4PSWA

Crystal structure of histone acetyltransferase complex
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
316
structure length
316
Chain Sequence
DFKPETWTSSANEALRVSIVGENAVQFSPLFTYPIYGDSEKIYGYKDLIIHLAFDSVTFKPYVNVKYSAKLGDDNIVDVEKKLLSFLPKDDVIVRDEAKWVDCFAEERKTHNLSDVFEKVSEYSLNGEEFVVYKSSLVDDFARRMHRRVQIFSLLFIEAANYIDETDPSWQIYWLLNKKTKELIGFVTTYKYWHYLGAKSFDEDIDKKFRAKISQFLIFPPYQNKGHGSCLYEAIIQSWLEDKSITEITVEDPNEAFDDLRDRNDIQRLRKLGYDAVFQKHSDLSDEFLESSRKSLKLEERQFNRLVEMLLLLNNS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone acetyltransferase type B catalytic subunit
publication title Hat2p recognizes the histone H3 tail to specify the acetylation of the newly synthesized H3/H4 heterodimer by the Hat1p/Hat2p complex
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transferase
total genus 101
structure length 316
sequence length 316
ec nomenclature ec 2.3.1.48: Histone acetyltransferase.
pdb deposition date 2014-03-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
A PF10394 Hat1_N Histone acetyl transferase HAT1 N-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.390 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4pswA03
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4pswA02
3.90.360.10 Alpha Beta Alpha-Beta Complex Histone Acetyltransferase; domain 1 Histone acetyl transferase 1 (HAT1), N-terminal domain 4pswA01
1IYLA 1S7KA 4L89A 3PGPA 2Q0YA 4YRHA 1M4DA 2Q04A 1CJWA 2Z0ZA 2ZXVA 3R1KA 5ISVA 1BOBA 1YX0A 4XPLA 2RC4A 1ON0A 2OZUA 2CNTA 1PUAA 4KOWA 2AE6A 4AG7A 4CRYB 2FL4A 2G3AA 4RI1A 1B6BA 2PR1A 2VI7A 3IWGA 1RO5A 4KOXA 4KVOE 2VBQA 3V8IA 1P4NA 1QSRA 4JLYA 3EO4A 3TO6A 2WPXA 2J8MA 5KTCA 3R9FA 3OWCA 3D2MA 4CAVA 3LD2A 4MI4A 3G8WA 2BEIA 5FVJA 2Y0MA 2REFA 4F0YA 1MJ9A 2PRBA 2J8RA 3N7ZA 4UA3A 4MHDA 3EC4A 2JDDA 4RS2A 2CY2A 3JUWA 5H86A 2PQ8A 4CAXA 3NE7A 4R3KA 3P2HA 4PSXA 2J8NA 3D3SA 4HNWB 2R7HA 4IUSA 4KOSA 3MGDA 1MJBA 4M85A 1YREA 4MY0A 2OH1A 4X5KA 3R9EA 4U5YA 3KKWA 4NF1A 2VXKA 2JEVA 2B58A 4CS0B 3S6KA 5HMNA 4BMHA 1Y9KA 3RYOA 3P2FA 3GY9A 2FCKA 1WWZA 2FS5A 2GANA 1Z4RA 4QVTA 1IIDA 4LUAA 4EVYA 2ZW4A 4KLWA 4R87A 1YGHA 4L8AA 5IB0A 1MK4A 2GIVA 3TT2A 3QB8A 3F8KA 1PU9A 2WPWA 1SQHA 2BSWA 4FD5A 1KUVA 4CAWA 4B5PB 4MJ8A 1OZPA 2FT0A 4KVXA 3W6SA 4HNXB 4KZTA 4QUSA 3B8GA 1QSNA 2JDCA 1Z4EA 2I79A 3ZJ0A 1KUYA 1WK4A 4XPKA 3T9YA 2REEA 2O28A 3FBUA 3ZZIA 1YK3A 2EVNA 3TE4A 3W91A 1V0CA 1KUXA 4I49A 4M3SA 3TFYA 2Q4VA 4JXRA 2ZW7A 4KUAA 5C82A 2EUIA 2C27A 2B3VA 4YFJA 4KVME 1YLEA 2ARHA 2Q4YA 4H6ZA 4KLVA 2PC1A 1B87A 2ZPAA 5JQ4A 5C88A 5DWMA 4Y49B 1Q2DA 2P6FA 1S3ZA 1Y9WA 3D2PA 2KCWA 2JLMA 3PP9A 4Y49C 2IL4A 4F6AA 1M4GA 4HKFA 2CNMA 4AB7A 1XEBA 2G0BA 4CRZB 4J3GA 3TOAA 1R57A 2QMLA 1VKCA 3GYAA 1I1DA 3DNSA 3CXSA 2QECA 3EXNA 4NSQA 1IB1E 4DNCA 4FD4A 2OZGA 4OAEA 1S7NA 2AJ6A 5J8FA 2K5TA 2OU2A 2NMTA 4KUBA 1XE4A 1NSLA 2A4NA 3DSBA 2CNSA 4QC6A 3FNCA 2B3UA 4UWIA 2B4DA 1YR0A 1QSTA 4JJXA 1BO4A 4R57A 2D4OA 3CXQA 5F46A 4UWJA 1IYKA 2PR8A 1QSOA 2D4PA 3WR7A 4JWPA 1N71A 1VHSA 1KZFA 3GKRA 4QB9A 1NE9A 3TO9A 4NXYA 2HUZA 4JD6A 1Q2YA 4PK3A 1Z9UA 1LRZA 5H84A 4U9ZA 3DDDA 3R95A 3VWEA 3CXPA 2BL1A 2Z11A 2FE7A 4JXQA 4MY3A 1TIQA 1GHEA 2HV2A 3TO7A 1NMTA 2VZYA 3F0AA 3LODA 5EC4A 3T90A 1S60A 3S6GA 1CM0A 3FB3A 2P0WA 4H89A 1XIXA 3TCVA 3DR6A 1RXTA 4FD7A 4PSWA 2R1IA 3F5BA 3R9GA 2P6GA 3S6HA 3W6XA 3K9UA 4AVCA 3SXOA 2I00A 5EBVA 2OZHA 3TTHA 2B4DB 3SHPA 4AVBA 1YVOA 4KOVA 3I9SA 1S7LA 2ATRA 4PK2A 4FD6A 1Q2CA 4E8OA 2Q44A 5JPHA 4ONUA 2B4BA 2ZW6A 1M44A 4LX9A 2B5GA 4KORA 3UY5A 4HNYB 2ZW5A 4OLLA 5KTDA 2H5MA 2VQYA 5IV0A 3G3SA 1MJAA 4KOTA 5F47A 2Z10A 4GS4A 3FIXA 1U6MA 4U9YA 3H4QA 3D8PA 4ORFA 2QIRA 3R96A 3PZJA 3FXTA 1I21A 4E0AA 4KOYA 2HQYA 3BJ7A 3QAHA 5J8CA 1IICA 3TOBA 5E96A 4K30A 4B5OA 2G3TA 5HH1A 1Y7RA 1S5KA 3FRMA 2R8VA 3IGRA 1XF8A 4OADA 2F5IA 4R9MA 1UFHA 4NEXA 1K4JA 2OB0A 2X7BA 2FIWA 4E2AA 4NCZA 5F49A 4XPDB 3EY5A 4YGOA 3I3GA 4B5PA 4PV6A 2FXFA 2R98A 4XPDC 3E0KA 1S7FA 4AVAA 5F48A 5I0CA 4MBUA 4IF5A 1J4JA 3VWDA 2PDOA 3BLNA 3BJ8A 2BUEA 2B5GB 3DR8A 1XMTA 1M1DA 3SXNA 4XNHB 5KTAA 1M4IA 2P6EA 1QSMA 5GCNA 4XNHC 5DWNA 3JVNA 5IX3A 1L0CA 4R3LA 2FSRA 4H6UA 1FY7A 4AG9A 3C26A 3EFAA 2DXQA 2FIAA 2PSWA 4KOUA 5CNPA 4II9A 4UBRA 2Q7BA 4QBJA 2VZZA 2GE3A 1P0HA 4ZBGA 3S6FA 1YVKA 3FYNA 1I12A 2VEZA
chains in the Genus database with same CATH superfamily
1D5YA 2EZKA 2EQRA 2HWVA 2RVCA 4A3LJ 4Y13A 5FB2A 3FJUA 1H89C 2MGQA 2E71A 2DOAA 1TWHJ 1ENHA 3LOCA 1DU0A 3A4CA 1YQAA 3DTIA 3DWLE 3FEDA 3BJAA 4LG0B 3ABMH 2CV2A 3J7AY 1JTYA 2XF5A 4JQFA 1BL0A 2CNTA 1U3EM 1Z5RA 2MLKA 4RUHA 4A32A 4IL6C 4OIDA 2G3AA 1V4RA 4LOCA 4F7ZA 1RR8C 2DODA 2D1VA 3K4LA 2PR1A 4NB5A 2ZCWA 3TBIA 2VC0A 4A12A 4NGNA 4FUUA 2EIKH 3QPHA 4KVOE 1ELMP 4P10A 2DMNA 4HA8A 2WAQN 3U2RA 2HQAA 4UCNA 3TO6A 2ZO4A 2HDDA 3QP5A 5IOYA 1SFXA 1APLC 3LD2A 3JRAA 4ZGYB 5IB9A 2K5CA 3HEFA 3IU1A 2Y75A 3T8WA 3G2BA 2BEIA 1AKHA 3ZGKA 3BC8A 3DTKA 1K6YA 3B6AA 1KU3A 2ZMEB 2IPQX 2PRBA 2OBPA 1TW2A 3M8FA 3RJPA 1B72A 1GHCA 4LIVA 5ERIA 4GO1A 1IO2A 4MHDA 2E7XA 4BXXJ 3CCEI 4CICA 5E79C 5A2QK 2DXIA 1YIJI 1HDUA 5BMZA 2QZ8A 2WZNA 1YW4A 1ZGAA 3H8GA 4A3JJ 2PQ8A 1A35A 3GTPJ 4KN4X 2BZTA 4M72A 2Q4ZA 4U87A 4X1EA 4HV5A 5DDGA 2HVQA 4R1HA 4OC0A 4CCKA 4HNWB 4WXDA 4UEEA 2BEOA 2VBXA 5AG6A 1ZG1A 3MGDA 2IBDA 1MH4A 2ESNA 2LKXA 4CGZA 4BBHA 4G7ZF 2DYRH 4RGXA 3ZMDA 4BKXA 4M85A 1YREA 4P4JA 2L7ZA 2K4JA 3BTLA 2AQFA 2Y69H 3AKZA 4X5KA 2OAZA 1Z8WA 4EGYA 3NAUA 4XORA 3RCOA 3HLPA 1WFXA 1BLLE 3S9NA 2XEIA 1AA7A 3WU0A 4RS8A 1JWQA 4KSAA 4JP0A 5JVGF 1IG7A 2YS9A 4L9NA 3QWLA 3L9FA 4Y52J 3BCBA 3FK7A 1HDQA 2C6YA 1Y9KA 3BR2A 1Z2LA 2KHMA 3JTHA 4XN0A 2DFHA 3GW2A 3KPHA 3UR3C 2IGNA 2STTA 4A33A 5FKOA 1FP2A 1BIBA 1K79A 1G2HA 3IH3A 2M87A 1S9HA 4EEFG 1U6GA 3MN8A 2R7FA 4LUAA 1KU2A 1Y8QB 1VQ5I 2Y31A 4B12A 2W85A 3TW7A 2IGMA 2VJJA 1VQ7I 2E1CA 3DLAA 3I54A 5E3LA 6CPAA 5JVTA 4AIJA 4UIAA 3CESA 4JK1X 2DTZA 3A03A 3QYEA 5BWAB 3WTYC 4TV7A 4LK1F 1YGHA 1WJCA 2BXZA 3U1KA 4PFPA 5J47A 5IB0A 6PAXA 3FHNA 2EINH 3GXOA 2B9SA 1WRJA 1YRNB 1P7IA 4ONWA 3QB8A 3KR4A 1XSVA 2Y0SN 1LQ1A 4P4DA 1ZHFA 3BTCA 1XN7A 5B66C 3ISXA 3KHXA 3HM5A 2CTBA 1MH3A 4K2EA 4P9UA 2PJPA 2VONA 2Z9OA 1MMNA 1F4KA 1B9NA 3TEDA 4YWYA 5GTHC 4CAWA 4AYBN 3FXRA 3BXMA 2Y30A 3D1NI 2AFMA 1A36A 5DM7F 3LWUA 2V7FA 4V19K 2EA4A 3W6SA 3C2BA 3HHGA 4QUSA 3CJTB 4IRGA 4NBQA 5HNFA 4UFVA 2HYFA 1UJ8A 1QSNA 2I79A 1LFPA 2WV1A 1SFKA 1H8AC 2R93J 2Z3MA 1G3TA 3IAS2 3EYYA 5J3LA 3VOEA 1EH7A 3F9KA 4XPKA 2REEA 4XIDA 4C2XA 2FQ4A 3H92A 1MBJA 2K3FA 4H4KC 3RPUA 3ZZIA 2GFQA 3OYHA 4G7OF 3M8JA 1LVKA 3CMMA 1XSXA 2F4MB 2VL1A 4ESJA 3I3LA 3AG2H 4HQMA 3PQKA 1EE3P 3IL2A 3I56I 1ZKGA 4ZYGA 3PM1A 4JXRA 4IHSA 2AFXA 1ZELA 3DV8A 2YX4A 3E7LA 2IA0A 1LE8B 4ZYHA 2PRQA 4KVME 5CBMA 2ARHA 1U9NA 5H2FC 4BACA 2P6TA 3CJRB 1I1GA 2ZOGA 2A5YB 4H6ZA 4PJNA 3NFZA 4NNJA 1HA8A 1D0ZA 1EA3A 4BEHB 1XMXA 5LYIA 4O23A 5HLIA 5K8PA 2DTRA 3PSIA 1JI8A 3IC1A 4BE2A 1Y7EA 1NTCA 3W6JB 1K4TA 4IZZA 3OYKA 3T8RA 1LAMA 4ZDLA 1QZYA 2EBJA 2QQBA 1GXQA 2VT2A 2NVUB 4XKCA 5D8LB 4FTHA 2HXOA 2LBFB 4HNUA 2ACJA 2P6FA 3R6SA 3K6GA 5KK1A 5IP9J 3CC4I 1GVJA 3FXKA 2JLMA 1EH6A 2FE3A 4EV0A 1Y1WJ 4OP4A 4Y49C 3LSRA 3HKZN 4UCMA 3LACA 1IXCA 2PJ8A 3GLLA 1Q1VA 4ITVA 4KN7X 4P96A 5DCMB 4UV8A 1IN5A 4BUPA 3D66A 1FTTA 1K7AA 2WADA 4UVAA 3TOAA 4C9YA 4BHPA 3I53A 2HVRA 3GYAA 1IOIA 3J81K 3CXSA 3IO1A 2O8XA 4KISA 2CU7A 1HW2A 3S1MJ 4DNCA 1IB1E 3SYTA 3EXNA 4CSWA 2JZYA 3H0DA 3N4MA 2OZGA 2GXGA 4OAEA 3BR5A 2EA2A 1W4MA 3OYDA 2NMTA 5K1YA 3OMYA 1HDDC 3G1LA 2JVGA 4XOPA 4LB6B 1BM9A 2HB6A 5LEJA 2A4NA 3S3OA 1BW5A 3F3XA 4QTRA 3FNCA 1JUPA 4QC6A 2F2EA 2NOJB 2CFOA 1MDMB 1SFEA 2A6TA 4WK8F 3DLLF 3S2HJ 5D8NA 1RI7A 3QU6A 3M9AA 3F0CA 1RC9A 1H8LA 1QSTA 4BDYA 2BHZA 3GWZA 1Z3YA 1XX5A 4QPQA 1QA6A 3N5FA 5LRJA 3VODA 2CJJA 4UWJA 5LGTA 1FC3A 1K83J 1P2FA 1Y0NA 3WTZA 2QWWA 3JR9A 4ETSA 3DBRB 3CZXA 3JCUC 2GBYA 2HGCA 1WKMA 1IRGA 3U9GA 4OU0A 4BU2A 3E6MA 1KZHA 4JWPA 2PBIA 1N71A 5J1UA 4S05A 3HL2A 4BNCA 1KZFA 1LUJB 1Z1DA 2ZXWH 3GTMJ 1BI0A 4RBOA 5GAHJ 2Y48A 2QBYA 2HUZA 1SMTA 5E1WA 4JD6A 4KT6A 1XOVA 3OSFA 5JFRA 3AG3H 2EK5A 2NS0A 1Z05A 3ZN1A 2MLGA 2Y9ZA 3OYLA 2DEAA 2R7UA 2LKSA 3H9QA 5GP9A 4P4FA 1UCRA 5AIQA 3BR0A 3AFHA 2ZENA 4LJZF 4C3HJ 3R95A 2LP0A 2EILH 1IN6A 4BJ5C 3PB4X 3GFLA 1Y6IA 1GHEA 2HV2A 1ELLP 3JW4A 2HOEA 2KMUA 1NMTA 5EC4A 4ESFA 3IUOA 1S60A 2VKDA 3OYBA 1CM0A 3FB3A 1XIXA 1D1CA 2DBBA 4EQQA 4BYYA 3S1QJ 1IW7F 4CYOA 2IXSA 3HOUJ 2EFNA 3ECHA 3B2YA 4RB3C 2LNBA 3UNGC 1T39A 4PXEA 1YG2A 3S6HA 1HSJA 4AVCA 2CMPA 2UXXA 1Z0XA 3WHCA 2OTJI 4MFJA 1BPMA 3CF2A 5EBVA 5K7HA 5D5VB 1FLIA 3ISZA 1D1BA 3FM3A 4O5VA 2XAJA 4AVBA 2HPIA 1VZ0A 2JA5J 1HQCA 5IP7J 1Y8RB 3V7CA 2K9MA 4ZC3A 2KJCA 2DT7B 1ORKA 2NVYJ 4PK2A 3Q9SA 2P7CB 4X8IA 2DFEA 2Z99A 2Q51A 2DO7A 2VJ4A 5LGNA 1M1EB 2XPVA 3BR1A 5LFAA 5GADJ 1CPXA 2XRNA 4FWUA 5JPHA 1HSTA 3IAM2 1QPIA 4KSIA 1YJ9I 5FKLA 2A07F 5IYDJ 3N05A 4A3EJ 1IRZA 2ODFA 4NGPA 4EMEA 3CCUI 4ZZLA 3KP2A 2YR2A 4I0AA 1EF4A 2FQ3A 4AD9A 4BL0B 3LSKA 1ZAOA 4KORA 3RNZA 1HF0A 2VOOA 3SI2A 3WGGA 1P92A 1KQ9A 3K4NA 3O6BB 1IRFA 2W25A 4XKBA 2VT3A 3ZCOA 3V8LA 1F36A 3BCAA 4BE0A 4HF2A 1LAPA 2H5MA 3G3SA 4KOTA 3PJRA 1BPNA 2PJ1A 4N0BA 3JRFA 1A2ZA 2IS2A 2Z10A 3PSFA 2R7ZJ 2CF4A 2FNAA 2HTSA 2AFWA 2O61A 3KCCA 1U6MA 3FIXA 1HKTA 3C1DA 3KP6A 2WAFA 2EIJH 1R7JA 1YE9A 4FX4A 3HOTA 2HTJA 3JTGA 1FZPB 3PZJA 1OYWA 1UZCA 2ZKZA 3QOEA 1X2NA 4E0AA 5B1AH 1ZGWA 1OPCA 2FSWA 2NOGA 2VQCA 2E2IJ 4IXAA 3ASOH 3CDLA 4GCVA 1IICA 5E96A 2IEKA 1IY7A 3EDPA 2V26A 2PJ7A 2RQQA 3CCLI 1R3NA 2PJAA 3FRMA 4WJBA 3HRTA 3MFKA 3P7NA 1ZR2A 1XF8A 2YNDA 2CFXA 1IN7A 1UFHA 4NEXA 1ZTRA 3ERED 1K4JA 3MMYB 1TWCJ 2LFBA 5F49A 3OY9A 1TBXA 1IF1A 4D0PA 3EY5A 2MH2A 3AG4H 2PMZA 1OCPA 2DK5A 4UNOA 4HX4A 3F23A 4L5IA 2AXLA 2CIJA 3K70D 2X9DA 3OYEA 4BD9A 4C2ZA 2FNPA 1YLOA 2PMZN 3E0KA 2C6PA 1ZLJA 4DYRA 3JTKA 1VQ8I 4A38A 1MMSA 5DUKA 4YFXF 3E5QA 2OR4A 3FMSA 1IOFA 4FCYA 1WJDA 2FOKA 4UUSA 2H27A 3EUAA 2G0EA 3BPXA 3CCSI 1PYTB 4HSTA 4M9XA 2FVGA 1JT6A 2J9AA 3Q0WA 2PDOA 5HVHA 4A3CJ 1Y0YA 4RMNA 3WC6A 3DR8A 1XMTA 3G6EI 4B3AA 1Z67A 2IGOA 4KIFA 1AMPA 4XNHB 1I50J 1RZ4A 1TQMA 2CW0F 3NRVA 3F72A 3PNTA 5GPAA 1FOKA 2JQ7A 1PYVA 2DPDA 1YW7A 1FIPA 4YEJA 2LRDA 4ON0A 1FTZA 2JBKA 4CYQA 5GCNA 3FK6A 2QGUA 1ZRFA 2W00A 5IX3A 4C30A 2IS1A 1VQLI 5K5RA 3S2DJ 2EB7A 4R3LA 2FSRA 2OA4A 1FY7A 3FF3A 1SVLA 3DPUA 4CO8A 4O3MA 5E1XA 1DQUA 3BHXA 4A2ZA 2GOMA 3HHHA 2O3FA 1DPUA 2PG4A 3L00A 1NK3P 5HDGA 1ZG3A 5CNPA 1DGRM 2EV6A 1YMEA 2LD5A 4P1WA 2Q7BA 3BG3A 3CJQB 2EIMH 2Q2EA 4NHJA 4RGUA 4M9ZA 1P0HA 2M5WA 2ELJA 2XHKA 4P4EA 4F92B 5D5XB 1MIJA 4I99C 4D7NA 2UUZA 3PEIA 5BNGA 4FQGA 5KCMA 2GLOA 4E7HA 2LY2A 3HG9A 2BE5F 2VE8A 3H36A 3KZZA 4ABZA 1Z8LA 4Q7AA 1J5YA 5J1RA 4BQNA 1TKFA 3D4UA 1IYLA 2ZEMA 1ETQA 4MEYF 4L89A 1NG7A 2OCEA 2BY0A 1CX8A 4E7KA 2ZEDA 3S15J 1MNDA 2Q0YA 4YRHA 1FNNA 1M4DA 3RZDJ 4DJLA 3PFIA 4L9VA 3O2PE 3A0BC 1W7PB 2XEJA 3I59A 1YX0A 3LA2A 4XPLA 2RC4A 3HBLA 4UB6C 2OZUA 5CJ9A 5F0CA 5FLXK 4LQGA 4DUKA 2QJ8A 3PNVA 4KOWA 1XC5A 1FP1D 4AXVA 5K8MA 1R1TA 1YW9A 2A05A 4XRSA 4X2TA 3G1OA 5GPCA 2ABZA 1TW3A 1CF7A 1B6BA 1UHSA 4RB2C 1YTYA 4A30A 5G20A 3O8GA 3WT4A 1RO5A 1ODDA 4KOXA 2VKVA 4RLFA 2Z5UA 2XGCA 4NFRA 1ZO0A 1ZLKA 2VBQA 3V8IA 4CGPA 3KASA 1V55H 1IXRC 2CUFA 4JLYA 3EO4A 5JI6A 2WPXA 1SVOA 3CZ6A 4XR6A 1QVUA 4KSFA 1Z91A 1DUXC 5F09A 2LOOA 5K5OA 3D2MA 1XTAA 4CAVA 3DKWA 3SJXA 2NRAC 2M3AA 3Q0UA 1XCBA 3G8WA 1ZN2A 1R5ID 3QYFA 2LREA 3HOWJ 2IAIA 3BR3A 3QQAA 4QLCU 5EGOB 5EG0B 3F6VA 3PO3J 2REFA 2ISYA 1YO5C 4JOMA 3FH4A 3N7ZA 4UA3A 3G4SI 4FAIA 1R43A 3KP4A 5DEQA 3HXLA 1OR7A 3EC4A 3K2KA 4UCPA 2RV8A 4E7SA 5E20A 3W3CA 5CPAA 4C2UA 4OAZA 4EM1A 2M8GX 2ELKA 1IC8A 5F1RA 3EYIA 4A3DJ 3M4OJ 2CG4A 2CY2A 2YU9J 3JUWA 2FA5A 2C6GA 2V9KA 5ICGA 1BC8C 2HR3A 1KYWA 3P2HA 4ZH4F 4JX5A 4R3KA 3LFKA 5L3BA 3S17J 1T8IA 4B6ZA 5KVRA 3DCFA 1VQ6I 5HNHA 5FKKA 4XLNF 2J8NA 3D3SA 1GV2A 3PL8A 3K10A 3EUKL 1CQTA 5F6FA 2GXBA 3ABLH 1PP7U 1D8KA 1PJRA 1MKMA 1HOMA 4RB1A 2M9HA 3V7RA 4ZX8A 4MY0A 5HVGA 4LQ6A 2VQLA 3MD2A 3R9EA 4BXUA 5ELYA 3KKWA 5EEGA 2VXKA 5LEKA 2RN7A 1R71A 5ICFA 1JJ8C 5G21A 5FFZA 1LOKA 2LR8A 4RAYA 1XSDA 3ZQIA 5CYVA 2DJNA 5DYMA 1LKXA 5EJCA 1QVTA 2R7TA 1R36A 4F52A 4C68A 3RTRA 2FMLA 3GTKJ 4W97A 2PJRA 2VOPA 4P44A 4AIKA 2IS4A 1WWZA 3CMEI 1USSA 4Z2YA 2PI0A 3GTGJ 1OLTA 2FS5A 8CPAA 4N9HA 3IRQA 4MCRA 4QVTA 3PB7X 1U5TC 2UV1A 4OMYA 3FXQA 3M1EA 5HXDA 1G4DA 2HOTA 2JMWA 2X6XA 3OR1C 2QLZA 4C7HA 1P4WA 1W36D 3RKXA 3B7IA 1YS6A 5GAGJ 2E60A 2FUG2 4B48A 1AKHB 5IT9K 1QO0D 4M73A 4MXUA 3H35A 1IGBA 2OF7A 4B14A 3DPLC 3R0JA 1B72B 4G6TB 2XC7A 1MK4A 4L0YB 3TT2A 4DZJA 1P9QC 3HTUA 2E1MC 3ISPA 4XNFA 3A01A 2HPMA 3PNYA 3H8FA 1PU9A 4B11A 1L3LA 4CGNA 3WTSC 4LLGF 2K27A 3K9TA 1OR7C 2YNCA 1XFOA 2XV4S 2QQ9A 3DP7A 4RLQA 1P4AA 3RQ4A 5IYCJ 1KUVA 2JSPA 5FKMA 3DFGA 4OC2A 3KFWX 3D5SC 2XROA 1WZ2A 1PDNC 4M3EA 4HNXB 4KZTA 4BQOA 3B8GA 1IN4A 1TXRA 1UG2A 3CDXA 2CQNA 1Z4EA 1I6XA 3ZJ0A 2H94A 2XGXA 2LK2A 1S7OA 4CCNA 3IKTA 1ETOA 4GFBA 3LSMA 2X85A 1MBFA 1VNDA 5H6QA 5KHDA 1YK3A 3TE4A 1RNLA 2MD5A 3FX3A 3WTTC 3W91A 3DEWA 4IHYA 3G71I 1KUXA 1V0CA 4M3SA 5AIPA 4BH9A 3TFYA 3COAC 2O7OA 5FJ8J 3V4GA 5G1ZA 2Q4VA 4B47A 2QSFX 1I39A 4KUAA 3V38A 3GB0A 1JKOC 5C82A 5E1ZB 1DE4C 2EUIA 3VPRA 5J40A 4KICA 2C27A 3HZJA 1F1ZA 2XIGA 1W7PD 4EJOA 3GYHX 1WJEA 2JRMA 2E5NA 5HS8A 5DCFA 2QM3A 4MHZA 2OQRA 3T1BA 3MAJA 2F5EA 5LYLA 4UVCA 3OOPA 4IKFA 4IQ4A 4D5FA 3GX4X 3NH8A 2M1BA 2FBKA 4KIGA 4IHXA 2XAGA 4HV6A 4PQAA 2WY7Q 2PC1A 2ZPAA 4L18B 1FMVA 3RIRA 3QAYA 5C88A 2IRFG 5DWMA 9ANTA 4Y49B 3AAFA 3GLXA 3C2GA 2JWTA 2JEWA 5FO5A 1WQ2A 3GBGA 3L1PA 4KITB 1O7LA 4O6JA 5FROA 5TISC 5K7FA 4KDPA 3AL0C 1S3ZA 5E8IA 1U8RA 2XEGA 3D2PA 4UF4A 3PP9A 2VLAA 1X1PA 3M7GA 4I2OA 4CPAA 3MZYA 1WPKA 3S8PA 3H5RA 4DGWB 2HVSA 2IL4A 1SFUA 3IEHA 4OIOF 2XDVA 2CNMA 4YIIA 4PK4A 4AB7A 2QVOA 1ZG8A 2ME0A 5D6FA 1FJLA 1I6HJ 5E3NA 1VQ9I 1XEBA 4F3QA 2R92J 5I4MA 1R57A 1VKCA 4KJZA 2YNCC 3LSPA 4MCSA 4YELA 4CYCA 2VUMJ 3VYUB 1HKSA 2NSMA 2QA4I 3HOSA 2L7KA 5HODA 3RKYA 2V8VA 2AFZA 1MBKA 3LSJA 4DIQA 5J8FA 1BJZA 2K5TA 3ONQA 2R7RA 3OYMA 3K0LA 1W5CC 3HOVJ 3GLJA 3BG7A 2Z1DA 3OS0A 1NSLA 2K9LA 3B73A 1J2XA 4BY7J 3WODF 3J80Z 3DEUA 1ZRCA 2CNSA 2LC2A 2IJLA 5EDNA 4NGRA 4L5JA 4XK4A 3ZRGA 1ZG5A 3B3TA 5LHHA 4RN7A 4UWIA 4U0YA 2B4DA 4IHMA 3RAMA 2VKEA 4HEA2 4JJXA 4HRIA 1QZZA 4YRVA 3CC2I 1X2MA 1ETXA 3NQOA 4BQQA 4YG2F 2D4OA 3P9IA 4AIDA 4HPQA 3GFMA 3JRBA 2CO5A 2Z3YA 2XAQA 5CVJA 5L3GA 4A3KJ 1S3JA 3IV5A 5FD5A 2D4PA 3D7DA 4GXOA 4OC5A 2EFPA 3DQVC 4LLNA 2BVLA 3LA7A 2DLLA 3DBLB 2ESHA 2JVHA 1VHSA 3GKRA 4GXHA 1MBHA 2R7QA 3P9KA 5LGUA 3E6CC 3BZ6A 4ZX9A 4BXFA 3I9V2 5GTIC 3RO0A 1TKJA 3OYCA 1R4MB 1ZGJA 3A2KA 3S16J 1X10A 2FX0A 1B9MA 1Z9UA 5JR3A 4ZI6A 2HDWA 4HZFA 4XRMA 3OIQA 2XVCA 5CVIA 2ZJQF 1ZR4A 3DDDA 1B4AA 1HXDA 4HQEA 4A0ZA 3KZWA 2A6EF 4M71A 2Z11A 1H88C 2FE7A 1O3SA 3S9MA 1CP6A 2VN2A 1N77A 2ZJ2A 2AXTC 4WWCA 2ZSHB 3F8FA 2DOEA 2EV5A 3G1MA 3IP4B 1TL8A 1SAXA 3F0AA 2L4MA 3S6GA 2KP6A 3TW6A 2GU2A 5D5WB 3NH4A 3W6KB 1TZLA 2P0WA 4H89A 2L5QA 5LRKA 3GCMA 4R8FA 3DR6A 2B7EA 1RXTA 1XD7A 1GV5A 1FYKA 4ZYDA 5L3CA 4EVIA 2L9VA 3CQZJ 2R1IA 3H3UA 4XSZF 2VI6A 1ZG9A 1FSEA 3K2ZA 2JT1A 4B10A 5DM6F 2I00A 2DOFA 2IA1A 2OZHA 3I4NJ 3SHPA 1T38A 4MHYA 3FKJA 1GLNA 3FBNB 4NC6A 3HSRA 3FDYA 2JA6J 1IN8A 3HOZJ 1D8JA 2BO9A 5FLVA 4KOVA 4CA0A 5EEHA 2IVMA 1POGA 4UUTA 3LAPA 4OC4A 5M3FJ 1Q2CA 2DPTA 5LYFA 1LVAA 2DDAA 2OTLI 2ECBA 4E8OA 1JQGA 3PRTA 2YX7A 3Q3SA 2GLJA 4OC3A 2E36A 2MC4A 4C2MJ 2V8HA 2CV0A 2RDPA 2V8GA 1U78A 4A31A 3LSHA 2ZW6A 1EKEA 3IH2A 1WSUA 3H1CA 4LX9A 1QNTA 2QBYB 2CQXA 3OYIA 3VEPA 2ID3A 2O4HA 2VXZA 4OLLA 2L3DA 2ZFUA 2C6CA 2VQYA 5IV0A 5F47A 5GAEJ 1FEXA 2HYJA 2BW3A 3LQQA 1K6OA 4WWVA 3R60A 4L9JA 2BXYA 2DJIA 1RRJA 1LFUP 5LHIA 2F4IA 1IGNA 2EO8A 4G6QA 2TDXA 5LYDA 4X0GA 5TGTA 4B09A 1FMWA 5DD8A 4RM3A 2M7AA 3TMOA 1LDKB 1OISA 2E7WA 4I76A 3TGNA 5IOZA 4ANJA 3JSOA 1I21A 2R4GA 3HPGA 3FVLA 5D4SA 3GTJJ 1HW1A 2ADUA 1MSFC 2DPSA 3QAHA 2Z2SB 3BJ7A 3H5ZA 4CGOA 1TTYA 3HDDA 3S93A 2HZDA 3PB9X 7CPAA 3BZKA 3IWZA 3GZ5A 4MMOA 2ZFWA 3KYLA 2EZLA 2MBFA 3TOBA 1J09A 2DCEA 2LY1A 4AIHA 3FXMA 3MN2A 1YRNA 3OL3A 3ULQB 5HH1A 5K8NA 4G94A 3B3SA 2GREA 2F4OB 5M5WJ 1TP4A 4E7ZA 2V6CA 4A0YA 4OADA 4R9MA 1YW6A 5B1BH 5FD6A 2FIWA 4BINA 2RQPA 3LMSA 2V1NA 3RZOJ 3PIOF 1ARMA 1ZREA 3I3GA 3HUGA 1J9IA 2GQQA 2KIMA 2HQNA 3BTIA 4ENKA 4PV6A 2ZEFA 3JAMK 1QHHD 4AWXB 4K3NA 2W57A 1PVEA 1GUUA 2D45A 4EWTA 1S7FA 5F48A 3HPHA 4MBUA 2ZJRF 4BHCA 3E97A 2L9SA 1IDYA 1R4NB 3HC7A 2KIQA 4E4HA 1WJ5A 4OIPF 2M2EA 2RKHA 3ESWB 4IF5A 1VQ4I 2LSOA 2VODA 5AG7A 1P7JA 3VWDA 2V6EA 1A04A 3BJ8A 3I55I 3NA6A 3OL4A 2O53A 2WWYA 3CLQA 1M1DA 2ZELA 3VWBA 5LRRA 4HDVA 2XUBA 4A6DA 2JPCA 1O4XA 1MD0A 4Q48A 5KTAA 4GYGA 2YNEA 4BGDA 2LKPA 2BOLA 3JRDA 2RB7A 2EPFA 1ON1A 3CTAA 5ILSA 2CRGA 3CCJI 1HKQA 3ABUA 2FU4A 2VBZA 3BROA 4MCQA 1XGOA 1FWZA 1OCCH 2M7BA 1S5LC 4BEHA 3ZMUA 5LBQA 1LNWA 4H6UA 4B3XA 3P9CA 1I3QJ 3CUQA 4AG9A 3RYRA 1BI2A 2DPUA 4A94A 1AYEA 4GGGA 2K4BA 3EFAA 3WU2C 2DXQA 3CCYA 2FIAA 2Q43A 1IUFA 3TP0A 5D29A 3EPZA 3JREA 1BJAA 5M5XJ 3ZMTA 2CV1A 4ENMA 4KA4A 2O6GE 3PBEA 3GFJA 4UBRA 1R00A 2QKLB 3L2NA 3BQZA 4YFKF 4QBJA 1R1UA 3D5RC 3WU1B 1DDNA 5HVFA 4XRSG 2V9PA 3H9JA 4XLEA 1IU8A 4ZBGA 5CPRB 2DQLA 1YVKA 5J1YA 3ZP5A 3FYNA 3ROUA 3TDZC 1XRYA 2VEZA 2IW5A 4WXHA 1VQOI 3CC7I 2BY3A 1X4PA 1KQ8A 2PVWA 2NXNB 4FISA 4MRIA 2P8TA 4CHUA 3SJEA 1B1BA 2RNJA 2HC9A 3FM5A 1VTNC 2ZEPA 2JUCA 1LANA 2RFHA 5E18F 1IJWC 4H2KA 3PGPA 2TCTA 4N4OB 1R5GA 4UUSB 4G12A 4A93J 1MW7A 2X4HA 2Q8KA 1CJWA 2Z0ZA 2ZXVA 5A27A 1QHGA 5ISVA 1H0MA 1BOBA 2UZKA 3K1MA 4FE7A 3MCZA 4PJMA 4ENJA 4YU9A 4Z65A 4FASD 4PXBA 5J6XA 4HBLA 1Y0UA 1MGTA 2VQGA 1QU3A 1F43A 1PUAA 3HRUA 5A2QZ 2AE6A 4AG7A 4CRYB 1Z21A 2W24A 2FL4A 4RI1A 1KA8A 1Z6RA 1Z9CA 5FFXA 4ZTFA 2VI7A 2X6YA 2BY2A 4Y33A 3IWGA 1NH3A 4UB8C 3IH4A 4FETA 2H8WA 4D1QA 4NJRA 2M4KA 3AG1H 3A9LA 4ZY2A 4PDKA 1QSRA 3QPSA 4D9JA 3SJGA 1YJWI 4JYWA 2DQRA 3MKWB 1XDUA 1P4XA 1HDPA 2Q0OA 2J8MA 5KTCA 1H9GA 5K7ZA 1QQ9A 4HYEA 4CAEA 1JKRC 1PUFA 4HNTA 2O9LA 4PPZA 4BHBA 2DMUA 4U88A 1U0JA 5ICCA 2BYVE 1LB2A 1RUOA 5FVJA 2X51A 1EH8A 1TF9A 3ZPLA 2COBA 2M4GA 3CUQC 2MH9A 2W84A 1W5TA 2XKPA 2J8RA 3KR5A 5HS9A 4DZPA 5JM6A 2F5DA 1ZLHA 2OV7A 2Q2EB 4B1RA 2HYGD 5F27A 3E6BA 4MLOA 1FYMA 4NJQA 1XDSA 2O0YA 1PCAA 5H86A 3PUBA 2LVSA 2TRTA 2IQ6A 4CAXA 3FF5A 4ASNA 3NE7A 1T56A 3BTJA 2HU9A 3O8HA 4G6DA 2OUMA 3FEEA 1LJ9A 3D0SA 2R7HA 1VI0A 2AFSA 4IUSA 4KOSA 4M6GA 4AM3A 3TX8A 3DBHB 4WXCA 1XPXA 3TKYA 4NDLA 2F8HA 2CH0A 1JGSA 2WY8Q 2JSCA 1X3ZB 3H9GA 3W2WA 5M3MJ 1G6NA 1N25A 1MJBA 4F55A 4BDZA 1HCRA 1XB4A 4PFOA 3KLOA 2COMA 4J01A 1E0EA 3WTUC 4U5YA 2BV6A 3FWEA 2R5ZA 3KQZA 1F2PA 4NF1A 4NGMA 1Y1VJ 3K70C 3KI9A 1FX7A 5LD2C 3CD6I 3OSGA 2A5WA 1GXPA 3ZMSA 4CS0B 4IX7A 3S6KA 1CP7A 2ZNYA 1G3WA 4B4CA 4BMHA 2L7MP 3RYOA 2M30A 2IJZA 2OD5A 1IRXA 1U5TB 4DBQA 3CO7C 4D7MA 1BI3A 3T8TA 1V5EA 4Y17A 2DMTA 2X6WA 1E3HA 1OBRA 3Q0VA 2KZGA 1IIDA 4A37A 2LDUA 1J7KA 1R22A 3MWMA 3M3YJ 5EF6A 3PFEA 3HSFA 4EVYA 3R4KA 4UUVA 2D2WA 2ZW4A 2Z3LA 3M8EA 3KX2A 5BQTA 4HDUA 3CF5F 1X1CA 3WE3A 4RGRA 4DQ2A 1NSAA 1ITYA 2E1MB 3BI0A 1YIOA 2HOAA 4UEZA 1TC3C 2PIZA 4L8AA 3B3CA 2GIVA 2K85A 4U7DA 5EZHA 4BJTA 3CCQI 1RKWA 3VFZA 1JTXA 3KP3A 1R23A 4U0WA 4RAZA 1X1DA 1XG1A 2WPWA 5KNLA 2PMHA 3M07A 3GEZA 1QQIA 5CQEA 1QGPA 2F7VA 4G1PA 2OCCH 2EH3A 1S72I 1XCVA 4II3A 5G22A 4EJWA 2JTVA 3QYBA 5JHFA 3SHFA 4KT5C 1F2OA 4NGTA 2HQ5A 4Q38A 4B5PB 1JJ6C 2VPLA 4MJ8A 4CUGA 4XMYA 1OZPA 3F6OA 2FT0A 4KVXA 4KYWA 4OKOA 2A69F 3ZMZA 3KHZA 2Q1ZB 3HIFA 5ED4A 4ZTJA 1OCOH 2DMPA 3HSEA 3S2WA 3GZ6A 5FKNA 4KFCA 2G9WA 2KIFA 4IEJA 1Q7LA 2CTCA 3VARA 1T98A 3T9YA 3LA3A 3E1SA 2HDCA 3FBUA 4NQWA 2FBIA 1J0RA 3TL4X 4J00A 2EVNA 3KL9A 2RREA 3EUHA 4A0XA 4EATA 3ABTA 1LFWA 4I49A 3WE2A 5AONA 2KRFA 1YX3A 2CUEA 1X19A 2Z16A 1IAWA 3BR6A 1MNMC 4B13A 2ZW7A 1V5FA 2PE3A 2PJRB 3GVAA 2LY9A 1OYIA 4A3BJ 2B3VA 2H6CA 3KLNA 1B6AA 2H1LA 1ON2A 3CLOA 3J81Z 2OQGA 1MBEA 4ENNA 1ERDA 4KMUX 2DFFA 1YQEA 2H6BA 4GYIA 1T6SA 2EZHA 4G7HF 4KLVA 4RAFA 1GYTA 3LSGA 2EWNA 2K9NA 5IYBJ 1FT7A 5JH9A 4FHTA 1R6RA 3AL0B 1ONVA 5JLXA 1B87A 4G9YA 3G3ZA 4PJ0C 1FSHA 2VJIA 4YIFA 4EJTA 4NUBA 2JJ7A 4CXFA 2WUUA 4JX6A 3ASNH 4LG3A 1W1WE 3BQYA 3ECOA 4A3MJ 1CBXA 3BDDA 2ICWG 3A01B 1Y9WA 3I1UA 3LWFA 2VIXA 1E2XA 1SC7A 2PJ4A 3PBBA 2HXIA 2K7LA 5HLGA 1A5JA 3L2UA 3B35A 1S7AA 1Z3XA 3A1YA 4HKFA 5DUIA 1XS9A 2O03A 3S3MA 3PUFA 3GF2A 1D0XA 1U2WA 5EEAA 1VFCA 2X1DA 3E3VA 5DTDA 4J3GA 4LMYA 2QENA 2K40A 3REOA 4IRHA 3PFYA 3EQLF 3K4BA 4WCGA 3HTSB 1I1DA 1U9OA 2EJRA 2VB6A 3KEYA 4U7BA 2QECA 2NVXJ 4NSQA 2V79A 4FD4A 4HLXA 3GMEA 3G73A 5HDNA 3FHZA 2YSRA 4EJVA 2STWA 3L2WA 2DK8A 1WH5A 3E5XA 3ELKA 1R9TJ 2VKHA 2P4WA 3QPLA 1C0WA 2ISZA 4OIQF 1FOXA 2PJCA 2FJ1A 4LLLA 5ICEA 3K4MA 2E1OA 4V2FA 1T95A 1V54H 1Q1HA 3OWTA 2F6CA 1N75A 2ZXJA 3CMAI 1R49A 1KU7A 1I1SA 2JK3A 2L2OA 2GA1A 1YR0A 1OKRA 5CKTA 3EUHC 1BO4A 1I27A 3WC5A 5F0FA 4MO7A 5F46A 4RGSA 4HX7A 1NG6A 2PR8A 2YGWA 4PUSA 1RIOH 5HDKA 4IJAA 4I98B 3BY6A 3ZQGA 1BA5A 3RZAA 3I64A 2ZBKA 4MFPA 1QPMA 2ZEGA 5LLQA 3IC7A 4UHTA 5AGEA 2M0CA 4M6IA 4E6KG 2XSDC 3WR7A 3IRRA 1W7PA 3CDIA 3DEEA 4M6HA 4P4BA 4UY8I 1NE9A 2P81A 4S0HB 3DPTA 2VASA 2QEXI 5THWA 5K8OA 1BR4A 2IGKA 4PK3A 3D5LA 3VB2A 4IQJA 4AVPA 3SXYA 2NVTJ 1XJOA 2DMQA 4M6VA 3PIPF 3K1PA 3ZQLA 1IV8A 4IOCF 5H84A 3BLYA 4NC7A 3TDUC 2R7XA 4U9ZA 3SI0A 4I02A 4S04A 3VWEA 1TWAJ 4JXQA 2XASA 1WWXA 1ETWA 3VYSB 2MA3A 4E70A 4EM0B 1TIQA 2VZYA 1AOYA 4A95A 3T90A 1O3TA 4CYNA 2PFBA 1XMAA 2EFOA 4IF4A 3SDGA 5DS9A 2R5YA 1F5TA 3SJMA 3B02A 3L2CA 2AQEA 2EBIA 5CVVA 5B3SH 1TWGJ 4PSWA 4P6YA 3KQXA 2RAEA 3ZQQA 2WB1A 3CCMI 1RTQA 3IKVA 4R8HA 2FF4A 2YU3A 4YFNF 2P6GA 3F5BA 5D6EA 3DF8A 2JN6A 3C3WA 2QVPA 3IFEA 1WJAA 3D7FA 4Y4RA 4CYDA 2Z3NA 3TTHA 2PJ5A 2B4DB 3RDIA 2KDOA 1YX5A 1WI9A 3F8NA 3CCRI 1K78A 5L3FA 2V1UA 5C4XJ 1ZYRF 2PCUA 3R61A 3I9SA 1K4SA 2ATRA 4BAYA 4IPAA 2ZXIA 1PP8F 3BG6A 1YSJA 1REPC 2BHYA 2OC6A 2XKOA 2EFWA 5F1JA 2NNNA 2DA6A 1R1VA 1TLHB 2F5VA 4CH7A 4CCJA 4BE1A 4ONUA 3H5AA 2KRHA 4MIMA 1EV7A 4V2GA 2FMYA 4CCLA 4F8ZA 2Z3KA 4F91B 2B4BA 1SD7A 1M44A 4UVBA 3IWWA 2HS5A 4II2A 4ZDPA 2XRLA 3FXLA 1IZ1A 3M1CA 3W2VA 1WH7A 2W82A 2B5GA 4KS9A 1OCRH 4HNYB 2CXAA 4UV9A 1WHUA 1YJNI 3UY5A 3QPTA 2WAQA 4OIRF 3L2RA 2EK9A 1XMBA 1GVDA 2HI3A 3DU5A 3KIOA 2PJ2A 2DI3A 4RB0A 3VDXA 2H1KA 1Z8XA 2L01A 2J5PA 4GS4A 3OYAA 1B8IA 1QBJA 2EK8A 2L9NA 3H4QA 4XN3A 3D8PA 5C44J 3HOXJ 3DGVA 4XLHA 2J5OA 4AU7A 3S1NJ 2IT0A 5DV5A 2A68F 2A61A 4I01A 3WG9A 5D5UB 3V7SA 1A31A 3QU3A 2QIRA 3K69A 4LIUA 3OYFA 3FXTA 4OC1A 3SZPA 4HOBA 2DA1A 3SFZA 3UKGA 3RYPA 2M45A 4Q47A 4KOYA 2X48A 4CDGA 1RUNA 4PJLA 1M4LA 2BGCA 4MQ9F 5LHGA 1G3SA 2G7UA 4JBAA 3S32A 5AG4A 4MFEA 1GT0C 1BAVA 2JRTA 4HF1A 2CQ7A 1CGPA 3OOUA 5FRMA 2ZEEA 4B5OA 1S7EA 3WG7H 5HVQC 4M3FA 1FOYA 3WTVC 4JYKA 1YS7A 3C2HA 2X0LA 2F5IA 3HRMA 3EETA 5E3OA 2AO9A 4PJJA 2H8RA 2OB0A 1OFCX 4E2AA 2PJ9A 4NCZA 1DGWY 3FECA 4XSXF 2YPRA 1S8NA 2GLFA 2ZEHA 3U21A 3BG5A 4LFUA 1W0TA 1VHOA 3KE2A 4MHNA 4ZJZA 3BP8A 4XPDC 3C18A 2FRHA 2QSHX 5A28A 2O8KA 2HOSA 3KEOA 4LK0F 5L3DA 4AVAA 5I0CA 4TNUA 1QMUA 3K4JA 1USTA 3FXUA 4C3JJ 1D5VA 2PJ3A 4OWRB 3BOQA 1KU9A 2GZWA 5TRDA 1AHDP 4LG0A 4F9VA 5BS6A 3OS2A 2O5RA 2XSJC 1P6RA 2DYSH 2NS7A 2BUEA 1UFMA 3ZMVA 3PFOA 3SJFA 3RKWA 2XF6A 1J59A 5LRGA 3IU2A 3GUDA 5F64A 4Q4ZF 3OV8A 4MHGA 4CCMA 2K9SA 2BW3B 3ZXSA 1M4IA 2V8DA 1IUYA 4XLAA 4BBRJ 2P6EA 1UG0A 3KEQA 5DWNA 1JUSA 3SQNA 1SAUA 3I4MJ 3KYCB 3D68A 3CMYA 4R7MA 1OMIA 2VPRA 3DLJA 2IP2A 5ILUA 2E1NA 3IWFA 1KGSA 5IP6A 3F21A 1YITI 1R5HA 2LLKA 2Y0SA 5J1QA 4F0XA 1O7FA 4PXCA 1TQIA 4XQFA 2XAFA 2R7SA 5D8KB 1X4OA 5FLXZ 2C1CA 2Z3PA 3NH5A 3FBIB 2ZMEA 4R79A 2UWMA 3WGIA 4WX9A 2HZTA 4CZCA 4F93B 5KAIC 2KFDA 2KZVA 2VZZA 3FZVA 4HF0A 3ZQ7A 4RDUA 1UAAA 2GE3A 4AYBA 3S6FA 1DTDA 2KQRA 3KYDB 1UB9A 1AWCA 4Z6YA 2VL8A 3HUGB 2XB0X 1UELB 4B8XA 3IJ3A 4J19A 1FIAA 5JLWA 2QQAA 3LNQA 4DYCA 2RGVA 1S7KA 2DW4A 3JRHA 1NK2P 3HRSA 4X3RA 2W7NA 5FRNA 1D1AA 1ZARA 4QWQA 3ZOBA 5J4YA 1WGXA 1Z8TA 1WJBA 2YUSA 3WABA 2NNYA 2Q04A 1Z7UA 5FLMJ 2EV0A 5F04A 3R1KA 4ZZDA 2JUGA 2QQ8A 1JXSA 4WF2A 4I7HA 4FBEA 2M8EA 1ON0A 4W9YA 1WCMJ 1HC8A 3E0JB 1ZG7A 3U1DA 2HKXA 4IVNA 3K1NA 3SDBA 1X3UA 2CQQA 2NYQA 4ZY0A 1Y0RA 4B43A 3CO6C 3RSNA 1P4NA 2M0MA 3GUXA 3MKZA 2NAZA 1FPQA 3A02A 3R9FA 3BT9A 3CUQB 3OWCA 2WTEA 1NHAA 3F22A 1SD5A 1YLFA 3QODA 4DOZA 3GTOJ 1I3AA 1SD4A 1FOWA 4PZJA 4MI4A 1OJLA 1OYYA 2Y0MA 1G3YA 5C4JJ 4F0YA 3K4CA 2P5VA 2XGEA 1MJ9A 3HKZA 1VF9A 2GAUA 3OYJA 1JT0A 2CWEA 1EJ9A 5BOXA 2MABA 5E3MA 4LITA 3KETA 2L54A 1ZQ3P 2JA2A 2JDDA 4M74A 2DU9A 2E2HJ 4RS2A 2ZMEC 1DP7P 2NVQJ 5HS7A 5JHUA 1DPRA 2FXAA 4C2YA 1SMYF 3IIBA 4CAFA 2DA2A 2LMDA 2ZOFA 2PJ0A 4PSXA 1LPQA 4LGWA 3VSKA 2MG4A 3L7WA 3J7AO 1E17A 5H6RA 5K5QA 1V5GA 3BI1A 3WC7A 2R7OA 3HGGA 2D1HA 3RPUD 3K7AJ 2K3PA 2HEOA 3WTWC 4DYQA 5IT9Z 3FIWA 3QOPA 2B0LA 3CDHA 3CUOA 2ETHA 3FMRA 4Y15A 3T0YA 2OH1A 4LD5A 2PN6A 1ZLIA 4KMFA 5BPIA 2JEVA 3ERMA 1ZK8A 1O3RA 3LFUA 1K61A 2B58A 2BBYA 2F48A 2MSYA 3FXOA 5HMNA 3CP2A 3OYNA 3PO2J 1FBQA 3DKYA 3QP6A 2W1OA 2EZIA 2K86A 2X1EA 3P2FA 3CJNA 3GY9A 4HNVA 1QRYA 5BPDA 2FCKA 4CGLA 2CW8A 1LE8A 4X6AJ 2P5KA 1SEUA 2GANA 4HW0A 3CPXA 1Z4RA 3BZCA 3JRCA 4F9UA 4KUMA 4KNYA 4EMSA 2QCOA 3LQRA 2WYRA 4A5NA 2PLYA 3KZYA 3ZR8X 1PUFB 2Q7SA 3ZQFA 4M9SA 4KLWA 3PB8X 4R87A 2DT6A 5LRSA 3GTQJ 2XAHA 2PIYA 3FMCA 3H8EA 1LDDA 1SFOJ 3MRUA 4U0VA 4CGMA 2WBMA 3CXQA 2DDBA 2FEZA 1FBUA 4I6ZA 3HJEA 3TQNA 2LBFA 3B3WA 2IS6A 5AG5A 2N8GA 1DU6A 2LF7A 1IV6A 3F8KA 3J7ZI 4AUXA 4EGZA 3D67A 2XPUA 3SFIA 3B6CA 3IHUA 2POKA 3KGQA 1YW8A 4R76A 4B44A 1YFHA 5DD4A 3KP7A 1BR1A 2R7VA 3I0TA 2V1XA 5KAFC 1SQHA 1ZRDA 2BSWA 4FD5A 2JBJA 1FBSA 5DCMA 4FX0A 3T5XA 4LB5A 2L7FP 1W5SA 2PX9A 3DKXA 4A3GJ 2ZNZA 1RKTA 2LTPA 3ML6A 4CCOA 2DA4A 4W1UA 3VH9A 2BCOA 5E17F 5F0HA 2JDCA 2CYYA 2HNHA 2ZSIB 5CQGA 1XGNA 4MFKA 3RQIA 3Q5FA 4GM5A 1KUYA 4QSHA 3GFIA 1WK4A 3TP3A 1ETKA 2B63J 3OS1A 2R5ZB 2F5FA 2O28A 1IXSB 1VGYA 3D7GA 3O3KA 2E19A 2CW7A 1VQMI 1TT5B 4HSRA 1QZEA 3VYRB 4IHVA 3RI4A 1SANA 1MDMA 2GA2A 4C7IA 1AUGA 1BBYA 2KLOA 2NYXA 1VQNI 1BR2A 4AVZA 2CUZA 4M6YA 3BJOA 1JKQC 2IMOA 3B3VA 2Z3OA 1LDJA 1VHEA 4YFJA 3ZN0A 4XONA 3HGYA 1RR7A 1YLEA 2PJBA 2Q4YA 3CPAA 2DFIA 3V8KA 4IO9F 3E6DA 2KL4A 3MQ0A 4PGGA 3I58A 2E5ZA 2X6OA 3RKQA 2HKOA 4N9IA 4I09A 4JX4A 1ZH5A 3S1RJ 2OJED 3OR2C 4G8XA 4IAVA 4BQAA 3NARA 4I0BA 5JGFA 5JQ4A 2NS8A 4MHPA 2DAOA 1BI1A 2DN0A 2E34A 2L9RA 1Q2DA 3NE8A 2BOAA 2VXDA 4RAGA 2RNGA 3K2AA 4GRIA 3BPVA 4MEXF 2KCWA 2A3SA 4HX8A 4OOIA 4P4IA 2ECCA 2WV0A 2L4AA 5IT3A 4F6AA 2ZB9A 1M4GA 1A6IA 2W48A 3P5JA 4DJAA 3C7JA 1OQYA 1T2KA 2ZEOA 4UEFA 4HAMA 4QIWN 4HPSA 1FT9A 2G0BA 2R7DA 4CRZB 5E8GA 2X1CA 1ETVA 3K4KA 5IPAA 1BOAA 2QMLA 3FX6A 1CPSA 1TKHA 3DNSA 3H3ZA 4MTEA 4NGQA 4E7IA 1SVMA 3A0HC 2WA0A 5D4RA 1HBXG 3GTLJ 4TWEA 4MCPA 1S7NA 2PMUA 2AJ6A 3HOYJ 2OU2A 4KUBA 4PGHA 4ZYQA 4PXDA 3I59B 1XE4A 4NQWB 3F8CA 4DW6A 3DSBA 4MGRA 2D5VA 2G9DA 2F5CA 3LSTA 3DXJF 3SI1A 3W2AA 3OIOA 2B3UA 4M3DA 2V9VA 4XKVA 1T08B 1CF7B 2VBWA 2JA8J 2DT5A 1WVRA 4R57A 4M3BA 2EWBA 3OIPA 2CUJA 2OPTA 1G8XA 2GOXB 3BWGA 3VSLA 3JSPA 3ZQCA 2CGPA 4XLFA 4AC0A 3OYGA 1IYKA 1RPWA 3H3VK 4DYOA 2ZXHA 1MZBA 1TT0A 3BJ6A 4CYPA 1QSOA 3MKYB 3GIUA 2R7WA 1X1BA 3H0GJ 2P6SA 5CLSA 1RESA 2KISA 3MZHA 1TNSA 4XOTA 4P5OA 4QB9A 1YI2I 3WGHA 1PUEE 3TO9A 1LCPA 3Q9VA 4NXYA 1D3YA 1VIXA 2MD0A 5J4VA 2I3CA 1Q2YA 1RETA 2VBYA 4MNUA 2DA7A 4IOAF 1JHFA 2V77A 4YIRX 1JE8A 2QYVA 2FBHA 4IHWA 4XM3A 2BY1A 3J80K 1DP3A 1LRZA 4MQVA 1YYVA 2WAEA 4Y3OA 4C2TA 1MMGA 1LFBA 4UFXA 4A2UA 2PEXA 1IDZA 2ELHA 2GWRA 1VQPI 4XLCA 2BL1A 3CXPA 4MY3A 4N4NB 3CT9A 3VATA 1XMKA 2LH9A 2KT0A 2KIUA 1JGGA 3TO7A 3LODA 3L09A 2QKMB 2ZC2A 4XICA 2R0QC 2VE9A 3SEZA 1MMDA 4KIBA 3LMMA 2QSGX 4RM2A 3WHBA 2E2JJ 2JPBA 2KJBA 2V1DA 1T0FA 1W0UA 2LG4A 4QPOA 3TCVA 5H20A 4XBFA 4ESBA 4XKWA 4M6XA 1N78A 4FD7A 3MVPA 1AU7A 3KZIC 1UWYA 3FXJA 1ARLA 2CQKA 3R9GA 1O3QA 3W6XA 5EZGA 3K9UA 2PVVA 3CCVI 3SXOA 3PQJA 1OCZH 4A5MA 2DA5A 3F8BA 3JRIA 4H0EA 5EMIA 3TC8A 4E7LA 2KKOA 1H9TA 2BVMA 3JRGA 2AS5F 1YVOA 1BIAA 1X3WB 1S6LA 5KTDA 2GXAA 1S7LA 4M3GA 4UXNA 2ZJPF 3R0AA 3S9LA 3HB9A 4FD6A 4A69C 1UHMA 4OINF 4Y7NJ 1UHWA 4FT8A 4XLPF 2Q44A 2MW8A 1LEBA 4DBRA 2L02A 2P5LC 1Y39A 4MFLA 4Q5SF 1UMQA 3KP5A 4EM2A 4ZYEA 1G59A 2XB5A 1E3OC 2UXNA 4A3FJ 1BW6A 4L0ZB 1J75A 3H5NA 3HUVA 1L0OC 2QF7A 3ZQHA 1B59A 1XGMA 3MZ8A 4XRFA 5IY5H 2ZW5A 2AFUA 1JKPC 1MMAA 2XPWA 1HW5A 1MJAA 3FISA 2XF7A 4Q36A 3E5UA 4OIWA 1U5TA 4OMZA 4MFZA 3RPQA 1YHQI 3QRFF 2Y2ZA 3L2QA 4L9TA 1XBUA 3D7HA 2V4JC 3JAMZ 2OZ6A 4U9YA 5DS0A 1SD6A 1Z6TA 1HLVA 2FD5A 2QUFA 5EYRA 1WI3A 2M34A 4ORFA 4BS9A 5HLHA 3R96A 1KYZA 1ACIA 3MEXA 5F08A 2QYOA 2VC1A 4EFDA 1KONA 1BC7C 2MC3A 3X2QH 2R5YB 2WSAA 1TQPA 3W6VA 1GDTA 2HQYA 3DU6A 2LF8A 3JRUA 5J8CA 2HQRA 1F57A 3ABKH 1ETYA 2GIZA 4MFQA 4K30A 2W4SA 4A39A 2G3TA 1Y7RA 2DA3A 1S5KA 4BBSJ 4MFDA 4MTDA 1T0FC 3FMQA 3N97A 2I5UA 4UFWA 2EFQA 4GDFA 2R8VA 4IK2A 3IGRA 4P45A 5HLTA 3WTXC 1MNEA 2ID6A 2DF5A 4IRIA 2X7BA 1BN5A 2PJ6A 2XAUA 4XPDB 1JHHA 3V42A 1K78B 4YGOA 1I5ZA 1F9NA 3LL7A 4C3IJ 3SZTA 2GM4A 2P7VB 4B5PA 2FXFA 2R98A 2I8DA 4ZY1A 1ULYA 3PB6X 1JUMA 2IA2A 1U8BA 1KQ0A 4R6TA 2AHQA 2I10A 3LAJA 3V7ZA 4UIBA 1O57A 3SEQA 2AFOA 2K9QA 1T33A 2VJ5A 1X58A 4P9FA 5TJJA 1J4JA 5FGMA 4NGSA 2LYCA 1LEAA 3BLNA 3I4PA 1MSEC 3S3NA 3FKIJ 2B5GB 4BY1J 4A6EA 1TWFJ 3I5UA 2KRCA 5M5YJ 4OMEA 3SXNA 3VYTB 3DTEA 3QNVA 5CVUA 4RA2A 3I71A 5L3EA 4EJUA 4FE4A 2JA7J 1QSMA 3LSIA 1B8IB 4XNHC 2WC2A 2Y9YA 1W36C 1A6QA 3MKLA 4JZ0A 2L0KA 3JVNA 1V3FA 5ILVA 3NWSA 2G7HA 2FOWA 4D5CA 1TF8A 3SZGA 4XL9A 3F8MA 2Z33A 3IWEA 4OAYA 4NC8A 1L0CA 4HG2A 4L5EA 1MBGA 2MFZA 5B5EC 3C26A 3BG9A 1S29A 4CYCB 1KWMA 5C3EJ 2VQHA 3S14J 4A3IJ 5CVRA 3V8JA 1X1AA 1Y56A 2KPMA 2PSWA 4KOUA 5EGOA 1R58A 3GO5A 1D0YA 5EG0A 1OCTC 2HFHA 2ME6A 3RBUA 1E3PA 3NEUA 4II9A 2H09A 1HEEA 1XGSA 4HLYA 2KDZA 3GZNB 2MYSA 3HYIA 1FYLA 4BJ6C 4E7JA 3J7YJ 5HOOA 2A6HF 2CS3A 4P55A 4PCQA 2XGDA 4IHTA 1TNTA 1YOVB 1Z77A 3NWTA 2CSOA 1X12A 4CZZA 1FNOA 1I12A 1CG2A 1STZA 1Z7LA 1WJFA 2WB1N 2E35A 3L2VA 2XEFA 4ZDOA 2R3SA 4ZYAA 1VQKI 2K02A 2OOTA 2ANPA 3CP8A
chains in the Genus database with same CATH topology
1IYLA 1S7KA 4L89A 1NG7A 2W7NA 5FRNA 3PGPA 1D1AA 4N4OB 2DOAA 4E7KA 1MNDA 2Q0YA 4YRHA 1WJBA 1M4DA 1MW7A 1CJWA 2Q04A 2Z0ZA 2ZXVA 3R1KA 5A27A 1QHGA 3A4CA 3DTIA 3DWLE 5ISVA 2JUGA 1BOBA 1YX0A 4PJMA 2CV2A 4XPLA 2RC4A 3J7AY 4FASD 1ON0A 2XF5A 2OZUA 4JQFA 2CNTA 3PNVA 2VQGA 1PUAA 1QU3A 4KOWA 2AE6A 4A32A 4AG7A 3E0JB 1Z21A 4CRYB 2FL4A 2G3AA 4RI1A 1B6BA 2PR1A 4A30A 3K4LA 4ZTFA 3TBIA 2VI7A 2X6YA 3SDBA 5G20A 4Y33A 3IWGA 1RO5A 4KOXA 4FETA 4RLFA 4B43A 4KVOE 3RSNA 1ZO0A 2VBQA 3V8IA 4CGPA 4D1QA 1P4NA 2M4KA 3A9LA 2M0MA 1QSRA 2HQAA 4D9JA 3EO4A 2WPXA 3MKZA 4JLYA 4UCNA 3TO6A 3CZ6A 4XR6A 3MKWB 4KSFA 2J8MA 5KTCA 3R9FA 4CAEA 2LOOA 3D2MA 3OWCA 4CAVA 4HNTA 3LD2A 3QODA 4DOZA 4ZGYB 2M3AA 1U0JA 2K5CA 3IU1A 4MI4A 3G8WA 3G2BA 3QYFA 2BEIA 2LREA 2X51A 3ZGKA 2Y0MA 3BC8A 3DTKA 2REFA 5FVJA 4F0YA 3K4CA 1K6YA 2M4GA 3HKZA 1MJ9A 2PRBA 2J8RA 4JOMA 3N7ZA 3OYJA 4UA3A 4MHDA 4LIVA 2OV7A 2Q2EB 2MABA 3HXLA 4LITA 3EC4A 4UCPA 4MLOA 2JA2A 4E7SA 3W3CA 2JDDA 4C2UA 2DXIA 4OAZA 4RS2A 2CY2A 3JUWA 5H86A 3PUBA 2PQ8A 4CAXA 3NE7A 4C2YA 2V9KA 4R3KA 3P2HA 4CAFA 4U87A 2HU9A 5HNHA 4PSXA 2HVQA 2J8NA 2OUMA 3VSKA 4CCKA 3D3SA 4HNWB 1V5GA 3PL8A 2R7HA 4IUSA 4KOSA 2R7OA 3K10A 3EUKL 3MGDA 2CH0A 3RPUD 2WY8Q 2K3PA 3W2WA 3H9GA 4BBHA 1PJRA 4F55A 4BDZA 1MJBA 1YREA 4M85A 2OH1A 4MY0A 2AQFA 2VQLA 3MD2A 4PFOA 3AKZA 4J01A 1E0EA 4X5KA 3R9EA 4U5YA 4XORA 3RCOA 3KKWA 4NF1A 3K70C 1WFXA 5LD2C 2VXKA 2JEVA 1AA7A 2A5WA 4KSAA 3LFUA 2B58A 4CS0B 4IX7A 3S6KA 1LKXA 5HMNA 3CP2A 3OYNA 4BMHA 3DKYA 3BCBA 2R7TA 4F52A 4C68A 2W1OA 1Y9KA 3RYOA 3RTRA 2X1EA 3P2FA 4DBQA 1IRXA 3GY9A 2KHMA 2PJRA 4XN0A 2IS4A 2FCKA 2CW8A 3UR3C 2IGNA 1V5EA 1WWZA 4A33A 4CGLA 2X6WA 2FS5A 1OLTA 2GANA 1Z4RA 1S9HA 4QVTA 1IIDA 2UV1A 4LUAA 4B12A 2IGMA 2VJJA 2X6XA 4EVYA 3DLAA 3OR1C 3ZR8X 4C7HA 2ZW4A 2Z3LA 4KLWA 3KX2A 1W36D 3CESA 1X1CA 3QYEA 4R87A 2DT6A 2E60A 2FUG2 4B48A 2E1MB 1YGHA 5BWAB 1WJCA 3H35A 4CGMA 2WBMA 4B14A 3DPLC 4PFPA 4L8AA 5IB0A 3FHNA 4G6TB 2XC7A 1MK4A 2GIVA 3TT2A 2LBFA 4BJTA 1P9QC 2IS6A 2E1MC 4XNFA 3QB8A 5AG5A 2HPMA 3PNYA 3F8KA 1PU9A 1X1DA 2WPWA 4B11A 4CGNA 5KNLA 5CQEA 4B44A 1BR1A 1OR7C 2R7VA 2YNCA 1SQHA 4II3A 2BSWA 4FD5A 5G22A 4RLQA 3RQ4A 1MMNA 1KUVA 3QYBA 2JSPA 5JHFA 4B5PB 4Q38A 3DKXA 4CAWA 3D5SC 4MJ8A 2VPLA 4CUGA 4XMYA 1OZPA 2FT0A 4KVXA 2V7FA 4CCOA 3W6SA 4HNXB 4KZTA 4QUSA 4BQOA 3B8GA 4UFVA 2Q1ZB 5HNFA 4ZTJA 1QSNA 2JDCA 2HNHA 2ZSIB 5CQGA 1Z4EA 2I79A 1LFPA 1SFKA 4MFKA 2Z3MA 3ZJ0A 1KUYA 3IAS2 4CCNA 1WK4A 3OS1A 3F9KA 4XPKA 3T9YA 2REEA 3E1SA 2O28A 3FBUA 3LSMA 2X85A 5KHDA 3ZZIA 1YK3A 4H4KC 4C2XA 2CW7A 4J00A 2EVNA 3TL4X 3OYHA 3TE4A 3M8JA 2RREA 1LVKA 3CMMA 4HSRA 3VYRB 4EATA 1KUXA 1V0CA 4I49A 4M3SA 3W91A 3I3LA 3TFYA 1YX3A 4C7IA 1X19A 2Z16A 2KLOA 2Q4VA 5G1ZA 1BR2A 4AVZA 4B47A 4B13A 4JXRA 2ZW7A 1V5FA 4KUAA 2CUZA 2PJRB 5C82A 1ZELA 2EUIA 2Z3OA 2C27A 2B3VA 4YFJA 4KVME 4XONA 1YLEA 2ARHA 1WJEA 4BACA 2Q4YA 3CJRB 2E5NA 1ERDA 4H6ZA 4PJNA 2KL4A 2E5ZA 4NNJA 4IKFA 1HA8A 1D0ZA 1EA3A 4IQ4A 4BEHB 4KLVA 3LSGA 3OR2C 1R6RA 2WY7Q 3PSIA 3AL0B 1JI8A 2PC1A 1B87A 2ZPAA 4BE2A 5JQ4A 1FMVA 5C88A 2VJIA 3OYKA 4IZZA 5DWMA 4ZDLA 4Y49B 4NUBA 2WUUA 1Q2DA 3C2GA 5AG6A 4XKCA 4LG3A 3GBGA 2LBFB 4HNUA 4KITB 2VXDA 5FROA 2RNGA 3AL0C 3K6GA 4GRIA 1S3ZA 1Y9WA 3D2PA 2VIXA 2KCWA 2JLMA 2VLAA 3PP9A 4Y49C 3L2UA 2IL4A 3S8PA 3H5RA 4DGWB 2HVSA 1Z3XA 3A1YA 1M4GA 4UCMA 4HKFA 4F6AA 2XDVA 2CNMA 4DJAA 3S3MA 4PK4A 4AB7A 1D0XA 4ITVA 2X1DA 1XEBA 4BUPA 4F3QA 2G0BA 4CRZB 4J3GA 2WADA 2X1CA 4C9YA 3TOAA 3K4KA 1R57A 2QMLA 2HVRA 4KJZA 1VKCA 1I1DA 3PFYA 4YELA 3K4BA 2YNCC 3GYAA 3DNSA 3CXSA 2QECA 2VB6A 4KISA 3KEYA 3VYUB 4U7BA 1IB1E 3EXNA 3SYTA 4NSQA 4FD4A 4CSWA 3H0DA 4E7IA 4DNCA 2WA0A 2OZGA 3HOSA 2L7KA 4OAEA 3L2WA 1S7NA 2AJ6A 2VKHA 4DIQA 2K5TA 5J8FA 2OU2A 3OYDA 2NMTA 3ONQA 2R7RA 3OYMA 4KUBA 3OMYA 2JVGA 4XOPA 4NQWB 3BG7A 2Z1DA 1XE4A 3OS0A 1NSLA 2A4NA 2K9LA 3S3OA 3DSBA 3K4MA 2CNSA 4QC6A 1T95A 3FNCA 2LC2A 2NOJB 3OWTA 2CFOA 3W2AA 2F6CA 1N75A 3ZRGA 2A6TA 2B3UA 4UWIA 2B4DA 2L2OA 4XKVA 1YR0A 4HEA2 1QSTA 4JJXA 4HRIA 5CKTA 3EUHC 4YRVA 4BDYA 1BO4A 4R57A 1Z3YA 4QPQA 4BQQA 3OIPA 2CUJA 2D4OA 1G8XA 2GOXB 3VSLA 3CXQA 5F46A 4HPQA 1NG6A 4XLFA 3OYGA 1IYKA 4PUSA 2PR8A 2YGWA 4UWJA 2ZXHA 4CYPA 1TT0A 1QSOA 3MKYB 5JPHA 2R7WA 2D4PA 4MFPA 1X1BA 4BU2A 5AGEA 4E6KG 3DQVC 3WR7A 2BVLA 3DEEA 4XOTA 4JWPA 2JVHA 4P5OA 3HL2A 1KZFA 1N71A 1VHSA 3GKRA 4QB9A 1NE9A 2R7QA 3DPTA 3TO9A 2VASA 2HUZA 4NXYA 1BR4A 2MD0A 2IGKA 4KT6A 4BXFA 3I9V2 1Q2YA 4JD6A 4PK3A 3D5LA 3OYCA 4IQJA 3A2KA 4XM3A 1DP3A 1Z9UA 3OYLA 2HDWA 1LRZA 5H84A 2R7UA 3OIQA 3H9QA 2WAEA 3BLYA 4NC7A 1MMGA 4Y3OA 4C2TA 3AFHA 2R7XA 4U9ZA 4UFXA 3DDDA 3R95A 3VWEA 4XLCA 2BL1A 2Z11A 4BJ5C 4N4NB 2FE7A 3CXPA 3VYSB 2LH9A 4JXQA 4MY3A 1TIQA 1Y6IA 1GHEA 1N77A 2HV2A 3TO7A 2KMUA 2ZSHB 3IP4B 1NMTA 2VZYA 2QKMB 3F0AA 3LODA 3IUOA 5EC4A 3T90A 3SEZA 4A95A 1S60A 2KP6A 1MMDA 2VKDA 3S6GA 3LMMA 4CYNA 3OYBA 1CM0A 4RM2A 1TZLA 2P0WA 3FB3A 1XIXA 4H89A 1D1CA 2L5QA 2LG4A 4QPOA 2AQEA 3TCVA 3DR6A 1RXTA 4XKWA 4CYOA 2IXSA 1N78A 4FD7A 4PSWA 3ZQQA 2R1IA 3UNGC 2WB1A 3F5BA 3R9GA 2P6GA 3S6HA 3W6XA 3K9UA 4AVCA 2CMPA 3SXOA 4B10A 2I00A 1WJAA 4MFJA 5EBVA 3CF2A 4Y4RA 2OZHA 2Z3NA 4E7LA 1D1BA 3TTHA 2B4DB 3SHPA 4AVBA 2BVMA 2KDOA 1YX5A 2HPIA 3FKJA 1GLNA 3FBNB 1YVOA 1VZ0A 3FDYA 4KOVA 2K9MA 4CA0A 5KTDA 4ZC3A 1S7LA 3I9SA 2DT7B 2ATRA 4PK2A 4FD6A 1Q2CA 2DPTA 2ZXIA 4E8OA 3BG6A 2Q44A 2VJ4A 2OC6A 4DBRA 5LFAA 2MC4A 4CH7A 2F5VA 4MFLA 4CCJA 4BE1A 3IAM2 3H5AA 2KRHA 2CV0A 4ONUA 4CCLA 1G59A 2Z3KA 4A31A 3LSHA 4F91B 2B4BA 1M44A 2ZW6A 3N05A 4II2A 4ZDPA 4LX9A 3H5NA 3M1CA 3W2VA 2W82A 3OYIA 2B5GA 4BL0B 2VXZA 3LSKA 4KORA 4KS9A 4HNYB 2CXAA 2ZW5A 4OLLA 3K4NA 3UY5A 3ZCOA 1MMAA 2WAQA 2ZFUA 4XKBA 4BE0A 3L2RA 2H5MA 3BCAA 1MJAA 2VQYA 3G3SA 3DU5A 4KOTA 5F47A 5IV0A 3PJRA 3VDXA 2XF7A 4Q36A 2BW3A 4MFZA 2IS2A 2DJIA 2Z10A 3PSFA 3L2QA 2F4IA 4GS4A 2V4JC 3OYAA 3FIXA 1U6MA 2L9NA 3H4QA 4XN3A 3D8PA 4U9YA 4XLHA 2WAFA 5TGTA 4X0GA 2P6FA 1YE9A 4AU7A 4ORFA 1FMWA 3HOTA 4BS9A 4RM3A 2M7AA 3TMOA 2QIRA 3R96A 1LDKB 3PZJA 3FXTA 4LIUA 3OYFA 4ANJA 1I21A 2R4GA 3HPGA 1KONA 3QOEA 2WSAA 4E0AA 2DPSA 4KOYA 4CGOA 2HQYA 3BJ7A 2Z2SB 3H5ZA 3DU6A 2VQCA 4PJLA 3QAHA 3S93A 2HZDA 5J8CA 3KYLA 3S32A 5AG4A 1IICA 3TOBA 1J09A 5E96A 2DCEA 2LY1A 4MFQA 4K30A 2V26A 2W4SA 3OOUA 5FRMA 2RQQA 4B5OA 3OL3A 2G3TA 5HH1A 1Y7RA 5HVQC 1S5KA 3FRMA 4UFWA 1T0FC 4E7ZA 2R8VA 3IGRA 1XF8A 3C2HA 2YNDA 4OADA 2F5IA 4R9MA 1UFHA 5HLTA 4NEXA 1MNEA 4PJJA 1K4JA 3MMYB 2OB0A 2FIWA 2X7BA 2XAUA 1DGWY 4NCZA 3OY9A 2V1NA 4XPDB 5F49A 3EY5A 3V42A 4YGOA 2PMZA 3LL7A 3I3GA 4B5PA 3U21A 2FXFA 2R98A 4PV6A 2I8DA 3K70D 1QHHD 4ZJZA 3OYEA 4C2ZA 4XPDC 5A28A 3E0KA 3JTKA 1S7FA 4AVAA 5F48A 5I0CA 3HPHA 4MBUA 3K4JA 3SEQA 1WJDA 2L9SA 3EUAA 3HC7A 4E4HA 1WJ5A 2VJ5A 4IF5A 4HSTA 1J4JA 4OWRB 5AG7A 2PDOA 3VWDA 2V6EA 2LYCA 3BLNA 3BJ8A 3OS2A 2O5RA 2XSJC 4RMNA 3S3NA 2BUEA 2B5GB 3DR8A 3OL4A 1XMTA 2IGOA 2XF6A 1M1DA 2KRCA 3IU2A 3SXNA 3VWBA 4XNHB 3VYTB 3DTEA 5KTAA 4CCMA 3PNTA 2BW3B 3ZXSA 1PYVA 1M4IA 2YNEA 4BGDA 2BOLA 4XLAA 2LRDA 4YEJA 2P6EA 1UG0A 1QSMA 3LSIA 5GCNA 4XNHC 4CYQA 1W36C 5DWNA 5G21A 2W00A 1SAUA 4C30A 3NWSA 2IS1A 3JVNA 5IX3A 3SZGA 4XL9A 3IWEA 4OAYA 4NC8A 1L0CA 4HG2A 4R3LA 2FSRA 2M7BA 2MFZA 4BEHA 4H6UA 4B3XA 1FY7A 3DPUA 4AG9A 3C26A 1DQUA 4A2ZA 2GOMA 4E2AA 2Y0SA 2VQHA 3EFAA 2DXQA 1X1AA 1Y56A 2KPMA 2FIAA 2PSWA 4KOUA 4F0XA 3EPZA 5CNPA 4XQFA 1D0YA 1DGRM 2R7SA 1X4OA 2Z3PA 2CV1A 3FBIB 4R79A 2UWMA 4II9A 4UBRA 4P1WA 2QKLB 4CZCA 4F93B 2Q7BA 4QBJA 3CJQB 2KZVA 2VZZA 3D5RC 1UAAA 2MYSA 4BJ6C 4E7JA 1P0HA 4XLEA 3H9JA 2CS3A 2ELJA 4AYBA 5HOOA 5CPRB 2GE3A 4ZBGA 3S6FA 2KQRA 1YVKA 3NWTA 4F92B 3FYNA 1I12A 2UUZA 2VL8A 2VEZA 1Z7LA 1WJFA 5KCMA 1X4PA 3HUGB 3L2VA 4E7HA 1UELB 2LY2A 3HG9A 4ZDOA 4ZYAA 3CP8A 4BQNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IYL A;  1S7K A;  4L89 A;  3PGP A;  2Q0Y A;  4YRH A;  1M4D A;  2Q04 A;  1CJW A;  2Z0Z A;  2ZXV A;  3R1K A;  5ISV A;  1BOB A;  1YX0 A;  4XPL A;  2RC4 A;  1ON0 A;  2OZU A;  2CNT A;  1PUA A;  4KOW A;  2AE6 A;  4AG7 A;  4CRY B;  2FL4 A;  2G3A A;  4RI1 A;  1B6B A;  2PR1 A;  2VI7 A;  3IWG A;  1RO5 A;  4KOX A;  4KVO E;  2VBQ A;  3V8I A;  1P4N A;  1QSR A;  4JLY A;  3EO4 A;  3TO6 A;  2WPX A;  2J8M A;  5KTC A;  3R9F A;  3OWC A;  3D2M A;  4CAV A;  3LD2 A;  4MI4 A;  3G8W A;  2BEI A;  5FVJ A;  2Y0M A;  2REF A;  4F0Y A;  1MJ9 A;  2PRB A;  2J8R A;  3N7Z A;  4UA3 A;  4MHD A;  3EC4 A;  2JDD A;  4RS2 A;  2CY2 A;  3JUW A;  5H86 A;  2PQ8 A;  4CAX A;  3NE7 A;  4R3K A;  3P2H A;  4PSX A;  2J8N A;  3D3S A;  4HNW B;  2R7H A;  4IUS A;  4KOS A;  3MGD A;  1MJB A;  4M85 A;  1YRE A;  4MY0 A;  2OH1 A;  4X5K A;  3R9E A;  4U5Y A;  3KKW A;  4NF1 A;  2VXK A;  2JEV A;  2B58 A;  4CS0 B;  3S6K A;  5HMN A;  4BMH A;  1Y9K A;  3RYO A;  3P2F A;  3GY9 A;  2FCK A;  1WWZ A;  2FS5 A;  2GAN A;  1Z4R A;  4QVT A;  1IID A;  4LUA A;  4EVY A;  2ZW4 A;  4KLW A;  4R87 A;  1YGH A;  4L8A A;  5IB0 A;  1MK4 A;  2GIV A;  3TT2 A;  3QB8 A;  3F8K A;  1PU9 A;  2WPW A;  1SQH A;  2BSW A;  4FD5 A;  1KUV A;  4CAW A;  4B5P B;  4MJ8 A;  1OZP A;  2FT0 A;  4KVX A;  3W6S A;  4HNX B;  4KZT A;  4QUS A;  3B8G A;  1QSN A;  2JDC A;  1Z4E A;  2I79 A;  3ZJ0 A;  1KUY A;  1WK4 A;  4XPK A;  3T9Y A;  2REE A;  2O28 A;  3FBU A;  3ZZI A;  1YK3 A;  2EVN A;  3TE4 A;  3W91 A;  1V0C A;  1KUX A;  4I49 A;  4M3S A;  3TFY A;  2Q4V A;  4JXR A;  2ZW7 A;  4KUA A;  5C82 A;  2EUI A;  2C27 A;  2B3V A;  4YFJ A;  4KVM E;  1YLE A;  2ARH A;  2Q4Y A;  4H6Z A;  4KLV A;  2PC1 A;  1B87 A;  2ZPA A;  5JQ4 A;  5C88 A;  5DWM A;  4Y49 B;  1Q2D A;  2P6F A;  1S3Z A;  1Y9W A;  3D2P A;  2KCW A;  2JLM A;  3PP9 A;  4Y49 C;  2IL4 A;  4F6A A;  1M4G A;  4HKF A;  2CNM A;  4AB7 A;  1XEB A;  2G0B A;  4CRZ B;  4J3G A;  3TOA A;  1R57 A;  2QML A;  1VKC A;  3GYA A;  1I1D A;  3DNS A;  3CXS A;  2QEC A;  3EXN A;  4NSQ A;  1IB1 E;  4DNC A;  4FD4 A;  2OZG A;  4OAE A;  1S7N A;  2AJ6 A;  5J8F A;  2K5T A;  2OU2 A;  2NMT A;  4KUB A;  1XE4 A;  1NSL A;  2A4N A;  3DSB A;  2CNS A;  4QC6 A;  3FNC A;  2B3U A;  4UWI A;  2B4D A;  1YR0 A;  1QST A;  4JJX A;  1BO4 A;  4R57 A;  2D4O A;  3CXQ A;  5F46 A;  4UWJ A;  1IYK A;  2PR8 A;  1QSO A;  2D4P A;  3WR7 A;  4JWP A;  1N71 A;  1VHS A;  1KZF A;  3GKR A;  4QB9 A;  1NE9 A;  3TO9 A;  4NXY A;  2HUZ A;  4JD6 A;  1Q2Y A;  4PK3 A;  1Z9U A;  1LRZ A;  5H84 A;  4U9Z A;  3DDD A;  3R95 A;  3VWE A;  3CXP A;  2BL1 A;  2Z11 A;  2FE7 A;  4JXQ A;  4MY3 A;  1TIQ A;  1GHE A;  2HV2 A;  3TO7 A;  1NMT A;  2VZY A;  3F0A A;  3LOD A;  5EC4 A;  3T90 A;  1S60 A;  3S6G A;  1CM0 A;  3FB3 A;  2P0W A;  4H89 A;  1XIX A;  3TCV A;  3DR6 A;  1RXT A;  4FD7 A;  4PSW A;  2R1I A;  3F5B A;  3R9G A;  2P6G A;  3S6H A;  3W6X A;  3K9U A;  4AVC A;  3SXO A;  2I00 A;  5EBV A;  2OZH A;  3TTH A;  2B4D B;  3SHP A;  4AVB A;  1YVO A;  4KOV A;  3I9S A;  1S7L A;  2ATR A;  4PK2 A;  4FD6 A;  1Q2C A;  4E8O A;  2Q44 A;  5JPH A;  4ONU A;  2B4B A;  2ZW6 A;  1M44 A;  4LX9 A;  2B5G A;  4KOR A;  3UY5 A;  4HNY B;  2ZW5 A;  4OLL A;  5KTD A;  2H5M A;  2VQY A;  5IV0 A;  3G3S A;  1MJA A;  4KOT A;  5F47 A;  2Z10 A;  4GS4 A;  3FIX A;  1U6M A;  4U9Y A;  3H4Q A;  3D8P A;  4ORF A;  2QIR A;  3R96 A;  3PZJ A;  3FXT A;  1I21 A;  4E0A A;  4KOY A;  2HQY A;  3BJ7 A;  3QAH A;  5J8C A;  1IIC A;  3TOB A;  5E96 A;  4K30 A;  4B5O A;  2G3T A;  5HH1 A;  1Y7R A;  1S5K A;  3FRM A;  2R8V A;  3IGR A;  1XF8 A;  4OAD A;  2F5I A;  4R9M A;  1UFH A;  4NEX A;  1K4J A;  2OB0 A;  2X7B A;  2FIW A;  4E2A A;  4NCZ A;  5F49 A;  4XPD B;  3EY5 A;  4YGO A;  3I3G A;  4B5P A;  4PV6 A;  2FXF A;  2R98 A;  4XPD C;  3E0K A;  1S7F A;  4AVA A;  5F48 A;  5I0C A;  4MBU A;  4IF5 A;  1J4J A;  3VWD A;  2PDO A;  3BLN A;  3BJ8 A;  2BUE A;  2B5G B;  3DR8 A;  1XMT A;  1M1D A;  3SXN A;  4XNH B;  5KTA A;  1M4I A;  2P6E A;  1QSM A;  5GCN A;  4XNH C;  5DWN A;  3JVN A;  5IX3 A;  1L0C A;  4R3L A;  2FSR A;  4H6U A;  1FY7 A;  4AG9 A;  3C26 A;  3EFA A;  2DXQ A;  2FIA A;  2PSW A;  4KOU A;  5CNP A;  4II9 A;  4UBR A;  2Q7B A;  4QBJ A;  2VZZ A;  2GE3 A;  1P0H A;  4ZBG A;  3S6F A;  1YVK A;  3FYN A;  1I12 A;  2VEZ A; 
#chains in the Genus database with same CATH topology
 1D5Y A;  2EZK A;  2EQR A;  2HWV A;  2RVC A;  4A3L J;  4Y13 A;  5FB2 A;  3FJU A;  1H89 C;  2MGQ A;  2E71 A;  2DOA A;  1TWH J;  1ENH A;  3LOC A;  1DU0 A;  3A4C A;  1YQA A;  3DTI A;  3DWL E;  3FED A;  3BJA A;  4LG0 B;  3ABM H;  2CV2 A;  3J7A Y;  1JTY A;  2XF5 A;  4JQF A;  1BL0 A;  2CNT A;  1U3E M;  1Z5R A;  2MLK A;  4RUH A;  4A32 A;  4IL6 C;  4OID A;  2G3A A;  1V4R A;  4LOC A;  4F7Z A;  1RR8 C;  2DOD A;  2D1V A;  3K4L A;  2PR1 A;  4NB5 A;  2ZCW A;  3TBI A;  2VC0 A;  4A12 A;  4NGN A;  4FUU A;  2EIK H;  3QPH A;  4KVO E;  1ELM P;  4P10 A;  2DMN A;  4HA8 A;  2WAQ N;  3U2R A;  2HQA A;  4UCN A;  3TO6 A;  2ZO4 A;  2HDD A;  3QP5 A;  5IOY A;  1SFX A;  1APL C;  3LD2 A;  3JRA A;  4ZGY B;  5IB9 A;  2K5C A;  3HEF A;  3IU1 A;  2Y75 A;  3T8W A;  3G2B A;  2BEI A;  1AKH A;  3ZGK A;  3BC8 A;  3DTK A;  1K6Y A;  3B6A A;  1KU3 A;  2ZME B;  2IPQ X;  2PRB A;  2OBP A;  1TW2 A;  3M8F A;  3RJP A;  1B72 A;  1GHC A;  4LIV A;  5ERI A;  4GO1 A;  1IO2 A;  4MHD A;  2E7X A;  4BXX J;  3CCE I;  4CIC A;  5E79 C;  5A2Q K;  2DXI A;  1YIJ I;  1HDU A;  5BMZ A;  2QZ8 A;  2WZN A;  1YW4 A;  1ZGA A;  3H8G A;  4A3J J;  2PQ8 A;  1A35 A;  3GTP J;  4KN4 X;  2BZT A;  4M72 A;  2Q4Z A;  4U87 A;  4X1E A;  4HV5 A;  5DDG A;  2HVQ A;  4R1H A;  4OC0 A;  4CCK A;  4HNW B;  4WXD A;  4UEE A;  2BEO A;  2VBX A;  5AG6 A;  1ZG1 A;  3MGD A;  2IBD A;  1MH4 A;  2ESN A;  2LKX A;  4CGZ A;  4BBH A;  4G7Z F;  2DYR H;  4RGX A;  3ZMD A;  4BKX A;  4M85 A;  1YRE A;  4P4J A;  2L7Z A;  2K4J A;  3BTL A;  2AQF A;  2Y69 H;  3AKZ A;  4X5K A;  2OAZ A;  1Z8W A;  4EGY A;  3NAU A;  4XOR A;  3RCO A;  3HLP A;  1WFX A;  1BLL E;  3S9N A;  2XEI A;  1AA7 A;  3WU0 A;  4RS8 A;  1JWQ A;  4KSA A;  4JP0 A;  5JVG F;  1IG7 A;  2YS9 A;  4L9N A;  3QWL A;  3L9F A;  4Y52 J;  3BCB A;  3FK7 A;  1HDQ A;  2C6Y A;  1Y9K A;  3BR2 A;  1Z2L A;  2KHM A;  3JTH A;  4XN0 A;  2DFH A;  3GW2 A;  3KPH A;  3UR3 C;  2IGN A;  2STT A;  4A33 A;  5FKO A;  1FP2 A;  1BIB A;  1K79 A;  1G2H A;  3IH3 A;  2M87 A;  1S9H A;  4EEF G;  1U6G A;  3MN8 A;  2R7F A;  4LUA A;  1KU2 A;  1Y8Q B;  1VQ5 I;  2Y31 A;  4B12 A;  2W85 A;  3TW7 A;  2IGM A;  2VJJ A;  1VQ7 I;  2E1C A;  3DLA A;  3I54 A;  5E3L A;  6CPA A;  5JVT A;  4AIJ A;  4UIA A;  3CES A;  4JK1 X;  2DTZ A;  3A03 A;  3QYE A;  5BWA B;  3WTY C;  4TV7 A;  4LK1 F;  1YGH A;  1WJC A;  2BXZ A;  3U1K A;  4PFP A;  5J47 A;  5IB0 A;  6PAX A;  3FHN A;  2EIN H;  3GXO A;  2B9S A;  1WRJ A;  1YRN B;  1P7I A;  4ONW A;  3QB8 A;  3KR4 A;  1XSV A;  2Y0S N;  1LQ1 A;  4P4D A;  1ZHF A;  3BTC A;  1XN7 A;  5B66 C;  3ISX A;  3KHX A;  3HM5 A;  2CTB A;  1MH3 A;  4K2E A;  4P9U A;  2PJP A;  2VON A;  2Z9O A;  1MMN A;  1F4K A;  1B9N A;  3TED A;  4YWY A;  5GTH C;  4CAW A;  4AYB N;  3FXR A;  3BXM A;  2Y30 A;  3D1N I;  2AFM A;  1A36 A;  5DM7 F;  3LWU A;  2V7F A;  4V19 K;  2EA4 A;  3W6S A;  3C2B A;  3HHG A;  4QUS A;  3CJT B;  4IRG A;  4NBQ A;  5HNF A;  4UFV A;  2HYF A;  1UJ8 A;  1QSN A;  2I79 A;  1LFP A;  2WV1 A;  1SFK A;  1H8A C;  2R93 J;  2Z3M A;  1G3T A;  3IAS 2;  3EYY A;  5J3L A;  3VOE A;  1EH7 A;  3F9K A;  4XPK A;  2REE A;  4XID A;  4C2X A;  2FQ4 A;  3H92 A;  1MBJ A;  2K3F A;  4H4K C;  3RPU A;  3ZZI A;  2GFQ A;  3OYH A;  4G7O F;  3M8J A;  1LVK A;  3CMM A;  1XSX A;  2F4M B;  2VL1 A;  4ESJ A;  3I3L A;  3AG2 H;  4HQM A;  3PQK A;  1EE3 P;  3IL2 A;  3I56 I;  1ZKG A;  4ZYG A;  3PM1 A;  4JXR A;  4IHS A;  2AFX A;  1ZEL A;  3DV8 A;  2YX4 A;  3E7L A;  2IA0 A;  1LE8 B;  4ZYH A;  2PRQ A;  4KVM E;  5CBM A;  2ARH A;  1U9N A;  5H2F C;  4BAC A;  2P6T A;  3CJR B;  1I1G A;  2ZOG A;  2A5Y B;  4H6Z A;  4PJN A;  3NFZ A;  4NNJ A;  1HA8 A;  1D0Z A;  1EA3 A;  4BEH B;  1XMX A;  5LYI A;  4O23 A;  5HLI A;  5K8P A;  2DTR A;  3PSI A;  1JI8 A;  3IC1 A;  4BE2 A;  1Y7E A;  1NTC A;  3W6J B;  1K4T A;  4IZZ A;  3OYK A;  3T8R A;  1LAM A;  4ZDL A;  1QZY A;  2EBJ A;  2QQB A;  1GXQ A;  2VT2 A;  2NVU B;  4XKC A;  5D8L B;  4FTH A;  2HXO A;  2LBF B;  4HNU A;  2ACJ A;  2P6F A;  3R6S A;  3K6G A;  5KK1 A;  5IP9 J;  3CC4 I;  1GVJ A;  3FXK A;  2JLM A;  1EH6 A;  2FE3 A;  4EV0 A;  1Y1W J;  4OP4 A;  4Y49 C;  3LSR A;  3HKZ N;  4UCM A;  3LAC A;  1IXC A;  2PJ8 A;  3GLL A;  1Q1V A;  4ITV A;  4KN7 X;  4P96 A;  5DCM B;  4UV8 A;  1IN5 A;  4BUP A;  3D66 A;  1FTT A;  1K7A A;  2WAD A;  4UVA A;  3TOA A;  4C9Y A;  4BHP A;  3I53 A;  2HVR A;  3GYA A;  1IOI A;  3J81 K;  3CXS A;  3IO1 A;  2O8X A;  4KIS A;  2CU7 A;  1HW2 A;  3S1M J;  4DNC A;  1IB1 E;  3SYT A;  3EXN A;  4CSW A;  2JZY A;  3H0D A;  3N4M A;  2OZG A;  2GXG A;  4OAE A;  3BR5 A;  2EA2 A;  1W4M A;  3OYD A;  2NMT A;  5K1Y A;  3OMY A;  1HDD C;  3G1L A;  2JVG A;  4XOP A;  4LB6 B;  1BM9 A;  2HB6 A;  5LEJ A;  2A4N A;  3S3O A;  1BW5 A;  3F3X A;  4QTR A;  3FNC A;  1JUP A;  4QC6 A;  2F2E A;  2NOJ B;  2CFO A;  1MDM B;  1SFE A;  2A6T A;  4WK8 F;  3DLL F;  3S2H J;  5D8N A;  1RI7 A;  3QU6 A;  3M9A A;  3F0C A;  1RC9 A;  1H8L A;  1QST A;  4BDY A;  2BHZ A;  3GWZ A;  1Z3Y A;  1XX5 A;  4QPQ A;  1QA6 A;  3N5F A;  5LRJ A;  3VOD A;  2CJJ A;  4UWJ A;  5LGT A;  1FC3 A;  1K83 J;  1P2F A;  1Y0N A;  3WTZ A;  2QWW A;  3JR9 A;  4ETS A;  3DBR B;  3CZX A;  3JCU C;  2GBY A;  2HGC A;  1WKM A;  1IRG A;  3U9G A;  4OU0 A;  4BU2 A;  3E6M A;  1KZH A;  4JWP A;  2PBI A;  1N71 A;  5J1U A;  4S05 A;  3HL2 A;  4BNC A;  1KZF A;  1LUJ B;  1Z1D A;  2ZXW H;  3GTM J;  1BI0 A;  4RBO A;  5GAH J;  2Y48 A;  2QBY A;  2HUZ A;  1SMT A;  5E1W A;  4JD6 A;  4KT6 A;  1XOV A;  3OSF A;  5JFR A;  3AG3 H;  2EK5 A;  2NS0 A;  1Z05 A;  3ZN1 A;  2MLG A;  2Y9Z A;  3OYL A;  2DEA A;  2R7U A;  2LKS A;  3H9Q A;  5GP9 A;  4P4F A;  1UCR A;  5AIQ A;  3BR0 A;  3AFH A;  2ZEN A;  4LJZ F;  4C3H J;  3R95 A;  2LP0 A;  2EIL H;  1IN6 A;  4BJ5 C;  3PB4 X;  3GFL A;  1Y6I A;  1GHE A;  2HV2 A;  1ELL P;  3JW4 A;  2HOE A;  2KMU A;  1NMT A;  5EC4 A;  4ESF A;  3IUO A;  1S60 A;  2VKD A;  3OYB A;  1CM0 A;  3FB3 A;  1XIX A;  1D1C A;  2DBB A;  4EQQ A;  4BYY A;  3S1Q J;  1IW7 F;  4CYO A;  2IXS A;  3HOU J;  2EFN A;  3ECH A;  3B2Y A;  4RB3 C;  2LNB A;  3UNG C;  1T39 A;  4PXE A;  1YG2 A;  3S6H A;  1HSJ A;  4AVC A;  2CMP A;  2UXX A;  1Z0X A;  3WHC A;  2OTJ I;  4MFJ A;  1BPM A;  3CF2 A;  5EBV A;  5K7H A;  5D5V B;  1FLI A;  3ISZ A;  1D1B A;  3FM3 A;  4O5V A;  2XAJ A;  4AVB A;  2HPI A;  1VZ0 A;  2JA5 J;  1HQC A;  5IP7 J;  1Y8R B;  3V7C A;  2K9M A;  4ZC3 A;  2KJC A;  2DT7 B;  1ORK A;  2NVY J;  4PK2 A;  3Q9S A;  2P7C B;  4X8I A;  2DFE A;  2Z99 A;  2Q51 A;  2DO7 A;  2VJ4 A;  5LGN A;  1M1E B;  2XPV A;  3BR1 A;  5LFA A;  5GAD J;  1CPX A;  2XRN A;  4FWU A;  5JPH A;  1HST A;  3IAM 2;  1QPI A;  4KSI A;  1YJ9 I;  5FKL A;  2A07 F;  5IYD J;  3N05 A;  4A3E J;  1IRZ A;  2ODF A;  4NGP A;  4EME A;  3CCU I;  4ZZL A;  3KP2 A;  2YR2 A;  4I0A A;  1EF4 A;  2FQ3 A;  4AD9 A;  4BL0 B;  3LSK A;  1ZAO A;  4KOR A;  3RNZ A;  1HF0 A;  2VOO A;  3SI2 A;  3WGG A;  1P92 A;  1KQ9 A;  3K4N A;  3O6B B;  1IRF A;  2W25 A;  4XKB A;  2VT3 A;  3ZCO A;  3V8L A;  1F36 A;  3BCA A;  4BE0 A;  4HF2 A;  1LAP A;  2H5M A;  3G3S A;  4KOT A;  3PJR A;  1BPN A;  2PJ1 A;  4N0B A;  3JRF A;  1A2Z A;  2IS2 A;  2Z10 A;  3PSF A;  2R7Z J;  2CF4 A;  2FNA A;  2HTS A;  2AFW A;  2O61 A;  3KCC A;  1U6M A;  3FIX A;  1HKT A;  3C1D A;  3KP6 A;  2WAF A;  2EIJ H;  1R7J A;  1YE9 A;  4FX4 A;  3HOT A;  2HTJ A;  3JTG A;  1FZP B;  3PZJ A;  1OYW A;  1UZC A;  2ZKZ A;  3QOE A;  1X2N A;  4E0A A;  5B1A H;  1ZGW A;  1OPC A;  2FSW A;  2NOG A;  2VQC A;  2E2I J;  4IXA A;  3ASO H;  3CDL A;  4GCV A;  1IIC A;  5E96 A;  2IEK A;  1IY7 A;  3EDP A;  2V26 A;  2PJ7 A;  2RQQ A;  3CCL I;  1R3N A;  2PJA A;  3FRM A;  4WJB A;  3HRT A;  3MFK A;  3P7N A;  1ZR2 A;  1XF8 A;  2YND A;  2CFX A;  1IN7 A;  1UFH A;  4NEX A;  1ZTR A;  3ERE D;  1K4J A;  3MMY B;  1TWC J;  2LFB A;  5F49 A;  3OY9 A;  1TBX A;  1IF1 A;  4D0P A;  3EY5 A;  2MH2 A;  3AG4 H;  2PMZ A;  1OCP A;  2DK5 A;  4UNO A;  4HX4 A;  3F23 A;  4L5I A;  2AXL A;  2CIJ A;  3K70 D;  2X9D A;  3OYE A;  4BD9 A;  4C2Z A;  2FNP A;  1YLO A;  2PMZ N;  3E0K A;  2C6P A;  1ZLJ A;  4DYR A;  3JTK A;  1VQ8 I;  4A38 A;  1MMS A;  5DUK A;  4YFX F;  3E5Q A;  2OR4 A;  3FMS A;  1IOF A;  4FCY A;  1WJD A;  2FOK A;  4UUS A;  2H27 A;  3EUA A;  2G0E A;  3BPX A;  3CCS I;  1PYT B;  4HST A;  4M9X A;  2FVG A;  1JT6 A;  2J9A A;  3Q0W A;  2PDO A;  5HVH A;  4A3C J;  1Y0Y A;  4RMN A;  3WC6 A;  3DR8 A;  1XMT A;  3G6E I;  4B3A A;  1Z67 A;  2IGO A;  4KIF A;  1AMP A;  4XNH B;  1I50 J;  1RZ4 A;  1TQM A;  2CW0 F;  3NRV A;  3F72 A;  3PNT A;  5GPA A;  1FOK A;  2JQ7 A;  1PYV A;  2DPD A;  1YW7 A;  1FIP A;  4YEJ A;  2LRD A;  4ON0 A;  1FTZ A;  2JBK A;  4CYQ A;  5GCN A;  3FK6 A;  2QGU A;  1ZRF A;  2W00 A;  5IX3 A;  4C30 A;  2IS1 A;  1VQL I;  5K5R A;  3S2D J;  2EB7 A;  4R3L A;  2FSR A;  2OA4 A;  1FY7 A;  3FF3 A;  1SVL A;  3DPU A;  4CO8 A;  4O3M A;  5E1X A;  1DQU A;  3BHX A;  4A2Z A;  2GOM A;  3HHH A;  2O3F A;  1DPU A;  2PG4 A;  3L00 A;  1NK3 P;  5HDG A;  1ZG3 A;  5CNP A;  1DGR M;  2EV6 A;  1YME A;  2LD5 A;  4P1W A;  2Q7B A;  3BG3 A;  3CJQ B;  2EIM H;  2Q2E A;  4NHJ A;  4RGU A;  4M9Z A;  1P0H A;  2M5W A;  2ELJ A;  2XHK A;  4P4E A;  4F92 B;  5D5X B;  1MIJ A;  4I99 C;  4D7N A;  2UUZ A;  3PEI A;  5BNG A;  4FQG A;  5KCM A;  2GLO A;  4E7H A;  2LY2 A;  3HG9 A;  2BE5 F;  2VE8 A;  3H36 A;  3KZZ A;  4ABZ A;  1Z8L A;  4Q7A A;  1J5Y A;  5J1R A;  4BQN A;  1TKF A;  3D4U A;  1IYL A;  2ZEM A;  1ETQ A;  4MEY F;  4L89 A;  1NG7 A;  2OCE A;  2BY0 A;  1CX8 A;  4E7K A;  2ZED A;  3S15 J;  1MND A;  2Q0Y A;  4YRH A;  1FNN A;  1M4D A;  3RZD J;  4DJL A;  3PFI A;  4L9V A;  3O2P E;  3A0B C;  1W7P B;  2XEJ A;  3I59 A;  1YX0 A;  3LA2 A;  4XPL A;  2RC4 A;  3HBL A;  4UB6 C;  2OZU A;  5CJ9 A;  5F0C A;  5FLX K;  4LQG A;  4DUK A;  2QJ8 A;  3PNV A;  4KOW A;  1XC5 A;  1FP1 D;  4AXV A;  5K8M A;  1R1T A;  1YW9 A;  2A05 A;  4XRS A;  4X2T A;  3G1O A;  5GPC A;  2ABZ A;  1TW3 A;  1CF7 A;  1B6B A;  1UHS A;  4RB2 C;  1YTY A;  4A30 A;  5G20 A;  3O8G A;  3WT4 A;  1RO5 A;  1ODD A;  4KOX A;  2VKV A;  4RLF A;  2Z5U A;  2XGC A;  4NFR A;  1ZO0 A;  1ZLK A;  2VBQ A;  3V8I A;  4CGP A;  3KAS A;  1V55 H;  1IXR C;  2CUF A;  4JLY A;  3EO4 A;  5JI6 A;  2WPX A;  1SVO A;  3CZ6 A;  4XR6 A;  1QVU A;  4KSF A;  1Z91 A;  1DUX C;  5F09 A;  2LOO A;  5K5O A;  3D2M A;  1XTA A;  4CAV A;  3DKW A;  3SJX A;  2NRA C;  2M3A A;  3Q0U A;  1XCB A;  3G8W A;  1ZN2 A;  1R5I D;  3QYF A;  2LRE A;  3HOW J;  2IAI A;  3BR3 A;  3QQA A;  4QLC U;  5EGO B;  5EG0 B;  3F6V A;  3PO3 J;  2REF A;  2ISY A;  1YO5 C;  4JOM A;  3FH4 A;  3N7Z A;  4UA3 A;  3G4S I;  4FAI A;  1R43 A;  3KP4 A;  5DEQ A;  3HXL A;  1OR7 A;  3EC4 A;  3K2K A;  4UCP A;  2RV8 A;  4E7S A;  5E20 A;  3W3C A;  5CPA A;  4C2U A;  4OAZ A;  4EM1 A;  2M8G X;  2ELK A;  1IC8 A;  5F1R A;  3EYI A;  4A3D J;  3M4O J;  2CG4 A;  2CY2 A;  2YU9 J;  3JUW A;  2FA5 A;  2C6G A;  2V9K A;  5ICG A;  1BC8 C;  2HR3 A;  1KYW A;  3P2H A;  4ZH4 F;  4JX5 A;  4R3K A;  3LFK A;  5L3B A;  3S17 J;  1T8I A;  4B6Z A;  5KVR A;  3DCF A;  1VQ6 I;  5HNH A;  5FKK A;  4XLN F;  2J8N A;  3D3S A;  1GV2 A;  3PL8 A;  3K10 A;  3EUK L;  1CQT A;  5F6F A;  2GXB A;  3ABL H;  1PP7 U;  1D8K A;  1PJR A;  1MKM A;  1HOM A;  4RB1 A;  2M9H A;  3V7R A;  4ZX8 A;  4MY0 A;  5HVG A;  4LQ6 A;  2VQL A;  3MD2 A;  3R9E A;  4BXU A;  5ELY A;  3KKW A;  5EEG A;  2VXK A;  5LEK A;  2RN7 A;  1R71 A;  5ICF A;  1JJ8 C;  5G21 A;  5FFZ A;  1LOK A;  2LR8 A;  4RAY A;  1XSD A;  3ZQI A;  5CYV A;  2DJN A;  5DYM A;  1LKX A;  5EJC A;  1QVT A;  2R7T A;  1R36 A;  4F52 A;  4C68 A;  3RTR A;  2FML A;  3GTK J;  4W97 A;  2PJR A;  2VOP A;  4P44 A;  4AIK A;  2IS4 A;  1WWZ A;  3CME I;  1USS A;  4Z2Y A;  2PI0 A;  3GTG J;  1OLT A;  2FS5 A;  8CPA A;  4N9H A;  3IRQ A;  4MCR A;  4QVT A;  3PB7 X;  1U5T C;  2UV1 A;  4OMY A;  3FXQ A;  3M1E A;  5HXD A;  1G4D A;  2HOT A;  2JMW A;  2X6X A;  3OR1 C;  2QLZ A;  4C7H A;  1P4W A;  1W36 D;  3RKX A;  3B7I A;  1YS6 A;  5GAG J;  2E60 A;  2FUG 2;  4B48 A;  1AKH B;  5IT9 K;  1QO0 D;  4M73 A;  4MXU A;  3H35 A;  1IGB A;  2OF7 A;  4B14 A;  3DPL C;  3R0J A;  1B72 B;  4G6T B;  2XC7 A;  1MK4 A;  4L0Y B;  3TT2 A;  4DZJ A;  1P9Q C;  3HTU A;  2E1M C;  3ISP A;  4XNF A;  3A01 A;  2HPM A;  3PNY A;  3H8F A;  1PU9 A;  4B11 A;  1L3L A;  4CGN A;  3WTS C;  4LLG F;  2K27 A;  3K9T A;  1OR7 C;  2YNC A;  1XFO A;  2XV4 S;  2QQ9 A;  3DP7 A;  4RLQ A;  1P4A A;  3RQ4 A;  5IYC J;  1KUV A;  2JSP A;  5FKM A;  3DFG A;  4OC2 A;  3KFW X;  3D5S C;  2XRO A;  1WZ2 A;  1PDN C;  4M3E A;  4HNX B;  4KZT A;  4BQO A;  3B8G A;  1IN4 A;  1TXR A;  1UG2 A;  3CDX A;  2CQN A;  1Z4E A;  1I6X A;  3ZJ0 A;  2H94 A;  2XGX A;  2LK2 A;  1S7O A;  4CCN A;  3IKT A;  1ETO A;  4GFB A;  3LSM A;  2X85 A;  1MBF A;  1VND A;  5H6Q A;  5KHD A;  1YK3 A;  3TE4 A;  1RNL A;  2MD5 A;  3FX3 A;  3WTT C;  3W91 A;  3DEW A;  4IHY A;  3G71 I;  1KUX A;  1V0C A;  4M3S A;  5AIP A;  4BH9 A;  3TFY A;  3COA C;  2O7O A;  5FJ8 J;  3V4G A;  5G1Z A;  2Q4V A;  4B47 A;  2QSF X;  1I39 A;  4KUA A;  3V38 A;  3GB0 A;  1JKO C;  5C82 A;  5E1Z B;  1DE4 C;  2EUI A;  3VPR A;  5J40 A;  4KIC A;  2C27 A;  3HZJ A;  1F1Z A;  2XIG A;  1W7P D;  4EJO A;  3GYH X;  1WJE A;  2JRM A;  2E5N A;  5HS8 A;  5DCF A;  2QM3 A;  4MHZ A;  2OQR A;  3T1B A;  3MAJ A;  2F5E A;  5LYL A;  4UVC A;  3OOP A;  4IKF A;  4IQ4 A;  4D5F A;  3GX4 X;  3NH8 A;  2M1B A;  2FBK A;  4KIG A;  4IHX A;  2XAG A;  4HV6 A;  4PQA A;  2WY7 Q;  2PC1 A;  2ZPA A;  4L18 B;  1FMV A;  3RIR A;  3QAY A;  5C88 A;  2IRF G;  5DWM A;  9ANT A;  4Y49 B;  3AAF A;  3GLX A;  3C2G A;  2JWT A;  2JEW A;  5FO5 A;  1WQ2 A;  3GBG A;  3L1P A;  4KIT B;  1O7L A;  4O6J A;  5FRO A;  5TIS C;  5K7F A;  4KDP A;  3AL0 C;  1S3Z A;  5E8I A;  1U8R A;  2XEG A;  3D2P A;  4UF4 A;  3PP9 A;  2VLA A;  1X1P A;  3M7G A;  4I2O A;  4CPA A;  3MZY A;  1WPK A;  3S8P A;  3H5R A;  4DGW B;  2HVS A;  2IL4 A;  1SFU A;  3IEH A;  4OIO F;  2XDV A;  2CNM A;  4YII A;  4PK4 A;  4AB7 A;  2QVO A;  1ZG8 A;  2ME0 A;  5D6F A;  1FJL A;  1I6H J;  5E3N A;  1VQ9 I;  1XEB A;  4F3Q A;  2R92 J;  5I4M A;  1R57 A;  1VKC A;  4KJZ A;  2YNC C;  3LSP A;  4MCS A;  4YEL A;  4CYC A;  2VUM J;  3VYU B;  1HKS A;  2NSM A;  2QA4 I;  3HOS A;  2L7K A;  5HOD A;  3RKY A;  2V8V A;  2AFZ A;  1MBK A;  3LSJ A;  4DIQ A;  5J8F A;  1BJZ A;  2K5T A;  3ONQ A;  2R7R A;  3OYM A;  3K0L A;  1W5C C;  3HOV J;  3GLJ A;  3BG7 A;  2Z1D A;  3OS0 A;  1NSL A;  2K9L A;  3B73 A;  1J2X A;  4BY7 J;  3WOD F;  3J80 Z;  3DEU A;  1ZRC A;  2CNS A;  2LC2 A;  2IJL A;  5EDN A;  4NGR A;  4L5J A;  4XK4 A;  3ZRG A;  1ZG5 A;  3B3T A;  5LHH A;  4RN7 A;  4UWI A;  4U0Y A;  2B4D A;  4IHM A;  3RAM A;  2VKE A;  4HEA 2;  4JJX A;  4HRI A;  1QZZ A;  4YRV A;  3CC2 I;  1X2M A;  1ETX A;  3NQO A;  4BQQ A;  4YG2 F;  2D4O A;  3P9I A;  4AID A;  4HPQ A;  3GFM A;  3JRB A;  2CO5 A;  2Z3Y A;  2XAQ A;  5CVJ A;  5L3G A;  4A3K J;  1S3J A;  3IV5 A;  5FD5 A;  2D4P A;  3D7D A;  4GXO A;  4OC5 A;  2EFP A;  3DQV C;  4LLN A;  2BVL A;  3LA7 A;  2DLL A;  3DBL B;  2ESH A;  2JVH A;  1VHS A;  3GKR A;  4GXH A;  1MBH A;  2R7Q A;  3P9K A;  5LGU A;  3E6C C;  3BZ6 A;  4ZX9 A;  4BXF A;  3I9V 2;  5GTI C;  3RO0 A;  1TKJ A;  3OYC A;  1R4M B;  1ZGJ A;  3A2K A;  3S16 J;  1X10 A;  2FX0 A;  1B9M A;  1Z9U A;  5JR3 A;  4ZI6 A;  2HDW A;  4HZF A;  4XRM A;  3OIQ A;  2XVC A;  5CVI A;  2ZJQ F;  1ZR4 A;  3DDD A;  1B4A A;  1HXD A;  4HQE A;  4A0Z A;  3KZW A;  2A6E F;  4M71 A;  2Z11 A;  1H88 C;  2FE7 A;  1O3S A;  3S9M A;  1CP6 A;  2VN2 A;  1N77 A;  2ZJ2 A;  2AXT C;  4WWC A;  2ZSH B;  3F8F A;  2DOE A;  2EV5 A;  3G1M A;  3IP4 B;  1TL8 A;  1SAX A;  3F0A A;  2L4M A;  3S6G A;  2KP6 A;  3TW6 A;  2GU2 A;  5D5W B;  3NH4 A;  3W6K B;  1TZL A;  2P0W A;  4H89 A;  2L5Q A;  5LRK A;  3GCM A;  4R8F A;  3DR6 A;  2B7E A;  1RXT A;  1XD7 A;  1GV5 A;  1FYK A;  4ZYD A;  5L3C A;  4EVI A;  2L9V A;  3CQZ J;  2R1I A;  3H3U A;  4XSZ F;  2VI6 A;  1ZG9 A;  1FSE A;  3K2Z A;  2JT1 A;  4B10 A;  5DM6 F;  2I00 A;  2DOF A;  2IA1 A;  2OZH A;  3I4N J;  3SHP A;  1T38 A;  4MHY A;  3FKJ A;  1GLN A;  3FBN B;  4NC6 A;  3HSR A;  3FDY A;  2JA6 J;  1IN8 A;  3HOZ J;  1D8J A;  2BO9 A;  5FLV A;  4KOV A;  4CA0 A;  5EEH A;  2IVM A;  1POG A;  4UUT A;  3LAP A;  4OC4 A;  5M3F J;  1Q2C A;  2DPT A;  5LYF A;  1LVA A;  2DDA A;  2OTL I;  2ECB A;  4E8O A;  1JQG A;  3PRT A;  2YX7 A;  3Q3S A;  2GLJ A;  4OC3 A;  2E36 A;  2MC4 A;  4C2M J;  2V8H A;  2CV0 A;  2RDP A;  2V8G A;  1U78 A;  4A31 A;  3LSH A;  2ZW6 A;  1EKE A;  3IH2 A;  1WSU A;  3H1C A;  4LX9 A;  1QNT A;  2QBY B;  2CQX A;  3OYI A;  3VEP A;  2ID3 A;  2O4H A;  2VXZ A;  4OLL A;  2L3D A;  2ZFU A;  2C6C A;  2VQY A;  5IV0 A;  5F47 A;  5GAE J;  1FEX A;  2HYJ A;  2BW3 A;  3LQQ A;  1K6O A;  4WWV A;  3R60 A;  4L9J A;  2BXY A;  2DJI A;  1RRJ A;  1LFU P;  5LHI A;  2F4I A;  1IGN A;  2EO8 A;  4G6Q A;  2TDX A;  5LYD A;  4X0G A;  5TGT A;  4B09 A;  1FMW A;  5DD8 A;  4RM3 A;  2M7A A;  3TMO A;  1LDK B;  1OIS A;  2E7W A;  4I76 A;  3TGN A;  5IOZ A;  4ANJ A;  3JSO A;  1I21 A;  2R4G A;  3HPG A;  3FVL A;  5D4S A;  3GTJ J;  1HW1 A;  2ADU A;  1MSF C;  2DPS A;  3QAH A;  2Z2S B;  3BJ7 A;  3H5Z A;  4CGO A;  1TTY A;  3HDD A;  3S93 A;  2HZD A;  3PB9 X;  7CPA A;  3BZK A;  3IWZ A;  3GZ5 A;  4MMO A;  2ZFW A;  3KYL A;  2EZL A;  2MBF A;  3TOB A;  1J09 A;  2DCE A;  2LY1 A;  4AIH A;  3FXM A;  3MN2 A;  1YRN A;  3OL3 A;  3ULQ B;  5HH1 A;  5K8N A;  4G94 A;  3B3S A;  2GRE A;  2F4O B;  5M5W J;  1TP4 A;  4E7Z A;  2V6C A;  4A0Y A;  4OAD A;  4R9M A;  1YW6 A;  5B1B H;  5FD6 A;  2FIW A;  4BIN A;  2RQP A;  3LMS A;  2V1N A;  3RZO J;  3PIO F;  1ARM A;  1ZRE A;  3I3G A;  3HUG A;  1J9I A;  2GQQ A;  2KIM A;  2HQN A;  3BTI A;  4ENK A;  4PV6 A;  2ZEF A;  3JAM K;  1QHH D;  4AWX B;  4K3N A;  2W57 A;  1PVE A;  1GUU A;  2D45 A;  4EWT A;  1S7F A;  5F48 A;  3HPH A;  4MBU A;  2ZJR F;  4BHC A;  3E97 A;  2L9S A;  1IDY A;  1R4N B;  3HC7 A;  2KIQ A;  4E4H A;  1WJ5 A;  4OIP F;  2M2E A;  2RKH A;  3ESW B;  4IF5 A;  1VQ4 I;  2LSO A;  2VOD A;  5AG7 A;  1P7J A;  3VWD A;  2V6E A;  1A04 A;  3BJ8 A;  3I55 I;  3NA6 A;  3OL4 A;  2O53 A;  2WWY A;  3CLQ A;  1M1D A;  2ZEL A;  3VWB A;  5LRR A;  4HDV A;  2XUB A;  4A6D A;  2JPC A;  1O4X A;  1MD0 A;  4Q48 A;  5KTA A;  4GYG A;  2YNE A;  4BGD A;  2LKP A;  2BOL A;  3JRD A;  2RB7 A;  2EPF A;  1ON1 A;  3CTA A;  5ILS A;  2CRG A;  3CCJ I;  1HKQ A;  3ABU A;  2FU4 A;  2VBZ A;  3BRO A;  4MCQ A;  1XGO A;  1FWZ A;  1OCC H;  2M7B A;  1S5L C;  4BEH A;  3ZMU A;  5LBQ A;  1LNW A;  4H6U A;  4B3X A;  3P9C A;  1I3Q J;  3CUQ A;  4AG9 A;  3RYR A;  1BI2 A;  2DPU A;  4A94 A;  1AYE A;  4GGG A;  2K4B A;  3EFA A;  3WU2 C;  2DXQ A;  3CCY A;  2FIA A;  2Q43 A;  1IUF A;  3TP0 A;  5D29 A;  3EPZ A;  3JRE A;  1BJA A;  5M5X J;  3ZMT A;  2CV1 A;  4ENM A;  4KA4 A;  2O6G E;  3PBE A;  3GFJ A;  4UBR A;  1R00 A;  2QKL B;  3L2N A;  3BQZ A;  4YFK F;  4QBJ A;  1R1U A;  3D5R C;  3WU1 B;  1DDN A;  5HVF A;  4XRS G;  2V9P A;  3H9J A;  4XLE A;  1IU8 A;  4ZBG A;  5CPR B;  2DQL A;  1YVK A;  5J1Y A;  3ZP5 A;  3FYN A;  3ROU A;  3TDZ C;  1XRY A;  2VEZ A;  2IW5 A;  4WXH A;  1VQO I;  3CC7 I;  2BY3 A;  1X4P A;  1KQ8 A;  2PVW A;  2NXN B;  4FIS A;  4MRI A;  2P8T A;  4CHU A;  3SJE A;  1B1B A;  2RNJ A;  2HC9 A;  3FM5 A;  1VTN C;  2ZEP A;  2JUC A;  1LAN A;  2RFH A;  5E18 F;  1IJW C;  4H2K A;  3PGP A;  2TCT A;  4N4O B;  1R5G A;  4UUS B;  4G12 A;  4A93 J;  1MW7 A;  2X4H A;  2Q8K A;  1CJW A;  2Z0Z A;  2ZXV A;  5A27 A;  1QHG A;  5ISV A;  1H0M A;  1BOB A;  2UZK A;  3K1M A;  4FE7 A;  3MCZ A;  4PJM A;  4ENJ A;  4YU9 A;  4Z65 A;  4FAS D;  4PXB A;  5J6X A;  4HBL A;  1Y0U A;  1MGT A;  2VQG A;  1QU3 A;  1F43 A;  1PUA A;  3HRU A;  5A2Q Z;  2AE6 A;  4AG7 A;  4CRY B;  1Z21 A;  2W24 A;  2FL4 A;  4RI1 A;  1KA8 A;  1Z6R A;  1Z9C A;  5FFX A;  4ZTF A;  2VI7 A;  2X6Y A;  2BY2 A;  4Y33 A;  3IWG A;  1NH3 A;  4UB8 C;  3IH4 A;  4FET A;  2H8W A;  4D1Q A;  4NJR A;  2M4K A;  3AG1 H;  3A9L A;  4ZY2 A;  4PDK A;  1QSR A;  3QPS A;  4D9J A;  3SJG A;  1YJW I;  4JYW A;  2DQR A;  3MKW B;  1XDU A;  1P4X A;  1HDP A;  2Q0O A;  2J8M A;  5KTC A;  1H9G A;  5K7Z A;  1QQ9 A;  4HYE A;  4CAE A;  1JKR C;  1PUF A;  4HNT A;  2O9L A;  4PPZ A;  4BHB A;  2DMU A;  4U88 A;  1U0J A;  5ICC A;  2BYV E;  1LB2 A;  1RUO A;  5FVJ A;  2X51 A;  1EH8 A;  1TF9 A;  3ZPL A;  2COB A;  2M4G A;  3CUQ C;  2MH9 A;  2W84 A;  1W5T A;  2XKP A;  2J8R A;  3KR5 A;  5HS9 A;  4DZP A;  5JM6 A;  2F5D A;  1ZLH A;  2OV7 A;  2Q2E B;  4B1R A;  2HYG D;  5F27 A;  3E6B A;  4MLO A;  1FYM A;  4NJQ A;  1XDS A;  2O0Y A;  1PCA A;  5H86 A;  3PUB A;  2LVS A;  2TRT A;  2IQ6 A;  4CAX A;  3FF5 A;  4ASN A;  3NE7 A;  1T56 A;  3BTJ A;  2HU9 A;  3O8H A;  4G6D A;  2OUM A;  3FEE A;  1LJ9 A;  3D0S A;  2R7H A;  1VI0 A;  2AFS A;  4IUS A;  4KOS A;  4M6G A;  4AM3 A;  3TX8 A;  3DBH B;  4WXC A;  1XPX A;  3TKY A;  4NDL A;  2F8H A;  2CH0 A;  1JGS A;  2WY8 Q;  2JSC A;  1X3Z B;  3H9G A;  3W2W A;  5M3M J;  1G6N A;  1N25 A;  1MJB A;  4F55 A;  4BDZ A;  1HCR A;  1XB4 A;  4PFO A;  3KLO A;  2COM A;  4J01 A;  1E0E A;  3WTU C;  4U5Y A;  2BV6 A;  3FWE A;  2R5Z A;  3KQZ A;  1F2P A;  4NF1 A;  4NGM A;  1Y1V J;  3K70 C;  3KI9 A;  1FX7 A;  5LD2 C;  3CD6 I;  3OSG A;  2A5W A;  1GXP A;  3ZMS A;  4CS0 B;  4IX7 A;  3S6K A;  1CP7 A;  2ZNY A;  1G3W A;  4B4C A;  4BMH A;  2L7M P;  3RYO A;  2M30 A;  2IJZ A;  2OD5 A;  1IRX A;  1U5T B;  4DBQ A;  3CO7 C;  4D7M A;  1BI3 A;  3T8T A;  1V5E A;  4Y17 A;  2DMT A;  2X6W A;  1E3H A;  1OBR A;  3Q0V A;  2KZG A;  1IID A;  4A37 A;  2LDU A;  1J7K A;  1R22 A;  3MWM A;  3M3Y J;  5EF6 A;  3PFE A;  3HSF A;  4EVY A;  3R4K A;  4UUV A;  2D2W A;  2ZW4 A;  2Z3L A;  3M8E A;  3KX2 A;  5BQT A;  4HDU A;  3CF5 F;  1X1C A;  3WE3 A;  4RGR A;  4DQ2 A;  1NSA A;  1ITY A;  2E1M B;  3BI0 A;  1YIO A;  2HOA A;  4UEZ A;  1TC3 C;  2PIZ A;  4L8A A;  3B3C A;  2GIV A;  2K85 A;  4U7D A;  5EZH A;  4BJT A;  3CCQ I;  1RKW A;  3VFZ A;  1JTX A;  3KP3 A;  1R23 A;  4U0W A;  4RAZ A;  1X1D A;  1XG1 A;  2WPW A;  5KNL A;  2PMH A;  3M07 A;  3GEZ A;  1QQI A;  5CQE A;  1QGP A;  2F7V A;  4G1P A;  2OCC H;  2EH3 A;  1S72 I;  1XCV A;  4II3 A;  5G22 A;  4EJW A;  2JTV A;  3QYB A;  5JHF A;  3SHF A;  4KT5 C;  1F2O A;  4NGT A;  2HQ5 A;  4Q38 A;  4B5P B;  1JJ6 C;  2VPL A;  4MJ8 A;  4CUG A;  4XMY A;  1OZP A;  3F6O A;  2FT0 A;  4KVX A;  4KYW A;  4OKO A;  2A69 F;  3ZMZ A;  3KHZ A;  2Q1Z B;  3HIF A;  5ED4 A;  4ZTJ A;  1OCO H;  2DMP A;  3HSE A;  3S2W A;  3GZ6 A;  5FKN A;  4KFC A;  2G9W A;  2KIF A;  4IEJ A;  1Q7L A;  2CTC A;  3VAR A;  1T98 A;  3T9Y A;  3LA3 A;  3E1S A;  2HDC A;  3FBU A;  4NQW A;  2FBI A;  1J0R A;  3TL4 X;  4J00 A;  2EVN A;  3KL9 A;  2RRE A;  3EUH A;  4A0X A;  4EAT A;  3ABT A;  1LFW A;  4I49 A;  3WE2 A;  5AON A;  2KRF A;  1YX3 A;  2CUE A;  1X19 A;  2Z16 A;  1IAW A;  3BR6 A;  1MNM C;  4B13 A;  2ZW7 A;  1V5F A;  2PE3 A;  2PJR B;  3GVA A;  2LY9 A;  1OYI A;  4A3B J;  2B3V A;  2H6C A;  3KLN A;  1B6A A;  2H1L A;  1ON2 A;  3CLO A;  3J81 Z;  2OQG A;  1MBE A;  4ENN A;  1ERD A;  4KMU X;  2DFF A;  1YQE A;  2H6B A;  4GYI A;  1T6S A;  2EZH A;  4G7H F;  4KLV A;  4RAF A;  1GYT A;  3LSG A;  2EWN A;  2K9N A;  5IYB J;  1FT7 A;  5JH9 A;  4FHT A;  1R6R A;  3AL0 B;  1ONV A;  5JLX A;  1B87 A;  4G9Y A;  3G3Z A;  4PJ0 C;  1FSH A;  2VJI A;  4YIF A;  4EJT A;  4NUB A;  2JJ7 A;  4CXF A;  2WUU A;  4JX6 A;  3ASN H;  4LG3 A;  1W1W E;  3BQY A;  3ECO A;  4A3M J;  1CBX A;  3BDD A;  2ICW G;  3A01 B;  1Y9W A;  3I1U A;  3LWF A;  2VIX A;  1E2X A;  1SC7 A;  2PJ4 A;  3PBB A;  2HXI A;  2K7L A;  5HLG A;  1A5J A;  3L2U A;  3B35 A;  1S7A A;  1Z3X A;  3A1Y A;  4HKF A;  5DUI A;  1XS9 A;  2O03 A;  3S3M A;  3PUF A;  3GF2 A;  1D0X A;  1U2W A;  5EEA A;  1VFC A;  2X1D A;  3E3V A;  5DTD A;  4J3G A;  4LMY A;  2QEN A;  2K40 A;  3REO A;  4IRH A;  3PFY A;  3EQL F;  3K4B A;  4WCG A;  3HTS B;  1I1D A;  1U9O A;  2EJR A;  2VB6 A;  3KEY A;  4U7B A;  2QEC A;  2NVX J;  4NSQ A;  2V79 A;  4FD4 A;  4HLX A;  3GME A;  3G73 A;  5HDN A;  3FHZ A;  2YSR A;  4EJV A;  2STW A;  3L2W A;  2DK8 A;  1WH5 A;  3E5X A;  3ELK A;  1R9T J;  2VKH A;  2P4W A;  3QPL A;  1C0W A;  2ISZ A;  4OIQ F;  1FOX A;  2PJC A;  2FJ1 A;  4LLL A;  5ICE A;  3K4M A;  2E1O A;  4V2F A;  1T95 A;  1V54 H;  1Q1H A;  3OWT A;  2F6C A;  1N75 A;  2ZXJ A;  3CMA I;  1R49 A;  1KU7 A;  1I1S A;  2JK3 A;  2L2O A;  2GA1 A;  1YR0 A;  1OKR A;  5CKT A;  3EUH C;  1BO4 A;  1I27 A;  3WC5 A;  5F0F A;  4MO7 A;  5F46 A;  4RGS A;  4HX7 A;  1NG6 A;  2PR8 A;  2YGW A;  4PUS A;  1RIO H;  5HDK A;  4IJA A;  4I98 B;  3BY6 A;  3ZQG A;  1BA5 A;  3RZA A;  3I64 A;  2ZBK A;  4MFP A;  1QPM A;  2ZEG A;  5LLQ A;  3IC7 A;  4UHT A;  5AGE A;  2M0C A;  4M6I A;  4E6K G;  2XSD C;  3WR7 A;  3IRR A;  1W7P A;  3CDI A;  3DEE A;  4M6H A;  4P4B A;  4UY8 I;  1NE9 A;  2P81 A;  4S0H B;  3DPT A;  2VAS A;  2QEX I;  5THW A;  5K8O A;  1BR4 A;  2IGK A;  4PK3 A;  3D5L A;  3VB2 A;  4IQJ A;  4AVP A;  3SXY A;  2NVT J;  1XJO A;  2DMQ A;  4M6V A;  3PIP F;  3K1P A;  3ZQL A;  1IV8 A;  4IOC F;  5H84 A;  3BLY A;  4NC7 A;  3TDU C;  2R7X A;  4U9Z A;  3SI0 A;  4I02 A;  4S04 A;  3VWE A;  1TWA J;  4JXQ A;  2XAS A;  1WWX A;  1ETW A;  3VYS B;  2MA3 A;  4E70 A;  4EM0 B;  1TIQ A;  2VZY A;  1AOY A;  4A95 A;  3T90 A;  1O3T A;  4CYN A;  2PFB A;  1XMA A;  2EFO A;  4IF4 A;  3SDG A;  5DS9 A;  2R5Y A;  1F5T A;  3SJM A;  3B02 A;  3L2C A;  2AQE A;  2EBI A;  5CVV A;  5B3S H;  1TWG J;  4PSW A;  4P6Y A;  3KQX A;  2RAE A;  3ZQQ A;  2WB1 A;  3CCM I;  1RTQ A;  3IKV A;  4R8H A;  2FF4 A;  2YU3 A;  4YFN F;  2P6G A;  3F5B A;  5D6E A;  3DF8 A;  2JN6 A;  3C3W A;  2QVP A;  3IFE A;  1WJA A;  3D7F A;  4Y4R A;  4CYD A;  2Z3N A;  3TTH A;  2PJ5 A;  2B4D B;  3RDI A;  2KDO A;  1YX5 A;  1WI9 A;  3F8N A;  3CCR I;  1K78 A;  5L3F A;  2V1U A;  5C4X J;  1ZYR F;  2PCU A;  3R61 A;  3I9S A;  1K4S A;  2ATR A;  4BAY A;  4IPA A;  2ZXI A;  1PP8 F;  3BG6 A;  1YSJ A;  1REP C;  2BHY A;  2OC6 A;  2XKO A;  2EFW A;  5F1J A;  2NNN A;  2DA6 A;  1R1V A;  1TLH B;  2F5V A;  4CH7 A;  4CCJ A;  4BE1 A;  4ONU A;  3H5A A;  2KRH A;  4MIM A;  1EV7 A;  4V2G A;  2FMY A;  4CCL A;  4F8Z A;  2Z3K A;  4F91 B;  2B4B A;  1SD7 A;  1M44 A;  4UVB A;  3IWW A;  2HS5 A;  4II2 A;  4ZDP A;  2XRL A;  3FXL A;  1IZ1 A;  3M1C A;  3W2V A;  1WH7 A;  2W82 A;  2B5G A;  4KS9 A;  1OCR H;  4HNY B;  2CXA A;  4UV9 A;  1WHU A;  1YJN I;  3UY5 A;  3QPT A;  2WAQ A;  4OIR F;  3L2R A;  2EK9 A;  1XMB A;  1GVD A;  2HI3 A;  3DU5 A;  3KIO A;  2PJ2 A;  2DI3 A;  4RB0 A;  3VDX A;  2H1K A;  1Z8X A;  2L01 A;  2J5P A;  4GS4 A;  3OYA A;  1B8I A;  1QBJ A;  2EK8 A;  2L9N A;  3H4Q A;  4XN3 A;  3D8P A;  5C44 J;  3HOX J;  3DGV A;  4XLH A;  2J5O A;  4AU7 A;  3S1N J;  2IT0 A;  5DV5 A;  2A68 F;  2A61 A;  4I01 A;  3WG9 A;  5D5U B;  3V7S A;  1A31 A;  3QU3 A;  2QIR A;  3K69 A;  4LIU A;  3OYF A;  3FXT A;  4OC1 A;  3SZP A;  4HOB A;  2DA1 A;  3SFZ A;  3UKG A;  3RYP A;  2M45 A;  4Q47 A;  4KOY A;  2X48 A;  4CDG A;  1RUN A;  4PJL A;  1M4L A;  2BGC A;  4MQ9 F;  5LHG A;  1G3S A;  2G7U A;  4JBA A;  3S32 A;  5AG4 A;  4MFE A;  1GT0 C;  1BAV A;  2JRT A;  4HF1 A;  2CQ7 A;  1CGP A;  3OOU A;  5FRM A;  2ZEE A;  4B5O A;  1S7E A;  3WG7 H;  5HVQ C;  4M3F A;  1FOY A;  3WTV C;  4JYK A;  1YS7 A;  3C2H A;  2X0L A;  2F5I A;  3HRM A;  3EET A;  5E3O A;  2AO9 A;  4PJJ A;  2H8R A;  2OB0 A;  1OFC X;  4E2A A;  2PJ9 A;  4NCZ A;  1DGW Y;  3FEC A;  4XSX F;  2YPR A;  1S8N A;  2GLF A;  2ZEH A;  3U21 A;  3BG5 A;  4LFU A;  1W0T A;  1VHO A;  3KE2 A;  4MHN A;  4ZJZ A;  3BP8 A;  4XPD C;  3C18 A;  2FRH A;  2QSH X;  5A28 A;  2O8K A;  2HOS A;  3KEO A;  4LK0 F;  5L3D A;  4AVA A;  5I0C A;  4TNU A;  1QMU A;  3K4J A;  1UST A;  3FXU A;  4C3J J;  1D5V A;  2PJ3 A;  4OWR B;  3BOQ A;  1KU9 A;  2GZW A;  5TRD A;  1AHD P;  4LG0 A;  4F9V A;  5BS6 A;  3OS2 A;  2O5R A;  2XSJ C;  1P6R A;  2DYS H;  2NS7 A;  2BUE A;  1UFM A;  3ZMV A;  3PFO A;  3SJF A;  3RKW A;  2XF6 A;  1J59 A;  5LRG A;  3IU2 A;  3GUD A;  5F64 A;  4Q4Z F;  3OV8 A;  4MHG A;  4CCM A;  2K9S A;  2BW3 B;  3ZXS A;  1M4I A;  2V8D A;  1IUY A;  4XLA A;  4BBR J;  2P6E A;  1UG0 A;  3KEQ A;  5DWN A;  1JUS A;  3SQN A;  1SAU A;  3I4M J;  3KYC B;  3D68 A;  3CMY A;  4R7M A;  1OMI A;  2VPR A;  3DLJ A;  2IP2 A;  5ILU A;  2E1N A;  3IWF A;  1KGS A;  5IP6 A;  3F21 A;  1YIT I;  1R5H A;  2LLK A;  2Y0S A;  5J1Q A;  4F0X A;  1O7F A;  4PXC A;  1TQI A;  4XQF A;  2XAF A;  2R7S A;  5D8K B;  1X4O A;  5FLX Z;  2C1C A;  2Z3P A;  3NH5 A;  3FBI B;  2ZME A;  4R79 A;  2UWM A;  3WGI A;  4WX9 A;  2HZT A;  4CZC A;  4F93 B;  5KAI C;  2KFD A;  2KZV A;  2VZZ A;  3FZV A;  4HF0 A;  3ZQ7 A;  4RDU A;  1UAA A;  2GE3 A;  4AYB A;  3S6F A;  1DTD A;  2KQR A;  3KYD B;  1UB9 A;  1AWC A;  4Z6Y A;  2VL8 A;  3HUG B;  2XB0 X;  1UEL B;  4B8X A;  3IJ3 A;  4J19 A;  1FIA A;  5JLW A;  2QQA A;  3LNQ A;  4DYC A;  2RGV A;  1S7K A;  2DW4 A;  3JRH A;  1NK2 P;  3HRS A;  4X3R A;  2W7N A;  5FRN A;  1D1A A;  1ZAR A;  4QWQ A;  3ZOB A;  5J4Y A;  1WGX A;  1Z8T A;  1WJB A;  2YUS A;  3WAB A;  2NNY A;  2Q04 A;  1Z7U A;  5FLM J;  2EV0 A;  5F04 A;  3R1K A;  4ZZD A;  2JUG A;  2QQ8 A;  1JXS A;  4WF2 A;  4I7H A;  4FBE A;  2M8E A;  1ON0 A;  4W9Y A;  1WCM J;  1HC8 A;  3E0J B;  1ZG7 A;  3U1D A;  2HKX A;  4IVN A;  3K1N A;  3SDB A;  1X3U A;  2CQQ A;  2NYQ A;  4ZY0 A;  1Y0R A;  4B43 A;  3CO6 C;  3RSN A;  1P4N A;  2M0M A;  3GUX A;  3MKZ A;  2NAZ A;  1FPQ A;  3A02 A;  3R9F A;  3BT9 A;  3CUQ B;  3OWC A;  2WTE A;  1NHA A;  3F22 A;  1SD5 A;  1YLF A;  3QOD A;  4DOZ A;  3GTO J;  1I3A A;  1SD4 A;  1FOW A;  4PZJ A;  4MI4 A;  1OJL A;  1OYY A;  2Y0M A;  1G3Y A;  5C4J J;  4F0Y A;  3K4C A;  2P5V A;  2XGE A;  1MJ9 A;  3HKZ A;  1VF9 A;  2GAU A;  3OYJ A;  1JT0 A;  2CWE A;  1EJ9 A;  5BOX A;  2MAB A;  5E3M A;  4LIT A;  3KET A;  2L54 A;  1ZQ3 P;  2JA2 A;  2JDD A;  4M74 A;  2DU9 A;  2E2H J;  4RS2 A;  2ZME C;  1DP7 P;  2NVQ J;  5HS7 A;  5JHU A;  1DPR A;  2FXA A;  4C2Y A;  1SMY F;  3IIB A;  4CAF A;  2DA2 A;  2LMD A;  2ZOF A;  2PJ0 A;  4PSX A;  1LPQ A;  4LGW A;  3VSK A;  2MG4 A;  3L7W A;  3J7A O;  1E17 A;  5H6R A;  5K5Q A;  1V5G A;  3BI1 A;  3WC7 A;  2R7O A;  3HGG A;  2D1H A;  3RPU D;  3K7A J;  2K3P A;  2HEO A;  3WTW C;  4DYQ A;  5IT9 Z;  3FIW A;  3QOP A;  2B0L A;  3CDH A;  3CUO A;  2ETH A;  3FMR A;  4Y15 A;  3T0Y A;  2OH1 A;  4LD5 A;  2PN6 A;  1ZLI A;  4KMF A;  5BPI A;  2JEV A;  3ERM A;  1ZK8 A;  1O3R A;  3LFU A;  1K61 A;  2B58 A;  2BBY A;  2F48 A;  2MSY A;  3FXO A;  5HMN A;  3CP2 A;  3OYN A;  3PO2 J;  1FBQ A;  3DKY A;  3QP6 A;  2W1O A;  2EZI A;  2K86 A;  2X1E A;  3P2F A;  3CJN A;  3GY9 A;  4HNV A;  1QRY A;  5BPD A;  2FCK A;  4CGL A;  2CW8 A;  1LE8 A;  4X6A J;  2P5K A;  1SEU A;  2GAN A;  4HW0 A;  3CPX A;  1Z4R A;  3BZC A;  3JRC A;  4F9U A;  4KUM A;  4KNY A;  4EMS A;  2QCO A;  3LQR A;  2WYR A;  4A5N A;  2PLY A;  3KZY A;  3ZR8 X;  1PUF B;  2Q7S A;  3ZQF A;  4M9S A;  4KLW A;  3PB8 X;  4R87 A;  2DT6 A;  5LRS A;  3GTQ J;  2XAH A;  2PIY A;  3FMC A;  3H8E A;  1LDD A;  1SFO J;  3MRU A;  4U0V A;  4CGM A;  2WBM A;  3CXQ A;  2DDB A;  2FEZ A;  1FBU A;  4I6Z A;  3HJE A;  3TQN A;  2LBF A;  3B3W A;  2IS6 A;  5AG5 A;  2N8G A;  1DU6 A;  2LF7 A;  1IV6 A;  3F8K A;  3J7Z I;  4AUX A;  4EGZ A;  3D67 A;  2XPU A;  3SFI A;  3B6C A;  3IHU A;  2POK A;  3KGQ A;  1YW8 A;  4R76 A;  4B44 A;  1YFH A;  5DD4 A;  3KP7 A;  1BR1 A;  2R7V A;  3I0T A;  2V1X A;  5KAF C;  1SQH A;  1ZRD A;  2BSW A;  4FD5 A;  2JBJ A;  1FBS A;  5DCM A;  4FX0 A;  3T5X A;  4LB5 A;  2L7F P;  1W5S A;  2PX9 A;  3DKX A;  4A3G J;  2ZNZ A;  1RKT A;  2LTP A;  3ML6 A;  4CCO A;  2DA4 A;  4W1U A;  3VH9 A;  2BCO A;  5E17 F;  5F0H A;  2JDC A;  2CYY A;  2HNH A;  2ZSI B;  5CQG A;  1XGN A;  4MFK A;  3RQI A;  3Q5F A;  4GM5 A;  1KUY A;  4QSH A;  3GFI A;  1WK4 A;  3TP3 A;  1ETK A;  2B63 J;  3OS1 A;  2R5Z B;  2F5F A;  2O28 A;  1IXS B;  1VGY A;  3D7G A;  3O3K A;  2E19 A;  2CW7 A;  1VQM I;  1TT5 B;  4HSR A;  1QZE A;  3VYR B;  4IHV A;  3RI4 A;  1SAN A;  1MDM A;  2GA2 A;  4C7I A;  1AUG A;  1BBY A;  2KLO A;  2NYX A;  1VQN I;  1BR2 A;  4AVZ A;  2CUZ A;  4M6Y A;  3BJO A;  1JKQ C;  2IMO A;  3B3V A;  2Z3O A;  1LDJ A;  1VHE A;  4YFJ A;  3ZN0 A;  4XON A;  3HGY A;  1RR7 A;  1YLE A;  2PJB A;  2Q4Y A;  3CPA A;  2DFI A;  3V8K A;  4IO9 F;  3E6D A;  2KL4 A;  3MQ0 A;  4PGG A;  3I58 A;  2E5Z A;  2X6O A;  3RKQ A;  2HKO A;  4N9I A;  4I09 A;  4JX4 A;  1ZH5 A;  3S1R J;  2OJE D;  3OR2 C;  4G8X A;  4IAV A;  4BQA A;  3NAR A;  4I0B A;  5JGF A;  5JQ4 A;  2NS8 A;  4MHP A;  2DAO A;  1BI1 A;  2DN0 A;  2E34 A;  2L9R A;  1Q2D A;  3NE8 A;  2BOA A;  2VXD A;  4RAG A;  2RNG A;  3K2A A;  4GRI A;  3BPV A;  4MEX F;  2KCW A;  2A3S A;  4HX8 A;  4OOI A;  4P4I A;  2ECC A;  2WV0 A;  2L4A A;  5IT3 A;  4F6A A;  2ZB9 A;  1M4G A;  1A6I A;  2W48 A;  3P5J A;  4DJA A;  3C7J A;  1OQY A;  1T2K A;  2ZEO A;  4UEF A;  4HAM A;  4QIW N;  4HPS A;  1FT9 A;  2G0B A;  2R7D A;  4CRZ B;  5E8G A;  2X1C A;  1ETV A;  3K4K A;  5IPA A;  1BOA A;  2QML A;  3FX6 A;  1CPS A;  1TKH A;  3DNS A;  3H3Z A;  4MTE A;  4NGQ A;  4E7I A;  1SVM A;  3A0H C;  2WA0 A;  5D4R A;  1HBX G;  3GTL J;  4TWE A;  4MCP A;  1S7N A;  2PMU A;  2AJ6 A;  3HOY J;  2OU2 A;  4KUB A;  4PGH A;  4ZYQ A;  4PXD A;  3I59 B;  1XE4 A;  4NQW B;  3F8C A;  4DW6 A;  3DSB A;  4MGR A;  2D5V A;  2G9D A;  2F5C A;  3LST A;  3DXJ F;  3SI1 A;  3W2A A;  3OIO A;  2B3U A;  4M3D A;  2V9V A;  4XKV A;  1T08 B;  1CF7 B;  2VBW A;  2JA8 J;  2DT5 A;  1WVR A;  4R57 A;  4M3B A;  2EWB A;  3OIP A;  2CUJ A;  2OPT A;  1G8X A;  2GOX B;  3BWG A;  3VSL A;  3JSP A;  3ZQC A;  2CGP A;  4XLF A;  4AC0 A;  3OYG A;  1IYK A;  1RPW A;  3H3V K;  4DYO A;  2ZXH A;  1MZB A;  1TT0 A;  3BJ6 A;  4CYP A;  1QSO A;  3MKY B;  3GIU A;  2R7W A;  1X1B A;  3H0G J;  2P6S A;  5CLS A;  1RES A;  2KIS A;  3MZH A;  1TNS A;  4XOT A;  4P5O A;  4QB9 A;  1YI2 I;  3WGH A;  1PUE E;  3TO9 A;  1LCP A;  3Q9V A;  4NXY A;  1D3Y A;  1VIX A;  2MD0 A;  5J4V A;  2I3C A;  1Q2Y A;  1RET A;  2VBY A;  4MNU A;  2DA7 A;  4IOA F;  1JHF A;  2V77 A;  4YIR X;  1JE8 A;  2QYV A;  2FBH A;  4IHW A;  4XM3 A;  2BY1 A;  3J80 K;  1DP3 A;  1LRZ A;  4MQV A;  1YYV A;  2WAE A;  4Y3O A;  4C2T A;  1MMG A;  1LFB A;  4UFX A;  4A2U A;  2PEX A;  1IDZ A;  2ELH A;  2GWR A;  1VQP I;  4XLC A;  2BL1 A;  3CXP A;  4MY3 A;  4N4N B;  3CT9 A;  3VAT A;  1XMK A;  2LH9 A;  2KT0 A;  2KIU A;  1JGG A;  3TO7 A;  3LOD A;  3L09 A;  2QKM B;  2ZC2 A;  4XIC A;  2R0Q C;  2VE9 A;  3SEZ A;  1MMD A;  4KIB A;  3LMM A;  2QSG X;  4RM2 A;  3WHB A;  2E2J J;  2JPB A;  2KJB A;  2V1D A;  1T0F A;  1W0U A;  2LG4 A;  4QPO A;  3TCV A;  5H20 A;  4XBF A;  4ESB A;  4XKW A;  4M6X A;  1N78 A;  4FD7 A;  3MVP A;  1AU7 A;  3KZI C;  1UWY A;  3FXJ A;  1ARL A;  2CQK A;  3R9G A;  1O3Q A;  3W6X A;  5EZG A;  3K9U A;  2PVV A;  3CCV I;  3SXO A;  3PQJ A;  1OCZ H;  4A5M A;  2DA5 A;  3F8B A;  3JRI A;  4H0E A;  5EMI A;  3TC8 A;  4E7L A;  2KKO A;  1H9T A;  2BVM A;  3JRG A;  2AS5 F;  1YVO A;  1BIA A;  1X3W B;  1S6L A;  5KTD A;  2GXA A;  1S7L A;  4M3G A;  4UXN A;  2ZJP F;  3R0A A;  3S9L A;  3HB9 A;  4FD6 A;  4A69 C;  1UHM A;  4OIN F;  4Y7N J;  1UHW A;  4FT8 A;  4XLP F;  2Q44 A;  2MW8 A;  1LEB A;  4DBR A;  2L02 A;  2P5L C;  1Y39 A;  4MFL A;  4Q5S F;  1UMQ A;  3KP5 A;  4EM2 A;  4ZYE A;  1G59 A;  2XB5 A;  1E3O C;  2UXN A;  4A3F J;  1BW6 A;  4L0Z B;  1J75 A;  3H5N A;  3HUV A;  1L0O C;  2QF7 A;  3ZQH A;  1B59 A;  1XGM A;  3MZ8 A;  4XRF A;  5IY5 H;  2ZW5 A;  2AFU A;  1JKP C;  1MMA A;  2XPW A;  1HW5 A;  1MJA A;  3FIS A;  2XF7 A;  4Q36 A;  3E5U A;  4OIW A;  1U5T A;  4OMZ A;  4MFZ A;  3RPQ A;  1YHQ I;  3QRF F;  2Y2Z A;  3L2Q A;  4L9T A;  1XBU A;  3D7H A;  2V4J C;  3JAM Z;  2OZ6 A;  4U9Y A;  5DS0 A;  1SD6 A;  1Z6T A;  1HLV A;  2FD5 A;  2QUF A;  5EYR A;  1WI3 A;  2M34 A;  4ORF A;  4BS9 A;  5HLH A;  3R96 A;  1KYZ A;  1ACI A;  3MEX A;  5F08 A;  2QYO A;  2VC1 A;  4EFD A;  1KON A;  1BC7 C;  2MC3 A;  3X2Q H;  2R5Y B;  2WSA A;  1TQP A;  3W6V A;  1GDT A;  2HQY A;  3DU6 A;  2LF8 A;  3JRU A;  5J8C A;  2HQR A;  1F57 A;  3ABK H;  1ETY A;  2GIZ A;  4MFQ A;  4K30 A;  2W4S A;  4A39 A;  2G3T A;  1Y7R A;  2DA3 A;  1S5K A;  4BBS J;  4MFD A;  4MTD A;  1T0F C;  3FMQ A;  3N97 A;  2I5U A;  4UFW A;  2EFQ A;  4GDF A;  2R8V A;  4IK2 A;  3IGR A;  4P45 A;  5HLT A;  3WTX C;  1MNE A;  2ID6 A;  2DF5 A;  4IRI A;  2X7B A;  1BN5 A;  2PJ6 A;  2XAU A;  4XPD B;  1JHH A;  3V42 A;  1K78 B;  4YGO A;  1I5Z A;  1F9N A;  3LL7 A;  4C3I J;  3SZT A;  2GM4 A;  2P7V B;  4B5P A;  2FXF A;  2R98 A;  2I8D A;  4ZY1 A;  1ULY A;  3PB6 X;  1JUM A;  2IA2 A;  1U8B A;  1KQ0 A;  4R6T A;  2AHQ A;  2I10 A;  3LAJ A;  3V7Z A;  4UIB A;  1O57 A;  3SEQ A;  2AFO A;  2K9Q A;  1T33 A;  2VJ5 A;  1X58 A;  4P9F A;  5TJJ A;  1J4J A;  5FGM A;  4NGS A;  2LYC A;  1LEA A;  3BLN A;  3I4P A;  1MSE C;  3S3N A;  3FKI J;  2B5G B;  4BY1 J;  4A6E A;  1TWF J;  3I5U A;  2KRC A;  5M5Y J;  4OME A;  3SXN A;  3VYT B;  3DTE A;  3QNV A;  5CVU A;  4RA2 A;  3I71 A;  5L3E A;  4EJU A;  4FE4 A;  2JA7 J;  1QSM A;  3LSI A;  1B8I B;  4XNH C;  2WC2 A;  2Y9Y A;  1W36 C;  1A6Q A;  3MKL A;  4JZ0 A;  2L0K A;  3JVN A;  1V3F A;  5ILV A;  3NWS A;  2G7H A;  2FOW A;  4D5C A;  1TF8 A;  3SZG A;  4XL9 A;  3F8M A;  2Z33 A;  3IWE A;  4OAY A;  4NC8 A;  1L0C A;  4HG2 A;  4L5E A;  1MBG A;  2MFZ A;  5B5E C;  3C26 A;  3BG9 A;  1S29 A;  4CYC B;  1KWM A;  5C3E J;  2VQH A;  3S14 J;  4A3I J;  5CVR A;  3V8J A;  1X1A A;  1Y56 A;  2KPM A;  2PSW A;  4KOU A;  5EGO A;  1R58 A;  3GO5 A;  1D0Y A;  5EG0 A;  1OCT C;  2HFH A;  2ME6 A;  3RBU A;  1E3P A;  3NEU A;  4II9 A;  2H09 A;  1HEE A;  1XGS A;  4HLY A;  2KDZ A;  3GZN B;  2MYS A;  3HYI A;  1FYL A;  4BJ6 C;  4E7J A;  3J7Y J;  5HOO A;  2A6H F;  2CS3 A;  4P55 A;  4PCQ A;  2XGD A;  4IHT A;  1TNT A;  1YOV B;  1Z77 A;  3NWT A;  2CSO A;  1X12 A;  4CZZ A;  1FNO A;  1I12 A;  1CG2 A;  1STZ A;  1Z7L A;  1WJF A;  2WB1 N;  2E35 A;  3L2V A;  2XEF A;  4ZDO A;  2R3S A;  4ZYA A;  1VQK I;  2K02 A;  2OOT A;  2ANP A;  3CP8 A; 
#chains in the Genus database with same CATH homology
 1IYL A;  1S7K A;  4L89 A;  1NG7 A;  2W7N A;  5FRN A;  3PGP A;  1D1A A;  4N4O B;  2DOA A;  4E7K A;  1MND A;  2Q0Y A;  4YRH A;  1WJB A;  1M4D A;  1MW7 A;  1CJW A;  2Q04 A;  2Z0Z A;  2ZXV A;  3R1K A;  5A27 A;  1QHG A;  3A4C A;  3DTI A;  3DWL E;  5ISV A;  2JUG A;  1BOB A;  1YX0 A;  4PJM A;  2CV2 A;  4XPL A;  2RC4 A;  3J7A Y;  4FAS D;  1ON0 A;  2XF5 A;  2OZU A;  4JQF A;  2CNT A;  3PNV A;  2VQG A;  1PUA A;  1QU3 A;  4KOW A;  2AE6 A;  4A32 A;  4AG7 A;  3E0J B;  1Z21 A;  4CRY B;  2FL4 A;  2G3A A;  4RI1 A;  1B6B A;  2PR1 A;  4A30 A;  3K4L A;  4ZTF A;  3TBI A;  2VI7 A;  2X6Y A;  3SDB A;  5G20 A;  4Y33 A;  3IWG A;  1RO5 A;  4KOX A;  4FET A;  4RLF A;  4B43 A;  4KVO E;  3RSN A;  1ZO0 A;  2VBQ A;  3V8I A;  4CGP A;  4D1Q A;  1P4N A;  2M4K A;  3A9L A;  2M0M A;  1QSR A;  2HQA A;  4D9J A;  3EO4 A;  2WPX A;  3MKZ A;  4JLY A;  4UCN A;  3TO6 A;  3CZ6 A;  4XR6 A;  3MKW B;  4KSF A;  2J8M A;  5KTC A;  3R9F A;  4CAE A;  2LOO A;  3D2M A;  3OWC A;  4CAV A;  4HNT A;  3LD2 A;  3QOD A;  4DOZ A;  4ZGY B;  2M3A A;  1U0J A;  2K5C A;  3IU1 A;  4MI4 A;  3G8W A;  3G2B A;  3QYF A;  2BEI A;  2LRE A;  2X51 A;  3ZGK A;  2Y0M A;  3BC8 A;  3DTK A;  2REF A;  5FVJ A;  4F0Y A;  3K4C A;  1K6Y A;  2M4G A;  3HKZ A;  1MJ9 A;  2PRB A;  2J8R A;  4JOM A;  3N7Z A;  3OYJ A;  4UA3 A;  4MHD A;  4LIV A;  2OV7 A;  2Q2E B;  2MAB A;  3HXL A;  4LIT A;  3EC4 A;  4UCP A;  4MLO A;  2JA2 A;  4E7S A;  3W3C A;  2JDD A;  4C2U A;  2DXI A;  4OAZ A;  4RS2 A;  2CY2 A;  3JUW A;  5H86 A;  3PUB A;  2PQ8 A;  4CAX A;  3NE7 A;  4C2Y A;  2V9K A;  4R3K A;  3P2H A;  4CAF A;  4U87 A;  2HU9 A;  5HNH A;  4PSX A;  2HVQ A;  2J8N A;  2OUM A;  3VSK A;  4CCK A;  3D3S A;  4HNW B;  1V5G A;  3PL8 A;  2R7H A;  4IUS A;  4KOS A;  2R7O A;  3K10 A;  3EUK L;  3MGD A;  2CH0 A;  3RPU D;  2WY8 Q;  2K3P A;  3W2W A;  3H9G A;  4BBH A;  1PJR A;  4F55 A;  4BDZ A;  1MJB A;  1YRE A;  4M85 A;  2OH1 A;  4MY0 A;  2AQF A;  2VQL A;  3MD2 A;  4PFO A;  3AKZ A;  4J01 A;  1E0E A;  4X5K A;  3R9E A;  4U5Y A;  4XOR A;  3RCO A;  3KKW A;  4NF1 A;  3K70 C;  1WFX A;  5LD2 C;  2VXK A;  2JEV A;  1AA7 A;  2A5W A;  4KSA A;  3LFU A;  2B58 A;  4CS0 B;  4IX7 A;  3S6K A;  1LKX A;  5HMN A;  3CP2 A;  3OYN A;  4BMH A;  3DKY A;  3BCB A;  2R7T A;  4F52 A;  4C68 A;  2W1O A;  1Y9K A;  3RYO A;  3RTR A;  2X1E A;  3P2F A;  4DBQ A;  1IRX A;  3GY9 A;  2KHM A;  2PJR A;  4XN0 A;  2IS4 A;  2FCK A;  2CW8 A;  3UR3 C;  2IGN A;  1V5E A;  1WWZ A;  4A33 A;  4CGL A;  2X6W A;  2FS5 A;  1OLT A;  2GAN A;  1Z4R A;  1S9H A;  4QVT A;  1IID A;  2UV1 A;  4LUA A;  4B12 A;  2IGM A;  2VJJ A;  2X6X A;  4EVY A;  3DLA A;  3OR1 C;  3ZR8 X;  4C7H A;  2ZW4 A;  2Z3L A;  4KLW A;  3KX2 A;  1W36 D;  3CES A;  1X1C A;  3QYE A;  4R87 A;  2DT6 A;  2E60 A;  2FUG 2;  4B48 A;  2E1M B;  1YGH A;  5BWA B;  1WJC A;  3H35 A;  4CGM A;  2WBM A;  4B14 A;  3DPL C;  4PFP A;  4L8A A;  5IB0 A;  3FHN A;  4G6T B;  2XC7 A;  1MK4 A;  2GIV A;  3TT2 A;  2LBF A;  4BJT A;  1P9Q C;  2IS6 A;  2E1M C;  4XNF A;  3QB8 A;  5AG5 A;  2HPM A;  3PNY A;  3F8K A;  1PU9 A;  1X1D A;  2WPW A;  4B11 A;  4CGN A;  5KNL A;  5CQE A;  4B44 A;  1BR1 A;  1OR7 C;  2R7V A;  2YNC A;  1SQH A;  4II3 A;  2BSW A;  4FD5 A;  5G22 A;  4RLQ A;  3RQ4 A;  1MMN A;  1KUV A;  3QYB A;  2JSP A;  5JHF A;  4B5P B;  4Q38 A;  3DKX A;  4CAW A;  3D5S C;  4MJ8 A;  2VPL A;  4CUG A;  4XMY A;  1OZP A;  2FT0 A;  4KVX A;  2V7F A;  4CCO A;  3W6S A;  4HNX B;  4KZT A;  4QUS A;  4BQO A;  3B8G A;  4UFV A;  2Q1Z B;  5HNF A;  4ZTJ A;  1QSN A;  2JDC A;  2HNH A;  2ZSI B;  5CQG A;  1Z4E A;  2I79 A;  1LFP A;  1SFK A;  4MFK A;  2Z3M A;  3ZJ0 A;  1KUY A;  3IAS 2;  4CCN A;  1WK4 A;  3OS1 A;  3F9K A;  4XPK A;  3T9Y A;  2REE A;  3E1S A;  2O28 A;  3FBU A;  3LSM A;  2X85 A;  5KHD A;  3ZZI A;  1YK3 A;  4H4K C;  4C2X A;  2CW7 A;  4J00 A;  2EVN A;  3TL4 X;  3OYH A;  3TE4 A;  3M8J A;  2RRE A;  1LVK A;  3CMM A;  4HSR A;  3VYR B;  4EAT A;  1KUX A;  1V0C A;  4I49 A;  4M3S A;  3W91 A;  3I3L A;  3TFY A;  1YX3 A;  4C7I A;  1X19 A;  2Z16 A;  2KLO A;  2Q4V A;  5G1Z A;  1BR2 A;  4AVZ A;  4B47 A;  4B13 A;  4JXR A;  2ZW7 A;  1V5F A;  4KUA A;  2CUZ A;  2PJR B;  5C82 A;  1ZEL A;  2EUI A;  2Z3O A;  2C27 A;  2B3V A;  4YFJ A;  4KVM E;  4XON A;  1YLE A;  2ARH A;  1WJE A;  4BAC A;  2Q4Y A;  3CJR B;  2E5N A;  1ERD A;  4H6Z A;  4PJN A;  2KL4 A;  2E5Z A;  4NNJ A;  4IKF A;  1HA8 A;  1D0Z A;  1EA3 A;  4IQ4 A;  4BEH B;  4KLV A;  3LSG A;  3OR2 C;  1R6R A;  2WY7 Q;  3PSI A;  3AL0 B;  1JI8 A;  2PC1 A;  1B87 A;  2ZPA A;  4BE2 A;  5JQ4 A;  1FMV A;  5C88 A;  2VJI A;  3OYK A;  4IZZ A;  5DWM A;  4ZDL A;  4Y49 B;  4NUB A;  2WUU A;  1Q2D A;  3C2G A;  5AG6 A;  4XKC A;  4LG3 A;  3GBG A;  2LBF B;  4HNU A;  4KIT B;  2VXD A;  5FRO A;  2RNG A;  3AL0 C;  3K6G A;  4GRI A;  1S3Z A;  1Y9W A;  3D2P A;  2VIX A;  2KCW A;  2JLM A;  2VLA A;  3PP9 A;  4Y49 C;  3L2U A;  2IL4 A;  3S8P A;  3H5R A;  4DGW B;  2HVS A;  1Z3X A;  3A1Y A;  1M4G A;  4UCM A;  4HKF A;  4F6A A;  2XDV A;  2CNM A;  4DJA A;  3S3M A;  4PK4 A;  4AB7 A;  1D0X A;  4ITV A;  2X1D A;  1XEB A;  4BUP A;  4F3Q A;  2G0B A;  4CRZ B;  4J3G A;  2WAD A;  2X1C A;  4C9Y A;  3TOA A;  3K4K A;  1R57 A;  2QML A;  2HVR A;  4KJZ A;  1VKC A;  1I1D A;  3PFY A;  4YEL A;  3K4B A;  2YNC C;  3GYA A;  3DNS A;  3CXS A;  2QEC A;  2VB6 A;  4KIS A;  3KEY A;  3VYU B;  4U7B A;  1IB1 E;  3EXN A;  3SYT A;  4NSQ A;  4FD4 A;  4CSW A;  3H0D A;  4E7I A;  4DNC A;  2WA0 A;  2OZG A;  3HOS A;  2L7K A;  4OAE A;  3L2W A;  1S7N A;  2AJ6 A;  2VKH A;  4DIQ A;  2K5T A;  5J8F A;  2OU2 A;  3OYD A;  2NMT A;  3ONQ A;  2R7R A;  3OYM A;  4KUB A;  3OMY A;  2JVG A;  4XOP A;  4NQW B;  3BG7 A;  2Z1D A;  1XE4 A;  3OS0 A;  1NSL A;  2A4N A;  2K9L A;  3S3O A;  3DSB A;  3K4M A;  2CNS A;  4QC6 A;  1T95 A;  3FNC A;  2LC2 A;  2NOJ B;  3OWT A;  2CFO A;  3W2A A;  2F6C A;  1N75 A;  3ZRG A;  2A6T A;  2B3U A;  4UWI A;  2B4D A;  2L2O A;  4XKV A;  1YR0 A;  4HEA 2;  1QST A;  4JJX A;  4HRI A;  5CKT A;  3EUH C;  4YRV A;  4BDY A;  1BO4 A;  4R57 A;  1Z3Y A;  4QPQ A;  4BQQ A;  3OIP A;  2CUJ A;  2D4O A;  1G8X A;  2GOX B;  3VSL A;  3CXQ A;  5F46 A;  4HPQ A;  1NG6 A;  4XLF A;  3OYG A;  1IYK A;  4PUS A;  2PR8 A;  2YGW A;  4UWJ A;  2ZXH A;  4CYP A;  1TT0 A;  1QSO A;  3MKY B;  5JPH A;  2R7W A;  2D4P A;  4MFP A;  1X1B A;  4BU2 A;  5AGE A;  4E6K G;  3DQV C;  3WR7 A;  2BVL A;  3DEE A;  4XOT A;  4JWP A;  2JVH A;  4P5O A;  3HL2 A;  1KZF A;  1N71 A;  1VHS A;  3GKR A;  4QB9 A;  1NE9 A;  2R7Q A;  3DPT A;  3TO9 A;  2VAS A;  2HUZ A;  4NXY A;  1BR4 A;  2MD0 A;  2IGK A;  4KT6 A;  4BXF A;  3I9V 2;  1Q2Y A;  4JD6 A;  4PK3 A;  3D5L A;  3OYC A;  4IQJ A;  3A2K A;  4XM3 A;  1DP3 A;  1Z9U A;  3OYL A;  2HDW A;  1LRZ A;  5H84 A;  2R7U A;  3OIQ A;  3H9Q A;  2WAE A;  3BLY A;  4NC7 A;  1MMG A;  4Y3O A;  4C2T A;  3AFH A;  2R7X A;  4U9Z A;  4UFX A;  3DDD A;  3R95 A;  3VWE A;  4XLC A;  2BL1 A;  2Z11 A;  4BJ5 C;  4N4N B;  2FE7 A;  3CXP A;  3VYS B;  2LH9 A;  4JXQ A;  4MY3 A;  1TIQ A;  1Y6I A;  1GHE A;  1N77 A;  2HV2 A;  3TO7 A;  2KMU A;  2ZSH B;  3IP4 B;  1NMT A;  2VZY A;  2QKM B;  3F0A A;  3LOD A;  3IUO A;  5EC4 A;  3T90 A;  3SEZ A;  4A95 A;  1S60 A;  2KP6 A;  1MMD A;  2VKD A;  3S6G A;  3LMM A;  4CYN A;  3OYB A;  1CM0 A;  4RM2 A;  1TZL A;  2P0W A;  3FB3 A;  1XIX A;  4H89 A;  1D1C A;  2L5Q A;  2LG4 A;  4QPO A;  2AQE A;  3TCV A;  3DR6 A;  1RXT A;  4XKW A;  4CYO A;  2IXS A;  1N78 A;  4FD7 A;  4PSW A;  3ZQQ A;  2R1I A;  3UNG C;  2WB1 A;  3F5B A;  3R9G A;  2P6G A;  3S6H A;  3W6X A;  3K9U A;  4AVC A;  2CMP A;  3SXO A;  4B10 A;  2I00 A;  1WJA A;  4MFJ A;  5EBV A;  3CF2 A;  4Y4R A;  2OZH A;  2Z3N A;  4E7L A;  1D1B A;  3TTH A;  2B4D B;  3SHP A;  4AVB A;  2BVM A;  2KDO A;  1YX5 A;  2HPI A;  3FKJ A;  1GLN A;  3FBN B;  1YVO A;  1VZ0 A;  3FDY A;  4KOV A;  2K9M A;  4CA0 A;  5KTD A;  4ZC3 A;  1S7L A;  3I9S A;  2DT7 B;  2ATR A;  4PK2 A;  4FD6 A;  1Q2C A;  2DPT A;  2ZXI A;  4E8O A;  3BG6 A;  2Q44 A;  2VJ4 A;  2OC6 A;  4DBR A;  5LFA A;  2MC4 A;  4CH7 A;  2F5V A;  4MFL A;  4CCJ A;  4BE1 A;  3IAM 2;  3H5A A;  2KRH A;  2CV0 A;  4ONU A;  4CCL A;  1G59 A;  2Z3K A;  4A31 A;  3LSH A;  4F91 B;  2B4B A;  1M44 A;  2ZW6 A;  3N05 A;  4II2 A;  4ZDP A;  4LX9 A;  3H5N A;  3M1C A;  3W2V A;  2W82 A;  3OYI A;  2B5G A;  4BL0 B;  2VXZ A;  3LSK A;  4KOR A;  4KS9 A;  4HNY B;  2CXA A;  2ZW5 A;  4OLL A;  3K4N A;  3UY5 A;  3ZCO A;  1MMA A;  2WAQ A;  2ZFU A;  4XKB A;  4BE0 A;  3L2R A;  2H5M A;  3BCA A;  1MJA A;  2VQY A;  3G3S A;  3DU5 A;  4KOT A;  5F47 A;  5IV0 A;  3PJR A;  3VDX A;  2XF7 A;  4Q36 A;  2BW3 A;  4MFZ A;  2IS2 A;  2DJI A;  2Z10 A;  3PSF A;  3L2Q A;  2F4I A;  4GS4 A;  2V4J C;  3OYA A;  3FIX A;  1U6M A;  2L9N A;  3H4Q A;  4XN3 A;  3D8P A;  4U9Y A;  4XLH A;  2WAF A;  5TGT A;  4X0G A;  2P6F A;  1YE9 A;  4AU7 A;  4ORF A;  1FMW A;  3HOT A;  4BS9 A;  4RM3 A;  2M7A A;  3TMO A;  2QIR A;  3R96 A;  1LDK B;  3PZJ A;  3FXT A;  4LIU A;  3OYF A;  4ANJ A;  1I21 A;  2R4G A;  3HPG A;  1KON A;  3QOE A;  2WSA A;  4E0A A;  2DPS A;  4KOY A;  4CGO A;  2HQY A;  3BJ7 A;  2Z2S B;  3H5Z A;  3DU6 A;  2VQC A;  4PJL A;  3QAH A;  3S93 A;  2HZD A;  5J8C A;  3KYL A;  3S32 A;  5AG4 A;  1IIC A;  3TOB A;  1J09 A;  5E96 A;  2DCE A;  2LY1 A;  4MFQ A;  4K30 A;  2V26 A;  2W4S A;  3OOU A;  5FRM A;  2RQQ A;  4B5O A;  3OL3 A;  2G3T A;  5HH1 A;  1Y7R A;  5HVQ C;  1S5K A;  3FRM A;  4UFW A;  1T0F C;  4E7Z A;  2R8V A;  3IGR A;  1XF8 A;  3C2H A;  2YND A;  4OAD A;  2F5I A;  4R9M A;  1UFH A;  5HLT A;  4NEX A;  1MNE A;  4PJJ A;  1K4J A;  3MMY B;  2OB0 A;  2FIW A;  2X7B A;  2XAU A;  1DGW Y;  4NCZ A;  3OY9 A;  2V1N A;  4XPD B;  5F49 A;  3EY5 A;  3V42 A;  4YGO A;  2PMZ A;  3LL7 A;  3I3G A;  4B5P A;  3U21 A;  2FXF A;  2R98 A;  4PV6 A;  2I8D A;  3K70 D;  1QHH D;  4ZJZ A;  3OYE A;  4C2Z A;  4XPD C;  5A28 A;  3E0K A;  3JTK A;  1S7F A;  4AVA A;  5F48 A;  5I0C A;  3HPH A;  4MBU A;  3K4J A;  3SEQ A;  1WJD A;  2L9S A;  3EUA A;  3HC7 A;  4E4H A;  1WJ5 A;  2VJ5 A;  4IF5 A;  4HST A;  1J4J A;  4OWR B;  5AG7 A;  2PDO A;  3VWD A;  2V6E A;  2LYC A;  3BLN A;  3BJ8 A;  3OS2 A;  2O5R A;  2XSJ C;  4RMN A;  3S3N A;  2BUE A;  2B5G B;  3DR8 A;  3OL4 A;  1XMT A;  2IGO A;  2XF6 A;  1M1D A;  2KRC A;  3IU2 A;  3SXN A;  3VWB A;  4XNH B;  3VYT B;  3DTE A;  5KTA A;  4CCM A;  3PNT A;  2BW3 B;  3ZXS A;  1PYV A;  1M4I A;  2YNE A;  4BGD A;  2BOL A;  4XLA A;  2LRD A;  4YEJ A;  2P6E A;  1UG0 A;  1QSM A;  3LSI A;  5GCN A;  4XNH C;  4CYQ A;  1W36 C;  5DWN A;  5G21 A;  2W00 A;  1SAU A;  4C30 A;  3NWS A;  2IS1 A;  3JVN A;  5IX3 A;  3SZG A;  4XL9 A;  3IWE A;  4OAY A;  4NC8 A;  1L0C A;  4HG2 A;  4R3L A;  2FSR A;  2M7B A;  2MFZ A;  4BEH A;  4H6U A;  4B3X A;  1FY7 A;  3DPU A;  4AG9 A;  3C26 A;  1DQU A;  4A2Z A;  2GOM A;  4E2A A;  2Y0S A;  2VQH A;  3EFA A;  2DXQ A;  1X1A A;  1Y56 A;  2KPM A;  2FIA A;  2PSW A;  4KOU A;  4F0X A;  3EPZ A;  5CNP A;  4XQF A;  1D0Y A;  1DGR M;  2R7S A;  1X4O A;  2Z3P A;  2CV1 A;  3FBI B;  4R79 A;  2UWM A;  4II9 A;  4UBR A;  4P1W A;  2QKL B;  4CZC A;  4F93 B;  2Q7B A;  4QBJ A;  3CJQ B;  2KZV A;  2VZZ A;  3D5R C;  1UAA A;  2MYS A;  4BJ6 C;  4E7J A;  1P0H A;  4XLE A;  3H9J A;  2CS3 A;  2ELJ A;  4AYB A;  5HOO A;  5CPR B;  2GE3 A;  4ZBG A;  3S6F A;  2KQR A;  1YVK A;  3NWT A;  4F92 B;  3FYN A;  1I12 A;  2UUZ A;  2VL8 A;  2VEZ A;  1Z7L A;  1WJF A;  5KCM A;  1X4P A;  3HUG B;  3L2V A;  4E7H A;  1UEL B;  2LY2 A;  3HG9 A;  4ZDO A;  4ZYA A;  3CP8 A;  4BQN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...