1KUYA

X-ray crystallographic studies of serotonin n-acetyltransferase catalysis and inhibition
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
166
structure length
166
Chain Sequence
HTLPANEFRCLTPEDAAGVFEIEREAFISVSGNCPLNLDEVQHFLTLCPELSLGWFVEGRLVAFIIGSLWDEERLTQESLALHRPRGHSAHLHALAVHRSFRQQGKGSVLLWRYLHHVGAQPAVRRAVLMCEDALVPFYQRFGFHPAGPCAIVVGSLTFTEMHCSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-ray crystallographic studies of serotonin N-acetyltransferase catalysis and inhibition.
pubmed doi rcsb
source organism Ovis aries
molecule tags Transferase
molecule keywords Serotonin N-acetyltransferase
total genus 44
structure length 166
sequence length 166
ec nomenclature ec 2.3.1.87: Aralkylamine N-acetyltransferase.
pdb deposition date 2002-01-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 1kuyA00
4H89A 2PC1A 2OZUA 4M85A 4FD7A 4B5PB 2OH1A 5IV0A 2GANA 4BMHA 2EVNA 4HNWB 2F5IA 2Z0ZA 4KUBA 2PDOA 3TO7A 3VWEA 5F47A 4KOYA 4H6UA 2OZHA 3E0KA 3F5BA 3R9EA 1KUVA 4ONUA 3DSBA 1MK4A 3G3SA 4KLVA 3R9FA 3R96A 1WK4A 4X5KA 1Y7RA 1NSLA 4L89A 2EUIA 4IF5A 5EC4A 4M3SA 3T90A 1XIXA 1QSTA 1PUAA 1KUYA 3TO9A 3FRMA 3P2HA 4Y49B 4YGOA 2REEA 3IWGA 4CS0B 3W6SA 1KZFA 1S60A 3TOBA 4UWIA 1LRZA 3ZJ0A 3KKWA 5E96A 2VBQA 1Y9WA 2B4BA 2QIRA 2HUZA 3PGPA 2I00A 5KTAA 2GE3A 4U9YA 4AVAA 5JPHA 3R9GA 2RC4A 1I21A 3GY9A 3IGRA 2QMLA 2GIVA 2FXFA 2VXKA 2B4DA 5HH1A 2VI7A 4QC6A 1Z9UA 3DR6A 5ISVA 3FIXA 3W91A 1IICA 3BJ8A 1M4DA 3BLNA 3TCVA 4HNYB 2BL1A 3D3SA 4KORA 4AB7A 1YR0A 3F8KA 1VKCA 3JUWA 5IB0A 4JXRA 3OWCA 4NXYA 4R9MA 4RI1A 1QSRA 4LX9A 2CY2A 5C82A 2G3TA 5DWNA 3EO4A 4JD6A 5DWMA 1S5KA 2IL4A 4R3LA 4KVOE 1R57A 4XPDB 1Z4EA 4JWPA 2J8MA 1S7NA 3PZJA 5F46A 3JVNA 3FB3A 2VQYA 4NEXA 3R95A 3W6XA 4E0AA 3FYNA 2J8RA 3D2MA 4QBJA 4CRZB 3TOAA 1GHEA 4LUAA 1QSNA 2CNSA 5H86A 1VHSA 1RXTA 1U6MA 2B3UA 1FY7A 3DDDA 3D2PA 1M44A 3TO6A 4J3GA 4YRHA 3TE4A 5KTDA 5FVJA 2JLMA 1CJWA 3SXOA 1MJAA 2OU2A 2R7HA 2NMTA 4FD4A 4NCZA 3EC4A 4KZTA 3R1KA 1L0CA 4E8OA 4HNXB 4UA3A 2BUEA 1XF8A 2Q4VA 4U5YA 4DNCA 1XEBA 2KCWA 4K30A 4L8AA 4HKFA 4KOSA 1I1DA 2Z11A 2P6EA 3P2FA 2P6GA 4UWJA 4KOTA 3FNCA 4KLWA 2ZW5A 4CAVA 2VZYA 4PK2A 2BSWA 1IYKA 3NE7A 1BOBA 2WPXA 2B5GB 5I0CA 4CRYB 4AG7A 1B87A 4XNHC 5J8FA 3C26A 4ZBGA 4PSXA 1UFHA 4XPKA 1YLEA 4I49A 1P0HA 3S6FA 4CAXA 4UBRA 1ON0A 2R98A 4Y49C 5KTCA 4QVTA 3ZZIA 4KOVA 4IUSA 1K4JA 3MGDA 4KOWA 1S3ZA 1YK3A 2FS5A 4NSQA 2VEZA 3QB8A 2JEVA 4OLLA 5GCNA 3S6GA 4II9A 3G8WA 4E2AA 1YVKA 3S6KA 3B8GA 1YGHA 2B4DB 2P6FA 1IB1E 3K9UA 2FL4A 1Z4RA 1BO4A 4OAEA 2FSRA 3FXTA 2FIWA 2ARHA 1S7LA 2P0WA 2B58A 3GYAA 3CXPA 2G3AA 4OADA 4AVBA 1Q2DA 1QSMA 4MJ8A 4JXQA 3GKRA 4KUAA 1RO5A 2ZW6A 2D4PA 4MY3A 2PSWA 4MBUA 2ZW7A 3LD2A 3F0AA 4YFJA 1M4IA 1N71A 3DR8A 2Q4YA 5JQ4A 3T9YA 1NMTA 2G0BA 2BEIA 1YVOA 3PP9A 4QB9A 4FD6A 4KVME 5F49A 3N7ZA 4FD5A 2PQ8A 2OB0A 5J8CA 2QECA 4AVCA 1Y9KA 2C27A 4KOXA 4U9ZA 3CXQA 3I9SA 2Q0YA 1M1DA 4F6AA 2O28A 1TIQA 2Y0MA 4KVXA 4F0YA 4QUSA 2ZXVA 3TTHA 3EFAA 4CAWA 1S7FA 2FCKA 3FBUA 2J8NA 4B5PA 1IYLA 2VZZA 1Q2YA 2D4OA 1CM0A 3V8IA 1J4JA 1IIDA 2PR1A 2HV2A 1KUXA 2ZW4A 2PRBA 2REFA 4MY0A 2Z10A 1P4NA 3DNSA 1XE4A 2AE6A 4PK3A 2Q04A 3S6HA 1B6BA 3EY5A 4R3KA 2FIAA 1WWZA 2JDDA 1V0CA 1SQHA 1QSOA 4ORFA 1XMTA 4B5OA 4EVYA 1MJBA 2OZGA 4AG9A 5HMNA 2B3VA 5CNPA 3D8PA 5H84A 4JJXA 2HQYA 4XPDC 4MHDA 3SHPA 4JLYA 2Q44A 1OZPA 1NE9A 1M4GA 3RYOA 3EXNA 5F48A 4XNHB 4R57A 3BJ7A 3VWDA 2B5GA 3SXNA 4R87A 2DXQA 4PV6A 4NF1A 5C88A 3LODA 2K5TA 3QAHA 2ZPAA 4RS2A 1I12A 2Q7BA 2JDCA 2A4NA 4MI4A 3I3GA 2R8VA 5EBVA 3TT2A 4H6ZA 1MJ9A 4XPLA 1YX0A 2H5MA 2X7BA 2WPWA 3H4QA 2R1IA 2FE7A 1S7KA 2PR8A 2ATRA 2CNMA 2CNTA 2FT0A 4PSWA 4GS4A 3CXSA 3UY5A 1PU9A 3TFYA 1Q2CA 5IX3A 1YREA 4KOUA 3WR7A 2I79A 2AJ6A
chains in the Genus database with same CATH superfamily
4H89A 1F57A 2PC1A 2OZUA 3S9LA 4M85A 5AG5A 1BLLE 4FD7A 4B5PB 4NJRA 2OH1A 5IV0A 2GANA 4M6HA 4BMHA 2DF5A 2EVNA 3WABA 4HNWB 3V38A 4B11A 2F5IA 4OC1A 2Z0ZA 4UFWA 4KUBA 2PDOA 4RUHA 3TO7A 3VWEA 5F47A 4MHNA 2C6PA 2JEWA 4H6UA 4KOYA 1CG2A 2YNCA 3LMSA 1XMBA 2OZHA 1TXRA 3V7ZA 3E0KA 3PBBA 4UF4A 4WJBA 5A28A 2F7VA 3F5BA 2PCUA 2WUUA 3R9EA 1XFOA 4CYPA 4MMOA 1KUVA 4ONUA 3DSBA 1MK4A 3G3SA 4KLVA 4UEFA 3R9FA 4C7HA 4F9UA 3R96A 1WK4A 4X5KA 1Y7RA 3B3VA 1NSLA 4CAEA 4L89A 2EUIA 4IF5A 5EC4A 1ZG7A 3VH9A 4M3SA 4CYQA 3T90A 1XIXA 1QSTA 3PRTA 3PB8X 2ZEEA 4B12A 2GFQA 4A95A 1PUAA 1KUYA 5HXDA 2NYQA 1X12A 4PQAA 4A39A 4B10A 3TO9A 1IGBA 2ABZA 1RTQA 4Z65A 3FRMA 3P2HA 3NH5A 4M6IA 2PVVA 4OC4A 4Y49B 4P10A 4YGOA 3B35A 2REEA 2Q7SA 4KS9A 1ZO0A 5A27A 3IWGA 3RZAA 2QJ8A 8CPAA 2Z3LA 1CPSA 2GREA 4CS0B 1VIXA 3W6SA 1KZFA 1S60A 3TOBA 4UWIA 1LRZA 3ZJ0A 3IJ3A 3KKWA 5E96A 2VBQA 1Y9WA 4A37A 1ELLP 3NE8A 2B4BA 1Y0RA 2DPSA 2QIRA 2CXAA 5K8OA 1PCAA 2HUZA 2PE3A 3PGPA 2I00A 2CTCA 4CYOA 2OOTA 5KTAA 1DTDA 1YSJA 2GE3A 3GIUA 3H8EA 4R76A 4U9YA 4AVAA 4UEZA 5JPHA 2ZEGA 3R9GA 2RC4A 2WZNA 2DEAA 2YGWA 2ZOFA 1I21A 4BINA 3GY9A 3IGRA 4F0XA 2QMLA 4IAVA 1R3NA 1X10A 1M4LA 2FXFA 2GIVA 4P4FA 4PXBA 1LCPA 4ZX9A 2ZEPA 3FH4A 4MRIA 4ZY2A 4OIDA 2VXKA 4MHZA 2B4DA 5HH1A 2VI7A 3DR6A 1Z9UA 1CP6A 4P44A 4QC6A 5ISVA 3FIXA 3W91A 1IICA 1TF9A 3ISZA 2ZELA 3BJ8A 1M4DA 3B7IA 4H2KA 4MCRA 3BLNA 4OKOA 4OC2A 3GLJA 3KASA 5K8PA 3TCVA 4HNYB 2BL1A 3D3SA 4KORA 4AB7A 1YR0A 3SJFA 2CTBA 2ZEHA 3F8KA 1XBUA 1VKCA 3JUWA 4C2YA 5IB0A 4JXRA 1YW4A 3OWCA 4OIWA 2C6CA 3KGQA 4NXYA 3B3TA 4R9MA 4MCSA 4P4JA 4IHMA 4RI1A 4C2XA 3WC6A 1QSRA 4LX9A 4A33A 2CY2A 3KHXA 4FWUA 2G3TA 4UFXA 1EE3P 2IQ6A 3RO0A 5C82A 2F8HA 3LACA 5DWNA 2PIYA 4MFPA 2IMOA 3EO4A 4JD6A 5DWMA 2ZEOA 2Z3PA 3B3SA 3K2KA 2PJ6A 5CBMA 1S5KA 2IL4A 4NGRA 4R3LA 4KVOE 1R57A 4R8FA 3KQXA 4MFKA 3BHXA 4XPDB 1Z4EA 2YNEA 4JWPA 5EMIA 2J8MA 1S7NA 1UWYA 3A9LA 2Q43A 3KHZA 3PZJA 2V8VA 2WSAA 3IFEA 4FBEA 4P4DA 5F46A 3JVNA 3MRUA 3FB3A 4NGPA 2VQYA 4NEXA 3R95A 3W6XA 6CPAA 5K8NA 2ZEFA 1NSAA 4C7IA 2ZEMA 3D7FA 3PB7X 4E0AA 4NGTA 4X3RA 4M6GA 3FYNA 3PB6X 1ZLIA 2J8RA 1Z8LA 3D2MA 4CRZB 4QBJA 4UIBA 3IU1A 3TOAA 1Y7EA 1GHEA 1LOKA 4NFRA 2BO9A 3NFZA 4LUAA 1QSNA 2Z3KA 2I3CA 2CNSA 5H86A 4CGLA 3N5FA 1ARMA 1VHSA 4A94A 1RXTA 4MXUA 2PJ0A 4ONWA 1HEEA 1U6MA 3I1UA 2B3UA 2FVGA 2AFMA 2V77A 4DJLA 3ISXA 2J9AA 1FY7A 1XJOA 2GLFA 3D2PA 3DDDA 4PXCA 1M44A 4WWVA 4X8IA 5LYFA 3TO6A 1HDUA 4J3GA 4YRHA 3TE4A 1ARLA 5ELYA 5FVJA 5KTDA 2JLMA 1CJWA 3SXOA 1MJAA 2OU2A 3PEIA 2QYVA 1JQGA 2R7HA 4CGMA 3SI0A 2NMTA 2PJ9A 4FD4A 4NCZA 2AFOA 3EC4A 4KZTA 1YMEA 2ANPA 2Q51A 3R1KA 1L0CA 4E8OA 3NH4A 3KR4A 4HNXB 2BUEA 4UA3A 4W9YA 5AG6A 1XF8A 2PIZA 2Q4VA 4U5YA 3SJXA 4DNCA 1XEBA 2KCWA 4K30A 4L8AA 4HKFA 4KOSA 4MFJA 4MHPA 1QMUA 3NA6A 1I1DA 4F8ZA 1VGYA 2Z11A 2P6EA 1Z8TA 4OC3A 2C6GA 3P2FA 2P6GA 3KI9A 4NGSA 3PBEA 4UWJA 4KOTA 3H5ZA 5LRGA 2XEIA 3VATA 3FNCA 1TKHA 3IIBA 4KLWA 4IK2A 2ZW5A 4CAVA 1LAPA 4O23A 2PJ8A 2VZYA 3CPAA 4PK2A 2BSWA 1IYKA 1FNOA 3NE7A 3RNZA 1BOBA 1CX8A 3FVLA 2C1CA 4ZYQA 3TC8A 3JRUA 3FECA 3B3WA 2WPXA 5LYDA 2B5GB 3H8FA 5I0CA 4CRYB 4AG7A 5HVFA 1B87A 3SJEA 4K3NA 4DUKA 1IY7A 4B14A 4XNHC 5J8FA 2O4HA 3C26A 4ZBGA 4PSXA 3D67A 7CPAA 1UFHA 4P6YA 3BXMA 4XPKA 3WC5A 2JBJA 1YLEA 4I49A 1P0HA 4PXEA 1Z2LA 3K9TA 4UBRA 3S6FA 1ON0A 2R98A 4CAXA 3D7HA 4EFDA 4R7MA 4Y49C 4C2ZA 3H8GA 4QVTA 3ZZIA 5IB9A 4KOVA 5KTCA 4IUSA 5G1ZA 1K4JA 4BD9A 3MGDA 4KOWA 4P4EA 4CGNA 2OR4A 1S3ZA 1YK3A 2PJAA 2FS5A 1ZG8A 4NSQA 4ZI6A 1JWQA 2VEZA 3QB8A 1TKJA 2HC9A 2JEVA 2ZEDA 3IU2A 4OLLA 2Z3OA 5GCNA 3S6GA 4CYNA 4II9A 1AUGA 4KSIA 2PJBA 3G8WA 4E2AA 4UCMA 4UIAA 2BOAA 1KWMA 4A32A 1YVKA 3S6KA 4EWTA 3B8GA 2G9DA 4JZ0A 2Z3MA 4KSFA 1BPNA 4HPSA 2JBKA 1YGHA 2B4DB 5AGEA 2PJ1A 3D68A 3FEDA 3HLPA 2P6FA 1IB1E 4CGOA 4LQGA 1R43A 2IJZA 4OMEA 3PB9X 3K9UA 5AG7A 2FL4A 4TWEA 2O53A 5G21A 2V8DA 4MFLA 3FMCA 5THWA 1Z4RA 4EMEA 1BO4A 4OAEA 1VHEA 2RFHA 4A38A 4P45A 1VHOA 3WC7A 4A30A 3SI1A 2FSRA 3FXTA 2FIWA 4CPAA 2ARHA 1S7LA 1F2PA 2B58A 1QQ9A 2EWBA 2P0WA 3CXPA 3D7DA 1H8LA 2G3AA 3GYAA 3JTKA 2XEGA 4OADA 1Q2DA 2Q4ZA 4MHYA 2WYRA 1QSMA 4GM5A 4MFQA 4MJ8A 4Q38A 4JXQA 5JGFA 4MCPA 4RN7A 4F9VA 3FJUA 3S9NA 3KL9A 3GKRA 4C68A 4KUAA 1RO5A 3DGVA 2ZW6A 4FAIA 2D4PA 2CF4A 2PRQA 3IWEA 3FF3A 4MY3A 2PSWA 4MBUA 2ZW7A 3LD2A 3F0AA 3RAMA 5JH9A 2PJ3A 4YWYA 1F2OA 1OBRA 3NH8A 1M4IA 1N71A 4YU9A 4YFJA 1YW6A 3DR8A 3T8WA 2Q4YA 2BCOA 5JQ4A 2AFUA 1A2ZA 4P4IA 3T9YA 4NGQA 2RB7A 1NMTA 2G0BA 2HB6A 3BI0A 4MCQA 4GXHA 2BEIA 3KQZA 2V8HA 4TNUA 2PJ4A 3MN8A 4PXDA 1CBXA 1YVOA 1TKFA 1XOVA 3PP9A 4QB9A 4FD6A 4R6TA 4Q36A 1LAMA 4KVME 5F49A 4ZY0A 3N7ZA 1CP7A 4OC5A 3SJGA 3PFOA 1YQEA 2PQ8A 4FD5A 4LQ6A 2OB0A 5J8CA 2QECA 5K8MA 4AVCA 1Y9KA 2C27A 5G20A 5JM6A 4G1PA 4MFZA 4KOXA 4U9ZA 3CXQA 3I9SA 5BWAB 2Q0YA 3FX6A 5LRJA 1M1DA 4F6AA 2NSMA 2PJ7A 3GUXA 5LYLA 3CT9A 2O28A 1TIQA 2Y0MA 4KVXA 4F0YA 4QUSA 4DYOA 3D66A 1LANA 3PFEA 5LRKA 2ZXVA 1Q7LA 3TTHA 3IO1A 3EFAA 4CAWA 1S7FA 2FCKA 3LWUA 1DE4C 3FBUA 5CPAA 5DS0A 2J8NA 4B5PA 3HUVA 1IYLA 2VZZA 2ODFA 4CAFA 1HDQA 5F09A 1Q2YA 5J1QA 2DPTA 2D4OA 4AVBA 1CM0A 3V8IA 1J4JA 1IIDA 2AFSA 2PR1A 4BBHA 1AYEA 1BAVA 1IOFA 2EK8A 2HV2A 2PJCA 1KUXA 4ZGYB 2ZW4A 3D4UA 2PRBA 2REFA 1TF8A 2POKA 1ZG9A 4MY0A 2AFXA 2Z10A 2AFZA 5D29A 1P4NA 4ZY1A 3DNSA 1XE4A 2AE6A 3GB0A 2Q04A 4PK3A 1B6BA 4X2TA 3S6HA 3EY5A 4R3KA 2FIAA 1WWZA 2JDDA 1V0CA 3IC1A 1SQHA 1Y0YA 4NGNA 1QSOA 4ORFA 3IWWA 3L2NA 1XMTA 4Q7AA 4B5OA 4EVYA 1MJBA 2PVWA 2OZGA 4UCPA 4AG9A 5HMNA 2B3VA 5CNPA 3D8PA 2GLJA 2V8GA 5H84A 4JJXA 2HQYA 3KZWA 4XPDC 5I4MA 3VARA 3D7GA 3S9MA 4MHDA 3SHPA 4JLYA 2Q44A 1OZPA 4AXVA 1NE9A 1M4GA 2ZENA 3RYOA 3EXNA 5F48A 4XNHB 4R57A 2QVPA 3BJ7A 3VWDA 2B5GA 2AFWA 3B2YA 3SXNA 4R87A 5AG4A 2DXQA 2EO8A 4PV6A 4NF1A 1YLOA 5HVHA 1ELMP 4OP4A 3KR5A 1PYTB 3PB4X 5C88A 3LODA 2K5TA 1LFWA 2PJ2A 3QAYA 4JYWA 1Z8XA 1AMPA 4OC0A 4B13A 2CIJA 3QAHA 2EBJA 3QNVA 2XEFA 4CGPA 2ZPAA 4A2ZA 4RS2A 1I12A 2XEJA 2Q7BA 4B6ZA 5D8NA 4P4BA 3TX8A 2JDCA 4A31A 2A4NA 4MI4A 3I3GA 2R8VA 1Z5RA 5EBVA 2YNCC 3TT2A 5HVGA 1FT7A 4NGMA 3CPXA 2VL1A 4H6ZA 1MJ9A 4XPLA 1YX0A 2H5MA 3CZXA 3RBUA 3WT4A 2X7BA 1GYTA 2WPWA 2R1IA 3FEEA 3H4QA 4KSAA 2FE7A 4ZX8A 1CPXA 3DLJA 3SI2A 1S7KA 2PR8A 3CDXA 2Z3NA 2ATRA 2CNMA 2CNTA 2FT0A 1IU8A 4UCNA 5LYIA 4PSWA 4GS4A 3CXSA 3B3CA 4UEEA 3UY5A 1PU9A 2GU2A 2PJ5A 3BI1A 1XRYA 1BPMA 4NJQA 3TFYA 1Q2CA 2ZOGA 5IX3A 5G22A 2YNDA 1YREA 1IOIA 1ZLHA 4KOUA 4FUUA 2EK9A 4PPZA 4UFVA 3WR7A 3IEHA 2I79A 2AJ6A 1Z8WA
chains in the Genus database with same CATH topology
4H89A 2PC1A 2OZUA 4M85A 5AG5A 4FD7A 4B5PB 2OH1A 5IV0A 2GANA 4BMHA 2EVNA 4HNWB 4B11A 2F5IA 2Z0ZA 4UFWA 4KUBA 2PDOA 3TO7A 3VWEA 5F47A 4KOYA 4H6UA 2YNCA 2OZHA 3E0KA 5A28A 3F5BA 2WUUA 3R9EA 4CYPA 1KUVA 4ONUA 3DSBA 1MK4A 3G3SA 4KLVA 3R9FA 4C7HA 3R96A 1WK4A 4X5KA 1Y7RA 1NSLA 4CAEA 4L89A 2EUIA 4IF5A 5EC4A 4M3SA 4CYQA 3T90A 1XIXA 1QSTA 4B12A 4A95A 1PUAA 1KUYA 4B10A 3TO9A 3FRMA 3P2HA 4Y49B 4YGOA 2REEA 4KS9A 1ZO0A 5A27A 3IWGA 2Z3LA 4CS0B 3W6SA 1KZFA 1S60A 3TOBA 4UWIA 1LRZA 3ZJ0A 3KKWA 5E96A 2VBQA 1Y9WA 2B4BA 2DPSA 2QIRA 2CXAA 2HUZA 3PGPA 2I00A 4CYOA 5KTAA 2GE3A 4U9YA 4AVAA 5JPHA 3R9GA 2RC4A 2YGWA 1I21A 3GY9A 3IGRA 4F0XA 2QMLA 2GIVA 2FXFA 2VXKA 2B4DA 5HH1A 3DR6A 2VI7A 1Z9UA 4QC6A 5ISVA 3FIXA 3W91A 1IICA 3BJ8A 1M4DA 3BLNA 3TCVA 4HNYB 2BL1A 3D3SA 4KORA 4AB7A 1YR0A 3F8KA 1VKCA 3JUWA 4C2YA 5IB0A 4JXRA 3OWCA 4NXYA 4R9MA 4RI1A 4C2XA 1QSRA 4LX9A 4A33A 2CY2A 4UFXA 5C82A 2G3TA 5DWNA 4MFPA 3EO4A 4JD6A 5DWMA 2Z3PA 1S5KA 2IL4A 4R3LA 4KVOE 1R57A 4MFKA 4XPDB 1Z4EA 2YNEA 4JWPA 2J8MA 1S7NA 3A9LA 3PZJA 2WSAA 5F46A 3JVNA 3FB3A 2VQYA 4NEXA 3R95A 3W6XA 4C7IA 4E0AA 3FYNA 2J8RA 3D2MA 4QBJA 4CRZB 3TOAA 3IU1A 1GHEA 4LUAA 1QSNA 2Z3KA 2CNSA 5H86A 4CGLA 1VHSA 1RXTA 1U6MA 2B3UA 1FY7A 3DDDA 3D2PA 1M44A 3TO6A 4J3GA 4YRHA 3TE4A 5KTDA 5FVJA 2JLMA 1CJWA 3SXOA 1MJAA 2OU2A 2R7HA 4CGMA 2NMTA 4FD4A 4NCZA 3EC4A 4KZTA 3R1KA 1L0CA 4E8OA 4HNXB 4UA3A 2BUEA 5AG6A 1XF8A 2Q4VA 4U5YA 4DNCA 1XEBA 2KCWA 4K30A 4L8AA 4HKFA 4KOSA 4MFJA 1I1DA 2Z11A 2P6EA 3P2FA 2P6GA 4UWJA 4KOTA 3H5ZA 3FNCA 4KLWA 2ZW5A 4CAVA 2VZYA 4PK2A 2BSWA 1IYKA 3NE7A 1BOBA 2WPXA 2B5GB 5I0CA 4CRYB 4AG7A 1B87A 4B14A 4XNHC 5J8FA 3C26A 4ZBGA 4PSXA 1UFHA 4XPKA 1YLEA 4I49A 1P0HA 3S6FA 4CAXA 4UBRA 1ON0A 2R98A 4Y49C 4C2ZA 5KTCA 4QVTA 3ZZIA 4KOVA 4IUSA 5G1ZA 1K4JA 3MGDA 4KOWA 4CGNA 1S3ZA 1YK3A 2FS5A 4NSQA 2VEZA 3QB8A 3IU2A 2JEVA 4OLLA 2Z3OA 5GCNA 3S6GA 4CYNA 4II9A 3G8WA 4E2AA 4UCMA 4A32A 1YVKA 3S6KA 3B8GA 2Z3MA 4KSFA 1YGHA 2B4DB 5AGEA 2P6FA 1IB1E 4CGOA 3K9UA 5AG7A 2FL4A 5G21A 4MFLA 1Z4RA 1BO4A 4OAEA 4A30A 2FSRA 3FXTA 2FIWA 2ARHA 1S7LA 2P0WA 2B58A 3GYAA 3CXPA 3JTKA 2G3AA 4OADA 4AVBA 1Q2DA 4Q38A 4MFQA 1QSMA 4MJ8A 4JXQA 3GKRA 4C68A 4KUAA 1RO5A 2ZW6A 2D4PA 3IWEA 4MY3A 2PSWA 4MBUA 2ZW7A 3LD2A 3F0AA 4YFJA 1M4IA 1N71A 3DR8A 2Q4YA 5JQ4A 3T9YA 1NMTA 2G0BA 2BEIA 1YVOA 3PP9A 4QB9A 4FD6A 4Q36A 4KVME 5F49A 3N7ZA 4FD5A 2PQ8A 2OB0A 5J8CA 2QECA 4AVCA 1Y9KA 2C27A 5G20A 4MFZA 4KOXA 4U9ZA 3CXQA 3I9SA 5BWAB 2Q0YA 1M1DA 4F6AA 2O28A 1TIQA 2Y0MA 4KVXA 4F0YA 4QUSA 2ZXVA 3TTHA 3EFAA 4CAWA 1S7FA 2FCKA 3FBUA 2J8NA 4B5PA 1IYLA 2VZZA 4CAFA 1Q2YA 2DPTA 2D4OA 1CM0A 3V8IA 1J4JA 1IIDA 2PR1A 4BBHA 2HV2A 1KUXA 4ZGYB 2ZW4A 2PRBA 2REFA 4MY0A 2Z10A 1P4NA 3DNSA 1XE4A 2AE6A 4PK3A 2Q04A 3S6HA 1B6BA 3EY5A 4R3KA 2FIAA 1WWZA 2JDDA 1V0CA 1SQHA 1QSOA 4ORFA 1XMTA 4B5OA 4EVYA 1MJBA 2OZGA 4UCPA 4AG9A 5HMNA 2B3VA 5CNPA 3D8PA 5H84A 4JJXA 2HQYA 4XPDC 4MHDA 3SHPA 4JLYA 2Q44A 1OZPA 1NE9A 1M4GA 3RYOA 3EXNA 5F48A 4XNHB 4R57A 3BJ7A 3VWDA 2B5GA 3SXNA 4R87A 5AG4A 2DXQA 4PV6A 4NF1A 5C88A 3LODA 2K5TA 4B13A 3QAHA 4CGPA 2ZPAA 4A2ZA 4RS2A 1I12A 2Q7BA 2JDCA 4A31A 2A4NA 4MI4A 3I3GA 2R8VA 5EBVA 2YNCC 3TT2A 4H6ZA 1MJ9A 4XPLA 1YX0A 2H5MA 2X7BA 2WPWA 3H4QA 2R1IA 4KSAA 2FE7A 1S7KA 2PR8A 2Z3NA 2ATRA 2CNMA 2CNTA 2FT0A 4UCNA 4PSWA 4GS4A 3CXSA 3UY5A 1PU9A 3TFYA 1Q2CA 5IX3A 5G22A 2YNDA 1YREA 4KOUA 4UFVA 3WR7A 2I79A 2AJ6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4H89 A;  2PC1 A;  2OZU A;  4M85 A;  4FD7 A;  4B5P B;  2OH1 A;  5IV0 A;  2GAN A;  4BMH A;  2EVN A;  4HNW B;  2F5I A;  2Z0Z A;  4KUB A;  2PDO A;  3TO7 A;  3VWE A;  5F47 A;  4KOY A;  4H6U A;  2OZH A;  3E0K A;  3F5B A;  3R9E A;  1KUV A;  4ONU A;  3DSB A;  1MK4 A;  3G3S A;  4KLV A;  3R9F A;  3R96 A;  1WK4 A;  4X5K A;  1Y7R A;  1NSL A;  4L89 A;  2EUI A;  4IF5 A;  5EC4 A;  4M3S A;  3T90 A;  1XIX A;  1QST A;  1PUA A;  1KUY A;  3TO9 A;  3FRM A;  3P2H A;  4Y49 B;  4YGO A;  2REE A;  3IWG A;  4CS0 B;  3W6S A;  1KZF A;  1S60 A;  3TOB A;  4UWI A;  1LRZ A;  3ZJ0 A;  3KKW A;  5E96 A;  2VBQ A;  1Y9W A;  2B4B A;  2QIR A;  2HUZ A;  3PGP A;  2I00 A;  5KTA A;  2GE3 A;  4U9Y A;  4AVA A;  5JPH A;  3R9G A;  2RC4 A;  1I21 A;  3GY9 A;  3IGR A;  2QML A;  2GIV A;  2FXF A;  2VXK A;  2B4D A;  5HH1 A;  2VI7 A;  4QC6 A;  1Z9U A;  3DR6 A;  5ISV A;  3FIX A;  3W91 A;  1IIC A;  3BJ8 A;  1M4D A;  3BLN A;  3TCV A;  4HNY B;  2BL1 A;  3D3S A;  4KOR A;  4AB7 A;  1YR0 A;  3F8K A;  1VKC A;  3JUW A;  5IB0 A;  4JXR A;  3OWC A;  4NXY A;  4R9M A;  4RI1 A;  1QSR A;  4LX9 A;  2CY2 A;  5C82 A;  2G3T A;  5DWN A;  3EO4 A;  4JD6 A;  5DWM A;  1S5K A;  2IL4 A;  4R3L A;  4KVO E;  1R57 A;  4XPD B;  1Z4E A;  4JWP A;  2J8M A;  1S7N A;  3PZJ A;  5F46 A;  3JVN A;  3FB3 A;  2VQY A;  4NEX A;  3R95 A;  3W6X A;  4E0A A;  3FYN A;  2J8R A;  3D2M A;  4QBJ A;  4CRZ B;  3TOA A;  1GHE A;  4LUA A;  1QSN A;  2CNS A;  5H86 A;  1VHS A;  1RXT A;  1U6M A;  2B3U A;  1FY7 A;  3DDD A;  3D2P A;  1M44 A;  3TO6 A;  4J3G A;  4YRH A;  3TE4 A;  5KTD A;  5FVJ A;  2JLM A;  1CJW A;  3SXO A;  1MJA A;  2OU2 A;  2R7H A;  2NMT A;  4FD4 A;  4NCZ A;  3EC4 A;  4KZT A;  3R1K A;  1L0C A;  4E8O A;  4HNX B;  4UA3 A;  2BUE A;  1XF8 A;  2Q4V A;  4U5Y A;  4DNC A;  1XEB A;  2KCW A;  4K30 A;  4L8A A;  4HKF A;  4KOS A;  1I1D A;  2Z11 A;  2P6E A;  3P2F A;  2P6G A;  4UWJ A;  4KOT A;  3FNC A;  4KLW A;  2ZW5 A;  4CAV A;  2VZY A;  4PK2 A;  2BSW A;  1IYK A;  3NE7 A;  1BOB A;  2WPX A;  2B5G B;  5I0C A;  4CRY B;  4AG7 A;  1B87 A;  4XNH C;  5J8F A;  3C26 A;  4ZBG A;  4PSX A;  1UFH A;  4XPK A;  1YLE A;  4I49 A;  1P0H A;  3S6F A;  4CAX A;  4UBR A;  1ON0 A;  2R98 A;  4Y49 C;  5KTC A;  4QVT A;  3ZZI A;  4KOV A;  4IUS A;  1K4J A;  3MGD A;  4KOW A;  1S3Z A;  1YK3 A;  2FS5 A;  4NSQ A;  2VEZ A;  3QB8 A;  2JEV A;  4OLL A;  5GCN A;  3S6G A;  4II9 A;  3G8W A;  4E2A A;  1YVK A;  3S6K A;  3B8G A;  1YGH A;  2B4D B;  2P6F A;  1IB1 E;  3K9U A;  2FL4 A;  1Z4R A;  1BO4 A;  4OAE A;  2FSR A;  3FXT A;  2FIW A;  2ARH A;  1S7L A;  2P0W A;  2B58 A;  3GYA A;  3CXP A;  2G3A A;  4OAD A;  4AVB A;  1Q2D A;  1QSM A;  4MJ8 A;  4JXQ A;  3GKR A;  4KUA A;  1RO5 A;  2ZW6 A;  2D4P A;  4MY3 A;  2PSW A;  4MBU A;  2ZW7 A;  3LD2 A;  3F0A A;  4YFJ A;  1M4I A;  1N71 A;  3DR8 A;  2Q4Y A;  5JQ4 A;  3T9Y A;  1NMT A;  2G0B A;  2BEI A;  1YVO A;  3PP9 A;  4QB9 A;  4FD6 A;  4KVM E;  5F49 A;  3N7Z A;  4FD5 A;  2PQ8 A;  2OB0 A;  5J8C A;  2QEC A;  4AVC A;  1Y9K A;  2C27 A;  4KOX A;  4U9Z A;  3CXQ A;  3I9S A;  2Q0Y A;  1M1D A;  4F6A A;  2O28 A;  1TIQ A;  2Y0M A;  4KVX A;  4F0Y A;  4QUS A;  2ZXV A;  3TTH A;  3EFA A;  4CAW A;  1S7F A;  2FCK A;  3FBU A;  2J8N A;  4B5P A;  1IYL A;  2VZZ A;  1Q2Y A;  2D4O A;  1CM0 A;  3V8I A;  1J4J A;  1IID A;  2PR1 A;  2HV2 A;  1KUX A;  2ZW4 A;  2PRB A;  2REF A;  4MY0 A;  2Z10 A;  1P4N A;  3DNS A;  1XE4 A;  2AE6 A;  4PK3 A;  2Q04 A;  3S6H A;  1B6B A;  3EY5 A;  4R3K A;  2FIA A;  1WWZ A;  2JDD A;  1V0C A;  1SQH A;  1QSO A;  4ORF A;  1XMT A;  4B5O A;  4EVY A;  1MJB A;  2OZG A;  4AG9 A;  5HMN A;  2B3V A;  5CNP A;  3D8P A;  5H84 A;  4JJX A;  2HQY A;  4XPD C;  4MHD A;  3SHP A;  4JLY A;  2Q44 A;  1OZP A;  1NE9 A;  1M4G A;  3RYO A;  3EXN A;  5F48 A;  4XNH B;  4R57 A;  3BJ7 A;  3VWD A;  2B5G A;  3SXN A;  4R87 A;  2DXQ A;  4PV6 A;  4NF1 A;  5C88 A;  3LOD A;  2K5T A;  3QAH A;  2ZPA A;  4RS2 A;  1I12 A;  2Q7B A;  2JDC A;  2A4N A;  4MI4 A;  3I3G A;  2R8V A;  5EBV A;  3TT2 A;  4H6Z A;  1MJ9 A;  4XPL A;  1YX0 A;  2H5M A;  2X7B A;  2WPW A;  3H4Q A;  2R1I A;  2FE7 A;  1S7K A;  2PR8 A;  2ATR A;  2CNM A;  2CNT A;  2FT0 A;  4PSW A;  4GS4 A;  3CXS A;  3UY5 A;  1PU9 A;  3TFY A;  1Q2C A;  5IX3 A;  1YRE A;  4KOU A;  3WR7 A;  2I79 A;  2AJ6 A; 
#chains in the Genus database with same CATH topology
 4H89 A;  1F57 A;  2PC1 A;  2OZU A;  3S9L A;  4M85 A;  5AG5 A;  1BLL E;  4FD7 A;  4B5P B;  4NJR A;  2OH1 A;  5IV0 A;  2GAN A;  4M6H A;  4BMH A;  2DF5 A;  2EVN A;  3WAB A;  4HNW B;  3V38 A;  4B11 A;  2F5I A;  4OC1 A;  2Z0Z A;  4UFW A;  4KUB A;  2PDO A;  4RUH A;  3TO7 A;  3VWE A;  5F47 A;  4MHN A;  2C6P A;  2JEW A;  4H6U A;  4KOY A;  1CG2 A;  2YNC A;  3LMS A;  1XMB A;  2OZH A;  1TXR A;  3V7Z A;  3E0K A;  3PBB A;  4UF4 A;  4WJB A;  5A28 A;  2F7V A;  3F5B A;  2PCU A;  2WUU A;  3R9E A;  1XFO A;  4CYP A;  4MMO A;  1KUV A;  4ONU A;  3DSB A;  1MK4 A;  3G3S A;  4KLV A;  4UEF A;  3R9F A;  4C7H A;  4F9U A;  3R96 A;  1WK4 A;  4X5K A;  1Y7R A;  3B3V A;  1NSL A;  4CAE A;  4L89 A;  2EUI A;  4IF5 A;  5EC4 A;  1ZG7 A;  3VH9 A;  4M3S A;  4CYQ A;  3T90 A;  1XIX A;  1QST A;  3PRT A;  3PB8 X;  2ZEE A;  4B12 A;  2GFQ A;  4A95 A;  1PUA A;  1KUY A;  5HXD A;  2NYQ A;  1X12 A;  4PQA A;  4A39 A;  4B10 A;  3TO9 A;  1IGB A;  2ABZ A;  1RTQ A;  4Z65 A;  3FRM A;  3P2H A;  3NH5 A;  4M6I A;  2PVV A;  4OC4 A;  4Y49 B;  4P10 A;  4YGO A;  3B35 A;  2REE A;  2Q7S A;  4KS9 A;  1ZO0 A;  5A27 A;  3IWG A;  3RZA A;  2QJ8 A;  8CPA A;  2Z3L A;  1CPS A;  2GRE A;  4CS0 B;  1VIX A;  3W6S A;  1KZF A;  1S60 A;  3TOB A;  4UWI A;  1LRZ A;  3ZJ0 A;  3IJ3 A;  3KKW A;  5E96 A;  2VBQ A;  1Y9W A;  4A37 A;  1ELL P;  3NE8 A;  2B4B A;  1Y0R A;  2DPS A;  2QIR A;  2CXA A;  5K8O A;  1PCA A;  2HUZ A;  2PE3 A;  3PGP A;  2I00 A;  2CTC A;  4CYO A;  2OOT A;  5KTA A;  1DTD A;  1YSJ A;  2GE3 A;  3GIU A;  3H8E A;  4R76 A;  4U9Y A;  4AVA A;  4UEZ A;  5JPH A;  2ZEG A;  3R9G A;  2RC4 A;  2WZN A;  2DEA A;  2YGW A;  2ZOF A;  1I21 A;  4BIN A;  3GY9 A;  3IGR A;  4F0X A;  2QML A;  4IAV A;  1R3N A;  1X10 A;  1M4L A;  2FXF A;  2GIV A;  4P4F A;  4PXB A;  1LCP A;  4ZX9 A;  2ZEP A;  3FH4 A;  4MRI A;  4ZY2 A;  4OID A;  2VXK A;  4MHZ A;  2B4D A;  5HH1 A;  2VI7 A;  3DR6 A;  1Z9U A;  1CP6 A;  4P44 A;  4QC6 A;  5ISV A;  3FIX A;  3W91 A;  1IIC A;  1TF9 A;  3ISZ A;  2ZEL A;  3BJ8 A;  1M4D A;  3B7I A;  4H2K A;  4MCR A;  3BLN A;  4OKO A;  4OC2 A;  3GLJ A;  3KAS A;  5K8P A;  3TCV A;  4HNY B;  2BL1 A;  3D3S A;  4KOR A;  4AB7 A;  1YR0 A;  3SJF A;  2CTB A;  2ZEH A;  3F8K A;  1XBU A;  1VKC A;  3JUW A;  4C2Y A;  5IB0 A;  4JXR A;  1YW4 A;  3OWC A;  4OIW A;  2C6C A;  3KGQ A;  4NXY A;  3B3T A;  4R9M A;  4MCS A;  4P4J A;  4IHM A;  4RI1 A;  4C2X A;  3WC6 A;  1QSR A;  4LX9 A;  4A33 A;  2CY2 A;  3KHX A;  4FWU A;  2G3T A;  4UFX A;  1EE3 P;  2IQ6 A;  3RO0 A;  5C82 A;  2F8H A;  3LAC A;  5DWN A;  2PIY A;  4MFP A;  2IMO A;  3EO4 A;  4JD6 A;  5DWM A;  2ZEO A;  2Z3P A;  3B3S A;  3K2K A;  2PJ6 A;  5CBM A;  1S5K A;  2IL4 A;  4NGR A;  4R3L A;  4KVO E;  1R57 A;  4R8F A;  3KQX A;  4MFK A;  3BHX A;  4XPD B;  1Z4E A;  2YNE A;  4JWP A;  5EMI A;  2J8M A;  1S7N A;  1UWY A;  3A9L A;  2Q43 A;  3KHZ A;  3PZJ A;  2V8V A;  2WSA A;  3IFE A;  4FBE A;  4P4D A;  5F46 A;  3JVN A;  3MRU A;  3FB3 A;  4NGP A;  2VQY A;  4NEX A;  3R95 A;  3W6X A;  6CPA A;  5K8N A;  2ZEF A;  1NSA A;  4C7I A;  2ZEM A;  3D7F A;  3PB7 X;  4E0A A;  4NGT A;  4X3R A;  4M6G A;  3FYN A;  3PB6 X;  1ZLI A;  2J8R A;  1Z8L A;  3D2M A;  4CRZ B;  4QBJ A;  4UIB A;  3IU1 A;  3TOA A;  1Y7E A;  1GHE A;  1LOK A;  4NFR A;  2BO9 A;  3NFZ A;  4LUA A;  1QSN A;  2Z3K A;  2I3C A;  2CNS A;  5H86 A;  4CGL A;  3N5F A;  1ARM A;  1VHS A;  4A94 A;  1RXT A;  4MXU A;  2PJ0 A;  4ONW A;  1HEE A;  1U6M A;  3I1U A;  2B3U A;  2FVG A;  2AFM A;  2V77 A;  4DJL A;  3ISX A;  2J9A A;  1FY7 A;  1XJO A;  2GLF A;  3D2P A;  3DDD A;  4PXC A;  1M44 A;  4WWV A;  4X8I A;  5LYF A;  3TO6 A;  1HDU A;  4J3G A;  4YRH A;  3TE4 A;  1ARL A;  5ELY A;  5FVJ A;  5KTD A;  2JLM A;  1CJW A;  3SXO A;  1MJA A;  2OU2 A;  3PEI A;  2QYV A;  1JQG A;  2R7H A;  4CGM A;  3SI0 A;  2NMT A;  2PJ9 A;  4FD4 A;  4NCZ A;  2AFO A;  3EC4 A;  4KZT A;  1YME A;  2ANP A;  2Q51 A;  3R1K A;  1L0C A;  4E8O A;  3NH4 A;  3KR4 A;  4HNX B;  2BUE A;  4UA3 A;  4W9Y A;  5AG6 A;  1XF8 A;  2PIZ A;  2Q4V A;  4U5Y A;  3SJX A;  4DNC A;  1XEB A;  2KCW A;  4K30 A;  4L8A A;  4HKF A;  4KOS A;  4MFJ A;  4MHP A;  1QMU A;  3NA6 A;  1I1D A;  4F8Z A;  1VGY A;  2Z11 A;  2P6E A;  1Z8T A;  4OC3 A;  2C6G A;  3P2F A;  2P6G A;  3KI9 A;  4NGS A;  3PBE A;  4UWJ A;  4KOT A;  3H5Z A;  5LRG A;  2XEI A;  3VAT A;  3FNC A;  1TKH A;  3IIB A;  4KLW A;  4IK2 A;  2ZW5 A;  4CAV A;  1LAP A;  4O23 A;  2PJ8 A;  2VZY A;  3CPA A;  4PK2 A;  2BSW A;  1IYK A;  1FNO A;  3NE7 A;  3RNZ A;  1BOB A;  1CX8 A;  3FVL A;  2C1C A;  4ZYQ A;  3TC8 A;  3JRU A;  3FEC A;  3B3W A;  2WPX A;  5LYD A;  2B5G B;  3H8F A;  5I0C A;  4CRY B;  4AG7 A;  5HVF A;  1B87 A;  3SJE A;  4K3N A;  4DUK A;  1IY7 A;  4B14 A;  4XNH C;  5J8F A;  2O4H A;  3C26 A;  4ZBG A;  4PSX A;  3D67 A;  7CPA A;  1UFH A;  4P6Y A;  3BXM A;  4XPK A;  3WC5 A;  2JBJ A;  1YLE A;  4I49 A;  1P0H A;  4PXE A;  1Z2L A;  3K9T A;  4UBR A;  3S6F A;  1ON0 A;  2R98 A;  4CAX A;  3D7H A;  4EFD A;  4R7M A;  4Y49 C;  4C2Z A;  3H8G A;  4QVT A;  3ZZI A;  5IB9 A;  4KOV A;  5KTC A;  4IUS A;  5G1Z A;  1K4J A;  4BD9 A;  3MGD A;  4KOW A;  4P4E A;  4CGN A;  2OR4 A;  1S3Z A;  1YK3 A;  2PJA A;  2FS5 A;  1ZG8 A;  4NSQ A;  4ZI6 A;  1JWQ A;  2VEZ A;  3QB8 A;  1TKJ A;  2HC9 A;  2JEV A;  2ZED A;  3IU2 A;  4OLL A;  2Z3O A;  5GCN A;  3S6G A;  4CYN A;  4II9 A;  1AUG A;  4KSI A;  2PJB A;  3G8W A;  4E2A A;  4UCM A;  4UIA A;  2BOA A;  1KWM A;  4A32 A;  1YVK A;  3S6K A;  4EWT A;  3B8G A;  2G9D A;  4JZ0 A;  2Z3M A;  4KSF A;  1BPN A;  4HPS A;  2JBK A;  1YGH A;  2B4D B;  5AGE A;  2PJ1 A;  3D68 A;  3FED A;  3HLP A;  2P6F A;  1IB1 E;  4CGO A;  4LQG A;  1R43 A;  2IJZ A;  4OME A;  3PB9 X;  3K9U A;  5AG7 A;  2FL4 A;  4TWE A;  2O53 A;  5G21 A;  2V8D A;  4MFL A;  3FMC A;  5THW A;  1Z4R A;  4EME A;  1BO4 A;  4OAE A;  1VHE A;  2RFH A;  4A38 A;  4P45 A;  1VHO A;  3WC7 A;  4A30 A;  3SI1 A;  2FSR A;  3FXT A;  2FIW A;  4CPA A;  2ARH A;  1S7L A;  1F2P A;  2B58 A;  1QQ9 A;  2EWB A;  2P0W A;  3CXP A;  3D7D A;  1H8L A;  2G3A A;  3GYA A;  3JTK A;  2XEG A;  4OAD A;  1Q2D A;  2Q4Z A;  4MHY A;  2WYR A;  1QSM A;  4GM5 A;  4MFQ A;  4MJ8 A;  4Q38 A;  4JXQ A;  5JGF A;  4MCP A;  4RN7 A;  4F9V A;  3FJU A;  3S9N A;  3KL9 A;  3GKR A;  4C68 A;  4KUA A;  1RO5 A;  3DGV A;  2ZW6 A;  4FAI A;  2D4P A;  2CF4 A;  2PRQ A;  3IWE A;  3FF3 A;  4MY3 A;  2PSW A;  4MBU A;  2ZW7 A;  3LD2 A;  3F0A A;  3RAM A;  5JH9 A;  2PJ3 A;  4YWY A;  1F2O A;  1OBR A;  3NH8 A;  1M4I A;  1N71 A;  4YU9 A;  4YFJ A;  1YW6 A;  3DR8 A;  3T8W A;  2Q4Y A;  2BCO A;  5JQ4 A;  2AFU A;  1A2Z A;  4P4I A;  3T9Y A;  4NGQ A;  2RB7 A;  1NMT A;  2G0B A;  2HB6 A;  3BI0 A;  4MCQ A;  4GXH A;  2BEI A;  3KQZ A;  2V8H A;  4TNU A;  2PJ4 A;  3MN8 A;  4PXD A;  1CBX A;  1YVO A;  1TKF A;  1XOV A;  3PP9 A;  4QB9 A;  4FD6 A;  4R6T A;  4Q36 A;  1LAM A;  4KVM E;  5F49 A;  4ZY0 A;  3N7Z A;  1CP7 A;  4OC5 A;  3SJG A;  3PFO A;  1YQE A;  2PQ8 A;  4FD5 A;  4LQ6 A;  2OB0 A;  5J8C A;  2QEC A;  5K8M A;  4AVC A;  1Y9K A;  2C27 A;  5G20 A;  5JM6 A;  4G1P A;  4MFZ A;  4KOX A;  4U9Z A;  3CXQ A;  3I9S A;  5BWA B;  2Q0Y A;  3FX6 A;  5LRJ A;  1M1D A;  4F6A A;  2NSM A;  2PJ7 A;  3GUX A;  5LYL A;  3CT9 A;  2O28 A;  1TIQ A;  2Y0M A;  4KVX A;  4F0Y A;  4QUS A;  4DYO A;  3D66 A;  1LAN A;  3PFE A;  5LRK A;  2ZXV A;  1Q7L A;  3TTH A;  3IO1 A;  3EFA A;  4CAW A;  1S7F A;  2FCK A;  3LWU A;  1DE4 C;  3FBU A;  5CPA A;  5DS0 A;  2J8N A;  4B5P A;  3HUV A;  1IYL A;  2VZZ A;  2ODF A;  4CAF A;  1HDQ A;  5F09 A;  1Q2Y A;  5J1Q A;  2DPT A;  2D4O A;  4AVB A;  1CM0 A;  3V8I A;  1J4J A;  1IID A;  2AFS A;  2PR1 A;  4BBH A;  1AYE A;  1BAV A;  1IOF A;  2EK8 A;  2HV2 A;  2PJC A;  1KUX A;  4ZGY B;  2ZW4 A;  3D4U A;  2PRB A;  2REF A;  1TF8 A;  2POK A;  1ZG9 A;  4MY0 A;  2AFX A;  2Z10 A;  2AFZ A;  5D29 A;  1P4N A;  4ZY1 A;  3DNS A;  1XE4 A;  2AE6 A;  3GB0 A;  2Q04 A;  4PK3 A;  1B6B A;  4X2T A;  3S6H A;  3EY5 A;  4R3K A;  2FIA A;  1WWZ A;  2JDD A;  1V0C A;  3IC1 A;  1SQH A;  1Y0Y A;  4NGN A;  1QSO A;  4ORF A;  3IWW A;  3L2N A;  1XMT A;  4Q7A A;  4B5O A;  4EVY A;  1MJB A;  2PVW A;  2OZG A;  4UCP A;  4AG9 A;  5HMN A;  2B3V A;  5CNP A;  3D8P A;  2GLJ A;  2V8G A;  5H84 A;  4JJX A;  2HQY A;  3KZW A;  4XPD C;  5I4M A;  3VAR A;  3D7G A;  3S9M A;  4MHD A;  3SHP A;  4JLY A;  2Q44 A;  1OZP A;  4AXV A;  1NE9 A;  1M4G A;  2ZEN A;  3RYO A;  3EXN A;  5F48 A;  4XNH B;  4R57 A;  2QVP A;  3BJ7 A;  3VWD A;  2B5G A;  2AFW A;  3B2Y A;  3SXN A;  4R87 A;  5AG4 A;  2DXQ A;  2EO8 A;  4PV6 A;  4NF1 A;  1YLO A;  5HVH A;  1ELM P;  4OP4 A;  3KR5 A;  1PYT B;  3PB4 X;  5C88 A;  3LOD A;  2K5T A;  1LFW A;  2PJ2 A;  3QAY A;  4JYW A;  1Z8X A;  1AMP A;  4OC0 A;  4B13 A;  2CIJ A;  3QAH A;  2EBJ A;  3QNV A;  2XEF A;  4CGP A;  2ZPA A;  4A2Z A;  4RS2 A;  1I12 A;  2XEJ A;  2Q7B A;  4B6Z A;  5D8N A;  4P4B A;  3TX8 A;  2JDC A;  4A31 A;  2A4N A;  4MI4 A;  3I3G A;  2R8V A;  1Z5R A;  5EBV A;  2YNC C;  3TT2 A;  5HVG A;  1FT7 A;  4NGM A;  3CPX A;  2VL1 A;  4H6Z A;  1MJ9 A;  4XPL A;  1YX0 A;  2H5M A;  3CZX A;  3RBU A;  3WT4 A;  2X7B A;  1GYT A;  2WPW A;  2R1I A;  3FEE A;  3H4Q A;  4KSA A;  2FE7 A;  4ZX8 A;  1CPX A;  3DLJ A;  3SI2 A;  1S7K A;  2PR8 A;  3CDX A;  2Z3N A;  2ATR A;  2CNM A;  2CNT A;  2FT0 A;  1IU8 A;  4UCN A;  5LYI A;  4PSW A;  4GS4 A;  3CXS A;  3B3C A;  4UEE A;  3UY5 A;  1PU9 A;  2GU2 A;  2PJ5 A;  3BI1 A;  1XRY A;  1BPM A;  4NJQ A;  3TFY A;  1Q2C A;  2ZOG A;  5IX3 A;  5G22 A;  2YND A;  1YRE A;  1IOI A;  1ZLH A;  4KOU A;  4FUU A;  2EK9 A;  4PPZ A;  4UFV A;  3WR7 A;  3IEH A;  2I79 A;  2AJ6 A;  1Z8W A; 
#chains in the Genus database with same CATH homology
 4H89 A;  2PC1 A;  2OZU A;  4M85 A;  5AG5 A;  4FD7 A;  4B5P B;  2OH1 A;  5IV0 A;  2GAN A;  4BMH A;  2EVN A;  4HNW B;  4B11 A;  2F5I A;  2Z0Z A;  4UFW A;  4KUB A;  2PDO A;  3TO7 A;  3VWE A;  5F47 A;  4KOY A;  4H6U A;  2YNC A;  2OZH A;  3E0K A;  5A28 A;  3F5B A;  2WUU A;  3R9E A;  4CYP A;  1KUV A;  4ONU A;  3DSB A;  1MK4 A;  3G3S A;  4KLV A;  3R9F A;  4C7H A;  3R96 A;  1WK4 A;  4X5K A;  1Y7R A;  1NSL A;  4CAE A;  4L89 A;  2EUI A;  4IF5 A;  5EC4 A;  4M3S A;  4CYQ A;  3T90 A;  1XIX A;  1QST A;  4B12 A;  4A95 A;  1PUA A;  1KUY A;  4B10 A;  3TO9 A;  3FRM A;  3P2H A;  4Y49 B;  4YGO A;  2REE A;  4KS9 A;  1ZO0 A;  5A27 A;  3IWG A;  2Z3L A;  4CS0 B;  3W6S A;  1KZF A;  1S60 A;  3TOB A;  4UWI A;  1LRZ A;  3ZJ0 A;  3KKW A;  5E96 A;  2VBQ A;  1Y9W A;  2B4B A;  2DPS A;  2QIR A;  2CXA A;  2HUZ A;  3PGP A;  2I00 A;  4CYO A;  5KTA A;  2GE3 A;  4U9Y A;  4AVA A;  5JPH A;  3R9G A;  2RC4 A;  2YGW A;  1I21 A;  3GY9 A;  3IGR A;  4F0X A;  2QML A;  2GIV A;  2FXF A;  2VXK A;  2B4D A;  5HH1 A;  3DR6 A;  2VI7 A;  1Z9U A;  4QC6 A;  5ISV A;  3FIX A;  3W91 A;  1IIC A;  3BJ8 A;  1M4D A;  3BLN A;  3TCV A;  4HNY B;  2BL1 A;  3D3S A;  4KOR A;  4AB7 A;  1YR0 A;  3F8K A;  1VKC A;  3JUW A;  4C2Y A;  5IB0 A;  4JXR A;  3OWC A;  4NXY A;  4R9M A;  4RI1 A;  4C2X A;  1QSR A;  4LX9 A;  4A33 A;  2CY2 A;  4UFX A;  5C82 A;  2G3T A;  5DWN A;  4MFP A;  3EO4 A;  4JD6 A;  5DWM A;  2Z3P A;  1S5K A;  2IL4 A;  4R3L A;  4KVO E;  1R57 A;  4MFK A;  4XPD B;  1Z4E A;  2YNE A;  4JWP A;  2J8M A;  1S7N A;  3A9L A;  3PZJ A;  2WSA A;  5F46 A;  3JVN A;  3FB3 A;  2VQY A;  4NEX A;  3R95 A;  3W6X A;  4C7I A;  4E0A A;  3FYN A;  2J8R A;  3D2M A;  4QBJ A;  4CRZ B;  3TOA A;  3IU1 A;  1GHE A;  4LUA A;  1QSN A;  2Z3K A;  2CNS A;  5H86 A;  4CGL A;  1VHS A;  1RXT A;  1U6M A;  2B3U A;  1FY7 A;  3DDD A;  3D2P A;  1M44 A;  3TO6 A;  4J3G A;  4YRH A;  3TE4 A;  5KTD A;  5FVJ A;  2JLM A;  1CJW A;  3SXO A;  1MJA A;  2OU2 A;  2R7H A;  4CGM A;  2NMT A;  4FD4 A;  4NCZ A;  3EC4 A;  4KZT A;  3R1K A;  1L0C A;  4E8O A;  4HNX B;  4UA3 A;  2BUE A;  5AG6 A;  1XF8 A;  2Q4V A;  4U5Y A;  4DNC A;  1XEB A;  2KCW A;  4K30 A;  4L8A A;  4HKF A;  4KOS A;  4MFJ A;  1I1D A;  2Z11 A;  2P6E A;  3P2F A;  2P6G A;  4UWJ A;  4KOT A;  3H5Z A;  3FNC A;  4KLW A;  2ZW5 A;  4CAV A;  2VZY A;  4PK2 A;  2BSW A;  1IYK A;  3NE7 A;  1BOB A;  2WPX A;  2B5G B;  5I0C A;  4CRY B;  4AG7 A;  1B87 A;  4B14 A;  4XNH C;  5J8F A;  3C26 A;  4ZBG A;  4PSX A;  1UFH A;  4XPK A;  1YLE A;  4I49 A;  1P0H A;  3S6F A;  4CAX A;  4UBR A;  1ON0 A;  2R98 A;  4Y49 C;  4C2Z A;  5KTC A;  4QVT A;  3ZZI A;  4KOV A;  4IUS A;  5G1Z A;  1K4J A;  3MGD A;  4KOW A;  4CGN A;  1S3Z A;  1YK3 A;  2FS5 A;  4NSQ A;  2VEZ A;  3QB8 A;  3IU2 A;  2JEV A;  4OLL A;  2Z3O A;  5GCN A;  3S6G A;  4CYN A;  4II9 A;  3G8W A;  4E2A A;  4UCM A;  4A32 A;  1YVK A;  3S6K A;  3B8G A;  2Z3M A;  4KSF A;  1YGH A;  2B4D B;  5AGE A;  2P6F A;  1IB1 E;  4CGO A;  3K9U A;  5AG7 A;  2FL4 A;  5G21 A;  4MFL A;  1Z4R A;  1BO4 A;  4OAE A;  4A30 A;  2FSR A;  3FXT A;  2FIW A;  2ARH A;  1S7L A;  2P0W A;  2B58 A;  3GYA A;  3CXP A;  3JTK A;  2G3A A;  4OAD A;  4AVB A;  1Q2D A;  4Q38 A;  4MFQ A;  1QSM A;  4MJ8 A;  4JXQ A;  3GKR A;  4C68 A;  4KUA A;  1RO5 A;  2ZW6 A;  2D4P A;  3IWE A;  4MY3 A;  2PSW A;  4MBU A;  2ZW7 A;  3LD2 A;  3F0A A;  4YFJ A;  1M4I A;  1N71 A;  3DR8 A;  2Q4Y A;  5JQ4 A;  3T9Y A;  1NMT A;  2G0B A;  2BEI A;  1YVO A;  3PP9 A;  4QB9 A;  4FD6 A;  4Q36 A;  4KVM E;  5F49 A;  3N7Z A;  4FD5 A;  2PQ8 A;  2OB0 A;  5J8C A;  2QEC A;  4AVC A;  1Y9K A;  2C27 A;  5G20 A;  4MFZ A;  4KOX A;  4U9Z A;  3CXQ A;  3I9S A;  5BWA B;  2Q0Y A;  1M1D A;  4F6A A;  2O28 A;  1TIQ A;  2Y0M A;  4KVX A;  4F0Y A;  4QUS A;  2ZXV A;  3TTH A;  3EFA A;  4CAW A;  1S7F A;  2FCK A;  3FBU A;  2J8N A;  4B5P A;  1IYL A;  2VZZ A;  4CAF A;  1Q2Y A;  2DPT A;  2D4O A;  1CM0 A;  3V8I A;  1J4J A;  1IID A;  2PR1 A;  4BBH A;  2HV2 A;  1KUX A;  4ZGY B;  2ZW4 A;  2PRB A;  2REF A;  4MY0 A;  2Z10 A;  1P4N A;  3DNS A;  1XE4 A;  2AE6 A;  4PK3 A;  2Q04 A;  3S6H A;  1B6B A;  3EY5 A;  4R3K A;  2FIA A;  1WWZ A;  2JDD A;  1V0C A;  1SQH A;  1QSO A;  4ORF A;  1XMT A;  4B5O A;  4EVY A;  1MJB A;  2OZG A;  4UCP A;  4AG9 A;  5HMN A;  2B3V A;  5CNP A;  3D8P A;  5H84 A;  4JJX A;  2HQY A;  4XPD C;  4MHD A;  3SHP A;  4JLY A;  2Q44 A;  1OZP A;  1NE9 A;  1M4G A;  3RYO A;  3EXN A;  5F48 A;  4XNH B;  4R57 A;  3BJ7 A;  3VWD A;  2B5G A;  3SXN A;  4R87 A;  5AG4 A;  2DXQ A;  4PV6 A;  4NF1 A;  5C88 A;  3LOD A;  2K5T A;  4B13 A;  3QAH A;  4CGP A;  2ZPA A;  4A2Z A;  4RS2 A;  1I12 A;  2Q7B A;  2JDC A;  4A31 A;  2A4N A;  4MI4 A;  3I3G A;  2R8V A;  5EBV A;  2YNC C;  3TT2 A;  4H6Z A;  1MJ9 A;  4XPL A;  1YX0 A;  2H5M A;  2X7B A;  2WPW A;  3H4Q A;  2R1I A;  4KSA A;  2FE7 A;  1S7K A;  2PR8 A;  2Z3N A;  2ATR A;  2CNM A;  2CNT A;  2FT0 A;  4UCN A;  4PSW A;  4GS4 A;  3CXS A;  3UY5 A;  1PU9 A;  3TFY A;  1Q2C A;  5IX3 A;  5G22 A;  2YND A;  1YRE A;  4KOU A;  4UFV A;  3WR7 A;  2I79 A;  2AJ6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...