4PSWA

Crystal structure of histone acetyltransferase complex
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
316
structure length
316
Chain Sequence
DFKPETWTSSANEALRVSIVGENAVQFSPLFTYPIYGDSEKIYGYKDLIIHLAFDSVTFKPYVNVKYSAKLGDDNIVDVEKKLLSFLPKDDVIVRDEAKWVDCFAEERKTHNLSDVFEKVSEYSLNGEEFVVYKSSLVDDFARRMHRRVQIFSLLFIEAANYIDETDPSWQIYWLLNKKTKELIGFVTTYKYWHYLGAKSFDEDIDKKFRAKISQFLIFPPYQNKGHGSCLYEAIIQSWLEDKSITEITVEDPNEAFDDLRDRNDIQRLRKLGYDAVFQKHSDLSDEFLESSRKSLKLEERQFNRLVEMLLLLNNS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Hat2p recognizes the histone H3 tail to specify the acetylation of the newly synthesized H3/H4 heterodimer by the Hat1p/Hat2p complex
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transferase
molecule keywords Histone acetyltransferase type B catalytic subunit
total genus 101
structure length 316
sequence length 316
ec nomenclature ec 2.3.1.48: Histone acetyltransferase.
pdb deposition date 2014-03-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
A PF10394 Hat1_N Histone acetyl transferase HAT1 N-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.390 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4pswA03
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4pswA02
3.90.360.10 Alpha Beta Alpha-Beta Complex Histone Acetyltransferase; domain 1 Histone acetyl transferase 1 (HAT1), N-terminal domain 4pswA01
2GANA 5HH1A 4KOVA 5EC4A 2HV2A 4R3LA 4KOYA 2R7HA 1U6MA 1MJAA 4MHDA 2JDDA 2B58A 2PDOA 4UWJA 3SHPA 2OU2A 2FIWA 2Q44A 3DDDA 3D3SA 2ZW7A 3E0KA 2A4NA 2VQYA 3H4QA 4MJ8A 3DNSA 1GHEA 4B5OA 2FE7A 4RS2A 2RC4A 3GY9A 2KCWA 5H86A 4PK3A 2JEVA 4KVXA 3QB8A 2R1IA 4KLVA 4CRYB 3DR6A 3KKWA 4Y49C 4NSQA 1L0CA 2ZW4A 1UFHA 3RYOA 1M1DA 2OZGA 4JLYA 5KTCA 2Q4YA 2Q7BA 1MJBA 4IF5A 3I9SA 4KOTA 2BEIA 3R9FA 1PUAA 2K5TA 4I49A 5KTDA 3ZJ0A 1S7LA 3F5BA 4QVTA 1M44A 4CAVA 1I21A 1KUYA 1P4NA 2WPWA 2I00A 1YLEA 4UBRA 2VBQA 1IIDA 4X5KA 2Z0ZA 3FXTA 3S6FA 2DXQA 1N71A 4E8OA 3JUWA 3TOAA 4AB7A 2HQYA 4PV6A 1NE9A 2BSWA 2JDCA 2F5IA 5DWMA 4EVYA 1Z4RA 1BO4A 2PC1A 3BLNA 2Z11A 5F49A 2ATRA 2J8NA 2G3AA 2EUIA 5CNPA 1XEBA 5I0CA 4KOXA 3JVNA 3K9UA 5J8FA 4HNXB 4XNHC 3FYNA 5E96A 4Y49B 1Y9WA 4BMHA 1I1DA 1SQHA 1Q2YA 3MGDA 4K30A 3TO6A 1YK3A 4NEXA 3TTHA 2H5MA 4OADA 3W6XA 3IWGA 3R9GA 4H6ZA 1QSRA 2QIRA 3VWDA 1CJWA 3C26A 1J4JA 2PR1A 2FT0A 1KUVA 1Z9UA 1XIXA 2NMTA 4U9ZA 3T9YA 3D2MA 4L89A 3V8IA 1RXTA 2HUZA 4PSXA 4KLWA 3DR8A 1I12A 4FD6A 4JXRA 1IYLA 2AE6A 4CS0B 4B5PB 4XPLA 3BJ7A 4II9A 1KUXA 1S60A 4OLLA 4KVME 1KZFA 4AG7A 4FD4A 1M4GA 1YR0A 3FNCA 5HMNA 3R96A 2C27A 3FIXA 5FVJA 1YX0A 3FB3A 4LUAA 5IX3A 3N7ZA 4AVAA 2I79A 1WK4A 1Q2CA 1Z4EA 3CXQA 5JPHA 4ONUA 4CAXA 2QECA 3LD2A 4MY3A 4J3GA 4GS4A 2VEZA 3P2HA 3PZJA 4QC6A 3S6KA 1M4IA 1XE4A 4R87A 2Q4VA 4KZTA 4YGOA 3P2FA 2REEA 2D4OA 3W91A 1V0CA 2WPXA 1S7KA 1MK4A 1MJ9A 1P0HA 2ZPAA 2CNSA 2PR8A 1WWZA 1LRZA 2X7BA 3QAHA 2G3TA 2ZW6A 4B5PA 1QSOA 1Y7RA 1IB1E 5C82A 2J8MA 3VWEA 4L8AA 2FIAA 2GE3A 2P0WA 1VKCA 4QUSA 2EVNA 2G0BA 2B5GA 4ZBGA 1QSNA 2B4DA 3TO9A 5JQ4A 5F48A 3R95A 3B8GA 2R8VA 4FD5A 4KOUA 5GCNA 3EC4A 3EY5A 4HKFA 4FD7A 4KVOE 3PGPA 1BOBA 4DNCA 1VHSA 2AJ6A 4OAEA 2FXFA 5EBVA 5KTAA 1QSTA 4YFJA 3CXPA 5ISVA 4IUSA 1S3ZA 2PSWA 4E0AA 2O28A 4NF1A 3FBUA 1FY7A 4ORFA 3S6GA 4M3SA 4KUAA 1R57A 1IICA 2OZHA 2Z10A 2FCKA 5IV0A 3TO7A 3BJ8A 3DSBA 3F0AA 1S7NA 1RO5A 3R9EA 2FSRA 1IYKA 2D4PA 1YGHA 4F6AA 3LODA 3W6SA 1XF8A 3TOBA 2VXKA 4MI4A 3CXSA 3SXNA 3G8WA 2J8RA 2REFA 2ARHA 2CNTA 1Y9KA 1YVOA 3PP9A 4RI1A 4R3KA 4HNYB 5H84A 2Q04A 4NCZA 2Y0MA 2P6FA 3I3GA 4UWIA 2ZW5A 4QBJA 1PU9A 1S5KA 4MBUA 2P6GA 4JWPA 2GIVA 4H6UA 3TE4A 3D2PA 2FS5A 3D8PA 4XPKA 3T90A 4U5YA 3F8KA 4CAWA 2PQ8A 4XNHB 4CRZB 5F46A 2BL1A 1YVKA 3FRMA 4UA3A 2JLMA 3TCVA 3EFAA 4AVBA 3ZZIA 1S7FA 3TFYA 3UY5A 2VZYA 4KOSA 2VI7A 2Q0YA 3OWCA 4JJXA 4AVCA 1NMTA 1QSMA 3EXNA 3NE7A 4KUBA 4R9MA 4MY0A 1TIQA 1NSLA 3SXOA 3G3SA 4KORA 4LX9A 1ON0A 5DWNA 2B5GB 2B3VA 1OZPA 1K4JA 1B87A 2CY2A 2OB0A 5J8CA 2B4BA 4H89A 1YREA 3GKRA 4HNWB 5IB0A 2OH1A 4E2AA 2B3UA 2CNMA 2P6EA 4NXYA 2VZZA 4JD6A 3TT2A 5F47A 3WR7A 2R98A 3S6HA 4R57A 4QB9A 1M4DA 2OZUA 5C88A 4KOWA 2B4DB 1Q2DA 4JXQA 4PSWA 1XMTA 4XPDC 2BUEA 4U9YA 2FL4A 2PRBA 4YRHA 2ZXVA 4XPDB 4M85A 3GYAA 3R1KA 2QMLA 4F0YA 2IL4A 3EO4A 4AG9A 3IGRA 1CM0A 1B6BA 4PK2A
chains in the Genus database with same CATH superfamily
3HKZA 2GANA 2OBPA 3IRQA 3DLJA 2AO9A 4WJBA 5EC4A 1JE8A 1DDNA 4BYYA 1YLFA 4FASD 4IHXA 1BM9A 4KMUX 1BW5A 3CUOA 5EJCA 2V8GA 2A05A 2XEIA 4PGHA 1HA8A 1MJAA 4LD5A 2NAZA 3ISXA 2ME0A 3WE3A 3S17J 2DU9A 4MFZA 2W25A 2V9KA 2EBJA 2EBIA 2E1MC 3F8NA 3K6GA 4NGMA 2JMWA 2OU2A 1GVJA 2R7WA 4MMOA 3L2CA 1HBXG 4OC4A 2O0YA 5FGMA 2XC7A 1P4WA 4I6ZA 1QU3A 2HVQA 2XAGA 2VQYA 4RB1A 2W7NA 3H4QA 4M6HA 1B9MA 1IO2A 2MGQA 2Z3YA 4LG3A 2MFZA 4C2XA 4XLEA 1CGPA 2BW3A 4B5OA 3DBLB 1ORKA 3BQYA 5EEGA 5LEJA 1W0TA 2R5ZB 4QWQA 3F6OA 4UUSA 2JSCA 4DBQA 4OC5A 4PK3A 1GDTA 2JEVA 3H9QA 2CQXA 5D29A 3LSHA 4KLVA 3HJEA 3DR6A 1Y39A 1Y1WJ 1W36D 1LAPA 4ZC3A 4TV7A 5JLXA 3TX8A 4JX4A 2IMOA 2XAQA 1T08B 2V1XA 2XGXA 2BVMA 3GCMA 1SVLA 3IHUA 5GTIC 2DJIA 4FTHA 3S3MA 1G3WA 3M9AA 1UFHA 4ZTFA 2OAZA 3S3OA 2ID3A 3F6VA 2OZGA 2V9PA 3NAUA 2IS2A 2L2OA 2VQGA 4JLYA 2EV6A 1USTA 1HW2A 2HOEA 4IQ4A 3LSPA 3PM1A 4IL6C 4FBEA 1CPXA 4X2TA 4BJTA 4IXAA 4UVBA 4LG0A 3KHXA 4KOTA 1HSJA 2QQAA 3FBNB 3FISA 4Y15A 2DBBA 2FF4A 4PDKA 1VQKI 3WU1B 1U2WA 3I54A 3D67A 4XKCA 4MFKA 3ZJ0A 4AC0A 1X2NA 2STWA 2ZEHA 3QYEA 2R7UA 3FMSA 3S9MA 4C7IA 3PL8A 4BQQA 3CUQA 2KLOA 4CAVA 1ON2A 4ZY0A 5DUKA 4RLFA 2I00A 4R6TA 4XLFA 2L02A 3F8BA 2CW0F 3TGNA 2EFWA 4A3BJ 2QYVA 1T0FC 3ZCOA 3V7SA 1X3WB 1M1EB 3W2WA 1SFOJ 2Z0ZA 4X5KA 4RBOA 1FEXA 2VKDA 1R71A 2DXQA 1S29A 1X4PA 1U8BA 1MNMC 1VQ6I 4GO1A 5HDKA 4ABZA 3LQQA 3JUWA 4UEEA 4LOCA 2R7OA 2IBDA 2TDXA 5D6EA 1XX5A 5F04A 3DBHB 3BG9A 3H9JA 1FTZA 5K5RA 3PUBA 2F7VA 3ELKA 4L5IA 5DWMA 2PJRB 4EVYA 4OKOA 1FX7A 1OKRA 3FMRA 3OYKA 3RKWA 4A3IJ 1BO4A 2RVCA 4GYGA 4I02A 1X12A 4OC2A 5F49A 2ATRA 1N78A 3E6BA 1VHOA 1BBYA 2G0EA 4OC0A 2L7ZA 4X1EA 3V8KA 2X6XA 2KIUA 3IWZA 3CC2I 2WYRA 3DEUA 5GPCA 3A01B 1U3EM 4U7BA 5D5UB 1IGBA 5DD4A 4JP0A 2ZFUA 2KIMA 5IP6A 3DPTA 3FX6A 1HW5A 4Q36A 3H0DA 2ZMEB 1FWZA 1OR7C 3HHGA 1P92A 1XCBA 2EJRA 2GOMA 2IA2A 4YG2F 3E3VA 3BR0A 3S93A 3H1CA 4EMSA 4AIDA 5EG0A 1ERDA 1Q2YA 3WC6A 3FZVA 3TO6A 5L3CA 4B12A 2YSRA 2Y0SA 5BNGA 3TTHA 2D45A 2GXGA 4W97A 2EZLA 3CP8A 2KIFA 3IWGA 3RZOJ 3CMEI 1QSRA 3VWDA 2EIJH 2ABZA 1CJWA 1Z8XA 2EK5A 3ASNH 4EM0B 3LWUA 2EILH 2JUGA 4EM1A 2PR1A 4HPSA 1OYWA 4DW6A 3KYCB 3COAC 2HDDA 2NOGA 3AAFA 2ZJPF 3GB0A 4RS8A 1R36A 1YRNB 3K4KA 2Q1ZB 3CCSI 4CYNA 3DTIA 3ZQLA 4KT6A 4U9ZA 3T9YA 1S6LA 3FIWA 3B3TA 3D2MA 4L89A 1IDYA 2XASA 5JH9A 1P2FA 3S9LA 1RXTA 2F4MB 3JW4A 2F4OB 4EATA 1QZEA 4BS9A 4KA4A 1SD7A 3A4CA 2LKPA 3LSRA 2DJNA 4YFXF 1G4DA 5H2FC 3G6EI 4KNYA 1IGNA 3C2BA 4MFPA 1OYIA 3RSNA 2DDAA 4BQAA 4B5PB 3MZHA 3IKTA 1Y0UA 1KONA 4RAFA 1LANA 3E6DA 1FOXA 1S60A 3HOZJ 1TT0A 2KRCA 2Z3OA 4OLLA 3MQ0A 3JRIA 2H8WA 3KYLA 1YW4A 3B3WA 5LYIA 5JR3A 2R7FA 4EJOA 1B72B 5IYBJ 1YITI 5IYDJ 4PJLA 1KZFA 4AG7A 3JTKA 1Z91A 5LEKA 1JJ6C 4Q47A 4LLNA 3IAS2 1VQLI 4PXCA 1SANA 1E2XA 3KP4A 1M4GA 2HDCA 2JA8J 4B4CA 2QUFA 1MMNA 1A6IA 3OS2A 3EUAA 1WVRA 5FLXZ 2O03A 3LFKA 3BG6A 3RCOA 2A07F 4JBAA 1YSJA 1IXSB 2HTJA 5FRMA 2WSAA 3FB3A 1JUSA 5HNFA 3EYIA 4AVAA 3KEOA 1WK4A 2B9SA 2DQRA 2XPVA 4ZX9A 4KIGA 3WC7A 1TW2A 1Z4EA 2X1CA 1RI7A 4KICA 5FFZA 1SFKA 4J3GA 2CQNA 1V5FA 4MY3A 1DP3A 3VEPA 1AA7A 1ELMP 1TKFA 3CCUI 4QC6A 2QEXI 3IH2A 1JHFA 1XE4A 4D9JA 1JJ8C 4NQWB 3GFLA 3JRGA 3HOWJ 3P2FA 2REEA 3ABTA 2D4OA 1QVTA 3N97A 1V0CA 1ZLHA 2LY2A 2PIYA 2L5QA 4M74A 3FXUA 3SZPA 5J1RA 3D7FA 4ZY2A 3Q9VA 1X3UA 1P0HA 1Z3YA 4Y17A 1XSDA 2ZPAA 3H8FA 2CNSA 4M9ZA 2PR8A 1LRZA 3KLNA 1RETA 2XHKA 1X19A 2IVMA 3QAHA 3QP5A 2XB0X 4DZJA 1ZYRF 1PP8F 4BE1A 4B5PA 2OQGA 3OY9A 1S7OA 1MBFA 1S8NA 2FJ1A 4QSHA 5C44J 2HQRA 2AFZA 5HVGA 1IRXA 1TT5B 2KQRA 1QQIA 3TMOA 4CICA 4F9UA 2GA1A 4P4FA 1XDSA 3WHBA 3IUOA 4ZBGA 1NTCA 2EVNA 3HKZN 2B5GA 2VODA 4II2A 2JSPA 4P9FA 1D0XA 4P4EA 3RI4A 4B3XA 4KDPA 1BN5A 1JHHA 2KRHA 1NHAA 4B43A 2R0QC 1GXPA 3LA2A 1TF9A 2MG4A 5JQ4A 2QSHX 5L3FA 5F48A 2AFOA 5G1ZA 4IOCF 2DOAA 4AVZA 4IRHA 2QA4I 3LSTA 2R8VA 2VN2A 2NOJB 3CCVI 3OOPA 2HB6A 2DFHA 2YNCC 3K9TA 4BDYA 4XRFA 1W5CC 3T8TA 2LR8A 3EY5A 5AGEA 3VATA 5KNLA 4FD7A 4LB6B 1U78A 3RKQA 3PGPA 1BOBA 2OD5A 2BOAA 3H92A 1W1WE 4G6DA 1ZG1A 1W7PA 2VJIA 4UUTA 3ZQIA 1FMVA 3MN2A 5ILUA 1KU3A 1R23A 4YFJA 3CXPA 3WTTC 3RZDJ 2RFHA 5C4XJ 1YHQI 1UMQA 1J5YA 3FBUA 1FY7A 2PJCA 1T33A 3ABKH 3KL9A 4KUAA 2X6YA 2DCEA 1R57A 3ZN0A 5K1YA 3L2WA 3G2BA 1IICA 4FWUA 1YYVA 4XN3A 4PXDA 1I27A 4CZZA 2OZHA 5F64A 1LNWA 3ULQB 1KYWA 5IV0A 2PEXA 3H3VK 3RYRA 3KEYA 1T98A 1S7EA 3MD2A 3ZQQA 3MFKA 4G7OF 1H9TA 3DPUA 1SVMA 4BJ6C 3OS0A 4K3NA 1YIOA 4LITA 4G94A 5C3EJ 1IC8A 4A95A 2PJ5A 5LYLA 1YGHA 3HUGA 4F6AA 3OR1C 4J19A 2ZJQF 2V6CA 3GFMA 1OCTC 3E1SA 1B59A 2DA4A 3CJRB 3H36A 2R7RA 2HYJA 2QM3A 1XRYA 4W1UA 5F27A 3IEHA 2LMDA 4FT8A 1K6OA 1T6SA 4IZZA 5CVRA 4A3JJ 3H5AA 2KISA 1JUMA 3BPXA 3WTUC 5E1ZB 2I5UA 3NWSA 3SYTA 3MN8A 2XV4S 4A2UA 2DFIA 2A5WA 2ZXIA 3OYCA 4CYCB 2ZBKA 5DCMB 1F4KA 2C1CA 2HXOA 4R7MA 4IF4A 2GU2A 2LBFA 4UCMA 4CAFA 2OF7A 2HQAA 3V38A 3LL7A 1ARLA 3S32A 4MFDA 3OYAA 3CO7C 5GTHC 2ELKA 2AFWA 2HVSA 3BR3A 2P81A 4NCZA 2G9WA 2Y0MA 5KK1A 4A3EJ 3KIOA 4UWIA 4G9YA 2ZJRF 2XAJA 1IJWC 1MNDA 2K02A 4LIVA 2LG4A 3L2RA 1TXRA 2NYQA 3KZWA 1ZQ3P 4S0HB 3KASA 1JGSA 4Y33A 5AG4A 4UUSB 2IXSA 4WF2A 1TC3C 3WTXC 2AQEA 1ZELA 4F92B 2K3PA 2ECBA 3I59B 3S1QJ 4E7HA 4RUHA 3TQNA 3VYTB 3T90A 5HDGA 3KPHA 2M87A 4I76A 4U5YA 2QSFX 1XSVA 3BTJA 3PFYA 2J5PA 3KP7A 4QPQA 5HLTA 1E0EA 1AUGA 2PE3A 2Z3LA 2X6WA 3BWGA 2L7KA 4TWEA 2LBFB 1APLC 2D1HA 1JT6A 3JSOA 4UA3A 5HLIA 2XPWA 4WK8F 1O3TA 2KHMA 3MRUA 3C1DA 3OS1A 2GA2A 4Y4RA 2P7CB 1WWXA 1PDNC 3B3SA 5TISC 3EFAA 4AVBA 4B10A 3GEZA 1CP6A 3RNZA 1XMXA 3UY5A 1W0UA 1FBSA 1OFCX 2RNJA 2KZGA 4KOSA 3QOEA 3H5ZA 2JN6A 3IWEA 2XUBA 1G3SA 2DAOA 4JJXA 2M1BA 1NMTA 1K7AA 4S04A 4M3EA 1WJ5A 2KPMA 1YJ9I 2ZOFA 1FZPB 5FFXA 2FNPA 4BEHB 2PVWA 1R22A 3PIPF 4HV6A 1YLOA 2BZTA 4KORA 1ON0A 1OCCH 4RMNA 3DCFA 1R9TJ 1V55H 2W84A 1O3RA 3FKIJ 1P9QC 2B3VA 4BE0A 2CY2A 2OB0A 1WHUA 3ERED 1Z05A 4Z6YA 3JRBA 3UNGC 2DA7A 2FEZA 2B4BA 4WWVA 4IK2A 4OIRF 5H20A 5J4VA 1K78A 2LYCA 3DLAA 5E8GA 1MNEA 4HLYA 1VQ8I 1TBXA 2QQBA 3CC4I 5IB0A 3I59A 3DTEA 4YELA 1E3PA 4DUKA 1WJFA 2C6CA 4GRIA 4OAYA 5HLGA 4XRSA 5LGNA 3CLQA 4XQFA 2HVRA 4DGWB 3BY6A 2R98A 1Y56A 1RUNA 3AL0C 3S6HA 3BR1A 4R57A 2OZUA 4KOWA 3BCBA 2CQKA 3CP2A 1WJDA 4CDGA 4JOMA 4PSWA 1R5ID 1AYEA 3L2QA 4P44A 2K86A 4ZYGA 4A6EA 2BUEA 3C18A 3VYSB 3WTZA 4F7ZA 2R5ZA 3M1CA 2PRBA 4YRHA 5KCMA 2QWWA 1RTQA 1U5TC 3WU0A 2ZMEA 2EV0A 4WCGA 1QNTA 3IRRA 1WJCA 4D7MA 2AHQA 2RKHA 3LOCA 4A94A 2L4MA 3L00A 3VODA 3LWFA 1CM0A 2POKA 4NFRA 2K85A 1LAMA 5L3EA 4U0YA 2K9SA 4I01A 1QPMA 1XB4A 3TP3A 2LKXA 1QO0D 4CH7A 2E7WA 4LFUA 2MD5A 2LC2A 2CV1A 2YU3A 5M5XJ 2NVYJ 3B6AA 4FAIA 2JT1A 3OYDA 3TKYA 3DF8A 1Z6RA 3MZ8A 4XL9A 3F0CA 2VIXA 8CPAA 3K4CA 3OV8A 3CF2A 3W2AA 3I5UA 4A33A 1JKQC 3V4GA 5CPRB 2VT3A 1F2OA 2FVGA 2GLJA 5E1XA 4CA0A 5ELYA 3DEEA 3ERMA 3SHPA 1TQMA 2JBKA 3DDDA 3PB8X 3IAM2 2AS5F 1JT0A 3NARA 3O3KA 1R00A 1RZ4A 4PZJA 4ZGYB 2M8GX 3E97A 5HDNA 5E3MA 1UJ8A 1WQ2A 2VBZA 4A3GJ 4E4HA 4MJ8A 3C2HA 3CO6C 5HNHA 4CGPA 2CTCA 3O8GA 4HYEA 2PBIA 3OR2C 1XFOA 2ELHA 2BO9A 2Z3KA 4MHYA 4BQOA 1RC9A 3OSFA 4L9VA 1RRJA 4BD9A 5FKNA 4OWRB 2ZJ2A 3SHFA 3CCLI 1B72A 2KCWA 2WY7Q 2M34A 3LSGA 1TTYA 4KVXA 1ZRDA 1Z5RA 4HX4A 1WZ2A 2R1IA 3MMYB 1BAVA 4BHBA 2GBYA 4CRYB 2R5YB 1LFUP 1D0ZA 5FLMJ 2BHZA 3DWLE 2LTPA 3PQJA 2IT0A 3CJTB 4M9XA 1L0CA 1X3ZB 4E70A 2NS0A 1FYMA 1GLNA 1TNSA 2QVPA 3SJEA 1ZGJA 5KTCA 2Q7BA 2ZNYA 1IZ1A 2OPTA 3DLLF 4KN7X 4M6GA 1Q1HA 2AXTC 4IF5A 1F9NA 2FBIA 4HAMA 1RIOH 3RTRA 3GTQJ 4R76A 2C6YA 2F6CA 1TWHJ 1U9NA 4YWYA 4B13A 2HOTA 3IC1A 4BXFA 1SD5A 2Y2ZA 3BC8A 4R1HA 1MMSA 4MFEA 4P4IA 5FKOA 4ZDOA 3F5BA 1OISA 1M44A 4Z2YA 1DPUA 4DYQA 1WKMA 4HQEA 3IWWA 4N4NB 3WT4A 2DA2A 2R93J 3PJRA 2Q2EA 3FXLA 4BAYA 1SFUA 1I21A 1KUYA 3BXMA 4KITB 4NGPA 2MH9A 1ZK8A 1LQ1A 3P9IA 3F3XA 3X2QH 3SJFA 5DS9A 1T0FA 3ABLH 3S8PA 1I6XA 2FE3A 2X1EA 1SAUA 1TWGJ 3FXTA 2VKEA 2EK8A 1FIAA 1YS7A 5I4MA 3PNTA 2HXIA 2VE9A 1HOMA 4ZX8A 4E8OA 4PV6A 3FXRA 4KSAA 3K0LA 2IQ6A 3L1PA 1IUYA 3F8MA 4C2TA 4MFLA 1YW7A 4ESJA 1A35A 2JDCA 2F5IA 4F9VA 2R7QA 2EZKA 1Y8RB 2AXLA 2LKSA 2UUZA 3GTOJ 1HDUA 3BLNA 3CPAA 2X0LA 3WE2A 5DM7F 4CYOA 3HEFA 4O23A 1MW7A 3L7WA 4PQAA 1VI0A 4B47A 4C2MJ 2EUIA 3KQZA 3BTLA 4KMFA 3JRUA 4HSTA 2IW5A 1NK3P 1K4TA 1QQ9A 3KETA 2HKXA 3FF3A 5E18F 2ZEFA 1UFMA 4BDZA 1ETKA 2ZEGA 3H5NA 3CDIA 4ON0A 3OSGA 2VJJA 2VBXA 4XONA 2V7FA 1JKPC 3GX4X 4BNCA 1D5VA 1BLLE 2DT5A 3WG7H 1P4XA 3DBRB 1A5JA 1O3QA 4K30A 1MH4A 1BR2A 2RQPA 2P6SA 1YK3A 1ETYA 1MMGA 2O53A 3SJXA 2H5MA 4RLQA 1IU8A 3VOEA 3ZQHA 3FECA 3W6XA 3Q9SA 2HI3A 1BOAA 4OIOF 1ZG9A 2KDOA 1R5GA 3C26A 4IVNA 3G1OA 3J81K 3HXLA 1T56A 3DKYA 1T2KA 2X4HA 2DXIA 2F5DA 3D5LA 1DU6A 4HLXA 2FT0A 2MW8A 1G59A 3KX2A 1UHWA 5FKLA 4IQJA 4EM2A 2ZSIB 5G20A 2QVOA 2XAFA 4IHVA 1Q7LA 3JR9A 4OC3A 4L9JA 4KIFA 2YNDA 4FCYA 1VQ9I 4CCLA 1ZKGA 4BBSJ 2NSMA 3LA3A 2XB5A 2HUZA 4M3FA 4RB0A 2GZWA 1TQIA 2M2EA 4QTRA 4LGWA 5D6FA 3TP0A 1LPQA 2ZFWA 2ZEOA 4IOAF 1I12A 5LYFA 4F0XA 2XAUA 3PUFA 1LE8A 3QP6A 4JXRA 2PLYA 2VT2A 2VPRA 3HRTA 2AE6A 2WAQA 5K8OA 1YW9A 4CSWA 4B6ZA 2PJAA 3PNYA 1FTTA 1F57A 2LRDA 3R0AA 1D8KA 2ZXHA 3KCCA 1YG2A 3CCQI 5DCMA 2HGCA 3V42A 3GF2A 2EZHA 4XSXF 4ENMA 2P8TA 3D7GA 3NE8A 3IL2A 2L9RA 2CTBA 1T8IA 1GVDA 1R4MB 2XGCA 5GP9A 5IB9A 3MVPA 1HQCA 4FD4A 4XLPF 3CZ6A 4HA8A 4G6QA 5B1AH 2BXYA 3FNCA 2V79A 4Y13A 2XPUA 5BQTA 5J40A 3R96A 1FOYA 1MZBA 5E3LA 2KZVA 4ESFA 1M4LA 1NK2P 3R4KA 5E1WA 3HRMA 4MTDA 2IS4A 2R7XA 2WZNA 4ZI6A 3EPZA 1VFCA 5E17F 3MEXA 5D5WB 2R7DA 3KE2A 3RJPA 3DKWA 2L01A 4B1RA 3N7ZA 1YE9A 1Z3XA 4M73A 1K79A 2VUMJ 3GUXA 1P4AA 2MA3A 5EGOB 3FKJA 3FHNA 2FX0A 1JQGA 3FM5A 4GS4A 1MMAA 2YU9J 3KEQA 1VF9A 2NRAC 3FDYA 3PZJA 5DS0A 5F0HA 2ZNZA 3K2ZA 1R3NA 4R87A 3I4MJ 4YGOA 2H94A 2YS9A 3PSIA 4AM3A 3A9LA 1R1TA 5AIPA 2WPXA 2XKOA 1S7KA 2K3FA 3B35A 3BR5A 3HOXJ 4LIUA 5J1UA 3RKXA 1TP4A 3PFOA 1UG0A 5ICFA 5IP7J 2RQQA 1P6RA 4CXFA 5JGFA 1XTAA 1JTXA 3REOA 5LFAA 2G3TA 2ZW6A 1EV7A 5E8IA 4UV9A 2XAHA 2A6EF 4OOIA 3GTLJ 2Q0OA 4YFKF 3JRAA 3GWZA 1V4RA 1HDQA 3GMEA 2GOXB 3CMYA 4MFJA 4U88A 1L0OC 3AG3H 5J3LA 2FIAA 2GE3A 1IV6A 2P0WA 1JGGA 2G0BA 2YX4A 3QODA 4R79A 2QENA 2PJ6A 5LLQA 2VB6A 1IUFA 2IJLA 3PQKA 2F5VA 2WB1N 5LD2C 1QSNA 4F91B 2PMZA 2F5EA 2B4DA 5BOXA 3TEDA 5BMZA 3R95A 1BPNA 4HNUA 2O7OA 2GFQA 4WXHA 2VQLA 5CPAA 3B8GA 4CGNA 2XF5A 2DA3A 3BLYA 4ZYHA 3N4MA 1Z6TA 2CF4A 1BA5A 2K9MA 1G6NA 3UKGA 3EC4A 2ZEDA 3DFGA 3L9FA 3GZ5A 1B8IB 4HKFA 3LMMA 3OYMA 4KVOE 3QPHA 4UCNA 2ECCA 2Y0SN 3BG3A 3VSKA 5D4SA 2MH2A 4L9NA 1NH3A 3F21A 5DM6F 4HDUA 4O3MA 3N05A 2OZ6A 1STZA 2D2WA 3ONQA 1IXCA 4OP4A 7CPAA 5ISVA 1XGOA 1S3ZA 1KQ9A 5F09A 2O28A 4ORFA 1HXDA 4LG0B 1V3FA 3CUQC 3PIOF 1TWAJ 4RA2A 5B3SH 2DF5A 4M71A 3PB9X 2QGUA 1Z8TA 1HDPA 2QKMB 3HOTA 3ZMZA 3ROUA 1B8IA 1ETXA 4XOTA 3DSBA 3GTKJ 2OCCH 2PMZN 1S7NA 1RO5A 1ZRFA 3SXYA 4A30A 2KT0A 2TCTA 2Z99A 4CO8A 1IYKA 2D4PA 4OIWA 3B7IA 4BEHA 2XIGA 2DK5A 2DYRH 3EUKL 2HS5A 4P1WA 4A0YA 4BHPA 4IRIA 4P6YA 2ICWG 1OMIA 1I3QJ 2EIMH 3K1PA 4BU2A 2R7SA 3BG5A 1BR1A 3W6SA 1XF8A 2W82A 1CP7A 2AFXA 3NH4A 2BY3A 1JUPA 1Z7UA 4RN7A 4IHMA 1RR8C 3K1MA 2VQCA 4ZYAA 1SFXA 2NXNB 2F5CA 5CLSA 3OL4A 2CV2A 1IN4A 2PIZA 3WC5A 1YVOA 2ISYA 3H8GA 2K40A 3MCZA 4LK0F 2IAIA 2A61A 2E71A 2P6TA 4C3IJ 2COBA 1WJAA 4JYKA 2WV1A 2DMPA 1T95A 2HZDA 4IPAA 5GAGJ 4ZY1A 4V2GA 2DPDA 2QBYA 2F8HA 4L9TA 1FT9A 1XGSA 2ZW5A 4QBJA 1QGPA 1PCAA 4UCPA 2V77A 1ZO0A 2FQ4A 3SDBA 4MBUA 2HPIA 1I3AA 3E6MA 1FOWA 2QKLB 3HOUJ 4P5OA 2P6GA 4ONWA 2GIVA 3HRUA 3D66A 1BJAA 4F55A 1BPMA 1N25A 1O7FA 3AFHA 2M30A 4IHYA 3A2KA 2FS5A 3D2PA 4RGUA 3MKZA 2VJ4A 1ZR4A 5IT9K 2VXZA 3C3WA 2PQ8A 5A2QZ 4CAWA 5F46A 4ZDPA 2BL1A 4IO9F 2CO5A 4UFWA 3HB9A 2GAUA 1LFWA 3QYBA 4RDUA 1U5TA 3OIQA 3ECOA 4MEXF 3BJ6A 2JTVA 4EFDA 1OQYA 3S2WA 3TCVA 3VYUB 3ZZIA 5EDNA 1I6HJ 5CVVA 2WB1A 5CVJA 4NDLA 1S7FA 2ADUA 2VZYA 1CF7B 2DMTA 3M4OJ 2V4JC 3CJNA 2A68F 4AVCA 4Q4ZF 2FQ3A 3NE7A 3J7AY 3NQOA 1GV2A 1AHDP 4ZZDA 1TIQA 3KZZA 1I50J 3K70C 2M8EA 2A3SA 5KVRA 4EJTA 1VQ4I 3RPUD 1H0MA 4OIDA 2AFUA 5D8NA 4H0EA 1XBUA 3PNVA 1LOKA 2M7AA 3M8FA 3WTVC 1FPQA 1K4JA 1B87A 5M5WJ 3BZKA 3LA7A 3H0GJ 5J8CA 2QBYB 2AQFA 2LDUA 2I10A 3BTIA 1SMTA 4ENNA 4KIBA 5ILSA 1BI3A 2CYYA 3ASOH 1ONVA 1XS9A 2CWEA 2Q51A 1Z77A 2WA0A 5IOYA 2Z9OA 2XRLA 2V26A 4A3MJ 1YO5C 2VLAA 2FXAA 3NWTA 4F93B 3HBLA 1Z1DA 3OYNA 3TC8A 5E79C 3HOYJ 4EGZA 4E2AA 3H35A 2B3UA 1MKMA 1QHGA 5FLXK 1QVUA 3IU2A 4EJWA 4KFCA 3TT2A 3BT9A 3A02A 2JPCA 1Z67A 4L0ZB 1BIBA 4I09A 2PJ9A 5F47A 3OYHA 1O3SA 4CZCA 4MNUA 1FYLA 5C88A 2V1UA 2H27A 4OC1A 4LK1F 1PUEE 2CG4A 1TKJA 1Q2DA 4PFOA 1KU7A 5CQEA 1PUFA 3WGHA 4LQ6A 4YIFA 4N9HA 1AMPA 2V8DA 4P45A 1E3OC 1EE3P 4PXEA 4D1QA 2GLOA 3BJAA 2RV8A 1A04A 2HFHA 4LLGF 3E6CC 4CGZA 3ZQCA 2FL4A 2ZMEC 4DYCA 3PBEA 4B48A 2ISZA 4MCSA 1WH7A 2EV5A 1ETVA 1ULYA 1J75A 4F0YA 3ESWB 4A39A 1D3YA 1CG2A 3CZXA 4F52A 2JK3A 3OYJA 2VC1A 1TWFJ 1QA6A 1B6BA 5K8MA 1WRJA 3VFZA 1X1DA 2JWTA 5HH1A 3QPTA 3DEWA 2H8RA 2P5LC 3FM3A 1TNTA 3ZMDA 2BY0A 3K4MA 4GDFA 5L3DA 5D5VB 2M4KA 4KOYA 1K83J 2K9NA 2NS7A 3CDXA 1GT0C 4MHPA 3J80K 3NH8A 2V8VA 2R7HA 3HTSB 3M1EA 5K5OA 1REPC 1U6MA 3PB7X 4MHDA 1DGWY 2MD0A 4AWXB 2JDDA 3F9KA 5LRJA 2M45A 2ZOGA 4A0XA 3SJGA 2MABA 2YNEA 3OYGA 1OLTA 5H6RA 3H8EA 3BJOA 4UWJA 2P4WA 2Q44A 5EZGA 3OYBA 5FKMA 3D3SA 5H6QA 1YQEA 3OL3A 2XEJA 2ZW7A 3E0KA 5LRGA 1MBJA 9ANTA 5GAEJ 3CD6I 3HSFA 4N4OB 5B66C 1GV5A 3DNSA 2X6OA 4Q7AA 4PUSA 1MBHA 3CJQB 3M3YJ 1XG1A 1RESA 3BR2A 3HZJA 2PFBA 1XJOA 3E5QA 1I1SA 2J9AA 3K4JA 1PYVA 2IGOA 5IT3A 4UUVA 2KP6A 5HXDA 3U1DA 1PVEA 2DT6A 3OYIA 4RAZA 1S7AA 1P7JA 5J6XA 3K4NA 3I55I 3J7ZI 1XOVA 4GFBA 3D68A 1W5TA 1YX3A 4BH9A 4XBFA 3LAPA 1OCOH 4P96A 2PMUA 3KKWA 4NSQA 1FT7A 2LD5A 2Y75A 1OYYA 3I9V2 3NEUA 2ZW4A 4C2UA 2XSJC 4MQ9F 3ZOBA 2VKVA 3GUDA 3DV8A 5FB2A 2YNCA 5CYVA 4DOZA 2LH9A 3JREA 2EFQA 1YFHA 4UIAA 3JRFA 4DJLA 2X7BA 5JM6A 1EH6A 2YX7A 2DLLA 4MEYF 1EA3A 3HHHA 2V1NA 4NNJA 2XRNA 3O6BB 3ZGKA 2BBYA 2HOSA 3LQRA 3JRCA 1O7LA 3KP3A 3RPUA 3S2DJ 1IOIA 2P7VB 3C7JA 3J7YJ 1FOKA 3I9SA 5THWA 2WV0A 4BBHA 4HZFA 3HPGA 3DU6A 4UF4A 3R9FA 2PJPA 1W4MA 1PUAA 3A0HC 3MKLA 4LB5A 1WI9A 4I49A 3J7AO 1S9HA 4N9IA 1OCRH 2PI0A 2GLFA 3R60A 2J5OA 3W6KB 2R5YA 4A3LJ 1S7LA 1WPKA 2IGKA 2VKHA 5DTDA 4B8XA 4CHUA 1YMEA 4RB3C 3HYIA 4HX8A 2WPWA 1H8LA 2PX9A 3BHXA 3B3CA 4CCJA 2DTZA 2PJBA 4UBRA 4AUXA 5IP9J 3OYFA 1UELB 1B4AA 4G8XA 1FSEA 5DDGA 2BOLA 5CVUA 1KZHA 2FMLA 1ZG8A 2JA5J 3JRDA 5KHDA 3KP6A 3S15J 1N71A 2Y69H 3ZQFA 3PFIA 4AB7A 1BJZA 2WTEA 3TDUC 2M4GA 4ZJZA 1NE9A 4F3QA 3G1LA 2BSWA 3TL4X 4E7ZA 5EF6A 4MHZA 1R49A 2WBMA 2EO8A 1MBEA 1LFPA 1Z4RA 1K61A 3DQVC 2PC1A 1IG7A 2Z11A 4KJZA 3AG1H 4II3A 1TF8A 2DEAA 3CPXA 3D4UA 2W4SA 4R8FA 2GIZA 4LMYA 4IHSA 2N8GA 1XEBA 4M3GA 4NC8A 3SEQA 4Q38A 4E6KG 4UV8A 4HOBA 2ZELA 1HC8A 3B3VA 5J8FA 2KFDA 4RB2C 4A12A 4HNXB 4XNHC 1W36C 2DYSH 3OYLA 2NVUB 4B44A 1D1AA 2DA1A 3FYNA 3L2NA 5E96A 4HX7A 2WY8Q 3F22A 2FD5A 4Y49B 1OR7A 1Y9WA 3CCEI 3S16J 2O4HA 3ECHA 1XDUA 2BHYA 2EWBA 2A5YB 3A0BC 3U1KA 5EEAA 4XNFA 2PJ8A 4BMHA 4NB5A 3MZYA 2DW4A 3VB2A 2K4JA 3DKXA 3BZ6A 2WWYA 4NEXA 1LDDA 5GADJ 3QPLA 2JVGA 2EWNA 2EINH 2P5VA 3HG9A 4OADA 2VL1A 2CH0A 4OIPF 1J09A 4M72A 1OBRA 2DQLA 2L9SA 3BI1A 1IRFA 4D5CA 1J4JA 3ABUA 4AU7A 2F2EA 4HDVA 1KUVA 5JI6A 3QRFF 2BXZA 3VH9A 1ACIA 1R1UA 1XIXA 2PJ1A 3K2KA 5DWNA 4MCQA 2K4BA 1IN5A 4HF1A 2NMTA 1UZCA 2C6PA 1IN7A 1KU9A 5HS9A 1QZYA 5C4JJ 3I71A 3V8IA 3OWTA 4JX6A 5TGTA 1XMAA 2VJ5A 3NRVA 3LSJA 3S3NA 2AFSA 1E3HA 5FKKA 1Z2LA 2KKOA 3JCUC 3LSKA 4PSXA 4XLCA 1ZGWA 4KLWA 1KGSA 3DR8A 2DN0A 3R6SA 4FD6A 3B73A 2E34A 2RDPA 1UHMA 4CUGA 3OYEA 1L3LA 1E17A 5LHIA 4XN0A 3J81Z 2RNGA 2PCUA 1TL8A 5K8PA 2DI3A 4KVME 2E36A 2IGNA 4KT5C 3TW6A 4AIKA 1HCRA 4OAZA 1ZLKA 1MMDA 1H89C 2VOPA 4NC7A 3F72A 4ENKA 1JI8A 4G7ZF 1DPRA 4JK1X 1PYTB 3A1YA 2P5KA 1LJ9A 1YR0A 1XSXA 2Y48A 3HSRA 2QQ9A 2IPQX 3K7AJ 3FIXA 4KS9A 3IH3A 5HLHA 1T38A 2HEOA 1ZLIA 1YX0A 5DYMA 4AYBA 1D0YA 2PN6A 2KDZA 4IHTA 3A01A 2IS6A 3FEEA 4LUAA 2I79A 1ETWA 2CW8A 2JBJA 2BEOA 2KMUA 5GAHJ 4YEJA 4EJVA 3HOSA 3CCJI 1A2ZA 4CAXA 4M6YA 1HKQA 4NJRA 1LFBA 4M6XA 2CUFA 2VEZA 1W5SA 3D5SC 1H9GA 1M4IA 4ASNA 1KQ8A 4UVAA 3GLXA 2HKOA 2JRMA 4E7SA 1TLHB 2JUCA 4M9SA 2M3AA 1QHHD 1X58A 3W91A 3H3ZA 4DQ2A 3ZRGA 3L2UA 2JRTA 2W48A 3CF5F 2FU4A 2O61A 1J59A 1ITYA 1MJ9A 4ZYDA 2XKPA 2LFBA 2RAEA 5AONA 4M6IA 1MIJA 5L3BA 2V9VA 3WTSC 3CQZJ 2VONA 1IRZA 1WWZA 3BTCA 5J1YA 1FYKA 4A3CJ 3RO0A 1S3JA 4MQVA 1QSOA 5J4YA 2DA6A 2E1NA 4C3HJ 2FNAA 2J8MA 2ZCWA 3VWEA 2XEGA 2X51A 3PRTA 2HQNA 2GWRA 4XMYA 2VC0A 3T8RA 3FMCA 3F8CA 2Z16A 1SMYF 2CQ7A 3G71I 2OTLI 4CCMA 1YX5A 1RKWA 5ICEA 5M3FJ 4MHGA 1HKTA 4BINA 2LY9A 5E20A 1SAXA 2JA6J 4AVPA 3TO9A 3PO3J 2BGCA 3L09A 1ELLP 1PUFB 5J1QA 1IOFA 1Z8WA 1BIAA 2E19A 1ZG3A 4BXUA 4DBRA 1Z21A 3SFZA 5GCNA 3QU6A 4UVCA 3DGVA 3P9KA 6CPAA 4NGTA 2VBWA 1TWCJ 4OMZA 4L18B 4A37A 4ENJA 3RPQA 1K6YA 3AL0B 2I8DA 4DNCA 4F8ZA 2DK8A 5LBQA 2AJ6A 3FJUA 2FXFA 5EBVA 3UR3C 3V8LA 4XKBA 5B5EC 4U0VA 5FROA 1ZR2A 1HDDC 4L0YB 2PSWA 3T8WA 4JQFA 4AXVA 4NF1A 2UV1A 3S6GA 5G21A 1XMKA 2ZB9A 4B09A 2BYVE 4NGSA 1HSTA 1DTDA 2K5CA 2NYXA 4I7HA 3FF5A 1UAAA 3GLJA 3DU5A 3AG2H 4A3DJ 2BY2A 2HOAA 5K5QA 2DMNA 3SEZA 3KI9A 5IPAA 2DODA 3BJ8A 4RGRA 5HS8A 2LY1A 5IYCJ 1R58A 3G1MA 2ANPA 4XOPA 1IAWA 2G7HA 2PJRA 1MH3A 2LOOA 3LAJA 5HOOA 3QNVA 1RNLA 2LSOA 3LODA 1IN6A 4GGGA 2HYGD 5ERIA 1XPXA 4A93J 1VZ0A 3V7ZA 3JSPA 3MAJA 3TOBA 2VXKA 3SZGA 4MI4A 4BUPA 3SXNA 4JYWA 3G8WA 2J8RA 1XC5A 2IEKA 4FE7A 1USSA 1HW1A 3FK6A 5IOZA 2PJ0A 1R1VA 3LSMA 3KQXA 4FETA 5F1JA 3CC7I 3AG4H 1VQNI 4RGSA 2LP0A 3PP9A 4CAEA 5D5XB 2H6CA 2FOWA 2Z1DA 1SVOA 2DA5A 2ZXWH 2GREA 4E7JA 4NGQA 4HNYB 2Y30A 5H84A 2Q04A 3BI0A 3MKWB 4A69C 2WUUA 2CUEA 2A6TA 4YFNF 1F5TA 2GXAA 2K9LA 1I1GA 4FHTA 4B11A 4M3BA 4BL0B 1PU9A 2IGMA 3GTMJ 1U6GA 5LRKA 5DCFA 1ETOA 2R7VA 4MCPA 1LVKA 2IJZA 2BV6A 5KAIC 4YRVA 2MYSA 4JWPA 4B14A 3FHZA 4A31A 4PJ0C 4H6UA 3TE4A 4XPKA 3K1NA 3KP5A 5BS6A 4KISA 4CGMA 2IS1A 4QLCU 1S72I 3F8KA 4CRZB 4XNHB 3IU1A 4WX9A 5J47A 4KSIA 2JJ7A 1D8JA 2R4GA 4MRIA 3FRMA 4FX4A 4HSRA 1FSHA 1WGXA 1Z0XA 1HF0A 2WAEA 2V6EA 1CX8A 1EH8A 1IN8A 3D7DA 2X1DA 3QU3A 4P4DA 3ISZA 3WU2C 3QQAA 3RQ4A 1MDMA 1NSAA 4EQQA 4DJAA 2BY1A 4V19K 1Y0NA 3GVAA 4PXBA 3SJMA 5AIQA 2Z3MA 5FLVA 1EF4A 1MDMB 2KL4A 2Q0YA 1TQPA 3QYFA 5FRNA 1X4OA 3EXNA 2EIKH 3E0JB 4E7KA 4KUBA 4XLNF 2R92J 3Q0WA 2Z2SB 4MY0A 3C2GA 4EJUA 3OMYA 2KJBA 4BXXJ 2HWVA 1NSLA 3SXOA 5EG0B 4R8HA 3G3SA 4LX9A 2UXXA 5ED4A 2E1MB 1V54H 1X1PA 2CRGA 1J7KA 2PMHA 4ZH4F 1LE8B 2B5GB 2EQRA 1FBUA 4IRGA 2ACJA 4ZYQA 3S2HJ 2CS3A 3VPRA 1LCPA 2D5VA 1MGTA 2EA4A 5JVTA 4MHNA 4UFVA 1EH7A 4H89A 2CUJA 3PSFA 2ZEEA 1XCVA 4P55A 5CKTA 3GKRA 3K10A 5LHHA 2HZTA 1F2PA 4CYCA 2RB7A 4HNWB 1MD0A 4I0BA 1UHSA 4UB8C 3HRSA 3GW2A 2LF7A 5A2QK 3CESA 2VZZA 3HGYA 3WHCA 4A6DA 2H6BA 3EYYA 3HM5A 3OOUA 3QPSA 4JX5A 4XK4A 4ZDLA 4DYRA 1JKOC 1LEAA 1NG6A 3PBBA 3CLOA 3U21A 3T1BA 2XVCA 1JTYA 2M0CA 2DMQA 1M4DA 4UFXA 2DPSA 2E1CA 1WJBA 3ZMTA 2XGEA 4CGOA 4CYPA 4UHTA 1XMTA 3HDDA 3FXMA 2R3SA 1DUXC 4XSZF 2PJ7A 1I39A 3G4SI 4U9YA 1G3TA 3RQIA 4FUUA 5AG7A 1C0WA 2DOFA 4RM3A 3MKYB 3FEDA 3S1NJ 3CCYA 1LVAA 3GO5A 3GYAA 2CGPA 1IW7F 2QMLA 2CW7A 2DT7B 2DDBA 2VASA 2IL4A 2C6GA 1D1CA 1BI2A 2ZENA 4AG9A 3I4NJ 2Q4ZA 3G3ZA 4C3JJ 4HPQA 3GTJJ 4PK2A 4EEFG 1D5YA 4D5FA 3SZTA 3RBUA 2Z3NA 1SC7A 4XR6A 2EZIA 4KOVA 2O9LA 3HIFA 3M7GA 4YIRX 2KJCA 3B6CA 3JTHA 4ETSA 4QPOA 3NH5A 1U0JA 2HC9A 1CQTA 2HV2A 2Q2EB 4NUBA 1FLIA 4R3LA 2FA5A 1A6QA 3N5FA 1IF1A 2PJ2A 1LDKB 4U0WA 1FJLA 3D7HA 3WTWC 4GXHA 5K8NA 1TZLA 2STTA 3GZ6A 4H4KC 3Q0VA 2K9QA 2B58A 4I0AA 4BKXA 2Q43A 4TNUA 4C2ZA 2OCEA 2PDOA 3BQZA 1DGRM 1IRGA 4OMEA 2FIWA 4BQNA 1T39A 3KYDB 1O4XA 4CYQA 3ZMUA 3IV5A 2XROA 5F1RA 4IKFA 2CXAA 1B6AA 2A4NA 1ODDA 3ZPLA 5D8KB 1GHEA 1Z8LA 3IFEA 4UEFA 2A6HF 2FE7A 3R61A 4E7IA 4RS2A 2XGDA 2RC4A 1FIPA 5EEHA 4LJZF 5FD5A 5E3OA 3EUHA 3GY9A 1Z9CA 4UEZA 3BG7A 3GFJA 4AYBN 2F48A 4B3AA 4RGXA 1Y7EA 4I98B 5H86A 4HNVA 4J00A 4NHJA 3KZYA 1JKRC 5DD8A 3H9GA 3QB8A 5HVFA 4DZPA 2VOOA 5M3MJ 1AU7A 2IP2A 3FK7A 2RN7A 2LVSA 2L7MP 1VQPI 4Y49C 2CFOA 3S1MJ 3KHZA 4C9YA 3CDHA 4E7LA 2L7FP 2PVVA 1PJRA 3GBGA 3RYOA 5FO5A 1M1DA 3GTGJ 2YGWA 5AG6A 1AKHA 1EKEA 5CQGA 5EGOA 2HU9A 4M6VA 4HG2A 2Q4YA 1OCZH 3Q0UA 4OU0A 5CVIA 1MJBA 2WAQN 4AIHA 2W85A 1VQ5I 5GPAA 2RREA 4ITVA 1SFEA 3ZQ7A 3K4BA 3LFUA 1U8RA 4BBRJ 3NA6A 1UCRA 4UNOA 4UIBA 2JEWA 3I0TA 2BEIA 4MLOA 2EH3A 4NBQA 2Q8KA 2K5TA 3K2AA 5KTDA 3HUVA 4D0PA 3I56I 3MWMA 4QVTA 1LKXA 2HNHA 1DP7P 3M07A 4UXNA 3KLOA 3QAYA 1R4NB 3S1RJ 2EFNA 2IA1A 2XDVA 4KUMA 3BDDA 1P4NA 4ZTJA 3HPHA 4RAYA 1YLEA 2B0LA 1AKHB 4HV5A 2EPFA 3G73A 3IO1A 2OOTA 1VGYA 4CPAA 4EV0A 4GM5A 4C2YA 1R7JA 1V5EA 2VBQA 4L5EA 3VDXA 1IIDA 3VSLA 1B9NA 1X10A 6PAXA 3S6FA 1VNDA 1VQ7I 3FVLA 3IC7A 1SD4A 4PPZA 2FRHA 4BHCA 4W9YA 2XSDC 2O5RA 3TOAA 5K7FA 2HQYA 3OIPA 5LRRA 1QPIA 3HC7A 2ME6A 2VXDA 4XIDA 1HLVA 4U87A 2MLKA 3JRHA 2KRFA 4XORA 3I1UA 2CFXA 5DV5A 3GIUA 4DYOA 1IDZA 1CPSA 4A5NA 2LNBA 3GYHX 5ILVA 4KSFA 3CMAI 1R6RA 2J8NA 2ZO4A 4PJMA 3Q5FA 5EZHA 2G3AA 3TW7A 3ZQGA 2JVHA 2UXNA 1O57A 2XF6A 4I2OA 1R43A 5CNPA 5I0CA 5EYRA 4KOXA 2F5FA 1BC7C 3JVNA 3K9UA 3SDGA 1CF7A 1NG7A 1SQHA 1XD7A 5LHGA 5F0CA 1Z7LA 4X3RA 3H3UA 4G7HF 3FBIB 3ISPA 1Y0RA 4Q5SF 1U5TB 1DU0A 1I1DA 1CBXA 2JA2A 2HTSA 5F0FA 3MGDA 1A31A 5AG5A 3GLLA 3S14J 2G9DA 2HDWA 3BR6A 5JFRA 2I3CA 4P10A 5LGUA 2Y31A 1YOVB 2FUG2 3WTYC 2MLGA 2VQHA 1ARMA 1RR7A 2F4IA 1FNOA 2A69F 3P7NA 5A27A 3R9GA 4H6ZA 1GHCA 3CUQB 2FSWA 1YW6A 3SI0A 1PP7U 2L3DA 2Z5UA 4I99C 4BE2A 2QIRA 1J2XA 4RAGA 1K4SA 4ESBA 4G12A 3I53A 2ID6A 3EETA 3FXJA 1ZH5A 2R7ZJ 2VPLA 1TW3A 2BVLA 5FD6A 2ZSHB 4KN4X 1Z9UA 2NVQJ 2O3FA 5TJJA 1G3YA 1BR4A 4HF0A 4LLLA 2HQ5A 2MC3A 1N77A 2WC2A 2NVXJ 3W6VA 4YU9A 1IY7A 3RIRA 4PCQA 1V5GA 1SEUA 3FXOA 2E1OA 2EK9A 2L9VA 4V2FA 1F1ZA 4XLHA 3W6JB 2DPUA 2E2JJ 1IYLA 3PFEA 1BW6A 4CS0B 2X85A 4XPLA 2E60A 1MBGA 3D5RC 3HSEA 3K69A 3QWLA 1YTYA 3BJ7A 1ENHA 4MCRA 4HNTA 2W57A 1KUXA 2PG4A 4II9A 3T0YA 4XM3A 3KFWX 3I4PA 2E7XA 3FH4A 2O6GE 1ZTRA 2JQ7A 4NGRA 4A0ZA 3CT9A 4H2KA 3IKVA 2OV7A 3CMMA 3ABMH 3BROA 4A2ZA 1WFXA 2IRFG 4FQGA 2BCOA 2QF7A 5HMNA 2PJ3A 4G1PA 3P5JA 1H8AC 2L9NA 3W3CA 4IX7A 3FX3A 2H1KA 2C27A 4N0BA 4O6JA 5FVJA 1SD6A 1VQMI 1UG2A 3FXQA 4MXUA 2VBYA 3F8FA 5IX3A 3QOPA 4HRIA 4C7HA 4X6AJ 2QLZA 1Q2CA 1P7IA 3CXQA 1RUOA 3GTPJ 5JPHA 4ONUA 1WCMJ 4NQWA 4YIIA 2QECA 4OINF 2HPMA 1X2MA 3WODF 3LD2A 4MGRA 3RYPA 3DPLC 3P2HA 3EUHC 4BJ5C 4ZYEA 3LMSA 3S6KA 2M0MA 3WGGA 4BY1J 2Q4VA 4KZTA 2ELJA 2VI6A 3LSIA 2Y9YA 4P4JA 4EWTA 3HTUA 3ML6A 4P9UA 5EMIA 3RKYA 4DIQA 3HL2A 2YUSA 2NS8A 3OIOA 1U9OA 1KQ0A 1MK4A 2NVTJ 4XRMA 5K7HA 2QJ8A 2VL8A 2EFPA 4IEJA 2X9DA 4LQGA 4Z65A 1IV8A 2CUZA 1ZARA 4D7NA 5LRSA 1XN7A 3KP2A 4MTEA 2E5ZA 2QQ8A 5F6FA 3ZN1A 5HVHA 4HBLA 2V1DA 1Y7RA 1F36A 4ZZLA 4BY7J 1IB1E 5C82A 3EQLF 3M8EA 3LNQA 1ETQA 2X48A 2B63J 1ZGAA 3KR5A 1OPCA 4L8AA 3BOQA 2WAFA 2EA2A 2CV0A 1QMUA 3RZAA 1VKCA 4FISA 4QUSA 2OQRA 3L2VA 5JHFA 4U7DA 1AOYA 5IT9Z 2DMUA 5JLWA 1VHEA 2M7BA 2LREA 1X1AA 2O8XA 5JHUA 4XICA 4HQMA 1H88C 2CJJA 1TKHA 3U2RA 3I58A 1BI1A 3ZR8X 1VQOI 1DQUA 3HOVJ 2AFMA 5DEQA 1G2HA 3Q3SA 4NC6A 4QIWN 1VIXA 4ANJA 4UY8I 3RDIA 1VTNC 4C30A 1G8XA 4HF2A 4CCOA 2Z3PA 4M3DA 4FD5A 4HEA2 4KOUA 4GCVA 1A36A 3D1NI 4X8IA 2BW3B 3WABA 4WXDA 3IIBA 4JZ0A 1YJNI 3GXOA 1X1CA 2CQQA 1YI2I 1DE4C 1ZLJA 2LLKA 4EMEA 2NNYA 5IY5H 1LB2A 1FBQA 1GXQA 2FBKA 5FJ8J 3F23A 3PO2J 3W2VA 2CSOA 1VHSA 3BP8A 1JXSA 4WWCA 1I5ZA 1KYZA 5KAFC 2GQQA 1JWQA 4IAVA 4OAEA 2ODFA 1N75A 5KTAA 3E5UA 3NFZA 1QSTA 2OJED 5D8LB 3BPVA 4A3KJ 1FC3A 1HEEA 4KYWA 4IUSA 4MO7A 4E0AA 1KU2A 1YQAA 2PRQA 2OR4A 1WSUA 4M3SA 4OMYA 2K7LA 5G22A 2JA7J 1ON1A 3ZMSA 1WI3A 5DUIA 4BACA 1QBJA 4AD9A 4CGLA 2Z10A 5JVGF 2FCKA 1YS6A 4K2EA 3JTGA 2DOEA 2KIQA 4O5VA 3ZXSA 3TO7A 5CBMA 3HGGA 3V8JA 1Q1VA 5ICGA 5HODA 3AKZA 2QSGX 4RM2A 2Q7SA 4GYIA 4MFQA 3K70D 3TDZC 2LF8A 3B02A 4L5JA 2XF7A 1YRNA 2D1VA 3F0AA 1QRYA 3TBIA 3R9EA 2H09A 1ZHFA 2FSRA 1POGA 2FBHA 3IP4B 2L0KA 2W24A 2QCOA 2QYOA 4PK4A 3U9GA 4NJQA 5LYDA 3D0SA 2EB7A 3CXSA 1YJWI 1ZRCA 2W00A 3P9CA 1GUUA 2L4AA 1ZG5A 2REFA 4AIJA 4FX0A 2ARHA 1J0RA 4IHWA 2M5WA 3HLPA 2GXBA 2CNTA 4BGDA 2FOKA 1Y9KA 3WGIA 4A5MA 2ETHA 3BZCA 3ZP5A 4RI1A 4R3KA 4A32A 2OC6A 1HKSA 4PGGA 3E5XA 3V7CA 1W7PB 3B2YA 3CDLA 1ZN2A 5K7ZA 2IA0A 3FXKA 4C68A 2WADA 1MSFC 1YW8A 2P6FA 3I3GA 5CJ9A 2K27A 2LK2A 2ZXJA 1KA8A 1FP1D 1R5HA 2EFOA 1J9IA 4Q48A 2ZEMA 5F08A 3JAMZ 1LUJB 1S5KA 3R0JA 2G7UA 2M9HA 4XKVA 3KR4A 5ICCA 2ZEPA 3IJ3A 4X0GA 3CCRI 1YIJI 3D8PA 2HYFA 1Y1VJ 1WJEA 5BPIA 3K4LA 1B1BA 3JAMK 1LEBA 2CIJA 4CCKA 2OTJI 3CTAA 1ZREA 1YVKA 4EGYA 3A03A 3J80Z 5BPDA 5L3GA 4Y3OA 1W7PD 2JLMA 4MIMA 2V8HA 1F43A 1ZG7A 2CU7A 2E35A 2MSYA 2UZKA 2XEFA 3LACA 2ESNA 2MC4A 3TFYA 3E7LA 3BCAA 1RKTA 1BI0A 4XLAA 4S05A 1K78B 2VI7A 2W1OA 3KGQA 2FMYA 1KWMA 3EDPA 3PB4X 3O8HA 1XGMA 3OWCA 4G6TB 1Y0YA 3PB6X 3T5XA 4OIQF 1UWYA 1QSMA 2DFFA 2B7EA 4R9MA 4CYDA 3DXJF 3V7RA 4FE4A 4XRSG 2VE8A 3HUGB 2R7TA 2COMA 1FNNA 3FMQA 2E5NA 1XGNA 3ZMVA 5D4RA 2ESHA 4XKWA 3M8JA 4IJAA 2Z33A 2UWMA 2PJ4A 5A28A 2H1LA 3SI2A 3GZNB 3O2PE 4HW0A 2BE5F 1RPWA 1OZPA 2L54A 2YR2A 4P4BA 3WG9A 2NNNA 4Y7NJ 3GFIA 3IWFA 1FP2A 2TRTA 3I64A 4CCNA 3IH4A 3CCMI 2O8KA 2RGVA 1YREA 2ZKZA 3KZIC 1Y8QB 4Y52J 4PFPA 4WXCA 1IXRC 3SI1A 2E2IJ 1OCPA 5B1BH 2OH1A 5TRDA 3RAMA 1UB9A 2ZC2A 2CNMA 2DFEA 1MBKA 2P6EA 1LDJA 4NXYA 2OUMA 3VWBA 4JD6A 2Y9ZA 2DPTA 3H5RA 1MSEC 1BL0A 3VARA 3WR7A 1AWCA 5M5YJ 4A3FJ 4QB9A 3SFIA 2E2HJ 2B4DB 4JXQA 2YPRA 4A38A 4XPDC 3S9NA 1D1BA 2QZ8A 4NGNA 1QZZA 3SQNA 1Y6IA 4PJJA 1FMWA 1WH5A 2CMPA 3VYRB 2GM4A 2JPBA 1EJ9A 4PJNA 2DO7A 2JZYA 3DP7A 1XMBA 2ZXVA 2OA4A 4M85A 4XPDB 5HVQC 3I3LA 3R1KA 4J01A 3PEIA 5LGTA 2MBFA 3FWEA 4GXOA 4EVIA 1BC8C 4UB6C 1ZAOA 5HS7A 1X1BA 5E3NA 1S5LC 1GYTA 2HR3A 3EO4A 3IGRA 1OJLA 5BWAB 2DTRA 3DTKA
chains in the Genus database with same CATH topology
3HKZA 2GANA 1X1DA 5HH1A 2Z3NA 4XR6A 4CH7A 4KOVA 5EC4A 2LC2A 2CV1A 3K4MA 4QPOA 1U0JA 4FASD 2HV2A 4KOYA 2M4KA 2Q2EB 4NUBA 4R3LA 3OYDA 1LDKB 2R7HA 4XL9A 1HA8A 1TZLA 1MJAA 1DGWY 2MD0A 2VIXA 1U6MA 3F9KA 3K4CA 4H4KC 3CF2A 3W2AA 2JDDA 4A33A 2B58A 4MFZA 5CPRB 4CA0A 2V9KA 2MABA 2YNEA 3OYGA 1OLTA 3DEEA 2PDOA 4UWJA 4C2ZA 2E1MC 1DGRM 3K6GA 3SHPA 2OU2A 2FIWA 2Q44A 4BQNA 2R7WA 3OYBA 3DDDA 3IAM2 4CYQA 3D3SA 2ZW7A 3E0KA 3OL3A 2XC7A 4IKFA 2CXAA 1QU3A 2A4NA 2HVQA 2VQYA 4ZGYB 2W7NA 3H4QA 4MJ8A 4LG3A 4N4OB 3C2HA 2MFZA 4E4HA 5HNHA 3DNSA 4PUSA 4C2XA 1GHEA 4CGPA 3CJQB 4XLEA 3OR2C 2BW3A 4B5OA 2FE7A 2Z3KA 4E7IA 4RS2A 2RC4A 3K4JA 1PYVA 4BQOA 2IGOA 2KP6A 3GY9A 4OWRB 2DT6A 3BG7A 3OYIA 2KCWA 2WY7Q 4DBQA 5H86A 3LSGA 4PK3A 3K4NA 2JEVA 3H9QA 4J00A 4KVXA 3H9GA 3QB8A 1YX3A 3LSHA 2R1IA 4KLVA 3MMYB 4CRYB 3DR6A 1W36D 3KKWA 4ZC3A 4Y49C 2CFOA 4NSQA 1D0ZA 4C9YA 3DWLE 4E7LA 2BVMA 1L0CA 3I9V2 1PJRA 2DJIA 3GBGA 3S3MA 1UFHA 4C2UA 2XSJC 4ZTFA 2ZW4A 1M1DA 3RYOA 3S3OA 2OZGA 2YGWA 5AG6A 2YNCA 4DOZA 2IS2A 2LH9A 5CQGA 2L2OA 1GLNA 2VQGA 4JLYA 2HU9A 5KTCA 4HG2A 2Q4YA 1EA3A 2V1NA 4NNJA 3ZGKA 2Q7BA 1MJBA 2RREA 4ITVA 4IQ4A 4IF5A 3K4BA 3LFUA 4BJTA 3RTRA 3I9SA 4KOTA 2BEIA 4BBHA 4MLOA 3FBNB 2F6CA 3DU6A 3HPGA 3R9FA 4B13A 1PUAA 4BXFA 3BC8A 2K5TA 4I49A 5KTDA 4XKCA 1S9HA 4MFKA 3ZJ0A 1S7LA 4ZDOA 3F5BA 4QVTA 1M44A 3QYEA 1LKXA 2IGKA 2HNHA 2VKHA 2R7UA 4N4NB 4C7IA 3PL8A 3PJRA 4BQQA 4CAVA 2KLOA 2XDVA 1I21A 1KUYA 1P4NA 4RLFA 2I00A 4KITB 4ZTJA 4XLFA 3HPHA 2WPWA 1YLEA 4CCJA 4UBRA 5F46A 1T0FC 3OYFA 1UELB 3ZCOA 3S8PA 4C2YA 1V5EA 2VBQA 2X1EA 3VDXA 1IIDA 1SAUA 3VSLA 2BOLA 3W2WA 4X5KA 2Z0ZA 3FXTA 3S6FA 2VKDA 2DXQA 5KHDA 1X4PA 1N71A 3PNTA 4E8OA 3JUWA 2O5RA 3TOAA 4AB7A 2HQYA 2R7OA 3OIPA 4KSAA 4PV6A 2M4GA 4ZJZA 1NE9A 3HC7A 2VXDA 4C2TA 4MFLA 4U87A 3H9JA 4XORA 4F3QA 3T90A 2BSWA 3TL4X 3PUBA 4E7ZA 2F5IA 2JDCA 2WBMA 5DWMA 2PJRB 2R7QA 4EVYA 1LFPA 1Z4RA 1BO4A 3DQVC 3OYKA 2PC1A 2UUZA 2Z11A 4KJZA 4II3A 3BLNA 4KSFA 5F49A 2ATRA 2W4SA 4CYOA 1R6RA 2J8NA 1N78A 1MW7A 4PJMA 2G3AA 4B47A 2EUIA 2JVHA 5CNPA 2XF6A 4HSTA 2X6XA 1XEBA 5I0CA 4NC8A 3SEQA 4KOXA 4Q38A 3JVNA 4E6KG 3K9UA 1NG7A 5J8FA 4BDZA 4HNXB 4U7BA 4XNHC 1W36C 3OYLA 1Z7LA 2ZFUA 3H5NA 4B44A 1D1AA 3DPTA 3FBIB 3FYNA 4Q36A 2VJJA 5E96A 2WY8Q 4XONA 2V7FA 3H0DA 4Y49B 1Y9WA 1OR7C 2GOMA 4BMHA 1I1DA 4XNFA 1ERDA 1Q2YA 2JA2A 3S93A 1SQHA 3MGDA 1BR2A 4K30A 5AG5A 3DKXA 3TO6A 2HDWA 1YK3A 4B12A 1MMGA 4NEXA 2Y0SA 3TTHA 2FUG2 2H5MA 4RLQA 2VQHA 5A27A 2JVGA 2F4IA 3HG9A 4OADA 2CH0A 3CP8A 3W6XA 3IWGA 3R9GA 4H6ZA 1J09A 1QSRA 2QIRA 3VWDA 2L9SA 4BE2A 2KDOA 1CJWA 3C26A 2DXIA 1J4JA 3HXLA 2JUGA 3DKYA 3D5LA 4AU7A 2PR1A 2FT0A 1KUVA 1G59A 2BVLA 2VPLA 2ZSHB 3KX2A 1Z9UA 4IQJA 1XIXA 2ZSIB 3K4KA 1BR4A 2Q1ZB 5G20A 4CYNA 2NMTA 1N77A 3DTIA 4U9ZA 4KT6A 3T9YA 3D2MA 4L89A 2YNDA 3V8IA 3OWTA 4CCLA 5TGTA 2VJ5A 3S3NA 1V5GA 1RXTA 2HUZA 4EATA 4BS9A 4XLCA 3A4CA 3LSKA 4PSXA 4KLWA 3DR8A 1I12A 4F0XA 2XAUA 4XLHA 4FD6A 4MFPA 4CUGA 3OYEA 1IYLA 2AE6A 3RSNA 4JXRA 4CS0B 2WAQA 2X85A 4XN0A 4B5PB 4XPLA 2E60A 1KONA 2RNGA 3D5RC 3BJ7A 4CSWA 4II9A 4HNTA 3PNYA 1KUXA 1S60A 2LRDA 1TT0A 2ZXHA 2KRCA 4XM3A 2Z3OA 4KVME 4OLLA 2IGNA 3V42A 3KYLA 4OAZA 1KZFA 4PJLA 2OV7A 1MMDA 3CMMA 3JTKA 4A2ZA 4AG7A 4NC7A 1WFXA 1JI8A 3IAS2 4FD4A 3A1YA 3CZ6A 1M4GA 1YR0A 3FNCA 5HMNA 1MMNA 3OS2A 2L9NA 3W3CA 3EUAA 4IX7A 3R96A 2C27A 3RCOA 2KZVA 3BG6A 3FIXA 3TT2A 4KS9A 5FVJA 2R7XA 1YX0A 2IS4A 4AYBA 1D0YA 3EPZA 5FRMA 2WSAA 2IS6A 3FB3A 4LUAA 5HNFA 5IX3A 4HRIA 4C7HA 3N7ZA 1YE9A 1Z3XA 1WK4A 2CW8A 2I79A 1Q2CA 4AVAA 3FKJA 2KMUA 3FHNA 1Z4EA 2X1CA 4YEJA 3CXQA 5JPHA 3HOSA 4ONUA 4CAXA 2QECA 3LD2A 4MY3A 1SFKA 2HPMA 4J3GA 1V5FA 4GS4A 1DP3A 1MMAA 3DPLC 1AA7A 2VEZA 3P2HA 3EUHC 3FDYA 4BJ5C 3PZJA 3D5SC 4QC6A 3S6KA 2M0MA 1M4IA 1XE4A 4D9JA 2Q4VA 4KZTA 4R87A 4NQWB 2ELJA 4YGOA 3PSIA 3P2FA 3A9LA 4E7SA 3LSIA 2REEA 2D4OA 2M3AA 1QHHD 4DIQA 3W91A 3HL2A 3L2UA 1V0CA 3ZRGA 2LY2A 2WPXA 2L5QA 1S7KA 1MK4A 1MJ9A 1P0HA 1Z3YA 2ZPAA 2VL8A 4LIUA 1UG0A 2CNSA 2RQQA 2CUZA 1WWZA 1LRZA 2PR8A 2X7BA 1X19A 2G3TA 5LFAA 3QAHA 2ZW6A 4B5PA 4BE1A 2E5ZA 3OY9A 1QSOA 1Y7RA 1IRXA 1IB1E 5C82A 2KQRA 3TMOA 2J8MA 2GOXB 4MFJA 3VWEA 2X51A 4L8AA 3IUOA 2WAFA 2FIAA 2CV0A 2GE3A 4XMYA 2P0WA 1VKCA 2EVNA 2G0BA 4QUSA 3L2VA 5JHFA 2Z16A 2B5GA 4ZBGA 4II2A 2JSPA 3QODA 1D0XA 4CCMA 4R79A 1YX5A 2M7BA 2LREA 1X1AA 2VB6A 4B3XA 2KRHA 2F5VA 4B43A 5LD2C 1QSNA 4F91B 4AVCA 2PMZA 2B4DA 3TO9A 3ZR8X 5JQ4A 1DQUA 5F48A 3R95A 4HNUA 5G1ZA 2DOAA 2VQLA 4AVZA 4ANJA 4CGOA 3B8GA 4C30A 2R8VA 4CGNA 1G8XA 2XF5A 2NOJB 3BLYA 1Z21A 4CCOA 4DBRA 2Z3PA 4HEA2 4FD5A 4KOUA 5GCNA 2K9MA 2YNCC 4BDYA 3EC4A 2BW3B 3EY5A 4CRZB 5AGEA 1X1CA 5KNLA 4HKFA 3LMMA 3OYMA 4FD7A 4KVOE 1K6YA 3AL0B 3PGPA 1BOBA 4UCNA 2I8DA 4DNCA 1VHSA 3W2VA 3VSKA 2VJIA 1FMVA 2AJ6A 4OAEA 2FXFA 5EBVA 3UR3C 1N75A 3N05A 5KTAA 4XKBA 3ONQA 1QSTA 4YFJA 3CXPA 5FROA 5ISVA 4IUSA 1S3ZA 2PSWA 4E0AA 4JQFA 2O28A 4NF1A 3FBUA 2UV1A 1FY7A 4ORFA 3S6GA 5G21A 4M3SA 4KUAA 5G22A 2X6YA 2DCEA 1R57A 3L2WA 3G2BA 2K5CA 4BACA 4XN3A 1IICA 1UAAA 2OZHA 3DU5A 2Z10A 2FCKA 4CGLA 5IV0A 3ZXSA 3TO7A 2QKMB 3SEZA 3AKZA 3HOTA 4RM2A 3KEYA 3MD2A 3ZQQA 3BJ8A 4XOTA 3K70D 3DSBA 4MFQA 3DPUA 3F0AA 2LY1A 2XF7A 1S7NA 4BJ6C 3TBIA 1RO5A 3OS0A 3R9EA 4LITA 4XOPA 4A30A 2PJRA 2FSRA 1IYKA 2D4PA 4A95A 2LOOA 1YGHA 4BEHA 3EUKL 3OR1C 4P1WA 5HOOA 4F6AA 4BU2A 3IP4B 2R7SA 3LODA 3E1SA 1BR1A 3W6SA 1XF8A 1VZ0A 2W82A 3CJRB 2R7RA 3TOBA 4PK4A 2VXKA 3SZGA 4MI4A 4BUPA 3CXSA 3SXNA 4IZZA 2W00A 3G8WA 3H5AA 2J8RA 2REFA 2ARHA 2VQCA 3NWSA 3SYTA 4ZYAA 3OL4A 2CV2A 2CNTA 4BGDA 1Y9KA 3LSMA 4FETA 2A5WA 2ZXIA 3OYCA 1YVOA 3PP9A 4RI1A 4CAEA 4A32A 4R3KA 4JXQA 2OC6A 2LBFA 4UCMA 4CAFA 2Z1DA 2HQAA 1WJAA 3LL7A 4E7JA 3S32A 3OYAA 4HNYB 5H84A 2Q04A 1T95A 4C68A 2HVSA 2HZDA 3MKWB 2WUUA 2Y0MA 2A6TA 4NCZA 2WADA 2P6FA 3I3GA 2K9LA 4UWIA 1MNDA 4LIVA 2ZW5A 2LG4A 4BL0B 3L2RA 2IGMA 1PU9A 4B11A 4UCPA 4QBJA 1ZO0A 4Y33A 3SDBA 1S5KA 4MBUA 5AG4A 2HPIA 2IXSA 2R7VA 1LVKA 2QKLB 4XKVA 4P5OA 4YRVA 2MYSA 2AQEA 1ZELA 2P6GA 4JWPA 4F92B 2GIVA 4B14A 2K3PA 4A31A 4F55A 4H6UA 4X0GA 3TE4A 3AFHA 4E7HA 2FS5A 3D2PA 3A2KA 3VYTB 3D8PA 4KISA 4XPKA 1WJEA 3MKZA 4U5YA 2VJ4A 2IS1A 3K4LA 4CGMA 3PFYA 5HLTA 4CCKA 1E0EA 4QPQA 2VXZA 2Z3LA 2PQ8A 3F8KA 4XNHB 4CAWA 2X6WA 4ZDPA 2L7KA 3IU1A 2BL1A 2LBFB 1YVKA 4UFWA 2R4GA 3FRMA 4UA3A 4HSRA 4Y3OA 3QYBA 3OIQA 2KHMA 2JLMA 2WAEA 2V6EA 2X1DA 3OS1A 4Y4RA 3TCVA 3EFAA 4AVBA 2MC4A 3VYUB 3ZZIA 4B10A 3RQ4A 1S7FA 2WB1A 3TFYA 3UY5A 3BCAA 4DJAA 2VZYA 4KOSA 3QOEA 4XLAA 2VI7A 2W1OA 2Z3MA 3H5ZA 2V4JC 2Q0YA 2KL4A 4G6TB 3IWEA 3OWCA 3QYFA 4JJXA 5FRNA 1X4OA 1NMTA 1QSMA 3EXNA 3NE7A 4MHDA 3E0JB 4E7KA 3J7AY 4KUBA 4R9MA 1WJ5A 2KPMA 2Z2SB 4MY0A 3C2GA 1TIQA 3OMYA 3HUGB 4BEHB 3K70C 2R7TA 1NSLA 3SXOA 2E5NA 3RPUD 3G3SA 4KORA 4LX9A 1ON0A 4RMNA 2E1MB 4XKWA 3M8JA 5DWNA 2UWMA 2B5GB 5A28A 3PNVA 1P9QC 2M7AA 2B3VA 4BE0A 2CS3A 1OZPA 1K4JA 1B87A 2CY2A 2OB0A 5J8CA 3UNGC 4UFVA 2AQFA 2B4BA 4H89A 2CUJA 3PSFA 4CCNA 2LYCA 3DLAA 2WA0A 5CKTA 1YREA 1MNEA 2V26A 3GKRA 3K10A 4HNWB 4PFPA 2VLAA 5IB0A 3NWTA 4F93B 3OYNA 3DTEA 2OH1A 4E2AA 4YELA 3H35A 2B3UA 1WJFA 2CNMA 3CESA 2P6EA 4NXYA 1QHGA 2OUMA 3VWBA 4GRIA 4OAYA 2DPTA 3H5RA 2VZZA 3IU2A 4ZDLA 3OOUA 4JD6A 5F47A 4XQFA 3WR7A 2HVRA 4DGWB 3OYHA 1NG6A 2R98A 1Y56A 4CZCA 3AL0C 3U21A 3S6HA 4R57A 4QB9A 1M4DA 2OZUA 5C88A 4KOWA 2B4DB 4UFXA 3BCBA 1Q2DA 3CP2A 1WJDA 1WJBA 4JOMA 4PFOA 5CQEA 2DPSA 4PSWA 1XMTA 4CYPA 4XPDC 1D1BA 3L2QA 1Y6IA 4PJJA 1FMWA 2BUEA 4U9YA 3VYSB 2CMPA 3VYRB 4D1QA 4PJNA 5AG7A 3M1CA 2FL4A 4RM3A 3MKYB 5KCMA 2PRBA 4YRHA 2ZXVA 4XPDB 4M85A 5HVQC 3I3LA 4B48A 3GYAA 3R1KA 4J01A 1WJCA 2QMLA 2CW7A 2DT7B 4F0YA 2VASA 2IL4A 1D1CA 1X1BA 3EO4A 4AG9A 3IGRA 4F52A 5BWAB 1CM0A 3OYJA 4HPQA 3DTKA 1B6BA 4PK2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GAN A;  5HH1 A;  4KOV A;  5EC4 A;  2HV2 A;  4R3L A;  4KOY A;  2R7H A;  1U6M A;  1MJA A;  4MHD A;  2JDD A;  2B58 A;  2PDO A;  4UWJ A;  3SHP A;  2OU2 A;  2FIW A;  2Q44 A;  3DDD A;  3D3S A;  2ZW7 A;  3E0K A;  2A4N A;  2VQY A;  3H4Q A;  4MJ8 A;  3DNS A;  1GHE A;  4B5O A;  2FE7 A;  4RS2 A;  2RC4 A;  3GY9 A;  2KCW A;  5H86 A;  4PK3 A;  2JEV A;  4KVX A;  3QB8 A;  2R1I A;  4KLV A;  4CRY B;  3DR6 A;  3KKW A;  4Y49 C;  4NSQ A;  1L0C A;  2ZW4 A;  1UFH A;  3RYO A;  1M1D A;  2OZG A;  4JLY A;  5KTC A;  2Q4Y A;  2Q7B A;  1MJB A;  4IF5 A;  3I9S A;  4KOT A;  2BEI A;  3R9F A;  1PUA A;  2K5T A;  4I49 A;  5KTD A;  3ZJ0 A;  1S7L A;  3F5B A;  4QVT A;  1M44 A;  4CAV A;  1I21 A;  1KUY A;  1P4N A;  2WPW A;  2I00 A;  1YLE A;  4UBR A;  2VBQ A;  1IID A;  4X5K A;  2Z0Z A;  3FXT A;  3S6F A;  2DXQ A;  1N71 A;  4E8O A;  3JUW A;  3TOA A;  4AB7 A;  2HQY A;  4PV6 A;  1NE9 A;  2BSW A;  2JDC A;  2F5I A;  5DWM A;  4EVY A;  1Z4R A;  1BO4 A;  2PC1 A;  3BLN A;  2Z11 A;  5F49 A;  2ATR A;  2J8N A;  2G3A A;  2EUI A;  5CNP A;  1XEB A;  5I0C A;  4KOX A;  3JVN A;  3K9U A;  5J8F A;  4HNX B;  4XNH C;  3FYN A;  5E96 A;  4Y49 B;  1Y9W A;  4BMH A;  1I1D A;  1SQH A;  1Q2Y A;  3MGD A;  4K30 A;  3TO6 A;  1YK3 A;  4NEX A;  3TTH A;  2H5M A;  4OAD A;  3W6X A;  3IWG A;  3R9G A;  4H6Z A;  1QSR A;  2QIR A;  3VWD A;  1CJW A;  3C26 A;  1J4J A;  2PR1 A;  2FT0 A;  1KUV A;  1Z9U A;  1XIX A;  2NMT A;  4U9Z A;  3T9Y A;  3D2M A;  4L89 A;  3V8I A;  1RXT A;  2HUZ A;  4PSX A;  4KLW A;  3DR8 A;  1I12 A;  4FD6 A;  4JXR A;  1IYL A;  2AE6 A;  4CS0 B;  4B5P B;  4XPL A;  3BJ7 A;  4II9 A;  1KUX A;  1S60 A;  4OLL A;  4KVM E;  1KZF A;  4AG7 A;  4FD4 A;  1M4G A;  1YR0 A;  3FNC A;  5HMN A;  3R96 A;  2C27 A;  3FIX A;  5FVJ A;  1YX0 A;  3FB3 A;  4LUA A;  5IX3 A;  3N7Z A;  4AVA A;  2I79 A;  1WK4 A;  1Q2C A;  1Z4E A;  3CXQ A;  5JPH A;  4ONU A;  4CAX A;  2QEC A;  3LD2 A;  4MY3 A;  4J3G A;  4GS4 A;  2VEZ A;  3P2H A;  3PZJ A;  4QC6 A;  3S6K A;  1M4I A;  1XE4 A;  4R87 A;  2Q4V A;  4KZT A;  4YGO A;  3P2F A;  2REE A;  2D4O A;  3W91 A;  1V0C A;  2WPX A;  1S7K A;  1MK4 A;  1MJ9 A;  1P0H A;  2ZPA A;  2CNS A;  2PR8 A;  1WWZ A;  1LRZ A;  2X7B A;  3QAH A;  2G3T A;  2ZW6 A;  4B5P A;  1QSO A;  1Y7R A;  1IB1 E;  5C82 A;  2J8M A;  3VWE A;  4L8A A;  2FIA A;  2GE3 A;  2P0W A;  1VKC A;  4QUS A;  2EVN A;  2G0B A;  2B5G A;  4ZBG A;  1QSN A;  2B4D A;  3TO9 A;  5JQ4 A;  5F48 A;  3R95 A;  3B8G A;  2R8V A;  4FD5 A;  4KOU A;  5GCN A;  3EC4 A;  3EY5 A;  4HKF A;  4FD7 A;  4KVO E;  3PGP A;  1BOB A;  4DNC A;  1VHS A;  2AJ6 A;  4OAE A;  2FXF A;  5EBV A;  5KTA A;  1QST A;  4YFJ A;  3CXP A;  5ISV A;  4IUS A;  1S3Z A;  2PSW A;  4E0A A;  2O28 A;  4NF1 A;  3FBU A;  1FY7 A;  4ORF A;  3S6G A;  4M3S A;  4KUA A;  1R57 A;  1IIC A;  2OZH A;  2Z10 A;  2FCK A;  5IV0 A;  3TO7 A;  3BJ8 A;  3DSB A;  3F0A A;  1S7N A;  1RO5 A;  3R9E A;  2FSR A;  1IYK A;  2D4P A;  1YGH A;  4F6A A;  3LOD A;  3W6S A;  1XF8 A;  3TOB A;  2VXK A;  4MI4 A;  3CXS A;  3SXN A;  3G8W A;  2J8R A;  2REF A;  2ARH A;  2CNT A;  1Y9K A;  1YVO A;  3PP9 A;  4RI1 A;  4R3K A;  4HNY B;  5H84 A;  2Q04 A;  4NCZ A;  2Y0M A;  2P6F A;  3I3G A;  4UWI A;  2ZW5 A;  4QBJ A;  1PU9 A;  1S5K A;  4MBU A;  2P6G A;  4JWP A;  2GIV A;  4H6U A;  3TE4 A;  3D2P A;  2FS5 A;  3D8P A;  4XPK A;  3T90 A;  4U5Y A;  3F8K A;  4CAW A;  2PQ8 A;  4XNH B;  4CRZ B;  5F46 A;  2BL1 A;  1YVK A;  3FRM A;  4UA3 A;  2JLM A;  3TCV A;  3EFA A;  4AVB A;  3ZZI A;  1S7F A;  3TFY A;  3UY5 A;  2VZY A;  4KOS A;  2VI7 A;  2Q0Y A;  3OWC A;  4JJX A;  4AVC A;  1NMT A;  1QSM A;  3EXN A;  3NE7 A;  4KUB A;  4R9M A;  4MY0 A;  1TIQ A;  1NSL A;  3SXO A;  3G3S A;  4KOR A;  4LX9 A;  1ON0 A;  5DWN A;  2B5G B;  2B3V A;  1OZP A;  1K4J A;  1B87 A;  2CY2 A;  2OB0 A;  5J8C A;  2B4B A;  4H89 A;  1YRE A;  3GKR A;  4HNW B;  5IB0 A;  2OH1 A;  4E2A A;  2B3U A;  2CNM A;  2P6E A;  4NXY A;  2VZZ A;  4JD6 A;  3TT2 A;  5F47 A;  3WR7 A;  2R98 A;  3S6H A;  4R57 A;  4QB9 A;  1M4D A;  2OZU A;  5C88 A;  4KOW A;  2B4D B;  1Q2D A;  4JXQ A;  4PSW A;  1XMT A;  4XPD C;  2BUE A;  4U9Y A;  2FL4 A;  2PRB A;  4YRH A;  2ZXV A;  4XPD B;  4M85 A;  3GYA A;  3R1K A;  2QML A;  4F0Y A;  2IL4 A;  3EO4 A;  4AG9 A;  3IGR A;  1CM0 A;  1B6B A;  4PK2 A; 
#chains in the Genus database with same CATH topology
 3HKZ A;  2GAN A;  2OBP A;  3IRQ A;  3DLJ A;  2AO9 A;  4WJB A;  5EC4 A;  1JE8 A;  1DDN A;  4BYY A;  1YLF A;  4FAS D;  4IHX A;  1BM9 A;  4KMU X;  1BW5 A;  3CUO A;  5EJC A;  2V8G A;  2A05 A;  2XEI A;  4PGH A;  1HA8 A;  1MJA A;  4LD5 A;  2NAZ A;  3ISX A;  2ME0 A;  3WE3 A;  3S17 J;  2DU9 A;  4MFZ A;  2W25 A;  2V9K A;  2EBJ A;  2EBI A;  2E1M C;  3F8N A;  3K6G A;  4NGM A;  2JMW A;  2OU2 A;  1GVJ A;  2R7W A;  4MMO A;  3L2C A;  1HBX G;  4OC4 A;  2O0Y A;  5FGM A;  2XC7 A;  1P4W A;  4I6Z A;  1QU3 A;  2HVQ A;  2XAG A;  2VQY A;  4RB1 A;  2W7N A;  3H4Q A;  4M6H A;  1B9M A;  1IO2 A;  2MGQ A;  2Z3Y A;  4LG3 A;  2MFZ A;  4C2X A;  4XLE A;  1CGP A;  2BW3 A;  4B5O A;  3DBL B;  1ORK A;  3BQY A;  5EEG A;  5LEJ A;  1W0T A;  2R5Z B;  4QWQ A;  3F6O A;  4UUS A;  2JSC A;  4DBQ A;  4OC5 A;  4PK3 A;  1GDT A;  2JEV A;  3H9Q A;  2CQX A;  5D29 A;  3LSH A;  4KLV A;  3HJE A;  3DR6 A;  1Y39 A;  1Y1W J;  1W36 D;  1LAP A;  4ZC3 A;  4TV7 A;  5JLX A;  3TX8 A;  4JX4 A;  2IMO A;  2XAQ A;  1T08 B;  2V1X A;  2XGX A;  2BVM A;  3GCM A;  1SVL A;  3IHU A;  5GTI C;  2DJI A;  4FTH A;  3S3M A;  1G3W A;  3M9A A;  1UFH A;  4ZTF A;  2OAZ A;  3S3O A;  2ID3 A;  3F6V A;  2OZG A;  2V9P A;  3NAU A;  2IS2 A;  2L2O A;  2VQG A;  4JLY A;  2EV6 A;  1UST A;  1HW2 A;  2HOE A;  4IQ4 A;  3LSP A;  3PM1 A;  4IL6 C;  4FBE A;  1CPX A;  4X2T A;  4BJT A;  4IXA A;  4UVB A;  4LG0 A;  3KHX A;  4KOT A;  1HSJ A;  2QQA A;  3FBN B;  3FIS A;  4Y15 A;  2DBB A;  2FF4 A;  4PDK A;  1VQK I;  3WU1 B;  1U2W A;  3I54 A;  3D67 A;  4XKC A;  4MFK A;  3ZJ0 A;  4AC0 A;  1X2N A;  2STW A;  2ZEH A;  3QYE A;  2R7U A;  3FMS A;  3S9M A;  4C7I A;  3PL8 A;  4BQQ A;  3CUQ A;  2KLO A;  4CAV A;  1ON2 A;  4ZY0 A;  5DUK A;  4RLF A;  2I00 A;  4R6T A;  4XLF A;  2L02 A;  3F8B A;  2CW0 F;  3TGN A;  2EFW A;  4A3B J;  2QYV A;  1T0F C;  3ZCO A;  3V7S A;  1X3W B;  1M1E B;  3W2W A;  1SFO J;  2Z0Z A;  4X5K A;  4RBO A;  1FEX A;  2VKD A;  1R71 A;  2DXQ A;  1S29 A;  1X4P A;  1U8B A;  1MNM C;  1VQ6 I;  4GO1 A;  5HDK A;  4ABZ A;  3LQQ A;  3JUW A;  4UEE A;  4LOC A;  2R7O A;  2IBD A;  2TDX A;  5D6E A;  1XX5 A;  5F04 A;  3DBH B;  3BG9 A;  3H9J A;  1FTZ A;  5K5R A;  3PUB A;  2F7V A;  3ELK A;  4L5I A;  5DWM A;  2PJR B;  4EVY A;  4OKO A;  1FX7 A;  1OKR A;  3FMR A;  3OYK A;  3RKW A;  4A3I J;  1BO4 A;  2RVC A;  4GYG A;  4I02 A;  1X12 A;  4OC2 A;  5F49 A;  2ATR A;  1N78 A;  3E6B A;  1VHO A;  1BBY A;  2G0E A;  4OC0 A;  2L7Z A;  4X1E A;  3V8K A;  2X6X A;  2KIU A;  3IWZ A;  3CC2 I;  2WYR A;  3DEU A;  5GPC A;  3A01 B;  1U3E M;  4U7B A;  5D5U B;  1IGB A;  5DD4 A;  4JP0 A;  2ZFU A;  2KIM A;  5IP6 A;  3DPT A;  3FX6 A;  1HW5 A;  4Q36 A;  3H0D A;  2ZME B;  1FWZ A;  1OR7 C;  3HHG A;  1P92 A;  1XCB A;  2EJR A;  2GOM A;  2IA2 A;  4YG2 F;  3E3V A;  3BR0 A;  3S93 A;  3H1C A;  4EMS A;  4AID A;  5EG0 A;  1ERD A;  1Q2Y A;  3WC6 A;  3FZV A;  3TO6 A;  5L3C A;  4B12 A;  2YSR A;  2Y0S A;  5BNG A;  3TTH A;  2D45 A;  2GXG A;  4W97 A;  2EZL A;  3CP8 A;  2KIF A;  3IWG A;  3RZO J;  3CME I;  1QSR A;  3VWD A;  2EIJ H;  2ABZ A;  1CJW A;  1Z8X A;  2EK5 A;  3ASN H;  4EM0 B;  3LWU A;  2EIL H;  2JUG A;  4EM1 A;  2PR1 A;  4HPS A;  1OYW A;  4DW6 A;  3KYC B;  3COA C;  2HDD A;  2NOG A;  3AAF A;  2ZJP F;  3GB0 A;  4RS8 A;  1R36 A;  1YRN B;  3K4K A;  2Q1Z B;  3CCS I;  4CYN A;  3DTI A;  3ZQL A;  4KT6 A;  4U9Z A;  3T9Y A;  1S6L A;  3FIW A;  3B3T A;  3D2M A;  4L89 A;  1IDY A;  2XAS A;  5JH9 A;  1P2F A;  3S9L A;  1RXT A;  2F4M B;  3JW4 A;  2F4O B;  4EAT A;  1QZE A;  4BS9 A;  4KA4 A;  1SD7 A;  3A4C A;  2LKP A;  3LSR A;  2DJN A;  4YFX F;  1G4D A;  5H2F C;  3G6E I;  4KNY A;  1IGN A;  3C2B A;  4MFP A;  1OYI A;  3RSN A;  2DDA A;  4BQA A;  4B5P B;  3MZH A;  3IKT A;  1Y0U A;  1KON A;  4RAF A;  1LAN A;  3E6D A;  1FOX A;  1S60 A;  3HOZ J;  1TT0 A;  2KRC A;  2Z3O A;  4OLL A;  3MQ0 A;  3JRI A;  2H8W A;  3KYL A;  1YW4 A;  3B3W A;  5LYI A;  5JR3 A;  2R7F A;  4EJO A;  1B72 B;  5IYB J;  1YIT I;  5IYD J;  4PJL A;  1KZF A;  4AG7 A;  3JTK A;  1Z91 A;  5LEK A;  1JJ6 C;  4Q47 A;  4LLN A;  3IAS 2;  1VQL I;  4PXC A;  1SAN A;  1E2X A;  3KP4 A;  1M4G A;  2HDC A;  2JA8 J;  4B4C A;  2QUF A;  1MMN A;  1A6I A;  3OS2 A;  3EUA A;  1WVR A;  5FLX Z;  2O03 A;  3LFK A;  3BG6 A;  3RCO A;  2A07 F;  4JBA A;  1YSJ A;  1IXS B;  2HTJ A;  5FRM A;  2WSA A;  3FB3 A;  1JUS A;  5HNF A;  3EYI A;  4AVA A;  3KEO A;  1WK4 A;  2B9S A;  2DQR A;  2XPV A;  4ZX9 A;  4KIG A;  3WC7 A;  1TW2 A;  1Z4E A;  2X1C A;  1RI7 A;  4KIC A;  5FFZ A;  1SFK A;  4J3G A;  2CQN A;  1V5F A;  4MY3 A;  1DP3 A;  3VEP A;  1AA7 A;  1ELM P;  1TKF A;  3CCU I;  4QC6 A;  2QEX I;  3IH2 A;  1JHF A;  1XE4 A;  4D9J A;  1JJ8 C;  4NQW B;  3GFL A;  3JRG A;  3HOW J;  3P2F A;  2REE A;  3ABT A;  2D4O A;  1QVT A;  3N97 A;  1V0C A;  1ZLH A;  2LY2 A;  2PIY A;  2L5Q A;  4M74 A;  3FXU A;  3SZP A;  5J1R A;  3D7F A;  4ZY2 A;  3Q9V A;  1X3U A;  1P0H A;  1Z3Y A;  4Y17 A;  1XSD A;  2ZPA A;  3H8F A;  2CNS A;  4M9Z A;  2PR8 A;  1LRZ A;  3KLN A;  1RET A;  2XHK A;  1X19 A;  2IVM A;  3QAH A;  3QP5 A;  2XB0 X;  4DZJ A;  1ZYR F;  1PP8 F;  4BE1 A;  4B5P A;  2OQG A;  3OY9 A;  1S7O A;  1MBF A;  1S8N A;  2FJ1 A;  4QSH A;  5C44 J;  2HQR A;  2AFZ A;  5HVG A;  1IRX A;  1TT5 B;  2KQR A;  1QQI A;  3TMO A;  4CIC A;  4F9U A;  2GA1 A;  4P4F A;  1XDS A;  3WHB A;  3IUO A;  4ZBG A;  1NTC A;  2EVN A;  3HKZ N;  2B5G A;  2VOD A;  4II2 A;  2JSP A;  4P9F A;  1D0X A;  4P4E A;  3RI4 A;  4B3X A;  4KDP A;  1BN5 A;  1JHH A;  2KRH A;  1NHA A;  4B43 A;  2R0Q C;  1GXP A;  3LA2 A;  1TF9 A;  2MG4 A;  5JQ4 A;  2QSH X;  5L3F A;  5F48 A;  2AFO A;  5G1Z A;  4IOC F;  2DOA A;  4AVZ A;  4IRH A;  2QA4 I;  3LST A;  2R8V A;  2VN2 A;  2NOJ B;  3CCV I;  3OOP A;  2HB6 A;  2DFH A;  2YNC C;  3K9T A;  4BDY A;  4XRF A;  1W5C C;  3T8T A;  2LR8 A;  3EY5 A;  5AGE A;  3VAT A;  5KNL A;  4FD7 A;  4LB6 B;  1U78 A;  3RKQ A;  3PGP A;  1BOB A;  2OD5 A;  2BOA A;  3H92 A;  1W1W E;  4G6D A;  1ZG1 A;  1W7P A;  2VJI A;  4UUT A;  3ZQI A;  1FMV A;  3MN2 A;  5ILU A;  1KU3 A;  1R23 A;  4YFJ A;  3CXP A;  3WTT C;  3RZD J;  2RFH A;  5C4X J;  1YHQ I;  1UMQ A;  1J5Y A;  3FBU A;  1FY7 A;  2PJC A;  1T33 A;  3ABK H;  3KL9 A;  4KUA A;  2X6Y A;  2DCE A;  1R57 A;  3ZN0 A;  5K1Y A;  3L2W A;  3G2B A;  1IIC A;  4FWU A;  1YYV A;  4XN3 A;  4PXD A;  1I27 A;  4CZZ A;  2OZH A;  5F64 A;  1LNW A;  3ULQ B;  1KYW A;  5IV0 A;  2PEX A;  3H3V K;  3RYR A;  3KEY A;  1T98 A;  1S7E A;  3MD2 A;  3ZQQ A;  3MFK A;  4G7O F;  1H9T A;  3DPU A;  1SVM A;  4BJ6 C;  3OS0 A;  4K3N A;  1YIO A;  4LIT A;  4G94 A;  5C3E J;  1IC8 A;  4A95 A;  2PJ5 A;  5LYL A;  1YGH A;  3HUG A;  4F6A A;  3OR1 C;  4J19 A;  2ZJQ F;  2V6C A;  3GFM A;  1OCT C;  3E1S A;  1B59 A;  2DA4 A;  3CJR B;  3H36 A;  2R7R A;  2HYJ A;  2QM3 A;  1XRY A;  4W1U A;  5F27 A;  3IEH A;  2LMD A;  4FT8 A;  1K6O A;  1T6S A;  4IZZ A;  5CVR A;  4A3J J;  3H5A A;  2KIS A;  1JUM A;  3BPX A;  3WTU C;  5E1Z B;  2I5U A;  3NWS A;  3SYT A;  3MN8 A;  2XV4 S;  4A2U A;  2DFI A;  2A5W A;  2ZXI A;  3OYC A;  4CYC B;  2ZBK A;  5DCM B;  1F4K A;  2C1C A;  2HXO A;  4R7M A;  4IF4 A;  2GU2 A;  2LBF A;  4UCM A;  4CAF A;  2OF7 A;  2HQA A;  3V38 A;  3LL7 A;  1ARL A;  3S32 A;  4MFD A;  3OYA A;  3CO7 C;  5GTH C;  2ELK A;  2AFW A;  2HVS A;  3BR3 A;  2P81 A;  4NCZ A;  2G9W A;  2Y0M A;  5KK1 A;  4A3E J;  3KIO A;  4UWI A;  4G9Y A;  2ZJR F;  2XAJ A;  1IJW C;  1MND A;  2K02 A;  4LIV A;  2LG4 A;  3L2R A;  1TXR A;  2NYQ A;  3KZW A;  1ZQ3 P;  4S0H B;  3KAS A;  1JGS A;  4Y33 A;  5AG4 A;  4UUS B;  2IXS A;  4WF2 A;  1TC3 C;  3WTX C;  2AQE A;  1ZEL A;  4F92 B;  2K3P A;  2ECB A;  3I59 B;  3S1Q J;  4E7H A;  4RUH A;  3TQN A;  3VYT B;  3T90 A;  5HDG A;  3KPH A;  2M87 A;  4I76 A;  4U5Y A;  2QSF X;  1XSV A;  3BTJ A;  3PFY A;  2J5P A;  3KP7 A;  4QPQ A;  5HLT A;  1E0E A;  1AUG A;  2PE3 A;  2Z3L A;  2X6W A;  3BWG A;  2L7K A;  4TWE A;  2LBF B;  1APL C;  2D1H A;  1JT6 A;  3JSO A;  4UA3 A;  5HLI A;  2XPW A;  4WK8 F;  1O3T A;  2KHM A;  3MRU A;  3C1D A;  3OS1 A;  2GA2 A;  4Y4R A;  2P7C B;  1WWX A;  1PDN C;  3B3S A;  5TIS C;  3EFA A;  4AVB A;  4B10 A;  3GEZ A;  1CP6 A;  3RNZ A;  1XMX A;  3UY5 A;  1W0U A;  1FBS A;  1OFC X;  2RNJ A;  2KZG A;  4KOS A;  3QOE A;  3H5Z A;  2JN6 A;  3IWE A;  2XUB A;  1G3S A;  2DAO A;  4JJX A;  2M1B A;  1NMT A;  1K7A A;  4S04 A;  4M3E A;  1WJ5 A;  2KPM A;  1YJ9 I;  2ZOF A;  1FZP B;  5FFX A;  2FNP A;  4BEH B;  2PVW A;  1R22 A;  3PIP F;  4HV6 A;  1YLO A;  2BZT A;  4KOR A;  1ON0 A;  1OCC H;  4RMN A;  3DCF A;  1R9T J;  1V55 H;  2W84 A;  1O3R A;  3FKI J;  1P9Q C;  2B3V A;  4BE0 A;  2CY2 A;  2OB0 A;  1WHU A;  3ERE D;  1Z05 A;  4Z6Y A;  3JRB A;  3UNG C;  2DA7 A;  2FEZ A;  2B4B A;  4WWV A;  4IK2 A;  4OIR F;  5H20 A;  5J4V A;  1K78 A;  2LYC A;  3DLA A;  5E8G A;  1MNE A;  4HLY A;  1VQ8 I;  1TBX A;  2QQB A;  3CC4 I;  5IB0 A;  3I59 A;  3DTE A;  4YEL A;  1E3P A;  4DUK A;  1WJF A;  2C6C A;  4GRI A;  4OAY A;  5HLG A;  4XRS A;  5LGN A;  3CLQ A;  4XQF A;  2HVR A;  4DGW B;  3BY6 A;  2R98 A;  1Y56 A;  1RUN A;  3AL0 C;  3S6H A;  3BR1 A;  4R57 A;  2OZU A;  4KOW A;  3BCB A;  2CQK A;  3CP2 A;  1WJD A;  4CDG A;  4JOM A;  4PSW A;  1R5I D;  1AYE A;  3L2Q A;  4P44 A;  2K86 A;  4ZYG A;  4A6E A;  2BUE A;  3C18 A;  3VYS B;  3WTZ A;  4F7Z A;  2R5Z A;  3M1C A;  2PRB A;  4YRH A;  5KCM A;  2QWW A;  1RTQ A;  1U5T C;  3WU0 A;  2ZME A;  2EV0 A;  4WCG A;  1QNT A;  3IRR A;  1WJC A;  4D7M A;  2AHQ A;  2RKH A;  3LOC A;  4A94 A;  2L4M A;  3L00 A;  3VOD A;  3LWF A;  1CM0 A;  2POK A;  4NFR A;  2K85 A;  1LAM A;  5L3E A;  4U0Y A;  2K9S A;  4I01 A;  1QPM A;  1XB4 A;  3TP3 A;  2LKX A;  1QO0 D;  4CH7 A;  2E7W A;  4LFU A;  2MD5 A;  2LC2 A;  2CV1 A;  2YU3 A;  5M5X J;  2NVY J;  3B6A A;  4FAI A;  2JT1 A;  3OYD A;  3TKY A;  3DF8 A;  1Z6R A;  3MZ8 A;  4XL9 A;  3F0C A;  2VIX A;  8CPA A;  3K4C A;  3OV8 A;  3CF2 A;  3W2A A;  3I5U A;  4A33 A;  1JKQ C;  3V4G A;  5CPR B;  2VT3 A;  1F2O A;  2FVG A;  2GLJ A;  5E1X A;  4CA0 A;  5ELY A;  3DEE A;  3ERM A;  3SHP A;  1TQM A;  2JBK A;  3DDD A;  3PB8 X;  3IAM 2;  2AS5 F;  1JT0 A;  3NAR A;  3O3K A;  1R00 A;  1RZ4 A;  4PZJ A;  4ZGY B;  2M8G X;  3E97 A;  5HDN A;  5E3M A;  1UJ8 A;  1WQ2 A;  2VBZ A;  4A3G J;  4E4H A;  4MJ8 A;  3C2H A;  3CO6 C;  5HNH A;  4CGP A;  2CTC A;  3O8G A;  4HYE A;  2PBI A;  3OR2 C;  1XFO A;  2ELH A;  2BO9 A;  2Z3K A;  4MHY A;  4BQO A;  1RC9 A;  3OSF A;  4L9V A;  1RRJ A;  4BD9 A;  5FKN A;  4OWR B;  2ZJ2 A;  3SHF A;  3CCL I;  1B72 A;  2KCW A;  2WY7 Q;  2M34 A;  3LSG A;  1TTY A;  4KVX A;  1ZRD A;  1Z5R A;  4HX4 A;  1WZ2 A;  2R1I A;  3MMY B;  1BAV A;  4BHB A;  2GBY A;  4CRY B;  2R5Y B;  1LFU P;  1D0Z A;  5FLM J;  2BHZ A;  3DWL E;  2LTP A;  3PQJ A;  2IT0 A;  3CJT B;  4M9X A;  1L0C A;  1X3Z B;  4E70 A;  2NS0 A;  1FYM A;  1GLN A;  1TNS A;  2QVP A;  3SJE A;  1ZGJ A;  5KTC A;  2Q7B A;  2ZNY A;  1IZ1 A;  2OPT A;  3DLL F;  4KN7 X;  4M6G A;  1Q1H A;  2AXT C;  4IF5 A;  1F9N A;  2FBI A;  4HAM A;  1RIO H;  3RTR A;  3GTQ J;  4R76 A;  2C6Y A;  2F6C A;  1TWH J;  1U9N A;  4YWY A;  4B13 A;  2HOT A;  3IC1 A;  4BXF A;  1SD5 A;  2Y2Z A;  3BC8 A;  4R1H A;  1MMS A;  4MFE A;  4P4I A;  5FKO A;  4ZDO A;  3F5B A;  1OIS A;  1M44 A;  4Z2Y A;  1DPU A;  4DYQ A;  1WKM A;  4HQE A;  3IWW A;  4N4N B;  3WT4 A;  2DA2 A;  2R93 J;  3PJR A;  2Q2E A;  3FXL A;  4BAY A;  1SFU A;  1I21 A;  1KUY A;  3BXM A;  4KIT B;  4NGP A;  2MH9 A;  1ZK8 A;  1LQ1 A;  3P9I A;  3F3X A;  3X2Q H;  3SJF A;  5DS9 A;  1T0F A;  3ABL H;  3S8P A;  1I6X A;  2FE3 A;  2X1E A;  1SAU A;  1TWG J;  3FXT A;  2VKE A;  2EK8 A;  1FIA A;  1YS7 A;  5I4M A;  3PNT A;  2HXI A;  2VE9 A;  1HOM A;  4ZX8 A;  4E8O A;  4PV6 A;  3FXR A;  4KSA A;  3K0L A;  2IQ6 A;  3L1P A;  1IUY A;  3F8M A;  4C2T A;  4MFL A;  1YW7 A;  4ESJ A;  1A35 A;  2JDC A;  2F5I A;  4F9V A;  2R7Q A;  2EZK A;  1Y8R B;  2AXL A;  2LKS A;  2UUZ A;  3GTO J;  1HDU A;  3BLN A;  3CPA A;  2X0L A;  3WE2 A;  5DM7 F;  4CYO A;  3HEF A;  4O23 A;  1MW7 A;  3L7W A;  4PQA A;  1VI0 A;  4B47 A;  4C2M J;  2EUI A;  3KQZ A;  3BTL A;  4KMF A;  3JRU A;  4HST A;  2IW5 A;  1NK3 P;  1K4T A;  1QQ9 A;  3KET A;  2HKX A;  3FF3 A;  5E18 F;  2ZEF A;  1UFM A;  4BDZ A;  1ETK A;  2ZEG A;  3H5N A;  3CDI A;  4ON0 A;  3OSG A;  2VJJ A;  2VBX A;  4XON A;  2V7F A;  1JKP C;  3GX4 X;  4BNC A;  1D5V A;  1BLL E;  2DT5 A;  3WG7 H;  1P4X A;  3DBR B;  1A5J A;  1O3Q A;  4K30 A;  1MH4 A;  1BR2 A;  2RQP A;  2P6S A;  1YK3 A;  1ETY A;  1MMG A;  2O53 A;  3SJX A;  2H5M A;  4RLQ A;  1IU8 A;  3VOE A;  3ZQH A;  3FEC A;  3W6X A;  3Q9S A;  2HI3 A;  1BOA A;  4OIO F;  1ZG9 A;  2KDO A;  1R5G A;  3C26 A;  4IVN A;  3G1O A;  3J81 K;  3HXL A;  1T56 A;  3DKY A;  1T2K A;  2X4H A;  2DXI A;  2F5D A;  3D5L A;  1DU6 A;  4HLX A;  2FT0 A;  2MW8 A;  1G59 A;  3KX2 A;  1UHW A;  5FKL A;  4IQJ A;  4EM2 A;  2ZSI B;  5G20 A;  2QVO A;  2XAF A;  4IHV A;  1Q7L A;  3JR9 A;  4OC3 A;  4L9J A;  4KIF A;  2YND A;  4FCY A;  1VQ9 I;  4CCL A;  1ZKG A;  4BBS J;  2NSM A;  3LA3 A;  2XB5 A;  2HUZ A;  4M3F A;  4RB0 A;  2GZW A;  1TQI A;  2M2E A;  4QTR A;  4LGW A;  5D6F A;  3TP0 A;  1LPQ A;  2ZFW A;  2ZEO A;  4IOA F;  1I12 A;  5LYF A;  4F0X A;  2XAU A;  3PUF A;  1LE8 A;  3QP6 A;  4JXR A;  2PLY A;  2VT2 A;  2VPR A;  3HRT A;  2AE6 A;  2WAQ A;  5K8O A;  1YW9 A;  4CSW A;  4B6Z A;  2PJA A;  3PNY A;  1FTT A;  1F57 A;  2LRD A;  3R0A A;  1D8K A;  2ZXH A;  3KCC A;  1YG2 A;  3CCQ I;  5DCM A;  2HGC A;  3V42 A;  3GF2 A;  2EZH A;  4XSX F;  4ENM A;  2P8T A;  3D7G A;  3NE8 A;  3IL2 A;  2L9R A;  2CTB A;  1T8I A;  1GVD A;  1R4M B;  2XGC A;  5GP9 A;  5IB9 A;  3MVP A;  1HQC A;  4FD4 A;  4XLP F;  3CZ6 A;  4HA8 A;  4G6Q A;  5B1A H;  2BXY A;  3FNC A;  2V79 A;  4Y13 A;  2XPU A;  5BQT A;  5J40 A;  3R96 A;  1FOY A;  1MZB A;  5E3L A;  2KZV A;  4ESF A;  1M4L A;  1NK2 P;  3R4K A;  5E1W A;  3HRM A;  4MTD A;  2IS4 A;  2R7X A;  2WZN A;  4ZI6 A;  3EPZ A;  1VFC A;  5E17 F;  3MEX A;  5D5W B;  2R7D A;  3KE2 A;  3RJP A;  3DKW A;  2L01 A;  4B1R A;  3N7Z A;  1YE9 A;  1Z3X A;  4M73 A;  1K79 A;  2VUM J;  3GUX A;  1P4A A;  2MA3 A;  5EGO B;  3FKJ A;  3FHN A;  2FX0 A;  1JQG A;  3FM5 A;  4GS4 A;  1MMA A;  2YU9 J;  3KEQ A;  1VF9 A;  2NRA C;  3FDY A;  3PZJ A;  5DS0 A;  5F0H A;  2ZNZ A;  3K2Z A;  1R3N A;  4R87 A;  3I4M J;  4YGO A;  2H94 A;  2YS9 A;  3PSI A;  4AM3 A;  3A9L A;  1R1T A;  5AIP A;  2WPX A;  2XKO A;  1S7K A;  2K3F A;  3B35 A;  3BR5 A;  3HOX J;  4LIU A;  5J1U A;  3RKX A;  1TP4 A;  3PFO A;  1UG0 A;  5ICF A;  5IP7 J;  2RQQ A;  1P6R A;  4CXF A;  5JGF A;  1XTA A;  1JTX A;  3REO A;  5LFA A;  2G3T A;  2ZW6 A;  1EV7 A;  5E8I A;  4UV9 A;  2XAH A;  2A6E F;  4OOI A;  3GTL J;  2Q0O A;  4YFK F;  3JRA A;  3GWZ A;  1V4R A;  1HDQ A;  3GME A;  2GOX B;  3CMY A;  4MFJ A;  4U88 A;  1L0O C;  3AG3 H;  5J3L A;  2FIA A;  2GE3 A;  1IV6 A;  2P0W A;  1JGG A;  2G0B A;  2YX4 A;  3QOD A;  4R79 A;  2QEN A;  2PJ6 A;  5LLQ A;  2VB6 A;  1IUF A;  2IJL A;  3PQK A;  2F5V A;  2WB1 N;  5LD2 C;  1QSN A;  4F91 B;  2PMZ A;  2F5E A;  2B4D A;  5BOX A;  3TED A;  5BMZ A;  3R95 A;  1BPN A;  4HNU A;  2O7O A;  2GFQ A;  4WXH A;  2VQL A;  5CPA A;  3B8G A;  4CGN A;  2XF5 A;  2DA3 A;  3BLY A;  4ZYH A;  3N4M A;  1Z6T A;  2CF4 A;  1BA5 A;  2K9M A;  1G6N A;  3UKG A;  3EC4 A;  2ZED A;  3DFG A;  3L9F A;  3GZ5 A;  1B8I B;  4HKF A;  3LMM A;  3OYM A;  4KVO E;  3QPH A;  4UCN A;  2ECC A;  2Y0S N;  3BG3 A;  3VSK A;  5D4S A;  2MH2 A;  4L9N A;  1NH3 A;  3F21 A;  5DM6 F;  4HDU A;  4O3M A;  3N05 A;  2OZ6 A;  1STZ A;  2D2W A;  3ONQ A;  1IXC A;  4OP4 A;  7CPA A;  5ISV A;  1XGO A;  1S3Z A;  1KQ9 A;  5F09 A;  2O28 A;  4ORF A;  1HXD A;  4LG0 B;  1V3F A;  3CUQ C;  3PIO F;  1TWA J;  4RA2 A;  5B3S H;  2DF5 A;  4M71 A;  3PB9 X;  2QGU A;  1Z8T A;  1HDP A;  2QKM B;  3HOT A;  3ZMZ A;  3ROU A;  1B8I A;  1ETX A;  4XOT A;  3DSB A;  3GTK J;  2OCC H;  2PMZ N;  1S7N A;  1RO5 A;  1ZRF A;  3SXY A;  4A30 A;  2KT0 A;  2TCT A;  2Z99 A;  4CO8 A;  1IYK A;  2D4P A;  4OIW A;  3B7I A;  4BEH A;  2XIG A;  2DK5 A;  2DYR H;  3EUK L;  2HS5 A;  4P1W A;  4A0Y A;  4BHP A;  4IRI A;  4P6Y A;  2ICW G;  1OMI A;  1I3Q J;  2EIM H;  3K1P A;  4BU2 A;  2R7S A;  3BG5 A;  1BR1 A;  3W6S A;  1XF8 A;  2W82 A;  1CP7 A;  2AFX A;  3NH4 A;  2BY3 A;  1JUP A;  1Z7U A;  4RN7 A;  4IHM A;  1RR8 C;  3K1M A;  2VQC A;  4ZYA A;  1SFX A;  2NXN B;  2F5C A;  5CLS A;  3OL4 A;  2CV2 A;  1IN4 A;  2PIZ A;  3WC5 A;  1YVO A;  2ISY A;  3H8G A;  2K40 A;  3MCZ A;  4LK0 F;  2IAI A;  2A61 A;  2E71 A;  2P6T A;  4C3I J;  2COB A;  1WJA A;  4JYK A;  2WV1 A;  2DMP A;  1T95 A;  2HZD A;  4IPA A;  5GAG J;  4ZY1 A;  4V2G A;  2DPD A;  2QBY A;  2F8H A;  4L9T A;  1FT9 A;  1XGS A;  2ZW5 A;  4QBJ A;  1QGP A;  1PCA A;  4UCP A;  2V77 A;  1ZO0 A;  2FQ4 A;  3SDB A;  4MBU A;  2HPI A;  1I3A A;  3E6M A;  1FOW A;  2QKL B;  3HOU J;  4P5O A;  2P6G A;  4ONW A;  2GIV A;  3HRU A;  3D66 A;  1BJA A;  4F55 A;  1BPM A;  1N25 A;  1O7F A;  3AFH A;  2M30 A;  4IHY A;  3A2K A;  2FS5 A;  3D2P A;  4RGU A;  3MKZ A;  2VJ4 A;  1ZR4 A;  5IT9 K;  2VXZ A;  3C3W A;  2PQ8 A;  5A2Q Z;  4CAW A;  5F46 A;  4ZDP A;  2BL1 A;  4IO9 F;  2CO5 A;  4UFW A;  3HB9 A;  2GAU A;  1LFW A;  3QYB A;  4RDU A;  1U5T A;  3OIQ A;  3ECO A;  4MEX F;  3BJ6 A;  2JTV A;  4EFD A;  1OQY A;  3S2W A;  3TCV A;  3VYU B;  3ZZI A;  5EDN A;  1I6H J;  5CVV A;  2WB1 A;  5CVJ A;  4NDL A;  1S7F A;  2ADU A;  2VZY A;  1CF7 B;  2DMT A;  3M4O J;  2V4J C;  3CJN A;  2A68 F;  4AVC A;  4Q4Z F;  2FQ3 A;  3NE7 A;  3J7A Y;  3NQO A;  1GV2 A;  1AHD P;  4ZZD A;  1TIQ A;  3KZZ A;  1I50 J;  3K70 C;  2M8E A;  2A3S A;  5KVR A;  4EJT A;  1VQ4 I;  3RPU D;  1H0M A;  4OID A;  2AFU A;  5D8N A;  4H0E A;  1XBU A;  3PNV A;  1LOK A;  2M7A A;  3M8F A;  3WTV C;  1FPQ A;  1K4J A;  1B87 A;  5M5W J;  3BZK A;  3LA7 A;  3H0G J;  5J8C A;  2QBY B;  2AQF A;  2LDU A;  2I10 A;  3BTI A;  1SMT A;  4ENN A;  4KIB A;  5ILS A;  1BI3 A;  2CYY A;  3ASO H;  1ONV A;  1XS9 A;  2CWE A;  2Q51 A;  1Z77 A;  2WA0 A;  5IOY A;  2Z9O A;  2XRL A;  2V26 A;  4A3M J;  1YO5 C;  2VLA A;  2FXA A;  3NWT A;  4F93 B;  3HBL A;  1Z1D A;  3OYN A;  3TC8 A;  5E79 C;  3HOY J;  4EGZ A;  4E2A A;  3H35 A;  2B3U A;  1MKM A;  1QHG A;  5FLX K;  1QVU A;  3IU2 A;  4EJW A;  4KFC A;  3TT2 A;  3BT9 A;  3A02 A;  2JPC A;  1Z67 A;  4L0Z B;  1BIB A;  4I09 A;  2PJ9 A;  5F47 A;  3OYH A;  1O3S A;  4CZC A;  4MNU A;  1FYL A;  5C88 A;  2V1U A;  2H27 A;  4OC1 A;  4LK1 F;  1PUE E;  2CG4 A;  1TKJ A;  1Q2D A;  4PFO A;  1KU7 A;  5CQE A;  1PUF A;  3WGH A;  4LQ6 A;  4YIF A;  4N9H A;  1AMP A;  2V8D A;  4P45 A;  1E3O C;  1EE3 P;  4PXE A;  4D1Q A;  2GLO A;  3BJA A;  2RV8 A;  1A04 A;  2HFH A;  4LLG F;  3E6C C;  4CGZ A;  3ZQC A;  2FL4 A;  2ZME C;  4DYC A;  3PBE A;  4B48 A;  2ISZ A;  4MCS A;  1WH7 A;  2EV5 A;  1ETV A;  1ULY A;  1J75 A;  4F0Y A;  3ESW B;  4A39 A;  1D3Y A;  1CG2 A;  3CZX A;  4F52 A;  2JK3 A;  3OYJ A;  2VC1 A;  1TWF J;  1QA6 A;  1B6B A;  5K8M A;  1WRJ A;  3VFZ A;  1X1D A;  2JWT A;  5HH1 A;  3QPT A;  3DEW A;  2H8R A;  2P5L C;  3FM3 A;  1TNT A;  3ZMD A;  2BY0 A;  3K4M A;  4GDF A;  5L3D A;  5D5V B;  2M4K A;  4KOY A;  1K83 J;  2K9N A;  2NS7 A;  3CDX A;  1GT0 C;  4MHP A;  3J80 K;  3NH8 A;  2V8V A;  2R7H A;  3HTS B;  3M1E A;  5K5O A;  1REP C;  1U6M A;  3PB7 X;  4MHD A;  1DGW Y;  2MD0 A;  4AWX B;  2JDD A;  3F9K A;  5LRJ A;  2M45 A;  2ZOG A;  4A0X A;  3SJG A;  2MAB A;  2YNE A;  3OYG A;  1OLT A;  5H6R A;  3H8E A;  3BJO A;  4UWJ A;  2P4W A;  2Q44 A;  5EZG A;  3OYB A;  5FKM A;  3D3S A;  5H6Q A;  1YQE A;  3OL3 A;  2XEJ A;  2ZW7 A;  3E0K A;  5LRG A;  1MBJ A;  9ANT A;  5GAE J;  3CD6 I;  3HSF A;  4N4O B;  5B66 C;  1GV5 A;  3DNS A;  2X6O A;  4Q7A A;  4PUS A;  1MBH A;  3CJQ B;  3M3Y J;  1XG1 A;  1RES A;  3BR2 A;  3HZJ A;  2PFB A;  1XJO A;  3E5Q A;  1I1S A;  2J9A A;  3K4J A;  1PYV A;  2IGO A;  5IT3 A;  4UUV A;  2KP6 A;  5HXD A;  3U1D A;  1PVE A;  2DT6 A;  3OYI A;  4RAZ A;  1S7A A;  1P7J A;  5J6X A;  3K4N A;  3I55 I;  3J7Z I;  1XOV A;  4GFB A;  3D68 A;  1W5T A;  1YX3 A;  4BH9 A;  4XBF A;  3LAP A;  1OCO H;  4P96 A;  2PMU A;  3KKW A;  4NSQ A;  1FT7 A;  2LD5 A;  2Y75 A;  1OYY A;  3I9V 2;  3NEU A;  2ZW4 A;  4C2U A;  2XSJ C;  4MQ9 F;  3ZOB A;  2VKV A;  3GUD A;  3DV8 A;  5FB2 A;  2YNC A;  5CYV A;  4DOZ A;  2LH9 A;  3JRE A;  2EFQ A;  1YFH A;  4UIA A;  3JRF A;  4DJL A;  2X7B A;  5JM6 A;  1EH6 A;  2YX7 A;  2DLL A;  4MEY F;  1EA3 A;  3HHH A;  2V1N A;  4NNJ A;  2XRN A;  3O6B B;  3ZGK A;  2BBY A;  2HOS A;  3LQR A;  3JRC A;  1O7L A;  3KP3 A;  3RPU A;  3S2D J;  1IOI A;  2P7V B;  3C7J A;  3J7Y J;  1FOK A;  3I9S A;  5THW A;  2WV0 A;  4BBH A;  4HZF A;  3HPG A;  3DU6 A;  4UF4 A;  3R9F A;  2PJP A;  1W4M A;  1PUA A;  3A0H C;  3MKL A;  4LB5 A;  1WI9 A;  4I49 A;  3J7A O;  1S9H A;  4N9I A;  1OCR H;  2PI0 A;  2GLF A;  3R60 A;  2J5O A;  3W6K B;  2R5Y A;  4A3L J;  1S7L A;  1WPK A;  2IGK A;  2VKH A;  5DTD A;  4B8X A;  4CHU A;  1YME A;  4RB3 C;  3HYI A;  4HX8 A;  2WPW A;  1H8L A;  2PX9 A;  3BHX A;  3B3C A;  4CCJ A;  2DTZ A;  2PJB A;  4UBR A;  4AUX A;  5IP9 J;  3OYF A;  1UEL B;  1B4A A;  4G8X A;  1FSE A;  5DDG A;  2BOL A;  5CVU A;  1KZH A;  2FML A;  1ZG8 A;  2JA5 J;  3JRD A;  5KHD A;  3KP6 A;  3S15 J;  1N71 A;  2Y69 H;  3ZQF A;  3PFI A;  4AB7 A;  1BJZ A;  2WTE A;  3TDU C;  2M4G A;  4ZJZ A;  1NE9 A;  4F3Q A;  3G1L A;  2BSW A;  3TL4 X;  4E7Z A;  5EF6 A;  4MHZ A;  1R49 A;  2WBM A;  2EO8 A;  1MBE A;  1LFP A;  1Z4R A;  1K61 A;  3DQV C;  2PC1 A;  1IG7 A;  2Z11 A;  4KJZ A;  3AG1 H;  4II3 A;  1TF8 A;  2DEA A;  3CPX A;  3D4U A;  2W4S A;  4R8F A;  2GIZ A;  4LMY A;  4IHS A;  2N8G A;  1XEB A;  4M3G A;  4NC8 A;  3SEQ A;  4Q38 A;  4E6K G;  4UV8 A;  4HOB A;  2ZEL A;  1HC8 A;  3B3V A;  5J8F A;  2KFD A;  4RB2 C;  4A12 A;  4HNX B;  4XNH C;  1W36 C;  2DYS H;  3OYL A;  2NVU B;  4B44 A;  1D1A A;  2DA1 A;  3FYN A;  3L2N A;  5E96 A;  4HX7 A;  2WY8 Q;  3F22 A;  2FD5 A;  4Y49 B;  1OR7 A;  1Y9W A;  3CCE I;  3S16 J;  2O4H A;  3ECH A;  1XDU A;  2BHY A;  2EWB A;  2A5Y B;  3A0B C;  3U1K A;  5EEA A;  4XNF A;  2PJ8 A;  4BMH A;  4NB5 A;  3MZY A;  2DW4 A;  3VB2 A;  2K4J A;  3DKX A;  3BZ6 A;  2WWY A;  4NEX A;  1LDD A;  5GAD J;  3QPL A;  2JVG A;  2EWN A;  2EIN H;  2P5V A;  3HG9 A;  4OAD A;  2VL1 A;  2CH0 A;  4OIP F;  1J09 A;  4M72 A;  1OBR A;  2DQL A;  2L9S A;  3BI1 A;  1IRF A;  4D5C A;  1J4J A;  3ABU A;  4AU7 A;  2F2E A;  4HDV A;  1KUV A;  5JI6 A;  3QRF F;  2BXZ A;  3VH9 A;  1ACI A;  1R1U A;  1XIX A;  2PJ1 A;  3K2K A;  5DWN A;  4MCQ A;  2K4B A;  1IN5 A;  4HF1 A;  2NMT A;  1UZC A;  2C6P A;  1IN7 A;  1KU9 A;  5HS9 A;  1QZY A;  5C4J J;  3I71 A;  3V8I A;  3OWT A;  4JX6 A;  5TGT A;  1XMA A;  2VJ5 A;  3NRV A;  3LSJ A;  3S3N A;  2AFS A;  1E3H A;  5FKK A;  1Z2L A;  2KKO A;  3JCU C;  3LSK A;  4PSX A;  4XLC A;  1ZGW A;  4KLW A;  1KGS A;  3DR8 A;  2DN0 A;  3R6S A;  4FD6 A;  3B73 A;  2E34 A;  2RDP A;  1UHM A;  4CUG A;  3OYE A;  1L3L A;  1E17 A;  5LHI A;  4XN0 A;  3J81 Z;  2RNG A;  2PCU A;  1TL8 A;  5K8P A;  2DI3 A;  4KVM E;  2E36 A;  2IGN A;  4KT5 C;  3TW6 A;  4AIK A;  1HCR A;  4OAZ A;  1ZLK A;  1MMD A;  1H89 C;  2VOP A;  4NC7 A;  3F72 A;  4ENK A;  1JI8 A;  4G7Z F;  1DPR A;  4JK1 X;  1PYT B;  3A1Y A;  2P5K A;  1LJ9 A;  1YR0 A;  1XSX A;  2Y48 A;  3HSR A;  2QQ9 A;  2IPQ X;  3K7A J;  3FIX A;  4KS9 A;  3IH3 A;  5HLH A;  1T38 A;  2HEO A;  1ZLI A;  1YX0 A;  5DYM A;  4AYB A;  1D0Y A;  2PN6 A;  2KDZ A;  4IHT A;  3A01 A;  2IS6 A;  3FEE A;  4LUA A;  2I79 A;  1ETW A;  2CW8 A;  2JBJ A;  2BEO A;  2KMU A;  5GAH J;  4YEJ A;  4EJV A;  3HOS A;  3CCJ I;  1A2Z A;  4CAX A;  4M6Y A;  1HKQ A;  4NJR A;  1LFB A;  4M6X A;  2CUF A;  2VEZ A;  1W5S A;  3D5S C;  1H9G A;  1M4I A;  4ASN A;  1KQ8 A;  4UVA A;  3GLX A;  2HKO A;  2JRM A;  4E7S A;  1TLH B;  2JUC A;  4M9S A;  2M3A A;  1QHH D;  1X58 A;  3W91 A;  3H3Z A;  4DQ2 A;  3ZRG A;  3L2U A;  2JRT A;  2W48 A;  3CF5 F;  2FU4 A;  2O61 A;  1J59 A;  1ITY A;  1MJ9 A;  4ZYD A;  2XKP A;  2LFB A;  2RAE A;  5AON A;  4M6I A;  1MIJ A;  5L3B A;  2V9V A;  3WTS C;  3CQZ J;  2VON A;  1IRZ A;  1WWZ A;  3BTC A;  5J1Y A;  1FYK A;  4A3C J;  3RO0 A;  1S3J A;  4MQV A;  1QSO A;  5J4Y A;  2DA6 A;  2E1N A;  4C3H J;  2FNA A;  2J8M A;  2ZCW A;  3VWE A;  2XEG A;  2X51 A;  3PRT A;  2HQN A;  2GWR A;  4XMY A;  2VC0 A;  3T8R A;  3FMC A;  3F8C A;  2Z16 A;  1SMY F;  2CQ7 A;  3G71 I;  2OTL I;  4CCM A;  1YX5 A;  1RKW A;  5ICE A;  5M3F J;  4MHG A;  1HKT A;  4BIN A;  2LY9 A;  5E20 A;  1SAX A;  2JA6 J;  4AVP A;  3TO9 A;  3PO3 J;  2BGC A;  3L09 A;  1ELL P;  1PUF B;  5J1Q A;  1IOF A;  1Z8W A;  1BIA A;  2E19 A;  1ZG3 A;  4BXU A;  4DBR A;  1Z21 A;  3SFZ A;  5GCN A;  3QU6 A;  4UVC A;  3DGV A;  3P9K A;  6CPA A;  4NGT A;  2VBW A;  1TWC J;  4OMZ A;  4L18 B;  4A37 A;  4ENJ A;  3RPQ A;  1K6Y A;  3AL0 B;  2I8D A;  4DNC A;  4F8Z A;  2DK8 A;  5LBQ A;  2AJ6 A;  3FJU A;  2FXF A;  5EBV A;  3UR3 C;  3V8L A;  4XKB A;  5B5E C;  4U0V A;  5FRO A;  1ZR2 A;  1HDD C;  4L0Y B;  2PSW A;  3T8W A;  4JQF A;  4AXV A;  4NF1 A;  2UV1 A;  3S6G A;  5G21 A;  1XMK A;  2ZB9 A;  4B09 A;  2BYV E;  4NGS A;  1HST A;  1DTD A;  2K5C A;  2NYX A;  4I7H A;  3FF5 A;  1UAA A;  3GLJ A;  3DU5 A;  3AG2 H;  4A3D J;  2BY2 A;  2HOA A;  5K5Q A;  2DMN A;  3SEZ A;  3KI9 A;  5IPA A;  2DOD A;  3BJ8 A;  4RGR A;  5HS8 A;  2LY1 A;  5IYC J;  1R58 A;  3G1M A;  2ANP A;  4XOP A;  1IAW A;  2G7H A;  2PJR A;  1MH3 A;  2LOO A;  3LAJ A;  5HOO A;  3QNV A;  1RNL A;  2LSO A;  3LOD A;  1IN6 A;  4GGG A;  2HYG D;  5ERI A;  1XPX A;  4A93 J;  1VZ0 A;  3V7Z A;  3JSP A;  3MAJ A;  3TOB A;  2VXK A;  3SZG A;  4MI4 A;  4BUP A;  3SXN A;  4JYW A;  3G8W A;  2J8R A;  1XC5 A;  2IEK A;  4FE7 A;  1USS A;  1HW1 A;  3FK6 A;  5IOZ A;  2PJ0 A;  1R1V A;  3LSM A;  3KQX A;  4FET A;  5F1J A;  3CC7 I;  3AG4 H;  1VQN I;  4RGS A;  2LP0 A;  3PP9 A;  4CAE A;  5D5X B;  2H6C A;  2FOW A;  2Z1D A;  1SVO A;  2DA5 A;  2ZXW H;  2GRE A;  4E7J A;  4NGQ A;  4HNY B;  2Y30 A;  5H84 A;  2Q04 A;  3BI0 A;  3MKW B;  4A69 C;  2WUU A;  2CUE A;  2A6T A;  4YFN F;  1F5T A;  2GXA A;  2K9L A;  1I1G A;  4FHT A;  4B11 A;  4M3B A;  4BL0 B;  1PU9 A;  2IGM A;  3GTM J;  1U6G A;  5LRK A;  5DCF A;  1ETO A;  2R7V A;  4MCP A;  1LVK A;  2IJZ A;  2BV6 A;  5KAI C;  4YRV A;  2MYS A;  4JWP A;  4B14 A;  3FHZ A;  4A31 A;  4PJ0 C;  4H6U A;  3TE4 A;  4XPK A;  3K1N A;  3KP5 A;  5BS6 A;  4KIS A;  4CGM A;  2IS1 A;  4QLC U;  1S72 I;  3F8K A;  4CRZ B;  4XNH B;  3IU1 A;  4WX9 A;  5J47 A;  4KSI A;  2JJ7 A;  1D8J A;  2R4G A;  4MRI A;  3FRM A;  4FX4 A;  4HSR A;  1FSH A;  1WGX A;  1Z0X A;  1HF0 A;  2WAE A;  2V6E A;  1CX8 A;  1EH8 A;  1IN8 A;  3D7D A;  2X1D A;  3QU3 A;  4P4D A;  3ISZ A;  3WU2 C;  3QQA A;  3RQ4 A;  1MDM A;  1NSA A;  4EQQ A;  4DJA A;  2BY1 A;  4V19 K;  1Y0N A;  3GVA A;  4PXB A;  3SJM A;  5AIQ A;  2Z3M A;  5FLV A;  1EF4 A;  1MDM B;  2KL4 A;  2Q0Y A;  1TQP A;  3QYF A;  5FRN A;  1X4O A;  3EXN A;  2EIK H;  3E0J B;  4E7K A;  4KUB A;  4XLN F;  2R92 J;  3Q0W A;  2Z2S B;  4MY0 A;  3C2G A;  4EJU A;  3OMY A;  2KJB A;  4BXX J;  2HWV A;  1NSL A;  3SXO A;  5EG0 B;  4R8H A;  3G3S A;  4LX9 A;  2UXX A;  5ED4 A;  2E1M B;  1V54 H;  1X1P A;  2CRG A;  1J7K A;  2PMH A;  4ZH4 F;  1LE8 B;  2B5G B;  2EQR A;  1FBU A;  4IRG A;  2ACJ A;  4ZYQ A;  3S2H J;  2CS3 A;  3VPR A;  1LCP A;  2D5V A;  1MGT A;  2EA4 A;  5JVT A;  4MHN A;  4UFV A;  1EH7 A;  4H89 A;  2CUJ A;  3PSF A;  2ZEE A;  1XCV A;  4P55 A;  5CKT A;  3GKR A;  3K10 A;  5LHH A;  2HZT A;  1F2P A;  4CYC A;  2RB7 A;  4HNW B;  1MD0 A;  4I0B A;  1UHS A;  4UB8 C;  3HRS A;  3GW2 A;  2LF7 A;  5A2Q K;  3CES A;  2VZZ A;  3HGY A;  3WHC A;  4A6D A;  2H6B A;  3EYY A;  3HM5 A;  3OOU A;  3QPS A;  4JX5 A;  4XK4 A;  4ZDL A;  4DYR A;  1JKO C;  1LEA A;  1NG6 A;  3PBB A;  3CLO A;  3U21 A;  3T1B A;  2XVC A;  1JTY A;  2M0C A;  2DMQ A;  1M4D A;  4UFX A;  2DPS A;  2E1C A;  1WJB A;  3ZMT A;  2XGE A;  4CGO A;  4CYP A;  4UHT A;  1XMT A;  3HDD A;  3FXM A;  2R3S A;  1DUX C;  4XSZ F;  2PJ7 A;  1I39 A;  3G4S I;  4U9Y A;  1G3T A;  3RQI A;  4FUU A;  5AG7 A;  1C0W A;  2DOF A;  4RM3 A;  3MKY B;  3FED A;  3S1N J;  3CCY A;  1LVA A;  3GO5 A;  3GYA A;  2CGP A;  1IW7 F;  2QML A;  2CW7 A;  2DT7 B;  2DDB A;  2VAS A;  2IL4 A;  2C6G A;  1D1C A;  1BI2 A;  2ZEN A;  4AG9 A;  3I4N J;  2Q4Z A;  3G3Z A;  4C3J J;  4HPQ A;  3GTJ J;  4PK2 A;  4EEF G;  1D5Y A;  4D5F A;  3SZT A;  3RBU A;  2Z3N A;  1SC7 A;  4XR6 A;  2EZI A;  4KOV A;  2O9L A;  3HIF A;  3M7G A;  4YIR X;  2KJC A;  3B6C A;  3JTH A;  4ETS A;  4QPO A;  3NH5 A;  1U0J A;  2HC9 A;  1CQT A;  2HV2 A;  2Q2E B;  4NUB A;  1FLI A;  4R3L A;  2FA5 A;  1A6Q A;  3N5F A;  1IF1 A;  2PJ2 A;  1LDK B;  4U0W A;  1FJL A;  3D7H A;  3WTW C;  4GXH A;  5K8N A;  1TZL A;  2STT A;  3GZ6 A;  4H4K C;  3Q0V A;  2K9Q A;  2B58 A;  4I0A A;  4BKX A;  2Q43 A;  4TNU A;  4C2Z A;  2OCE A;  2PDO A;  3BQZ A;  1DGR M;  1IRG A;  4OME A;  2FIW A;  4BQN A;  1T39 A;  3KYD B;  1O4X A;  4CYQ A;  3ZMU A;  3IV5 A;  2XRO A;  5F1R A;  4IKF A;  2CXA A;  1B6A A;  2A4N A;  1ODD A;  3ZPL A;  5D8K B;  1GHE A;  1Z8L A;  3IFE A;  4UEF A;  2A6H F;  2FE7 A;  3R61 A;  4E7I A;  4RS2 A;  2XGD A;  2RC4 A;  1FIP A;  5EEH A;  4LJZ F;  5FD5 A;  5E3O A;  3EUH A;  3GY9 A;  1Z9C A;  4UEZ A;  3BG7 A;  3GFJ A;  4AYB N;  2F48 A;  4B3A A;  4RGX A;  1Y7E A;  4I98 B;  5H86 A;  4HNV A;  4J00 A;  4NHJ A;  3KZY A;  1JKR C;  5DD8 A;  3H9G A;  3QB8 A;  5HVF A;  4DZP A;  2VOO A;  5M3M J;  1AU7 A;  2IP2 A;  3FK7 A;  2RN7 A;  2LVS A;  2L7M P;  1VQP I;  4Y49 C;  2CFO A;  3S1M J;  3KHZ A;  4C9Y A;  3CDH A;  4E7L A;  2L7F P;  2PVV A;  1PJR A;  3GBG A;  3RYO A;  5FO5 A;  1M1D A;  3GTG J;  2YGW A;  5AG6 A;  1AKH A;  1EKE A;  5CQG A;  5EGO A;  2HU9 A;  4M6V A;  4HG2 A;  2Q4Y A;  1OCZ H;  3Q0U A;  4OU0 A;  5CVI A;  1MJB A;  2WAQ N;  4AIH A;  2W85 A;  1VQ5 I;  5GPA A;  2RRE A;  4ITV A;  1SFE A;  3ZQ7 A;  3K4B A;  3LFU A;  1U8R A;  4BBR J;  3NA6 A;  1UCR A;  4UNO A;  4UIB A;  2JEW A;  3I0T A;  2BEI A;  4MLO A;  2EH3 A;  4NBQ A;  2Q8K A;  2K5T A;  3K2A A;  5KTD A;  3HUV A;  4D0P A;  3I56 I;  3MWM A;  4QVT A;  1LKX A;  2HNH A;  1DP7 P;  3M07 A;  4UXN A;  3KLO A;  3QAY A;  1R4N B;  3S1R J;  2EFN A;  2IA1 A;  2XDV A;  4KUM A;  3BDD A;  1P4N A;  4ZTJ A;  3HPH A;  4RAY A;  1YLE A;  2B0L A;  1AKH B;  4HV5 A;  2EPF A;  3G73 A;  3IO1 A;  2OOT A;  1VGY A;  4CPA A;  4EV0 A;  4GM5 A;  4C2Y A;  1R7J A;  1V5E A;  2VBQ A;  4L5E A;  3VDX A;  1IID A;  3VSL A;  1B9N A;  1X10 A;  6PAX A;  3S6F A;  1VND A;  1VQ7 I;  3FVL A;  3IC7 A;  1SD4 A;  4PPZ A;  2FRH A;  4BHC A;  4W9Y A;  2XSD C;  2O5R A;  3TOA A;  5K7F A;  2HQY A;  3OIP A;  5LRR A;  1QPI A;  3HC7 A;  2ME6 A;  2VXD A;  4XID A;  1HLV A;  4U87 A;  2MLK A;  3JRH A;  2KRF A;  4XOR A;  3I1U A;  2CFX A;  5DV5 A;  3GIU A;  4DYO A;  1IDZ A;  1CPS A;  4A5N A;  2LNB A;  3GYH X;  5ILV A;  4KSF A;  3CMA I;  1R6R A;  2J8N A;  2ZO4 A;  4PJM A;  3Q5F A;  5EZH A;  2G3A A;  3TW7 A;  3ZQG A;  2JVH A;  2UXN A;  1O57 A;  2XF6 A;  4I2O A;  1R43 A;  5CNP A;  5I0C A;  5EYR A;  4KOX A;  2F5F A;  1BC7 C;  3JVN A;  3K9U A;  3SDG A;  1CF7 A;  1NG7 A;  1SQH A;  1XD7 A;  5LHG A;  5F0C A;  1Z7L A;  4X3R A;  3H3U A;  4G7H F;  3FBI B;  3ISP A;  1Y0R A;  4Q5S F;  1U5T B;  1DU0 A;  1I1D A;  1CBX A;  2JA2 A;  2HTS A;  5F0F A;  3MGD A;  1A31 A;  5AG5 A;  3GLL A;  3S14 J;  2G9D A;  2HDW A;  3BR6 A;  5JFR A;  2I3C A;  4P10 A;  5LGU A;  2Y31 A;  1YOV B;  2FUG 2;  3WTY C;  2MLG A;  2VQH A;  1ARM A;  1RR7 A;  2F4I A;  1FNO A;  2A69 F;  3P7N A;  5A27 A;  3R9G A;  4H6Z A;  1GHC A;  3CUQ B;  2FSW A;  1YW6 A;  3SI0 A;  1PP7 U;  2L3D A;  2Z5U A;  4I99 C;  4BE2 A;  2QIR A;  1J2X A;  4RAG A;  1K4S A;  4ESB A;  4G12 A;  3I53 A;  2ID6 A;  3EET A;  3FXJ A;  1ZH5 A;  2R7Z J;  2VPL A;  1TW3 A;  2BVL A;  5FD6 A;  2ZSH B;  4KN4 X;  1Z9U A;  2NVQ J;  2O3F A;  5TJJ A;  1G3Y A;  1BR4 A;  4HF0 A;  4LLL A;  2HQ5 A;  2MC3 A;  1N77 A;  2WC2 A;  2NVX J;  3W6V A;  4YU9 A;  1IY7 A;  3RIR A;  4PCQ A;  1V5G A;  1SEU A;  3FXO A;  2E1O A;  2EK9 A;  2L9V A;  4V2F A;  1F1Z A;  4XLH A;  3W6J B;  2DPU A;  2E2J J;  1IYL A;  3PFE A;  1BW6 A;  4CS0 B;  2X85 A;  4XPL A;  2E60 A;  1MBG A;  3D5R C;  3HSE A;  3K69 A;  3QWL A;  1YTY A;  3BJ7 A;  1ENH A;  4MCR A;  4HNT A;  2W57 A;  1KUX A;  2PG4 A;  4II9 A;  3T0Y A;  4XM3 A;  3KFW X;  3I4P A;  2E7X A;  3FH4 A;  2O6G E;  1ZTR A;  2JQ7 A;  4NGR A;  4A0Z A;  3CT9 A;  4H2K A;  3IKV A;  2OV7 A;  3CMM A;  3ABM H;  3BRO A;  4A2Z A;  1WFX A;  2IRF G;  4FQG A;  2BCO A;  2QF7 A;  5HMN A;  2PJ3 A;  4G1P A;  3P5J A;  1H8A C;  2L9N A;  3W3C A;  4IX7 A;  3FX3 A;  2H1K A;  2C27 A;  4N0B A;  4O6J A;  5FVJ A;  1SD6 A;  1VQM I;  1UG2 A;  3FXQ A;  4MXU A;  2VBY A;  3F8F A;  5IX3 A;  3QOP A;  4HRI A;  4C7H A;  4X6A J;  2QLZ A;  1Q2C A;  1P7I A;  3CXQ A;  1RUO A;  3GTP J;  5JPH A;  4ONU A;  1WCM J;  4NQW A;  4YII A;  2QEC A;  4OIN F;  2HPM A;  1X2M A;  3WOD F;  3LD2 A;  4MGR A;  3RYP A;  3DPL C;  3P2H A;  3EUH C;  4BJ5 C;  4ZYE A;  3LMS A;  3S6K A;  2M0M A;  3WGG A;  4BY1 J;  2Q4V A;  4KZT A;  2ELJ A;  2VI6 A;  3LSI A;  2Y9Y A;  4P4J A;  4EWT A;  3HTU A;  3ML6 A;  4P9U A;  5EMI A;  3RKY A;  4DIQ A;  3HL2 A;  2YUS A;  2NS8 A;  3OIO A;  1U9O A;  1KQ0 A;  1MK4 A;  2NVT J;  4XRM A;  5K7H A;  2QJ8 A;  2VL8 A;  2EFP A;  4IEJ A;  2X9D A;  4LQG A;  4Z65 A;  1IV8 A;  2CUZ A;  1ZAR A;  4D7N A;  5LRS A;  1XN7 A;  3KP2 A;  4MTE A;  2E5Z A;  2QQ8 A;  5F6F A;  3ZN1 A;  5HVH A;  4HBL A;  2V1D A;  1Y7R A;  1F36 A;  4ZZL A;  4BY7 J;  1IB1 E;  5C82 A;  3EQL F;  3M8E A;  3LNQ A;  1ETQ A;  2X48 A;  2B63 J;  1ZGA A;  3KR5 A;  1OPC A;  4L8A A;  3BOQ A;  2WAF A;  2EA2 A;  2CV0 A;  1QMU A;  3RZA A;  1VKC A;  4FIS A;  4QUS A;  2OQR A;  3L2V A;  5JHF A;  4U7D A;  1AOY A;  5IT9 Z;  2DMU A;  5JLW A;  1VHE A;  2M7B A;  2LRE A;  1X1A A;  2O8X A;  5JHU A;  4XIC A;  4HQM A;  1H88 C;  2CJJ A;  1TKH A;  3U2R A;  3I58 A;  1BI1 A;  3ZR8 X;  1VQO I;  1DQU A;  3HOV J;  2AFM A;  5DEQ A;  1G2H A;  3Q3S A;  4NC6 A;  4QIW N;  1VIX A;  4ANJ A;  4UY8 I;  3RDI A;  1VTN C;  4C30 A;  1G8X A;  4HF2 A;  4CCO A;  2Z3P A;  4M3D A;  4FD5 A;  4HEA 2;  4KOU A;  4GCV A;  1A36 A;  3D1N I;  4X8I A;  2BW3 B;  3WAB A;  4WXD A;  3IIB A;  4JZ0 A;  1YJN I;  3GXO A;  1X1C A;  2CQQ A;  1YI2 I;  1DE4 C;  1ZLJ A;  2LLK A;  4EME A;  2NNY A;  5IY5 H;  1LB2 A;  1FBQ A;  1GXQ A;  2FBK A;  5FJ8 J;  3F23 A;  3PO2 J;  3W2V A;  2CSO A;  1VHS A;  3BP8 A;  1JXS A;  4WWC A;  1I5Z A;  1KYZ A;  5KAF C;  2GQQ A;  1JWQ A;  4IAV A;  4OAE A;  2ODF A;  1N75 A;  5KTA A;  3E5U A;  3NFZ A;  1QST A;  2OJE D;  5D8L B;  3BPV A;  4A3K J;  1FC3 A;  1HEE A;  4KYW A;  4IUS A;  4MO7 A;  4E0A A;  1KU2 A;  1YQA A;  2PRQ A;  2OR4 A;  1WSU A;  4M3S A;  4OMY A;  2K7L A;  5G22 A;  2JA7 J;  1ON1 A;  3ZMS A;  1WI3 A;  5DUI A;  4BAC A;  1QBJ A;  4AD9 A;  4CGL A;  2Z10 A;  5JVG F;  2FCK A;  1YS6 A;  4K2E A;  3JTG A;  2DOE A;  2KIQ A;  4O5V A;  3ZXS A;  3TO7 A;  5CBM A;  3HGG A;  3V8J A;  1Q1V A;  5ICG A;  5HOD A;  3AKZ A;  2QSG X;  4RM2 A;  2Q7S A;  4GYI A;  4MFQ A;  3K70 D;  3TDZ C;  2LF8 A;  3B02 A;  4L5J A;  2XF7 A;  1YRN A;  2D1V A;  3F0A A;  1QRY A;  3TBI A;  3R9E A;  2H09 A;  1ZHF A;  2FSR A;  1POG A;  2FBH A;  3IP4 B;  2L0K A;  2W24 A;  2QCO A;  2QYO A;  4PK4 A;  3U9G A;  4NJQ A;  5LYD A;  3D0S A;  2EB7 A;  3CXS A;  1YJW I;  1ZRC A;  2W00 A;  3P9C A;  1GUU A;  2L4A A;  1ZG5 A;  2REF A;  4AIJ A;  4FX0 A;  2ARH A;  1J0R A;  4IHW A;  2M5W A;  3HLP A;  2GXB A;  2CNT A;  4BGD A;  2FOK A;  1Y9K A;  3WGI A;  4A5M A;  2ETH A;  3BZC A;  3ZP5 A;  4RI1 A;  4R3K A;  4A32 A;  2OC6 A;  1HKS A;  4PGG A;  3E5X A;  3V7C A;  1W7P B;  3B2Y A;  3CDL A;  1ZN2 A;  5K7Z A;  2IA0 A;  3FXK A;  4C68 A;  2WAD A;  1MSF C;  1YW8 A;  2P6F A;  3I3G A;  5CJ9 A;  2K27 A;  2LK2 A;  2ZXJ A;  1KA8 A;  1FP1 D;  1R5H A;  2EFO A;  1J9I A;  4Q48 A;  2ZEM A;  5F08 A;  3JAM Z;  1LUJ B;  1S5K A;  3R0J A;  2G7U A;  2M9H A;  4XKV A;  3KR4 A;  5ICC A;  2ZEP A;  3IJ3 A;  4X0G A;  3CCR I;  1YIJ I;  3D8P A;  2HYF A;  1Y1V J;  1WJE A;  5BPI A;  3K4L A;  1B1B A;  3JAM K;  1LEB A;  2CIJ A;  4CCK A;  2OTJ I;  3CTA A;  1ZRE A;  1YVK A;  4EGY A;  3A03 A;  3J80 Z;  5BPD A;  5L3G A;  4Y3O A;  1W7P D;  2JLM A;  4MIM A;  2V8H A;  1F43 A;  1ZG7 A;  2CU7 A;  2E35 A;  2MSY A;  2UZK A;  2XEF A;  3LAC A;  2ESN A;  2MC4 A;  3TFY A;  3E7L A;  3BCA A;  1RKT A;  1BI0 A;  4XLA A;  4S05 A;  1K78 B;  2VI7 A;  2W1O A;  3KGQ A;  2FMY A;  1KWM A;  3EDP A;  3PB4 X;  3O8H A;  1XGM A;  3OWC A;  4G6T B;  1Y0Y A;  3PB6 X;  3T5X A;  4OIQ F;  1UWY A;  1QSM A;  2DFF A;  2B7E A;  4R9M A;  4CYD A;  3DXJ F;  3V7R A;  4FE4 A;  4XRS G;  2VE8 A;  3HUG B;  2R7T A;  2COM A;  1FNN A;  3FMQ A;  2E5N A;  1XGN A;  3ZMV A;  5D4R A;  2ESH A;  4XKW A;  3M8J A;  4IJA A;  2Z33 A;  2UWM A;  2PJ4 A;  5A28 A;  2H1L A;  3SI2 A;  3GZN B;  3O2P E;  4HW0 A;  2BE5 F;  1RPW A;  1OZP A;  2L54 A;  2YR2 A;  4P4B A;  3WG9 A;  2NNN A;  4Y7N J;  3GFI A;  3IWF A;  1FP2 A;  2TRT A;  3I64 A;  4CCN A;  3IH4 A;  3CCM I;  2O8K A;  2RGV A;  1YRE A;  2ZKZ A;  3KZI C;  1Y8Q B;  4Y52 J;  4PFP A;  4WXC A;  1IXR C;  3SI1 A;  2E2I J;  1OCP A;  5B1B H;  2OH1 A;  5TRD A;  3RAM A;  1UB9 A;  2ZC2 A;  2CNM A;  2DFE A;  1MBK A;  2P6E A;  1LDJ A;  4NXY A;  2OUM A;  3VWB A;  4JD6 A;  2Y9Z A;  2DPT A;  3H5R A;  1MSE C;  1BL0 A;  3VAR A;  3WR7 A;  1AWC A;  5M5Y J;  4A3F J;  4QB9 A;  3SFI A;  2E2H J;  2B4D B;  4JXQ A;  2YPR A;  4A38 A;  4XPD C;  3S9N A;  1D1B A;  2QZ8 A;  4NGN A;  1QZZ A;  3SQN A;  1Y6I A;  4PJJ A;  1FMW A;  1WH5 A;  2CMP A;  3VYR B;  2GM4 A;  2JPB A;  1EJ9 A;  4PJN A;  2DO7 A;  2JZY A;  3DP7 A;  1XMB A;  2ZXV A;  2OA4 A;  4M85 A;  4XPD B;  5HVQ C;  3I3L A;  3R1K A;  4J01 A;  3PEI A;  5LGT A;  2MBF A;  3FWE A;  4GXO A;  4EVI A;  1BC8 C;  4UB6 C;  1ZAO A;  5HS7 A;  1X1B A;  5E3N A;  1S5L C;  1GYT A;  2HR3 A;  3EO4 A;  3IGR A;  1OJL A;  5BWA B;  2DTR A;  3DTK A; 
#chains in the Genus database with same CATH homology
 3HKZ A;  2GAN A;  1X1D A;  5HH1 A;  2Z3N A;  4XR6 A;  4CH7 A;  4KOV A;  5EC4 A;  2LC2 A;  2CV1 A;  3K4M A;  4QPO A;  1U0J A;  4FAS D;  2HV2 A;  4KOY A;  2M4K A;  2Q2E B;  4NUB A;  4R3L A;  3OYD A;  1LDK B;  2R7H A;  4XL9 A;  1HA8 A;  1TZL A;  1MJA A;  1DGW Y;  2MD0 A;  2VIX A;  1U6M A;  3F9K A;  3K4C A;  4H4K C;  3CF2 A;  3W2A A;  2JDD A;  4A33 A;  2B58 A;  4MFZ A;  5CPR B;  4CA0 A;  2V9K A;  2MAB A;  2YNE A;  3OYG A;  1OLT A;  3DEE A;  2PDO A;  4UWJ A;  4C2Z A;  2E1M C;  1DGR M;  3K6G A;  3SHP A;  2OU2 A;  2FIW A;  2Q44 A;  4BQN A;  2R7W A;  3OYB A;  3DDD A;  3IAM 2;  4CYQ A;  3D3S A;  2ZW7 A;  3E0K A;  3OL3 A;  2XC7 A;  4IKF A;  2CXA A;  1QU3 A;  2A4N A;  2HVQ A;  2VQY A;  4ZGY B;  2W7N A;  3H4Q A;  4MJ8 A;  4LG3 A;  4N4O B;  3C2H A;  2MFZ A;  4E4H A;  5HNH A;  3DNS A;  4PUS A;  4C2X A;  1GHE A;  4CGP A;  3CJQ B;  4XLE A;  3OR2 C;  2BW3 A;  4B5O A;  2FE7 A;  2Z3K A;  4E7I A;  4RS2 A;  2RC4 A;  3K4J A;  1PYV A;  4BQO A;  2IGO A;  2KP6 A;  3GY9 A;  4OWR B;  2DT6 A;  3BG7 A;  3OYI A;  2KCW A;  2WY7 Q;  4DBQ A;  5H86 A;  3LSG A;  4PK3 A;  3K4N A;  2JEV A;  3H9Q A;  4J00 A;  4KVX A;  3H9G A;  3QB8 A;  1YX3 A;  3LSH A;  2R1I A;  4KLV A;  3MMY B;  4CRY B;  3DR6 A;  1W36 D;  3KKW A;  4ZC3 A;  4Y49 C;  2CFO A;  4NSQ A;  1D0Z A;  4C9Y A;  3DWL E;  4E7L A;  2BVM A;  1L0C A;  3I9V 2;  1PJR A;  2DJI A;  3GBG A;  3S3M A;  1UFH A;  4C2U A;  2XSJ C;  4ZTF A;  2ZW4 A;  1M1D A;  3RYO A;  3S3O A;  2OZG A;  2YGW A;  5AG6 A;  2YNC A;  4DOZ A;  2IS2 A;  2LH9 A;  5CQG A;  2L2O A;  1GLN A;  2VQG A;  4JLY A;  2HU9 A;  5KTC A;  4HG2 A;  2Q4Y A;  1EA3 A;  2V1N A;  4NNJ A;  3ZGK A;  2Q7B A;  1MJB A;  2RRE A;  4ITV A;  4IQ4 A;  4IF5 A;  3K4B A;  3LFU A;  4BJT A;  3RTR A;  3I9S A;  4KOT A;  2BEI A;  4BBH A;  4MLO A;  3FBN B;  2F6C A;  3DU6 A;  3HPG A;  3R9F A;  4B13 A;  1PUA A;  4BXF A;  3BC8 A;  2K5T A;  4I49 A;  5KTD A;  4XKC A;  1S9H A;  4MFK A;  3ZJ0 A;  1S7L A;  4ZDO A;  3F5B A;  4QVT A;  1M44 A;  3QYE A;  1LKX A;  2IGK A;  2HNH A;  2VKH A;  2R7U A;  4N4N B;  4C7I A;  3PL8 A;  3PJR A;  4BQQ A;  4CAV A;  2KLO A;  2XDV A;  1I21 A;  1KUY A;  1P4N A;  4RLF A;  2I00 A;  4KIT B;  4ZTJ A;  4XLF A;  3HPH A;  2WPW A;  1YLE A;  4CCJ A;  4UBR A;  5F46 A;  1T0F C;  3OYF A;  1UEL B;  3ZCO A;  3S8P A;  4C2Y A;  1V5E A;  2VBQ A;  2X1E A;  3VDX A;  1IID A;  1SAU A;  3VSL A;  2BOL A;  3W2W A;  4X5K A;  2Z0Z A;  3FXT A;  3S6F A;  2VKD A;  2DXQ A;  5KHD A;  1X4P A;  1N71 A;  3PNT A;  4E8O A;  3JUW A;  2O5R A;  3TOA A;  4AB7 A;  2HQY A;  2R7O A;  3OIP A;  4KSA A;  4PV6 A;  2M4G A;  4ZJZ A;  1NE9 A;  3HC7 A;  2VXD A;  4C2T A;  4MFL A;  4U87 A;  3H9J A;  4XOR A;  4F3Q A;  3T90 A;  2BSW A;  3TL4 X;  3PUB A;  4E7Z A;  2F5I A;  2JDC A;  2WBM A;  5DWM A;  2PJR B;  2R7Q A;  4EVY A;  1LFP A;  1Z4R A;  1BO4 A;  3DQV C;  3OYK A;  2PC1 A;  2UUZ A;  2Z11 A;  4KJZ A;  4II3 A;  3BLN A;  4KSF A;  5F49 A;  2ATR A;  2W4S A;  4CYO A;  1R6R A;  2J8N A;  1N78 A;  1MW7 A;  4PJM A;  2G3A A;  4B47 A;  2EUI A;  2JVH A;  5CNP A;  2XF6 A;  4HST A;  2X6X A;  1XEB A;  5I0C A;  4NC8 A;  3SEQ A;  4KOX A;  4Q38 A;  3JVN A;  4E6K G;  3K9U A;  1NG7 A;  5J8F A;  4BDZ A;  4HNX B;  4U7B A;  4XNH C;  1W36 C;  3OYL A;  1Z7L A;  2ZFU A;  3H5N A;  4B44 A;  1D1A A;  3DPT A;  3FBI B;  3FYN A;  4Q36 A;  2VJJ A;  5E96 A;  2WY8 Q;  4XON A;  2V7F A;  3H0D A;  4Y49 B;  1Y9W A;  1OR7 C;  2GOM A;  4BMH A;  1I1D A;  4XNF A;  1ERD A;  1Q2Y A;  2JA2 A;  3S93 A;  1SQH A;  3MGD A;  1BR2 A;  4K30 A;  5AG5 A;  3DKX A;  3TO6 A;  2HDW A;  1YK3 A;  4B12 A;  1MMG A;  4NEX A;  2Y0S A;  3TTH A;  2FUG 2;  2H5M A;  4RLQ A;  2VQH A;  5A27 A;  2JVG A;  2F4I A;  3HG9 A;  4OAD A;  2CH0 A;  3CP8 A;  3W6X A;  3IWG A;  3R9G A;  4H6Z A;  1J09 A;  1QSR A;  2QIR A;  3VWD A;  2L9S A;  4BE2 A;  2KDO A;  1CJW A;  3C26 A;  2DXI A;  1J4J A;  3HXL A;  2JUG A;  3DKY A;  3D5L A;  4AU7 A;  2PR1 A;  2FT0 A;  1KUV A;  1G59 A;  2BVL A;  2VPL A;  2ZSH B;  3KX2 A;  1Z9U A;  4IQJ A;  1XIX A;  2ZSI B;  3K4K A;  1BR4 A;  2Q1Z B;  5G20 A;  4CYN A;  2NMT A;  1N77 A;  3DTI A;  4U9Z A;  4KT6 A;  3T9Y A;  3D2M A;  4L89 A;  2YND A;  3V8I A;  3OWT A;  4CCL A;  5TGT A;  2VJ5 A;  3S3N A;  1V5G A;  1RXT A;  2HUZ A;  4EAT A;  4BS9 A;  4XLC A;  3A4C A;  3LSK A;  4PSX A;  4KLW A;  3DR8 A;  1I12 A;  4F0X A;  2XAU A;  4XLH A;  4FD6 A;  4MFP A;  4CUG A;  3OYE A;  1IYL A;  2AE6 A;  3RSN A;  4JXR A;  4CS0 B;  2WAQ A;  2X85 A;  4XN0 A;  4B5P B;  4XPL A;  2E60 A;  1KON A;  2RNG A;  3D5R C;  3BJ7 A;  4CSW A;  4II9 A;  4HNT A;  3PNY A;  1KUX A;  1S60 A;  2LRD A;  1TT0 A;  2ZXH A;  2KRC A;  4XM3 A;  2Z3O A;  4KVM E;  4OLL A;  2IGN A;  3V42 A;  3KYL A;  4OAZ A;  1KZF A;  4PJL A;  2OV7 A;  1MMD A;  3CMM A;  3JTK A;  4A2Z A;  4AG7 A;  4NC7 A;  1WFX A;  1JI8 A;  3IAS 2;  4FD4 A;  3A1Y A;  3CZ6 A;  1M4G A;  1YR0 A;  3FNC A;  5HMN A;  1MMN A;  3OS2 A;  2L9N A;  3W3C A;  3EUA A;  4IX7 A;  3R96 A;  2C27 A;  3RCO A;  2KZV A;  3BG6 A;  3FIX A;  3TT2 A;  4KS9 A;  5FVJ A;  2R7X A;  1YX0 A;  2IS4 A;  4AYB A;  1D0Y A;  3EPZ A;  5FRM A;  2WSA A;  2IS6 A;  3FB3 A;  4LUA A;  5HNF A;  5IX3 A;  4HRI A;  4C7H A;  3N7Z A;  1YE9 A;  1Z3X A;  1WK4 A;  2CW8 A;  2I79 A;  1Q2C A;  4AVA A;  3FKJ A;  2KMU A;  3FHN A;  1Z4E A;  2X1C A;  4YEJ A;  3CXQ A;  5JPH A;  3HOS A;  4ONU A;  4CAX A;  2QEC A;  3LD2 A;  4MY3 A;  1SFK A;  2HPM A;  4J3G A;  1V5F A;  4GS4 A;  1DP3 A;  1MMA A;  3DPL C;  1AA7 A;  2VEZ A;  3P2H A;  3EUH C;  3FDY A;  4BJ5 C;  3PZJ A;  3D5S C;  4QC6 A;  3S6K A;  2M0M A;  1M4I A;  1XE4 A;  4D9J A;  2Q4V A;  4KZT A;  4R87 A;  4NQW B;  2ELJ A;  4YGO A;  3PSI A;  3P2F A;  3A9L A;  4E7S A;  3LSI A;  2REE A;  2D4O A;  2M3A A;  1QHH D;  4DIQ A;  3W91 A;  3HL2 A;  3L2U A;  1V0C A;  3ZRG A;  2LY2 A;  2WPX A;  2L5Q A;  1S7K A;  1MK4 A;  1MJ9 A;  1P0H A;  1Z3Y A;  2ZPA A;  2VL8 A;  4LIU A;  1UG0 A;  2CNS A;  2RQQ A;  2CUZ A;  1WWZ A;  1LRZ A;  2PR8 A;  2X7B A;  1X19 A;  2G3T A;  5LFA A;  3QAH A;  2ZW6 A;  4B5P A;  4BE1 A;  2E5Z A;  3OY9 A;  1QSO A;  1Y7R A;  1IRX A;  1IB1 E;  5C82 A;  2KQR A;  3TMO A;  2J8M A;  2GOX B;  4MFJ A;  3VWE A;  2X51 A;  4L8A A;  3IUO A;  2WAF A;  2FIA A;  2CV0 A;  2GE3 A;  4XMY A;  2P0W A;  1VKC A;  2EVN A;  2G0B A;  4QUS A;  3L2V A;  5JHF A;  2Z16 A;  2B5G A;  4ZBG A;  4II2 A;  2JSP A;  3QOD A;  1D0X A;  4CCM A;  4R79 A;  1YX5 A;  2M7B A;  2LRE A;  1X1A A;  2VB6 A;  4B3X A;  2KRH A;  2F5V A;  4B43 A;  5LD2 C;  1QSN A;  4F91 B;  4AVC A;  2PMZ A;  2B4D A;  3TO9 A;  3ZR8 X;  5JQ4 A;  1DQU A;  5F48 A;  3R95 A;  4HNU A;  5G1Z A;  2DOA A;  2VQL A;  4AVZ A;  4ANJ A;  4CGO A;  3B8G A;  4C30 A;  2R8V A;  4CGN A;  1G8X A;  2XF5 A;  2NOJ B;  3BLY A;  1Z21 A;  4CCO A;  4DBR A;  2Z3P A;  4HEA 2;  4FD5 A;  4KOU A;  5GCN A;  2K9M A;  2YNC C;  4BDY A;  3EC4 A;  2BW3 B;  3EY5 A;  4CRZ B;  5AGE A;  1X1C A;  5KNL A;  4HKF A;  3LMM A;  3OYM A;  4FD7 A;  4KVO E;  1K6Y A;  3AL0 B;  3PGP A;  1BOB A;  4UCN A;  2I8D A;  4DNC A;  1VHS A;  3W2V A;  3VSK A;  2VJI A;  1FMV A;  2AJ6 A;  4OAE A;  2FXF A;  5EBV A;  3UR3 C;  1N75 A;  3N05 A;  5KTA A;  4XKB A;  3ONQ A;  1QST A;  4YFJ A;  3CXP A;  5FRO A;  5ISV A;  4IUS A;  1S3Z A;  2PSW A;  4E0A A;  4JQF A;  2O28 A;  4NF1 A;  3FBU A;  2UV1 A;  1FY7 A;  4ORF A;  3S6G A;  5G21 A;  4M3S A;  4KUA A;  5G22 A;  2X6Y A;  2DCE A;  1R57 A;  3L2W A;  3G2B A;  2K5C A;  4BAC A;  4XN3 A;  1IIC A;  1UAA A;  2OZH A;  3DU5 A;  2Z10 A;  2FCK A;  4CGL A;  5IV0 A;  3ZXS A;  3TO7 A;  2QKM B;  3SEZ A;  3AKZ A;  3HOT A;  4RM2 A;  3KEY A;  3MD2 A;  3ZQQ A;  3BJ8 A;  4XOT A;  3K70 D;  3DSB A;  4MFQ A;  3DPU A;  3F0A A;  2LY1 A;  2XF7 A;  1S7N A;  4BJ6 C;  3TBI A;  1RO5 A;  3OS0 A;  3R9E A;  4LIT A;  4XOP A;  4A30 A;  2PJR A;  2FSR A;  1IYK A;  2D4P A;  4A95 A;  2LOO A;  1YGH A;  4BEH A;  3EUK L;  3OR1 C;  4P1W A;  5HOO A;  4F6A A;  4BU2 A;  3IP4 B;  2R7S A;  3LOD A;  3E1S A;  1BR1 A;  3W6S A;  1XF8 A;  1VZ0 A;  2W82 A;  3CJR B;  2R7R A;  3TOB A;  4PK4 A;  2VXK A;  3SZG A;  4MI4 A;  4BUP A;  3CXS A;  3SXN A;  4IZZ A;  2W00 A;  3G8W A;  3H5A A;  2J8R A;  2REF A;  2ARH A;  2VQC A;  3NWS A;  3SYT A;  4ZYA A;  3OL4 A;  2CV2 A;  2CNT A;  4BGD A;  1Y9K A;  3LSM A;  4FET A;  2A5W A;  2ZXI A;  3OYC A;  1YVO A;  3PP9 A;  4RI1 A;  4CAE A;  4A32 A;  4R3K A;  4JXQ A;  2OC6 A;  2LBF A;  4UCM A;  4CAF A;  2Z1D A;  2HQA A;  1WJA A;  3LL7 A;  4E7J A;  3S32 A;  3OYA A;  4HNY B;  5H84 A;  2Q04 A;  1T95 A;  4C68 A;  2HVS A;  2HZD A;  3MKW B;  2WUU A;  2Y0M A;  2A6T A;  4NCZ A;  2WAD A;  2P6F A;  3I3G A;  2K9L A;  4UWI A;  1MND A;  4LIV A;  2ZW5 A;  2LG4 A;  4BL0 B;  3L2R A;  2IGM A;  1PU9 A;  4B11 A;  4UCP A;  4QBJ A;  1ZO0 A;  4Y33 A;  3SDB A;  1S5K A;  4MBU A;  5AG4 A;  2HPI A;  2IXS A;  2R7V A;  1LVK A;  2QKL B;  4XKV A;  4P5O A;  4YRV A;  2MYS A;  2AQE A;  1ZEL A;  2P6G A;  4JWP A;  4F92 B;  2GIV A;  4B14 A;  2K3P A;  4A31 A;  4F55 A;  4H6U A;  4X0G A;  3TE4 A;  3AFH A;  4E7H A;  2FS5 A;  3D2P A;  3A2K A;  3VYT B;  3D8P A;  4KIS A;  4XPK A;  1WJE A;  3MKZ A;  4U5Y A;  2VJ4 A;  2IS1 A;  3K4L A;  4CGM A;  3PFY A;  5HLT A;  4CCK A;  1E0E A;  4QPQ A;  2VXZ A;  2Z3L A;  2PQ8 A;  3F8K A;  4XNH B;  4CAW A;  2X6W A;  4ZDP A;  2L7K A;  3IU1 A;  2BL1 A;  2LBF B;  1YVK A;  4UFW A;  2R4G A;  3FRM A;  4UA3 A;  4HSR A;  4Y3O A;  3QYB A;  3OIQ A;  2KHM A;  2JLM A;  2WAE A;  2V6E A;  2X1D A;  3OS1 A;  4Y4R A;  3TCV A;  3EFA A;  4AVB A;  2MC4 A;  3VYU B;  3ZZI A;  4B10 A;  3RQ4 A;  1S7F A;  2WB1 A;  3TFY A;  3UY5 A;  3BCA A;  4DJA A;  2VZY A;  4KOS A;  3QOE A;  4XLA A;  2VI7 A;  2W1O A;  2Z3M A;  3H5Z A;  2V4J C;  2Q0Y A;  2KL4 A;  4G6T B;  3IWE A;  3OWC A;  3QYF A;  4JJX A;  5FRN A;  1X4O A;  1NMT A;  1QSM A;  3EXN A;  3NE7 A;  4MHD A;  3E0J B;  4E7K A;  3J7A Y;  4KUB A;  4R9M A;  1WJ5 A;  2KPM A;  2Z2S B;  4MY0 A;  3C2G A;  1TIQ A;  3OMY A;  3HUG B;  4BEH B;  3K70 C;  2R7T A;  1NSL A;  3SXO A;  2E5N A;  3RPU D;  3G3S A;  4KOR A;  4LX9 A;  1ON0 A;  4RMN A;  2E1M B;  4XKW A;  3M8J A;  5DWN A;  2UWM A;  2B5G B;  5A28 A;  3PNV A;  1P9Q C;  2M7A A;  2B3V A;  4BE0 A;  2CS3 A;  1OZP A;  1K4J A;  1B87 A;  2CY2 A;  2OB0 A;  5J8C A;  3UNG C;  4UFV A;  2AQF A;  2B4B A;  4H89 A;  2CUJ A;  3PSF A;  4CCN A;  2LYC A;  3DLA A;  2WA0 A;  5CKT A;  1YRE A;  1MNE A;  2V26 A;  3GKR A;  3K10 A;  4HNW B;  4PFP A;  2VLA A;  5IB0 A;  3NWT A;  4F93 B;  3OYN A;  3DTE A;  2OH1 A;  4E2A A;  4YEL A;  3H35 A;  2B3U A;  1WJF A;  2CNM A;  3CES A;  2P6E A;  4NXY A;  1QHG A;  2OUM A;  3VWB A;  4GRI A;  4OAY A;  2DPT A;  3H5R A;  2VZZ A;  3IU2 A;  4ZDL A;  3OOU A;  4JD6 A;  5F47 A;  4XQF A;  3WR7 A;  2HVR A;  4DGW B;  3OYH A;  1NG6 A;  2R98 A;  1Y56 A;  4CZC A;  3AL0 C;  3U21 A;  3S6H A;  4R57 A;  4QB9 A;  1M4D A;  2OZU A;  5C88 A;  4KOW A;  2B4D B;  4UFX A;  3BCB A;  1Q2D A;  3CP2 A;  1WJD A;  1WJB A;  4JOM A;  4PFO A;  5CQE A;  2DPS A;  4PSW A;  1XMT A;  4CYP A;  4XPD C;  1D1B A;  3L2Q A;  1Y6I A;  4PJJ A;  1FMW A;  2BUE A;  4U9Y A;  3VYS B;  2CMP A;  3VYR B;  4D1Q A;  4PJN A;  5AG7 A;  3M1C A;  2FL4 A;  4RM3 A;  3MKY B;  5KCM A;  2PRB A;  4YRH A;  2ZXV A;  4XPD B;  4M85 A;  5HVQ C;  3I3L A;  4B48 A;  3GYA A;  3R1K A;  4J01 A;  1WJC A;  2QML A;  2CW7 A;  2DT7 B;  4F0Y A;  2VAS A;  2IL4 A;  1D1C A;  1X1B A;  3EO4 A;  4AG9 A;  3IGR A;  4F52 A;  5BWA B;  1CM0 A;  3OYJ A;  4HPQ A;  3DTK A;  1B6B A;  4PK2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...