;  2J8M A;  4PK3 A;  4A2Z A;  1I21 A;  3GYA A;  1V0C A;  3PGP A;  4XNH B;  3H5N A;  1Z4R A;  2BW3 B;  1G8X A;  2D4P A;  4JJX A;  4UFW A;  2PSW A;  4YEJ A;  4UCP A;  1WJF A;  1W36 C;  1FMW A;  1D1C A;  1S60 A;  2R1I A;  4KOY A;  2BW3 A;  3TBI A;  2CW8 A;  4BEH B;  1D1A A;  2AJ6 A;  2B58 A;  2DPT A;  1GLN A;  3DPT A;  3K4J A;  4XQF A;  2ARH A;  3TT2 A;  3DNS A;  3BCB A;  4CA0 A;  4ZJZ A;  1TZL A;  3A1Y A;  2KMU A;  1QSO A;  1ZO0 A;  2YGW A;  3CES A;  1QHG A;  1DGW Y;  4LIU A;  4KVO E;  1MMG A;  4BJ5 C;  4MY3 A;  3M1C A;  1MNE A;  4RM3 A;  3CZ6 A;  1GHE A;  1S7L A;  2VQG A;  4XNF A;  4KIS A;  3I3G A;  3K4C A;  2KRC A;  2YNE A;  4KS9 A;  2HPI A;  2Q4Y A;  1UG0 A;  2Z3L A;  3TE4 A;  2GIV A;  4KSA A;  1SAU A;  4B11 A;  2VKD A;  4ZYA A;  5J8C A;  2PMZ A;  1XIX A;  2QEC A;  4XPK A;  4XOT A;  2A4N A;  1DGR M;  4NC8 A;  2Z1D A;  2MC4 A;  4C9Y A;  4XON A;  4B5O A;  3ZGK A;  4OAD A;  4E0A A;  1N78 A;  1WJC A;  2B3U A;  4U87 A;  4DIQ A;  4MHD A;  1N77 A;  3H9G A;  3FXT A;  2VQH A;  3UNG C;  1YLE A;  1RXT A;  4B13 A;  5AG7 A;  5KTD A;  4P5O A;  4NCZ A;  3PNT A;  2WY8 Q;  3LSG A;  4D1Q A;  5A27 A;  4CYO A;  4H6Z A;  3TL4 X;  2XDV A;  2O5R A;  1EA3 A;  1ZEL A;  1IYK A;  2P6F A;  4NEX A;  1IB1 E;  1R57 A;  4KOV A;  1P4N A;  4CGO A;  1Z7L A;  1J09 A;  4II3 A;  2WAD A;  3D5R C;  3QB8 A;  4HKF A;  4KVM E;  4NXY A;  2PR1 A;  4ZDP A;  2KZV A;  3UY5 A;  2VXD A;  4YRH A;  1D1B A;  5FRN A;  1YK3 A;  4JXQ A;  5HNH A;  4KOS A;  1D0Y A;  4CCJ A;  2Q04 A;  2K3P A;  2X6Y A;  4FD5 A;  3SYT A;  5F47 A;  4E8O A;  5J8F A;  4CCK A;  2LC2 A;  4CRZ B;  1Q2C A;  1Y9K A;  4Y3O A;  3H9Q A;  3EO4 A;  2Z3K A;  3L2W A;  2UWM A;  4KVX A;  2FSR A;  2ELJ A;  3QYB A;  4E7K A;  4E7I A;  1UFH A;  4QB9 A;  3LOD A;  5G1Z A;  4CAF A;  4Y49 B;  2WSA A;  1Z3X A;  4MFK A;  4A31 A;  3DKX A;  4XLF A;  4BQN A;  4E7H A;  1PUA A;  4BDY A;  4B10 A;  4UWI A;  3AFH A;  2E5N A;  2DXQ A;  1XMT A;  1WJA A;  2L2O A;  3NE7 A;  4H4K C;  4QUS A;  4BE1 A;  4K30 A;  4PSW A;  2KPM A;  4U7B A;  3C2G A;  4II2 A;  4N4N B;  2G0B A;  4PJJ A;  4BBH A;  4B3X A;  3QYF A;  2OH1 A;  2GOX B;  2REF A;  4CGP A;  4BJ6 C;  3H35 A;  4Q36 A;  1BO4 A;  2B4B A;  4MFQ A;  5KCM A;  2RC4 A;  5EBV A;  2P0W A;  2M7A A;  3QYE A;  3PSF A;  3MKY B;  4JOM A;  4QPO A;  2CV1 A;  4ZDO A;  2CNM A;  2RNG A;  5KHD A;  2LRE A;  1UEL B;  3QOE A;  3MKZ A;  3LL7 A;  2R7U A;  3RCO A;  2BVM A;  2CW7 A;  4YEL A;  1X1D A;  4NC7 A;  2OC6 A;  5TGT A;  4BJT A;  4MBU A;  1YE9 A;  2KQR A;  2XSJ C;  2R4G A;  4P1W A;  4F52 A;  2JDD A;  3FNC A;  3K4K A;  2CUJ A;  2XF6 A;  2WB1 A;  4XKW A;  3EPZ A;  3U21 A;  4FAS D;  3FRM A;  1DQU A;  2G3T A;  5DWM A;  3PFY A;  2ZW5 A;  2B4D B;  2WA0 A;  5JHF A;  5HLT A;  2FXF A;  3EFA A;  5F48 A;  1WFX A;  1LDK B;  1K6Y A;  3OOU A;  4AVC A;  2REE A;  3M8J A;  4DBR A;  4KSF A;  3L2Q A;  2EVN A;  1MJA A;  3DKY A;  1XE4 A;  3PP9 A;  1WWZ A;  4PUS A;  1DP3 A;  1KUV A;  1WJD A;  1QSM A;  2OB0 A;  1X4P A;  2BSW A;  5F46 A;  4F6A A;  3EUK L;  4KJZ A;  2ZPA A;  2JVH A;  3DTE A;  3HKZ A;  4MI4 A;  4H89 A;  3VWB A;  2I8D A;  3PSI A;  3R9G A;  2BVL A;  3KEY A;  4RMN A;  2C27 A;  3RPU D;  4XL9 A;  4UCN A;  1MMN A;  2L9N A;  1I12 A;  3IWE A;  3I3L A;  1YVK A;  2VJ5 A;  2IGO A;  4UBR A;  3P2H A;  4CAE A;  4AVZ A;  3TOB A;  3IP4 B;  1TIQ A;  4E2A A;  4PFP A;  2I00 A;  4HNT A;  1RO5 A;  4EAT A;  4GRI A;  2Z11 A;  4R9M A;  5AG6 A;  4CAX A;  2VEZ A;  3OR2 C;  3HUG B;  3ZR8 X;  3DPU A;  2VJI A;  4HEA 2;  1S9H A;  3S93 A;  4CZC A;  4IZZ A;  1M4G A;  4XLH A;  4MFZ A;  3ZXS A;  2Z3M A;  2AE6 A;  4CAV A;  2OV7 A;  1IRX A;  3OS2 A;  4F55 A;  3CXP A;  3D3S A;  3VYU B;  3TFY A;  3HOS A;  2E5Z A;  3H5Z A;  3NWT A;  3CP8 A;  3K4M A;  2UV1 A;  3RSN A;  2OZU A;  3FIX A;  3OYN A;  2R98 A;  3IU2 A;  3VYT B;  4A95 A;  2LOO A;  1YX3 A;  4PK4 A;  4N4O B;  4R57 A;  1Z21 A;  1IIC A;  4DOZ A;  4RM2 A;  4OLL A;  4B5P B;  3MKW B;  3BJ8 A;  3NWS A;  2HUZ A;  3H4Q A;  4E7J A;  4B12 A;  3HPH A;  1QU3 A;  3H5R A;  4BE2 A;  3HOT A;  1YR0 A;  4H6U A;  3LFU A;  2IS6 A;  3D5L A;  2HQA A;  4MY0 A;  4ZBG A;  5HVQ C;  1QHH D;  2V26 A;  2Y0S A;  4GS4 A;  2HU9 A;  2ZW6 A;  5KTC A;  3GBG A;  1M1D A;  4JXR A;  2VQL A;  2VZY A;  4XNH C;  4EVY A;  3OWC A;  2JEV A;  2FL4 A;  4LUA A;  5H84 A;  4KOX A;  3ZRG A;  3DPL C;  1SQH A;  3VDX A;  1X19 A;  2DXI A;  4HNX B;  5AG4 A;  1NG6 A;  4B48 A;  3OYB A;  2O28 A;  2L9S A;  1HA8 A;  1WJE A;  2OUM A;  4YRV A;  3SXO A;  1AA7 A;  4RLQ A;  1OZP A;  1JI8 A;  4MFJ A;  4B14 A;  2GAN A;  1Z3Y A;  2VXZ A;  4JQF A;  3E1S A;  2BUE A;  4FD6 A;  2NMT A;  4B5P A;  3OYI A;  2VJ4 A;  3L2R A;  3VYR B;  1R6R A;  3VSK A;  4B44 A;  1M4I A;  3KKW A;  1G59 A;  4B47 A;  3OYK A;  4E7S A;  2Z3N A;  5JQ4 A;  3ZZI A;  1M4D A;  4M85 A;  1CJW A;  5KNL A;  2XC7 A;  4KOR A;  5A28 A;  4PJM A;  4C2U A;  3HL2 A;  3W91 A;  3OIQ A;  5IX3 A;  3TCV A;  4DJA A;  4J01 A;  3PJR A;  4XR6 A;  3F0A A;  4YGO A;  2PDO A;  3FB3 A;  5CNP A;  3C2H A;  4PFO A;  2VAS A;  4FD4 A;  2DJI A;  2LY2 A;  3R96 A;  3WR7 A;  2VLA A;  3I9V 2;  3GY9 A;  2EUI A;  4NUB A;  1S7F A;  3IUO A;  4HG2 A;  3W2V A;  1MJB A;  1NMT A;  2VQY A;  2CXA A;  4QVT A;  4CGN A;  2B5G A;  2JLM A;  2IL4 A;  3AKZ A;  2Q44 A;  3VWD A;  2ZXI A;  1YGH A;  2X51 A;  2VZZ A;  2Z10 A;  3DR8 A;  1X4O A;  5I0C A;  5KTA A;  2JSP A;  5BWA B;  4R87 A;  4A33 A;  4HSR A;  1PJR A;  3H5A A;  3OR1 C;  1FMV A;  3H9J A;  4XN0 A;  3K70 D;  2OZH A;  4XPL A;  4BU2 A;  1IYL A;  5C82 A;  2K9M A;  4X0G A;  5H86 A;  2CV2 A;  1ERD A;  4CGL A;  1D0X A;  3LSI A;  4FET A;  4XLA A;  3E0K A;  2IGN A;  4KLV A;  4DNC A;  2W7N A;  2M4G A;  3SDB A;  3OS0 A;  5JPH A;  3LD2 A;  3V8I A;  4BMH A;  2X6X A;  3KYL A;  2YNC C;  2B4D A;  2K5C A;  4RI1 A;  2PJR B;  1BR2 A;  4IQ4 A;  4XPD C;  4NNJ A;  3TO6 A;  2M7B A;  2MYS A;  4M3S A;  2IS1 A;  3QAH A;  2CY2 A;  4F0Y A;  2GOM A;  3MGD A;  4X5K A;  1WK4 A;  3DQV C;  2AQF A;  3FBI B;  2R7O A;  2FE7 A;  4XKC A;  3DSB A;  4JD6 A;  4UFV A;  3ZQQ A;  3DWL E;  4F93 B;  1Z4E A;  4Y4R A;  4UWJ A;  4A32 A;  2BL1 A;  4XMY A;  1T0F C;  3OMY A;  2YND A;  3N7Z A;  2ZW7 A;  2CMP A;  2Z3P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...