1KUYA

X-ray crystallographic studies of serotonin n-acetyltransferase catalysis and inhibition
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
166
structure length
166
Chain Sequence
HTLPANEFRCLTPEDAAGVFEIEREAFISVSGNCPLNLDEVQHFLTLCPELSLGWFVEGRLVAFIIGSLWDEERLTQESLALHRPRGHSAHLHALAVHRSFRQQGKGSVLLWRYLHHVGAQPAVRRAVLMCEDALVPFYQRFGFHPAGPCAIVVGSLTFTEMHCSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Serotonin N-acetyltransferase
publication title X-ray crystallographic studies of serotonin N-acetyltransferase catalysis and inhibition.
pubmed doi rcsb
source organism Ovis aries
total genus 44
structure length 166
sequence length 166
ec nomenclature ec 2.3.1.87: Aralkylamine N-acetyltransferase.
pdb deposition date 2002-01-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 1kuyA00
2PRBA 2RC4A 3FRMA 3NE7A 4E0AA 2B3VA 4XPDB 4U9YA 3DSBA 2CY2A 3GYAA 2ZW4A 2Z0ZA 1L0CA 5JQ4A 4KOSA 1KUYA 1CM0A 4KVME 1QSMA 3RYOA 3GKRA 3TFYA 2PC1A 4KZTA 1Q2CA 5ISVA 4GS4A 4H6UA 4QVTA 2HUZA 3JUWA 4KORA 4XPDC 1V0CA 4I49A 4KOWA 4JD6A 3VWDA 4HNWB 4KOXA 1YK3A 1Z9UA 1S7KA 2HV2A 1YVOA 4FD7A 1FY7A 4KLWA 4MI4A 5E96A 1M4GA 3TO9A 2VXKA 2OZGA 4BMHA 1I12A 5J8FA 2FE7A 1WK4A 1Z4RA 2AJ6A 2JEVA 4CAWA 2BEIA 1IB1E 4H89A 4YGOA 1B87A 4RS2A 1M44A 4II9A 1BO4A 4M85A 4Y49B 2B4DA 2PQ8A 3KKWA 3B8GA 4F0YA 2VQYA 4XPKA 2Q0YA 4OLLA 1MJAA 1S7FA 4AG9A 4X5KA 3QB8A 1YVKA 1YGHA 4L8AA 4CRYB 2PR1A 4NF1A 1YREA 1Z4EA 2OZHA 2G3AA 3PP9A 2JDDA 4Y49C 5KTAA 1QSOA 2B5GB 4PV6A 2Q04A 5IV0A 3DDDA 4J3GA 4JXQA 1IIDA 2Y0MA 4CRZB 3EXNA 3H4QA 2K5TA 1OZPA 2KCWA 3TO6A 2Q7BA 2NMTA 1SQHA 2R98A 2OZUA 1P0HA 2VZZA 4AVCA 4U5YA 4E8OA 2JLMA 2ZW5A 5EC4A 2R1IA 3S6GA 1M4IA 2VEZA 3CXQA 4R57A 5CNPA 4JXRA 1B6BA 3LD2A 3SXOA 4B5OA 3R95A 2BUEA 4PK3A 2Q44A 3FYNA 4NSQA 1UFHA 2FS5A 2PDOA 3OWCA 4AG7A 4B5PA 2CNMA 2OH1A 1GHEA 2B5GA 4MJ8A 2B4DB 1S7NA 1VHSA 2B4BA 4LUAA 1YLEA 3PZJA 4XNHC 3EFAA 1R57A 1YX0A 3BJ8A 2G0BA 5HMNA 4FD5A 4H6ZA 4MY3A 2CNTA 1Y7RA 5H86A 5F47A 3K9UA 2EUIA 2IL4A 2QMLA 4RI1A 4KUBA 1PU9A 4FD4A 5FVJA 3TCVA 3W6SA 2Q4VA 3P2FA 1U6MA 2ZPAA 3F0AA 3W91A 5DWNA 2BL1A 3IWGA 1KUVA 4ORFA 3C26A 1MJBA 4R9MA 4IUSA 1I1DA 1XE4A 4PK2A 3FIXA 2DXQA 4UBRA 2BSWA 4UA3A 2A4NA 1XEBA 1XF8A 5GCNA 4YRHA 2J8RA 3R9GA 1QSRA 4MY0A 3ZJ0A 4R3KA 3WR7A 4KOTA 3E0KA 2P6FA 5HH1A 4KOYA 4HNXB 3D2MA 4B5PB 3R1KA 3F8KA 3PGPA 1IICA 3EY5A 2Z10A 5DWMA 4L89A 2X7BA 3FBUA 4PSWA 2G3TA 3DR6A 2D4PA 2P6EA 1CJWA 1Y9KA 4R3LA 1WWZA 2AE6A 4EVYA 4NEXA 2GANA 1IYKA 2FL4A 1BOBA 1J4JA 3R96A 1I21A 4KOVA 2WPXA 4NXYA 5J8CA 3R9EA 1YR0A 1Q2DA 5F46A 3I9SA 3GY9A 2I79A 3FNCA 4U9ZA 5F48A 2VZYA 2QECA 2HQYA 1QSNA 3EC4A 4KLVA 1QSTA 2B3UA 3TE4A 4CS0B 4FD6A 4MBUA 2PR8A 2GE3A 1KUXA 3T9YA 3D8PA 1M1DA 5C82A 3FXTA 1KZFA 5IX3A 3DR8A 1RXTA 2P6GA 2VI7A 2FXFA 2WPWA 1XIXA 4ZBGA 2FSRA 4UWJA 2Z11A 4OADA 3CXPA 2REEA 4NCZA 1PUAA 4DNCA 4AVAA 1NMTA 2ARHA 3JVNA 4CAVA 1Q2YA 1ON0A 2P0WA 2Q4YA 4PSXA 4QUSA 4XPLA 5IB0A 2ZXVA 3MGDA 3SXNA 5JPHA 4IF5A 3T90A 1NSLA 5I0CA 1K4JA 4OAEA 3ZZIA 2I00A 2FIAA 4R87A 2H5MA 4ONUA 4JJXA 1XMTA 4KUAA 4UWIA 1VKCA 3W6XA 3FB3A 1S60A 3P2HA 3S6KA 4QBJA 1Y9WA 1MJ9A 3F5BA 3QAHA 1LRZA 3UY5A 4AVBA 3V8IA 4HNYB 3EO4A 4CAXA 1TIQA 3CXSA 2PSWA 3BLNA 4KVOE 2FIWA 1RO5A 5KTDA 2ZW6A 3TOAA 3TTHA 1S5KA 2GIVA 5EBVA 1N71A 2REFA 4MHDA 4QB9A 4JWPA 1P4NA 4M3SA 5F49A 3S6HA 3TO7A 3N7ZA 4LX9A 1IYLA 3VWEA 3IGRA 2J8MA 2B58A 4KOUA 5H84A 4E2AA 2F5IA 2R8VA 3D2PA 4KVXA 2FT0A 2QIRA 3LODA 2D4OA 2C27A 4HKFA 3SHPA 1M4DA 2OB0A 3DNSA 2R7HA 1NE9A 2OU2A 2VBQA 3S6FA 3TT2A 4AB7A 2EVNA 2ATRA 3G3SA 4K30A 4QC6A 2CNSA 2JDCA 5KTCA 3D3SA 2FCKA 3I3GA 3TOBA 2ZW7A 3R9FA 4F6AA 5C88A 4YFJA 2O28A 2J8NA 3BJ7A 4XNHB 1S3ZA 1MK4A 1S7LA 3G8WA 4JLYA
chains in the Genus database with same CATH superfamily
1AYEA 2V77A 2PRBA 2RC4A 3FRMA 1F2PA 3H5ZA 3NE7A 4BD9A 4E0AA 2B3VA 1Z8XA 2DPSA 4IK2A 4M6HA 4XPDB 3V7ZA 4PXBA 4U9YA 3VATA 2EWBA 3DSBA 2V8GA 2CY2A 1RTQA 3GYAA 3JRUA 2ZW4A 4CYNA 2PIYA 1LAMA 2Z0ZA 3D7HA 1L0CA 2YNCC 4MMOA 1LANA 4C7IA 5JQ4A 4KOSA 1KUYA 2QJ8A 1CM0A 4KVME 1QSMA 2C1CA 2ZEMA 3L2NA 3PFOA 4WWVA 3RYOA 2ANPA 3GKRA 3CT9A 4TWEA 3TFYA 2PC1A 4KZTA 1Q2CA 5ISVA 4GS4A 4H6UA 4QVTA 4F9UA 2PJCA 3SJEA 2HUZA 3JUWA 1ZG7A 4CYQA 4KORA 3PB8X 4XPDC 5F09A 1V0CA 2Q4ZA 4I49A 4KOWA 1Z2LA 2CIJA 4JD6A 3VWDA 2ABZA 4HNWB 4GM5A 3HUVA 4KOXA 3SJXA 1YK3A 4OP4A 5HVHA 1Z9UA 4A32A 1S7KA 2HV2A 2PJ7A 1YVOA 4FD7A 1FY7A 4KLWA 4CYOA 4MI4A 4OC5A 5E96A 1ZG8A 1M4GA 2BCOA 4FWUA 2BO9A 4MCSA 1ARMA 3TO9A 2IMOA 5K8OA 2VXKA 1ZLIA 2OZGA 4B11A 3PB6X 4MHNA 4B14A 4BMHA 1IGBA 4NGRA 1IOIA 1I12A 5J8FA 2FE7A 1YLOA 1Z8TA 1WK4A 1AMPA 3FF3A 1Z4RA 2AJ6A 2JEVA 3B7IA 4MRIA 4CAWA 3WT4A 2BEIA 1IB1E 3IEHA 4H89A 3IIBA 4YGOA 2CTBA 2PJ6A 4BBHA 5IB9A 2HB6A 1B87A 3IWWA 4RS2A 3RAMA 1M44A 1CBXA 1BO4A 4II9A 5HVFA 3QNVA 4P4FA 2PJ0A 4M85A 3DLJA 1CX8A 4MCRA 3B3WA 4Y49B 2B4DA 2Z3NA 4CYPA 5LRKA 2PQ8A 3KKWA 3B8GA 4F0YA 2ZEGA 2VQYA 2FVGA 1Z8LA 4XPKA 4A30A 2Q0YA 4OLLA 4MHYA 3HLPA 3MRUA 1MJAA 1S7FA 5THWA 4AG9A 4X5KA 3QB8A 1YVKA 1YGHA 4L8AA 5DS0A 4CRYB 5A27A 3D7GA 2PR1A 4NF1A 3NFZA 1YREA 1Z4EA 1Z8WA 2OZHA 2G3AA 2PIZA 3PP9A 4MFPA 2JDDA 4P4BA 4Z65A 4Y49C 5KTAA 1QSOA 2B5GB 4PV6A 4A37A 1HDUA 2DEAA 1H8LA 2Q04A 4MCPA 4CGPA 3DDDA 4J3GA 4JXQA 5IV0A 1IIDA 2PJ9A 2Y0MA 3KI9A 4MFKA 5JGFA 4CRZB 5K8NA 1EE3P 3EXNA 3H4QA 2K5TA 2KCWA 1BPMA 1OZPA 1X12A 2V8VA 4X8IA 3TO6A 4P4IA 1IU8A 2Q7BA 2NMTA 1SQHA 2R98A 2ZOFA 2OZUA 1P0HA 3KQXA 5J1QA 3KGQA 2VZZA 3RZAA 4AVCA 4U5YA 5LYIA 4E8OA 4P4DA 2JLMA 2ZW5A 1A2ZA 5EC4A 1ELLP 2R1IA 5D29A 1YW4A 1M4IA 2VEZA 3CXQA 4R57A 3S6GA 5AG4A 3NA6A 3NH8A 4JXRA 1B6BA 1TXRA 3N5FA 4OC0A 5CNPA 5HXDA 3D67A 3PEIA 1CP7A 3LD2A 4MFQA 3SXOA 3KL9A 4CGOA 4B5OA 3R95A 4ZGYB 2BUEA 2CF4A 2O4HA 3CZXA 4PK3A 2C6PA 5LRGA 2Q44A 4EFDA 3FYNA 3S9LA 2VL1A 4NSQA 1CPXA 1UFHA 2FS5A 4UEFA 1CPSA 2DPTA 4MXUA 2PDOA 3OWCA 4AG7A 3LACA 4B5PA 4C2XA 3SJFA 4UEZA 2CNMA 4UCPA 4NGSA 3KR5A 2AFZA 1F2OA 1GHEA 2B5GA 2OH1A 4MJ8A 2PE3A 1OBRA 2B4DB 1IY7A 1TF8A 4K3NA 1S7NA 1VHSA 1BPNA 2AFSA 4A94A 2B4BA 4KSIA 3I1UA 2EO8A 4LUAA 1YLEA 4R76A 2AFUA 3PZJA 4XNHC 3EFAA 3WABA 1R57A 4Q7AA 1YX0A 2EK9A 4C68A 3BJ8A 3FMCA 1YMEA 3BI0A 2G0BA 5HMNA 3GLJA 4FD5A 4H6ZA 4IHMA 4MY3A 2Z3KA 3FX6A 1ZLHA 2CNTA 2EBJA 4C2YA 1Y7RA 5H86A 2PJ4A 2EK8A 5F47A 4F8ZA 3K9UA 3LMSA 4JYWA 2C6CA 2EUIA 4P4JA 4OC4A 3RNZA 2IL4A 1Y0YA 2QMLA 4RI1A 4KUBA 1PU9A 4FD4A 4ZI6A 5FVJA 2OR4A 3TCVA 3W6SA 2Q4VA 1TKHA 3P2FA 1U6MA 2NSMA 3H8GA 2AFWA 2ZPAA 3F0AA 1LCPA 3W91A 4RN7A 4NGPA 5DWNA 3K9TA 4KSFA 2BL1A 3IWGA 3PBEA 1KUVA 4P6YA 7CPAA 4ORFA 4ZY2A 3C26A 1MJBA 2AFXA 2F8HA 1LFWA 4R9MA 4DUKA 2ZEEA 2ZEPA 2YNDA 1F57A 3PRTA 3IJ3A 4IUSA 2ZEOA 4ZX9A 4HPSA 1I1DA 3FH4A 1XE4A 3PB7X 4YWYA 4PK2A 3FIXA 1Z5RA 5JM6A 4O23A 1VHOA 2DXQA 4UBRA 2BSWA 4UA3A 2YNCA 3GUXA 4OMEA 4B13A 2A4NA 1XEBA 1XF8A 3IU1A 5EMIA 1PCAA 1UWYA 4YRHA 5G20A 5GCNA 2J8RA 3R9GA 1QSRA 1ZO0A 3PB9X 2IJZA 4MY0A 4R6TA 3ZJ0A 5I4MA 4R3KA 3WR7A 4KOTA 4LQGA 3E0KA 2P6FA 5HH1A 4KOYA 2PVWA 2WUUA 4HNXB 3D2MA 4B5PB 4WJBA 3R1KA 3FEEA 2CXAA 2G9DA 2Z3MA 3B3CA 3F8KA 3PGPA 3MN8A 2PJBA 1Q7LA 1IICA 4P44A 5JH9A 3EY5A 2V8HA 1CP6A 2Z10A 1X10A 2ZEFA 5DWMA 4JZ0A 5ELYA 4L89A 2X7BA 3SJGA 3FBUA 4PSWA 2G3TA 3DR6A 2D4PA 2P6EA 1CJWA 1Y9KA 4R3LA 1WWZA 3DGVA 3NE8A 1BLLE 2AE6A 4UFVA 3RBUA 1DE4C 4EVYA 4NEXA 2GANA 3D68A 1IYKA 1FNOA 2FL4A 1BOBA 1J4JA 3R96A 1I21A 4KOVA 4KSAA 2WPXA 4H2KA 4NXYA 2CTCA 5J8CA 4G1PA 3R9EA 4MFZA 2NYQA 2Q51A 3FJUA 1YR0A 4B6ZA 2HC9A 1Q2DA 3VARA 4MHPA 4NGMA 8CPAA 1Y0RA 5F46A 4Q36A 3I9SA 2ZOGA 2XEIA 3KQZA 1LAPA 3KASA 3PB4X 3GY9A 2GFQA 3V38A 2ZELA 4OC2A 4R7MA 2I79A 3KZWA 4B10A 5HVGA 2F7VA 4FBEA 2J9AA 3FNCA 4U9ZA 2QYVA 4PPZA 5F48A 2VZYA 2YGWA 1HEEA 2QECA 2PJ8A 2ZEHA 3WC7A 1M4LA 2GLJA 4OIDA 4TNUA 4OIWA 4CAEA 2HQYA 1QSNA 3EC4A 4KLVA 4ONWA 1JWQA 1QSTA 3H8EA 1ZG9A 2B3UA 3IWEA 3TE4A 4ZX8A 3ISZA 4CS0B 4FD6A 4MBUA 2PR8A 2GE3A 4EWTA 4F0XA 3WC5A 5AGEA 1KUXA 3T9YA 1AUGA 5CBMA 4PXDA 3D8PA 1M1DA 2Q7SA 4P45A 3D7FA 3SI0A 5BWAB 3FXTA 1KZFA 5AG7A 4AXVA 3K2KA 5C82A 5IX3A 3DR8A 1RXTA 5D8NA 1DTDA 4P10A 2P6GA 2VI7A 4C2ZA 4W9YA 2FXFA 2WPWA 1XIXA 2YNEA 4OC3A 3D66A 4P4EA 2V8DA 3T8WA 4ZBGA 1GYTA 2XEJA 2Z3PA 4NFRA 1FT7A 4RUHA 3D7DA 4FUUA 2FSRA 2XEFA 2AFOA 2JBJA 3NH5A 2Z11A 4IAVA 4KS9A 3CXPA 4OADA 4UWJA 2REEA 4CGLA 2ZENA 2PJ1A 1PUAA 3IFEA 4NCZA 4AVAA 1NMTA 2ARHA 2Q43A 4DNCA 3B3VA 3S9NA 3JVNA 4UF4A 4CAVA 4MHZA 5CPAA 1Q2YA 1ON0A 2P0WA 2Q4YA 4C7HA 5K8PA 4ZY0A 3NH4A 1R3NA 2QVPA 4R8FA 1KWMA 4UCNA 3S9MA 1BAVA 4PSXA 4QUSA 3SI1A 2ODFA 5AG6A 4OKOA 4XPLA 3TX8A 5IB0A 3PBBA 1YSJA 1NSAA 2ZXVA 1PYTB 1TKFA 3FVLA 3MGDA 4NGNA 2GREA 3FEDA 3SXNA 5JPHA 4A2ZA 4IF5A 3KHXA 1NSLA 3T90A 4CAFA 5I0CA 2OOTA 1K4JA 4MCQA 4X2TA 4OAEA 3GIUA 3ZZIA 2I00A 2FIAA 4R87A 4UFWA 2H5MA 4Q38A 4CGMA 6CPAA 4ONUA 4JJXA 1XMTA 4KUAA 4UWIA 4ZYQA 5LYLA 5K8MA 1VKCA 2AFMA 1LOKA 2I3CA 3W6XA 3FB3A 1S60A 3P2HA 5G21A 3S6KA 3TC8A 4NJQA 4QBJA 1Y9WA 4A39A 4BINA 1MJ9A 1XJOA 1Y7EA 3F5BA 3QAHA 2POKA 3GB0A 4F9VA 2GU2A 2PJ2A 1LRZA 3UY5A 4AVBA 3V8IA 4CPAA 1VGYA 4HNYB 2WZNA 3PFEA 3EO4A 4CAXA 1TIQA 2JEWA 3B2YA 3CXSA 1VHEA 4UEEA 4B12A 2PSWA 3BLNA 4KVOE 4MFJA 2FIWA 1RO5A 1XMBA 4NGQA 2O53A 2Z3OA 5KTDA 4EMEA 1CG2A 1XFOA 2ZW6A 4NGTA 3TOAA 3BHXA 1ELMP 4MFLA 4NJRA 3B35A 3TTHA 3BI1A 1S5KA 4FAIA 2GIVA 5EBVA 4CGNA 1N71A 1XOVA 2REFA 5G1ZA 4MHDA 4QB9A 3RO0A 2WSAA 3QAYA 4JWPA 1R43A 1YW6A 2PJ5A 4GXHA 4M6IA 3IC1A 1P4NA 4M3SA 2PRQA 5F49A 3S6HA 4A33A 3TO7A 2Z3LA 2BOAA 4PXCA 3CPXA 2RFHA 3N7ZA 4LX9A 3SI2A 1IYLA 3VWEA 5LYDA 3IGRA 4DJLA 3B3TA 2GLFA 2J8MA 2PJ3A 2B58A 1VIXA 4KOUA 5H84A 4UIBA 4E2AA 2F5IA 2R8VA 2PVVA 4ZY1A 2C6GA 2ZEDA 4M6GA 1HDQA 3D2PA 4KVXA 3B3SA 2FT0A 3ISXA 5G22A 2QIRA 3H8FA 3JTKA 4DYOA 3LODA 2XEGA 2D4OA 2C27A 4HKFA 3SHPA 3IU2A 3IO1A 1M4DA 2OB0A 3DNSA 2R7HA 3BXMA 1YQEA 1NE9A 2WYRA 4UFXA 2OU2A 4YU9A 1XRYA 3VH9A 1JQGA 2VBQA 3S6FA 3TT2A 4AB7A 1TKJA 2EVNA 1TF9A 2ATRA 3G3SA 4K30A 4QC6A 5AG5A 2CNSA 1XBUA 2JDCA 2DF5A 3A9LA 4PXEA 5KTCA 1ARLA 3D3SA 1QMUA 2FCKA 3I3GA 4OC1A 5LRJA 3TOBA 5A28A 2ZW7A 3R9FA 3WC6A 4A95A 5LYFA 3D4UA 2IQ6A 1QQ9A 4LQ6A 1IOFA 4UIAA 4F6AA 3FECA 5C88A 4YFJA 4X3RA 3LWUA 2O28A 3KR4A 2J8NA 2PJAA 3BJ7A 2JBKA 3CPAA 4A38A 4UCMA 4XNHB 1S3ZA 3CDXA 1MK4A 1S7LA 3G8WA 4JLYA 4PQAA 3KHZA 4A31A 2PCUA 2RB7A
chains in the Genus database with same CATH topology
2PRBA 2RC4A 3FRMA 3H5ZA 3NE7A 4E0AA 2B3VA 2DPSA 4XPDB 4U9YA 3DSBA 2CY2A 3GYAA 2ZW4A 4CYNA 2Z0ZA 1L0CA 2YNCC 4C7IA 5JQ4A 4KOSA 1KUYA 1CM0A 4KVME 1QSMA 3RYOA 3GKRA 3TFYA 2PC1A 4KZTA 1Q2CA 5ISVA 4GS4A 4H6UA 4QVTA 2HUZA 3JUWA 4CYQA 4KORA 4XPDC 1V0CA 4I49A 4KOWA 4JD6A 3VWDA 4HNWB 4KOXA 1YK3A 1Z9UA 4A32A 1S7KA 2HV2A 1YVOA 4FD7A 1FY7A 4KLWA 4CYOA 4MI4A 5E96A 1M4GA 3TO9A 2VXKA 4B11A 2OZGA 4B14A 4BMHA 1I12A 5J8FA 2FE7A 1WK4A 1Z4RA 2AJ6A 2JEVA 4CAWA 2BEIA 1IB1E 4H89A 4YGOA 4BBHA 1B87A 4RS2A 1M44A 4II9A 1BO4A 4M85A 4Y49B 2B4DA 2Z3NA 4CYPA 2PQ8A 3KKWA 3B8GA 4F0YA 2VQYA 4XPKA 4A30A 2Q0YA 4OLLA 1MJAA 1S7FA 4AG9A 4X5KA 3QB8A 1YVKA 1YGHA 4L8AA 4CRYB 5A27A 2PR1A 4NF1A 1YREA 1Z4EA 2OZHA 2G3AA 3PP9A 4MFPA 2JDDA 4Y49C 5KTAA 1QSOA 2B5GB 4PV6A 2Q04A 4CGPA 3DDDA 4J3GA 4JXQA 5IV0A 1IIDA 2Y0MA 4MFKA 4CRZB 3EXNA 3H4QA 2K5TA 1OZPA 2KCWA 3TO6A 2Q7BA 2NMTA 1SQHA 2R98A 2OZUA 1P0HA 2VZZA 4AVCA 4U5YA 4E8OA 2JLMA 2ZW5A 5EC4A 2R1IA 3S6GA 1M4IA 2VEZA 3CXQA 4R57A 5AG4A 5CNPA 4JXRA 1B6BA 3LD2A 4MFQA 3SXOA 4CGOA 4B5OA 3R95A 4ZGYB 2BUEA 4PK3A 2Q44A 3FYNA 4NSQA 1UFHA 2FS5A 2DPTA 2PDOA 3OWCA 4AG7A 4C2XA 4B5PA 2CNMA 4UCPA 2OH1A 1GHEA 2B5GA 4MJ8A 2B4DB 1S7NA 1VHSA 2B4BA 4LUAA 1YLEA 3PZJA 4XNHC 3EFAA 1R57A 1YX0A 4C68A 3BJ8A 2G0BA 5HMNA 4FD5A 4H6ZA 4MY3A 2Z3KA 2CNTA 4C2YA 1Y7RA 5H86A 5F47A 3K9UA 2EUIA 2IL4A 2QMLA 4RI1A 4KUBA 1PU9A 4FD4A 5FVJA 3TCVA 3W6SA 2Q4VA 3P2FA 1U6MA 2ZPAA 3F0AA 3W91A 5DWNA 4KSFA 2BL1A 3IWGA 1KUVA 4ORFA 3C26A 1MJBA 4R9MA 2YNDA 4IUSA 1I1DA 1XE4A 4PK2A 3FIXA 2DXQA 4UBRA 2BSWA 4UA3A 2YNCA 4B13A 2A4NA 1XEBA 1XF8A 3IU1A 5G20A 4YRHA 5GCNA 2J8RA 3R9GA 1QSRA 1ZO0A 4MY0A 3ZJ0A 4R3KA 3WR7A 4KOTA 3E0KA 2P6FA 5HH1A 4KOYA 2WUUA 4HNXB 3D2MA 4B5PB 3R1KA 2CXAA 3F8KA 2Z3MA 3PGPA 1IICA 3EY5A 2Z10A 5DWMA 4L89A 2X7BA 3FBUA 4PSWA 2G3TA 3DR6A 2D4PA 2P6EA 1CJWA 1Y9KA 4R3LA 1WWZA 4UFVA 2AE6A 4EVYA 4NEXA 2GANA 1IYKA 2FL4A 1BOBA 1J4JA 3R96A 1I21A 4KOVA 4KSAA 2WPXA 4NXYA 5J8CA 3R9EA 4MFZA 1YR0A 1Q2DA 5F46A 4Q36A 3I9SA 3GY9A 2I79A 4B10A 3FNCA 4U9ZA 5F48A 2VZYA 2YGWA 2QECA 4CAEA 2HQYA 1QSNA 3EC4A 4KLVA 1QSTA 2B3UA 3IWEA 3TE4A 4F0XA 4CS0B 4FD6A 4MBUA 2PR8A 2GE3A 5AGEA 1KUXA 3T9YA 3D8PA 1M1DA 5BWAB 5C82A 3FXTA 1KZFA 5AG7A 5IX3A 3DR8A 1RXTA 2P6GA 2VI7A 4C2ZA 2FXFA 2WPWA 1XIXA 2YNEA 4ZBGA 2Z3PA 2FSRA 4UWJA 2Z11A 4OADA 4KS9A 3CXPA 2REEA 4CGLA 4NCZA 1PUAA 4DNCA 4AVAA 1NMTA 2ARHA 3JVNA 4CAVA 1Q2YA 1ON0A 2P0WA 2Q4YA 4C7HA 4UCNA 4PSXA 4QUSA 5AG6A 4XPLA 5IB0A 2ZXVA 3MGDA 3SXNA 5JPHA 4A2ZA 4IF5A 3T90A 1NSLA 4CAFA 5I0CA 1K4JA 4OAEA 3ZZIA 2I00A 2FIAA 4R87A 4UFWA 2H5MA 4Q38A 4CGMA 4ONUA 4JJXA 1XMTA 4KUAA 4UWIA 1VKCA 3W6XA 3FB3A 1S60A 3P2HA 5G21A 3S6KA 4QBJA 1Y9WA 1MJ9A 3F5BA 3QAHA 1LRZA 3UY5A 4AVBA 3V8IA 4HNYB 3EO4A 4CAXA 1TIQA 3CXSA 4B12A 2PSWA 3BLNA 4KVOE 4MFJA 2FIWA 1RO5A 2Z3OA 5KTDA 2ZW6A 3TOAA 4MFLA 3TTHA 1S5KA 2GIVA 5EBVA 4CGNA 1N71A 2REFA 5G1ZA 4MHDA 4QB9A 2WSAA 4JWPA 1P4NA 4M3SA 5F49A 3S6HA 4A33A 3TO7A 2Z3LA 3N7ZA 4LX9A 1IYLA 3VWEA 3IGRA 2J8MA 2B58A 4KOUA 5H84A 4E2AA 2F5IA 2R8VA 3D2PA 4KVXA 2FT0A 5G22A 2QIRA 3JTKA 3LODA 2D4OA 2C27A 4HKFA 3SHPA 3IU2A 1M4DA 2OB0A 3DNSA 2R7HA 1NE9A 4UFXA 2OU2A 2VBQA 3S6FA 3TT2A 4AB7A 2EVNA 5AG5A 2ATRA 3G3SA 4K30A 4QC6A 2CNSA 2JDCA 3A9LA 5KTCA 3D3SA 2FCKA 3I3GA 3TOBA 5A28A 2ZW7A 3R9FA 4A95A 4F6AA 5C88A 4YFJA 2O28A 2J8NA 3BJ7A 4UCMA 4XNHB 1S3ZA 1MK4A 1S7LA 3G8WA 4JLYA 4A31A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PRB A;  2RC4 A;  3FRM A;  3NE7 A;  4E0A A;  2B3V A;  4XPD B;  4U9Y A;  3DSB A;  2CY2 A;  3GYA A;  2ZW4 A;  2Z0Z A;  1L0C A;  5JQ4 A;  4KOS A;  1KUY A;  1CM0 A;  4KVM E;  1QSM A;  3RYO A;  3GKR A;  3TFY A;  2PC1 A;  4KZT A;  1Q2C A;  5ISV A;  4GS4 A;  4H6U A;  4QVT A;  2HUZ A;  3JUW A;  4KOR A;  4XPD C;  1V0C A;  4I49 A;  4KOW A;  4JD6 A;  3VWD A;  4HNW B;  4KOX A;  1YK3 A;  1Z9U A;  1S7K A;  2HV2 A;  1YVO A;  4FD7 A;  1FY7 A;  4KLW A;  4MI4 A;  5E96 A;  1M4G A;  3TO9 A;  2VXK A;  2OZG A;  4BMH A;  1I12 A;  5J8F A;  2FE7 A;  1WK4 A;  1Z4R A;  2AJ6 A;  2JEV A;  4CAW A;  2BEI A;  1IB1 E;  4H89 A;  4YGO A;  1B87 A;  4RS2 A;  1M44 A;  4II9 A;  1BO4 A;  4M85 A;  4Y49 B;  2B4D A;  2PQ8 A;  3KKW A;  3B8G A;  4F0Y A;  2VQY A;  4XPK A;  2Q0Y A;  4OLL A;  1MJA A;  1S7F A;  4AG9 A;  4X5K A;  3QB8 A;  1YVK A;  1YGH A;  4L8A A;  4CRY B;  2PR1 A;  4NF1 A;  1YRE A;  1Z4E A;  2OZH A;  2G3A A;  3PP9 A;  2JDD A;  4Y49 C;  5KTA A;  1QSO A;  2B5G B;  4PV6 A;  2Q04 A;  5IV0 A;  3DDD A;  4J3G A;  4JXQ A;  1IID A;  2Y0M A;  4CRZ B;  3EXN A;  3H4Q A;  2K5T A;  1OZP A;  2KCW A;  3TO6 A;  2Q7B A;  2NMT A;  1SQH A;  2R98 A;  2OZU A;  1P0H A;  2VZZ A;  4AVC A;  4U5Y A;  4E8O A;  2JLM A;  2ZW5 A;  5EC4 A;  2R1I A;  3S6G A;  1M4I A;  2VEZ A;  3CXQ A;  4R57 A;  5CNP A;  4JXR A;  1B6B A;  3LD2 A;  3SXO A;  4B5O A;  3R95 A;  2BUE A;  4PK3 A;  2Q44 A;  3FYN A;  4NSQ A;  1UFH A;  2FS5 A;  2PDO A;  3OWC A;  4AG7 A;  4B5P A;  2CNM A;  2OH1 A;  1GHE A;  2B5G A;  4MJ8 A;  2B4D B;  1S7N A;  1VHS A;  2B4B A;  4LUA A;  1YLE A;  3PZJ A;  4XNH C;  3EFA A;  1R57 A;  1YX0 A;  3BJ8 A;  2G0B A;  5HMN A;  4FD5 A;  4H6Z A;  4MY3 A;  2CNT A;  1Y7R A;  5H86 A;  5F47 A;  3K9U A;  2EUI A;  2IL4 A;  2QML A;  4RI1 A;  4KUB A;  1PU9 A;  4FD4 A;  5FVJ A;  3TCV A;  3W6S A;  2Q4V A;  3P2F A;  1U6M A;  2ZPA A;  3F0A A;  3W91 A;  5DWN A;  2BL1 A;  3IWG A;  1KUV A;  4ORF A;  3C26 A;  1MJB A;  4R9M A;  4IUS A;  1I1D A;  1XE4 A;  4PK2 A;  3FIX A;  2DXQ A;  4UBR A;  2BSW A;  4UA3 A;  2A4N A;  1XEB A;  1XF8 A;  5GCN A;  4YRH A;  2J8R A;  3R9G A;  1QSR A;  4MY0 A;  3ZJ0 A;  4R3K A;  3WR7 A;  4KOT A;  3E0K A;  2P6F A;  5HH1 A;  4KOY A;  4HNX B;  3D2M A;  4B5P B;  3R1K A;  3F8K A;  3PGP A;  1IIC A;  3EY5 A;  2Z10 A;  5DWM A;  4L89 A;  2X7B A;  3FBU A;  4PSW A;  2G3T A;  3DR6 A;  2D4P A;  2P6E A;  1CJW A;  1Y9K A;  4R3L A;  1WWZ A;  2AE6 A;  4EVY A;  4NEX A;  2GAN A;  1IYK A;  2FL4 A;  1BOB A;  1J4J A;  3R96 A;  1I21 A;  4KOV A;  2WPX A;  4NXY A;  5J8C A;  3R9E A;  1YR0 A;  1Q2D A;  5F46 A;  3I9S A;  3GY9 A;  2I79 A;  3FNC A;  4U9Z A;  5F48 A;  2VZY A;  2QEC A;  2HQY A;  1QSN A;  3EC4 A;  4KLV A;  1QST A;  2B3U A;  3TE4 A;  4CS0 B;  4FD6 A;  4MBU A;  2PR8 A;  2GE3 A;  1KUX A;  3T9Y A;  3D8P A;  1M1D A;  5C82 A;  3FXT A;  1KZF A;  5IX3 A;  3DR8 A;  1RXT A;  2P6G A;  2VI7 A;  2FXF A;  2WPW A;  1XIX A;  4ZBG A;  2FSR A;  4UWJ A;  2Z11 A;  4OAD A;  3CXP A;  2REE A;  4NCZ A;  1PUA A;  4DNC A;  4AVA A;  1NMT A;  2ARH A;  3JVN A;  4CAV A;  1Q2Y A;  1ON0 A;  2P0W A;  2Q4Y A;  4PSX A;  4QUS A;  4XPL A;  5IB0 A;  2ZXV A;  3MGD A;  3SXN A;  5JPH A;  4IF5 A;  3T90 A;  1NSL A;  5I0C A;  1K4J A;  4OAE A;  3ZZI A;  2I00 A;  2FIA A;  4R87 A;  2H5M A;  4ONU A;  4JJX A;  1XMT A;  4KUA A;  4UWI A;  1VKC A;  3W6X A;  3FB3 A;  1S60 A;  3P2H A;  3S6K A;  4QBJ A;  1Y9W A;  1MJ9 A;  3F5B A;  3QAH A;  1LRZ A;  3UY5 A;  4AVB A;  3V8I A;  4HNY B;  3EO4 A;  4CAX A;  1TIQ A;  3CXS A;  2PSW A;  3BLN A;  4KVO E;  2FIW A;  1RO5 A;  5KTD A;  2ZW6 A;  3TOA A;  3TTH A;  1S5K A;  2GIV A;  5EBV A;  1N71 A;  2REF A;  4MHD A;  4QB9 A;  4JWP A;  1P4N A;  4M3S A;  5F49 A;  3S6H A;  3TO7 A;  3N7Z A;  4LX9 A;  1IYL A;  3VWE A;  3IGR A;  2J8M A;  2B58 A;  4KOU A;  5H84 A;  4E2A A;  2F5I A;  2R8V A;  3D2P A;  4KVX A;  2FT0 A;  2QIR A;  3LOD A;  2D4O A;  2C27 A;  4HKF A;  3SHP A;  1M4D A;  2OB0 A;  3DNS A;  2R7H A;  1NE9 A;  2OU2 A;  2VBQ A;  3S6F A;  3TT2 A;  4AB7 A;  2EVN A;  2ATR A;  3G3S A;  4K30 A;  4QC6 A;  2CNS A;  2JDC A;  5KTC A;  3D3S A;  2FCK A;  3I3G A;  3TOB A;  2ZW7 A;  3R9F A;  4F6A A;  5C88 A;  4YFJ A;  2O28 A;  2J8N A;  3BJ7 A;  4XNH B;  1S3Z A;  1MK4 A;  1S7L A;  3G8W A;  4JLY A; 
#chains in the Genus database with same CATH topology
 1AYE A;  2V77 A;  2PRB A;  2RC4 A;  3FRM A;  1F2P A;  3H5Z A;  3NE7 A;  4BD9 A;  4E0A A;  2B3V A;  1Z8X A;  2DPS A;  4IK2 A;  4M6H A;  4XPD B;  3V7Z A;  4PXB A;  4U9Y A;  3VAT A;  2EWB A;  3DSB A;  2V8G A;  2CY2 A;  1RTQ A;  3GYA A;  3JRU A;  2ZW4 A;  4CYN A;  2PIY A;  1LAM A;  2Z0Z A;  3D7H A;  1L0C A;  2YNC C;  4MMO A;  1LAN A;  4C7I A;  5JQ4 A;  4KOS A;  1KUY A;  2QJ8 A;  1CM0 A;  4KVM E;  1QSM A;  2C1C A;  2ZEM A;  3L2N A;  3PFO A;  4WWV A;  3RYO A;  2ANP A;  3GKR A;  3CT9 A;  4TWE A;  3TFY A;  2PC1 A;  4KZT A;  1Q2C A;  5ISV A;  4GS4 A;  4H6U A;  4QVT A;  4F9U A;  2PJC A;  3SJE A;  2HUZ A;  3JUW A;  1ZG7 A;  4CYQ A;  4KOR A;  3PB8 X;  4XPD C;  5F09 A;  1V0C A;  2Q4Z A;  4I49 A;  4KOW A;  1Z2L A;  2CIJ A;  4JD6 A;  3VWD A;  2ABZ A;  4HNW B;  4GM5 A;  3HUV A;  4KOX A;  3SJX A;  1YK3 A;  4OP4 A;  5HVH A;  1Z9U A;  4A32 A;  1S7K A;  2HV2 A;  2PJ7 A;  1YVO A;  4FD7 A;  1FY7 A;  4KLW A;  4CYO A;  4MI4 A;  4OC5 A;  5E96 A;  1ZG8 A;  1M4G A;  2BCO A;  4FWU A;  2BO9 A;  4MCS A;  1ARM A;  3TO9 A;  2IMO A;  5K8O A;  2VXK A;  1ZLI A;  2OZG A;  4B11 A;  3PB6 X;  4MHN A;  4B14 A;  4BMH A;  1IGB A;  4NGR A;  1IOI A;  1I12 A;  5J8F A;  2FE7 A;  1YLO A;  1Z8T A;  1WK4 A;  1AMP A;  3FF3 A;  1Z4R A;  2AJ6 A;  2JEV A;  3B7I A;  4MRI A;  4CAW A;  3WT4 A;  2BEI A;  1IB1 E;  3IEH A;  4H89 A;  3IIB A;  4YGO A;  2CTB A;  2PJ6 A;  4BBH A;  5IB9 A;  2HB6 A;  1B87 A;  3IWW A;  4RS2 A;  3RAM A;  1M44 A;  1CBX A;  1BO4 A;  4II9 A;  5HVF A;  3QNV A;  4P4F A;  2PJ0 A;  4M85 A;  3DLJ A;  1CX8 A;  4MCR A;  3B3W A;  4Y49 B;  2B4D A;  2Z3N A;  4CYP A;  5LRK A;  2PQ8 A;  3KKW A;  3B8G A;  4F0Y A;  2ZEG A;  2VQY A;  2FVG A;  1Z8L A;  4XPK A;  4A30 A;  2Q0Y A;  4OLL A;  4MHY A;  3HLP A;  3MRU A;  1MJA A;  1S7F A;  5THW A;  4AG9 A;  4X5K A;  3QB8 A;  1YVK A;  1YGH A;  4L8A A;  5DS0 A;  4CRY B;  5A27 A;  3D7G A;  2PR1 A;  4NF1 A;  3NFZ A;  1YRE A;  1Z4E A;  1Z8W A;  2OZH A;  2G3A A;  2PIZ A;  3PP9 A;  4MFP A;  2JDD A;  4P4B A;  4Z65 A;  4Y49 C;  5KTA A;  1QSO A;  2B5G B;  4PV6 A;  4A37 A;  1HDU A;  2DEA A;  1H8L A;  2Q04 A;  4MCP A;  4CGP A;  3DDD A;  4J3G A;  4JXQ A;  5IV0 A;  1IID A;  2PJ9 A;  2Y0M A;  3KI9 A;  4MFK A;  5JGF A;  4CRZ B;  5K8N A;  1EE3 P;  3EXN A;  3H4Q A;  2K5T A;  2KCW A;  1BPM A;  1OZP A;  1X12 A;  2V8V A;  4X8I A;  3TO6 A;  4P4I A;  1IU8 A;  2Q7B A;  2NMT A;  1SQH A;  2R98 A;  2ZOF A;  2OZU A;  1P0H A;  3KQX A;  5J1Q A;  3KGQ A;  2VZZ A;  3RZA A;  4AVC A;  4U5Y A;  5LYI A;  4E8O A;  4P4D A;  2JLM A;  2ZW5 A;  1A2Z A;  5EC4 A;  1ELL P;  2R1I A;  5D29 A;  1YW4 A;  1M4I A;  2VEZ A;  3CXQ A;  4R57 A;  3S6G A;  5AG4 A;  3NA6 A;  3NH8 A;  4JXR A;  1B6B A;  1TXR A;  3N5F A;  4OC0 A;  5CNP A;  5HXD A;  3D67 A;  3PEI A;  1CP7 A;  3LD2 A;  4MFQ A;  3SXO A;  3KL9 A;  4CGO A;  4B5O A;  3R95 A;  4ZGY B;  2BUE A;  2CF4 A;  2O4H A;  3CZX A;  4PK3 A;  2C6P A;  5LRG A;  2Q44 A;  4EFD A;  3FYN A;  3S9L A;  2VL1 A;  4NSQ A;  1CPX A;  1UFH A;  2FS5 A;  4UEF A;  1CPS A;  2DPT A;  4MXU A;  2PDO A;  3OWC A;  4AG7 A;  3LAC A;  4B5P A;  4C2X A;  3SJF A;  4UEZ A;  2CNM A;  4UCP A;  4NGS A;  3KR5 A;  2AFZ A;  1F2O A;  1GHE A;  2B5G A;  2OH1 A;  4MJ8 A;  2PE3 A;  1OBR A;  2B4D B;  1IY7 A;  1TF8 A;  4K3N A;  1S7N A;  1VHS A;  1BPN A;  2AFS A;  4A94 A;  2B4B A;  4KSI A;  3I1U A;  2EO8 A;  4LUA A;  1YLE A;  4R76 A;  2AFU A;  3PZJ A;  4XNH C;  3EFA A;  3WAB A;  1R57 A;  4Q7A A;  1YX0 A;  2EK9 A;  4C68 A;  3BJ8 A;  3FMC A;  1YME A;  3BI0 A;  2G0B A;  5HMN A;  3GLJ A;  4FD5 A;  4H6Z A;  4IHM A;  4MY3 A;  2Z3K A;  3FX6 A;  1ZLH A;  2CNT A;  2EBJ A;  4C2Y A;  1Y7R A;  5H86 A;  2PJ4 A;  2EK8 A;  5F47 A;  4F8Z A;  3K9U A;  3LMS A;  4JYW A;  2C6C A;  2EUI A;  4P4J A;  4OC4 A;  3RNZ A;  2IL4 A;  1Y0Y A;  2QML A;  4RI1 A;  4KUB A;  1PU9 A;  4FD4 A;  4ZI6 A;  5FVJ A;  2OR4 A;  3TCV A;  3W6S A;  2Q4V A;  1TKH A;  3P2F A;  1U6M A;  2NSM A;  3H8G A;  2AFW A;  2ZPA A;  3F0A A;  1LCP A;  3W91 A;  4RN7 A;  4NGP A;  5DWN A;  3K9T A;  4KSF A;  2BL1 A;  3IWG A;  3PBE A;  1KUV A;  4P6Y A;  7CPA A;  4ORF A;  4ZY2 A;  3C26 A;  1MJB A;  2AFX A;  2F8H A;  1LFW A;  4R9M A;  4DUK A;  2ZEE A;  2ZEP A;  2YND A;  1F57 A;  3PRT A;  3IJ3 A;  4IUS A;  2ZEO A;  4ZX9 A;  4HPS A;  1I1D A;  3FH4 A;  1XE4 A;  3PB7 X;  4YWY A;  4PK2 A;  3FIX A;  1Z5R A;  5JM6 A;  4O23 A;  1VHO A;  2DXQ A;  4UBR A;  2BSW A;  4UA3 A;  2YNC A;  3GUX A;  4OME A;  4B13 A;  2A4N A;  1XEB A;  1XF8 A;  3IU1 A;  5EMI A;  1PCA A;  1UWY A;  4YRH A;  5G20 A;  5GCN A;  2J8R A;  3R9G A;  1QSR A;  1ZO0 A;  3PB9 X;  2IJZ A;  4MY0 A;  4R6T A;  3ZJ0 A;  5I4M A;  4R3K A;  3WR7 A;  4KOT A;  4LQG A;  3E0K A;  2P6F A;  5HH1 A;  4KOY A;  2PVW A;  2WUU A;  4HNX B;  3D2M A;  4B5P B;  4WJB A;  3R1K A;  3FEE A;  2CXA A;  2G9D A;  2Z3M A;  3B3C A;  3F8K A;  3PGP A;  3MN8 A;  2PJB A;  1Q7L A;  1IIC A;  4P44 A;  5JH9 A;  3EY5 A;  2V8H A;  1CP6 A;  2Z10 A;  1X10 A;  2ZEF A;  5DWM A;  4JZ0 A;  5ELY A;  4L89 A;  2X7B A;  3SJG A;  3FBU A;  4PSW A;  2G3T A;  3DR6 A;  2D4P A;  2P6E A;  1CJW A;  1Y9K A;  4R3L A;  1WWZ A;  3DGV A;  3NE8 A;  1BLL E;  2AE6 A;  4UFV A;  3RBU A;  1DE4 C;  4EVY A;  4NEX A;  2GAN A;  3D68 A;  1IYK A;  1FNO A;  2FL4 A;  1BOB A;  1J4J A;  3R96 A;  1I21 A;  4KOV A;  4KSA A;  2WPX A;  4H2K A;  4NXY A;  2CTC A;  5J8C A;  4G1P A;  3R9E A;  4MFZ A;  2NYQ A;  2Q51 A;  3FJU A;  1YR0 A;  4B6Z A;  2HC9 A;  1Q2D A;  3VAR A;  4MHP A;  4NGM A;  8CPA A;  1Y0R A;  5F46 A;  4Q36 A;  3I9S A;  2ZOG A;  2XEI A;  3KQZ A;  1LAP A;  3KAS A;  3PB4 X;  3GY9 A;  2GFQ A;  3V38 A;  2ZEL A;  4OC2 A;  4R7M A;  2I79 A;  3KZW A;  4B10 A;  5HVG A;  2F7V A;  4FBE A;  2J9A A;  3FNC A;  4U9Z A;  2QYV A;  4PPZ A;  5F48 A;  2VZY A;  2YGW A;  1HEE A;  2QEC A;  2PJ8 A;  2ZEH A;  3WC7 A;  1M4L A;  2GLJ A;  4OID A;  4TNU A;  4OIW A;  4CAE A;  2HQY A;  1QSN A;  3EC4 A;  4KLV A;  4ONW A;  1JWQ A;  1QST A;  3H8E A;  1ZG9 A;  2B3U A;  3IWE A;  3TE4 A;  4ZX8 A;  3ISZ A;  4CS0 B;  4FD6 A;  4MBU A;  2PR8 A;  2GE3 A;  4EWT A;  4F0X A;  3WC5 A;  5AGE A;  1KUX A;  3T9Y A;  1AUG A;  5CBM A;  4PXD A;  3D8P A;  1M1D A;  2Q7S A;  4P45 A;  3D7F A;  3SI0 A;  5BWA B;  3FXT A;  1KZF A;  5AG7 A;  4AXV A;  3K2K A;  5C82 A;  5IX3 A;  3DR8 A;  1RXT A;  5D8N A;  1DTD A;  4P10 A;  2P6G A;  2VI7 A;  4C2Z A;  4W9Y A;  2FXF A;  2WPW A;  1XIX A;  2YNE A;  4OC3 A;  3D66 A;  4P4E A;  2V8D A;  3T8W A;  4ZBG A;  1GYT A;  2XEJ A;  2Z3P A;  4NFR A;  1FT7 A;  4RUH A;  3D7D A;  4FUU A;  2FSR A;  2XEF A;  2AFO A;  2JBJ A;  3NH5 A;  2Z11 A;  4IAV A;  4KS9 A;  3CXP A;  4OAD A;  4UWJ A;  2REE A;  4CGL A;  2ZEN A;  2PJ1 A;  1PUA A;  3IFE A;  4NCZ A;  4AVA A;  1NMT A;  2ARH A;  2Q43 A;  4DNC A;  3B3V A;  3S9N A;  3JVN A;  4UF4 A;  4CAV A;  4MHZ A;  5CPA A;  1Q2Y A;  1ON0 A;  2P0W A;  2Q4Y A;  4C7H A;  5K8P A;  4ZY0 A;  3NH4 A;  1R3N A;  2QVP A;  4R8F A;  1KWM A;  4UCN A;  3S9M A;  1BAV A;  4PSX A;  4QUS A;  3SI1 A;  2ODF A;  5AG6 A;  4OKO A;  4XPL A;  3TX8 A;  5IB0 A;  3PBB A;  1YSJ A;  1NSA A;  2ZXV A;  1PYT B;  1TKF A;  3FVL A;  3MGD A;  4NGN A;  2GRE A;  3FED A;  3SXN A;  5JPH A;  4A2Z A;  4IF5 A;  3KHX A;  1NSL A;  3T90 A;  4CAF A;  5I0C A;  2OOT A;  1K4J A;  4MCQ A;  4X2T A;  4OAE A;  3GIU A;  3ZZI A;  2I00 A;  2FIA A;  4R87 A;  4UFW A;  2H5M A;  4Q38 A;  4CGM A;  6CPA A;  4ONU A;  4JJX A;  1XMT A;  4KUA A;  4UWI A;  4ZYQ A;  5LYL A;  5K8M A;  1VKC A;  2AFM A;  1LOK A;  2I3C A;  3W6X A;  3FB3 A;  1S60 A;  3P2H A;  5G21 A;  3S6K A;  3TC8 A;  4NJQ A;  4QBJ A;  1Y9W A;  4A39 A;  4BIN A;  1MJ9 A;  1XJO A;  1Y7E A;  3F5B A;  3QAH A;  2POK A;  3GB0 A;  4F9V A;  2GU2 A;  2PJ2 A;  1LRZ A;  3UY5 A;  4AVB A;  3V8I A;  4CPA A;  1VGY A;  4HNY B;  2WZN A;  3PFE A;  3EO4 A;  4CAX A;  1TIQ A;  2JEW A;  3B2Y A;  3CXS A;  1VHE A;  4UEE A;  4B12 A;  2PSW A;  3BLN A;  4KVO E;  4MFJ A;  2FIW A;  1RO5 A;  1XMB A;  4NGQ A;  2O53 A;  2Z3O A;  5KTD A;  4EME A;  1CG2 A;  1XFO A;  2ZW6 A;  4NGT A;  3TOA A;  3BHX A;  1ELM P;  4MFL A;  4NJR A;  3B35 A;  3TTH A;  3BI1 A;  1S5K A;  4FAI A;  2GIV A;  5EBV A;  4CGN A;  1N71 A;  1XOV A;  2REF A;  5G1Z A;  4MHD A;  4QB9 A;  3RO0 A;  2WSA A;  3QAY A;  4JWP A;  1R43 A;  1YW6 A;  2PJ5 A;  4GXH A;  4M6I A;  3IC1 A;  1P4N A;  4M3S A;  2PRQ A;  5F49 A;  3S6H A;  4A33 A;  3TO7 A;  2Z3L A;  2BOA A;  4PXC A;  3CPX A;  2RFH A;  3N7Z A;  4LX9 A;  3SI2 A;  1IYL A;  3VWE A;  5LYD A;  3IGR A;  4DJL A;  3B3T A;  2GLF A;  2J8M A;  2PJ3 A;  2B58 A;  1VIX A;  4KOU A;  5H84 A;  4UIB A;  4E2A A;  2F5I A;  2R8V A;  2PVV A;  4ZY1 A;  2C6G A;  2ZED A;  4M6G A;  1HDQ A;  3D2P A;  4KVX A;  3B3S A;  2FT0 A;  3ISX A;  5G22 A;  2QIR A;  3H8F A;  3JTK A;  4DYO A;  3LOD A;  2XEG A;  2D4O A;  2C27 A;  4HKF A;  3SHP A;  3IU2 A;  3IO1 A;  1M4D A;  2OB0 A;  3DNS A;  2R7H A;  3BXM A;  1YQE A;  1NE9 A;  2WYR A;  4UFX A;  2OU2 A;  4YU9 A;  1XRY A;  3VH9 A;  1JQG A;  2VBQ A;  3S6F A;  3TT2 A;  4AB7 A;  1TKJ A;  2EVN A;  1TF9 A;  2ATR A;  3G3S A;  4K30 A;  4QC6 A;  5AG5 A;  2CNS A;  1XBU A;  2JDC A;  2DF5 A;  3A9L A;  4PXE A;  5KTC A;  1ARL A;  3D3S A;  1QMU A;  2FCK A;  3I3G A;  4OC1 A;  5LRJ A;  3TOB A;  5A28 A;  2ZW7 A;  3R9F A;  3WC6 A;  4A95 A;  5LYF A;  3D4U A;  2IQ6 A;  1QQ9 A;  4LQ6 A;  1IOF A;  4UIA A;  4F6A A;  3FEC A;  5C88 A;  4YFJ A;  4X3R A;  3LWU A;  2O28 A;  3KR4 A;  2J8N A;  2PJA A;  3BJ7 A;  2JBK A;  3CPA A;  4A38 A;  4UCM A;  4XNH B;  1S3Z A;  3CDX A;  1MK4 A;  1S7L A;  3G8W A;  4JLY A;  4PQA A;  3KHZ A;  4A31 A;  2PCU A;  2RB7 A; 
#chains in the Genus database with same CATH homology
 2PRB A;  2RC4 A;  3FRM A;  3H5Z A;  3NE7 A;  4E0A A;  2B3V A;  2DPS A;  4XPD B;  4U9Y A;  3DSB A;  2CY2 A;  3GYA A;  2ZW4 A;  4CYN A;  2Z0Z A;  1L0C A;  2YNC C;  4C7I A;  5JQ4 A;  4KOS A;  1KUY A;  1CM0 A;  4KVM E;  1QSM A;  3RYO A;  3GKR A;  3TFY A;  2PC1 A;  4KZT A;  1Q2C A;  5ISV A;  4GS4 A;  4H6U A;  4QVT A;  2HUZ A;  3JUW A;  4CYQ A;  4KOR A;  4XPD C;  1V0C A;  4I49 A;  4KOW A;  4JD6 A;  3VWD A;  4HNW B;  4KOX A;  1YK3 A;  1Z9U A;  4A32 A;  1S7K A;  2HV2 A;  1YVO A;  4FD7 A;  1FY7 A;  4KLW A;  4CYO A;  4MI4 A;  5E96 A;  1M4G A;  3TO9 A;  2VXK A;  4B11 A;  2OZG A;  4B14 A;  4BMH A;  1I12 A;  5J8F A;  2FE7 A;  1WK4 A;  1Z4R A;  2AJ6 A;  2JEV A;  4CAW A;  2BEI A;  1IB1 E;  4H89 A;  4YGO A;  4BBH A;  1B87 A;  4RS2 A;  1M44 A;  4II9 A;  1BO4 A;  4M85 A;  4Y49 B;  2B4D A;  2Z3N A;  4CYP A;  2PQ8 A;  3KKW A;  3B8G A;  4F0Y A;  2VQY A;  4XPK A;  4A30 A;  2Q0Y A;  4OLL A;  1MJA A;  1S7F A;  4AG9 A;  4X5K A;  3QB8 A;  1YVK A;  1YGH A;  4L8A A;  4CRY B;  5A27 A;  2PR1 A;  4NF1 A;  1YRE A;  1Z4E A;  2OZH A;  2G3A A;  3PP9 A;  4MFP A;  2JDD A;  4Y49 C;  5KTA A;  1QSO A;  2B5G B;  4PV6 A;  2Q04 A;  4CGP A;  3DDD A;  4J3G A;  4JXQ A;  5IV0 A;  1IID A;  2Y0M A;  4MFK A;  4CRZ B;  3EXN A;  3H4Q A;  2K5T A;  1OZP A;  2KCW A;  3TO6 A;  2Q7B A;  2NMT A;  1SQH A;  2R98 A;  2OZU A;  1P0H A;  2VZZ A;  4AVC A;  4U5Y A;  4E8O A;  2JLM A;  2ZW5 A;  5EC4 A;  2R1I A;  3S6G A;  1M4I A;  2VEZ A;  3CXQ A;  4R57 A;  5AG4 A;  5CNP A;  4JXR A;  1B6B A;  3LD2 A;  4MFQ A;  3SXO A;  4CGO A;  4B5O A;  3R95 A;  4ZGY B;  2BUE A;  4PK3 A;  2Q44 A;  3FYN A;  4NSQ A;  1UFH A;  2FS5 A;  2DPT A;  2PDO A;  3OWC A;  4AG7 A;  4C2X A;  4B5P A;  2CNM A;  4UCP A;  2OH1 A;  1GHE A;  2B5G A;  4MJ8 A;  2B4D B;  1S7N A;  1VHS A;  2B4B A;  4LUA A;  1YLE A;  3PZJ A;  4XNH C;  3EFA A;  1R57 A;  1YX0 A;  4C68 A;  3BJ8 A;  2G0B A;  5HMN A;  4FD5 A;  4H6Z A;  4MY3 A;  2Z3K A;  2CNT A;  4C2Y A;  1Y7R A;  5H86 A;  5F47 A;  3K9U A;  2EUI A;  2IL4 A;  2QML A;  4RI1 A;  4KUB A;  1PU9 A;  4FD4 A;  5FVJ A;  3TCV A;  3W6S A;  2Q4V A;  3P2F A;  1U6M A;  2ZPA A;  3F0A A;  3W91 A;  5DWN A;  4KSF A;  2BL1 A;  3IWG A;  1KUV A;  4ORF A;  3C26 A;  1MJB A;  4R9M A;  2YND A;  4IUS A;  1I1D A;  1XE4 A;  4PK2 A;  3FIX A;  2DXQ A;  4UBR A;  2BSW A;  4UA3 A;  2YNC A;  4B13 A;  2A4N A;  1XEB A;  1XF8 A;  3IU1 A;  5G20 A;  4YRH A;  5GCN A;  2J8R A;  3R9G A;  1QSR A;  1ZO0 A;  4MY0 A;  3ZJ0 A;  4R3K A;  3WR7 A;  4KOT A;  3E0K A;  2P6F A;  5HH1 A;  4KOY A;  2WUU A;  4HNX B;  3D2M A;  4B5P B;  3R1K A;  2CXA A;  3F8K A;  2Z3M A;  3PGP A;  1IIC A;  3EY5 A;  2Z10 A;  5DWM A;  4L89 A;  2X7B A;  3FBU A;  4PSW A;  2G3T A;  3DR6 A;  2D4P A;  2P6E A;  1CJW A;  1Y9K A;  4R3L A;  1WWZ A;  4UFV A;  2AE6 A;  4EVY A;  4NEX A;  2GAN A;  1IYK A;  2FL4 A;  1BOB A;  1J4J A;  3R96 A;  1I21 A;  4KOV A;  4KSA A;  2WPX A;  4NXY A;  5J8C A;  3R9E A;  4MFZ A;  1YR0 A;  1Q2D A;  5F46 A;  4Q36 A;  3I9S A;  3GY9 A;  2I79 A;  4B10 A;  3FNC A;  4U9Z A;  5F48 A;  2VZY A;  2YGW A;  2QEC A;  4CAE A;  2HQY A;  1QSN A;  3EC4 A;  4KLV A;  1QST A;  2B3U A;  3IWE A;  3TE4 A;  4F0X A;  4CS0 B;  4FD6 A;  4MBU A;  2PR8 A;  2GE3 A;  5AGE A;  1KUX A;  3T9Y A;  3D8P A;  1M1D A;  5BWA B;  5C82 A;  3FXT A;  1KZF A;  5AG7 A;  5IX3 A;  3DR8 A;  1RXT A;  2P6G A;  2VI7 A;  4C2Z A;  2FXF A;  2WPW A;  1XIX A;  2YNE A;  4ZBG A;  2Z3P A;  2FSR A;  4UWJ A;  2Z11 A;  4OAD A;  4KS9 A;  3CXP A;  2REE A;  4CGL A;  4NCZ A;  1PUA A;  4DNC A;  4AVA A;  1NMT A;  2ARH A;  3JVN A;  4CAV A;  1Q2Y A;  1ON0 A;  2P0W A;  2Q4Y A;  4C7H A;  4UCN A;  4PSX A;  4QUS A;  5AG6 A;  4XPL A;  5IB0 A;  2ZXV A;  3MGD A;  3SXN A;  5JPH A;  4A2Z A;  4IF5 A;  3T90 A;  1NSL A;  4CAF A;  5I0C A;  1K4J A;  4OAE A;  3ZZI A;  2I00 A;  2FIA A;  4R87 A;  4UFW A;  2H5M A;  4Q38 A;  4CGM A;  4ONU A;  4JJX A;  1XMT A;  4KUA A;  4UWI A;  1VKC A;  3W6X A;  3FB3 A;  1S60 A;  3P2H A;  5G21 A;  3S6K A;  4QBJ A;  1Y9W A;  1MJ9 A;  3F5B A;  3QAH A;  1LRZ A;  3UY5 A;  4AVB A;  3V8I A;  4HNY B;  3EO4 A;  4CAX A;  1TIQ A;  3CXS A;  4B12 A;  2PSW A;  3BLN A;  4KVO E;  4MFJ A;  2FIW A;  1RO5 A;  2Z3O A;  5KTD A;  2ZW6 A;  3TOA A;  4MFL A;  3TTH A;  1S5K A;  2GIV A;  5EBV A;  4CGN A;  1N71 A;  2REF A;  5G1Z A;  4MHD A;  4QB9 A;  2WSA A;  4JWP A;  1P4N A;  4M3S A;  5F49 A;  3S6H A;  4A33 A;  3TO7 A;  2Z3L A;  3N7Z A;  4LX9 A;  1IYL A;  3VWE A;  3IGR A;  2J8M A;  2B58 A;  4KOU A;  5H84 A;  4E2A A;  2F5I A;  2R8V A;  3D2P A;  4KVX A;  2FT0 A;  5G22 A;  2QIR A;  3JTK A;  3LOD A;  2D4O A;  2C27 A;  4HKF A;  3SHP A;  3IU2 A;  1M4D A;  2OB0 A;  3DNS A;  2R7H A;  1NE9 A;  4UFX A;  2OU2 A;  2VBQ A;  3S6F A;  3TT2 A;  4AB7 A;  2EVN A;  5AG5 A;  2ATR A;  3G3S A;  4K30 A;  4QC6 A;  2CNS A;  2JDC A;  3A9L A;  5KTC A;  3D3S A;  2FCK A;  3I3G A;  3TOB A;  5A28 A;  2ZW7 A;  3R9F A;  4A95 A;  4F6A A;  5C88 A;  4YFJ A;  2O28 A;  2J8N A;  3BJ7 A;  4UCM A;  4XNH B;  1S3Z A;  1MK4 A;  1S7L A;  3G8W A;  4JLY A;  4A31 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...