1KUYA

X-ray crystallographic studies of serotonin n-acetyltransferase catalysis and inhibition
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
166
structure length
166
Chain Sequence
HTLPANEFRCLTPEDAAGVFEIEREAFISVSGNCPLNLDEVQHFLTLCPELSLGWFVEGRLVAFIIGSLWDEERLTQESLALHRPRGHSAHLHALAVHRSFRQQGKGSVLLWRYLHHVGAQPAVRRAVLMCEDALVPFYQRFGFHPAGPCAIVVGSLTFTEMHCSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Serotonin N-acetyltransferase
publication title X-ray crystallographic studies of serotonin N-acetyltransferase catalysis and inhibition.
pubmed doi rcsb
source organism Ovis aries
molecule tags Transferase
total genus 44
structure length 166
sequence length 166
ec nomenclature ec 2.3.1.87: Aralkylamine N-acetyltransferase.
pdb deposition date 2002-01-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 1kuyA00
2PRBA 2Q0YA 1Y9KA 1FY7A 2QIRA 3N7ZA 2P6GA 2O28A 4JJXA 3V8IA 3C26A 2F5IA 2P0WA 3P2FA 4XNHC 3S6HA 2PC1A 2NMTA 2FCKA 2GANA 4U9ZA 3TOAA 3R9EA 5J8FA 3R9GA 2R7HA 2VZYA 2PR8A 2HV2A 2RC4A 4XPDC 5F47A 5ISVA 2HQYA 4JD6A 1S5KA 2K5TA 5H84A 2JDCA 1YREA 1S3ZA 3K9UA 2OB0A 4CAXA 3G3SA 2B58A 1WWZA 5JPHA 1M4GA 4KVOE 4QUSA 2GE3A 2CNSA 2BEIA 4BMHA 5KTDA 4K30A 3R1KA 5IV0A 3LODA 2PR1A 4KOUA 3CXQA 4PK3A 3E0KA 3CXSA 1MK4A 3WR7A 3R96A 3ZJ0A 1LRZA 1XF8A 3TO9A 5E96A 4KUAA 5F48A 4B5OA 2PSWA 1V0CA 2B3VA 3EFAA 4KOWA 4OADA 3SHPA 1S7FA 4XPKA 1KUVA 4CAWA 4L8AA 2B4DA 2Q44A 4CS0B 4MHDA 2EVNA 5DWNA 2A4NA 4JXQA 1YX0A 1P0HA 5IX3A 4DNCA 4IUSA 4XNHB 1YVOA 2CY2A 3B8GA 3JVNA 3PGPA 5HMNA 1UFHA 2B3UA 1BOBA 4FD7A 1XE4A 4XPDB 2OU2A 3W91A 2ZPAA 2WPXA 1L0CA 1I1DA 4M3SA 3F0AA 4GS4A 1M1DA 2IL4A 1Z4RA 2REEA 4I49A 4U9YA 4M85A 1QSMA 1S7KA 4Y49C 4B5PA 3TOBA 2Z0ZA 4MJ8A 4XPLA 3ZZIA 1I12A 1I21A 3EO4A 4OAEA 5I0CA 2VZZA 5JQ4A 2ZW7A 2VQYA 1R57A 2I79A 3EY5A 5KTCA 2X7BA 3DR6A 1XMTA 2DXQA 3FYNA 2ZW6A 1KZFA 5GCNA 2G3AA 1PU9A 2B5GA 4EVYA 1K4JA 1PUAA 3R95A 2VXKA 4H6ZA 2JLMA 3TTHA 2ZW5A 2JEVA 2J8NA 1Q2CA 4QC6A 2FS5A 2QMLA 4KVXA 2FL4A 3I3GA 1M44A 2B4DB 3SXOA 5KTAA 4KUBA 4KOYA 1VKCA 3QB8A 2I00A 4HNXB 4PSWA 4R3KA 3IWGA 5HH1A 2Q7BA 1MJBA 2B4BA 3PZJA 2Z10A 2FE7A 4JWPA 1QSTA 4UWJA 2HUZA 1WK4A 4LX9A 4Y49B 1KUXA 1OZPA 4ZBGA 4MBUA 3VWEA 1YLEA 1CJWA 4KOVA 3DNSA 4JXRA 3SXNA 1MJAA 3RYOA 4KLWA 2BSWA 4R57A 3F8KA 3FXTA 4B5PB 4FD6A 4E8OA 3DR8A 4CAVA 1NMTA 1QSNA 2OZGA 1B6BA 5C88A 2BL1A 3GKRA 5J8CA 1RO5A 4AVCA 1Z9UA 1RXTA 3CXPA 3TCVA 3TT2A 2PQ8A 4F0YA 4CRYB 2FSRA 3BJ7A 2P6EA 1IIDA 1IICA 4FD5A 3S6FA 2EUIA 2AE6A 4NEXA 3GYAA 2Q4YA 1XEBA 2FIAA 1M4IA 3R9FA 2Y0MA 3LD2A 1J4JA 2B5GB 1NE9A 4RI1A 3BJ8A 2REFA 4KOSA 2VBQA 5FVJA 3PP9A 3S6KA 2Q4VA 3JUWA 4H89A 4HKFA 1QSOA 2CNMA 2OZUA 5F49A 3T90A 1GHEA 1B87A 1XIXA 4R9MA 5DWMA 2FT0A 1BO4A 2ZW4A 4YRHA 2QECA 3D3SA 2G0BA 2AJ6A 3NE7A 3T9YA 2H5MA 4NSQA 3TO7A 4MI4A 4KLVA 4AVAA 1Y9WA 1P4NA 1QSRA 3W6SA 3KKWA 2R8VA 4PK2A 3VWDA 2WPWA 4KORA 1IYKA 4CRZB 3IGRA 4AVBA 5EC4A 1Y7RA 4AG7A 4RS2A 3W6XA 3BLNA 4II9A 1IB1E 1YGHA 1ON0A 3QAHA 2R1IA 2J8MA 1YR0A 5EBVA 4ORFA 1CM0A 1YK3A 1VHSA 2BUEA 1Q2YA 2R98A 3OWCA 3F5BA 5IB0A 4QB9A 4KOXA 3FIXA 4E2AA 2ATRA 3H4QA 2P6FA 4L89A 2D4PA 3UY5A 4HNWB 2VI7A 3FBUA 4AG9A 4H6UA 4J3GA 4MY3A 3FB3A 1MJ9A 4UBRA 4AB7A 1IYLA 3D8PA 1S7LA 2Q04A 4HNYB 2ZXVA 3P2HA 3TFYA 3DDDA 4FD4A 2J8RA 5H86A 3TE4A 1Z4EA 3D2PA 3DSBA 4LUAA 2FXFA 1S60A 4MY0A 1SQHA 1KUYA 4F6AA 4R87A 4NXYA 1Q2DA 2VEZA 4KZTA 2FIWA 3MGDA 1U6MA 2OH1A 4JLYA 5CNPA 2ARHA 3G8WA 4UA3A 3S6GA 3FNCA 4YFJA 4PV6A 5C82A 3I9SA 3GY9A 2OZHA 4PSXA 4UWIA 2D4OA 3EXNA 2G3TA 4R3LA 5F46A 2C27A 2GIVA 4YGOA 1TIQA 2JDDA 1S7NA 4KOTA 1YVKA 4IF5A 4X5KA 4NCZA 3TO6A 1N71A 3FRMA 4OLLA 2CNTA 4QBJA 4ONUA 2PDOA 4KVME 4U5YA 3D2MA 1M4DA 2Z11A 4NF1A 4E0AA 2KCWA 1NSLA 3EC4A 4QVTA
chains in the Genus database with same CATH superfamily
2PRBA 4TWEA 3D66A 2Q0YA 5JH9A 2EO8A 1Y9KA 5AG5A 4CGNA 2DPSA 1FY7A 2PJ5A 2QIRA 3N7ZA 2P6GA 2O28A 1CBXA 4W9YA 3RZAA 4EVYA 3H8EA 2PJBA 3PB7X 1Q7LA 1LAMA 4JJXA 3V8IA 2AFOA 2Q7SA 3C26A 4C68A 2F5IA 3CPXA 2Q51A 2P0WA 3P2FA 5HVHA 4UIAA 5J1QA 3HUVA 4PQAA 4XNHC 4R7MA 3S6HA 2PC1A 2NMTA 2FCKA 2Z3LA 2GANA 4KSFA 4U9ZA 3TOAA 3R9EA 4MFZA 2V8GA 3S9MA 5J8FA 3R9GA 2PJ8A 2R7HA 2VZYA 3FEDA 2PR8A 1F57A 2HV2A 4IK2A 2RC4A 1XOVA 4XPDC 5F47A 5LRGA 4B13A 5AGEA 5ISVA 4F8ZA 2HQYA 4YU9A 4JD6A 1IOFA 1S5KA 2K5TA 2CTCA 3PEIA 4MHPA 4NGMA 3N5FA 2JDCA 1YREA 4OC2A 5H84A 1S3ZA 5K8PA 1Z8XA 2I3CA 5A28A 3K9UA 2ZEPA 1RTQA 2OB0A 4KSAA 4CAXA 1PCAA 3G3SA 1Z2LA 4Q36A 2B58A 1WWZA 2POKA 1M4GA 4KVOE 5JPHA 4QUSA 3CDXA 3BI1A 2GE3A 4H2KA 2NYQA 2CNSA 2BEIA 4BMHA 5JGFA 1HDQA 2PVVA 5KTDA 1ZO0A 4K30A 3R1KA 5AG4A 5IV0A 3LODA 2PR1A 4KOUA 3CXQA 1ZG8A 4EMEA 4UEFA 4PK3A 3E0KA 1ZLIA 3CXSA 3NA6A 1MK4A 2F8HA 4MXUA 3WR7A 1YLOA 1F2PA 4CYPA 3FJUA 4OP4A 2G9DA 1IGBA 4A31A 3R96A 3ZJ0A 1LRZA 4UF4A 5CPAA 1XF8A 4LQ6A 3TO9A 2GLJA 2WYRA 5E96A 5F09A 4KUAA 4R6TA 5F48A 4B5OA 2PSWA 1V0CA 2B3VA 3EFAA 4KOWA 4NFRA 4OADA 3SHPA 1S7FA 4XPKA 4M6GA 3B35A 4UFXA 1KUVA 6CPAA 4CAWA 4L8AA 2PVWA 2B4DA 2Q44A 1H8LA 1F2OA 2XEGA 4CS0B 4PXBA 3A9LA 2PIYA 1TF8A 1ZG7A 2EVNA 3IC1A 1QMUA 4MHDA 5DWNA 4CAFA 1AUGA 3KHZA 2ZENA 2A4NA 4JXQA 1YX0A 4OC4A 3T8WA 1UWYA 1P0HA 3DGVA 2BOAA 4UEZA 4C2YA 1FT7A 4UCMA 3WT4A 1CX8A 1XFOA 2PE3A 4CGLA 4ONWA 2CXAA 5IX3A 1IU8A 2CTBA 1CPSA 1AMPA 3PB4X 2IQ6A 4DJLA 5D29A 4DNCA 4IUSA 4X3RA 5G20A 3T90A 1ZLHA 2PJCA 3FX6A 4XNHB 1YVOA 2CY2A 3B8GA 1YMEA 3JVNA 3PGPA 5HMNA 1UFHA 2YNEA 3BXMA 2B3UA 1BOBA 4FD7A 4CPAA 5K8NA 1XE4A 3RO0A 4MHZA 4CYNA 4NJRA 4XPDB 4WWVA 2OU2A 2C6PA 3NH8A 3SJXA 3W91A 2ZPAA 1GYTA 4MFPA 3NE8A 2WPXA 4NGRA 1L0CA 1I1DA 3MN8A 4M3SA 3F0AA 5K8MA 3FMCA 4GS4A 2V8DA 4Q38A 4BBHA 1M1DA 3CZXA 1TKFA 1Y0YA 3NH5A 3H8GA 4B6ZA 2IL4A 1Z4RA 2ZEFA 4B12A 4KS9A 3RNZA 2GREA 2J9AA 4PPZA 3SJEA 1VIXA 2REEA 5IB9A 2RB7A 4I49A 4A32A 4U9YA 4EFDA 4M85A 1QSMA 2ABZA 5JM6A 1S7KA 4CYOA 2QVPA 4Y49C 2CF4A 4MCRA 2V8VA 1VGYA 4B5PA 4C2ZA 3TOBA 3KQXA 1LANA 2Z0ZA 4OC5A 1BPNA 3KR4A 4KSIA 4MJ8A 4XPLA 3ZZIA 3FH4A 1I12A 2O4HA 3I1UA 4MFQA 4MCSA 1I21A 4Z65A 2XEJA 4BINA 3PBBA 3EO4A 4OAEA 5I0CA 3IO1A 3B3SA 2VZZA 5JQ4A 2ZW7A 4MFJA 2VQYA 1R57A 2I79A 3SI0A 4MCPA 2ZELA 2BCOA 3EY5A 5AG6A 3KASA 5KTCA 5LRKA 2IJZA 2X7BA 3DR6A 1LFWA 3K9TA 2HC9A 1XMTA 4FWUA 2DXQA 4NGSA 5K8OA 2WZNA 4P4IA 3FYNA 2PJ6A 4OKOA 4P4JA 2ZW6A 3IEHA 1KZFA 5GCNA 3FVLA 2G3AA 1PU9A 2B5GA 3ISZA 2VL1A 1K4JA 1PUAA 2DPTA 3IWEA 2VXKA 3CPAA 4OMEA 3IU2A 3R95A 3WC5A 4H6ZA 2JLMA 2Z3OA 4CAEA 3TTHA 2ZW5A 1IY7A 1JWQA 2JEVA 3GLJA 2J8NA 4WJBA 1Q2CA 4GXHA 4QC6A 4M6HA 4K3NA 4TNUA 2FS5A 2QMLA 4KVXA 2GU2A 2YNDA 2FL4A 2HB6A 4UCPA 3I3GA 1M44A 2B4DB 2XEFA 2AFZA 4O23A 1EE3P 4ZX8A 3SXOA 3JRUA 3LACA 3PFOA 1BPMA 5A27A 5KTAA 3QAYA 4B10A 4KUBA 3TX8A 4KOYA 1VKCA 4LQGA 2ZOFA 1NSAA 2YNCA 3QB8A 8CPAA 2I00A 4HNXB 4CGPA 3NH4A 4PSWA 3IWGA 4R3KA 5HH1A 3S9LA 4A39A 2FVGA 3KR5A 2ZEMA 2Q7BA 4A30A 3IIBA 1DTDA 2PJ1A 3D67A 2JEWA 1CP6A 4A38A 2Z3MA 4F9VA 1ZG9A 1CPXA 1MJBA 2B4BA 3PZJA 2Z10A 4A33A 2FE7A 4OIDA 4F9UA 4OIWA 4B14A 4JWPA 1QSTA 1ARLA 4UWJA 1R43A 2HUZA 1WK4A 4LX9A 4Y49B 4PXEA 4FAIA 1KUXA 1BLLE 4OC3A 2YNCC 4MHNA 5LYIA 4X2TA 2C6CA 1OZPA 4ZBGA 4BD9A 4C7HA 1XRYA 4A2ZA 2Z3PA 4MBUA 3VWEA 2C1CA 3D7GA 1YLEA 3IJ3A 4RUHA 1CJWA 3PB8X 4KOVA 4ZYQA 3DNSA 4JXRA 3RBUA 1HDUA 3SXNA 2OR4A 3GB0A 1MJAA 3RYOA 3V38A 3TC8A 4KLWA 4NGTA 3RAMA 2BSWA 4MHYA 4R57A 3F8KA 3FXTA 4B5PB 4FD6A 4E8OA 3DR8A 4CAVA 1NMTA 3GUXA 4UCNA 1QSNA 2WSAA 1M4LA 2OZGA 1B6BA 2AFSA 4P44A 5I4MA 1LAPA 2BL1A 3GKRA 5C88A 5J8CA 3IU1A 1RO5A 5LYDA 4AVCA 4NGPA 5THWA 2V77A 3PB6X 3NFZA 1Z9UA 1Y7EA 1RXTA 3SI1A 3CXPA 1Y0RA 1Z8WA 3TCVA 4GM5A 2GLFA 5D8NA 3TT2A 2PQ8A 4F0YA 2PIZA 4CRYB 2FSRA 3BJ7A 2P6EA 1IIDA 5LRJA 2AFUA 2AFWA 4C2XA 1IICA 4FD5A 1ARMA 3KGQA 3S6FA 5EMIA 1IOIA 2EUIA 2AE6A 4NEXA 2JBKA 3GYAA 4ZI6A 2Q4YA 1XEBA 2FIAA 2ZEGA 1M4IA 4AXVA 3R9FA 2Y0MA 1XMBA 5LYFA 3LD2A 1CG2A 1J4JA 2B5GB 1NE9A 2DEAA 4RI1A 3D7FA 4CYQA 1YW4A 2PJAA 3BJ8A 3SI2A 2REFA 5BWAB 4KOSA 2IMOA 3B3CA 4JZ0A 3KQZA 4F0XA 2VBQA 5FVJA 3D7HA 2Q4ZA 4P10A 3PP9A 4P4FA 3S6KA 2Q4VA 3JUWA 1CP7A 1QQ9A 4OC1A 4NGQA 4P45A 1ELLP 4HPSA 3D7DA 4H89A 3LMSA 4HKFA 1QSOA 2CNMA 2OZUA 3FECA 3SJGA 5F49A 3BI0A 3IWWA 4MFLA 5DS0A 1GHEA 1B87A 1XIXA 2AFXA 3FEEA 4R9MA 2FT0A 1BO4A 2ZW4A 4OC0A 4YRHA 5DWMA 2QECA 3D3SA 2G0BA 1XJOA 1TXRA 3H5ZA 2AJ6A 1R3NA 2O53A 2PJ2A 3B7IA 2ZEOA 2ANPA 3NE7A 3T9YA 5HVGA 2H5MA 4NSQA 3DLJA 2EK8A 3TO7A 3KL9A 4MI4A 4MCQA 4P4EA 4KLVA 3HLPA 4AVAA 3VARA 3SJFA 3MRUA 2ZEHA 1Y9WA 2PJ0A 1P4NA 1TF9A 1QSRA 3V7ZA 4UIBA 3KKWA 3W6SA 2R8VA 4PK2A 4ZY0A 4NGNA 3VWDA 3B3TA 4R8FA 7CPAA 2WPWA 5G21A 4KORA 1IYKA 3S9NA 1KWMA 2EWBA 2QJ8A 4CRZB 5CBMA 3IGRA 4AVBA 5EC4A 1Y7RA 4AG7A 1FNOA 1Z8LA 2NSMA 4FUUA 4RS2A 3W6XA 3BLNA 4II9A 2Z3NA 1IB1E 1YGHA 5LYLA 1ON0A 3QAHA 2R1IA 4R76A 1YSJA 1JQGA 4MFKA 2J8MA 1YR0A 5EBVA 4ORFA 4ZX9A 2ZEDA 2ZEEA 1CM0A 2YGWA 1YK3A 1AYEA 4P6YA 1VHSA 2BUEA 1Q2YA 2QYVA 3B3WA 2R98A 1Z5RA 3OWCA 1LCPA 3F5BA 4QB9A 5IB0A 4KOXA 1X10A 1VHOA 3FIXA 4G1PA 4E2AA 2ATRA 4ZY2A 3H4QA 2Z3KA 3L2NA 1Z8TA 2P6FA 2PJ9A 1LOKA 2D4PA 4L89A 3UY5A 4HNWB 4MMOA 4X8IA 4IAVA 4PXDA 2VI7A 3FBUA 4AG9A 4H6UA 4J3GA 5G22A 1YQEA 4UFVA 4UEEA 2PJ7A 4MY3A 1BAVA 1TKHA 3FB3A 3D4UA 1MJ9A 4UBRA 3WABA 2AFMA 1IYLA 4AB7A 4P4BA 3D8PA 1S7LA 2Q04A 4HNYB 2Q43A 2EK9A 3QNVA 3KZWA 3LWUA 2ZXVA 3P2HA 4PXCA 5AG7A 3DDDA 4FD4A 4FBEA 3TFYA 2J8RA 5H86A 3FF3A 3TE4A 4C7IA 1Z4EA 3D2PA 3DSBA 4CGOA 1OBRA 2FXFA 1A2ZA 2RFHA 4LUAA 4ZGYB 1S60A 4MY0A 1SQHA 1DE4C 1KUYA 5G1ZA 4DYOA 4JYWA 4F6AA 2F7VA 4R87A 4NXYA 1X12A 1HEEA 4M6IA 1Q2DA 3ISXA 2VEZA 1PYTB 3K2KA 4KZTA 2DF5A 2FIWA 3MGDA 2BO9A 4YWYA 2ODFA 1TKJA 1YW6A 3D68A 4NJQA 1U6MA 2OH1A 3WC7A 4JLYA 5CNPA 4A95A 2EBJA 4ZY1A 2ARHA 3G8WA 3PFEA 3H8FA 3B3VA 5HVFA 1ELMP 4UA3A 2WUUA 4CGMA 3BHXA 3S6GA 3FNCA 3B2YA 4YFJA 4PV6A 1XBUA 2JBJA 3I9SA 3KHXA 4MRIA 5C82A 5ELYA 3PB9X 3GY9A 2CIJA 2OZHA 4PSXA 4A37A 4UWIA 2D4OA 4P4DA 3EXNA 2G3TA 3IFEA 4R3LA 4DUKA 2ZOGA 2XEIA 5F46A 2C27A 2GIVA 4YGOA 1TIQA 2PRQA 2C6GA 2JDDA 4UFWA 1S7NA 4A94A 4B11A 2PJ4A 4KOTA 1YVKA 4IF5A 3WC6A 2PCUA 2GFQA 4Q7AA 4NCZA 4X5KA 3TO6A 1N71A 3FRMA 1VHEA 3JTKA 4RN7A 5HXDA 4OLLA 2CNTA 4QBJA 3CT9A 4ONUA 2PDOA 4KVME 4U5YA 3KI9A 2V8HA 3D2MA 4IHMA 2OOTA 1M4DA 2Z11A 3GIUA 3PRTA 4NF1A 3VATA 4E0AA 2PJ3A 2KCWA 1NSLA 3VH9A 3EC4A 4QVTA 3PBEA 4EWTA
chains in the Genus database with same CATH topology
2PRBA 2Q0YA 1Y9KA 5AG5A 4CGNA 2DPSA 1FY7A 2QIRA 3N7ZA 2P6GA 2O28A 4JJXA 3V8IA 4C68A 3C26A 2F5IA 2P0WA 3P2FA 4XNHC 3S6HA 2PC1A 2NMTA 2FCKA 2Z3LA 2GANA 4KSFA 4U9ZA 3TOAA 3R9EA 4MFZA 5J8FA 3R9GA 2R7HA 2VZYA 2PR8A 4B13A 2HV2A 2RC4A 4XPDC 5F47A 5AGEA 5ISVA 2HQYA 4JD6A 1S5KA 2K5TA 5H84A 2JDCA 1YREA 1S3ZA 5A28A 3K9UA 4KSAA 2OB0A 4CAXA 3G3SA 4Q36A 2B58A 1WWZA 5JPHA 1M4GA 4KVOE 4QUSA 2GE3A 2CNSA 2BEIA 4BMHA 5KTDA 1ZO0A 4K30A 3R1KA 5AG4A 5IV0A 3LODA 2PR1A 4KOUA 3CXQA 4PK3A 3E0KA 3CXSA 1MK4A 3WR7A 4CYPA 4A31A 3R96A 3ZJ0A 1LRZA 1XF8A 3TO9A 5E96A 4KUAA 5F48A 4B5OA 2PSWA 1V0CA 2B3VA 3EFAA 4KOWA 4OADA 3SHPA 1S7FA 4XPKA 4UFXA 1KUVA 4CAWA 4L8AA 2B4DA 2Q44A 4CS0B 3A9LA 4MHDA 2EVNA 5DWNA 4CAFA 2A4NA 4JXQA 1YX0A 1P0HA 4C2YA 4UCMA 4CGLA 2CXAA 5IX3A 4DNCA 4IUSA 5G20A 4XNHB 1YVOA 2CY2A 3B8GA 3JVNA 3PGPA 5HMNA 1UFHA 2YNEA 2B3UA 1BOBA 4FD7A 1XE4A 4CYNA 4XPDB 2OU2A 3W91A 2ZPAA 4MFPA 2WPXA 1L0CA 1I1DA 4M3SA 3F0AA 4GS4A 4Q38A 4BBHA 1M1DA 2IL4A 1Z4RA 4B12A 4KS9A 2REEA 4I49A 4A32A 4U9YA 4M85A 1QSMA 1S7KA 4CYOA 4Y49C 4B5PA 4C2ZA 3TOBA 2Z0ZA 4MJ8A 4XPLA 3ZZIA 1I12A 4MFQA 1I21A 3EO4A 4OAEA 5I0CA 2VZZA 5JQ4A 2ZW7A 4MFJA 2VQYA 1R57A 2I79A 3EY5A 5AG6A 5KTCA 2X7BA 3DR6A 1XMTA 2DXQA 3FYNA 2ZW6A 1KZFA 5GCNA 2G3AA 1PU9A 2B5GA 4EVYA 1K4JA 1PUAA 2DPTA 3IWEA 2VXKA 3R95A 4ZGYB 3IU2A 4H6ZA 2JLMA 2Z3OA 4CAEA 3TTHA 2ZW5A 2JEVA 2J8NA 1Q2CA 4QC6A 2FS5A 2QMLA 4KVXA 2YNDA 2FL4A 4UCPA 3I3GA 1M44A 2B4DB 3SXOA 5A27A 5KTAA 4B10A 4KUBA 4KOYA 1VKCA 2YNCA 3QB8A 2I00A 4HNXB 4CGPA 4PSWA 4R3KA 3IWGA 5HH1A 2Q7BA 4A30A 2Z3MA 1MJBA 2B4BA 3PZJA 2Z10A 4A33A 2FE7A 4B14A 4JWPA 1QSTA 4UWJA 2HUZA 1WK4A 4LX9A 4Y49B 1KUXA 2YNCC 1OZPA 4ZBGA 4C7HA 4A2ZA 2Z3PA 4MBUA 3VWEA 1YLEA 1CJWA 4KOVA 3DNSA 4JXRA 3SXNA 1MJAA 3RYOA 4KLWA 2BSWA 4R57A 3F8KA 3FXTA 4B5PB 4FD6A 4E8OA 3DR8A 4CAVA 1NMTA 4UCNA 1QSNA 2WSAA 2OZGA 1B6BA 5C88A 2BL1A 3GKRA 5J8CA 3IU1A 1RO5A 4AVCA 1Z9UA 1RXTA 3CXPA 3TCVA 3TT2A 2PQ8A 4F0YA 4CRYB 2FSRA 3BJ7A 2P6EA 1IIDA 4C2XA 1IICA 4FD5A 3S6FA 2EUIA 2AE6A 4NEXA 3GYAA 2Q4YA 1XEBA 2FIAA 1M4IA 3R9FA 2Y0MA 3LD2A 1J4JA 2B5GB 1NE9A 4RI1A 4CYQA 3BJ8A 2REFA 5BWAB 4KOSA 4F0XA 2VBQA 5FVJA 3PP9A 3S6KA 2Q4VA 3JUWA 4H89A 4HKFA 1QSOA 2CNMA 2OZUA 5F49A 4MFLA 3T90A 1GHEA 1B87A 1XIXA 4R9MA 5DWMA 2FT0A 1BO4A 2ZW4A 4YRHA 2QECA 3D3SA 2G0BA 3H5ZA 2AJ6A 3NE7A 3T9YA 2H5MA 4NSQA 3TO7A 4MI4A 4KLVA 4AVAA 1Y9WA 1P4NA 1QSRA 3W6SA 3KKWA 2R8VA 4PK2A 3VWDA 2WPWA 5G21A 4KORA 1IYKA 4CRZB 3IGRA 4AVBA 5EC4A 1Y7RA 4AG7A 4RS2A 3W6XA 3BLNA 4II9A 2Z3NA 1IB1E 1YGHA 1ON0A 3QAHA 2R1IA 4MFKA 2J8MA 1YR0A 5EBVA 4ORFA 1CM0A 2YGWA 1YK3A 1VHSA 2BUEA 1Q2YA 2R98A 3OWCA 3F5BA 5IB0A 4QB9A 4KOXA 3FIXA 4E2AA 2ATRA 3H4QA 2Z3KA 2P6FA 4L89A 2D4PA 3UY5A 4HNWB 2VI7A 3FBUA 4AG9A 4H6UA 4J3GA 5G22A 4UFVA 4MY3A 3FB3A 1MJ9A 4UBRA 4AB7A 1IYLA 3D8PA 1S7LA 2Q04A 4HNYB 2ZXVA 3P2HA 5AG7A 3TFYA 3DDDA 4FD4A 2J8RA 5H86A 3TE4A 4C7IA 1Z4EA 3D2PA 3DSBA 4CGOA 4LUAA 2FXFA 1S60A 4MY0A 1SQHA 5G1ZA 1KUYA 4F6AA 4R87A 4NXYA 1Q2DA 2VEZA 4KZTA 2FIWA 3MGDA 1U6MA 2OH1A 4JLYA 5CNPA 4A95A 2ARHA 3G8WA 4UA3A 2WUUA 4CGMA 3S6GA 3FNCA 4YFJA 4PV6A 5C82A 3I9SA 3GY9A 2OZHA 4PSXA 4UWIA 2D4OA 3EXNA 2G3TA 4R3LA 5F46A 2C27A 2GIVA 4YGOA 1TIQA 2JDDA 4UFWA 1S7NA 4B11A 4KOTA 1YVKA 4IF5A 4X5KA 4NCZA 3TO6A 1N71A 3FRMA 3JTKA 4OLLA 2CNTA 4QBJA 4ONUA 2PDOA 4KVME 4U5YA 3D2MA 1M4DA 2Z11A 4NF1A 4E0AA 2KCWA 1NSLA 3EC4A 4QVTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PRB A;  2Q0Y A;  1Y9K A;  1FY7 A;  2QIR A;  3N7Z A;  2P6G A;  2O28 A;  4JJX A;  3V8I A;  3C26 A;  2F5I A;  2P0W A;  3P2F A;  4XNH C;  3S6H A;  2PC1 A;  2NMT A;  2FCK A;  2GAN A;  4U9Z A;  3TOA A;  3R9E A;  5J8F A;  3R9G A;  2R7H A;  2VZY A;  2PR8 A;  2HV2 A;  2RC4 A;  4XPD C;  5F47 A;  5ISV A;  2HQY A;  4JD6 A;  1S5K A;  2K5T A;  5H84 A;  2JDC A;  1YRE A;  1S3Z A;  3K9U A;  2OB0 A;  4CAX A;  3G3S A;  2B58 A;  1WWZ A;  5JPH A;  1M4G A;  4KVO E;  4QUS A;  2GE3 A;  2CNS A;  2BEI A;  4BMH A;  5KTD A;  4K30 A;  3R1K A;  5IV0 A;  3LOD A;  2PR1 A;  4KOU A;  3CXQ A;  4PK3 A;  3E0K A;  3CXS A;  1MK4 A;  3WR7 A;  3R96 A;  3ZJ0 A;  1LRZ A;  1XF8 A;  3TO9 A;  5E96 A;  4KUA A;  5F48 A;  4B5O A;  2PSW A;  1V0C A;  2B3V A;  3EFA A;  4KOW A;  4OAD A;  3SHP A;  1S7F A;  4XPK A;  1KUV A;  4CAW A;  4L8A A;  2B4D A;  2Q44 A;  4CS0 B;  4MHD A;  2EVN A;  5DWN A;  2A4N A;  4JXQ A;  1YX0 A;  1P0H A;  5IX3 A;  4DNC A;  4IUS A;  4XNH B;  1YVO A;  2CY2 A;  3B8G A;  3JVN A;  3PGP A;  5HMN A;  1UFH A;  2B3U A;  1BOB A;  4FD7 A;  1XE4 A;  4XPD B;  2OU2 A;  3W91 A;  2ZPA A;  2WPX A;  1L0C A;  1I1D A;  4M3S A;  3F0A A;  4GS4 A;  1M1D A;  2IL4 A;  1Z4R A;  2REE A;  4I49 A;  4U9Y A;  4M85 A;  1QSM A;  1S7K A;  4Y49 C;  4B5P A;  3TOB A;  2Z0Z A;  4MJ8 A;  4XPL A;  3ZZI A;  1I12 A;  1I21 A;  3EO4 A;  4OAE A;  5I0C A;  2VZZ A;  5JQ4 A;  2ZW7 A;  2VQY A;  1R57 A;  2I79 A;  3EY5 A;  5KTC A;  2X7B A;  3DR6 A;  1XMT A;  2DXQ A;  3FYN A;  2ZW6 A;  1KZF A;  5GCN A;  2G3A A;  1PU9 A;  2B5G A;  4EVY A;  1K4J A;  1PUA A;  3R95 A;  2VXK A;  4H6Z A;  2JLM A;  3TTH A;  2ZW5 A;  2JEV A;  2J8N A;  1Q2C A;  4QC6 A;  2FS5 A;  2QML A;  4KVX A;  2FL4 A;  3I3G A;  1M44 A;  2B4D B;  3SXO A;  5KTA A;  4KUB A;  4KOY A;  1VKC A;  3QB8 A;  2I00 A;  4HNX B;  4PSW A;  4R3K A;  3IWG A;  5HH1 A;  2Q7B A;  1MJB A;  2B4B A;  3PZJ A;  2Z10 A;  2FE7 A;  4JWP A;  1QST A;  4UWJ A;  2HUZ A;  1WK4 A;  4LX9 A;  4Y49 B;  1KUX A;  1OZP A;  4ZBG A;  4MBU A;  3VWE A;  1YLE A;  1CJW A;  4KOV A;  3DNS A;  4JXR A;  3SXN A;  1MJA A;  3RYO A;  4KLW A;  2BSW A;  4R57 A;  3F8K A;  3FXT A;  4B5P B;  4FD6 A;  4E8O A;  3DR8 A;  4CAV A;  1NMT A;  1QSN A;  2OZG A;  1B6B A;  5C88 A;  2BL1 A;  3GKR A;  5J8C A;  1RO5 A;  4AVC A;  1Z9U A;  1RXT A;  3CXP A;  3TCV A;  3TT2 A;  2PQ8 A;  4F0Y A;  4CRY B;  2FSR A;  3BJ7 A;  2P6E A;  1IID A;  1IIC A;  4FD5 A;  3S6F A;  2EUI A;  2AE6 A;  4NEX A;  3GYA A;  2Q4Y A;  1XEB A;  2FIA A;  1M4I A;  3R9F A;  2Y0M A;  3LD2 A;  1J4J A;  2B5G B;  1NE9 A;  4RI1 A;  3BJ8 A;  2REF A;  4KOS A;  2VBQ A;  5FVJ A;  3PP9 A;  3S6K A;  2Q4V A;  3JUW A;  4H89 A;  4HKF A;  1QSO A;  2CNM A;  2OZU A;  5F49 A;  3T90 A;  1GHE A;  1B87 A;  1XIX A;  4R9M A;  5DWM A;  2FT0 A;  1BO4 A;  2ZW4 A;  4YRH A;  2QEC A;  3D3S A;  2G0B A;  2AJ6 A;  3NE7 A;  3T9Y A;  2H5M A;  4NSQ A;  3TO7 A;  4MI4 A;  4KLV A;  4AVA A;  1Y9W A;  1P4N A;  1QSR A;  3W6S A;  3KKW A;  2R8V A;  4PK2 A;  3VWD A;  2WPW A;  4KOR A;  1IYK A;  4CRZ B;  3IGR A;  4AVB A;  5EC4 A;  1Y7R A;  4AG7 A;  4RS2 A;  3W6X A;  3BLN A;  4II9 A;  1IB1 E;  1YGH A;  1ON0 A;  3QAH A;  2R1I A;  2J8M A;  1YR0 A;  5EBV A;  4ORF A;  1CM0 A;  1YK3 A;  1VHS A;  2BUE A;  1Q2Y A;  2R98 A;  3OWC A;  3F5B A;  5IB0 A;  4QB9 A;  4KOX A;  3FIX A;  4E2A A;  2ATR A;  3H4Q A;  2P6F A;  4L89 A;  2D4P A;  3UY5 A;  4HNW B;  2VI7 A;  3FBU A;  4AG9 A;  4H6U A;  4J3G A;  4MY3 A;  3FB3 A;  1MJ9 A;  4UBR A;  4AB7 A;  1IYL A;  3D8P A;  1S7L A;  2Q04 A;  4HNY B;  2ZXV A;  3P2H A;  3TFY A;  3DDD A;  4FD4 A;  2J8R A;  5H86 A;  3TE4 A;  1Z4E A;  3D2P A;  3DSB A;  4LUA A;  2FXF A;  1S60 A;  4MY0 A;  1SQH A;  1KUY A;  4F6A A;  4R87 A;  4NXY A;  1Q2D A;  2VEZ A;  4KZT A;  2FIW A;  3MGD A;  1U6M A;  2OH1 A;  4JLY A;  5CNP A;  2ARH A;  3G8W A;  4UA3 A;  3S6G A;  3FNC A;  4YFJ A;  4PV6 A;  5C82 A;  3I9S A;  3GY9 A;  2OZH A;  4PSX A;  4UWI A;  2D4O A;  3EXN A;  2G3T A;  4R3L A;  5F46 A;  2C27 A;  2GIV A;  4YGO A;  1TIQ A;  2JDD A;  1S7N A;  4KOT A;  1YVK A;  4IF5 A;  4X5K A;  4NCZ A;  3TO6 A;  1N71 A;  3FRM A;  4OLL A;  2CNT A;  4QBJ A;  4ONU A;  2PDO A;  4KVM E;  4U5Y A;  3D2M A;  1M4D A;  2Z11 A;  4NF1 A;  4E0A A;  2KCW A;  1NSL A;  3EC4 A;  4QVT A; 
#chains in the Genus database with same CATH topology
 2PRB A;  4TWE A;  3D66 A;  2Q0Y A;  5JH9 A;  2EO8 A;  1Y9K A;  5AG5 A;  4CGN A;  2DPS A;  1FY7 A;  2PJ5 A;  2QIR A;  3N7Z A;  2P6G A;  2O28 A;  1CBX A;  4W9Y A;  3RZA A;  4EVY A;  3H8E A;  2PJB A;  3PB7 X;  1Q7L A;  1LAM A;  4JJX A;  3V8I A;  2AFO A;  2Q7S A;  3C26 A;  4C68 A;  2F5I A;  3CPX A;  2Q51 A;  2P0W A;  3P2F A;  5HVH A;  4UIA A;  5J1Q A;  3HUV A;  4PQA A;  4XNH C;  4R7M A;  3S6H A;  2PC1 A;  2NMT A;  2FCK A;  2Z3L A;  2GAN A;  4KSF A;  4U9Z A;  3TOA A;  3R9E A;  4MFZ A;  2V8G A;  3S9M A;  5J8F A;  3R9G A;  2PJ8 A;  2R7H A;  2VZY A;  3FED A;  2PR8 A;  1F57 A;  2HV2 A;  4IK2 A;  2RC4 A;  1XOV A;  4XPD C;  5F47 A;  5LRG A;  4B13 A;  5AGE A;  5ISV A;  4F8Z A;  2HQY A;  4YU9 A;  4JD6 A;  1IOF A;  1S5K A;  2K5T A;  2CTC A;  3PEI A;  4MHP A;  4NGM A;  3N5F A;  2JDC A;  1YRE A;  4OC2 A;  5H84 A;  1S3Z A;  5K8P A;  1Z8X A;  2I3C A;  5A28 A;  3K9U A;  2ZEP A;  1RTQ A;  2OB0 A;  4KSA A;  4CAX A;  1PCA A;  3G3S A;  1Z2L A;  4Q36 A;  2B58 A;  1WWZ A;  2POK A;  1M4G A;  4KVO E;  5JPH A;  4QUS A;  3CDX A;  3BI1 A;  2GE3 A;  4H2K A;  2NYQ A;  2CNS A;  2BEI A;  4BMH A;  5JGF A;  1HDQ A;  2PVV A;  5KTD A;  1ZO0 A;  4K30 A;  3R1K A;  5AG4 A;  5IV0 A;  3LOD A;  2PR1 A;  4KOU A;  3CXQ A;  1ZG8 A;  4EME A;  4UEF A;  4PK3 A;  3E0K A;  1ZLI A;  3CXS A;  3NA6 A;  1MK4 A;  2F8H A;  4MXU A;  3WR7 A;  1YLO A;  1F2P A;  4CYP A;  3FJU A;  4OP4 A;  2G9D A;  1IGB A;  4A31 A;  3R96 A;  3ZJ0 A;  1LRZ A;  4UF4 A;  5CPA A;  1XF8 A;  4LQ6 A;  3TO9 A;  2GLJ A;  2WYR A;  5E96 A;  5F09 A;  4KUA A;  4R6T A;  5F48 A;  4B5O A;  2PSW A;  1V0C A;  2B3V A;  3EFA A;  4KOW A;  4NFR A;  4OAD A;  3SHP A;  1S7F A;  4XPK A;  4M6G A;  3B35 A;  4UFX A;  1KUV A;  6CPA A;  4CAW A;  4L8A A;  2PVW A;  2B4D A;  2Q44 A;  1H8L A;  1F2O A;  2XEG A;  4CS0 B;  4PXB A;  3A9L A;  2PIY A;  1TF8 A;  1ZG7 A;  2EVN A;  3IC1 A;  1QMU A;  4MHD A;  5DWN A;  4CAF A;  1AUG A;  3KHZ A;  2ZEN A;  2A4N A;  4JXQ A;  1YX0 A;  4OC4 A;  3T8W A;  1UWY A;  1P0H A;  3DGV A;  2BOA A;  4UEZ A;  4C2Y A;  1FT7 A;  4UCM A;  3WT4 A;  1CX8 A;  1XFO A;  2PE3 A;  4CGL A;  4ONW A;  2CXA A;  5IX3 A;  1IU8 A;  2CTB A;  1CPS A;  1AMP A;  3PB4 X;  2IQ6 A;  4DJL A;  5D29 A;  4DNC A;  4IUS A;  4X3R A;  5G20 A;  3T90 A;  1ZLH A;  2PJC A;  3FX6 A;  4XNH B;  1YVO A;  2CY2 A;  3B8G A;  1YME A;  3JVN A;  3PGP A;  5HMN A;  1UFH A;  2YNE A;  3BXM A;  2B3U A;  1BOB A;  4FD7 A;  4CPA A;  5K8N A;  1XE4 A;  3RO0 A;  4MHZ A;  4CYN A;  4NJR A;  4XPD B;  4WWV A;  2OU2 A;  2C6P A;  3NH8 A;  3SJX A;  3W91 A;  2ZPA A;  1GYT A;  4MFP A;  3NE8 A;  2WPX A;  4NGR A;  1L0C A;  1I1D A;  3MN8 A;  4M3S A;  3F0A A;  5K8M A;  3FMC A;  4GS4 A;  2V8D A;  4Q38 A;  4BBH A;  1M1D A;  3CZX A;  1TKF A;  1Y0Y A;  3NH5 A;  3H8G A;  4B6Z A;  2IL4 A;  1Z4R A;  2ZEF A;  4B12 A;  4KS9 A;  3RNZ A;  2GRE A;  2J9A A;  4PPZ A;  3SJE A;  1VIX A;  2REE A;  5IB9 A;  2RB7 A;  4I49 A;  4A32 A;  4U9Y A;  4EFD A;  4M85 A;  1QSM A;  2ABZ A;  5JM6 A;  1S7K A;  4CYO A;  2QVP A;  4Y49 C;  2CF4 A;  4MCR A;  2V8V A;  1VGY A;  4B5P A;  4C2Z A;  3TOB A;  3KQX A;  1LAN A;  2Z0Z A;  4OC5 A;  1BPN A;  3KR4 A;  4KSI A;  4MJ8 A;  4XPL A;  3ZZI A;  3FH4 A;  1I12 A;  2O4H A;  3I1U A;  4MFQ A;  4MCS A;  1I21 A;  4Z65 A;  2XEJ A;  4BIN A;  3PBB A;  3EO4 A;  4OAE A;  5I0C A;  3IO1 A;  3B3S A;  2VZZ A;  5JQ4 A;  2ZW7 A;  4MFJ A;  2VQY A;  1R57 A;  2I79 A;  3SI0 A;  4MCP A;  2ZEL A;  2BCO A;  3EY5 A;  5AG6 A;  3KAS A;  5KTC A;  5LRK A;  2IJZ A;  2X7B A;  3DR6 A;  1LFW A;  3K9T A;  2HC9 A;  1XMT A;  4FWU A;  2DXQ A;  4NGS A;  5K8O A;  2WZN A;  4P4I A;  3FYN A;  2PJ6 A;  4OKO A;  4P4J A;  2ZW6 A;  3IEH A;  1KZF A;  5GCN A;  3FVL A;  2G3A A;  1PU9 A;  2B5G A;  3ISZ A;  2VL1 A;  1K4J A;  1PUA A;  2DPT A;  3IWE A;  2VXK A;  3CPA A;  4OME A;  3IU2 A;  3R95 A;  3WC5 A;  4H6Z A;  2JLM A;  2Z3O A;  4CAE A;  3TTH A;  2ZW5 A;  1IY7 A;  1JWQ A;  2JEV A;  3GLJ A;  2J8N A;  4WJB A;  1Q2C A;  4GXH A;  4QC6 A;  4M6H A;  4K3N A;  4TNU A;  2FS5 A;  2QML A;  4KVX A;  2GU2 A;  2YND A;  2FL4 A;  2HB6 A;  4UCP A;  3I3G A;  1M44 A;  2B4D B;  2XEF A;  2AFZ A;  4O23 A;  1EE3 P;  4ZX8 A;  3SXO A;  3JRU A;  3LAC A;  3PFO A;  1BPM A;  5A27 A;  5KTA A;  3QAY A;  4B10 A;  4KUB A;  3TX8 A;  4KOY A;  1VKC A;  4LQG A;  2ZOF A;  1NSA A;  2YNC A;  3QB8 A;  8CPA A;  2I00 A;  4HNX B;  4CGP A;  3NH4 A;  4PSW A;  3IWG A;  4R3K A;  5HH1 A;  3S9L A;  4A39 A;  2FVG A;  3KR5 A;  2ZEM A;  2Q7B A;  4A30 A;  3IIB A;  1DTD A;  2PJ1 A;  3D67 A;  2JEW A;  1CP6 A;  4A38 A;  2Z3M A;  4F9V A;  1ZG9 A;  1CPX A;  1MJB A;  2B4B A;  3PZJ A;  2Z10 A;  4A33 A;  2FE7 A;  4OID A;  4F9U A;  4OIW A;  4B14 A;  4JWP A;  1QST A;  1ARL A;  4UWJ A;  1R43 A;  2HUZ A;  1WK4 A;  4LX9 A;  4Y49 B;  4PXE A;  4FAI A;  1KUX A;  1BLL E;  4OC3 A;  2YNC C;  4MHN A;  5LYI A;  4X2T A;  2C6C A;  1OZP A;  4ZBG A;  4BD9 A;  4C7H A;  1XRY A;  4A2Z A;  2Z3P A;  4MBU A;  3VWE A;  2C1C A;  3D7G A;  1YLE A;  3IJ3 A;  4RUH A;  1CJW A;  3PB8 X;  4KOV A;  4ZYQ A;  3DNS A;  4JXR A;  3RBU A;  1HDU A;  3SXN A;  2OR4 A;  3GB0 A;  1MJA A;  3RYO A;  3V38 A;  3TC8 A;  4KLW A;  4NGT A;  3RAM A;  2BSW A;  4MHY A;  4R57 A;  3F8K A;  3FXT A;  4B5P B;  4FD6 A;  4E8O A;  3DR8 A;  4CAV A;  1NMT A;  3GUX A;  4UCN A;  1QSN A;  2WSA A;  1M4L A;  2OZG A;  1B6B A;  2AFS A;  4P44 A;  5I4M A;  1LAP A;  2BL1 A;  3GKR A;  5C88 A;  5J8C A;  3IU1 A;  1RO5 A;  5LYD A;  4AVC A;  4NGP A;  5THW A;  2V77 A;  3PB6 X;  3NFZ A;  1Z9U A;  1Y7E A;  1RXT A;  3SI1 A;  3CXP A;  1Y0R A;  1Z8W A;  3TCV A;  4GM5 A;  2GLF A;  5D8N A;  3TT2 A;  2PQ8 A;  4F0Y A;  2PIZ A;  4CRY B;  2FSR A;  3BJ7 A;  2P6E A;  1IID A;  5LRJ A;  2AFU A;  2AFW A;  4C2X A;  1IIC A;  4FD5 A;  1ARM A;  3KGQ A;  3S6F A;  5EMI A;  1IOI A;  2EUI A;  2AE6 A;  4NEX A;  2JBK A;  3GYA A;  4ZI6 A;  2Q4Y A;  1XEB A;  2FIA A;  2ZEG A;  1M4I A;  4AXV A;  3R9F A;  2Y0M A;  1XMB A;  5LYF A;  3LD2 A;  1CG2 A;  1J4J A;  2B5G B;  1NE9 A;  2DEA A;  4RI1 A;  3D7F A;  4CYQ A;  1YW4 A;  2PJA A;  3BJ8 A;  3SI2 A;  2REF A;  5BWA B;  4KOS A;  2IMO A;  3B3C A;  4JZ0 A;  3KQZ A;  4F0X A;  2VBQ A;  5FVJ A;  3D7H A;  2Q4Z A;  4P10 A;  3PP9 A;  4P4F A;  3S6K A;  2Q4V A;  3JUW A;  1CP7 A;  1QQ9 A;  4OC1 A;  4NGQ A;  4P45 A;  1ELL P;  4HPS A;  3D7D A;  4H89 A;  3LMS A;  4HKF A;  1QSO A;  2CNM A;  2OZU A;  3FEC A;  3SJG A;  5F49 A;  3BI0 A;  3IWW A;  4MFL A;  5DS0 A;  1GHE A;  1B87 A;  1XIX A;  2AFX A;  3FEE A;  4R9M A;  2FT0 A;  1BO4 A;  2ZW4 A;  4OC0 A;  4YRH A;  5DWM A;  2QEC A;  3D3S A;  2G0B A;  1XJO A;  1TXR A;  3H5Z A;  2AJ6 A;  1R3N A;  2O53 A;  2PJ2 A;  3B7I A;  2ZEO A;  2ANP A;  3NE7 A;  3T9Y A;  5HVG A;  2H5M A;  4NSQ A;  3DLJ A;  2EK8 A;  3TO7 A;  3KL9 A;  4MI4 A;  4MCQ A;  4P4E A;  4KLV A;  3HLP A;  4AVA A;  3VAR A;  3SJF A;  3MRU A;  2ZEH A;  1Y9W A;  2PJ0 A;  1P4N A;  1TF9 A;  1QSR A;  3V7Z A;  4UIB A;  3KKW A;  3W6S A;  2R8V A;  4PK2 A;  4ZY0 A;  4NGN A;  3VWD A;  3B3T A;  4R8F A;  7CPA A;  2WPW A;  5G21 A;  4KOR A;  1IYK A;  3S9N A;  1KWM A;  2EWB A;  2QJ8 A;  4CRZ B;  5CBM A;  3IGR A;  4AVB A;  5EC4 A;  1Y7R A;  4AG7 A;  1FNO A;  1Z8L A;  2NSM A;  4FUU A;  4RS2 A;  3W6X A;  3BLN A;  4II9 A;  2Z3N A;  1IB1 E;  1YGH A;  5LYL A;  1ON0 A;  3QAH A;  2R1I A;  4R76 A;  1YSJ A;  1JQG A;  4MFK A;  2J8M A;  1YR0 A;  5EBV A;  4ORF A;  4ZX9 A;  2ZED A;  2ZEE A;  1CM0 A;  2YGW A;  1YK3 A;  1AYE A;  4P6Y A;  1VHS A;  2BUE A;  1Q2Y A;  2QYV A;  3B3W A;  2R98 A;  1Z5R A;  3OWC A;  1LCP A;  3F5B A;  4QB9 A;  5IB0 A;  4KOX A;  1X10 A;  1VHO A;  3FIX A;  4G1P A;  4E2A A;  2ATR A;  4ZY2 A;  3H4Q A;  2Z3K A;  3L2N A;  1Z8T A;  2P6F A;  2PJ9 A;  1LOK A;  2D4P A;  4L89 A;  3UY5 A;  4HNW B;  4MMO A;  4X8I A;  4IAV A;  4PXD A;  2VI7 A;  3FBU A;  4AG9 A;  4H6U A;  4J3G A;  5G22 A;  1YQE A;  4UFV A;  4UEE A;  2PJ7 A;  4MY3 A;  1BAV A;  1TKH A;  3FB3 A;  3D4U A;  1MJ9 A;  4UBR A;  3WAB A;  2AFM A;  1IYL A;  4AB7 A;  4P4B A;  3D8P A;  1S7L A;  2Q04 A;  4HNY B;  2Q43 A;  2EK9 A;  3QNV A;  3KZW A;  3LWU A;  2ZXV A;  3P2H A;  4PXC A;  5AG7 A;  3DDD A;  4FD4 A;  4FBE A;  3TFY A;  2J8R A;  5H86 A;  3FF3 A;  3TE4 A;  4C7I A;  1Z4E A;  3D2P A;  3DSB A;  4CGO A;  1OBR A;  2FXF A;  1A2Z A;  2RFH A;  4LUA A;  4ZGY B;  1S60 A;  4MY0 A;  1SQH A;  1DE4 C;  1KUY A;  5G1Z A;  4DYO A;  4JYW A;  4F6A A;  2F7V A;  4R87 A;  4NXY A;  1X12 A;  1HEE A;  4M6I A;  1Q2D A;  3ISX A;  2VEZ A;  1PYT B;  3K2K A;  4KZT A;  2DF5 A;  2FIW A;  3MGD A;  2BO9 A;  4YWY A;  2ODF A;  1TKJ A;  1YW6 A;  3D68 A;  4NJQ A;  1U6M A;  2OH1 A;  3WC7 A;  4JLY A;  5CNP A;  4A95 A;  2EBJ A;  4ZY1 A;  2ARH A;  3G8W A;  3PFE A;  3H8F A;  3B3V A;  5HVF A;  1ELM P;  4UA3 A;  2WUU A;  4CGM A;  3BHX A;  3S6G A;  3FNC A;  3B2Y A;  4YFJ A;  4PV6 A;  1XBU A;  2JBJ A;  3I9S A;  3KHX A;  4MRI A;  5C82 A;  5ELY A;  3PB9 X;  3GY9 A;  2CIJ A;  2OZH A;  4PSX A;  4A37 A;  4UWI A;  2D4O A;  4P4D A;  3EXN A;  2G3T A;  3IFE A;  4R3L A;  4DUK A;  2ZOG A;  2XEI A;  5F46 A;  2C27 A;  2GIV A;  4YGO A;  1TIQ A;  2PRQ A;  2C6G A;  2JDD A;  4UFW A;  1S7N A;  4A94 A;  4B11 A;  2PJ4 A;  4KOT A;  1YVK A;  4IF5 A;  3WC6 A;  2PCU A;  2GFQ A;  4Q7A A;  4NCZ A;  4X5K A;  3TO6 A;  1N71 A;  3FRM A;  1VHE A;  3JTK A;  4RN7 A;  5HXD A;  4OLL A;  2CNT A;  4QBJ A;  3CT9 A;  4ONU A;  2PDO A;  4KVM E;  4U5Y A;  3KI9 A;  2V8H A;  3D2M A;  4IHM A;  2OOT A;  1M4D A;  2Z11 A;  3GIU A;  3PRT A;  4NF1 A;  3VAT A;  4E0A A;  2PJ3 A;  2KCW A;  1NSL A;  3VH9 A;  3EC4 A;  4QVT A;  3PBE A;  4EWT A; 
#chains in the Genus database with same CATH homology
 2PRB A;  2Q0Y A;  1Y9K A;  5AG5 A;  4CGN A;  2DPS A;  1FY7 A;  2QIR A;  3N7Z A;  2P6G A;  2O28 A;  4JJX A;  3V8I A;  4C68 A;  3C26 A;  2F5I A;  2P0W A;  3P2F A;  4XNH C;  3S6H A;  2PC1 A;  2NMT A;  2FCK A;  2Z3L A;  2GAN A;  4KSF A;  4U9Z A;  3TOA A;  3R9E A;  4MFZ A;  5J8F A;  3R9G A;  2R7H A;  2VZY A;  2PR8 A;  4B13 A;  2HV2 A;  2RC4 A;  4XPD C;  5F47 A;  5AGE A;  5ISV A;  2HQY A;  4JD6 A;  1S5K A;  2K5T A;  5H84 A;  2JDC A;  1YRE A;  1S3Z A;  5A28 A;  3K9U A;  4KSA A;  2OB0 A;  4CAX A;  3G3S A;  4Q36 A;  2B58 A;  1WWZ A;  5JPH A;  1M4G A;  4KVO E;  4QUS A;  2GE3 A;  2CNS A;  2BEI A;  4BMH A;  5KTD A;  1ZO0 A;  4K30 A;  3R1K A;  5AG4 A;  5IV0 A;  3LOD A;  2PR1 A;  4KOU A;  3CXQ A;  4PK3 A;  3E0K A;  3CXS A;  1MK4 A;  3WR7 A;  4CYP A;  4A31 A;  3R96 A;  3ZJ0 A;  1LRZ A;  1XF8 A;  3TO9 A;  5E96 A;  4KUA A;  5F48 A;  4B5O A;  2PSW A;  1V0C A;  2B3V A;  3EFA A;  4KOW A;  4OAD A;  3SHP A;  1S7F A;  4XPK A;  4UFX A;  1KUV A;  4CAW A;  4L8A A;  2B4D A;  2Q44 A;  4CS0 B;  3A9L A;  4MHD A;  2EVN A;  5DWN A;  4CAF A;  2A4N A;  4JXQ A;  1YX0 A;  1P0H A;  4C2Y A;  4UCM A;  4CGL A;  2CXA A;  5IX3 A;  4DNC A;  4IUS A;  5G20 A;  4XNH B;  1YVO A;  2CY2 A;  3B8G A;  3JVN A;  3PGP A;  5HMN A;  1UFH A;  2YNE A;  2B3U A;  1BOB A;  4FD7 A;  1XE4 A;  4CYN A;  4XPD B;  2OU2 A;  3W91 A;  2ZPA A;  4MFP A;  2WPX A;  1L0C A;  1I1D A;  4M3S A;  3F0A A;  4GS4 A;  4Q38 A;  4BBH A;  1M1D A;  2IL4 A;  1Z4R A;  4B12 A;  4KS9 A;  2REE A;  4I49 A;  4A32 A;  4U9Y A;  4M85 A;  1QSM A;  1S7K A;  4CYO A;  4Y49 C;  4B5P A;  4C2Z A;  3TOB A;  2Z0Z A;  4MJ8 A;  4XPL A;  3ZZI A;  1I12 A;  4MFQ A;  1I21 A;  3EO4 A;  4OAE A;  5I0C A;  2VZZ A;  5JQ4 A;  2ZW7 A;  4MFJ A;  2VQY A;  1R57 A;  2I79 A;  3EY5 A;  5AG6 A;  5KTC A;  2X7B A;  3DR6 A;  1XMT A;  2DXQ A;  3FYN A;  2ZW6 A;  1KZF A;  5GCN A;  2G3A A;  1PU9 A;  2B5G A;  4EVY A;  1K4J A;  1PUA A;  2DPT A;  3IWE A;  2VXK A;  3R95 A;  4ZGY B;  3IU2 A;  4H6Z A;  2JLM A;  2Z3O A;  4CAE A;  3TTH A;  2ZW5 A;  2JEV A;  2J8N A;  1Q2C A;  4QC6 A;  2FS5 A;  2QML A;  4KVX A;  2YND A;  2FL4 A;  4UCP A;  3I3G A;  1M44 A;  2B4D B;  3SXO A;  5A27 A;  5KTA A;  4B10 A;  4KUB A;  4KOY A;  1VKC A;  2YNC A;  3QB8 A;  2I00 A;  4HNX B;  4CGP A;  4PSW A;  4R3K A;  3IWG A;  5HH1 A;  2Q7B A;  4A30 A;  2Z3M A;  1MJB A;  2B4B A;  3PZJ A;  2Z10 A;  4A33 A;  2FE7 A;  4B14 A;  4JWP A;  1QST A;  4UWJ A;  2HUZ A;  1WK4 A;  4LX9 A;  4Y49 B;  1KUX A;  2YNC C;  1OZP A;  4ZBG A;  4C7H A;  4A2Z A;  2Z3P A;  4MBU A;  3VWE A;  1YLE A;  1CJW A;  4KOV A;  3DNS A;  4JXR A;  3SXN A;  1MJA A;  3RYO A;  4KLW A;  2BSW A;  4R57 A;  3F8K A;  3FXT A;  4B5P B;  4FD6 A;  4E8O A;  3DR8 A;  4CAV A;  1NMT A;  4UCN A;  1QSN A;  2WSA A;  2OZG A;  1B6B A;  5C88 A;  2BL1 A;  3GKR A;  5J8C A;  3IU1 A;  1RO5 A;  4AVC A;  1Z9U A;  1RXT A;  3CXP A;  3TCV A;  3TT2 A;  2PQ8 A;  4F0Y A;  4CRY B;  2FSR A;  3BJ7 A;  2P6E A;  1IID A;  4C2X A;  1IIC A;  4FD5 A;  3S6F A;  2EUI A;  2AE6 A;  4NEX A;  3GYA A;  2Q4Y A;  1XEB A;  2FIA A;  1M4I A;  3R9F A;  2Y0M A;  3LD2 A;  1J4J A;  2B5G B;  1NE9 A;  4RI1 A;  4CYQ A;  3BJ8 A;  2REF A;  5BWA B;  4KOS A;  4F0X A;  2VBQ A;  5FVJ A;  3PP9 A;  3S6K A;  2Q4V A;  3JUW A;  4H89 A;  4HKF A;  1QSO A;  2CNM A;  2OZU A;  5F49 A;  4MFL A;  3T90 A;  1GHE A;  1B87 A;  1XIX A;  4R9M A;  5DWM A;  2FT0 A;  1BO4 A;  2ZW4 A;  4YRH A;  2QEC A;  3D3S A;  2G0B A;  3H5Z A;  2AJ6 A;  3NE7 A;  3T9Y A;  2H5M A;  4NSQ A;  3TO7 A;  4MI4 A;  4KLV A;  4AVA A;  1Y9W A;  1P4N A;  1QSR A;  3W6S A;  3KKW A;  2R8V A;  4PK2 A;  3VWD A;  2WPW A;  5G21 A;  4KOR A;  1IYK A;  4CRZ B;  3IGR A;  4AVB A;  5EC4 A;  1Y7R A;  4AG7 A;  4RS2 A;  3W6X A;  3BLN A;  4II9 A;  2Z3N A;  1IB1 E;  1YGH A;  1ON0 A;  3QAH A;  2R1I A;  4MFK A;  2J8M A;  1YR0 A;  5EBV A;  4ORF A;  1CM0 A;  2YGW A;  1YK3 A;  1VHS A;  2BUE A;  1Q2Y A;  2R98 A;  3OWC A;  3F5B A;  5IB0 A;  4QB9 A;  4KOX A;  3FIX A;  4E2A A;  2ATR A;  3H4Q A;  2Z3K A;  2P6F A;  4L89 A;  2D4P A;  3UY5 A;  4HNW B;  2VI7 A;  3FBU A;  4AG9 A;  4H6U A;  4J3G A;  5G22 A;  4UFV A;  4MY3 A;  3FB3 A;  1MJ9 A;  4UBR A;  4AB7 A;  1IYL A;  3D8P A;  1S7L A;  2Q04 A;  4HNY B;  2ZXV A;  3P2H A;  5AG7 A;  3TFY A;  3DDD A;  4FD4 A;  2J8R A;  5H86 A;  3TE4 A;  4C7I A;  1Z4E A;  3D2P A;  3DSB A;  4CGO A;  4LUA A;  2FXF A;  1S60 A;  4MY0 A;  1SQH A;  5G1Z A;  1KUY A;  4F6A A;  4R87 A;  4NXY A;  1Q2D A;  2VEZ A;  4KZT A;  2FIW A;  3MGD A;  1U6M A;  2OH1 A;  4JLY A;  5CNP A;  4A95 A;  2ARH A;  3G8W A;  4UA3 A;  2WUU A;  4CGM A;  3S6G A;  3FNC A;  4YFJ A;  4PV6 A;  5C82 A;  3I9S A;  3GY9 A;  2OZH A;  4PSX A;  4UWI A;  2D4O A;  3EXN A;  2G3T A;  4R3L A;  5F46 A;  2C27 A;  2GIV A;  4YGO A;  1TIQ A;  2JDD A;  4UFW A;  1S7N A;  4B11 A;  4KOT A;  1YVK A;  4IF5 A;  4X5K A;  4NCZ A;  3TO6 A;  1N71 A;  3FRM A;  3JTK A;  4OLL A;  2CNT A;  4QBJ A;  4ONU A;  2PDO A;  4KVM E;  4U5Y A;  3D2M A;  1M4D A;  2Z11 A;  4NF1 A;  4E0A A;  2KCW A;  1NSL A;  3EC4 A;  4QVT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...