3B3WA

Crystal structure of the s228a mutant of the aminopeptidase from vibrio proteolyticus in complex with leucine
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
291
structure length
291
Chain Sequence
MPPITQQATVTAWLPQVDASQITGTISSLESFTNRFYTTTSGAQASDWIASEWQALSASLPNASVKQVSHSGYNQKSVVMTITGSEAPDEWIVIGGHLDSTIGSHTNEQSVAPGADDDASGIAAVTEVIRVLSENNFQPKRSIAFMAYAAEEVGLRGSQDLANQYKSEGKNVVSALQLDMTNYKGSAQDVVFITDYTDSNFTQYLTQLMDEYLPSLTYGFDTCGYACADHASWHNAGYPAAMPFESKFNDYNPRIHTTQDTLANSDPTGSHAKKFTQLGLAYAIEMGSATG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Bacterial leucyl aminopeptidase
publication title Zinc coordination geometry and ligand binding affinity: the structural and kinetic analysis of the second-shell serine 228 residue and the methionine 180 residue of the aminopeptidase from Vibrio proteolyticus.
pubmed doi rcsb
source organism Vibrio proteolyticus
total genus 109
structure length 291
sequence length 291
ec nomenclature ec 3.4.11.10: Bacterial leucyl aminopeptidase.
pdb deposition date 2007-10-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 3b3wA00
3VARA 4A39A 3D7FA 4DUKA 2O4HA 2GLFA 3ISZA 3T8WA 4NGPA 4TWEA 2GLJA 4NGTA 4UIAA 1Z5RA 2PJ8A 5LYFA 2EWBA 3SJXA 4DYOA 1F2OA 7CPAA 1BPNA 2PJCA 3PB7X 4RUHA 3PBEA 4O23A 4MCPA 3PBBA 2V8VA 2C1CA 3WABA 1NSAA 1CP6A 2ZEPA 2EK9A 3D7HA 1QMUA 2CTCA 5DS0A 3N5FA 5HVFA 2C6GA 3KHXA 4ZY1A 1LAPA 2Q43A 1VHOA 4P6YA 4LQGA 1TKJA 2AFZA 1ARLA 2QYVA 2WZNA 4P44A 4MCSA 1XFOA 2JBJA 2V8HA 2FVGA 2ZEEA 5CBMA 4EWTA 4R76A 3KASA 1BPMA 1CP7A 3PFEA 3KQZA 4MHZA 3PEIA 5K8MA 3IC1A 4F8ZA 4CPAA 4PXCA 1Z2LA 1M4LA 5K8PA 1HDUA 4OP4A 1UWYA 2XEJA 3SI1A 4UEFA 3IIBA 3PFOA 4GM5A 2WYRA 1R43A 2PCUA 2C6CA 5LRJA 2GREA 1Z8LA 4P4IA 1TF8A 1LCPA 3ISXA 5LRGA 2AFXA 2CF4A 2GU2A 4R6TA 1ZLIA 1ZG8A 8CPAA 2ZOFA 3FJUA 2AFWA 3D7GA 1CPXA 3FEEA 3VH9A 2VL1A 3H8EA 2QJ8A 1Q7LA 1EE3P 3WT4A 2PE3A 3FMCA 1TXRA 3KI9A 4X2TA 4PPZA 4FUUA 3BHXA 2PJ5A 3IWWA 1LANA 2ZOGA 4MMOA 1YSJA 1XRYA 2PJ6A 5THWA 1ARMA 3IEHA 3PB4X 3IFEA 3HUVA 4OKOA 2NSMA 1F2PA 3GB0A 3LWUA 4OC4A 1CBXA 2HC9A 3K9TA 6CPAA 2OOTA 3GLJA 5F09A 3FF3A 4NGNA 4IAVA 1IGBA 4WWVA 5HXDA 3B2YA 4P4JA 2J9AA 1Y0RA 2AFUA 4MCRA 4X3RA 2OR4A 5LYDA 5LYLA 2PVVA 3SJEA 4OMEA 4FWUA 4KSIA 3DGVA 2PJ1A 2I3CA 2ZEHA 4B6ZA 5K8OA 4P4FA 3GUXA 4A38A 4OC1A 2BCOA 1JQGA 5ELYA 2PJ7A 3DLJA 1YLOA 2PVWA 2ZENA 4F9VA 4Q7AA 4H2KA 3WC6A 3BI0A 1YMEA 5K8NA 1R3NA 3NH4A 4MRIA 3B3CA 2PJ4A 4OC2A 2NYQA 4AXVA 3FEDA 4NGSA 5LRKA 1PCAA 3PRTA 4JYWA 4OC0A 1F57A 2PJ2A 4TNUA 2BO9A 3CPAA 4MHNA 4K3NA 4WJBA 3KQXA 3KHZA 3SJGA 4UEEA 3S9NA 3IO1A 3NH5A 3FVLA 3KZWA 4PXDA 1CG2A 2IJZA 1XBUA 3S9MA 3S9LA 2C6PA 1TF9A 4FAIA 2PJBA 4EMEA 2ZEGA 1ELMP 3KR4A 3RAMA 3CT9A 1H8LA 2PJAA 1BLLE 4P10A 4X8IA 1YW4A 1BAVA 5JGFA 2AFOA 2ZELA 3WC7A 1GYTA 4IK2A 4OIDA 1OBRA 2XEIA 3BI1A 1IY7A 4A37A 5I4MA 5JM6A 2JEWA 2ZEOA 3SI0A 4BD9A 3NH8A 2PIYA 3KGQA 4PQAA 2IQ6A 3H8GA 1FT7A 4P45A 1LAMA 1VIXA 2HB6A 5HVGA 3CDXA 4NFRA 4UIBA 1XJOA 2XEGA 2O53A 4IHMA 2ZEDA 3D68A 3B35A 3B3SA 5HVHA 3LMSA 2PIZA 5D29A 4W9YA 2RB7A 1YW6A 3H8FA 3V38A 3B3WA 4NGQA 4EFDA 2PRQA 2Q51A 3D7DA 2ZEFA 2EK8A 4OIWA 2ANPA 2F7VA 4ZI6A 4OC5A 1PYTB 2ZEMA 1ELLP 1DE4C 2BOAA 4PXEA 4P4EA 4A94A 1CPSA 3TX8A 3NA6A 2CIJA 5IB9A 3CPXA 3PB8X 3QNVA 2PJ9A 3HLPA 3B7IA 4MCQA 3D4UA 1DTDA 2F8HA 1FNOA 4UEZA 1TKHA 1LFWA 1TKFA 1HDQA 3JRUA 4UF4A 1ZLHA 4G1PA 4YU9A 4F9UA 4P4BA 4R8FA 3WC5A 2Q4ZA 1VHEA 3FH4A 4MHYA 3VATA 3BXMA 4ZYQA 2V8DA 3K2KA 3FX6A 5CPAA 4NGRA 2PJ0A 1HEEA 4NJQA 5JH9A 4Z65A 4JZ0A 4ZX9A 3PB9X 2JBKA 2AFMA 4ONWA 2PJ3A 1VGYA 4ZY2A 4ZY0A 1XMBA 2AFSA 4P4DA 4ZX8A 2IMOA 1LOKA 2ABZA 3MRUA 4YWYA 3B3TA 3KR5A 2V77A 3PB6X 3IJ3A 3V7ZA 3SJFA 1QQ9A 2XEFA 4NJRA 3NFZA 4PXBA 1Y0YA 3D66A 3I1UA 3KL9A 1RTQA 3B3VA 1ZG9A 3L2NA 5J1QA 4DJLA 2POKA 5D8NA 2CTBA 4FBEA 3RBUA 3D67A 3SI2A 4R7MA 5LYIA 2DEAA 4OC3A 4NGMA 1Y7EA 2G9DA 1AYEA 3RZAA 1KWMA 3TC8A 3FECA 4MXUA 1ZG7A 2RFHA 3MN8A 1CX8A 2V8GA 4MHPA 1AMPA 2QVPA
chains in the Genus database with same CATH superfamily
3NE8A 3VARA 4A39A 3D7FA 4KORA 3IGRA 4DUKA 3F0AA 2Z3LA 2O4HA 2GLFA 2Q7BA 4CAXA 3ISZA 3T8WA 2FS5A 2PDOA 2YNCA 1J4JA 4NGPA 4TWEA 2NMTA 4CYPA 2PR1A 2GLJA 1YREA 2A4NA 4NGTA 3W6XA 4UIAA 3S6FA 1Z5RA 2PJ8A 3JVNA 2EWBA 2JEVA 4LX9A 5LYFA 3SJXA 2Z3NA 1NSLA 1MK4A 4DYOA 2EO8A 1IICA 2WPWA 1IOIA 1F2OA 7CPAA 1BPNA 1IYKA 2PJCA 2Z10A 3PB7X 3PBEA 4RUHA 4O23A 4MCPA 3PBBA 1M1DA 4KLWA 2V8VA 2C1CA 4UWIA 2EBJA 1NSAA 3E0KA 3F5BA 2FE7A 4R57A 3WABA 1CP6A 4QC6A 4UCNA 2B3UA 2ZEPA 4PSXA 2K5TA 1FY7A 2EK9A 2JDDA 3DDDA 4MI4A 4M6GA 1X10A 2D4OA 2ZW5A 3D7HA 1QMUA 4M6HA 2CTCA 5DS0A 3BJ7A 4FD5A 3N5FA 5HVFA 2C6GA 1S7NA 2I79A 3I9SA 3KHXA 4ZY1A 1LAPA 1GHEA 2Q43A 1VHOA 1YR0A 4P6YA 4LQGA 5IV0A 1TKJA 2AFZA 2J8MA 3R96A 1QSTA 1ARLA 2KCWA 2QYVA 2DF5A 2WZNA 4P44A 4MCSA 1XFOA 4PV6A 2JBJA 4I49A 2V8HA 2Z3PA 1S5KA 2FVGA 2ZEEA 1Z8XA 4A31A 1VKCA 5CBMA 2YNDA 4EWTA 5J8FA 2ZPAA 4M3SA 4CAVA 4R76A 3KASA 1BPMA 1CP7A 3JUWA 3PFEA 3KQZA 2B3VA 3NE7A 4MHZA 3PEIA 5K8MA 3FRMA 3IC1A 4F8ZA 4CPAA 4PXCA 1Z2LA 2OH1A 1M4LA 4A95A 5K8PA 1HDUA 4B14A 4ORFA 2OZGA 4OP4A 3R9GA 1UWYA 4IF5A 2XEJA 3SI1A 2ODFA 3TTHA 1RXTA 2Q44A 4UEFA 3IIBA 4XNHB 3PFOA 4GM5A 2WYRA 4NXYA 4HNXB 2B4BA 1R43A 4A30A 4AB7A 2PCUA 3CXSA 4QVTA 4JXRA 4CYQA 2C6CA 4UA3A 5LRJA 2GREA 2ZW4A 1Z8LA 1MJAA 2ATRA 4P4IA 1TF8A 1XMTA 1LCPA 1B87A 3ISXA 2FL4A 3GYAA 4M85A 5LRGA 4R87A 1SQHA 2GU2A 2AFXA 2CF4A 1QSMA 1YVOA 4KVXA 4R6TA 1X12A 1ZLIA 4II9A 1CM0A 1ZG8A 4F6AA 4FD7A 8CPAA 2ZOFA 3G8WA 1WWZA 3FJUA 2AFWA 3D7GA 3P2HA 3S6HA 1CPXA 3FEEA 3VH9A 2VL1A 4C7IA 3H8EA 2QJ8A 3TFYA 2QIRA 1Q7LA 4DNCA 3PP9A 1EE3P 3WT4A 2PE3A 3FMCA 2H5MA 1R57A 4AG7A 1WK4A 5EMIA 1TXRA 2DPTA 3KI9A 4KUBA 4KVOE 4MFPA 4X2TA 5KTAA 4PPZA 4FUUA 3BHXA 2PJ5A 2ZXVA 3IWWA 1LANA 2ZOGA 4NCZA 4MMOA 1YSJA 2EUIA 3IWGA 1XRYA 2PJ6A 5THWA 3W6SA 1ARMA 3IEHA 3PB4X 3IFEA 3PZJA 1XE4A 4Y49B 3HUVA 4OKOA 2NSMA 1F2PA 3GB0A 3LWUA 4OC4A 1CBXA 2HC9A 4XPKA 1S60A 3K9TA 6CPAA 3SXOA 2OOTA 5AGEA 2BSWA 2RC4A 3GLJA 2J8NA 1MJBA 1M4GA 5F09A 3FF3A 2VEZA 4NGNA 4IAVA 2P6GA 1IGBA 3JTKA 4WWVA 5HXDA 2JLMA 2FIAA 3B2YA 2R7HA 4LUAA 4P4JA 4B12A 3R9EA 3ZZIA 3DR8A 3R95A 4CRYB 4JD6A 2X7BA 2J9AA 1Y0RA 5JQ4A 4K30A 2AFUA 3FYNA 2B4DB 3FIXA 2G0BA 4B5OA 4MCRA 4X3RA 2OR4A 4UFVA 5F48A 5LYDA 4BBHA 4C2XA 5LYLA 2PVVA 3SJEA 1S3ZA 4OMEA 2G3AA 4FWUA 4KSIA 4QUSA 3LODA 3DR6A 1CJWA 3DGVA 4RS2A 2PJ1A 2I3CA 2ZEHA 1VHSA 4KOSA 4MY3A 4XPDB 4J3GA 1OZPA 4KZTA 1ZO0A 4H6ZA 3IU2A 4B6ZA 5F46A 5K8OA 2PR8A 1P4NA 2R8VA 4KOXA 3GUXA 3LACA 4P4FA 3T90A 4A38A 4PSWA 4OC1A 4ZBGA 1N71A 3C26A 2VZZA 4A33A 4BMHA 4F0YA 2BCOA 1JQGA 4KOYA 5ELYA 2OB0A 5C82A 2PJ7A 1M44A 3FXTA 5J8CA 3DLJA 4XNHC 3EFAA 3R9FA 4B13A 1YLOA 2PVWA 4UWJA 2ZENA 4F9VA 4Q7AA 4QB9A 4H2KA 4CYNA 4YFJA 4UCPA 3WC6A 3BI0A 4RN7A 1YMEA 1Y7RA 1Y9KA 1R3NA 5C88A 3NH4A 5K8NA 4MRIA 3B3CA 2PJ4A 2WSAA 4A2ZA 4OC2A 1YLEA 2NYQA 1KZFA 4PK3A 4HNYB 4AXVA 2P6FA 4BINA 3FEDA 4NGSA 5LRKA 1PCAA 2PC1A 4KOUA 3TT2A 5E96A 3PRTA 4JYWA 2B58A 4M6IA 4OC0A 4AG9A 1F57A 4CRZB 2PJ2A 4TNUA 2BO9A 3CPAA 4B5PA 4MHNA 5DWNA 1Z8WA 4K3NA 4CAWA 4WJBA 3KQXA 5HMNA 4CYOA 3KHZA 4NF1A 1LRZA 4OAEA 2Q0YA 2Y0MA 3SJGA 3TCVA 3CXPA 4UEEA 3S9NA 3IO1A 2C27A 3NH5A 3FVLA 3KZWA 4PXDA 1CG2A 1I12A 2IJZA 2HUZA 2Z3OA 3S6KA 1S7LA 4CGPA 5H86A 1XBUA 1Z4EA 2GIVA 3S9MA 3D3SA 3S9LA 2C6PA 1KUVA 5HH1A 1TF9A 4FAIA 1Q2YA 1S7KA 2PJBA 2REFA 2VQYA 2FCKA 2ZEGA 5F47A 4EMEA 1ELMP 3T9YA 3KR4A 3RAMA 5F49A 3CT9A 4IUSA 1H8LA 3S6GA 5DWMA 2PJAA 1BLLE 4MFKA 4P10A 4X8IA 4JLYA 5G22A 2GANA 3QAHA 4MFLA 1YK3A 1YW4A 1TIQA 3MGDA 4F0XA 5KTCA 2CNSA 3GKRA 1BO4A 5JPHA 1QSOA 5H84A 1XF8A 4GS4A 3SHPA 1BAVA 2J8RA 5JGFA 2AFOA 1PUAA 2ZELA 3WC7A 4E0AA 1YQEA 4Q38A 1GYTA 4NEXA 4IK2A 1MJ9A 4OIDA 4CGLA 4KUAA 2P6EA 2QECA 1OBRA 2XEIA 3BI1A 3CXQA 3W91A 4CAEA 1IY7A 5AG7A 4A37A 4R3LA 5I4MA 5JM6A 2JEWA 3R1KA 2ZEOA 5FVJA 3SI0A 3F8KA 4NSQA 4BD9A 1IB1E 2P0WA 2B4DA 2OZUA 2HV2A 3LD2A 3NH8A 1S7FA 4XPLA 3D2MA 2PIYA 2DXQA 3KGQA 4XPDC 4PQAA 2IQ6A 5ISVA 5GCNA 3H8GA 4ONUA 2EVNA 1FT7A 4P45A 3H4QA 1LAMA 5EC4A 3KKWA 1VIXA 2FIWA 2HB6A 4RI1A 5HVGA 4X5KA 3CDXA 4NFRA 2WPXA 1YGHA 2VBQA 4KOWA 4CGNA 2CNTA 2VZYA 4UIBA 1XJOA 4YRHA 3ZJ0A 2XEGA 2O53A 4IHMA 1Q2DA 4MFJA 2ZEDA 2FT0A 3CZXA 2B5GB 2CXAA 3D68A 4C2YA 2Z3MA 5A28A 3B35A 3B3SA 4KSAA 3LMSA 4MFZA 2VXKA 5HVHA 2Q4VA 2PIZA 1I21A 5D29A 4W9YA 2RB7A 3RNZA 1YW6A 1RO5A 3H8FA 4UFWA 3V38A 4CAFA 3WR7A 3B3WA 4CGOA 5BWAB 4NGQA 4EFDA 2R98A 3BLNA 4B10A 4H89A 2PRQA 2Q51A 3EO4A 1YX0A 3D7DA 2BL1A 2ZEFA 2EK8A 4U9YA 3EY5A 1BOBA 4OIWA 2ANPA 2F7VA 2Q4YA 4ZI6A 4OC5A 1PYTB 2VI7A 4OADA 3A9LA 2AJ6A 3I3GA 4MHDA 2ZEMA 2ZW6A 1ELLP 4YGOA 2Z0ZA 5G20A 1I1DA 1DE4C 2BOAA 4OLLA 4PXEA 1XIXA 4E8OA 1P0HA 4P4EA 4A94A 1M4DA 1CPSA 1Y9WA 2BUEA 4E2AA 3TX8A 3PGPA 4MFQA 3NA6A 2CIJA 5IB9A 3CPXA 4UFXA 1Q2CA 3PB8X 2PRBA 3QB8A 3QNVA 2PJ9A 4MJ8A 1KUYA 3HLPA 1XEBA 3B7IA 4Q36A 4MCQA 3D4UA 1DTDA 2F8HA 1FNOA 4UEZA 3GIUA 3IU1A 2CNMA 1TKHA 3EXNA 2O28A 1QSNA 4R3KA 1LFWA 3TO6A 3FNCA 2ZW7A 1QSRA 5KTDA 1TKFA 1HDQA 3JRUA 1Z4RA 2HQYA 3N7ZA 4UF4A 4EVYA 4CGMA 1ZLHA 4G1PA 4YU9A 2GFQA 4F9UA 4P4BA 4R8FA 2F5IA 3WC5A 2YNEA 2Q4ZA 3B8GA 1VHEA 2D4PA 3FH4A 4A32A 1KUXA 5G1ZA 3VWEA 2WUUA 4MHYA 1M4IA 2R1IA 4MBUA 3VATA 4CS0B 4AVCA 3H5ZA 4FD6A 3BXMA 4C7HA 4KVME 1AUGA 4ZYQA 3UY5A 3FB3A 2V8DA 3K2KA 3FX6A 4UCMA 4LQ6A 4Y49C 5CPAA 4NGRA 1JWQA 2CY2A 2Q7SA 4HPSA 2QMLA 4PK2A 2PJ0A 4GXHA 2REEA 1HEEA 5EBVA 3VWDA 2AE6A 5AG6A 4NJQA 2PQ8A 4HKFA 4JXQA 3DNSA 2I00A 5IB0A 5JH9A 4Z65A 3EC4A 4JZ0A 2DPSA 4ZX9A 5IX3A 1U6MA 3PB9X 2JBKA 1V0CA 1YVKA 4HNWB 2AFMA 4H6UA 4ONWA 2PJ3A 1VGYA 4ZY2A 3TO9A 4B5PB 4JJXA 4ZY0A 1XMBA 4MY0A 2AFSA 4P4DA 3K9UA 2IMOA 4ZX8A 3GY9A 1LOKA 1NMTA 2ABZA 4KLVA 1L0CA 3MRUA 2OU2A 1PU9A 4KOVA 3B3TA 4YWYA 3KR5A 1A2ZA 2V77A 3PB6X 4U9ZA 3RYOA 4UBRA 4L8AA 3IJ3A 1Z8TA 3QAYA 3V7ZA 1UFHA 3G3SA 3SJFA 1QQ9A 2FXFA 2XEFA 4NJRA 3NFZA 4PXBA 4B11A 1Y0YA 3D66A 3I1UA 3KL9A 1RTQA 5I0CA 2YGWA 2Z3KA 3B3VA 1Z9UA 1ZG9A 1B6BA 1IIDA 2B5GA 3RO0A 3TOAA 3D2PA 3FBUA 2Z11A 3L2NA 3TO7A 2BEIA 2GE3A 4DJLA 2POKA 5D8NA 5J1QA 4ZGYB 2CTBA 3OWCA 4FBEA 2IL4A 1K4JA 2OZHA 3RBUA 3D67A 4AVBA 3SI2A 4R7MA 2ARHA 5LYIA 2Q04A 3V8IA 2DEAA 2JDCA 4OC3A 5G21A 4L89A 4KSFA 3D8PA 4NGMA 4R9MA 4AVAA 4QBJA 1Y7EA 2G9DA 1AYEA 4KOTA 3RZAA 3SXNA 5AG5A 1IU8A 3TOBA 2FSRA 1KWMA 4KS9A 3TC8A 5A27A 3FECA 4MXUA 3DSBA 3P2FA 1ZG7A 4C2ZA 2G3TA 5CNPA 2RFHA 3MN8A 4U5YA 1IOFA 1CX8A 1ON0A 1XOVA 1NE9A 2V8GA 3BJ8A 4C68A 1IYLA 4MHPA 5AG4A 2YNCC 3IWEA 4JWPA 4FD4A 3TE4A 1AMPA 2QVPA 2PSWA
chains in the Genus database with same CATH topology
3VARA 4A39A 3D7FA 4DUKA 2O4HA 2GLFA 3ISZA 3T8WA 4NGPA 4TWEA 2GLJA 4NGTA 4UIAA 1Z5RA 2PJ8A 5LYFA 2EWBA 3SJXA 4DYOA 1F2OA 7CPAA 1BPNA 2PJCA 3PB7X 4RUHA 3PBEA 4O23A 4MCPA 3PBBA 2V8VA 2C1CA 3WABA 1NSAA 1CP6A 2ZEPA 2EK9A 3D7HA 1QMUA 2CTCA 5DS0A 3N5FA 5HVFA 2C6GA 3KHXA 4ZY1A 1LAPA 2Q43A 1VHOA 4P6YA 4LQGA 1TKJA 2AFZA 1ARLA 2QYVA 2WZNA 4P44A 4MCSA 1XFOA 2JBJA 2V8HA 2FVGA 2ZEEA 5CBMA 4EWTA 4R76A 3KASA 1BPMA 1CP7A 3PFEA 3KQZA 4MHZA 3PEIA 5K8MA 3IC1A 4F8ZA 4CPAA 4PXCA 1Z2LA 1M4LA 5K8PA 1HDUA 4OP4A 1UWYA 2XEJA 3SI1A 4UEFA 3IIBA 3PFOA 4GM5A 2WYRA 1R43A 2PCUA 2C6CA 5LRJA 2GREA 1Z8LA 4P4IA 1TF8A 1LCPA 3ISXA 5LRGA 2AFXA 2CF4A 2GU2A 4R6TA 1ZLIA 1ZG8A 8CPAA 2ZOFA 3FJUA 2AFWA 3D7GA 1CPXA 3FEEA 3VH9A 2VL1A 3H8EA 2QJ8A 1Q7LA 1EE3P 3WT4A 2PE3A 3FMCA 1TXRA 3KI9A 4X2TA 4PPZA 4FUUA 3BHXA 2PJ5A 3IWWA 1LANA 2ZOGA 4MMOA 1YSJA 1XRYA 2PJ6A 5THWA 1ARMA 3IEHA 3PB4X 3IFEA 3HUVA 4OKOA 2NSMA 1F2PA 3GB0A 3LWUA 4OC4A 1CBXA 2HC9A 3K9TA 6CPAA 2OOTA 3GLJA 5F09A 3FF3A 4NGNA 4IAVA 1IGBA 4WWVA 5HXDA 3B2YA 4P4JA 2J9AA 1Y0RA 2AFUA 4MCRA 4X3RA 2OR4A 5LYDA 5LYLA 2PVVA 3SJEA 4OMEA 4FWUA 4KSIA 3DGVA 2PJ1A 2I3CA 2ZEHA 4B6ZA 5K8OA 4P4FA 3GUXA 4A38A 4OC1A 2BCOA 1JQGA 5ELYA 2PJ7A 3DLJA 1YLOA 2PVWA 2ZENA 4F9VA 4Q7AA 4H2KA 3WC6A 3BI0A 1YMEA 5K8NA 1R3NA 3NH4A 4MRIA 3B3CA 2PJ4A 4OC2A 2NYQA 4AXVA 3FEDA 4NGSA 5LRKA 1PCAA 3PRTA 4JYWA 4OC0A 1F57A 2PJ2A 4TNUA 2BO9A 3CPAA 4MHNA 4K3NA 4WJBA 3KQXA 3KHZA 3SJGA 4UEEA 3S9NA 3IO1A 3NH5A 3FVLA 3KZWA 4PXDA 1CG2A 2IJZA 1XBUA 3S9MA 3S9LA 2C6PA 1TF9A 4FAIA 2PJBA 4EMEA 2ZEGA 1ELMP 3KR4A 3RAMA 3CT9A 1H8LA 2PJAA 1BLLE 4P10A 4X8IA 1YW4A 1BAVA 5JGFA 2AFOA 2ZELA 3WC7A 1GYTA 4IK2A 4OIDA 1OBRA 2XEIA 3BI1A 1IY7A 4A37A 5I4MA 5JM6A 2JEWA 2ZEOA 3SI0A 4BD9A 3NH8A 2PIYA 3KGQA 4PQAA 2IQ6A 3H8GA 1FT7A 4P45A 1LAMA 1VIXA 2HB6A 5HVGA 3CDXA 4NFRA 4UIBA 1XJOA 2XEGA 2O53A 4IHMA 2ZEDA 3D68A 3B35A 3B3SA 5HVHA 3LMSA 2PIZA 5D29A 4W9YA 2RB7A 1YW6A 3H8FA 3V38A 3B3WA 4NGQA 4EFDA 2PRQA 2Q51A 3D7DA 2ZEFA 2EK8A 4OIWA 2ANPA 2F7VA 4ZI6A 4OC5A 1PYTB 2ZEMA 1ELLP 1DE4C 2BOAA 4PXEA 4P4EA 4A94A 1CPSA 3TX8A 3NA6A 2CIJA 5IB9A 3CPXA 3PB8X 3QNVA 2PJ9A 3HLPA 3B7IA 4MCQA 3D4UA 1DTDA 2F8HA 1FNOA 4UEZA 1TKHA 1LFWA 1TKFA 1HDQA 3JRUA 4UF4A 1ZLHA 4G1PA 4YU9A 4F9UA 4P4BA 4R8FA 3WC5A 2Q4ZA 1VHEA 3FH4A 4MHYA 3VATA 3BXMA 4ZYQA 2V8DA 3K2KA 3FX6A 5CPAA 4NGRA 2PJ0A 1HEEA 4NJQA 5JH9A 4Z65A 4JZ0A 4ZX9A 3PB9X 2JBKA 2AFMA 4ONWA 2PJ3A 1VGYA 4ZY2A 4ZY0A 1XMBA 2AFSA 4P4DA 4ZX8A 2IMOA 1LOKA 2ABZA 3MRUA 4YWYA 3B3TA 3KR5A 2V77A 3PB6X 3IJ3A 3V7ZA 3SJFA 1QQ9A 2XEFA 4NJRA 3NFZA 4PXBA 1Y0YA 3D66A 3I1UA 3KL9A 1RTQA 3B3VA 1ZG9A 3L2NA 5J1QA 4DJLA 2POKA 5D8NA 2CTBA 4FBEA 3RBUA 3D67A 3SI2A 4R7MA 5LYIA 2DEAA 4OC3A 4NGMA 1Y7EA 2G9DA 1AYEA 3RZAA 1KWMA 3TC8A 3FECA 4MXUA 1ZG7A 2RFHA 3MN8A 1CX8A 2V8GA 4MHPA 1AMPA 2QVPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VAR A;  4A39 A;  3D7F A;  4DUK A;  2O4H A;  2GLF A;  3ISZ A;  3T8W A;  4NGP A;  4TWE A;  2GLJ A;  4NGT A;  4UIA A;  1Z5R A;  2PJ8 A;  5LYF A;  2EWB A;  3SJX A;  4DYO A;  1F2O A;  7CPA A;  1BPN A;  2PJC A;  3PB7 X;  4RUH A;  3PBE A;  4O23 A;  4MCP A;  3PBB A;  2V8V A;  2C1C A;  3WAB A;  1NSA A;  1CP6 A;  2ZEP A;  2EK9 A;  3D7H A;  1QMU A;  2CTC A;  5DS0 A;  3N5F A;  5HVF A;  2C6G A;  3KHX A;  4ZY1 A;  1LAP A;  2Q43 A;  1VHO A;  4P6Y A;  4LQG A;  1TKJ A;  2AFZ A;  1ARL A;  2QYV A;  2WZN A;  4P44 A;  4MCS A;  1XFO A;  2JBJ A;  2V8H A;  2FVG A;  2ZEE A;  5CBM A;  4EWT A;  4R76 A;  3KAS A;  1BPM A;  1CP7 A;  3PFE A;  3KQZ A;  4MHZ A;  3PEI A;  5K8M A;  3IC1 A;  4F8Z A;  4CPA A;  4PXC A;  1Z2L A;  1M4L A;  5K8P A;  1HDU A;  4OP4 A;  1UWY A;  2XEJ A;  3SI1 A;  4UEF A;  3IIB A;  3PFO A;  4GM5 A;  2WYR A;  1R43 A;  2PCU A;  2C6C A;  5LRJ A;  2GRE A;  1Z8L A;  4P4I A;  1TF8 A;  1LCP A;  3ISX A;  5LRG A;  2AFX A;  2CF4 A;  2GU2 A;  4R6T A;  1ZLI A;  1ZG8 A;  8CPA A;  2ZOF A;  3FJU A;  2AFW A;  3D7G A;  1CPX A;  3FEE A;  3VH9 A;  2VL1 A;  3H8E A;  2QJ8 A;  1Q7L A;  1EE3 P;  3WT4 A;  2PE3 A;  3FMC A;  1TXR A;  3KI9 A;  4X2T A;  4PPZ A;  4FUU A;  3BHX A;  2PJ5 A;  3IWW A;  1LAN A;  2ZOG A;  4MMO A;  1YSJ A;  1XRY A;  2PJ6 A;  5THW A;  1ARM A;  3IEH A;  3PB4 X;  3IFE A;  3HUV A;  4OKO A;  2NSM A;  1F2P A;  3GB0 A;  3LWU A;  4OC4 A;  1CBX A;  2HC9 A;  3K9T A;  6CPA A;  2OOT A;  3GLJ A;  5F09 A;  3FF3 A;  4NGN A;  4IAV A;  1IGB A;  4WWV A;  5HXD A;  3B2Y A;  4P4J A;  2J9A A;  1Y0R A;  2AFU A;  4MCR A;  4X3R A;  2OR4 A;  5LYD A;  5LYL A;  2PVV A;  3SJE A;  4OME A;  4FWU A;  4KSI A;  3DGV A;  2PJ1 A;  2I3C A;  2ZEH A;  4B6Z A;  5K8O A;  4P4F A;  3GUX A;  4A38 A;  4OC1 A;  2BCO A;  1JQG A;  5ELY A;  2PJ7 A;  3DLJ A;  1YLO A;  2PVW A;  2ZEN A;  4F9V A;  4Q7A A;  4H2K A;  3WC6 A;  3BI0 A;  1YME A;  5K8N A;  1R3N A;  3NH4 A;  4MRI A;  3B3C A;  2PJ4 A;  4OC2 A;  2NYQ A;  4AXV A;  3FED A;  4NGS A;  5LRK A;  1PCA A;  3PRT A;  4JYW A;  4OC0 A;  1F57 A;  2PJ2 A;  4TNU A;  2BO9 A;  3CPA A;  4MHN A;  4K3N A;  4WJB A;  3KQX A;  3KHZ A;  3SJG A;  4UEE A;  3S9N A;  3IO1 A;  3NH5 A;  3FVL A;  3KZW A;  4PXD A;  1CG2 A;  2IJZ A;  1XBU A;  3S9M A;  3S9L A;  2C6P A;  1TF9 A;  4FAI A;  2PJB A;  4EME A;  2ZEG A;  1ELM P;  3KR4 A;  3RAM A;  3CT9 A;  1H8L A;  2PJA A;  1BLL E;  4P10 A;  4X8I A;  1YW4 A;  1BAV A;  5JGF A;  2AFO A;  2ZEL A;  3WC7 A;  1GYT A;  4IK2 A;  4OID A;  1OBR A;  2XEI A;  3BI1 A;  1IY7 A;  4A37 A;  5I4M A;  5JM6 A;  2JEW A;  2ZEO A;  3SI0 A;  4BD9 A;  3NH8 A;  2PIY A;  3KGQ A;  4PQA A;  2IQ6 A;  3H8G A;  1FT7 A;  4P45 A;  1LAM A;  1VIX A;  2HB6 A;  5HVG A;  3CDX A;  4NFR A;  4UIB A;  1XJO A;  2XEG A;  2O53 A;  4IHM A;  2ZED A;  3D68 A;  3B35 A;  3B3S A;  5HVH A;  3LMS A;  2PIZ A;  5D29 A;  4W9Y A;  2RB7 A;  1YW6 A;  3H8F A;  3V38 A;  3B3W A;  4NGQ A;  4EFD A;  2PRQ A;  2Q51 A;  3D7D A;  2ZEF A;  2EK8 A;  4OIW A;  2ANP A;  2F7V A;  4ZI6 A;  4OC5 A;  1PYT B;  2ZEM A;  1ELL P;  1DE4 C;  2BOA A;  4PXE A;  4P4E A;  4A94 A;  1CPS A;  3TX8 A;  3NA6 A;  2CIJ A;  5IB9 A;  3CPX A;  3PB8 X;  3QNV A;  2PJ9 A;  3HLP A;  3B7I A;  4MCQ A;  3D4U A;  1DTD A;  2F8H A;  1FNO A;  4UEZ A;  1TKH A;  1LFW A;  1TKF A;  1HDQ A;  3JRU A;  4UF4 A;  1ZLH A;  4G1P A;  4YU9 A;  4F9U A;  4P4B A;  4R8F A;  3WC5 A;  2Q4Z A;  1VHE A;  3FH4 A;  4MHY A;  3VAT A;  3BXM A;  4ZYQ A;  2V8D A;  3K2K A;  3FX6 A;  5CPA A;  4NGR A;  2PJ0 A;  1HEE A;  4NJQ A;  5JH9 A;  4Z65 A;  4JZ0 A;  4ZX9 A;  3PB9 X;  2JBK A;  2AFM A;  4ONW A;  2PJ3 A;  1VGY A;  4ZY2 A;  4ZY0 A;  1XMB A;  2AFS A;  4P4D A;  4ZX8 A;  2IMO A;  1LOK A;  2ABZ A;  3MRU A;  4YWY A;  3B3T A;  3KR5 A;  2V77 A;  3PB6 X;  3IJ3 A;  3V7Z A;  3SJF A;  1QQ9 A;  2XEF A;  4NJR A;  3NFZ A;  4PXB A;  1Y0Y A;  3D66 A;  3I1U A;  3KL9 A;  1RTQ A;  3B3V A;  1ZG9 A;  3L2N A;  5J1Q A;  4DJL A;  2POK A;  5D8N A;  2CTB A;  4FBE A;  3RBU A;  3D67 A;  3SI2 A;  4R7M A;  5LYI A;  2DEA A;  4OC3 A;  4NGM A;  1Y7E A;  2G9D A;  1AYE A;  3RZA A;  1KWM A;  3TC8 A;  3FEC A;  4MXU A;  1ZG7 A;  2RFH A;  3MN8 A;  1CX8 A;  2V8G A;  4MHP A;  1AMP A;  2QVP A; 
#chains in the Genus database with same CATH topology
 3NE8 A;  3VAR A;  4A39 A;  3D7F A;  4KOR A;  3IGR A;  4DUK A;  3F0A A;  2Z3L A;  2O4H A;  2GLF A;  2Q7B A;  4CAX A;  3ISZ A;  3T8W A;  2FS5 A;  2PDO A;  2YNC A;  1J4J A;  4NGP A;  4TWE A;  2NMT A;  4CYP A;  2PR1 A;  2GLJ A;  1YRE A;  2A4N A;  4NGT A;  3W6X A;  4UIA A;  3S6F A;  1Z5R A;  2PJ8 A;  3JVN A;  2EWB A;  2JEV A;  4LX9 A;  5LYF A;  3SJX A;  2Z3N A;  1NSL A;  1MK4 A;  4DYO A;  2EO8 A;  1IIC A;  2WPW A;  1IOI A;  1F2O A;  7CPA A;  1BPN A;  1IYK A;  2PJC A;  2Z10 A;  3PB7 X;  3PBE A;  4RUH A;  4O23 A;  4MCP A;  3PBB A;  1M1D A;  4KLW A;  2V8V A;  2C1C A;  4UWI A;  2EBJ A;  1NSA A;  3E0K A;  3F5B A;  2FE7 A;  4R57 A;  3WAB A;  1CP6 A;  4QC6 A;  4UCN A;  2B3U A;  2ZEP A;  4PSX A;  2K5T A;  1FY7 A;  2EK9 A;  2JDD A;  3DDD A;  4MI4 A;  4M6G A;  1X10 A;  2D4O A;  2ZW5 A;  3D7H A;  1QMU A;  4M6H A;  2CTC A;  5DS0 A;  3BJ7 A;  4FD5 A;  3N5F A;  5HVF A;  2C6G A;  1S7N A;  2I79 A;  3I9S A;  3KHX A;  4ZY1 A;  1LAP A;  1GHE A;  2Q43 A;  1VHO A;  1YR0 A;  4P6Y A;  4LQG A;  5IV0 A;  1TKJ A;  2AFZ A;  2J8M A;  3R96 A;  1QST A;  1ARL A;  2KCW A;  2QYV A;  2DF5 A;  2WZN A;  4P44 A;  4MCS A;  1XFO A;  4PV6 A;  2JBJ A;  4I49 A;  2V8H A;  2Z3P A;  1S5K A;  2FVG A;  2ZEE A;  1Z8X A;  4A31 A;  1VKC A;  5CBM A;  2YND A;  4EWT A;  5J8F A;  2ZPA A;  4M3S A;  4CAV A;  4R76 A;  3KAS A;  1BPM A;  1CP7 A;  3JUW A;  3PFE A;  3KQZ A;  2B3V A;  3NE7 A;  4MHZ A;  3PEI A;  5K8M A;  3FRM A;  3IC1 A;  4F8Z A;  4CPA A;  4PXC A;  1Z2L A;  2OH1 A;  1M4L A;  4A95 A;  5K8P A;  1HDU A;  4B14 A;  4ORF A;  2OZG A;  4OP4 A;  3R9G A;  1UWY A;  4IF5 A;  2XEJ A;  3SI1 A;  2ODF A;  3TTH A;  1RXT A;  2Q44 A;  4UEF A;  3IIB A;  4XNH B;  3PFO A;  4GM5 A;  2WYR A;  4NXY A;  4HNX B;  2B4B A;  1R43 A;  4A30 A;  4AB7 A;  2PCU A;  3CXS A;  4QVT A;  4JXR A;  4CYQ A;  2C6C A;  4UA3 A;  5LRJ A;  2GRE A;  2ZW4 A;  1Z8L A;  1MJA A;  2ATR A;  4P4I A;  1TF8 A;  1XMT A;  1LCP A;  1B87 A;  3ISX A;  2FL4 A;  3GYA A;  4M85 A;  5LRG A;  4R87 A;  1SQH A;  2GU2 A;  2AFX A;  2CF4 A;  1QSM A;  1YVO A;  4KVX A;  4R6T A;  1X12 A;  1ZLI A;  4II9 A;  1CM0 A;  1ZG8 A;  4F6A A;  4FD7 A;  8CPA A;  2ZOF A;  3G8W A;  1WWZ A;  3FJU A;  2AFW A;  3D7G A;  3P2H A;  3S6H A;  1CPX A;  3FEE A;  3VH9 A;  2VL1 A;  4C7I A;  3H8E A;  2QJ8 A;  3TFY A;  2QIR A;  1Q7L A;  4DNC A;  3PP9 A;  1EE3 P;  3WT4 A;  2PE3 A;  3FMC A;  2H5M A;  1R57 A;  4AG7 A;  1WK4 A;  5EMI A;  1TXR A;  2DPT A;  3KI9 A;  4KUB A;  4KVO E;  4MFP A;  4X2T A;  5KTA A;  4PPZ A;  4FUU A;  3BHX A;  2PJ5 A;  2ZXV A;  3IWW A;  1LAN A;  2ZOG A;  4NCZ A;  4MMO A;  1YSJ A;  2EUI A;  3IWG A;  1XRY A;  2PJ6 A;  5THW A;  3W6S A;  1ARM A;  3IEH A;  3PB4 X;  3IFE A;  3PZJ A;  1XE4 A;  4Y49 B;  3HUV A;  4OKO A;  2NSM A;  1F2P A;  3GB0 A;  3LWU A;  4OC4 A;  1CBX A;  2HC9 A;  4XPK A;  1S60 A;  3K9T A;  6CPA A;  3SXO A;  2OOT A;  5AGE A;  2BSW A;  2RC4 A;  3GLJ A;  2J8N A;  1MJB A;  1M4G A;  5F09 A;  3FF3 A;  2VEZ A;  4NGN A;  4IAV A;  2P6G A;  1IGB A;  3JTK A;  4WWV A;  5HXD A;  2JLM A;  2FIA A;  3B2Y A;  2R7H A;  4LUA A;  4P4J A;  4B12 A;  3R9E A;  3ZZI A;  3DR8 A;  3R95 A;  4CRY B;  4JD6 A;  2X7B A;  2J9A A;  1Y0R A;  5JQ4 A;  4K30 A;  2AFU A;  3FYN A;  2B4D B;  3FIX A;  2G0B A;  4B5O A;  4MCR A;  4X3R A;  2OR4 A;  4UFV A;  5F48 A;  5LYD A;  4BBH A;  4C2X A;  5LYL A;  2PVV A;  3SJE A;  1S3Z A;  4OME A;  2G3A A;  4FWU A;  4KSI A;  4QUS A;  3LOD A;  3DR6 A;  1CJW A;  3DGV A;  4RS2 A;  2PJ1 A;  2I3C A;  2ZEH A;  1VHS A;  4KOS A;  4MY3 A;  4XPD B;  4J3G A;  1OZP A;  4KZT A;  1ZO0 A;  4H6Z A;  3IU2 A;  4B6Z A;  5F46 A;  5K8O A;  2PR8 A;  1P4N A;  2R8V A;  4KOX A;  3GUX A;  3LAC A;  4P4F A;  3T90 A;  4A38 A;  4PSW A;  4OC1 A;  4ZBG A;  1N71 A;  3C26 A;  2VZZ A;  4A33 A;  4BMH A;  4F0Y A;  2BCO A;  1JQG A;  4KOY A;  5ELY A;  2OB0 A;  5C82 A;  2PJ7 A;  1M44 A;  3FXT A;  5J8C A;  3DLJ A;  4XNH C;  3EFA A;  3R9F A;  4B13 A;  1YLO A;  2PVW A;  4UWJ A;  2ZEN A;  4F9V A;  4Q7A A;  4QB9 A;  4H2K A;  4CYN A;  4YFJ A;  4UCP A;  3WC6 A;  3BI0 A;  4RN7 A;  1YME A;  1Y7R A;  1Y9K A;  1R3N A;  5C88 A;  3NH4 A;  5K8N A;  4MRI A;  3B3C A;  2PJ4 A;  2WSA A;  4A2Z A;  4OC2 A;  1YLE A;  2NYQ A;  1KZF A;  4PK3 A;  4HNY B;  4AXV A;  2P6F A;  4BIN A;  3FED A;  4NGS A;  5LRK A;  1PCA A;  2PC1 A;  4KOU A;  3TT2 A;  5E96 A;  3PRT A;  4JYW A;  2B58 A;  4M6I A;  4OC0 A;  4AG9 A;  1F57 A;  4CRZ B;  2PJ2 A;  4TNU A;  2BO9 A;  3CPA A;  4B5P A;  4MHN A;  5DWN A;  1Z8W A;  4K3N A;  4CAW A;  4WJB A;  3KQX A;  5HMN A;  4CYO A;  3KHZ A;  4NF1 A;  1LRZ A;  4OAE A;  2Q0Y A;  2Y0M A;  3SJG A;  3TCV A;  3CXP A;  4UEE A;  3S9N A;  3IO1 A;  2C27 A;  3NH5 A;  3FVL A;  3KZW A;  4PXD A;  1CG2 A;  1I12 A;  2IJZ A;  2HUZ A;  2Z3O A;  3S6K A;  1S7L A;  4CGP A;  5H86 A;  1XBU A;  1Z4E A;  2GIV A;  3S9M A;  3D3S A;  3S9L A;  2C6P A;  1KUV A;  5HH1 A;  1TF9 A;  4FAI A;  1Q2Y A;  1S7K A;  2PJB A;  2REF A;  2VQY A;  2FCK A;  2ZEG A;  5F47 A;  4EME A;  1ELM P;  3T9Y A;  3KR4 A;  3RAM A;  5F49 A;  3CT9 A;  4IUS A;  1H8L A;  3S6G A;  5DWM A;  2PJA A;  1BLL E;  4MFK A;  4P10 A;  4X8I A;  4JLY A;  5G22 A;  2GAN A;  3QAH A;  4MFL A;  1YK3 A;  1YW4 A;  1TIQ A;  3MGD A;  4F0X A;  5KTC A;  2CNS A;  3GKR A;  1BO4 A;  5JPH A;  1QSO A;  5H84 A;  1XF8 A;  4GS4 A;  3SHP A;  1BAV A;  2J8R A;  5JGF A;  2AFO A;  1PUA A;  2ZEL A;  3WC7 A;  4E0A A;  1YQE A;  4Q38 A;  1GYT A;  4NEX A;  4IK2 A;  1MJ9 A;  4OID A;  4CGL A;  4KUA A;  2P6E A;  2QEC A;  1OBR A;  2XEI A;  3BI1 A;  3CXQ A;  3W91 A;  4CAE A;  1IY7 A;  5AG7 A;  4A37 A;  4R3L A;  5I4M A;  5JM6 A;  2JEW A;  3R1K A;  2ZEO A;  5FVJ A;  3SI0 A;  3F8K A;  4NSQ A;  4BD9 A;  1IB1 E;  2P0W A;  2B4D A;  2OZU A;  2HV2 A;  3LD2 A;  3NH8 A;  1S7F A;  4XPL A;  3D2M A;  2PIY A;  2DXQ A;  3KGQ A;  4XPD C;  4PQA A;  2IQ6 A;  5ISV A;  5GCN A;  3H8G A;  4ONU A;  2EVN A;  1FT7 A;  4P45 A;  3H4Q A;  1LAM A;  5EC4 A;  3KKW A;  1VIX A;  2FIW A;  2HB6 A;  4RI1 A;  5HVG A;  4X5K A;  3CDX A;  4NFR A;  2WPX A;  1YGH A;  2VBQ A;  4KOW A;  4CGN A;  2CNT A;  2VZY A;  4UIB A;  1XJO A;  4YRH A;  3ZJ0 A;  2XEG A;  2O53 A;  4IHM A;  1Q2D A;  4MFJ A;  2ZED A;  2FT0 A;  3CZX A;  2B5G B;  2CXA A;  3D68 A;  4C2Y A;  2Z3M A;  5A28 A;  3B35 A;  3B3S A;  4KSA A;  3LMS A;  4MFZ A;  2VXK A;  5HVH A;  2Q4V A;  2PIZ A;  1I21 A;  5D29 A;  4W9Y A;  2RB7 A;  3RNZ A;  1YW6 A;  1RO5 A;  3H8F A;  4UFW A;  3V38 A;  4CAF A;  3WR7 A;  3B3W A;  4CGO A;  5BWA B;  4NGQ A;  4EFD A;  2R98 A;  3BLN A;  4B10 A;  4H89 A;  2PRQ A;  2Q51 A;  3EO4 A;  1YX0 A;  3D7D A;  2BL1 A;  2ZEF A;  2EK8 A;  4U9Y A;  3EY5 A;  1BOB A;  4OIW A;  2ANP A;  2F7V A;  2Q4Y A;  4ZI6 A;  4OC5 A;  1PYT B;  2VI7 A;  4OAD A;  3A9L A;  2AJ6 A;  3I3G A;  4MHD A;  2ZEM A;  2ZW6 A;  1ELL P;  4YGO A;  2Z0Z A;  5G20 A;  1I1D A;  1DE4 C;  2BOA A;  4OLL A;  4PXE A;  1XIX A;  4E8O A;  1P0H A;  4P4E A;  4A94 A;  1M4D A;  1CPS A;  1Y9W A;  2BUE A;  4E2A A;  3TX8 A;  3PGP A;  4MFQ A;  3NA6 A;  2CIJ A;  5IB9 A;  3CPX A;  4UFX A;  1Q2C A;  3PB8 X;  2PRB A;  3QB8 A;  3QNV A;  2PJ9 A;  4MJ8 A;  1KUY A;  3HLP A;  1XEB A;  3B7I A;  4Q36 A;  4MCQ A;  3D4U A;  1DTD A;  2F8H A;  1FNO A;  4UEZ A;  3GIU A;  3IU1 A;  2CNM A;  1TKH A;  3EXN A;  2O28 A;  1QSN A;  4R3K A;  1LFW A;  3TO6 A;  3FNC A;  2ZW7 A;  1QSR A;  5KTD A;  1TKF A;  1HDQ A;  3JRU A;  1Z4R A;  2HQY A;  3N7Z A;  4UF4 A;  4EVY A;  4CGM A;  1ZLH A;  4G1P A;  4YU9 A;  2GFQ A;  4F9U A;  4P4B A;  4R8F A;  2F5I A;  3WC5 A;  2YNE A;  2Q4Z A;  3B8G A;  1VHE A;  2D4P A;  3FH4 A;  4A32 A;  1KUX A;  5G1Z A;  3VWE A;  2WUU A;  4MHY A;  1M4I A;  2R1I A;  4MBU A;  3VAT A;  4CS0 B;  4AVC A;  3H5Z A;  4FD6 A;  3BXM A;  4C7H A;  4KVM E;  1AUG A;  4ZYQ A;  3UY5 A;  3FB3 A;  2V8D A;  3K2K A;  3FX6 A;  4UCM A;  4LQ6 A;  4Y49 C;  5CPA A;  4NGR A;  1JWQ A;  2CY2 A;  2Q7S A;  4HPS A;  2QML A;  4PK2 A;  2PJ0 A;  4GXH A;  2REE A;  1HEE A;  5EBV A;  3VWD A;  2AE6 A;  5AG6 A;  4NJQ A;  2PQ8 A;  4HKF A;  4JXQ A;  3DNS A;  2I00 A;  5IB0 A;  5JH9 A;  4Z65 A;  3EC4 A;  4JZ0 A;  2DPS A;  4ZX9 A;  5IX3 A;  1U6M A;  3PB9 X;  2JBK A;  1V0C A;  1YVK A;  4HNW B;  2AFM A;  4H6U A;  4ONW A;  2PJ3 A;  1VGY A;  4ZY2 A;  3TO9 A;  4B5P B;  4JJX A;  4ZY0 A;  1XMB A;  4MY0 A;  2AFS A;  4P4D A;  3K9U A;  2IMO A;  4ZX8 A;  3GY9 A;  1LOK A;  1NMT A;  2ABZ A;  4KLV A;  1L0C A;  3MRU A;  2OU2 A;  1PU9 A;  4KOV A;  3B3T A;  4YWY A;  3KR5 A;  1A2Z A;  2V77 A;  3PB6 X;  4U9Z A;  3RYO A;  4UBR A;  4L8A A;  3IJ3 A;  1Z8T A;  3QAY A;  3V7Z A;  1UFH A;  3G3S A;  3SJF A;  1QQ9 A;  2FXF A;  2XEF A;  4NJR A;  3NFZ A;  4PXB A;  4B11 A;  1Y0Y A;  3D66 A;  3I1U A;  3KL9 A;  1RTQ A;  5I0C A;  2YGW A;  2Z3K A;  3B3V A;  1Z9U A;  1ZG9 A;  1B6B A;  1IID A;  2B5G A;  3RO0 A;  3TOA A;  3D2P A;  3FBU A;  2Z11 A;  3L2N A;  3TO7 A;  2BEI A;  2GE3 A;  4DJL A;  2POK A;  5D8N A;  5J1Q A;  4ZGY B;  2CTB A;  3OWC A;  4FBE A;  2IL4 A;  1K4J A;  2OZH A;  3RBU A;  3D67 A;  4AVB A;  3SI2 A;  4R7M A;  2ARH A;  5LYI A;  2Q04 A;  3V8I A;  2DEA A;  2JDC A;  4OC3 A;  5G21 A;  4L89 A;  4KSF A;  3D8P A;  4NGM A;  4R9M A;  4AVA A;  4QBJ A;  1Y7E A;  2G9D A;  1AYE A;  4KOT A;  3RZA A;  3SXN A;  5AG5 A;  1IU8 A;  3TOB A;  2FSR A;  1KWM A;  4KS9 A;  3TC8 A;  5A27 A;  3FEC A;  4MXU A;  3DSB A;  3P2F A;  1ZG7 A;  4C2Z A;  2G3T A;  5CNP A;  2RFH A;  3MN8 A;  4U5Y A;  1IOF A;  1CX8 A;  1ON0 A;  1XOV A;  1NE9 A;  2V8G A;  3BJ8 A;  4C68 A;  1IYL A;  4MHP A;  5AG4 A;  2YNC C;  3IWE A;  4JWP A;  4FD4 A;  3TE4 A;  1AMP A;  2QVP A;  2PSW A; 
#chains in the Genus database with same CATH homology
 3VAR A;  4A39 A;  3D7F A;  4DUK A;  2O4H A;  2GLF A;  3ISZ A;  3T8W A;  4NGP A;  4TWE A;  2GLJ A;  4NGT A;  4UIA A;  1Z5R A;  2PJ8 A;  5LYF A;  2EWB A;  3SJX A;  4DYO A;  1F2O A;  7CPA A;  1BPN A;  2PJC A;  3PB7 X;  4RUH A;  3PBE A;  4O23 A;  4MCP A;  3PBB A;  2V8V A;  2C1C A;  3WAB A;  1NSA A;  1CP6 A;  2ZEP A;  2EK9 A;  3D7H A;  1QMU A;  2CTC A;  5DS0 A;  3N5F A;  5HVF A;  2C6G A;  3KHX A;  4ZY1 A;  1LAP A;  2Q43 A;  1VHO A;  4P6Y A;  4LQG A;  1TKJ A;  2AFZ A;  1ARL A;  2QYV A;  2WZN A;  4P44 A;  4MCS A;  1XFO A;  2JBJ A;  2V8H A;  2FVG A;  2ZEE A;  5CBM A;  4EWT A;  4R76 A;  3KAS A;  1BPM A;  1CP7 A;  3PFE A;  3KQZ A;  4MHZ A;  3PEI A;  5K8M A;  3IC1 A;  4F8Z A;  4CPA A;  4PXC A;  1Z2L A;  1M4L A;  5K8P A;  1HDU A;  4OP4 A;  1UWY A;  2XEJ A;  3SI1 A;  4UEF A;  3IIB A;  3PFO A;  4GM5 A;  2WYR A;  1R43 A;  2PCU A;  2C6C A;  5LRJ A;  2GRE A;  1Z8L A;  4P4I A;  1TF8 A;  1LCP A;  3ISX A;  5LRG A;  2AFX A;  2CF4 A;  2GU2 A;  4R6T A;  1ZLI A;  1ZG8 A;  8CPA A;  2ZOF A;  3FJU A;  2AFW A;  3D7G A;  1CPX A;  3FEE A;  3VH9 A;  2VL1 A;  3H8E A;  2QJ8 A;  1Q7L A;  1EE3 P;  3WT4 A;  2PE3 A;  3FMC A;  1TXR A;  3KI9 A;  4X2T A;  4PPZ A;  4FUU A;  3BHX A;  2PJ5 A;  3IWW A;  1LAN A;  2ZOG A;  4MMO A;  1YSJ A;  1XRY A;  2PJ6 A;  5THW A;  1ARM A;  3IEH A;  3PB4 X;  3IFE A;  3HUV A;  4OKO A;  2NSM A;  1F2P A;  3GB0 A;  3LWU A;  4OC4 A;  1CBX A;  2HC9 A;  3K9T A;  6CPA A;  2OOT A;  3GLJ A;  5F09 A;  3FF3 A;  4NGN A;  4IAV A;  1IGB A;  4WWV A;  5HXD A;  3B2Y A;  4P4J A;  2J9A A;  1Y0R A;  2AFU A;  4MCR A;  4X3R A;  2OR4 A;  5LYD A;  5LYL A;  2PVV A;  3SJE A;  4OME A;  4FWU A;  4KSI A;  3DGV A;  2PJ1 A;  2I3C A;  2ZEH A;  4B6Z A;  5K8O A;  4P4F A;  3GUX A;  4A38 A;  4OC1 A;  2BCO A;  1JQG A;  5ELY A;  2PJ7 A;  3DLJ A;  1YLO A;  2PVW A;  2ZEN A;  4F9V A;  4Q7A A;  4H2K A;  3WC6 A;  3BI0 A;  1YME A;  5K8N A;  1R3N A;  3NH4 A;  4MRI A;  3B3C A;  2PJ4 A;  4OC2 A;  2NYQ A;  4AXV A;  3FED A;  4NGS A;  5LRK A;  1PCA A;  3PRT A;  4JYW A;  4OC0 A;  1F57 A;  2PJ2 A;  4TNU A;  2BO9 A;  3CPA A;  4MHN A;  4K3N A;  4WJB A;  3KQX A;  3KHZ A;  3SJG A;  4UEE A;  3S9N A;  3IO1 A;  3NH5 A;  3FVL A;  3KZW A;  4PXD A;  1CG2 A;  2IJZ A;  1XBU A;  3S9M A;  3S9L A;  2C6P A;  1TF9 A;  4FAI A;  2PJB A;  4EME A;  2ZEG A;  1ELM P;  3KR4 A;  3RAM A;  3CT9 A;  1H8L A;  2PJA A;  1BLL E;  4P10 A;  4X8I A;  1YW4 A;  1BAV A;  5JGF A;  2AFO A;  2ZEL A;  3WC7 A;  1GYT A;  4IK2 A;  4OID A;  1OBR A;  2XEI A;  3BI1 A;  1IY7 A;  4A37 A;  5I4M A;  5JM6 A;  2JEW A;  2ZEO A;  3SI0 A;  4BD9 A;  3NH8 A;  2PIY A;  3KGQ A;  4PQA A;  2IQ6 A;  3H8G A;  1FT7 A;  4P45 A;  1LAM A;  1VIX A;  2HB6 A;  5HVG A;  3CDX A;  4NFR A;  4UIB A;  1XJO A;  2XEG A;  2O53 A;  4IHM A;  2ZED A;  3D68 A;  3B35 A;  3B3S A;  5HVH A;  3LMS A;  2PIZ A;  5D29 A;  4W9Y A;  2RB7 A;  1YW6 A;  3H8F A;  3V38 A;  3B3W A;  4NGQ A;  4EFD A;  2PRQ A;  2Q51 A;  3D7D A;  2ZEF A;  2EK8 A;  4OIW A;  2ANP A;  2F7V A;  4ZI6 A;  4OC5 A;  1PYT B;  2ZEM A;  1ELL P;  1DE4 C;  2BOA A;  4PXE A;  4P4E A;  4A94 A;  1CPS A;  3TX8 A;  3NA6 A;  2CIJ A;  5IB9 A;  3CPX A;  3PB8 X;  3QNV A;  2PJ9 A;  3HLP A;  3B7I A;  4MCQ A;  3D4U A;  1DTD A;  2F8H A;  1FNO A;  4UEZ A;  1TKH A;  1LFW A;  1TKF A;  1HDQ A;  3JRU A;  4UF4 A;  1ZLH A;  4G1P A;  4YU9 A;  4F9U A;  4P4B A;  4R8F A;  3WC5 A;  2Q4Z A;  1VHE A;  3FH4 A;  4MHY A;  3VAT A;  3BXM A;  4ZYQ A;  2V8D A;  3K2K A;  3FX6 A;  5CPA A;  4NGR A;  2PJ0 A;  1HEE A;  4NJQ A;  5JH9 A;  4Z65 A;  4JZ0 A;  4ZX9 A;  3PB9 X;  2JBK A;  2AFM A;  4ONW A;  2PJ3 A;  1VGY A;  4ZY2 A;  4ZY0 A;  1XMB A;  2AFS A;  4P4D A;  4ZX8 A;  2IMO A;  1LOK A;  2ABZ A;  3MRU A;  4YWY A;  3B3T A;  3KR5 A;  2V77 A;  3PB6 X;  3IJ3 A;  3V7Z A;  3SJF A;  1QQ9 A;  2XEF A;  4NJR A;  3NFZ A;  4PXB A;  1Y0Y A;  3D66 A;  3I1U A;  3KL9 A;  1RTQ A;  3B3V A;  1ZG9 A;  3L2N A;  5J1Q A;  4DJL A;  2POK A;  5D8N A;  2CTB A;  4FBE A;  3RBU A;  3D67 A;  3SI2 A;  4R7M A;  5LYI A;  2DEA A;  4OC3 A;  4NGM A;  1Y7E A;  2G9D A;  1AYE A;  3RZA A;  1KWM A;  3TC8 A;  3FEC A;  4MXU A;  1ZG7 A;  2RFH A;  3MN8 A;  1CX8 A;  2V8G A;  4MHP A;  1AMP A;  2QVP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...