4PSWA

Crystal structure of histone acetyltransferase complex
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
316
structure length
316
Chain Sequence
DFKPETWTSSANEALRVSIVGENAVQFSPLFTYPIYGDSEKIYGYKDLIIHLAFDSVTFKPYVNVKYSAKLGDDNIVDVEKKLLSFLPKDDVIVRDEAKWVDCFAEERKTHNLSDVFEKVSEYSLNGEEFVVYKSSLVDDFARRMHRRVQIFSLLFIEAANYIDETDPSWQIYWLLNKKTKELIGFVTTYKYWHYLGAKSFDEDIDKKFRAKISQFLIFPPYQNKGHGSCLYEAIIQSWLEDKSITEITVEDPNEAFDDLRDRNDIQRLRKLGYDAVFQKHSDLSDEFLESSRKSLKLEERQFNRLVEMLLLLNNS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Histone acetyltransferase type B catalytic subunit
publication title Hat2p recognizes the histone H3 tail to specify the acetylation of the newly synthesized H3/H4 heterodimer by the Hat1p/Hat2p complex
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 101
structure length 316
sequence length 316
ec nomenclature ec 2.3.1.48: Histone acetyltransferase.
pdb deposition date 2014-03-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
A PF10394 Hat1_N Histone acetyl transferase HAT1 N-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.390 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4pswA03
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4pswA02
3.90.360.10 Alpha Beta Alpha-Beta Complex Histone Acetyltransferase; domain 1 Histone acetyl transferase 1 (HAT1), N-terminal domain 4pswA01
3T9YA 1KUYA 3FIXA 1IB1E 3F0AA 4R9MA 4JJXA 3F5BA 2HUZA 1YK3A 3NE7A 3TFYA 3C26A 4QBJA 3EXNA 4OADA 4PV6A 3LD2A 4B5PA 3I3GA 4Y49B 3S6HA 4I49A 2QIRA 5KTCA 2Z11A 3SXOA 1XEBA 2JDCA 2Q0YA 3IWGA 3PP9A 4J3GA 4KORA 2G3AA 4CRZB 4DNCA 4KOSA 2FCKA 5CNPA 2OZGA 4L8AA 3R9EA 4XPDB 4OLLA 5F46A 4NSQA 3T90A 4FD6A 3PGPA 4CAVA 2ZW6A 3ZZIA 4F0YA 2I79A 5H86A 4AVBA 1L0CA 1XMTA 4H6ZA 4OAEA 2REFA 2B5GA 4IF5A 2VZYA 4QB9A 4B5PB 2ZW4A 2HQYA 1VKCA 1MJBA 4UWJA 4AVCA 3FNCA 1CM0A 3MGDA 5I0CA 1S5KA 2BUEA 4MBUA 4H6UA 1S7FA 2CNSA 3FRMA 5IX3A 3FBUA 2OZUA 3IGRA 5GCNA 3TTHA 2H5MA 4JD6A 4ZBGA 3GYAA 4GS4A 1M4GA 4UBRA 3S6FA 5C88A 5JQ4A 1GHEA 5F47A 1Q2CA 2ZXVA 2ATRA 2B5GB 2PDOA 4XNHC 2Q04A 2JLMA 3EO4A 2G0BA 1IYKA 2D4OA 3SXNA 3V8IA 2JEVA 5DWMA 2IL4A 2WPWA 5KTDA 4KLVA 2D4PA 1TIQA 3GKRA 2Q4YA 2J8MA 2RC4A 1Y9KA 3OWCA 2R98A 1XIXA 1Q2DA 3TO9A 4XPDC 2K5TA 2AJ6A 1YVOA 1BO4A 2P6EA 4UA3A 4MI4A 4QUSA 2VQYA 4JXQA 1M4DA 2ZPAA 2CNMA 2B4DA 4KOVA 1NE9A 2FSRA 3EC4A 2GIVA 3LODA 4PSXA 2BSWA 3PZJA 1P0HA 3TO6A 1MJ9A 1WWZA 4IUSA 3CXSA 2J8RA 2Y0MA 5DWNA 4U5YA 1YGHA 3R1KA 3DNSA 2F5IA 2QMLA 3TOBA 1MJAA 5HH1A 2JDDA 2VZZA 1Z9UA 1LRZA 2PR1A 3S6KA 2PRBA 4X5KA 2B58A 1R57A 5IB0A 4PK2A 2B4DB 2X7BA 1S7LA 1K4JA 2FIWA 4CS0B 1IIDA 5FVJA 2WPXA 2VEZA 4XPLA 1QSOA 2Q7BA 4E0AA 4NEXA 3TE4A 3JUWA 3G3SA 4B5OA 1QSTA 1VHSA 3K9UA 1I1DA 1YR0A 3G8WA 1S3ZA 2A4NA 4JLYA 4KOYA 1V0CA 2OH1A 4PSWA 2CY2A 3GY9A 1ON0A 5KTAA 3D3SA 3R9FA 4KVOE 4JXRA 1I21A 1PUAA 3B8GA 3D8PA 4PK3A 4EVYA 5EC4A 2HV2A 4RI1A 4F6AA 2R8VA 4U9YA 3VWEA 1U6MA 2OZHA 3TT2A 4FD7A 3BLNA 4QVTA 4YFJA 1SQHA 2EVNA 4AG9A 3RYOA 4KOXA 4R3LA 1Z4RA 2OU2A 2FXFA 4NCZA 2Z0ZA 1OZPA 3DR8A 2FL4A 4Y49C 2BEIA 4KOTA 4KZTA 4CRYB 4QC6A 5F49A 4KOUA 4M3SA 1Z4EA 1RO5A 4HNYB 1M1DA 4L89A 1MK4A 2B3UA 3TO7A 3FB3A 4CAWA 2ARHA 2CNTA 4FD4A 4ORFA 1KZFA 2BL1A 2DXQA 2FS5A 3S6GA 3BJ7A 4CAXA 5EBVA 3DDDA 2FIAA 2B4BA 3CXQA 1YLEA 3TCVA 4LUAA 4H89A 1NSLA 3KKWA 1Y9WA 1WK4A 3E0KA 2KCWA 1FY7A 3QAHA 2FE7A 4MHDA 4ONUA 4MY0A 2O28A 3TOAA 3SHPA 1KUVA 3N7ZA 2VBQA 2I00A 2ZW7A 2R1IA 4XNHB 3DSBA 5C82A 2GE3A 1M4IA 3F8KA 3P2HA 2PSWA 4KVXA 3H4QA 4FD5A 3JVNA 4NF1A 3DR6A 4JWPA 5JPHA 3P2FA 4HKFA 1YVKA 1XF8A 3QB8A 1QSMA 1Q2YA 1YX0A 4BMHA 4KUAA 1J4JA 4YGOA 4HNWB 4YRHA 3EY5A 2FT0A 2P0WA 2PR8A 2VXKA 4R3KA 2AE6A 4E2AA 1M44A 1N71A 1XE4A 3UY5A 4NXYA 1IICA 2GANA 1RXTA 5J8FA 3W6XA 4XPKA 3R95A 2PQ8A 2PC1A 3W91A 4AG7A 2P6GA 4R57A 1IYLA 4R87A 2Q44A 1QSRA 3R96A 5J8CA 4MJ8A 4AB7A 1S7NA 2VI7A 4KLWA 1Y7RA 1S7KA 1QSNA 1P4NA 1B6BA 4U9ZA 2Z10A 1YREA 5E96A 1I12A 1NMTA 3I9SA 4UWIA 2OB0A 3VWDA 5IV0A 1UFHA 1S60A 2ZW5A 3D2PA 3ZJ0A 2G3TA 2P6FA 4AVAA 1KUXA 4HNXB 1B87A 1BOBA 4LX9A 3R9GA 5H84A 3EFAA 2C27A 4MY3A 2EUIA 2NMTA 3FYNA 4E8OA 2B3VA 4KOWA 4M85A 2J8NA 5ISVA 4RS2A 5F48A 3FXTA 4KUBA 4II9A 3BJ8A 3W6SA 4K30A 2R7HA 3WR7A 2Q4VA 1PU9A 2REEA 1CJWA 3CXPA 4KVME 5HMNA 2QECA 3D2MA
chains in the Genus database with same CATH superfamily
1S7OA 2Z3KA 1J5YA 3T9YA 1CG2A 4OC3A 3VSLA 2YNCA 5HVGA 3FXJA 4LLNA 1YG2A 1VQ8I 2CWEA 2A5WA 3FF5A 4R9MA 4EWTA 2EQRA 5DYMA 3KZZA 3KASA 3K4CA 3WGIA 4HLXA 2DA4A 3E6CC 2HUZA 1S7EA 4ESFA 1YK3A 1ZGWA 2L9RA 3QP6A 2O5RA 1WJCA 2FU4A 1IW7F 5ELYA 3SQNA 1SEUA 1F1ZA 2DW4A 2KRFA 4FASD 4BDYA 4OADA 3ABTA 4B5PA 5AG4A 3I3GA 3R6SA 3S6HA 1W0TA 2HKOA 2ZJ2A 4DBQA 5FJ8J 2Z11A 1YOVB 2IPQX 3GCMA 5H2FC 2F5DA 5C4JJ 3RIRA 2QSHX 4JX6A 4GDFA 3IEHA 2JDCA 3IWGA 3L9FA 2Q8KA 2D1VA 4CRZB 1GXPA 1USTA 3EDPA 4XK4A 2F4OB 2UV1A 3ASOH 4P4IA 1WGXA 2Y9ZA 5F0CA 4M6XA 1KYWA 5HDKA 3I59B 2WB1N 4NSQA 2V7FA 2GFQA 2XEGA 4UV8A 1QZZA 1DPRA 3DPTA 3OYIA 2ZJRF 4FD6A 4CAVA 4LD5A 3QPSA 3COAC 3FXLA 4F0YA 1K7AA 4YWYA 5H86A 3FIWA 1DGWY 4P55A 1BPNA 1L0CA 4H6ZA 3KE2A 4QTRA 3S1RJ 5GTHC 3RNZA 4OAEA 3A02A 5EJCA 4BXFA 1JI8A 1NSAA 3D5RC 1O3QA 1LFPA 2ZKZA 3DKYA 3M8FA 1WI9A 3H5AA 2IW5A 4RGUA 1XGSA 2XEIA 3O8GA 4HOBA 1BJZA 1MJBA 1AHDP 1VKCA 3L2NA 5JVGF 4RUHA 2N8GA 4W97A 2CYYA 1T2KA 2ZB9A 4YIIA 1GV5A 1ELLP 1Z0XA 3HTSB 1IGNA 1XCBA 2QKLB 2PCUA 4M6HA 5KNLA 2HQRA 4YIFA 5AIPA 2CNSA 4FE4A 3FRMA 3QWLA 2EPFA 1R9TJ 2DYRH 4KSAA 3GTKJ 2A5YB 2H1LA 2VXDA 3IUOA 1T0FA 2DPUA 4F7ZA 3RZAA 4KDPA 3PM1A 5GCNA 5IB9A 3KFWX 4HF0A 4ZBGA 4L0ZB 4D5FA 4C2TA 2DMTA 2VT2A 3MFKA 2NOJB 5JLXA 4MQ9F 3ERED 3PBBA 3BJ6A 3AL0B 2W57A 3S6FA 1GHEA 4LK0F 5E1XA 1N78A 4PXEA 4A31A 4FT8A 2QLZA 2RN7A 5D6FA 2LTPA 2F48A 4FX0A 4A6EA 1Q2CA 3LSRA 4J01A 4ZYEA 4XMYA 2V8VA 1EH8A 5CKTA 2ATRA 2J9AA 3S2DJ 2Y30A 2RV8A 3TW6A 1LDKB 2K4BA 2C6GA 1WHUA 2F4IA 2QA4I 4XONA 2ZC2A 2CRGA 5LHGA 3RCOA 2EO8A 2FBHA 1TF8A 1IYKA 2D4OA 4DBRA 1I27A 3SXNA 3V8IA 1O7FA 4A5MA 2JEVA 4LB5A 3KYCB 2HTJA 3I56I 3I53A 2IL4A 1J09A 1LFBA 3IFEA 4I99C 2PEXA 1UAAA 1TIQA 1B72B 4F0XA 4Y33A 3IV5A 3CCJI 3K1PA 3HSFA 2LD5A 3GKRA 2Q4YA 2J8MA 3Q9VA 4XORA 1MBGA 3CCQI 1TWGJ 4HA8A 1JHHA 4RLFA 5D5XB 3LMMA 1K78B 5JGFA 5LRJA 2NXNB 1ZG1A 3BXMA 1SD5A 3PNVA 5ILSA 1Q2DA 1XIXA 5DM6F 1A04A 3ZQQA 1XD7A 1S72I 4B12A 1IO2A 1ZTRA 4P9FA 3S93A 2MLGA 5GP9A 2Z33A 2OPTA 2ZEOA 3IL2A 1QMUA 1YW4A 3IWZA 1T8IA 2EV6A 1JWQA 4MFJA 1HDDC 2K5TA 5EGOA 1YVOA 1BO4A 2EK8A 2P6EA 2LF7A 4UA3A 4OAYA 3H5ZA 4U7BA 2MGQA 1YJ9I 3CC4I 3HHGA 3S2HJ 4JXQA 4XLEA 2ZEFA 2VKVA 5HS7A 1Z1DA 2HTSA 2JA2A 4BNCA 2ETHA 3WTTC 2BVLA 3BR6A 1ZYRF 4KJZA 2DDBA 1QPMA 3WU2C 4A69C 5JR3A 4B13A 2R3SA 1UZCA 1NTCA 4MHNA 3F8CA 2XROA 4B4CA 2BSWA 2VBWA 2GZWA 4M3EA 2LK2A 1UG0A 1AKHB 3EQLF 3PFEA 3GBGA 3RKXA 4IUSA 2GLOA 3KI9A 2XRNA 2PJPA 1WJEA 2VC0A 2CUZA 3HKZA 2KMUA 3R1KA 4GGGA 4XICA 1ETXA 5ICEA 2BBYA 2DOFA 1LEBA 4CA0A 2MLKA 1MBJA 5KHDA 3DBRB 1MNDA 2J5OA 2P5LC 5KAFC 2XKPA 5CVIA 1TNSA 3H3ZA 4NGSA 1TQMA 4B44A 2JDDA 4EJTA 2VZZA 3SZPA 2PR1A 3VYSB 3KZWA 3DLLF 1B8IB 4C2MJ 1R57A 2EFQA 3T8TA 4G6QA 4OIWA 2HYJA 4PK2A 4NJRA 5F0HA 1DP3A 1FBUA 2Z3PA 5K7ZA 1LE8B 2X7BA 4OOIA 2FIWA 3ESWB 4BDZA 5AG5A 3BPXA 3LACA 4CS0B 2NS8A 1IIDA 5FVJA 5IP7J 1FP2A 2VEZA 1G8XA 4XPLA 2V4JC 1OCPA 3GLXA 5J1QA 4D7NA 1R4NB 3GMEA 2Q7BA 4S05A 3HEFA 1RI7A 4NEXA 2DA6A 3JUWA 4B5OA 2B0LA 1F2PA 1ZN2A 2K9LA 5F27A 4U7DA 3MCZA 2GU2A 4XM3A 4UFWA 1QQIA 1TKFA 2JRTA 1FTTA 4JX5A 1RKWA 1ON1A 3D1NI 3HOVJ 3K9UA 2TRTA 3K9TA 5GAEJ 2MA3A 3K10A 4EGZA 2DA1A 5M3MJ 4YRVA 3GTOJ 4XR6A 3V7RA 4YFKF 1E3OC 3IP4B 4M6GA 5GPAA 4XQFA 3K2AA 5IY5H 1XSDA 5H6RA 4BY1J 1ON0A 1IN8A 2GOMA 1V55H 2BXYA 4KVOE 2G7UA 1EA3A 1ZKGA 3OYGA 1XJOA 3HUVA 2OQRA 4RAGA 2CJJA 5HODA 3VOEA 1U3EM 2JN6A 1N77A 2A6HF 3HOYJ 2PJ7A 4Z6YA 4F55A 1W0UA 4PK3A 1F43A 4ZZLA 1AWCA 2WZNA 4BUPA 2HV2A 2JPBA 4X1EA 3CESA 2VBXA 3B3CA 2V1UA 3DCFA 2WV1A 3F8NA 4U9YA 1YX3A 2OV7A 4GYGA 2OZHA 2QM3A 2PX9A 3E5UA 1N75A 2A6EF 1P9QC 4JBAA 2VIXA 4AWXB 4OC1A 4JZ0A 1XTAA 4P4FA 2KLOA 3BLNA 5THWA 1NG7A 4ZDOA 2Y69H 4AVPA 2VQHA 3E3VA 2DFEA 1KU7A 2EVNA 3IHUA 3K2ZA 4UF4A 3RYOA 2ME6A 2GXAA 4MEXF 2HZDA 4P4JA 2OU2A 3LSJA 3K70C 2Z0ZA 3BZ6A 4HYEA 3D7GA 1JTYA 2V6CA 4E7ZA 4I76A 4QC6A 2FMYA 2QWWA 3RZOJ 4A39A 3O6BB 4MHGA 4L18B 2QVOA 1VQNI 1M1DA 3KEOA 1MK4A 1M4LA 2IS2A 1PYVA 1U9OA 1K79A 3IH4A 3RZDJ 4CAWA 3S16J 4CGPA 5E17F 3S8PA 3CCSI 4G9YA 2XVCA 2YNCC 2ZEDA 2ZO4A 4RLQA 1YQEA 5E8IA 2E1MC 1ON2A 1HKQA 3FHZA 1OCZH 2RKHA 2RFHA 3Q3SA 2K9SA 4XRFA 4B3AA 1RR8C 1G3TA 3NWSA 2BL1A 4HRIA 3S6GA 2BVMA 3QOPA 1HKSA 1MMNA 5M5XJ 1JKQC 3BJ7A 2KQRA 2O3FA 5EBVA 1HDPA 2IP2A 1ACIA 4XLFA 1YLEA 1REPC 2PJ8A 5EG0B 2JSCA 4RM2A 2AXLA 1YLOA 4LUAA 3I4NJ 2STTA 4H89A 4FE7A 1ETOA 1R5ID 2QYOA 5ED4A 3NARA 3FMCA 1ENHA 5AIQA 2BE5F 1I6XA 4BS9A 4JX4A 1Y9WA 4ENKA 4KT6A 2VL8A 4HEA2 2DODA 2PI0A 5EZGA 4Y15A 1YS6A 4IQJA 1FY7A 2BO9A 2ABZA 2FE7A 2GQQA 5IPAA 2JA6J 4MCRA 2CQNA 1ARLA 3DTEA 4OIDA 4RN7A 4PZJA 4EJUA 5FB2A 1KWMA 2LY9A 3DKWA 4G6TB 4HSTA 3TOAA 2HNHA 5JFRA 2Z1DA 3CZ6A 2ACJA 4NHJA 3SHPA 2K85A 2DT6A 1IRZA 2I00A 3R61A 1IU8A 4L9TA 4XIDA 1Y1VJ 5C82A 2GE3A 1M4IA 1HW1A 5ILUA 3WTYC 2CW0F 3QYEA 1KQ0A 2ZBKA 2A05A 5FLVA 1X58A 1D1AA 3IWFA 3Q0UA 4NF1A 5A27A 3O2PE 3F3XA 3CC7I 2K40A 3H5NA 3HOWJ 3NAUA 1NH3A 3P2FA 4HKFA 1SC7A 1TF9A 3VFZA 1XF8A 5FRMA 1Z6TA 4OMZA 4ANJA 1Q2YA 2EWBA 4I6ZA 4C3IJ 4MFEA 2MFZA 1A2ZA 2L0KA 2IMOA 1XOVA 2E71A 1Y0RA 4IEJA 1F57A 5DS9A 3WGGA 5BPIA 2NVXJ 4YGOA 5LGUA 1Y8RB 3CP2A 5CBMA 3M1EA 3BHXA 2Q2EB 3D7FA 2LY1A 3KYLA 1IAWA 4C7HA 4CGMA 4BE2A 3ZQGA 2P0WA 4XLAA 2H8RA 3BY6A 1K83J 4CAEA 3FJUA 2KJCA 4D9JA 2AE6A 2LY2A 2ZCWA 4MMOA 1T0FC 2H6BA 1LFUP 2M3AA 4UEZA 2HQAA 4OIQF 1XE4A 4ZY1A 1IRFA 3H92A 1QHGA 4MNUA 2GANA 2W4SA 2RNGA 4TV7A 3F21A 3E5XA 4KISA 2AO9A 2L4AA 4XPKA 4KSFA 2QGUA 2Y0SA 5FKNA 3U1DA 2DQLA 4IHTA 3LFUA 4YFNF 3TGNA 5K1YA 1FTZA 1TW3A 2BZTA 3PQJA 5I4MA 1U5TA 3RO0A 3M1CA 2ESHA 5J47A 3DXJF 2P6GA 5FKMA 3N4MA 3BI0A 4LB6B 4M6IA 1WWXA 2D1HA 2XB5A 3G1OA 3OL4A 3JSOA 4MJ8A 3R96A 4G7ZF 1RPWA 3B3SA 2GWRA 3BR5A 5L3FA 2A68F 3EYIA 3CC2I 1VHEA 1Y7RA 4KLWA 2CFOA 3W3CA 4BH9A 1FMVA 2AFZA 1QSNA 1FNNA 3ZN1A 2PJ0A 3K1NA 3P9IA 2DEAA 1DU6A 3FK6A 1WJBA 1P4NA 1BAVA 3LAJA 2O7OA 4I09A 4U9ZA 4HV6A 5FD5A 1OISA 1R1VA 1SAUA 2BY3A 4A3IJ 4J19A 2Z3MA 3NQOA 2EZKA 3V7SA 4CZZA 3I9SA 4IHWA 1PJRA 3SFIA 2LMDA 2D45A 2XAHA 4XN3A 2VJ4A 3VWDA 2HI3A 2L02A 2IS1A 1S60A 3DEEA 3MKZA 2ZW5A 4QWQA 1STZA 2L5QA 3ISZA 4MFQA 2DT7B 1T38A 3ZJ0A 1J9IA 3NA6A 1XG1A 3V4GA 3ZOBA 2H09A 1U9NA 4UVCA 2G3TA 5DCMB 1PCAA 2MBFA 3C18A 4CCOA 4X6AJ 3HG9A 2Y48A 1R23A 2CQ7A 5LGNA 1KUXA 3FKJA 3CCEI 4RM3A 3A1YA 2JSPA 2JUCA 4MY3A 2EUIA 4E7LA 3FYNA 2CQKA 1Z9CA 4LLGF 3B73A 4PGHA 4XKWA 4UY8I 1TWCJ 1TZLA 5D4SA 2O8KA 2IJZA 4A0ZA 1ZG9A 4RS2A 5F48A 4ENMA 1MH4A 5EDNA 3WE2A 2DA5A 3QPTA 3W6SA 5E20A 4ETSA 3U1KA 5EMIA 1XN7A 2EB7A 5E3NA 3GWZA 2R7HA 2A3SA 3CCVI 8CPAA 3BDDA 4C2YA 1JHFA 1MIJA 3GXOA 5HMNA 4W1UA 1YW8A 2NOGA 3F9KA 4ENNA 1R43A 3A0HC 1HC8A 3JRUA 5K8OA 3GB0A 3PO3J 1IB1E 1MBKA 3I54A 2M2EA 1HXDA 3IC1A 4P6YA 1SVLA 5LYIA 4XKVA 5FKOA 2HVRA 3NH5A 4TNUA 3KP5A 3L2RA 5CVUA 4UCNA 1POGA 3LAPA 4X2TA 3CCMI 4HNUA 2P6SA 3BZKA 1V4RA 1ZG3A 5CLSA 2QSFX 4OWRB 1DDNA 3H8GA 3SFZA 4QBJA 3TC8A 3P5JA 4Y49B 1I3QJ 1OCCH 1ZK8A 3HC7A 4HNVA 1YRNB 3OIQA 1W5TA 1MGTA 2QIRA 3I4PA 3DLJA 1D1BA 5LYDA 2K9NA 1Z77A 3ZN0A 4AIJA 4KNYA 3GYHX 4BXXJ 2FEZA 3WODF 3BCBA 3PP9A 1WRJA 3DFGA 2WSAA 3GFMA 2Z2SB 2G3AA 2YSRA 1RESA 3LL7A 3U2RA 3ZP5A 1XMBA 4KOSA 5K8NA 3ULQB 1R36A 4XL9A 2CQXA 3FWEA 3B3TA 2CXAA 5CQGA 1YJNI 4OLLA 4P10A 2R93J 3KEQA 5BNGA 4F52A 1VQMI 3WTUC 2KT0A 4RB1A 1Y39A 4G6DA 4RMNA 3FBNB 4UB6C 2MG4A 4BQAA 3HRUA 4R6TA 1VQKI 3CDHA 2REFA 2B5GA 2L9VA 2ZXJA 1Y56A 2EA4A 3FM3A 4M72A 4M74A 1X1BA 2DO7A 2H1KA 2VZYA 3IU2A 2YS9A 4XLNF 3FKIJ 4LIVA 5LLQA 2ZW4A 2MH9A 4KIFA 5F0FA 2E7XA 2HOTA 1CM0A 3ISXA 3MGDA 4AVCA 2ECCA 3RPUA 2QQAA 2HPIA 4KIBA 1USSA 3R60A 4C2UA 3SI1A 2JBKA 2ZXHA 1G3YA 1S5KA 2EFPA 3FDYA 3MZYA 3CTAA 4PDKA 4DYQA 3CO6C 1H9TA 1WJDA 5IX3A 4M9ZA 3HSRA 3S1NJ 3FBUA 2OZUA 3RYRA 3IC7A 3DV8A 2H5MA 4JD6A 3IRQA 1HW2A 3GFIA 2LBFA 3K6GA 3VYTB 1EH7A 3GYAA 3OYJA 3EUKL 3A2KA 4GS4A 2ICWG 4UBRA 3UNGC 3AAFA 4Q48A 4L9NA 1LANA 1H0MA 1D8KA 4NGNA 1OLTA 4B47A 4QLCU 3WU1B 1SFOJ 3K4KA 4OINF 4AIHA 2ZXVA 3JRHA 2PJ6A 5C4XJ 3GUDA 1WSUA 2NRAC 1TBXA 4UHTA 2PBIA 1PUEE 3PIOF 2DPDA 1DTDA 2AFMA 1T98A 4G1PA 4F92B 3W2WA 2PIYA 2Q04A 3CMMA 3OIPA 3JRIA 4MLOA 5ICGA 4NGTA 3W6JB 1B4AA 3IH2A 4HV5A 4WXDA 1ZRDA 3DTIA 1SFUA 2ZMEA 3SYTA 1WJAA 4M3DA 4M73A 1GYTA 2PVWA 5DWMA 1X3UA 2MD0A 2XC7A 4MHPA 1OBRA 2DQRA 3DPLC 3I1UA 1UHMA 1IXRC 4NGQA 2E19A 1SD4A 4M3FA 3M3YJ 1XMKA 4B14A 3W6VA 3NWTA 3TEDA 4GM5A 2R98A 1OKRA 3E7LA 1ODDA 3HPHA 2POKA 2AFOA 2Q7SA 4MFLA 1KU9A 1MZBA 4P4EA 3TO9A 1OCRH 4YFXF 4A33A 1HW5A 4F9VA 1LOKA 1Q1VA 3OMYA 1F2OA 4QIWN 1AOYA 1K4TA 3CJNA 5DDGA 2AQEA 3T1BA 2R7VA 4ZYAA 2FNPA 5CVJA 2LYCA 4Q47A 4CCMA 4EJVA 3S3OA 2CTBA 5D29A 3OYFA 3UKGA 1FPQA 1TW2A 4XKCA 2OA4A 3FBIB 2ZPAA 4CYNA 2B4DA 2EZLA 5TISC 2PMZA 2E1OA 5JI6A 3RPQA 2DA7A 5D6EA 1D0XA 5J1YA 3EC4A 3WC5A 3LOCA 4Y13A 3D66A 2HQ5A 1B59A 1P0HA 1IJWC 1Y6IA 3GF2A 2VC1A 3JAMK 2LREA 1WJFA 3SDGA 1D0YA 4F3QA 5KK1A 4H0EA 4IKFA 6CPAA 2J8RA 3GVAA 5DWNA 5HOOA 1YGHA 4DYOA 2R92J 1FP1D 3DNSA 4NFRA 3H9QA 2F5IA 1TT5B 4KUMA 3I58A 2QMLA 2K3FA 1FSEA 4BEHA 5DEQA 1SD7A 1TWFJ 2BW3B 3RSNA 1RETA 1XGNA 2R5ZA 1SFEA 1MMAA 2VKDA 4G12A 3PB9X 3S3NA 2QEXI 1BI3A 5F64A 3S6KA 3IIBA 4X5KA 3Q9SA 4H2KA 1OFCX 2XHKA 2FD5A 2UXXA 3JAMZ 3WTZA 3GZ6A 2B7EA 3CDLA 1CPSA 3FVLA 5G22A 4DIQA 5HDNA 4OIRF 4IRIA 2H8WA 3HSEA 2IT0A 2O8XA 2RQQA 3CMAI 1EE3P 1LAPA 1X19A 1JKOC 2HB6A 3SJXA 2DXIA 1D3YA 1U5TC 4PGGA 2E5NA 3ZMVA 5LEKA 2C6YA 1TQIA 4E0AA 1OR7C 3QU6A 3TE4A 4UUSA 1BL0A 1WZ2A 1QZEA 1IXCA 1I5ZA 1P4WA 1QSTA 2GREA 2X1DA 1WJ5A 1VHSA 1I3AA 3F8BA 3MWMA 1R58A 5E3OA 3L7WA 3JTGA 1XDSA 1S3ZA 1S7AA 3JSPA 4NNJA 4EFDA 3HZJA 1KQ8A 3FF3A 3PB8X 4KOYA 2RVCA 3VATA 4NGRA 2GA1A 1R1UA 4HQEA 2EV0A 1AU7A 5LFAA 2CY2A 3GY9A 1SVMA 2R7OA 3CCRI 4DQ2A 4UXNA 2FOKA 2RNJA 3LSGA 3PSFA 2P7VB 1Y8QB 3ZGKA 4IPAA 1I21A 1PUAA 3OY9A 4IRGA 2DYSH 2XUBA 1Y0UA 1ZELA 3LSKA 4A5NA 1Z21A 2HOSA 1BW5A 2FOWA 2PJ1A 3B8GA 4D7MA 3D8PA 2KRHA 3KP7A 2ZXIA 3HUGA 3FM5A 5EC4A 5E3LA 2XSDC 1BW6A 4NGMA 2X6XA 2VPLA 2E2JJ 4F6AA 3IH3A 4M3BA 2E2HJ 1S9HA 4B09A 1U6MA 1RIOH 3C7JA 1QVTA 3JW4A 1I1GA 2OZ6A 4LG3A 4A30A 4BYYA 2ZELA 5KVRA 4D1QA 4FD7A 3KX2A 4LQGA 4YFJA 1RUNA 1SQHA 1IZ1A 5E3MA 2E60A 1XMXA 4IVNA 4KOXA 1FBQA 1V3FA 3PIPF 2FXFA 2DJNA 3BR1A 2DI3A 2MC3A 4AVZA 1OZPA 2OUMA 3DR8A 4CGLA 1JE8A 4KOTA 3OR1C 1XMAA 1ZLHA 4IAVA 2JA8J 3MKYB 4P44A 3KL9A 2M5WA 2GIZA 2VOOA 4M3SA 4YELA 1MNEA 5EF6A 1R3NA 3EUHA 2DCEA 2MD5A 2B3UA 3TMOA 1RR7A 4YIRX 3PQKA 3FZVA 4A95A 3M8JA 2ARHA 3FX6A 1QZYA 1XFOA 4A3KJ 4MCPA 3TQNA 1ZO0A 2XF7A 3F0CA 3PFIA 2IGMA 2A07F 1RZ4A 2PJ3A 1QQ9A 1JGSA 2O6GE 3PFOA 2J5PA 1SFXA 1D8JA 2DXQA 5J40A 2IGNA 3C2HA 2VODA 2JBJA 1SAXA 2FIAA 3ZMTA 3CXQA 1MBFA 2HGCA 2R7DA 5FLXK 4RA2A 2LRDA 3BG9A 1X3WB 3CDXA 2IA2A 3RJPA 1O4XA 4TWEA 5HXDA 4HSRA 2JRMA 2E1NA 1MSEC 3HJEA 3O3KA 2DF5A 3H1CA 2M0MA 3NH4A 3KCCA 4DZJA 3HM5A 2HOAA 1FYKA 3E0KA 2IGKA 2EZIA 1JJ8C 2VASA 1LB2A 2KCWA 4MCSA 1GUUA 6PAXA 1PUFA 1BLLE 5B5EC 4MHDA 3M7GA 4ONUA 2RGVA 4HLYA 1FYMA 1BIAA 1F9NA 4L9JA 3E6MA 3DU6A 5FLMJ 1HOMA 1W7PD 5D8KB 4ZX8A 5FLXZ 2R5YB 3CJTB 4IRHA 1F4KA 1W7PA 2FXAA 4E7IA 2PJRB 4Y52J 1KUVA 2WAEA 5AG6A 2L9NA 2ZW7A 1W1WE 3KHXA 1IUFA 4DYRA 4WWVA 1XSXA 1FC3A 1QU3A 3FXQA 3F8KA 2PSWA 3QAYA 4KVXA 3H4QA 2MYSA 4FD5A 2BXZA 3B3WA 3ZMSA 1MBEA 2ELHA 1S6LA 4MFPA 4OC0A 3DR6A 4EJWA 3LFKA 1IN5A 3D4UA 1P4AA 2KKOA 1LCPA 2PG4A 1YVKA 2BGCA 2LF8A 2XAQA 3QB8A 2HS5A 4BJ6C 2GA2A 1VTNC 3GEZA 1CF7A 3RDIA 4ZZDA 3A0BC 5CJ9A 2LKXA 3OYCA 1J4JA 4XSZF 3H5RA 1LUJB 4BACA 2EV5A 1HDUA 4PJNA 4B3XA 2ANPA 5ICCA 3S32A 2IRFG 4P4DA 2DAOA 2DK5A 2VXZA 3L2VA 2PR8A 3A9LA 4R3KA 3EUAA 3HGGA 3IAM2 4ZYHA 3OL3A 1N71A 4ABZA 3VDXA 4NBQA 1Z7LA 2ZNZA 3OS2A 2PMUA 1W4MA 3H9JA 5L3BA 3GLJA 3MZHA 1BIBA 1JUPA 2RQPA 2GXBA 1D5VA 1C0WA 2XB0X 4AIKA 2QBYB 1E3HA 1KONA 5KAIC 4M71A 5LRSA 3MEXA 4HQMA 1T33A 2WAFA 4UEEA 4AG7A 2YX7A 1J0RA 4A3DJ 3QNVA 4CYCB 4R57A 1IYLA 1SANA 4RS8A 2VQLA 1IDZA 2Q44A 4NDLA 1Z8TA 1BI2A 2K02A 2FBKA 2DPTA 4KIGA 5M5YJ 2W82A 1S7NA 4AB7A 2EJRA 3HOTA 1X1AA 4IQ4A 1NG6A 4D5CA 4E7KA 2ZMEC 3BTJA 2XF5A 2DMUA 3KGQA 2XSJC 4O6JA 1S29A 3VSKA 4JQFA 1EV7A 2M1BA 2VQGA 4O5VA 3CT9A 3RBUA 3PB4X 1MNMC 2O4HA 4PJLA 5HVQC 1H8AC 2Z10A 3DU5A 5BS6A 1TQPA 2ZEHA 3DBHB 1Q7LA 1NMTA 2K27A 4AM3A 3VH9A 2WAQN 5B66C 2KHMA 1MW7A 3B6AA 4Q38A 2R7XA 5IV0A 1UFHA 1OPCA 2ID6A 3OS0A 4IXAA 4AYBA 5K5OA 1WVRA 2CTCA 2CV0A 1S3JA 1P2FA 4XRSA 5JH9A 2NAZA 2VKHA 4HF2A 4E70A 1MBHA 1U6GA 1D5YA 4OAZA 5EEAA 4BY7J 4FAIA 3CLOA 1TC3C 3S17J 2ZSIB 4ZJZA 1B87A 4LX9A 2HU9A 2X6WA 3RI4A 3D5SC 1IRGA 2ODFA 2CUEA 3WHCA 3FK7A 3OYEA 2C27A 3QRFF 5F1JA 2AQFA 1VQOI 2CSOA 2X6OA 2CH0A 3ELKA 1CP7A 2B3VA 4KOWA 1ETVA 3ZCOA 2Q0OA 3FMQA 4KUBA 1W5SA 3K7AJ 2PJ4A 3TX8A 1F5TA 1A5JA 2E1CA 2L7MP 5LHHA 4K30A 2EINH 3CUQC 3FX3A 3I3LA 4NQWB 1QPIA 3QYBA 3T0YA 4BL0B 3NE8A 1H8LA 2LLKA 2AS5F 3PO2J 1KZHA 5JVTA 2KDZA 5CQEA 1B6AA 5H6QA 2V77A 4NC8A 2V8DA 3IWWA 4BKXA 3WR7A 3J7ZI 1PU9A 2CQQA 4EM0B 3BOQA 3U21A 3GZNB 4Q36A 1Z8WA 1W36C 3X2QH 1GXQA 1YE9A 3H35A 4KVME 2M87A 5FD6A 2QECA 1GHCA 5K7FA 2WTEA 4N9IA 2D5VA 3JRDA 4CICA 2FJ1A 3F0AA 1GVJA 1E17A 4RB0A 2VPRA 1FNOA 4JJXA 1J59A 3F5BA 2HZTA 4ZY2A 4KICA 3ABMH 2B63J 5L3EA 4KS9A 3GTQJ 4MEYF 3NE7A 4BQNA 4KFCA 2BV6A 4HZFA 4BJTA 3FH4A 3TFYA 5DUIA 1CP6A 2ME0A 1YJWI 1Z8XA 2YGWA 4EVIA 1E2XA 4A0XA 3HL2A 2WUUA 3LD2A 1IN4A 3B7IA 1R5GA 2IEKA 1HA8A 3ZXSA 4I49A 3VYRB 1Z7UA 5JLWA 3IAS2 3AG4H 3R0AA 3CO7C 5BWAB 4WK8F 3DBLB 4RAFA 1CGPA 2QCOA 1D1CA 2PRQA 2Q0YA 4FBEA 4J3GA 3S9NA 4KORA 4LOCA 3ZPLA 1MMSA 2KDOA 4A93J 2FCKA 5CNPA 4YG2F 1WFXA 2E7WA 1KU3A 1SMYF 5EZHA 3RKWA 3NRVA 1SFKA 4XPDB 2E1MB 3IKTA 3TDZC 3TW7A 1SMTA 2BOLA 4HDVA 2JA7J 2XF6A 1YIJI 3T90A 5F46A 1KU2A 4MGRA 1ELMP 3PL8A 3KEYA 2ZW6A 3ZZIA 3V42A 1RC9A 1D0ZA 4DUKA 1FT9A 4AVBA 1BM9A 2FA5A 1XMTA 2VL1A 4EMSA 5LRKA 2OCCH 5F08A 3GUXA 2XPWA 3DWLE 3G3ZA 3LQQA 4K2EA 2QQ8A 3B2YA 1HSTA 2ISYA 5HLTA 1G3SA 5K5QA 4B5PB 2VJIA 1YO5C 2HQYA 4UWJA 3FNCA 1OR7A 1UFMA 4JOMA 3AKZA 3FMSA 3DEUA 4L5IA 4UUTA 4BEHB 3J81K 1A6QA 2DA3A 2X0LA 1TWAJ 2F5FA 5A28A 5FRNA 2HYFA 2YPRA 1YX5A 1DUXC 3QODA 1PVEA 4MBUA 4CGOA 2XAUA 1X1DA 3Q5FA 1B72A 4P45A 2F5VA 4EGYA 3SZGA 4BBSJ 2FSWA 2W7NA 1BR1A 1JGGA 1K78A 3TTHA 2DFHA 2HVSA 3H36A 3JR9A 1CPXA 2XRLA 1M4GA 2DMNA 4OU0A 4L0YB 2OOTA 3EUHC 5L3DA 2K5CA 1BOAA 5K7HA 3J80K 5F47A 3D0SA 1RRJA 1X2NA 2CW8A 2KIFA 2NS0A 3CLQA 5DM7F 3GTPJ 2H27A 1K61A 3HYIA 1WPKA 2V1DA 1PP7U 1DP7P 4XNHC 2R7TA 1AUGA 1LKXA 3L1PA 3BG7A 3BR3A 5HS9A 3CCLI 2K4JA 3MMYB 3EO4A 2G0BA 3KHZA 4LLLA 4HW0A 3U9GA 1V5GA 3QPHA 3GTLJ 1VNDA 1Y7EA 2CW7A 2Q4ZA 2LH9A 2K86A 3DQVC 4V2GA 3VEPA 3G73A 1L0OC 3ABUA 2Q51A 5LYLA 3J80Z 3CP8A 1HDQA 2D4PA 5KTDA 1AKHA 5FKLA 4BE0A 3S14J 4HX7A 1U78A 5ILVA 5DD4A 3LSHA 2RC4A 3VYUB 2ELJA 2Y31A 1R71A 1Y9KA 1ETQA 3E1SA 4I2OA 3PJRA 1JJ6C 1ZLIA 2JVHA 4UCPA 2MSYA 1UJ8A 3BG5A 3OYMA 2Z99A 4PFPA 4IO9F 3Q0VA 5M5WJ 3S9LA 3DP7A 3QPLA 4GXOA 4CXFA 4FCYA 2BY2A 2KPMA 3HRSA 3TL4X 3LQRA 5DTDA 4JK1X 4UFXA 2XGXA 5E1WA 1TTYA 2K7LA 4ZTJA 2K9MA 1B8IA 1TNTA 4Y3OA 4IHXA 4MI4A 2L3DA 3H0DA 1XDUA 2VBYA 2VQYA 3ABLH 4KA4A 4C9YA 4U0VA 2PMHA 2R7WA 2CNMA 1BA5A 2BCOA 2DA2A 1LDJA 4KOVA 1LE8A 4PCQA 4ESBA 2CGPA 2NVTJ 2AFSA 3FHNA 2CV1A 2EIJH 4M6YA 5J6XA 2DTZA 3V7ZA 1BI1A 4MFKA 1XGOA 4C7IA 2LDUA 2OQGA 1QO0D 3ML6A 3V8KA 3PZJA 4B10A 4UIBA 2V8GA 1JUMA 3TO6A 3WTXC 1RTQA 3OYDA 1MJ9A 4RGRA 3KP4A 5IP9J 2O03A 4CGNA 5FGMA 3OIOA 1YIOA 3CXSA 2X4HA 3KZYA 2Y0MA 2ZEPA 4U5YA 1BJAA 7CPAA 4N9HA 3H8EA 1YITI 5JM6A 1YFHA 2VUMJ 3G1LA 4DJAA 2XAJA 4ZI6A 2KJBA 5EEGA 1FIAA 1O3RA 2WA0A 1ZG5A 3SZTA 4JYKA 3A01A 1MJAA 2CO5A 3I9V2 5J4YA 3GX4X 2ZEGA 1ZHFA 1LRZA 5D4RA 4FUUA 3DLAA 3RKQA 2LSOA 3T5XA 5EGOB 2PMZN 3WGHA 2YU3A 2PRBA 2B58A 1QBJA 4PJ0C 3BT9A 4U88A 4X8IA 5AG7A 1R22A 5AONA 2BOAA 3FXKA 1S7LA 5F04A 5AGEA 5TJJA 4EM1A 2WPXA 4XSXF 1QSOA 1IXSB 4DZPA 2QKMB 3CUOA 4IZZA 3ZQFA 3BI1A 1OMIA 4AC0A 3BPVA 1N25A 2QQ9A 5JHUA 3GTMJ 1BN5A 2NVYJ 1Z8LA 3JTKA 2Y9YA 4XRMA 5J4VA 3MRUA 3F6VA 4E6KG 1I1DA 3G8WA 3J7AO 3WU0A 3AFHA 4AXVA 4JLYA 4C2XA 3SJGA 3F22A 1H88C 2V6EA 1ZH5A 2Q43A 3L2QA 2EFNA 3D3SA 1A31A 2ZEEA 1IRXA 1ZQ3P 2CS3A 1WKMA 2OR4A 5C3EJ 4MO7A 1IUYA 3SHFA 4JXRA 3K0LA 3PEIA 3VWBA 1OJLA 1IOFA 1I50J 1U2WA 1MDMA 2DLLA 3K4MA 3QP5A 3FEEA 2VOPA 4DW6A 2VI6A 3SEZA 4I01A 2V9VA 3HIFA 4A3EJ 4WX9A 4EV0A 2XAFA 2OF7A 4EM2A 3REOA 5IYDJ 4PFOA 1CBXA 2QJ8A 3KQXA 4W9YA 4EMEA 3CQZJ 4XRSG 2CUJA 4II3A 1KA8A 3OYLA 2R8VA 2CF4A 3HRMA 2DOAA 2IQ6A 1Q1HA 4HX8A 2JVGA 3LSPA 2WC2A 4CDGA 1VQLI 1S5LC 4A94A 2NNYA 2OAZA 5E18F 3KPHA 2KP6A 5EG0A 2PE3A 2D2WA 2PIZA 1YW9A 3BJOA 3BWGA 4BHCA 1G4DA 4AG9A 4R3LA 1QNTA 5G1ZA 3BROA 4Z2YA 3HB9A 2FQ3A 2NS7A 1R4MB 2X1EA 4L9VA 4MFDA 3HLPA 3WT4A 2F6CA 5IT3A 4GRIA 1WI3A 2KZGA 1ZLKA 1V54H 1FZPB 1HCRA 1R7JA 2XGCA 4KZTA 4CRYB 1JKRC 4C30A 4LJZF 5F49A 1R1TA 5G21A 1RO5A 5HLGA 3SEQA 4EEFG 2ZFUA 3OS1A 2OBPA 2CMPA 5CVVA 4HX4A 3S15J 1TP4A 5IP6A 1M1EB 3BR2A 2WBMA 4MRIA 3B35A 3RAMA 2ZENA 5BMZA 1YTYA 3BTCA 2Z16A 2ISZA 3S1QJ 4FISA 2HDDA 2CNTA 4QPQA 3WHBA 1P7IA 2DDAA 2DFFA 4KMFA 1CQTA 2EH3A 2L7FP 2LG4A 2M0CA 1K6OA 2CFXA 4M9XA 3BJAA 5K8PA 2L9SA 2P5VA 3N05A 2YUSA 3A03A 3JRAA 1DU0A 2B4BA 3TDUC 2YR2A 5J1UA 3FISA 2LKSA 2O9LA 1G6NA 2AFXA 3GO5A 2RDPA 3LSIA 4JYWA 4Z65A 1LVAA 2JWTA 3W2VA 1BR4A 3ABKH 3GFJA 2IS4A 2Z3NA 3KKWA 4P4BA 2JUGA 2ECBA 1VQ9I 2FRHA 2COMA 5E1ZB 2OD5A 4KSIA 4OMEA 1XB4A 1WK4A 1ONVA 1LJ9A 1KQ9A 3CUQA 2R7QA 5BQTA 3CCYA 4CCNA 3AG2H 2NVUB 2Q2EA 1X4OA 2GXGA 3V8JA 4UVAA 1WQ2A 5F6FA 1O3TA 2O28A 4BU2A 4LK1F 3ZQIA 4FTHA 3OSGA 1W36D 3N7ZA 4LQ6A 1UELB 2TCTA 3K4LA 2NVQJ 3SI2A 4G7OF 3DSBA 3F72A 5LGTA 3AL0C 3P2HA 5D5VB 4Q5SF 2HKXA 3BZCA 4AU7A 2NYQA 4CGZA 3ERMA 3NFZA 4JWPA 2VE9A 5JPHA 4B8XA 4OC2A 3VODA 3D7DA 4KT5C 2R7RA 2CV2A 1QSMA 3HKZN 2V9KA 3GFLA 2P6TA 2M7BA 1R6RA 1TL8A 4ZYGA 1VQ7I 4ZC3A 4X0GA 4UVBA 5FROA 2LOOA 4EJOA 1A36A 2IA1A 4E7JA 4KUAA 5L3CA 3F6OA 2MABA 1J7KA 3L2CA 1Y1WJ 1KGSA 4CH7A 3VPRA 3E6BA 4P5OA 4U0WA 2JT1A 4HNWB 4YRHA 3EY5A 2FT0A 2VXKA 2OTLI 1FEXA 5F09A 4E2AA 1M44A 2HVQA 3DEWA 3K4BA 4LIUA 1XC5A 2XPVA 1OCOH 4ZDLA 3JRFA 1AYEA 2WYRA 3GW2A 2EIMH 1I6HJ 4PXDA 1ZAOA 2FF4A 1IICA 1UB9A 2EBJA 3K1MA 2VB6A 3G6EI 2P4WA 3KR5A 1IDYA 3W6XA 2Z9OA 3R95A 4IL6C 2VT3A 2PJAA 1FOXA 1BR2A 3CMEI 1HEEA 3Q0WA 3QYFA 4GCVA 3OOPA 3W91A 4R79A 3C2BA 4YEJA 3EPZA 5DCMA 5HNHA 3IKVA 5J8CA 4R1HA 4C3HJ 2EWNA 1IF1A 1VIXA 3IJ3A 4A3GJ 1B9NA 3N97A 3JRBA 2WWYA 1VQ4I 2VI7A 5IOZA 1R5HA 2XKOA 2VJJA 4IF4A 4NC6A 1T56A 1HF0A 2XEJA 3M8EA 2L01A 5TGTA 5DCFA 3I4MJ 3MQ0A 4B48A 1ZRFA 2W00A 4OKOA 3HGYA 3OWTA 5EEHA 2RREA 2O53A 4WXCA 4A0YA 3BCAA 2XGDA 3KP2A 1YREA 1J75A 4CYDA 2QSGX 1JUSA 4BXUA 1Z67A 1VFCA 2BHZA 1I12A 2PJCA 3KYDB 3KP3A 2GM4A 1FT7A 3CZXA 1JKPC 4A12A 3CD6I 4IHMA 2OB0A 2QYVA 5A2QK 3LNQA 5GAGJ 1X12A 3G2BA 4BE1A 3FXOA 1IV8A 5IT9K 1U5TB 4EATA 2ID3A 3FECA 3V38A 2XIGA 2WY8Q 2LFBA 5IYBJ 2DU9A 4BHBA 2F7VA 4R8HA 2I3CA 4LITA 3GZ5A 3QQAA 5L3GA 3D67A 4HNXB 2P81A 2Q1ZB 5DS0A 1XGMA 2CG4A 2QVPA 2H6CA 1P92A 1Z05A 2NMTA 4A2ZA 4E8OA 2J8NA 5ISVA 1TLHB 2W1OA 5A2QZ 4II9A 2VBZA 2W25A 4GYIA 3LSTA 5J3LA 3BJ8A 5H20A 2R7UA 5IT9Z 4R8FA 4EQQA 3BQZA 1YRNA 1UHWA 2M34A 2XDVA 3SDBA 4AYBN 2ESNA 4WCGA 3J7AY 4B11A 5M3FJ 5HS8A 4WJBA 1G2HA 4E7SA 3BC8A 4S04A 3H8FA 2E34A 3ISPA 2Q4VA 3SXYA 1T6SA 2LR8A 4A3CJ 2REEA 3KLOA 1CJWA 4PQAA 3ONQA 5BPDA 3TP0A 3IO1A 3D2MA 2M8GX 4K3NA 2JTVA 1KUYA 4G7HF 1JTXA 2PFBA 3FIXA 1FMWA 4MIMA 3HBLA 3C1DA 3KZIC 3S3MA 1MMDA 4AD9A 1YW7A 3PNTA 2PVVA 3K2KA 2RAEA 4CYOA 3KQZA 2X6YA 1YHQI 4ZGYB 3CJQB 4O3MA 3FXUA 2AXTC 5D8NA 4UIAA 4LGWA 4BQQA 4V19K 3F8FA 2WB1A 1R49A 3H0GJ 3OR2C 3C26A 1I1SA 2FE3A 2EK5A 2R7SA 4RB3C 3EXNA 2KL4A 3ZMZA 2UZKA 2V9PA 4PV6A 2DMQA 3M9AA 1O3SA 4HAMA 2K3PA 5KTCA 3OYAA 5DD8A 4BINA 5K5RA 5LYFA 4F91B 2X1CA 2XAGA 2VN2A 3QU3A 4CO8A 3SXOA 1XEBA 2CU7A 3ZMUA 2KIMA 4M6VA 3HDDA 2KFDA 4JP0A 2DT5A 4N0BA 4DNCA 4ZYQA 4HG2A 2BY0A 1Z3YA 2MW8A 4ASNA 4NGPA 2JPCA 4HPSA 1Y0NA 2DFIA 3I71A 2E5ZA 1XPXA 4RGSA 2OZGA 4L8AA 1SD6A 3R9EA 3K4JA 2W85A 1VF9A 1K6YA 4S0HB 3OYNA 4CAFA 1P6RA 3HOUJ 2AHQA 2WADA 3PGPA 3G1MA 4ZDPA 1YW6A 3K4NA 3CMYA 2I79A 2QZ8A 3V8LA 4QSHA 2L7ZA 1GV2A 3MN2A 4IF5A 1Z6RA 3ZR8X 1QA6A 3BTIA 4MCQA 4O23A 4QB9A 2F5EA 1BPMA 2VJ5A 4N4NB 3KR4A 4PPZA 2IGOA 2EBIA 5ERIA 2ZSHB 5FFZA 2CUFA 4X3RA 2LP0A 1GLNA 2XPUA 1PDNC 4WWCA 3DKXA 3E5QA 3P9CA 5IYCJ 2OTJI 1FOYA 3P7NA 5I0CA 3A01B 1VHOA 3BTLA 1OYWA 4M9SA 2HEOA 2BUEA 4H6UA 1EJ9A 1S7FA 2PJ9A 1XX5A 3C3WA 5IOYA 4A6DA 2DN0A 4IHSA 2AFUA 2E2IJ 1MKMA 1O57A 1UHSA 3OSFA 2ZNYA 2F2EA 3MZ8A 4FHTA 5BOXA 2HR3A 4KYWA 2JK3A 1ZARA 2EZHA 4CZCA 3IGRA 1FBSA 2ADUA 4DGWB 2C1CA 4L5EA 1OQYA 1F36A 1KYZA 2FMLA 2OC6A 3A4CA 1U8BA 3M4OJ 1QGPA 2Y0SN 5C88A 5JQ4A 2I10A 4XBFA 3IRRA 2R0QC 3PBEA 4A3FJ 2FNAA 2ZOGA 4H4KC 4ZTFA 1QRYA 2B5GB 2PDOA 2UUZA 3L2UA 2Z3LA 3PUFA 4LG0A 2PJ5A 3LMSA 1MSFC 1ETKA 2JLMA 1XS9A 4ONWA 3WC7A 4GO1A 1ZR4A 1FX7A 5GADJ 5B1BH 3HOXJ 1MD0A 3K69A 1QVUA 4NB5A 2FVGA 2KIUA 1ORKA 5TRDA 3UR3C 1IN6A 2KZVA 3LA3A 4CHUA 3BQYA 1DQUA 3KP6A 3ASNH 4KITB 2WPWA 4KLVA 4DOZA 1O7LA 4P1WA 1HQCA 2FBIA 2HOEA 2JZYA 2V1NA 1YLFA 3B6CA 4I7HA 3WABA 2R7FA 4UB8C 2HXOA 3OWCA 4AIDA 4A38A 1WH7A 4A3MJ 1MDMB 1ETYA 3GTJJ 3JRCA 2LBFB 3N5FA 2A6TA 3RKYA 2TDXA 2W48A 3VB2A 1E0EA 4CPAA 3OYKA 2BW3A 3D68A 3DGVA 2M45A 1VGYA 3OYHA 4MQVA 4XPDC 1WCMJ 4U87A 5CVRA 3WTVC 5DUKA 5C44J 5HDGA 2AJ6A 1ULYA 4F9UA 2BHYA 4HPQA 2DOEA 1Z3XA 2L7KA 5D5UB 3OOUA 2EFWA 1UWYA 5LRRA 4QUSA 1TWHJ 2VE8A 1M4DA 4G94A 2DPSA 1ZGAA 4ZY0A 4OP4A 2YX4A 3I59A 2W24A 2DMPA 1NE9A 4NUBA 4MFZA 1VI0A 1LNWA 2Z5UA 2FSRA 3T8RA 2GIVA 2E35A 2ZMEB 4ZYDA 1H9GA 3AG3H 3LODA 2JA5J 4WXHA 3G4SI 2HPMA 3QOEA 4PSXA 4IHVA 4A37A 5FO5A 3BP8A 3FXRA 2HYGD 4PUSA 2HXIA 3BLYA 4E4HA 1BC8C 1WWZA 3ZRGA 2IAIA 1X2MA 5CYVA 4P9UA 1FJLA 1GDTA 2G9WA 1R00A 3FMRA 1NK3P 4OC5A 4OC4A 2ZFWA 5HVFA 3WC6A 2M9HA 1EF4A 3L00A 3R4KA 4OIPF 2YU9J 1DPUA 1E3PA 3TOBA 3G71I 2M4KA 2C6CA 4CCKA 2V8HA 3GIUA 1X3ZB 5HH1A 4B6ZA 1Z9UA 1PYTB 2EA2A 1IG7A 4UUVA 2Y75A 3RYPA 3NEUA 4IOCF 4A3BJ 4RAYA 2H94A 5IB0A 3EETA 1XRYA 1SVOA 5HLIA 4MTDA 3ROUA 3WTSC 4B43A 2HWVA 4BHPA 2B4DB 3PFYA 3W2AA 1RKTA 4ENJA 1K4JA 1VQPI 2A69F 4BAYA 5GPCA 3ZQCA 1ZREA 1ETWA 2V79A 1LQ1A 2HQNA 1W5CC 3S2WA 1J2XA 3KLNA 1IY7A 3OV8A 3G3SA 4MHYA 3J7YJ 2MC4A 4PJMA 1QHHD 1XCVA 2HFHA 3CUQB 1MMGA 2R4GA 2PJ2A 1YSJA 3W6KB 2G9DA 1YR0A 1TKHA 4C68A 5CPRB 4OMYA 2A4NA 5LD2C 1T08B 2YNEA 3O8HA 1LDDA 1V0CA 2R5ZB 2OH1A 4PSWA 3LSMA 3AG1H 5KTAA 4FQGA 3L2WA 5LEJA 3PB7X 4DJLA 2IXSA 1OYIA 2I8DA 2X51A 2WV0A 3R9FA 2DTRA 2L4MA 2K9QA 3PNYA 3PRTA 2PJBA 1MH3A 4E7HA 1BI0A 2P7CB 3CPXA 1XSVA 3TKYA 5K8MA 1Z2LA 2KRCA 2WAQA 1NK2P 1FSHA 2C6PA 3HOSA 1T39A 1ERDA 2YNDA 1S8NA 3CF2A 1V5EA 2VQCA 5HLHA 3KETA 4EVYA 1I39A 1IOIA 4R76A 3J81Z 3GTGJ 4Y17A 2IJLA 4RI1A 3HXLA 3MN8A 4UUSB 1IC8A 4QPOA 1ZRCA 4C2ZA 2GOXB 2IBDA 4KMUX 3VWEA 2BY1A 2QQBA 3TT2A 4D0PA 3JCUC 4QVTA 4UFVA 3SJMA 5E8GA 3EYYA 3OYBA 5J1RA 1TXRA 1Z4RA 3IWEA 1RNLA 4OIOF 4NCZA 4XN0A 3FXMA 2JQ7A 1WH5A 2FL4A 4Y49C 3I55I 2BEIA 2FQ4A 2P8TA 1IN7A 3ZQHA 1IV6A 3SJEA 5D8LB 2ZJQF 2PN6A 1JXSA 1XBUA 1FOKA 4KOUA 1Z4EA 2MH2A 2G0EA 4HNYB 2F8HA 1IGBA 4L89A 3I5UA 2JJ7A 2BYVE 5G20A 3RTRA 1A35A 1Z5RA 3TO7A 4Q4ZF 3FB3A 4RAZA 2VLAA 1TKJA 2R5YA 2ZEMA 1V5FA 3HUGB 2F4MB 5DV5A 3MKLA 2B9SA 4FD4A 3FEDA 2PJRA 3H9GA 3CCUI 4ORFA 4C3JJ 2LVSA 3S9MA 1APLC 2XASA 1KZFA 2GLFA 4ON0A 9ANTA 3WG7H 2ZXWH 4RDUA 4FETA 2FS5A 1A6IA 1HLVA 4BBHA 4CAXA 1VQ6I 3DDDA 4CCLA 4I02A 4ESJA 3TCVA 4M3GA 1X1PA 2QUFA 5F1RA 2DBBA 3TBIA 4V2FA 3MD2A 4XLHA 1NSLA 4RB2C 3LWFA 1LAMA 4AUXA 1ZLJA 4WF2A 4DYCA 3RQIA 1ZGJA 1LPQA 4KN4X 4XOTA 4IHYA 2OJED 2XV4S 4CUGA 4ITVA 5JHFA 3HRTA 2M7AA 2V1XA 3I64A 1FYLA 1U8RA 4ZX9A 2Z3YA 1P7JA 3QAHA 1Y0YA 1FIPA 1VZ0A 4XOPA 1PP8F 3E0JB 4MY0A 4CYQA 3KIOA 2V26A 4YU9A 5LRGA 5B3SH 1NHAA 3DF8A 4XLPF 1EH6A 2XGEA 2O61A 4F8ZA 4CSWA 4I0BA 3JREA 1K4SA 2VBQA 5HVHA 1B1BA 2R1IA 4XNHB 3ZMDA 4II2A 2P5KA 1U0JA 1AMPA 2XEFA 2QBYA 4UNOA 4FWUA 3E97A 1H89C 1Z91A 2UWMA 4BBRJ 3ZQLA 3JVNA 2LNBA 3L09A 2UXNA 3LA2A 2E36A 3F23A 4CYCA 1LVKA 2QF7A 1ZR2A 5LBQA 2GAUA 1DE4C 4LMYA 1GVDA 3B02A 1TT0A 4IJAA 1YX0A 3MVPA 4BD9A 4BMHA 2OCEA 4MTEA 1PUFB 4B1RA 2ELKA 4A3LJ 4R7MA 2HDWA 1ZG7A 2DJIA 2RB7A 1ARMA 4UV9A 2NSMA 3HPGA 2X48A 2NNNA 3B3VA 3ECOA 1UMQA 3TP3A 1YMEA 3P9KA 4NJQA 2BEOA 2L2OA 3HTUA 1W7PB 4U0YA 2A61A 4PJJA 2IA0A 4IOAF 3CF5F 1BC7C 2HC9A 3DTKA 4XLCA 1HBXG 2HDCA 3GLLA 1LEAA 3BR0A 4NXYA 3UY5A 3CJRB 2ZJPF 3D5LA 5J8FA 1RXTA 2LKPA 3PB6X 1T95A 4Q7AA 1YI2I 2KIQA 1BBYA 2EIKH 4LFUA 3ECHA 2PQ8A 1UG2A 3JRGA 2PC1A 4P96A 2FX0A 5FFXA 3ZQ7A 1FWZA 2Z3OA 3RPUD 4R87A 3I0TA 2X85A 5EYRA 1X4PA 1DGRM 2WY7Q 4HBLA 4HDUA 1YYVA 1G59A 1QSRA 1X10A 4FX4A 5ICFA 1CF7B 3D7HA 3LWUA 1S7KA 1UCRA 5GTIC 5KCMA 4BQOA 3HOZJ 3M07A 2COBA 2JMWA 4Y7NJ 4A32A 3HHHA 3BG6A 5LHIA 2L54A 1FLIA 3H3UA 4PK4A 4XKBA 2EILH 2R7ZJ 1HSJA 1B6BA 2JEWA 3JTHA 3MKWB 2KISA 4NQWA 4IX7A 4A3JJ 4L5JA 2STWA 4I0AA 4GFBA 2F5CA 2IVMA 4NC7A 5B1AH 2O0YA 4F93B 1JT0A 4UWIA 2VKEA 1G3WA 2DK8A 5GAHJ 3R0JA 3WE3A 1GT0C 2Y2ZA 3D2PA 2PLYA 4HF1A 2X9DA 4UEFA 2FUG2 4CCJA 1L3LA 1OCTC 3IU1A 3DPUA 3V7CA 1P4XA 1JT6A 4G8XA 4ZH4F 3VARA 2EFOA 2P6FA 2AFWA 2CIJA 2QENA 1B9MA 5E79C 3SI0A 4AVAA 4HNTA 4UCMA 1VQ5I 2IS6A 5FKKA 4GXHA 5CPAA 1JQGA 2G7HA 1BOBA 3R9GA 1YS7A 1ZG8A 5H84A 2GLJA 3EFAA 3CDIA 4BJ5C 2EK9A 1HKTA 3E6DA 1OYYA 1RUOA 2VONA 1EKEA 2GBYA 3NH8A 4XNFA 1X1CA 2M8EA 4CYPA 4IK2A 3RQ4A 1FOWA 1AA7A 2LC2A 5D5WB 4J00A 4M85A 3K70D 3FXTA 4PXBA 2I5UA 3LA7A 3H3VK 3T8WA 4I98B 2M30A 2M4GA 5E96A 3WTWC 4N4OB 4BGDA 3WG9A 4RGXA 4Y4RA 3C2GA 4KN7X 4RBOA 1ITYA 2ZOFA 4MXUA 3CPAA 2NYXA 1CX8A 3S1MJ 3PSIA 1LFWA 1YQAA 3F8MA 4PXCA 4A2UA 3BG3A 5HNFA 3CXPA 4MHZA 4LG0B 3PUBA 3MAJA 3SJFA 2W84A
chains in the Genus database with same CATH topology
2Z3KA 3T9YA 1KUYA 3VSLA 2YNCA 1IB1E 3FIXA 1FMWA 3F0AA 2A5WA 4R9MA 3S3MA 3K4CA 4XKVA 1MMDA 2HVRA 4JJXA 3PNTA 3F5BA 3S6GA 4CYOA 4ZGYB 2X6YA 2HUZA 3L2RA 3CJQB 1YK3A 4KS9A 4BQQA 3NE7A 2O5RA 1WJCA 4BQNA 4UCNA 2WB1A 4HNUA 3OR2C 4BJTA 3TFYA 3C26A 4OWRB 4QBJA 2R7SA 2YGWA 4FASD 4BDYA 3HL2A 2KL4A 3EXNA 4OADA 4PV6A 2WUUA 3LD2A 4B5PA 5AG4A 3I3GA 4Y49B 1HA8A 2K3PA 3HC7A 3ZXSA 3VYRB 4I49A 3OIQA 3S6HA 2QIRA 3OYAA 3IAS2 5KTCA 5BWAB 4DBQA 2Z11A 4F91B 1D1BA 2X1CA 1D1CA 3SXOA 1XEBA 2JDCA 2Q0YA 3BCBA 3IWGA 3PP9A 2WSAA 4J3GA 2Z2SB 4KORA 2G3AA 4CRZB 4DNCA 3LL7A 4HG2A 2KDOA 4KOSA 2FCKA 1Z3YA 2UV1A 5CNPA 1WFXA 5ISVA 4XL9A 2OZGA 2E5ZA 4L8AA 3R9EA 2CXAA 3K4JA 5CQGA 1SFKA 4XPDB 2E1MB 4OLLA 5F46A 4NSQA 2BOLA 2V7FA 2XF6A 1K6YA 3T90A 4F52A 3DPTA 3OYNA 3OYIA 4FD6A 2WADA 3PGPA 4CAFA 4CAVA 3PL8A 4ZDPA 3KEYA 2ZW6A 3ZZIA 3K4NA 4F0YA 4RMNA 3V42A 1D0ZA 3FBNB 2I79A 1DGWY 1L0CA 5H86A 4AVBA 1XMTA 4H6ZA 4OAEA 4BXFA 3DWLE 1JI8A 2B5GA 3D5RC 2REFA 1Y56A 3ZR8X 2VZYA 1LFPA 3DKYA 1X1BA 3IU2A 3H5AA 4QB9A 2VJ5A 4N4NB 5HLTA 2IGOA 4B5PB 4LIVA 2VJIA 2HQYA 1VKCA 1MJBA 2ZSHB 2ZW4A 4UWJA 4AVCA 3FNCA 1CM0A 4JOMA 1GLNA 3MGDA 5KTAA 3AKZA 3DKXA 4BEHB 2HPIA 4C2UA 5I0CA 5A28A 2ZXHA 4CAEA 1S5KA 5FRNA 2QKLB 2BUEA 1YX5A 3FDYA 3QODA 5KNLA 4H6UA 4MBUA 1S7FA 2CNSA 1WJDA 4CGOA 3FRMA 5IX3A 2XAUA 1X1DA 4KSAA 2F5VA 3FBUA 2VXDA 2OZUA 3IUOA 3SZGA 4CZCA 3IGRA 2W7NA 1BR1A 5GCNA 2H5MA 4JD6A 4DGWB 2HVSA 4ZBGA 3TTHA 2OC6A 4C2TA 2LBFA 3K6GA 3VYTB 3GYAA 2NOJB 3A4CA 3EUKL 3OYJA 3A2KA 1M4GA 4GS4A 4UBRA 3UNGC 3AL0B 3S6FA 5C88A 1GHEA 5JQ4A 1N78A 3EUHC 2K5CA 5F47A 4A31A 1OLTA 4B47A 1Q2CA 2CW8A 3K4KA 4J01A 4H4KC 4XMYA 4ZTFA 2ZXVA 5CKTA 2ATRA 2B5GB 2PDOA 2UUZA 3L2UA 2Z3LA 1LDKB 4XNHC 4F92B 2R7TA 3W2WA 1LKXA 2Q04A 3CMMA 3BG7A 2F4IA 3OIPA 4XONA 2JLMA 3MMYB 3RCOA 4MLOA 3EO4A 2G0BA 1IYKA 2D4OA 4DBRA 1V5GA 3SXNA 3V8IA 2CW7A 2JEVA 2LH9A 3DQVC 3DTIA 5DWMA 3SYTA 1WJAA 3UR3C 2KZVA 2IL4A 2MD0A 1J09A 1DQUA 2XC7A 2WPWA 3CP8A 4KITB 2D4PA 3DPLC 4DOZA 1UAAA 1TIQA 4KLVA 5KTDA 4BE0A 4F0XA 4P1WA 4Y33A 3GKRA 2V1NA 3LSHA 2Q4YA 3VYUB 2J8MA 2ELJA 2RC4A 4XORA 1Y9KA 4B14A 3OWCA 3E1SA 3NWTA 4RLFA 3LMMA 2R98A 3PJRA 2JVHA 2LBFB 4UCPA 3PNVA 1XIXA 1Q2DA 2A6TA 3OYMA 3HPHA 4PFPA 3ZQQA 4MFLA 1E0EA 4B12A 3S93A 3OYKA 2BW3A 3TO9A 2KPMA 4A33A 3OYHA 3TL4X 4UFXA 4XPDC 4U87A 3OMYA 2K5TA 4MFJA 4ZTJA 2K9MA 2AJ6A 1YVOA 1BO4A 2P6EA 4Y3OA 2AQEA 4HPQA 4UA3A 2R7VA 1Z3XA 2L7KA 4OAYA 3OOUA 2LYCA 4ZYAA 4CCMA 4U7BA 3H0DA 3S3OA 2VQYA 3OYFA 4JXQA 4C9YA 4XLEA 1M4DA 4QUSA 4XKCA 3FBIB 2R7WA 2CNMA 2DPSA 2ZPAA 4CYNA 2JA2A 2B4DA 4KOVA 1NE9A 4NUBA 2PMZA 2BVLA 4MFZA 3FHNA 2CV1A 4KJZA 2FSRA 3EC4A 1D0XA 2GIVA 4MFKA 4C7IA 3LODA 4B13A 2HPMA 3QOEA 4PSXA 2BSWA 3PZJA 1P0HA 4PUSA 4B10A 1Y6IA 3BLYA 4E4HA 3TO6A 1UG0A 3OYDA 2LREA 1MJ9A 3ZRGA 1WWZA 1WJFA 3GBGA 1D0YA 4F3QA 4IUSA 4CGNA 4IKFA 3CXSA 2J8RA 1WJEA 2Y0MA 5DWNA 4U5YA 2CUZA 3HKZA 5HOOA 2KMUA 1YGHA 4IF5A 3R1KA 3DNSA 3H9QA 4DJAA 2F5IA 2QMLA 4MI4A 4BEHA 4CA0A 3TOBA 5KHDA 2M4KA 2WA0A 4CCKA 2BW3B 1MNDA 3RSNA 3I9V2 1MMAA 1MJAA 5HH1A 4B44A 2JDDA 2VZZA 1Z9UA 2VKDA 1LRZA 2PR1A 3S3NA 3DLAA 3VYSB 3S6KA 2PRBA 4X5KA 3R9GA 2B58A 1R57A 5IB0A 4PK2A 5AG7A 1DP3A 5G22A 4B43A 2B4DB 4DIQA 2Z3PA 3PFYA 2X7BA 3W2AA 1S7LA 2RQQA 1K4JA 2FIWA 4BDZA 5AG5A 1X19A 4CS0B 1IIDA 5FVJA 5AGEA 2WPXA 2DXIA 2VEZA 1G8XA 1QSOA 2V4JC 4XPLA 2E5NA 2Q7BA 2QKMB 4E0AA 4IZZA 1OR7C 4NEXA 3TE4A 3JUWA 3G3SA 4B5OA 3H5ZA 2K9LA 2MC4A 4PJMA 1QHHD 1QSTA 4XM3A 1MMGA 2X1DA 2R4GA 3JTKA 1WJ5A 1VHSA 4UFWA 3K9UA 4E6KG 1I1DA 1YR0A 3G8WA 1S3ZA 4C68A 3AFHA 5CPRB 2A4NA 3K10A 4NNJA 5LD2C 2YNEA 4JLYA 4YRVA 4KOYA 4C2XA 4XR6A 1V0CA 2OH1A 3IP4B 4PSWA 3LSMA 4XQFA 2V6EA 5LFAA 2CY2A 3L2QA 3L2WA 1ON0A 2GOMA 3GY9A 3D3SA 2IXSA 2I8DA 2R7OA 2X51A 1IRXA 3R9FA 2CS3A 4KVOE 3PNYA 1EA3A 4JXRA 4E7HA 3LSGA 3PSFA 3VWBA 3ZGKA 3OYGA 1I21A 1PUAA 2KRCA 3OY9A 2WAQA 3K4MA 3LSKA 1ZELA 3HOSA 1N77A 3B8GA 1Z21A 1ERDA 3SEZA 2YNDA 2KRHA 4F55A 3D8PA 4PK3A 2ZXIA 3CF2A 1V5EA 2VQCA 4EVYA 5EC4A 4BUPA 4PFOA 2HV2A 2X6XA 2VPLA 3CESA 3HXLA 4RI1A 2CUJA 4II3A 4F6AA 3OYLA 4QPOA 4C2ZA 2R8VA 2GOXB 4U9YA 2DOAA 1S9HA 3VWEA 1YX3A 2OV7A 2JVGA 1U6MA 2OZHA 1N75A 4LG3A 1P9QC 4A30A 2VIXA 4D1QA 3TT2A 4FD7A 3KX2A 2KLOA 3BLNA 4QVTA 1NG7A 4UFVA 2KP6A 4ZDOA 4YFJA 1SQHA 2VQHA 2EVNA 4AG9A 2E60A 3OYBA 3RYOA 4KOXA 4R3LA 1Z4RA 5G1ZA 2HZDA 3K70C 2OU2A 2X1EA 3IWEA 2FXFA 4NCZA 4XN0A 4AVZA 1OZPA 2Z0ZA 2F6CA 2OUMA 4GRIA 2FL4A 3DR8A 4Y49C 2BEIA 4CGLA 4KOTA 4KZTA 3OR1C 4CRYB 4E7ZA 4C30A 4QC6A 3MKYB 5F49A 4KOUA 4M3SA 1Z4EA 5G21A 1RO5A 4HNYB 3SEQA 4YELA 1MNEA 2ZFUA 3OS1A 1M1DA 4L89A 1MK4A 2DCEA 2CMPA 2IS2A 1PYVA 2B3UA 5G20A 3TMOA 3RTRA 3TO7A 3FB3A 4CAWA 2VLAA 2WBMA 3M8JA 4A95A 2ARHA 1V5FA 3HUGB 3S8PA 2CNTA 4CGPA 2Z16A 4FD4A 2PJRA 3H9GA 4QPQA 2YNCC 4RLQA 1ZO0A 4ORFA 2XF7A 2E1MC 2IGMA 1KZFA 2LG4A 2L9SA 4FETA 3NWSA 3N05A 4HRIA 2BL1A 2DXQA 2FS5A 3C2HA 2BVMA 1MMNA 2IGNA 3BJ7A 3DDDA 5EBVA 2KQRA 2FIAA 4BBHA 4CAXA 4CCLA 2B4BA 3CXQA 4XLFA 1YLEA 3TCVA 2LRDA 4RM2A 3TBIA 3LSIA 3MD2A 4XLHA 4LUAA 4H89A 1NSLA 3W2VA 1BR4A 2IS4A 2Z3NA 4HSRA 3KKWA 4BS9A 2JUGA 4XOTA 1Y9WA 4KT6A 4CUGA 2VL8A 2M0MA 4HEA2 4ITVA 5JHFA 2M7AA 1WK4A 3E0KA 2IGKA 2VASA 2KCWA 3R96A 4IQJA 1FY7A 2R7QA 3QAHA 4CCNA 2FE7A 4MHDA 4ONUA 1VZ0A 4XOPA 1X4OA 3E0JB 4MY0A 4CYQA 2O28A 2V26A 3DTEA 3DU6A 4BU2A 4HSTA 3TOAA 4G6TB 1W36D 4CSWA 2HNHA 4E7IA 3CZ6A 2Z1DA 3SHPA 2PJRB 1KUVA 3N7ZA 2VBQA 1UELB 2DT6A 2WAEA 2I00A 5AG6A 2L9NA 2ZW7A 3K4LA 2R1IA 4XNHB 3DSBA 4II2A 5C82A 1U0JA 2GE3A 1QU3A 3AL0C 1M4IA 3F8KA 2PSWA 3P2HA 4KVXA 3H4QA 3QYEA 2MYSA 4AU7A 4FD5A 2UWMA 3JVNA 1D1AA 4MFPA 4NF1A 3DR6A 5A27A 4JWPA 5JPHA 3H5NA 3P2FA 1LVKA 4HKFA 1YVKA 1XF8A 3QB8A 5FRMA 2R7RA 4ANJA 4BJ6C 2CV2A 1QSMA 1Q2YA 2V9KA 2M7BA 1R6RA 1TT0A 1YX0A 2MFZA 4ZC3A 4X0GA 5FROA 2LOOA 4BMHA 3OYCA 4E7JA 4KUAA 1J4JA 3H5RA 2MABA 4BACA 4YGOA 3CP2A 2HDWA 4PJNA 2DJIA 4B3XA 4CH7A 2Q2EB 2LY1A 3KYLA 3S32A 4P5OA 4C7HA 3HPGA 4CGMA 4BE2A 4HNWB 4YRHA 3EY5A 2FT0A 2P0WA 2VXZA 4XLAA 3L2VA 2PR8A 2VXKA 3A9LA 4R3KA 3EUAA 4D9JA 2AE6A 2LY2A 2L2OA 3IAM2 1M44A 4E2AA 2HVQA 3K4BA 1T0FC 3OL3A 4LIUA 4PJJA 2M3AA 4ZDLA 3VDXA 1N71A 2HQAA 1XE4A 1Z7LA 3DTKA 4XLCA 3OS2A 3UY5A 3H9JA 4NXYA 1IICA 1QHGA 3CJRB 3D5LA 1RXTA 2GANA 5J8FA 2W4SA 2VB6A 1T95A 2RNGA 3W6XA 4KISA 1KONA 4XPKA 4KSFA 3R95A 2Y0SA 1BR2A 3LFUA 2PQ8A 2PC1A 2WAFA 3QYFA 3W91A 4AG7A 3M1CA 4R79A 2P6GA 4R57A 4YEJA 3EPZA 1IYLA 5HNHA 2Z3OA 3RPUD 4R87A 2VQLA 2X85A 3OL4A 1X4PA 1DGRM 2WY7Q 1QSRA 2Q44A 4MJ8A 1G59A 5J8CA 2DPTA 2W82A 1S7NA 4AB7A 2VI7A 4KLWA 1Y7RA 3HOTA 1X1AA 2CFOA 2VJJA 3W3CA 1S7KA 4IQ4A 5KCMA 4BQOA 1NG6A 1FMVA 4E7KA 4A32A 2XF5A 1QSNA 3BG6A 5TGTA 4PK4A 2XSJC 4XKBA 3VSKA 1WJBA 2W00A 4JQFA 2VQGA 4B48A 1P4NA 1B6BA 3OWTA 3MKWB 4U9ZA 2RREA 4PJLA 5HVQC 2Z10A 3BCAA 3DU5A 4IX7A 1YREA 5E96A 4NC7A 1SAUA 1I12A 2Z3MA 1NMTA 3I9SA 4F93B 1PJRA 2KHMA 1MW7A 4Q38A 4XN3A 2VJ4A 2R7XA 2OB0A 4UWIA 3VWDA 5IV0A 1UFHA 2IS1A 1S60A 3DEEA 3MKZA 3OS0A 2ZW5A 4AYBA 2L5QA 3D2PA 4MFQA 2DT7B 3ZJ0A 2FUG2 3G2BA 4BE1A 4CCJA 2CV0A 3IU1A 5H84A 3DPUA 2G3TA 4EATA 2P6FA 2VKHA 4CCOA 2WY8Q 4AVAA 3HG9A 4OAZA 4HNTA 4UCMA 4LITA 2IS6A 2ZSIB 4ZJZA 1KUXA 3FKJA 1BOBA 2HU9A 4RM3A 1B87A 2X6WA 4HNXB 3D5SC 4LX9A 2Q1ZB 3EFAA 3A1YA 2JSPA 4BJ5C 3OYEA 2C27A 4MY3A 2EUIA 4E7LA 2NMTA 3FYNA 4A2ZA 4E8OA 2AQFA 1X1CA 4XNFA 4CYPA 4XKWA 3RQ4A 1AA7A 1TZLA 2CH0A 2LC2A 4J00A 3ZCOA 2B3VA 2J8NA 3K70D 4KOWA 3FXTA 2W1OA 4KUBA 4M85A 4RS2A 5F48A 4II9A 3BJ8A 3W6SA 4K30A 2R7UA 4NQWB 2M4GA 3I3LA 3QYBA 3J7AY 2XDVA 3SDBA 4BL0B 4N4OB 4BGDA 4B11A 4Y4RA 4E7SA 3BC8A 5CQEA 3C2GA 2R7HA 4NC8A 2Q4VA 3WR7A 3PSIA 1PU9A 2REEA 3U21A 1CJWA 4Q36A 5HNFA 1W36C 3CXPA 3ONQA 4C2YA 1YE9A 3H35A 4KVME 5HMNA 3F9KA 3PUBA 2QECA 3D2MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3T9Y A;  1KUY A;  3FIX A;  1IB1 E;  3F0A A;  4R9M A;  4JJX A;  3F5B A;  2HUZ A;  1YK3 A;  3NE7 A;  3TFY A;  3C26 A;  4QBJ A;  3EXN A;  4OAD A;  4PV6 A;  3LD2 A;  4B5P A;  3I3G A;  4Y49 B;  3S6H A;  4I49 A;  2QIR A;  5KTC A;  2Z11 A;  3SXO A;  1XEB A;  2JDC A;  2Q0Y A;  3IWG A;  3PP9 A;  4J3G A;  4KOR A;  2G3A A;  4CRZ B;  4DNC A;  4KOS A;  2FCK A;  5CNP A;  2OZG A;  4L8A A;  3R9E A;  4XPD B;  4OLL A;  5F46 A;  4NSQ A;  3T90 A;  4FD6 A;  3PGP A;  4CAV A;  2ZW6 A;  3ZZI A;  4F0Y A;  2I79 A;  5H86 A;  4AVB A;  1L0C A;  1XMT A;  4H6Z A;  4OAE A;  2REF A;  2B5G A;  4IF5 A;  2VZY A;  4QB9 A;  4B5P B;  2ZW4 A;  2HQY A;  1VKC A;  1MJB A;  4UWJ A;  4AVC A;  3FNC A;  1CM0 A;  3MGD A;  5I0C A;  1S5K A;  2BUE A;  4MBU A;  4H6U A;  1S7F A;  2CNS A;  3FRM A;  5IX3 A;  3FBU A;  2OZU A;  3IGR A;  5GCN A;  3TTH A;  2H5M A;  4JD6 A;  4ZBG A;  3GYA A;  4GS4 A;  1M4G A;  4UBR A;  3S6F A;  5C88 A;  5JQ4 A;  1GHE A;  5F47 A;  1Q2C A;  2ZXV A;  2ATR A;  2B5G B;  2PDO A;  4XNH C;  2Q04 A;  2JLM A;  3EO4 A;  2G0B A;  1IYK A;  2D4O A;  3SXN A;  3V8I A;  2JEV A;  5DWM A;  2IL4 A;  2WPW A;  5KTD A;  4KLV A;  2D4P A;  1TIQ A;  3GKR A;  2Q4Y A;  2J8M A;  2RC4 A;  1Y9K A;  3OWC A;  2R98 A;  1XIX A;  1Q2D A;  3TO9 A;  4XPD C;  2K5T A;  2AJ6 A;  1YVO A;  1BO4 A;  2P6E A;  4UA3 A;  4MI4 A;  4QUS A;  2VQY A;  4JXQ A;  1M4D A;  2ZPA A;  2CNM A;  2B4D A;  4KOV A;  1NE9 A;  2FSR A;  3EC4 A;  2GIV A;  3LOD A;  4PSX A;  2BSW A;  3PZJ A;  1P0H A;  3TO6 A;  1MJ9 A;  1WWZ A;  4IUS A;  3CXS A;  2J8R A;  2Y0M A;  5DWN A;  4U5Y A;  1YGH A;  3R1K A;  3DNS A;  2F5I A;  2QML A;  3TOB A;  1MJA A;  5HH1 A;  2JDD A;  2VZZ A;  1Z9U A;  1LRZ A;  2PR1 A;  3S6K A;  2PRB A;  4X5K A;  2B58 A;  1R57 A;  5IB0 A;  4PK2 A;  2B4D B;  2X7B A;  1S7L A;  1K4J A;  2FIW A;  4CS0 B;  1IID A;  5FVJ A;  2WPX A;  2VEZ A;  4XPL A;  1QSO A;  2Q7B A;  4E0A A;  4NEX A;  3TE4 A;  3JUW A;  3G3S A;  4B5O A;  1QST A;  1VHS A;  3K9U A;  1I1D A;  1YR0 A;  3G8W A;  1S3Z A;  2A4N A;  4JLY A;  4KOY A;  1V0C A;  2OH1 A;  4PSW A;  2CY2 A;  3GY9 A;  1ON0 A;  5KTA A;  3D3S A;  3R9F A;  4KVO E;  4JXR A;  1I21 A;  1PUA A;  3B8G A;  3D8P A;  4PK3 A;  4EVY A;  5EC4 A;  2HV2 A;  4RI1 A;  4F6A A;  2R8V A;  4U9Y A;  3VWE A;  1U6M A;  2OZH A;  3TT2 A;  4FD7 A;  3BLN A;  4QVT A;  4YFJ A;  1SQH A;  2EVN A;  4AG9 A;  3RYO A;  4KOX A;  4R3L A;  1Z4R A;  2OU2 A;  2FXF A;  4NCZ A;  2Z0Z A;  1OZP A;  3DR8 A;  2FL4 A;  4Y49 C;  2BEI A;  4KOT A;  4KZT A;  4CRY B;  4QC6 A;  5F49 A;  4KOU A;  4M3S A;  1Z4E A;  1RO5 A;  4HNY B;  1M1D A;  4L89 A;  1MK4 A;  2B3U A;  3TO7 A;  3FB3 A;  4CAW A;  2ARH A;  2CNT A;  4FD4 A;  4ORF A;  1KZF A;  2BL1 A;  2DXQ A;  2FS5 A;  3S6G A;  3BJ7 A;  4CAX A;  5EBV A;  3DDD A;  2FIA A;  2B4B A;  3CXQ A;  1YLE A;  3TCV A;  4LUA A;  4H89 A;  1NSL A;  3KKW A;  1Y9W A;  1WK4 A;  3E0K A;  2KCW A;  1FY7 A;  3QAH A;  2FE7 A;  4MHD A;  4ONU A;  4MY0 A;  2O28 A;  3TOA A;  3SHP A;  1KUV A;  3N7Z A;  2VBQ A;  2I00 A;  2ZW7 A;  2R1I A;  4XNH B;  3DSB A;  5C82 A;  2GE3 A;  1M4I A;  3F8K A;  3P2H A;  2PSW A;  4KVX A;  3H4Q A;  4FD5 A;  3JVN A;  4NF1 A;  3DR6 A;  4JWP A;  5JPH A;  3P2F A;  4HKF A;  1YVK A;  1XF8 A;  3QB8 A;  1QSM A;  1Q2Y A;  1YX0 A;  4BMH A;  4KUA A;  1J4J A;  4YGO A;  4HNW B;  4YRH A;  3EY5 A;  2FT0 A;  2P0W A;  2PR8 A;  2VXK A;  4R3K A;  2AE6 A;  4E2A A;  1M44 A;  1N71 A;  1XE4 A;  3UY5 A;  4NXY A;  1IIC A;  2GAN A;  1RXT A;  5J8F A;  3W6X A;  4XPK A;  3R95 A;  2PQ8 A;  2PC1 A;  3W91 A;  4AG7 A;  2P6G A;  4R57 A;  1IYL A;  4R87 A;  2Q44 A;  1QSR A;  3R96 A;  5J8C A;  4MJ8 A;  4AB7 A;  1S7N A;  2VI7 A;  4KLW A;  1Y7R A;  1S7K A;  1QSN A;  1P4N A;  1B6B A;  4U9Z A;  2Z10 A;  1YRE A;  5E96 A;  1I12 A;  1NMT A;  3I9S A;  4UWI A;  2OB0 A;  3VWD A;  5IV0 A;  1UFH A;  1S60 A;  2ZW5 A;  3D2P A;  3ZJ0 A;  2G3T A;  2P6F A;  4AVA A;  1KUX A;  4HNX B;  1B87 A;  1BOB A;  4LX9 A;  3R9G A;  5H84 A;  3EFA A;  2C27 A;  4MY3 A;  2EUI A;  2NMT A;  3FYN A;  4E8O A;  2B3V A;  4KOW A;  4M85 A;  2J8N A;  5ISV A;  4RS2 A;  5F48 A;  3FXT A;  4KUB A;  4II9 A;  3BJ8 A;  3W6S A;  4K30 A;  2R7H A;  3WR7 A;  2Q4V A;  1PU9 A;  2REE A;  1CJW A;  3CXP A;  4KVM E;  5HMN A;  2QEC A;  3D2M A; 
#chains in the Genus database with same CATH topology
 1S7O A;  2Z3K A;  1J5Y A;  3T9Y A;  1CG2 A;  4OC3 A;  3VSL A;  2YNC A;  5HVG A;  3FXJ A;  4LLN A;  1YG2 A;  1VQ8 I;  2CWE A;  2A5W A;  3FF5 A;  4R9M A;  4EWT A;  2EQR A;  5DYM A;  3KZZ A;  3KAS A;  3K4C A;  3WGI A;  4HLX A;  2DA4 A;  3E6C C;  2HUZ A;  1S7E A;  4ESF A;  1YK3 A;  1ZGW A;  2L9R A;  3QP6 A;  2O5R A;  1WJC A;  2FU4 A;  1IW7 F;  5ELY A;  3SQN A;  1SEU A;  1F1Z A;  2DW4 A;  2KRF A;  4FAS D;  4BDY A;  4OAD A;  3ABT A;  4B5P A;  5AG4 A;  3I3G A;  3R6S A;  3S6H A;  1W0T A;  2HKO A;  2ZJ2 A;  4DBQ A;  5FJ8 J;  2Z11 A;  1YOV B;  2IPQ X;  3GCM A;  5H2F C;  2F5D A;  5C4J J;  3RIR A;  2QSH X;  4JX6 A;  4GDF A;  3IEH A;  2JDC A;  3IWG A;  3L9F A;  2Q8K A;  2D1V A;  4CRZ B;  1GXP A;  1UST A;  3EDP A;  4XK4 A;  2F4O B;  2UV1 A;  3ASO H;  4P4I A;  1WGX A;  2Y9Z A;  5F0C A;  4M6X A;  1KYW A;  5HDK A;  3I59 B;  2WB1 N;  4NSQ A;  2V7F A;  2GFQ A;  2XEG A;  4UV8 A;  1QZZ A;  1DPR A;  3DPT A;  3OYI A;  2ZJR F;  4FD6 A;  4CAV A;  4LD5 A;  3QPS A;  3COA C;  3FXL A;  4F0Y A;  1K7A A;  4YWY A;  5H86 A;  3FIW A;  1DGW Y;  4P55 A;  1BPN A;  1L0C A;  4H6Z A;  3KE2 A;  4QTR A;  3S1R J;  5GTH C;  3RNZ A;  4OAE A;  3A02 A;  5EJC A;  4BXF A;  1JI8 A;  1NSA A;  3D5R C;  1O3Q A;  1LFP A;  2ZKZ A;  3DKY A;  3M8F A;  1WI9 A;  3H5A A;  2IW5 A;  4RGU A;  1XGS A;  2XEI A;  3O8G A;  4HOB A;  1BJZ A;  1MJB A;  1AHD P;  1VKC A;  3L2N A;  5JVG F;  4RUH A;  2N8G A;  4W97 A;  2CYY A;  1T2K A;  2ZB9 A;  4YII A;  1GV5 A;  1ELL P;  1Z0X A;  3HTS B;  1IGN A;  1XCB A;  2QKL B;  2PCU A;  4M6H A;  5KNL A;  2HQR A;  4YIF A;  5AIP A;  2CNS A;  4FE4 A;  3FRM A;  3QWL A;  2EPF A;  1R9T J;  2DYR H;  4KSA A;  3GTK J;  2A5Y B;  2H1L A;  2VXD A;  3IUO A;  1T0F A;  2DPU A;  4F7Z A;  3RZA A;  4KDP A;  3PM1 A;  5GCN A;  5IB9 A;  3KFW X;  4HF0 A;  4ZBG A;  4L0Z B;  4D5F A;  4C2T A;  2DMT A;  2VT2 A;  3MFK A;  2NOJ B;  5JLX A;  4MQ9 F;  3ERE D;  3PBB A;  3BJ6 A;  3AL0 B;  2W57 A;  3S6F A;  1GHE A;  4LK0 F;  5E1X A;  1N78 A;  4PXE A;  4A31 A;  4FT8 A;  2QLZ A;  2RN7 A;  5D6F A;  2LTP A;  2F48 A;  4FX0 A;  4A6E A;  1Q2C A;  3LSR A;  4J01 A;  4ZYE A;  4XMY A;  2V8V A;  1EH8 A;  5CKT A;  2ATR A;  2J9A A;  3S2D J;  2Y30 A;  2RV8 A;  3TW6 A;  1LDK B;  2K4B A;  2C6G A;  1WHU A;  2F4I A;  2QA4 I;  4XON A;  2ZC2 A;  2CRG A;  5LHG A;  3RCO A;  2EO8 A;  2FBH A;  1TF8 A;  1IYK A;  2D4O A;  4DBR A;  1I27 A;  3SXN A;  3V8I A;  1O7F A;  4A5M A;  2JEV A;  4LB5 A;  3KYC B;  2HTJ A;  3I56 I;  3I53 A;  2IL4 A;  1J09 A;  1LFB A;  3IFE A;  4I99 C;  2PEX A;  1UAA A;  1TIQ A;  1B72 B;  4F0X A;  4Y33 A;  3IV5 A;  3CCJ I;  3K1P A;  3HSF A;  2LD5 A;  3GKR A;  2Q4Y A;  2J8M A;  3Q9V A;  4XOR A;  1MBG A;  3CCQ I;  1TWG J;  4HA8 A;  1JHH A;  4RLF A;  5D5X B;  3LMM A;  1K78 B;  5JGF A;  5LRJ A;  2NXN B;  1ZG1 A;  3BXM A;  1SD5 A;  3PNV A;  5ILS A;  1Q2D A;  1XIX A;  5DM6 F;  1A04 A;  3ZQQ A;  1XD7 A;  1S72 I;  4B12 A;  1IO2 A;  1ZTR A;  4P9F A;  3S93 A;  2MLG A;  5GP9 A;  2Z33 A;  2OPT A;  2ZEO A;  3IL2 A;  1QMU A;  1YW4 A;  3IWZ A;  1T8I A;  2EV6 A;  1JWQ A;  4MFJ A;  1HDD C;  2K5T A;  5EGO A;  1YVO A;  1BO4 A;  2EK8 A;  2P6E A;  2LF7 A;  4UA3 A;  4OAY A;  3H5Z A;  4U7B A;  2MGQ A;  1YJ9 I;  3CC4 I;  3HHG A;  3S2H J;  4JXQ A;  4XLE A;  2ZEF A;  2VKV A;  5HS7 A;  1Z1D A;  2HTS A;  2JA2 A;  4BNC A;  2ETH A;  3WTT C;  2BVL A;  3BR6 A;  1ZYR F;  4KJZ A;  2DDB A;  1QPM A;  3WU2 C;  4A69 C;  5JR3 A;  4B13 A;  2R3S A;  1UZC A;  1NTC A;  4MHN A;  3F8C A;  2XRO A;  4B4C A;  2BSW A;  2VBW A;  2GZW A;  4M3E A;  2LK2 A;  1UG0 A;  1AKH B;  3EQL F;  3PFE A;  3GBG A;  3RKX A;  4IUS A;  2GLO A;  3KI9 A;  2XRN A;  2PJP A;  1WJE A;  2VC0 A;  2CUZ A;  3HKZ A;  2KMU A;  3R1K A;  4GGG A;  4XIC A;  1ETX A;  5ICE A;  2BBY A;  2DOF A;  1LEB A;  4CA0 A;  2MLK A;  1MBJ A;  5KHD A;  3DBR B;  1MND A;  2J5O A;  2P5L C;  5KAF C;  2XKP A;  5CVI A;  1TNS A;  3H3Z A;  4NGS A;  1TQM A;  4B44 A;  2JDD A;  4EJT A;  2VZZ A;  3SZP A;  2PR1 A;  3VYS B;  3KZW A;  3DLL F;  1B8I B;  4C2M J;  1R57 A;  2EFQ A;  3T8T A;  4G6Q A;  4OIW A;  2HYJ A;  4PK2 A;  4NJR A;  5F0H A;  1DP3 A;  1FBU A;  2Z3P A;  5K7Z A;  1LE8 B;  2X7B A;  4OOI A;  2FIW A;  3ESW B;  4BDZ A;  5AG5 A;  3BPX A;  3LAC A;  4CS0 B;  2NS8 A;  1IID A;  5FVJ A;  5IP7 J;  1FP2 A;  2VEZ A;  1G8X A;  4XPL A;  2V4J C;  1OCP A;  3GLX A;  5J1Q A;  4D7N A;  1R4N B;  3GME A;  2Q7B A;  4S05 A;  3HEF A;  1RI7 A;  4NEX A;  2DA6 A;  3JUW A;  4B5O A;  2B0L A;  1F2P A;  1ZN2 A;  2K9L A;  5F27 A;  4U7D A;  3MCZ A;  2GU2 A;  4XM3 A;  4UFW A;  1QQI A;  1TKF A;  2JRT A;  1FTT A;  4JX5 A;  1RKW A;  1ON1 A;  3D1N I;  3HOV J;  3K9U A;  2TRT A;  3K9T A;  5GAE J;  2MA3 A;  3K10 A;  4EGZ A;  2DA1 A;  5M3M J;  4YRV A;  3GTO J;  4XR6 A;  3V7R A;  4YFK F;  1E3O C;  3IP4 B;  4M6G A;  5GPA A;  4XQF A;  3K2A A;  5IY5 H;  1XSD A;  5H6R A;  4BY1 J;  1ON0 A;  1IN8 A;  2GOM A;  1V55 H;  2BXY A;  4KVO E;  2G7U A;  1EA3 A;  1ZKG A;  3OYG A;  1XJO A;  3HUV A;  2OQR A;  4RAG A;  2CJJ A;  5HOD A;  3VOE A;  1U3E M;  2JN6 A;  1N77 A;  2A6H F;  3HOY J;  2PJ7 A;  4Z6Y A;  4F55 A;  1W0U A;  4PK3 A;  1F43 A;  4ZZL A;  1AWC A;  2WZN A;  4BUP A;  2HV2 A;  2JPB A;  4X1E A;  3CES A;  2VBX A;  3B3C A;  2V1U A;  3DCF A;  2WV1 A;  3F8N A;  4U9Y A;  1YX3 A;  2OV7 A;  4GYG A;  2OZH A;  2QM3 A;  2PX9 A;  3E5U A;  1N75 A;  2A6E F;  1P9Q C;  4JBA A;  2VIX A;  4AWX B;  4OC1 A;  4JZ0 A;  1XTA A;  4P4F A;  2KLO A;  3BLN A;  5THW A;  1NG7 A;  4ZDO A;  2Y69 H;  4AVP A;  2VQH A;  3E3V A;  2DFE A;  1KU7 A;  2EVN A;  3IHU A;  3K2Z A;  4UF4 A;  3RYO A;  2ME6 A;  2GXA A;  4MEX F;  2HZD A;  4P4J A;  2OU2 A;  3LSJ A;  3K70 C;  2Z0Z A;  3BZ6 A;  4HYE A;  3D7G A;  1JTY A;  2V6C A;  4E7Z A;  4I76 A;  4QC6 A;  2FMY A;  2QWW A;  3RZO J;  4A39 A;  3O6B B;  4MHG A;  4L18 B;  2QVO A;  1VQN I;  1M1D A;  3KEO A;  1MK4 A;  1M4L A;  2IS2 A;  1PYV A;  1U9O A;  1K79 A;  3IH4 A;  3RZD J;  4CAW A;  3S16 J;  4CGP A;  5E17 F;  3S8P A;  3CCS I;  4G9Y A;  2XVC A;  2YNC C;  2ZED A;  2ZO4 A;  4RLQ A;  1YQE A;  5E8I A;  2E1M C;  1ON2 A;  1HKQ A;  3FHZ A;  1OCZ H;  2RKH A;  2RFH A;  3Q3S A;  2K9S A;  4XRF A;  4B3A A;  1RR8 C;  1G3T A;  3NWS A;  2BL1 A;  4HRI A;  3S6G A;  2BVM A;  3QOP A;  1HKS A;  1MMN A;  5M5X J;  1JKQ C;  3BJ7 A;  2KQR A;  2O3F A;  5EBV A;  1HDP A;  2IP2 A;  1ACI A;  4XLF A;  1YLE A;  1REP C;  2PJ8 A;  5EG0 B;  2JSC A;  4RM2 A;  2AXL A;  1YLO A;  4LUA A;  3I4N J;  2STT A;  4H89 A;  4FE7 A;  1ETO A;  1R5I D;  2QYO A;  5ED4 A;  3NAR A;  3FMC A;  1ENH A;  5AIQ A;  2BE5 F;  1I6X A;  4BS9 A;  4JX4 A;  1Y9W A;  4ENK A;  4KT6 A;  2VL8 A;  4HEA 2;  2DOD A;  2PI0 A;  5EZG A;  4Y15 A;  1YS6 A;  4IQJ A;  1FY7 A;  2BO9 A;  2ABZ A;  2FE7 A;  2GQQ A;  5IPA A;  2JA6 J;  4MCR A;  2CQN A;  1ARL A;  3DTE A;  4OID A;  4RN7 A;  4PZJ A;  4EJU A;  5FB2 A;  1KWM A;  2LY9 A;  3DKW A;  4G6T B;  4HST A;  3TOA A;  2HNH A;  5JFR A;  2Z1D A;  3CZ6 A;  2ACJ A;  4NHJ A;  3SHP A;  2K85 A;  2DT6 A;  1IRZ A;  2I00 A;  3R61 A;  1IU8 A;  4L9T A;  4XID A;  1Y1V J;  5C82 A;  2GE3 A;  1M4I A;  1HW1 A;  5ILU A;  3WTY C;  2CW0 F;  3QYE A;  1KQ0 A;  2ZBK A;  2A05 A;  5FLV A;  1X58 A;  1D1A A;  3IWF A;  3Q0U A;  4NF1 A;  5A27 A;  3O2P E;  3F3X A;  3CC7 I;  2K40 A;  3H5N A;  3HOW J;  3NAU A;  1NH3 A;  3P2F A;  4HKF A;  1SC7 A;  1TF9 A;  3VFZ A;  1XF8 A;  5FRM A;  1Z6T A;  4OMZ A;  4ANJ A;  1Q2Y A;  2EWB A;  4I6Z A;  4C3I J;  4MFE A;  2MFZ A;  1A2Z A;  2L0K A;  2IMO A;  1XOV A;  2E71 A;  1Y0R A;  4IEJ A;  1F57 A;  5DS9 A;  3WGG A;  5BPI A;  2NVX J;  4YGO A;  5LGU A;  1Y8R B;  3CP2 A;  5CBM A;  3M1E A;  3BHX A;  2Q2E B;  3D7F A;  2LY1 A;  3KYL A;  1IAW A;  4C7H A;  4CGM A;  4BE2 A;  3ZQG A;  2P0W A;  4XLA A;  2H8R A;  3BY6 A;  1K83 J;  4CAE A;  3FJU A;  2KJC A;  4D9J A;  2AE6 A;  2LY2 A;  2ZCW A;  4MMO A;  1T0F C;  2H6B A;  1LFU P;  2M3A A;  4UEZ A;  2HQA A;  4OIQ F;  1XE4 A;  4ZY1 A;  1IRF A;  3H92 A;  1QHG A;  4MNU A;  2GAN A;  2W4S A;  2RNG A;  4TV7 A;  3F21 A;  3E5X A;  4KIS A;  2AO9 A;  2L4A A;  4XPK A;  4KSF A;  2QGU A;  2Y0S A;  5FKN A;  3U1D A;  2DQL A;  4IHT A;  3LFU A;  4YFN F;  3TGN A;  5K1Y A;  1FTZ A;  1TW3 A;  2BZT A;  3PQJ A;  5I4M A;  1U5T A;  3RO0 A;  3M1C A;  2ESH A;  5J47 A;  3DXJ F;  2P6G A;  5FKM A;  3N4M A;  3BI0 A;  4LB6 B;  4M6I A;  1WWX A;  2D1H A;  2XB5 A;  3G1O A;  3OL4 A;  3JSO A;  4MJ8 A;  3R96 A;  4G7Z F;  1RPW A;  3B3S A;  2GWR A;  3BR5 A;  5L3F A;  2A68 F;  3EYI A;  3CC2 I;  1VHE A;  1Y7R A;  4KLW A;  2CFO A;  3W3C A;  4BH9 A;  1FMV A;  2AFZ A;  1QSN A;  1FNN A;  3ZN1 A;  2PJ0 A;  3K1N A;  3P9I A;  2DEA A;  1DU6 A;  3FK6 A;  1WJB A;  1P4N A;  1BAV A;  3LAJ A;  2O7O A;  4I09 A;  4U9Z A;  4HV6 A;  5FD5 A;  1OIS A;  1R1V A;  1SAU A;  2BY3 A;  4A3I J;  4J19 A;  2Z3M A;  3NQO A;  2EZK A;  3V7S A;  4CZZ A;  3I9S A;  4IHW A;  1PJR A;  3SFI A;  2LMD A;  2D45 A;  2XAH A;  4XN3 A;  2VJ4 A;  3VWD A;  2HI3 A;  2L02 A;  2IS1 A;  1S60 A;  3DEE A;  3MKZ A;  2ZW5 A;  4QWQ A;  1STZ A;  2L5Q A;  3ISZ A;  4MFQ A;  2DT7 B;  1T38 A;  3ZJ0 A;  1J9I A;  3NA6 A;  1XG1 A;  3V4G A;  3ZOB A;  2H09 A;  1U9N A;  4UVC A;  2G3T A;  5DCM B;  1PCA A;  2MBF A;  3C18 A;  4CCO A;  4X6A J;  3HG9 A;  2Y48 A;  1R23 A;  2CQ7 A;  5LGN A;  1KUX A;  3FKJ A;  3CCE I;  4RM3 A;  3A1Y A;  2JSP A;  2JUC A;  4MY3 A;  2EUI A;  4E7L A;  3FYN A;  2CQK A;  1Z9C A;  4LLG F;  3B73 A;  4PGH A;  4XKW A;  4UY8 I;  1TWC J;  1TZL A;  5D4S A;  2O8K A;  2IJZ A;  4A0Z A;  1ZG9 A;  4RS2 A;  5F48 A;  4ENM A;  1MH4 A;  5EDN A;  3WE2 A;  2DA5 A;  3QPT A;  3W6S A;  5E20 A;  4ETS A;  3U1K A;  5EMI A;  1XN7 A;  2EB7 A;  5E3N A;  3GWZ A;  2R7H A;  2A3S A;  3CCV I;  8CPA A;  3BDD A;  4C2Y A;  1JHF A;  1MIJ A;  3GXO A;  5HMN A;  4W1U A;  1YW8 A;  2NOG A;  3F9K A;  4ENN A;  1R43 A;  3A0H C;  1HC8 A;  3JRU A;  5K8O A;  3GB0 A;  3PO3 J;  1IB1 E;  1MBK A;  3I54 A;  2M2E A;  1HXD A;  3IC1 A;  4P6Y A;  1SVL A;  5LYI A;  4XKV A;  5FKO A;  2HVR A;  3NH5 A;  4TNU A;  3KP5 A;  3L2R A;  5CVU A;  4UCN A;  1POG A;  3LAP A;  4X2T A;  3CCM I;  4HNU A;  2P6S A;  3BZK A;  1V4R A;  1ZG3 A;  5CLS A;  2QSF X;  4OWR B;  1DDN A;  3H8G A;  3SFZ A;  4QBJ A;  3TC8 A;  3P5J A;  4Y49 B;  1I3Q J;  1OCC H;  1ZK8 A;  3HC7 A;  4HNV A;  1YRN B;  3OIQ A;  1W5T A;  1MGT A;  2QIR A;  3I4P A;  3DLJ A;  1D1B A;  5LYD A;  2K9N A;  1Z77 A;  3ZN0 A;  4AIJ A;  4KNY A;  3GYH X;  4BXX J;  2FEZ A;  3WOD F;  3BCB A;  3PP9 A;  1WRJ A;  3DFG A;  2WSA A;  3GFM A;  2Z2S B;  2G3A A;  2YSR A;  1RES A;  3LL7 A;  3U2R A;  3ZP5 A;  1XMB A;  4KOS A;  5K8N A;  3ULQ B;  1R36 A;  4XL9 A;  2CQX A;  3FWE A;  3B3T A;  2CXA A;  5CQG A;  1YJN I;  4OLL A;  4P10 A;  2R93 J;  3KEQ A;  5BNG A;  4F52 A;  1VQM I;  3WTU C;  2KT0 A;  4RB1 A;  1Y39 A;  4G6D A;  4RMN A;  3FBN B;  4UB6 C;  2MG4 A;  4BQA A;  3HRU A;  4R6T A;  1VQK I;  3CDH A;  2REF A;  2B5G A;  2L9V A;  2ZXJ A;  1Y56 A;  2EA4 A;  3FM3 A;  4M72 A;  4M74 A;  1X1B A;  2DO7 A;  2H1K A;  2VZY A;  3IU2 A;  2YS9 A;  4XLN F;  3FKI J;  4LIV A;  5LLQ A;  2ZW4 A;  2MH9 A;  4KIF A;  5F0F A;  2E7X A;  2HOT A;  1CM0 A;  3ISX A;  3MGD A;  4AVC A;  2ECC A;  3RPU A;  2QQA A;  2HPI A;  4KIB A;  1USS A;  3R60 A;  4C2U A;  3SI1 A;  2JBK A;  2ZXH A;  1G3Y A;  1S5K A;  2EFP A;  3FDY A;  3MZY A;  3CTA A;  4PDK A;  4DYQ A;  3CO6 C;  1H9T A;  1WJD A;  5IX3 A;  4M9Z A;  3HSR A;  3S1N J;  3FBU A;  2OZU A;  3RYR A;  3IC7 A;  3DV8 A;  2H5M A;  4JD6 A;  3IRQ A;  1HW2 A;  3GFI A;  2LBF A;  3K6G A;  3VYT B;  1EH7 A;  3GYA A;  3OYJ A;  3EUK L;  3A2K A;  4GS4 A;  2ICW G;  4UBR A;  3UNG C;  3AAF A;  4Q48 A;  4L9N A;  1LAN A;  1H0M A;  1D8K A;  4NGN A;  1OLT A;  4B47 A;  4QLC U;  3WU1 B;  1SFO J;  3K4K A;  4OIN F;  4AIH A;  2ZXV A;  3JRH A;  2PJ6 A;  5C4X J;  3GUD A;  1WSU A;  2NRA C;  1TBX A;  4UHT A;  2PBI A;  1PUE E;  3PIO F;  2DPD A;  1DTD A;  2AFM A;  1T98 A;  4G1P A;  4F92 B;  3W2W A;  2PIY A;  2Q04 A;  3CMM A;  3OIP A;  3JRI A;  4MLO A;  5ICG A;  4NGT A;  3W6J B;  1B4A A;  3IH2 A;  4HV5 A;  4WXD A;  1ZRD A;  3DTI A;  1SFU A;  2ZME A;  3SYT A;  1WJA A;  4M3D A;  4M73 A;  1GYT A;  2PVW A;  5DWM A;  1X3U A;  2MD0 A;  2XC7 A;  4MHP A;  1OBR A;  2DQR A;  3DPL C;  3I1U A;  1UHM A;  1IXR C;  4NGQ A;  2E19 A;  1SD4 A;  4M3F A;  3M3Y J;  1XMK A;  4B14 A;  3W6V A;  3NWT A;  3TED A;  4GM5 A;  2R98 A;  1OKR A;  3E7L A;  1ODD A;  3HPH A;  2POK A;  2AFO A;  2Q7S A;  4MFL A;  1KU9 A;  1MZB A;  4P4E A;  3TO9 A;  1OCR H;  4YFX F;  4A33 A;  1HW5 A;  4F9V A;  1LOK A;  1Q1V A;  3OMY A;  1F2O A;  4QIW N;  1AOY A;  1K4T A;  3CJN A;  5DDG A;  2AQE A;  3T1B A;  2R7V A;  4ZYA A;  2FNP A;  5CVJ A;  2LYC A;  4Q47 A;  4CCM A;  4EJV A;  3S3O A;  2CTB A;  5D29 A;  3OYF A;  3UKG A;  1FPQ A;  1TW2 A;  4XKC A;  2OA4 A;  3FBI B;  2ZPA A;  4CYN A;  2B4D A;  2EZL A;  5TIS C;  2PMZ A;  2E1O A;  5JI6 A;  3RPQ A;  2DA7 A;  5D6E A;  1D0X A;  5J1Y A;  3EC4 A;  3WC5 A;  3LOC A;  4Y13 A;  3D66 A;  2HQ5 A;  1B59 A;  1P0H A;  1IJW C;  1Y6I A;  3GF2 A;  2VC1 A;  3JAM K;  2LRE A;  1WJF A;  3SDG A;  1D0Y A;  4F3Q A;  5KK1 A;  4H0E A;  4IKF A;  6CPA A;  2J8R A;  3GVA A;  5DWN A;  5HOO A;  1YGH A;  4DYO A;  2R92 J;  1FP1 D;  3DNS A;  4NFR A;  3H9Q A;  2F5I A;  1TT5 B;  4KUM A;  3I58 A;  2QML A;  2K3F A;  1FSE A;  4BEH A;  5DEQ A;  1SD7 A;  1TWF J;  2BW3 B;  3RSN A;  1RET A;  1XGN A;  2R5Z A;  1SFE A;  1MMA A;  2VKD A;  4G12 A;  3PB9 X;  3S3N A;  2QEX I;  1BI3 A;  5F64 A;  3S6K A;  3IIB A;  4X5K A;  3Q9S A;  4H2K A;  1OFC X;  2XHK A;  2FD5 A;  2UXX A;  3JAM Z;  3WTZ A;  3GZ6 A;  2B7E A;  3CDL A;  1CPS A;  3FVL A;  5G22 A;  4DIQ A;  5HDN A;  4OIR F;  4IRI A;  2H8W A;  3HSE A;  2IT0 A;  2O8X A;  2RQQ A;  3CMA I;  1EE3 P;  1LAP A;  1X19 A;  1JKO C;  2HB6 A;  3SJX A;  2DXI A;  1D3Y A;  1U5T C;  4PGG A;  2E5N A;  3ZMV A;  5LEK A;  2C6Y A;  1TQI A;  4E0A A;  1OR7 C;  3QU6 A;  3TE4 A;  4UUS A;  1BL0 A;  1WZ2 A;  1QZE A;  1IXC A;  1I5Z A;  1P4W A;  1QST A;  2GRE A;  2X1D A;  1WJ5 A;  1VHS A;  1I3A A;  3F8B A;  3MWM A;  1R58 A;  5E3O A;  3L7W A;  3JTG A;  1XDS A;  1S3Z A;  1S7A A;  3JSP A;  4NNJ A;  4EFD A;  3HZJ A;  1KQ8 A;  3FF3 A;  3PB8 X;  4KOY A;  2RVC A;  3VAT A;  4NGR A;  2GA1 A;  1R1U A;  4HQE A;  2EV0 A;  1AU7 A;  5LFA A;  2CY2 A;  3GY9 A;  1SVM A;  2R7O A;  3CCR I;  4DQ2 A;  4UXN A;  2FOK A;  2RNJ A;  3LSG A;  3PSF A;  2P7V B;  1Y8Q B;  3ZGK A;  4IPA A;  1I21 A;  1PUA A;  3OY9 A;  4IRG A;  2DYS H;  2XUB A;  1Y0U A;  1ZEL A;  3LSK A;  4A5N A;  1Z21 A;  2HOS A;  1BW5 A;  2FOW A;  2PJ1 A;  3B8G A;  4D7M A;  3D8P A;  2KRH A;  3KP7 A;  2ZXI A;  3HUG A;  3FM5 A;  5EC4 A;  5E3L A;  2XSD C;  1BW6 A;  4NGM A;  2X6X A;  2VPL A;  2E2J J;  4F6A A;  3IH3 A;  4M3B A;  2E2H J;  1S9H A;  4B09 A;  1U6M A;  1RIO H;  3C7J A;  1QVT A;  3JW4 A;  1I1G A;  2OZ6 A;  4LG3 A;  4A30 A;  4BYY A;  2ZEL A;  5KVR A;  4D1Q A;  4FD7 A;  3KX2 A;  4LQG A;  4YFJ A;  1RUN A;  1SQH A;  1IZ1 A;  5E3M A;  2E60 A;  1XMX A;  4IVN A;  4KOX A;  1FBQ A;  1V3F A;  3PIP F;  2FXF A;  2DJN A;  3BR1 A;  2DI3 A;  2MC3 A;  4AVZ A;  1OZP A;  2OUM A;  3DR8 A;  4CGL A;  1JE8 A;  4KOT A;  3OR1 C;  1XMA A;  1ZLH A;  4IAV A;  2JA8 J;  3MKY B;  4P44 A;  3KL9 A;  2M5W A;  2GIZ A;  2VOO A;  4M3S A;  4YEL A;  1MNE A;  5EF6 A;  1R3N A;  3EUH A;  2DCE A;  2MD5 A;  2B3U A;  3TMO A;  1RR7 A;  4YIR X;  3PQK A;  3FZV A;  4A95 A;  3M8J A;  2ARH A;  3FX6 A;  1QZY A;  1XFO A;  4A3K J;  4MCP A;  3TQN A;  1ZO0 A;  2XF7 A;  3F0C A;  3PFI A;  2IGM A;  2A07 F;  1RZ4 A;  2PJ3 A;  1QQ9 A;  1JGS A;  2O6G E;  3PFO A;  2J5P A;  1SFX A;  1D8J A;  2DXQ A;  5J40 A;  2IGN A;  3C2H A;  2VOD A;  2JBJ A;  1SAX A;  2FIA A;  3ZMT A;  3CXQ A;  1MBF A;  2HGC A;  2R7D A;  5FLX K;  4RA2 A;  2LRD A;  3BG9 A;  1X3W B;  3CDX A;  2IA2 A;  3RJP A;  1O4X A;  4TWE A;  5HXD A;  4HSR A;  2JRM A;  2E1N A;  1MSE C;  3HJE A;  3O3K A;  2DF5 A;  3H1C A;  2M0M A;  3NH4 A;  3KCC A;  4DZJ A;  3HM5 A;  2HOA A;  1FYK A;  3E0K A;  2IGK A;  2EZI A;  1JJ8 C;  2VAS A;  1LB2 A;  2KCW A;  4MCS A;  1GUU A;  6PAX A;  1PUF A;  1BLL E;  5B5E C;  4MHD A;  3M7G A;  4ONU A;  2RGV A;  4HLY A;  1FYM A;  1BIA A;  1F9N A;  4L9J A;  3E6M A;  3DU6 A;  5FLM J;  1HOM A;  1W7P D;  5D8K B;  4ZX8 A;  5FLX Z;  2R5Y B;  3CJT B;  4IRH A;  1F4K A;  1W7P A;  2FXA A;  4E7I A;  2PJR B;  4Y52 J;  1KUV A;  2WAE A;  5AG6 A;  2L9N A;  2ZW7 A;  1W1W E;  3KHX A;  1IUF A;  4DYR A;  4WWV A;  1XSX A;  1FC3 A;  1QU3 A;  3FXQ A;  3F8K A;  2PSW A;  3QAY A;  4KVX A;  3H4Q A;  2MYS A;  4FD5 A;  2BXZ A;  3B3W A;  3ZMS A;  1MBE A;  2ELH A;  1S6L A;  4MFP A;  4OC0 A;  3DR6 A;  4EJW A;  3LFK A;  1IN5 A;  3D4U A;  1P4A A;  2KKO A;  1LCP A;  2PG4 A;  1YVK A;  2BGC A;  2LF8 A;  2XAQ A;  3QB8 A;  2HS5 A;  4BJ6 C;  2GA2 A;  1VTN C;  3GEZ A;  1CF7 A;  3RDI A;  4ZZD A;  3A0B C;  5CJ9 A;  2LKX A;  3OYC A;  1J4J A;  4XSZ F;  3H5R A;  1LUJ B;  4BAC A;  2EV5 A;  1HDU A;  4PJN A;  4B3X A;  2ANP A;  5ICC A;  3S32 A;  2IRF G;  4P4D A;  2DAO A;  2DK5 A;  2VXZ A;  3L2V A;  2PR8 A;  3A9L A;  4R3K A;  3EUA A;  3HGG A;  3IAM 2;  4ZYH A;  3OL3 A;  1N71 A;  4ABZ A;  3VDX A;  4NBQ A;  1Z7L A;  2ZNZ A;  3OS2 A;  2PMU A;  1W4M A;  3H9J A;  5L3B A;  3GLJ A;  3MZH A;  1BIB A;  1JUP A;  2RQP A;  2GXB A;  1D5V A;  1C0W A;  2XB0 X;  4AIK A;  2QBY B;  1E3H A;  1KON A;  5KAI C;  4M71 A;  5LRS A;  3MEX A;  4HQM A;  1T33 A;  2WAF A;  4UEE A;  4AG7 A;  2YX7 A;  1J0R A;  4A3D J;  3QNV A;  4CYC B;  4R57 A;  1IYL A;  1SAN A;  4RS8 A;  2VQL A;  1IDZ A;  2Q44 A;  4NDL A;  1Z8T A;  1BI2 A;  2K02 A;  2FBK A;  2DPT A;  4KIG A;  5M5Y J;  2W82 A;  1S7N A;  4AB7 A;  2EJR A;  3HOT A;  1X1A A;  4IQ4 A;  1NG6 A;  4D5C A;  4E7K A;  2ZME C;  3BTJ A;  2XF5 A;  2DMU A;  3KGQ A;  2XSJ C;  4O6J A;  1S29 A;  3VSK A;  4JQF A;  1EV7 A;  2M1B A;  2VQG A;  4O5V A;  3CT9 A;  3RBU A;  3PB4 X;  1MNM C;  2O4H A;  4PJL A;  5HVQ C;  1H8A C;  2Z10 A;  3DU5 A;  5BS6 A;  1TQP A;  2ZEH A;  3DBH B;  1Q7L A;  1NMT A;  2K27 A;  4AM3 A;  3VH9 A;  2WAQ N;  5B66 C;  2KHM A;  1MW7 A;  3B6A A;  4Q38 A;  2R7X A;  5IV0 A;  1UFH A;  1OPC A;  2ID6 A;  3OS0 A;  4IXA A;  4AYB A;  5K5O A;  1WVR A;  2CTC A;  2CV0 A;  1S3J A;  1P2F A;  4XRS A;  5JH9 A;  2NAZ A;  2VKH A;  4HF2 A;  4E70 A;  1MBH A;  1U6G A;  1D5Y A;  4OAZ A;  5EEA A;  4BY7 J;  4FAI A;  3CLO A;  1TC3 C;  3S17 J;  2ZSI B;  4ZJZ A;  1B87 A;  4LX9 A;  2HU9 A;  2X6W A;  3RI4 A;  3D5S C;  1IRG A;  2ODF A;  2CUE A;  3WHC A;  3FK7 A;  3OYE A;  2C27 A;  3QRF F;  5F1J A;  2AQF A;  1VQO I;  2CSO A;  2X6O A;  2CH0 A;  3ELK A;  1CP7 A;  2B3V A;  4KOW A;  1ETV A;  3ZCO A;  2Q0O A;  3FMQ A;  4KUB A;  1W5S A;  3K7A J;  2PJ4 A;  3TX8 A;  1F5T A;  1A5J A;  2E1C A;  2L7M P;  5LHH A;  4K30 A;  2EIN H;  3CUQ C;  3FX3 A;  3I3L A;  4NQW B;  1QPI A;  3QYB A;  3T0Y A;  4BL0 B;  3NE8 A;  1H8L A;  2LLK A;  2AS5 F;  3PO2 J;  1KZH A;  5JVT A;  2KDZ A;  5CQE A;  1B6A A;  5H6Q A;  2V77 A;  4NC8 A;  2V8D A;  3IWW A;  4BKX A;  3WR7 A;  3J7Z I;  1PU9 A;  2CQQ A;  4EM0 B;  3BOQ A;  3U21 A;  3GZN B;  4Q36 A;  1Z8W A;  1W36 C;  3X2Q H;  1GXQ A;  1YE9 A;  3H35 A;  4KVM E;  2M87 A;  5FD6 A;  2QEC A;  1GHC A;  5K7F A;  2WTE A;  4N9I A;  2D5V A;  3JRD A;  4CIC A;  2FJ1 A;  3F0A A;  1GVJ A;  1E17 A;  4RB0 A;  2VPR A;  1FNO A;  4JJX A;  1J59 A;  3F5B A;  2HZT A;  4ZY2 A;  4KIC A;  3ABM H;  2B63 J;  5L3E A;  4KS9 A;  3GTQ J;  4MEY F;  3NE7 A;  4BQN A;  4KFC A;  2BV6 A;  4HZF A;  4BJT A;  3FH4 A;  3TFY A;  5DUI A;  1CP6 A;  2ME0 A;  1YJW I;  1Z8X A;  2YGW A;  4EVI A;  1E2X A;  4A0X A;  3HL2 A;  2WUU A;  3LD2 A;  1IN4 A;  3B7I A;  1R5G A;  2IEK A;  1HA8 A;  3ZXS A;  4I49 A;  3VYR B;  1Z7U A;  5JLW A;  3IAS 2;  3AG4 H;  3R0A A;  3CO7 C;  5BWA B;  4WK8 F;  3DBL B;  4RAF A;  1CGP A;  2QCO A;  1D1C A;  2PRQ A;  2Q0Y A;  4FBE A;  4J3G A;  3S9N A;  4KOR A;  4LOC A;  3ZPL A;  1MMS A;  2KDO A;  4A93 J;  2FCK A;  5CNP A;  4YG2 F;  1WFX A;  2E7W A;  1KU3 A;  1SMY F;  5EZH A;  3RKW A;  3NRV A;  1SFK A;  4XPD B;  2E1M B;  3IKT A;  3TDZ C;  3TW7 A;  1SMT A;  2BOL A;  4HDV A;  2JA7 J;  2XF6 A;  1YIJ I;  3T90 A;  5F46 A;  1KU2 A;  4MGR A;  1ELM P;  3PL8 A;  3KEY A;  2ZW6 A;  3ZZI A;  3V42 A;  1RC9 A;  1D0Z A;  4DUK A;  1FT9 A;  4AVB A;  1BM9 A;  2FA5 A;  1XMT A;  2VL1 A;  4EMS A;  5LRK A;  2OCC H;  5F08 A;  3GUX A;  2XPW A;  3DWL E;  3G3Z A;  3LQQ A;  4K2E A;  2QQ8 A;  3B2Y A;  1HST A;  2ISY A;  5HLT A;  1G3S A;  5K5Q A;  4B5P B;  2VJI A;  1YO5 C;  2HQY A;  4UWJ A;  3FNC A;  1OR7 A;  1UFM A;  4JOM A;  3AKZ A;  3FMS A;  3DEU A;  4L5I A;  4UUT A;  4BEH B;  3J81 K;  1A6Q A;  2DA3 A;  2X0L A;  1TWA J;  2F5F A;  5A28 A;  5FRN A;  2HYF A;  2YPR A;  1YX5 A;  1DUX C;  3QOD A;  1PVE A;  4MBU A;  4CGO A;  2XAU A;  1X1D A;  3Q5F A;  1B72 A;  4P45 A;  2F5V A;  4EGY A;  3SZG A;  4BBS J;  2FSW A;  2W7N A;  1BR1 A;  1JGG A;  1K78 A;  3TTH A;  2DFH A;  2HVS A;  3H36 A;  3JR9 A;  1CPX A;  2XRL A;  1M4G A;  2DMN A;  4OU0 A;  4L0Y B;  2OOT A;  3EUH C;  5L3D A;  2K5C A;  1BOA A;  5K7H A;  3J80 K;  5F47 A;  3D0S A;  1RRJ A;  1X2N A;  2CW8 A;  2KIF A;  2NS0 A;  3CLQ A;  5DM7 F;  3GTP J;  2H27 A;  1K61 A;  3HYI A;  1WPK A;  2V1D A;  1PP7 U;  1DP7 P;  4XNH C;  2R7T A;  1AUG A;  1LKX A;  3L1P A;  3BG7 A;  3BR3 A;  5HS9 A;  3CCL I;  2K4J A;  3MMY B;  3EO4 A;  2G0B A;  3KHZ A;  4LLL A;  4HW0 A;  3U9G A;  1V5G A;  3QPH A;  3GTL J;  1VND A;  1Y7E A;  2CW7 A;  2Q4Z A;  2LH9 A;  2K86 A;  3DQV C;  4V2G A;  3VEP A;  3G73 A;  1L0O C;  3ABU A;  2Q51 A;  5LYL A;  3J80 Z;  3CP8 A;  1HDQ A;  2D4P A;  5KTD A;  1AKH A;  5FKL A;  4BE0 A;  3S14 J;  4HX7 A;  1U78 A;  5ILV A;  5DD4 A;  3LSH A;  2RC4 A;  3VYU B;  2ELJ A;  2Y31 A;  1R71 A;  1Y9K A;  1ETQ A;  3E1S A;  4I2O A;  3PJR A;  1JJ6 C;  1ZLI A;  2JVH A;  4UCP A;  2MSY A;  1UJ8 A;  3BG5 A;  3OYM A;  2Z99 A;  4PFP A;  4IO9 F;  3Q0V A;  5M5W J;  3S9L A;  3DP7 A;  3QPL A;  4GXO A;  4CXF A;  4FCY A;  2BY2 A;  2KPM A;  3HRS A;  3TL4 X;  3LQR A;  5DTD A;  4JK1 X;  4UFX A;  2XGX A;  5E1W A;  1TTY A;  2K7L A;  4ZTJ A;  2K9M A;  1B8I A;  1TNT A;  4Y3O A;  4IHX A;  4MI4 A;  2L3D A;  3H0D A;  1XDU A;  2VBY A;  2VQY A;  3ABL H;  4KA4 A;  4C9Y A;  4U0V A;  2PMH A;  2R7W A;  2CNM A;  1BA5 A;  2BCO A;  2DA2 A;  1LDJ A;  4KOV A;  1LE8 A;  4PCQ A;  4ESB A;  2CGP A;  2NVT J;  2AFS A;  3FHN A;  2CV1 A;  2EIJ H;  4M6Y A;  5J6X A;  2DTZ A;  3V7Z A;  1BI1 A;  4MFK A;  1XGO A;  4C7I A;  2LDU A;  2OQG A;  1QO0 D;  3ML6 A;  3V8K A;  3PZJ A;  4B10 A;  4UIB A;  2V8G A;  1JUM A;  3TO6 A;  3WTX C;  1RTQ A;  3OYD A;  1MJ9 A;  4RGR A;  3KP4 A;  5IP9 J;  2O03 A;  4CGN A;  5FGM A;  3OIO A;  1YIO A;  3CXS A;  2X4H A;  3KZY A;  2Y0M A;  2ZEP A;  4U5Y A;  1BJA A;  7CPA A;  4N9H A;  3H8E A;  1YIT I;  5JM6 A;  1YFH A;  2VUM J;  3G1L A;  4DJA A;  2XAJ A;  4ZI6 A;  2KJB A;  5EEG A;  1FIA A;  1O3R A;  2WA0 A;  1ZG5 A;  3SZT A;  4JYK A;  3A01 A;  1MJA A;  2CO5 A;  3I9V 2;  5J4Y A;  3GX4 X;  2ZEG A;  1ZHF A;  1LRZ A;  5D4R A;  4FUU A;  3DLA A;  3RKQ A;  2LSO A;  3T5X A;  5EGO B;  2PMZ N;  3WGH A;  2YU3 A;  2PRB A;  2B58 A;  1QBJ A;  4PJ0 C;  3BT9 A;  4U88 A;  4X8I A;  5AG7 A;  1R22 A;  5AON A;  2BOA A;  3FXK A;  1S7L A;  5F04 A;  5AGE A;  5TJJ A;  4EM1 A;  2WPX A;  4XSX F;  1QSO A;  1IXS B;  4DZP A;  2QKM B;  3CUO A;  4IZZ A;  3ZQF A;  3BI1 A;  1OMI A;  4AC0 A;  3BPV A;  1N25 A;  2QQ9 A;  5JHU A;  3GTM J;  1BN5 A;  2NVY J;  1Z8L A;  3JTK A;  2Y9Y A;  4XRM A;  5J4V A;  3MRU A;  3F6V A;  4E6K G;  1I1D A;  3G8W A;  3J7A O;  3WU0 A;  3AFH A;  4AXV A;  4JLY A;  4C2X A;  3SJG A;  3F22 A;  1H88 C;  2V6E A;  1ZH5 A;  2Q43 A;  3L2Q A;  2EFN A;  3D3S A;  1A31 A;  2ZEE A;  1IRX A;  1ZQ3 P;  2CS3 A;  1WKM A;  2OR4 A;  5C3E J;  4MO7 A;  1IUY A;  3SHF A;  4JXR A;  3K0L A;  3PEI A;  3VWB A;  1OJL A;  1IOF A;  1I50 J;  1U2W A;  1MDM A;  2DLL A;  3K4M A;  3QP5 A;  3FEE A;  2VOP A;  4DW6 A;  2VI6 A;  3SEZ A;  4I01 A;  2V9V A;  3HIF A;  4A3E J;  4WX9 A;  4EV0 A;  2XAF A;  2OF7 A;  4EM2 A;  3REO A;  5IYD J;  4PFO A;  1CBX A;  2QJ8 A;  3KQX A;  4W9Y A;  4EME A;  3CQZ J;  4XRS G;  2CUJ A;  4II3 A;  1KA8 A;  3OYL A;  2R8V A;  2CF4 A;  3HRM A;  2DOA A;  2IQ6 A;  1Q1H A;  4HX8 A;  2JVG A;  3LSP A;  2WC2 A;  4CDG A;  1VQL I;  1S5L C;  4A94 A;  2NNY A;  2OAZ A;  5E18 F;  3KPH A;  2KP6 A;  5EG0 A;  2PE3 A;  2D2W A;  2PIZ A;  1YW9 A;  3BJO A;  3BWG A;  4BHC A;  1G4D A;  4AG9 A;  4R3L A;  1QNT A;  5G1Z A;  3BRO A;  4Z2Y A;  3HB9 A;  2FQ3 A;  2NS7 A;  1R4M B;  2X1E A;  4L9V A;  4MFD A;  3HLP A;  3WT4 A;  2F6C A;  5IT3 A;  4GRI A;  1WI3 A;  2KZG A;  1ZLK A;  1V54 H;  1FZP B;  1HCR A;  1R7J A;  2XGC A;  4KZT A;  4CRY B;  1JKR C;  4C30 A;  4LJZ F;  5F49 A;  1R1T A;  5G21 A;  1RO5 A;  5HLG A;  3SEQ A;  4EEF G;  2ZFU A;  3OS1 A;  2OBP A;  2CMP A;  5CVV A;  4HX4 A;  3S15 J;  1TP4 A;  5IP6 A;  1M1E B;  3BR2 A;  2WBM A;  4MRI A;  3B35 A;  3RAM A;  2ZEN A;  5BMZ A;  1YTY A;  3BTC A;  2Z16 A;  2ISZ A;  3S1Q J;  4FIS A;  2HDD A;  2CNT A;  4QPQ A;  3WHB A;  1P7I A;  2DDA A;  2DFF A;  4KMF A;  1CQT A;  2EH3 A;  2L7F P;  2LG4 A;  2M0C A;  1K6O A;  2CFX A;  4M9X A;  3BJA A;  5K8P A;  2L9S A;  2P5V A;  3N05 A;  2YUS A;  3A03 A;  3JRA A;  1DU0 A;  2B4B A;  3TDU C;  2YR2 A;  5J1U A;  3FIS A;  2LKS A;  2O9L A;  1G6N A;  2AFX A;  3GO5 A;  2RDP A;  3LSI A;  4JYW A;  4Z65 A;  1LVA A;  2JWT A;  3W2V A;  1BR4 A;  3ABK H;  3GFJ A;  2IS4 A;  2Z3N A;  3KKW A;  4P4B A;  2JUG A;  2ECB A;  1VQ9 I;  2FRH A;  2COM A;  5E1Z B;  2OD5 A;  4KSI A;  4OME A;  1XB4 A;  1WK4 A;  1ONV A;  1LJ9 A;  1KQ9 A;  3CUQ A;  2R7Q A;  5BQT A;  3CCY A;  4CCN A;  3AG2 H;  2NVU B;  2Q2E A;  1X4O A;  2GXG A;  3V8J A;  4UVA A;  1WQ2 A;  5F6F A;  1O3T A;  2O28 A;  4BU2 A;  4LK1 F;  3ZQI A;  4FTH A;  3OSG A;  1W36 D;  3N7Z A;  4LQ6 A;  1UEL B;  2TCT A;  3K4L A;  2NVQ J;  3SI2 A;  4G7O F;  3DSB A;  3F72 A;  5LGT A;  3AL0 C;  3P2H A;  5D5V B;  4Q5S F;  2HKX A;  3BZC A;  4AU7 A;  2NYQ A;  4CGZ A;  3ERM A;  3NFZ A;  4JWP A;  2VE9 A;  5JPH A;  4B8X A;  4OC2 A;  3VOD A;  3D7D A;  4KT5 C;  2R7R A;  2CV2 A;  1QSM A;  3HKZ N;  2V9K A;  3GFL A;  2P6T A;  2M7B A;  1R6R A;  1TL8 A;  4ZYG A;  1VQ7 I;  4ZC3 A;  4X0G A;  4UVB A;  5FRO A;  2LOO A;  4EJO A;  1A36 A;  2IA1 A;  4E7J A;  4KUA A;  5L3C A;  3F6O A;  2MAB A;  1J7K A;  3L2C A;  1Y1W J;  1KGS A;  4CH7 A;  3VPR A;  3E6B A;  4P5O A;  4U0W A;  2JT1 A;  4HNW B;  4YRH A;  3EY5 A;  2FT0 A;  2VXK A;  2OTL I;  1FEX A;  5F09 A;  4E2A A;  1M44 A;  2HVQ A;  3DEW A;  3K4B A;  4LIU A;  1XC5 A;  2XPV A;  1OCO H;  4ZDL A;  3JRF A;  1AYE A;  2WYR A;  3GW2 A;  2EIM H;  1I6H J;  4PXD A;  1ZAO A;  2FF4 A;  1IIC A;  1UB9 A;  2EBJ A;  3K1M A;  2VB6 A;  3G6E I;  2P4W A;  3KR5 A;  1IDY A;  3W6X A;  2Z9O A;  3R95 A;  4IL6 C;  2VT3 A;  2PJA A;  1FOX A;  1BR2 A;  3CME I;  1HEE A;  3Q0W A;  3QYF A;  4GCV A;  3OOP A;  3W91 A;  4R79 A;  3C2B A;  4YEJ A;  3EPZ A;  5DCM A;  5HNH A;  3IKV A;  5J8C A;  4R1H A;  4C3H J;  2EWN A;  1IF1 A;  1VIX A;  3IJ3 A;  4A3G J;  1B9N A;  3N97 A;  3JRB A;  2WWY A;  1VQ4 I;  2VI7 A;  5IOZ A;  1R5H A;  2XKO A;  2VJJ A;  4IF4 A;  4NC6 A;  1T56 A;  1HF0 A;  2XEJ A;  3M8E A;  2L01 A;  5TGT A;  5DCF A;  3I4M J;  3MQ0 A;  4B48 A;  1ZRF A;  2W00 A;  4OKO A;  3HGY A;  3OWT A;  5EEH A;  2RRE A;  2O53 A;  4WXC A;  4A0Y A;  3BCA A;  2XGD A;  3KP2 A;  1YRE A;  1J75 A;  4CYD A;  2QSG X;  1JUS A;  4BXU A;  1Z67 A;  1VFC A;  2BHZ A;  1I12 A;  2PJC A;  3KYD B;  3KP3 A;  2GM4 A;  1FT7 A;  3CZX A;  1JKP C;  4A12 A;  3CD6 I;  4IHM A;  2OB0 A;  2QYV A;  5A2Q K;  3LNQ A;  5GAG J;  1X12 A;  3G2B A;  4BE1 A;  3FXO A;  1IV8 A;  5IT9 K;  1U5T B;  4EAT A;  2ID3 A;  3FEC A;  3V38 A;  2XIG A;  2WY8 Q;  2LFB A;  5IYB J;  2DU9 A;  4BHB A;  2F7V A;  4R8H A;  2I3C A;  4LIT A;  3GZ5 A;  3QQA A;  5L3G A;  3D67 A;  4HNX B;  2P81 A;  2Q1Z B;  5DS0 A;  1XGM A;  2CG4 A;  2QVP A;  2H6C A;  1P92 A;  1Z05 A;  2NMT A;  4A2Z A;  4E8O A;  2J8N A;  5ISV A;  1TLH B;  2W1O A;  5A2Q Z;  4II9 A;  2VBZ A;  2W25 A;  4GYI A;  3LST A;  5J3L A;  3BJ8 A;  5H20 A;  2R7U A;  5IT9 Z;  4R8F A;  4EQQ A;  3BQZ A;  1YRN A;  1UHW A;  2M34 A;  2XDV A;  3SDB A;  4AYB N;  2ESN A;  4WCG A;  3J7A Y;  4B11 A;  5M3F J;  5HS8 A;  4WJB A;  1G2H A;  4E7S A;  3BC8 A;  4S04 A;  3H8F A;  2E34 A;  3ISP A;  2Q4V A;  3SXY A;  1T6S A;  2LR8 A;  4A3C J;  2REE A;  3KLO A;  1CJW A;  4PQA A;  3ONQ A;  5BPD A;  3TP0 A;  3IO1 A;  3D2M A;  2M8G X;  4K3N A;  2JTV A;  1KUY A;  4G7H F;  1JTX A;  2PFB A;  3FIX A;  1FMW A;  4MIM A;  3HBL A;  3C1D A;  3KZI C;  3S3M A;  1MMD A;  4AD9 A;  1YW7 A;  3PNT A;  2PVV A;  3K2K A;  2RAE A;  4CYO A;  3KQZ A;  2X6Y A;  1YHQ I;  4ZGY B;  3CJQ B;  4O3M A;  3FXU A;  2AXT C;  5D8N A;  4UIA A;  4LGW A;  4BQQ A;  4V19 K;  3F8F A;  2WB1 A;  1R49 A;  3H0G J;  3OR2 C;  3C26 A;  1I1S A;  2FE3 A;  2EK5 A;  2R7S A;  4RB3 C;  3EXN A;  2KL4 A;  3ZMZ A;  2UZK A;  2V9P A;  4PV6 A;  2DMQ A;  3M9A A;  1O3S A;  4HAM A;  2K3P A;  5KTC A;  3OYA A;  5DD8 A;  4BIN A;  5K5R A;  5LYF A;  4F91 B;  2X1C A;  2XAG A;  2VN2 A;  3QU3 A;  4CO8 A;  3SXO A;  1XEB A;  2CU7 A;  3ZMU A;  2KIM A;  4M6V A;  3HDD A;  2KFD A;  4JP0 A;  2DT5 A;  4N0B A;  4DNC A;  4ZYQ A;  4HG2 A;  2BY0 A;  1Z3Y A;  2MW8 A;  4ASN A;  4NGP A;  2JPC A;  4HPS A;  1Y0N A;  2DFI A;  3I71 A;  2E5Z A;  1XPX A;  4RGS A;  2OZG A;  4L8A A;  1SD6 A;  3R9E A;  3K4J A;  2W85 A;  1VF9 A;  1K6Y A;  4S0H B;  3OYN A;  4CAF A;  1P6R A;  3HOU J;  2AHQ A;  2WAD A;  3PGP A;  3G1M A;  4ZDP A;  1YW6 A;  3K4N A;  3CMY A;  2I79 A;  2QZ8 A;  3V8L A;  4QSH A;  2L7Z A;  1GV2 A;  3MN2 A;  4IF5 A;  1Z6R A;  3ZR8 X;  1QA6 A;  3BTI A;  4MCQ A;  4O23 A;  4QB9 A;  2F5E A;  1BPM A;  2VJ5 A;  4N4N B;  3KR4 A;  4PPZ A;  2IGO A;  2EBI A;  5ERI A;  2ZSH B;  5FFZ A;  2CUF A;  4X3R A;  2LP0 A;  1GLN A;  2XPU A;  1PDN C;  4WWC A;  3DKX A;  3E5Q A;  3P9C A;  5IYC J;  2OTJ I;  1FOY A;  3P7N A;  5I0C A;  3A01 B;  1VHO A;  3BTL A;  1OYW A;  4M9S A;  2HEO A;  2BUE A;  4H6U A;  1EJ9 A;  1S7F A;  2PJ9 A;  1XX5 A;  3C3W A;  5IOY A;  4A6D A;  2DN0 A;  4IHS A;  2AFU A;  2E2I J;  1MKM A;  1O57 A;  1UHS A;  3OSF A;  2ZNY A;  2F2E A;  3MZ8 A;  4FHT A;  5BOX A;  2HR3 A;  4KYW A;  2JK3 A;  1ZAR A;  2EZH A;  4CZC A;  3IGR A;  1FBS A;  2ADU A;  4DGW B;  2C1C A;  4L5E A;  1OQY A;  1F36 A;  1KYZ A;  2FML A;  2OC6 A;  3A4C A;  1U8B A;  3M4O J;  1QGP A;  2Y0S N;  5C88 A;  5JQ4 A;  2I10 A;  4XBF A;  3IRR A;  2R0Q C;  3PBE A;  4A3F J;  2FNA A;  2ZOG A;  4H4K C;  4ZTF A;  1QRY A;  2B5G B;  2PDO A;  2UUZ A;  3L2U A;  2Z3L A;  3PUF A;  4LG0 A;  2PJ5 A;  3LMS A;  1MSF C;  1ETK A;  2JLM A;  1XS9 A;  4ONW A;  3WC7 A;  4GO1 A;  1ZR4 A;  1FX7 A;  5GAD J;  5B1B H;  3HOX J;  1MD0 A;  3K69 A;  1QVU A;  4NB5 A;  2FVG A;  2KIU A;  1ORK A;  5TRD A;  3UR3 C;  1IN6 A;  2KZV A;  3LA3 A;  4CHU A;  3BQY A;  1DQU A;  3KP6 A;  3ASN H;  4KIT B;  2WPW A;  4KLV A;  4DOZ A;  1O7L A;  4P1W A;  1HQC A;  2FBI A;  2HOE A;  2JZY A;  2V1N A;  1YLF A;  3B6C A;  4I7H A;  3WAB A;  2R7F A;  4UB8 C;  2HXO A;  3OWC A;  4AID A;  4A38 A;  1WH7 A;  4A3M J;  1MDM B;  1ETY A;  3GTJ J;  3JRC A;  2LBF B;  3N5F A;  2A6T A;  3RKY A;  2TDX A;  2W48 A;  3VB2 A;  1E0E A;  4CPA A;  3OYK A;  2BW3 A;  3D68 A;  3DGV A;  2M45 A;  1VGY A;  3OYH A;  4MQV A;  4XPD C;  1WCM J;  4U87 A;  5CVR A;  3WTV C;  5DUK A;  5C44 J;  5HDG A;  2AJ6 A;  1ULY A;  4F9U A;  2BHY A;  4HPQ A;  2DOE A;  1Z3X A;  2L7K A;  5D5U B;  3OOU A;  2EFW A;  1UWY A;  5LRR A;  4QUS A;  1TWH J;  2VE8 A;  1M4D A;  4G94 A;  2DPS A;  1ZGA A;  4ZY0 A;  4OP4 A;  2YX4 A;  3I59 A;  2W24 A;  2DMP A;  1NE9 A;  4NUB A;  4MFZ A;  1VI0 A;  1LNW A;  2Z5U A;  2FSR A;  3T8R A;  2GIV A;  2E35 A;  2ZME B;  4ZYD A;  1H9G A;  3AG3 H;  3LOD A;  2JA5 J;  4WXH A;  3G4S I;  2HPM A;  3QOE A;  4PSX A;  4IHV A;  4A37 A;  5FO5 A;  3BP8 A;  3FXR A;  2HYG D;  4PUS A;  2HXI A;  3BLY A;  4E4H A;  1BC8 C;  1WWZ A;  3ZRG A;  2IAI A;  1X2M A;  5CYV A;  4P9U A;  1FJL A;  1GDT A;  2G9W A;  1R00 A;  3FMR A;  1NK3 P;  4OC5 A;  4OC4 A;  2ZFW A;  5HVF A;  3WC6 A;  2M9H A;  1EF4 A;  3L00 A;  3R4K A;  4OIP F;  2YU9 J;  1DPU A;  1E3P A;  3TOB A;  3G71 I;  2M4K A;  2C6C A;  4CCK A;  2V8H A;  3GIU A;  1X3Z B;  5HH1 A;  4B6Z A;  1Z9U A;  1PYT B;  2EA2 A;  1IG7 A;  4UUV A;  2Y75 A;  3RYP A;  3NEU A;  4IOC F;  4A3B J;  4RAY A;  2H94 A;  5IB0 A;  3EET A;  1XRY A;  1SVO A;  5HLI A;  4MTD A;  3ROU A;  3WTS C;  4B43 A;  2HWV A;  4BHP A;  2B4D B;  3PFY A;  3W2A A;  1RKT A;  4ENJ A;  1K4J A;  1VQP I;  2A69 F;  4BAY A;  5GPC A;  3ZQC A;  1ZRE A;  1ETW A;  2V79 A;  1LQ1 A;  2HQN A;  1W5C C;  3S2W A;  1J2X A;  3KLN A;  1IY7 A;  3OV8 A;  3G3S A;  4MHY A;  3J7Y J;  2MC4 A;  4PJM A;  1QHH D;  1XCV A;  2HFH A;  3CUQ B;  1MMG A;  2R4G A;  2PJ2 A;  1YSJ A;  3W6K B;  2G9D A;  1YR0 A;  1TKH A;  4C68 A;  5CPR B;  4OMY A;  2A4N A;  5LD2 C;  1T08 B;  2YNE A;  3O8H A;  1LDD A;  1V0C A;  2R5Z B;  2OH1 A;  4PSW A;  3LSM A;  3AG1 H;  5KTA A;  4FQG A;  3L2W A;  5LEJ A;  3PB7 X;  4DJL A;  2IXS A;  1OYI A;  2I8D A;  2X51 A;  2WV0 A;  3R9F A;  2DTR A;  2L4M A;  2K9Q A;  3PNY A;  3PRT A;  2PJB A;  1MH3 A;  4E7H A;  1BI0 A;  2P7C B;  3CPX A;  1XSV A;  3TKY A;  5K8M A;  1Z2L A;  2KRC A;  2WAQ A;  1NK2 P;  1FSH A;  2C6P A;  3HOS A;  1T39 A;  1ERD A;  2YND A;  1S8N A;  3CF2 A;  1V5E A;  2VQC A;  5HLH A;  3KET A;  4EVY A;  1I39 A;  1IOI A;  4R76 A;  3J81 Z;  3GTG J;  4Y17 A;  2IJL A;  4RI1 A;  3HXL A;  3MN8 A;  4UUS B;  1IC8 A;  4QPO A;  1ZRC A;  4C2Z A;  2GOX B;  2IBD A;  4KMU X;  3VWE A;  2BY1 A;  2QQB A;  3TT2 A;  4D0P A;  3JCU C;  4QVT A;  4UFV A;  3SJM A;  5E8G A;  3EYY A;  3OYB A;  5J1R A;  1TXR A;  1Z4R A;  3IWE A;  1RNL A;  4OIO F;  4NCZ A;  4XN0 A;  3FXM A;  2JQ7 A;  1WH5 A;  2FL4 A;  4Y49 C;  3I55 I;  2BEI A;  2FQ4 A;  2P8T A;  1IN7 A;  3ZQH A;  1IV6 A;  3SJE A;  5D8L B;  2ZJQ F;  2PN6 A;  1JXS A;  1XBU A;  1FOK A;  4KOU A;  1Z4E A;  2MH2 A;  2G0E A;  4HNY B;  2F8H A;  1IGB A;  4L89 A;  3I5U A;  2JJ7 A;  2BYV E;  5G20 A;  3RTR A;  1A35 A;  1Z5R A;  3TO7 A;  4Q4Z F;  3FB3 A;  4RAZ A;  2VLA A;  1TKJ A;  2R5Y A;  2ZEM A;  1V5F A;  3HUG B;  2F4M B;  5DV5 A;  3MKL A;  2B9S A;  4FD4 A;  3FED A;  2PJR A;  3H9G A;  3CCU I;  4ORF A;  4C3J J;  2LVS A;  3S9M A;  1APL C;  2XAS A;  1KZF A;  2GLF A;  4ON0 A;  9ANT A;  3WG7 H;  2ZXW H;  4RDU A;  4FET A;  2FS5 A;  1A6I A;  1HLV A;  4BBH A;  4CAX A;  1VQ6 I;  3DDD A;  4CCL A;  4I02 A;  4ESJ A;  3TCV A;  4M3G A;  1X1P A;  2QUF A;  5F1R A;  2DBB A;  3TBI A;  4V2F A;  3MD2 A;  4XLH A;  1NSL A;  4RB2 C;  3LWF A;  1LAM A;  4AUX A;  1ZLJ A;  4WF2 A;  4DYC A;  3RQI A;  1ZGJ A;  1LPQ A;  4KN4 X;  4XOT A;  4IHY A;  2OJE D;  2XV4 S;  4CUG A;  4ITV A;  5JHF A;  3HRT A;  2M7A A;  2V1X A;  3I64 A;  1FYL A;  1U8R A;  4ZX9 A;  2Z3Y A;  1P7J A;  3QAH A;  1Y0Y A;  1FIP A;  1VZ0 A;  4XOP A;  1PP8 F;  3E0J B;  4MY0 A;  4CYQ A;  3KIO A;  2V26 A;  4YU9 A;  5LRG A;  5B3S H;  1NHA A;  3DF8 A;  4XLP F;  1EH6 A;  2XGE A;  2O61 A;  4F8Z A;  4CSW A;  4I0B A;  3JRE A;  1K4S A;  2VBQ A;  5HVH A;  1B1B A;  2R1I A;  4XNH B;  3ZMD A;  4II2 A;  2P5K A;  1U0J A;  1AMP A;  2XEF A;  2QBY A;  4UNO A;  4FWU A;  3E97 A;  1H89 C;  1Z91 A;  2UWM A;  4BBR J;  3ZQL A;  3JVN A;  2LNB A;  3L09 A;  2UXN A;  3LA2 A;  2E36 A;  3F23 A;  4CYC A;  1LVK A;  2QF7 A;  1ZR2 A;  5LBQ A;  2GAU A;  1DE4 C;  4LMY A;  1GVD A;  3B02 A;  1TT0 A;  4IJA A;  1YX0 A;  3MVP A;  4BD9 A;  4BMH A;  2OCE A;  4MTE A;  1PUF B;  4B1R A;  2ELK A;  4A3L J;  4R7M A;  2HDW A;  1ZG7 A;  2DJI A;  2RB7 A;  1ARM A;  4UV9 A;  2NSM A;  3HPG A;  2X48 A;  2NNN A;  3B3V A;  3ECO A;  1UMQ A;  3TP3 A;  1YME A;  3P9K A;  4NJQ A;  2BEO A;  2L2O A;  3HTU A;  1W7P B;  4U0Y A;  2A61 A;  4PJJ A;  2IA0 A;  4IOA F;  3CF5 F;  1BC7 C;  2HC9 A;  3DTK A;  4XLC A;  1HBX G;  2HDC A;  3GLL A;  1LEA A;  3BR0 A;  4NXY A;  3UY5 A;  3CJR B;  2ZJP F;  3D5L A;  5J8F A;  1RXT A;  2LKP A;  3PB6 X;  1T95 A;  4Q7A A;  1YI2 I;  2KIQ A;  1BBY A;  2EIK H;  4LFU A;  3ECH A;  2PQ8 A;  1UG2 A;  3JRG A;  2PC1 A;  4P96 A;  2FX0 A;  5FFX A;  3ZQ7 A;  1FWZ A;  2Z3O A;  3RPU D;  4R87 A;  3I0T A;  2X85 A;  5EYR A;  1X4P A;  1DGR M;  2WY7 Q;  4HBL A;  4HDU A;  1YYV A;  1G59 A;  1QSR A;  1X10 A;  4FX4 A;  5ICF A;  1CF7 B;  3D7H A;  3LWU A;  1S7K A;  1UCR A;  5GTI C;  5KCM A;  4BQO A;  3HOZ J;  3M07 A;  2COB A;  2JMW A;  4Y7N J;  4A32 A;  3HHH A;  3BG6 A;  5LHI A;  2L54 A;  1FLI A;  3H3U A;  4PK4 A;  4XKB A;  2EIL H;  2R7Z J;  1HSJ A;  1B6B A;  2JEW A;  3JTH A;  3MKW B;  2KIS A;  4NQW A;  4IX7 A;  4A3J J;  4L5J A;  2STW A;  4I0A A;  4GFB A;  2F5C A;  2IVM A;  4NC7 A;  5B1A H;  2O0Y A;  4F93 B;  1JT0 A;  4UWI A;  2VKE A;  1G3W A;  2DK8 A;  5GAH J;  3R0J A;  3WE3 A;  1GT0 C;  2Y2Z A;  3D2P A;  2PLY A;  4HF1 A;  2X9D A;  4UEF A;  2FUG 2;  4CCJ A;  1L3L A;  1OCT C;  3IU1 A;  3DPU A;  3V7C A;  1P4X A;  1JT6 A;  4G8X A;  4ZH4 F;  3VAR A;  2EFO A;  2P6F A;  2AFW A;  2CIJ A;  2QEN A;  1B9M A;  5E79 C;  3SI0 A;  4AVA A;  4HNT A;  4UCM A;  1VQ5 I;  2IS6 A;  5FKK A;  4GXH A;  5CPA A;  1JQG A;  2G7H A;  1BOB A;  3R9G A;  1YS7 A;  1ZG8 A;  5H84 A;  2GLJ A;  3EFA A;  3CDI A;  4BJ5 C;  2EK9 A;  1HKT A;  3E6D A;  1OYY A;  1RUO A;  2VON A;  1EKE A;  2GBY A;  3NH8 A;  4XNF A;  1X1C A;  2M8E A;  4CYP A;  4IK2 A;  3RQ4 A;  1FOW A;  1AA7 A;  2LC2 A;  5D5W B;  4J00 A;  4M85 A;  3K70 D;  3FXT A;  4PXB A;  2I5U A;  3LA7 A;  3H3V K;  3T8W A;  4I98 B;  2M30 A;  2M4G A;  5E96 A;  3WTW C;  4N4O B;  4BGD A;  3WG9 A;  4RGX A;  4Y4R A;  3C2G A;  4KN7 X;  4RBO A;  1ITY A;  2ZOF A;  4MXU A;  3CPA A;  2NYX A;  1CX8 A;  3S1M J;  3PSI A;  1LFW A;  1YQA A;  3F8M A;  4PXC A;  4A2U A;  3BG3 A;  5HNF A;  3CXP A;  4MHZ A;  4LG0 B;  3PUB A;  3MAJ A;  3SJF A;  2W84 A; 
#chains in the Genus database with same CATH homology
 2Z3K A;  3T9Y A;  1KUY A;  3VSL A;  2YNC A;  1IB1 E;  3FIX A;  1FMW A;  3F0A A;  2A5W A;  4R9M A;  3S3M A;  3K4C A;  4XKV A;  1MMD A;  2HVR A;  4JJX A;  3PNT A;  3F5B A;  3S6G A;  4CYO A;  4ZGY B;  2X6Y A;  2HUZ A;  3L2R A;  3CJQ B;  1YK3 A;  4KS9 A;  4BQQ A;  3NE7 A;  2O5R A;  1WJC A;  4BQN A;  4UCN A;  2WB1 A;  4HNU A;  3OR2 C;  4BJT A;  3TFY A;  3C26 A;  4OWR B;  4QBJ A;  2R7S A;  2YGW A;  4FAS D;  4BDY A;  3HL2 A;  2KL4 A;  3EXN A;  4OAD A;  4PV6 A;  2WUU A;  3LD2 A;  4B5P A;  5AG4 A;  3I3G A;  4Y49 B;  1HA8 A;  2K3P A;  3HC7 A;  3ZXS A;  3VYR B;  4I49 A;  3OIQ A;  3S6H A;  2QIR A;  3OYA A;  3IAS 2;  5KTC A;  5BWA B;  4DBQ A;  2Z11 A;  4F91 B;  1D1B A;  2X1C A;  1D1C A;  3SXO A;  1XEB A;  2JDC A;  2Q0Y A;  3BCB A;  3IWG A;  3PP9 A;  2WSA A;  4J3G A;  2Z2S B;  4KOR A;  2G3A A;  4CRZ B;  4DNC A;  3LL7 A;  4HG2 A;  2KDO A;  4KOS A;  2FCK A;  1Z3Y A;  2UV1 A;  5CNP A;  1WFX A;  5ISV A;  4XL9 A;  2OZG A;  2E5Z A;  4L8A A;  3R9E A;  2CXA A;  3K4J A;  5CQG A;  1SFK A;  4XPD B;  2E1M B;  4OLL A;  5F46 A;  4NSQ A;  2BOL A;  2V7F A;  2XF6 A;  1K6Y A;  3T90 A;  4F52 A;  3DPT A;  3OYN A;  3OYI A;  4FD6 A;  2WAD A;  3PGP A;  4CAF A;  4CAV A;  3PL8 A;  4ZDP A;  3KEY A;  2ZW6 A;  3ZZI A;  3K4N A;  4F0Y A;  4RMN A;  3V42 A;  1D0Z A;  3FBN B;  2I79 A;  1DGW Y;  1L0C A;  5H86 A;  4AVB A;  1XMT A;  4H6Z A;  4OAE A;  4BXF A;  3DWL E;  1JI8 A;  2B5G A;  3D5R C;  2REF A;  1Y56 A;  3ZR8 X;  2VZY A;  1LFP A;  3DKY A;  1X1B A;  3IU2 A;  3H5A A;  4QB9 A;  2VJ5 A;  4N4N B;  5HLT A;  2IGO A;  4B5P B;  4LIV A;  2VJI A;  2HQY A;  1VKC A;  1MJB A;  2ZSH B;  2ZW4 A;  4UWJ A;  4AVC A;  3FNC A;  1CM0 A;  4JOM A;  1GLN A;  3MGD A;  5KTA A;  3AKZ A;  3DKX A;  4BEH B;  2HPI A;  4C2U A;  5I0C A;  5A28 A;  2ZXH A;  4CAE A;  1S5K A;  5FRN A;  2QKL B;  2BUE A;  1YX5 A;  3FDY A;  3QOD A;  5KNL A;  4H6U A;  4MBU A;  1S7F A;  2CNS A;  1WJD A;  4CGO A;  3FRM A;  5IX3 A;  2XAU A;  1X1D A;  4KSA A;  2F5V A;  3FBU A;  2VXD A;  2OZU A;  3IUO A;  3SZG A;  4CZC A;  3IGR A;  2W7N A;  1BR1 A;  5GCN A;  2H5M A;  4JD6 A;  4DGW B;  2HVS A;  4ZBG A;  3TTH A;  2OC6 A;  4C2T A;  2LBF A;  3K6G A;  3VYT B;  3GYA A;  2NOJ B;  3A4C A;  3EUK L;  3OYJ A;  3A2K A;  1M4G A;  4GS4 A;  4UBR A;  3UNG C;  3AL0 B;  3S6F A;  5C88 A;  1GHE A;  5JQ4 A;  1N78 A;  3EUH C;  2K5C A;  5F47 A;  4A31 A;  1OLT A;  4B47 A;  1Q2C A;  2CW8 A;  3K4K A;  4J01 A;  4H4K C;  4XMY A;  4ZTF A;  2ZXV A;  5CKT A;  2ATR A;  2B5G B;  2PDO A;  2UUZ A;  3L2U A;  2Z3L A;  1LDK B;  4XNH C;  4F92 B;  2R7T A;  3W2W A;  1LKX A;  2Q04 A;  3CMM A;  3BG7 A;  2F4I A;  3OIP A;  4XON A;  2JLM A;  3MMY B;  3RCO A;  4MLO A;  3EO4 A;  2G0B A;  1IYK A;  2D4O A;  4DBR A;  1V5G A;  3SXN A;  3V8I A;  2CW7 A;  2JEV A;  2LH9 A;  3DQV C;  3DTI A;  5DWM A;  3SYT A;  1WJA A;  3UR3 C;  2KZV A;  2IL4 A;  2MD0 A;  1J09 A;  1DQU A;  2XC7 A;  2WPW A;  3CP8 A;  4KIT B;  2D4P A;  3DPL C;  4DOZ A;  1UAA A;  1TIQ A;  4KLV A;  5KTD A;  4BE0 A;  4F0X A;  4P1W A;  4Y33 A;  3GKR A;  2V1N A;  3LSH A;  2Q4Y A;  3VYU B;  2J8M A;  2ELJ A;  2RC4 A;  4XOR A;  1Y9K A;  4B14 A;  3OWC A;  3E1S A;  3NWT A;  4RLF A;  3LMM A;  2R98 A;  3PJR A;  2JVH A;  2LBF B;  4UCP A;  3PNV A;  1XIX A;  1Q2D A;  2A6T A;  3OYM A;  3HPH A;  4PFP A;  3ZQQ A;  4MFL A;  1E0E A;  4B12 A;  3S93 A;  3OYK A;  2BW3 A;  3TO9 A;  2KPM A;  4A33 A;  3OYH A;  3TL4 X;  4UFX A;  4XPD C;  4U87 A;  3OMY A;  2K5T A;  4MFJ A;  4ZTJ A;  2K9M A;  2AJ6 A;  1YVO A;  1BO4 A;  2P6E A;  4Y3O A;  2AQE A;  4HPQ A;  4UA3 A;  2R7V A;  1Z3X A;  2L7K A;  4OAY A;  3OOU A;  2LYC A;  4ZYA A;  4CCM A;  4U7B A;  3H0D A;  3S3O A;  2VQY A;  3OYF A;  4JXQ A;  4C9Y A;  4XLE A;  1M4D A;  4QUS A;  4XKC A;  3FBI B;  2R7W A;  2CNM A;  2DPS A;  2ZPA A;  4CYN A;  2JA2 A;  2B4D A;  4KOV A;  1NE9 A;  4NUB A;  2PMZ A;  2BVL A;  4MFZ A;  3FHN A;  2CV1 A;  4KJZ A;  2FSR A;  3EC4 A;  1D0X A;  2GIV A;  4MFK A;  4C7I A;  3LOD A;  4B13 A;  2HPM A;  3QOE A;  4PSX A;  2BSW A;  3PZJ A;  1P0H A;  4PUS A;  4B10 A;  1Y6I A;  3BLY A;  4E4H A;  3TO6 A;  1UG0 A;  3OYD A;  2LRE A;  1MJ9 A;  3ZRG A;  1WWZ A;  1WJF A;  3GBG A;  1D0Y A;  4F3Q A;  4IUS A;  4CGN A;  4IKF A;  3CXS A;  2J8R A;  1WJE A;  2Y0M A;  5DWN A;  4U5Y A;  2CUZ A;  3HKZ A;  5HOO A;  2KMU A;  1YGH A;  4IF5 A;  3R1K A;  3DNS A;  3H9Q A;  4DJA A;  2F5I A;  2QML A;  4MI4 A;  4BEH A;  4CA0 A;  3TOB A;  5KHD A;  2M4K A;  2WA0 A;  4CCK A;  2BW3 B;  1MND A;  3RSN A;  3I9V 2;  1MMA A;  1MJA A;  5HH1 A;  4B44 A;  2JDD A;  2VZZ A;  1Z9U A;  2VKD A;  1LRZ A;  2PR1 A;  3S3N A;  3DLA A;  3VYS B;  3S6K A;  2PRB A;  4X5K A;  3R9G A;  2B58 A;  1R57 A;  5IB0 A;  4PK2 A;  5AG7 A;  1DP3 A;  5G22 A;  4B43 A;  2B4D B;  4DIQ A;  2Z3P A;  3PFY A;  2X7B A;  3W2A A;  1S7L A;  2RQQ A;  1K4J A;  2FIW A;  4BDZ A;  5AG5 A;  1X19 A;  4CS0 B;  1IID A;  5FVJ A;  5AGE A;  2WPX A;  2DXI A;  2VEZ A;  1G8X A;  1QSO A;  2V4J C;  4XPL A;  2E5N A;  2Q7B A;  2QKM B;  4E0A A;  4IZZ A;  1OR7 C;  4NEX A;  3TE4 A;  3JUW A;  3G3S A;  4B5O A;  3H5Z A;  2K9L A;  2MC4 A;  4PJM A;  1QHH D;  1QST A;  4XM3 A;  1MMG A;  2X1D A;  2R4G A;  3JTK A;  1WJ5 A;  1VHS A;  4UFW A;  3K9U A;  4E6K G;  1I1D A;  1YR0 A;  3G8W A;  1S3Z A;  4C68 A;  3AFH A;  5CPR B;  2A4N A;  3K10 A;  4NNJ A;  5LD2 C;  2YNE A;  4JLY A;  4YRV A;  4KOY A;  4C2X A;  4XR6 A;  1V0C A;  2OH1 A;  3IP4 B;  4PSW A;  3LSM A;  4XQF A;  2V6E A;  5LFA A;  2CY2 A;  3L2Q A;  3L2W A;  1ON0 A;  2GOM A;  3GY9 A;  3D3S A;  2IXS A;  2I8D A;  2R7O A;  2X51 A;  1IRX A;  3R9F A;  2CS3 A;  4KVO E;  3PNY A;  1EA3 A;  4JXR A;  4E7H A;  3LSG A;  3PSF A;  3VWB A;  3ZGK A;  3OYG A;  1I21 A;  1PUA A;  2KRC A;  3OY9 A;  2WAQ A;  3K4M A;  3LSK A;  1ZEL A;  3HOS A;  1N77 A;  3B8G A;  1Z21 A;  1ERD A;  3SEZ A;  2YND A;  2KRH A;  4F55 A;  3D8P A;  4PK3 A;  2ZXI A;  3CF2 A;  1V5E A;  2VQC A;  4EVY A;  5EC4 A;  4BUP A;  4PFO A;  2HV2 A;  2X6X A;  2VPL A;  3CES A;  3HXL A;  4RI1 A;  2CUJ A;  4II3 A;  4F6A A;  3OYL A;  4QPO A;  4C2Z A;  2R8V A;  2GOX B;  4U9Y A;  2DOA A;  1S9H A;  3VWE A;  1YX3 A;  2OV7 A;  2JVG A;  1U6M A;  2OZH A;  1N75 A;  4LG3 A;  1P9Q C;  4A30 A;  2VIX A;  4D1Q A;  3TT2 A;  4FD7 A;  3KX2 A;  2KLO A;  3BLN A;  4QVT A;  1NG7 A;  4UFV A;  2KP6 A;  4ZDO A;  4YFJ A;  1SQH A;  2VQH A;  2EVN A;  4AG9 A;  2E60 A;  3OYB A;  3RYO A;  4KOX A;  4R3L A;  1Z4R A;  5G1Z A;  2HZD A;  3K70 C;  2OU2 A;  2X1E A;  3IWE A;  2FXF A;  4NCZ A;  4XN0 A;  4AVZ A;  1OZP A;  2Z0Z A;  2F6C A;  2OUM A;  4GRI A;  2FL4 A;  3DR8 A;  4Y49 C;  2BEI A;  4CGL A;  4KOT A;  4KZT A;  3OR1 C;  4CRY B;  4E7Z A;  4C30 A;  4QC6 A;  3MKY B;  5F49 A;  4KOU A;  4M3S A;  1Z4E A;  5G21 A;  1RO5 A;  4HNY B;  3SEQ A;  4YEL A;  1MNE A;  2ZFU A;  3OS1 A;  1M1D A;  4L89 A;  1MK4 A;  2DCE A;  2CMP A;  2IS2 A;  1PYV A;  2B3U A;  5G20 A;  3TMO A;  3RTR A;  3TO7 A;  3FB3 A;  4CAW A;  2VLA A;  2WBM A;  3M8J A;  4A95 A;  2ARH A;  1V5F A;  3HUG B;  3S8P A;  2CNT A;  4CGP A;  2Z16 A;  4FD4 A;  2PJR A;  3H9G A;  4QPQ A;  2YNC C;  4RLQ A;  1ZO0 A;  4ORF A;  2XF7 A;  2E1M C;  2IGM A;  1KZF A;  2LG4 A;  2L9S A;  4FET A;  3NWS A;  3N05 A;  4HRI A;  2BL1 A;  2DXQ A;  2FS5 A;  3C2H A;  2BVM A;  1MMN A;  2IGN A;  3BJ7 A;  3DDD A;  5EBV A;  2KQR A;  2FIA A;  4BBH A;  4CAX A;  4CCL A;  2B4B A;  3CXQ A;  4XLF A;  1YLE A;  3TCV A;  2LRD A;  4RM2 A;  3TBI A;  3LSI A;  3MD2 A;  4XLH A;  4LUA A;  4H89 A;  1NSL A;  3W2V A;  1BR4 A;  2IS4 A;  2Z3N A;  4HSR A;  3KKW A;  4BS9 A;  2JUG A;  4XOT A;  1Y9W A;  4KT6 A;  4CUG A;  2VL8 A;  2M0M A;  4HEA 2;  4ITV A;  5JHF A;  2M7A A;  1WK4 A;  3E0K A;  2IGK A;  2VAS A;  2KCW A;  3R96 A;  4IQJ A;  1FY7 A;  2R7Q A;  3QAH A;  4CCN A;  2FE7 A;  4MHD A;  4ONU A;  1VZ0 A;  4XOP A;  1X4O A;  3E0J B;  4MY0 A;  4CYQ A;  2O28 A;  2V26 A;  3DTE A;  3DU6 A;  4BU2 A;  4HST A;  3TOA A;  4G6T B;  1W36 D;  4CSW A;  2HNH A;  4E7I A;  3CZ6 A;  2Z1D A;  3SHP A;  2PJR B;  1KUV A;  3N7Z A;  2VBQ A;  1UEL B;  2DT6 A;  2WAE A;  2I00 A;  5AG6 A;  2L9N A;  2ZW7 A;  3K4L A;  2R1I A;  4XNH B;  3DSB A;  4II2 A;  5C82 A;  1U0J A;  2GE3 A;  1QU3 A;  3AL0 C;  1M4I A;  3F8K A;  2PSW A;  3P2H A;  4KVX A;  3H4Q A;  3QYE A;  2MYS A;  4AU7 A;  4FD5 A;  2UWM A;  3JVN A;  1D1A A;  4MFP A;  4NF1 A;  3DR6 A;  5A27 A;  4JWP A;  5JPH A;  3H5N A;  3P2F A;  1LVK A;  4HKF A;  1YVK A;  1XF8 A;  3QB8 A;  5FRM A;  2R7R A;  4ANJ A;  4BJ6 C;  2CV2 A;  1QSM A;  1Q2Y A;  2V9K A;  2M7B A;  1R6R A;  1TT0 A;  1YX0 A;  2MFZ A;  4ZC3 A;  4X0G A;  5FRO A;  2LOO A;  4BMH A;  3OYC A;  4E7J A;  4KUA A;  1J4J A;  3H5R A;  2MAB A;  4BAC A;  4YGO A;  3CP2 A;  2HDW A;  4PJN A;  2DJI A;  4B3X A;  4CH7 A;  2Q2E B;  2LY1 A;  3KYL A;  3S32 A;  4P5O A;  4C7H A;  3HPG A;  4CGM A;  4BE2 A;  4HNW B;  4YRH A;  3EY5 A;  2FT0 A;  2P0W A;  2VXZ A;  4XLA A;  3L2V A;  2PR8 A;  2VXK A;  3A9L A;  4R3K A;  3EUA A;  4D9J A;  2AE6 A;  2LY2 A;  2L2O A;  3IAM 2;  1M44 A;  4E2A A;  2HVQ A;  3K4B A;  1T0F C;  3OL3 A;  4LIU A;  4PJJ A;  2M3A A;  4ZDL A;  3VDX A;  1N71 A;  2HQA A;  1XE4 A;  1Z7L A;  3DTK A;  4XLC A;  3OS2 A;  3UY5 A;  3H9J A;  4NXY A;  1IIC A;  1QHG A;  3CJR B;  3D5L A;  1RXT A;  2GAN A;  5J8F A;  2W4S A;  2VB6 A;  1T95 A;  2RNG A;  3W6X A;  4KIS A;  1KON A;  4XPK A;  4KSF A;  3R95 A;  2Y0S A;  1BR2 A;  3LFU A;  2PQ8 A;  2PC1 A;  2WAF A;  3QYF A;  3W91 A;  4AG7 A;  3M1C A;  4R79 A;  2P6G A;  4R57 A;  4YEJ A;  3EPZ A;  1IYL A;  5HNH A;  2Z3O A;  3RPU D;  4R87 A;  2VQL A;  2X85 A;  3OL4 A;  1X4P A;  1DGR M;  2WY7 Q;  1QSR A;  2Q44 A;  4MJ8 A;  1G59 A;  5J8C A;  2DPT A;  2W82 A;  1S7N A;  4AB7 A;  2VI7 A;  4KLW A;  1Y7R A;  3HOT A;  1X1A A;  2CFO A;  2VJJ A;  3W3C A;  1S7K A;  4IQ4 A;  5KCM A;  4BQO A;  1NG6 A;  1FMV A;  4E7K A;  4A32 A;  2XF5 A;  1QSN A;  3BG6 A;  5TGT A;  4PK4 A;  2XSJ C;  4XKB A;  3VSK A;  1WJB A;  2W00 A;  4JQF A;  2VQG A;  4B48 A;  1P4N A;  1B6B A;  3OWT A;  3MKW B;  4U9Z A;  2RRE A;  4PJL A;  5HVQ C;  2Z10 A;  3BCA A;  3DU5 A;  4IX7 A;  1YRE A;  5E96 A;  4NC7 A;  1SAU A;  1I12 A;  2Z3M A;  1NMT A;  3I9S A;  4F93 B;  1PJR A;  2KHM A;  1MW7 A;  4Q38 A;  4XN3 A;  2VJ4 A;  2R7X A;  2OB0 A;  4UWI A;  3VWD A;  5IV0 A;  1UFH A;  2IS1 A;  1S60 A;  3DEE A;  3MKZ A;  3OS0 A;  2ZW5 A;  4AYB A;  2L5Q A;  3D2P A;  4MFQ A;  2DT7 B;  3ZJ0 A;  2FUG 2;  3G2B A;  4BE1 A;  4CCJ A;  2CV0 A;  3IU1 A;  5H84 A;  3DPU A;  2G3T A;  4EAT A;  2P6F A;  2VKH A;  4CCO A;  2WY8 Q;  4AVA A;  3HG9 A;  4OAZ A;  4HNT A;  4UCM A;  4LIT A;  2IS6 A;  2ZSI B;  4ZJZ A;  1KUX A;  3FKJ A;  1BOB A;  2HU9 A;  4RM3 A;  1B87 A;  2X6W A;  4HNX B;  3D5S C;  4LX9 A;  2Q1Z B;  3EFA A;  3A1Y A;  2JSP A;  4BJ5 C;  3OYE A;  2C27 A;  4MY3 A;  2EUI A;  4E7L A;  2NMT A;  3FYN A;  4A2Z A;  4E8O A;  2AQF A;  1X1C A;  4XNF A;  4CYP A;  4XKW A;  3RQ4 A;  1AA7 A;  1TZL A;  2CH0 A;  2LC2 A;  4J00 A;  3ZCO A;  2B3V A;  2J8N A;  3K70 D;  4KOW A;  3FXT A;  2W1O A;  4KUB A;  4M85 A;  4RS2 A;  5F48 A;  4II9 A;  3BJ8 A;  3W6S A;  4K30 A;  2R7U A;  4NQW B;  2M4G A;  3I3L A;  3QYB A;  3J7A Y;  2XDV A;  3SDB A;  4BL0 B;  4N4O B;  4BGD A;  4B11 A;  4Y4R A;  4E7S A;  3BC8 A;  5CQE A;  3C2G A;  2R7H A;  4NC8 A;  2Q4V A;  3WR7 A;  3PSI A;  1PU9 A;  2REE A;  3U21 A;  1CJW A;  4Q36 A;  5HNF A;  1W36 C;  3CXP A;  3ONQ A;  4C2Y A;  1YE9 A;  3H35 A;  4KVM E;  5HMN A;  3F9K A;  3PUB A;  2QEC A;  3D2M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...