3B3WA

Crystal structure of the s228a mutant of the aminopeptidase from vibrio proteolyticus in complex with leucine
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
291
structure length
291
Chain Sequence
MPPITQQATVTAWLPQVDASQITGTISSLESFTNRFYTTTSGAQASDWIASEWQALSASLPNASVKQVSHSGYNQKSVVMTITGSEAPDEWIVIGGHLDSTIGSHTNEQSVAPGADDDASGIAAVTEVIRVLSENNFQPKRSIAFMAYAAEEVGLRGSQDLANQYKSEGKNVVSALQLDMTNYKGSAQDVVFITDYTDSNFTQYLTQLMDEYLPSLTYGFDTCGYACADHASWHNAGYPAAMPFESKFNDYNPRIHTTQDTLANSDPTGSHAKKFTQLGLAYAIEMGSATG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Bacterial leucyl aminopeptidase
publication title Zinc coordination geometry and ligand binding affinity: the structural and kinetic analysis of the second-shell serine 228 residue and the methionine 180 residue of the aminopeptidase from Vibrio proteolyticus.
pubmed doi rcsb
source organism Vibrio proteolyticus
molecule tags Hydrolase
total genus 109
structure length 291
sequence length 291
ec nomenclature ec 3.4.11.10: Bacterial leucyl aminopeptidase.
pdb deposition date 2007-10-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 3b3wA00
1R43A 1BAVA 2ABZA 3NA6A 2PIYA 2NSMA 4B6ZA 3BI1A 3PB4X 3SJFA 2G9DA 4UEZA 1Q7LA 3LMSA 4P4IA 5JH9A 1CP7A 2IJZA 3H8EA 3VATA 3D68A 1F2PA 3D66A 3BI0A 2HB6A 2O4HA 4PQAA 4UF4A 3WC6A 4ZY1A 4NGSA 4NFRA 1XBUA 5K8PA 3KHXA 3DGVA 3NH8A 1ZLHA 3KR4A 4OIWA 3JRUA 4MXUA 2CTCA 4CPAA 3RBUA 5LRKA 3PFOA 3PBBA 2C6CA 3VARA 2XEFA 2ZEEA 3KR5A 4DJLA 3TX8A 5LYFA 1PCAA 3GUXA 4AXVA 3PFEA 4IK2A 1BPNA 2I3CA 1Y7EA 3V38A 1YW4A 5K8MA 4P4JA 1TF8A 1TKHA 1F2OA 1JQGA 1Z2LA 1LCPA 2RFHA 1VHOA 3FEDA 4G1PA 3IC1A 4UIBA 1TXRA 4YWYA 3CT9A 3GB0A 3H8GA 4OC3A 2BOAA 4JYWA 3IEHA 2V8HA 5HVHA 1BPMA 2AFOA 1OBRA 4H2KA 3D4UA 3RZAA 3SJGA 5F09A 1R3NA 2GLJA 3QNVA 2Q43A 2PJ5A 2WZNA 2ZEGA 2PJ0A 3B3SA 3LWUA 2QVPA 3IWWA 5HVGA 3NFZA 5CBMA 2PJ2A 3MN8A 4R8FA 4R76A 1VGYA 1ZG8A 4A39A 2ZEMA 1ELMP 3TC8A 3MRUA 2F8HA 4NGNA 2PE3A 2PJ1A 5LYIA 3GLJA 3FH4A 2ANPA 2Q4ZA 4UIAA 3NH4A 2XEJA 3VH9A 2DEAA 4FWUA 2PJBA 1F57A 3K2KA 3B3TA 3D7HA 2ZEFA 4OC1A 2AFZA 4A37A 4X2TA 4NJQA 2PJ7A 4IAVA 3B35A 3D67A 4UEEA 1Z5RA 4P4BA 1ZLIA 4ZX9A 2ZEPA 3ISXA 2V8VA 4WJBA 1AYEA 2BCOA 1YLOA 1DE4C 1XFOA 4MHNA 2ZOFA 1BLLE 4DUKA 2XEGA 3I1UA 3BHXA 5I4MA 4MRIA 4P45A 3KI9A 4FUUA 4ONWA 1PYTB 4R6TA 2AFUA 1CPSA 2PJCA 3WT4A 2AFSA 2O53A 3IJ3A 4EFDA 1IGBA 3B7IA 1TF9A 2FVGA 4A94A 2CIJA 2PRQA 4MMOA 1DTDA 2HC9A 2XEIA 4NJRA 3NH5A 3N5FA 1VHEA 2PJ8A 2PCUA 3KASA 3SI0A 3KGQA 3IO1A 4F8ZA 2EWBA 4F9UA 1CP6A 4MHYA 1YW6A 3SI2A 4ZYQA 4DYOA 4OP4A 4KSIA 3IFEA 1YMEA 2AFWA 1LAMA 1EE3P 2QYVA 2C1CA 2GREA 2PVVA 3WC7A 1M4LA 2BO9A 1TKJA 1VIXA 2EK9A 4OC5A 1YSJA 4LQGA 3B3WA 1AMPA 1HEEA 5LRGA 4PXDA 4Q7AA 2V8GA 4PXBA 4ZY2A 1XJOA 4P4DA 3FECA 1LFWA 2ZENA 4MCRA 2JBJA 3SI1A 3CPXA 1QQ9A 6CPAA 4OMEA 2OOTA 3S9MA 1ELLP 3S9NA 5LYLA 4MCPA 3RAMA 7CPAA 4NGPA 4OKOA 1LANA 3FEEA 3WC5A 4NGTA 4P6YA 3SJXA 2PJAA 5CPAA 4EMEA 1Y0YA 4BD9A 1QMUA 1TKFA 1CG2A 3PEIA 5ELYA 3FVLA 3ISZA 3FMCA 1XRYA 2CTBA 5IB9A 3PRTA 4FBEA 2NYQA 3KHZA 1CPXA 2ZEDA 4NGQA 1FT7A 5K8NA 3PB9X 1KWMA 4K3NA 4ZI6A 2IMOA 2OR4A 2AFMA 4P4FA 5LRJA 3BXMA 1NSAA 2PIZA 2F7VA 2EK8A 2ZOGA 2GLFA 4TWEA 1HDUA 2C6GA 2RB7A 4MHPA 1Y0RA 2ZEHA 4A38A 1XMBA 1FNOA 4NGMA 1HDQA 4X8IA 3B3CA 3L2NA 5LYDA 2ZELA 4YU9A 4UEFA 1H8LA 2ZEOA 4JZ0A 4X3RA 3H8FA 5HVFA 2POKA 5THWA 1ZG9A 2PJ6A 4R7MA 4ZY0A 2C6PA 5DS0A 3SJEA 5HXDA 1ZG7A 3PB6X 2PJ4A 3CDXA 1IY7A 2PJ9A 5D29A 4MHZA 4P4EA 3T8WA 2JBKA 3PB8X 1UWYA 1ARLA 2WYRA 4EWTA 2J9AA 5J1QA 4MCQA 3WABA 3HLPA 3DLJA 1LOKA 4P10A 4PXEA 4OC0A 4PXCA 3D7DA 3CPAA 3D7FA 4OC2A 3V7ZA 4RUHA 2IQ6A 4O23A 3K9TA 3KZWA 3B3VA 4WWVA 5K8OA 4W9YA 2QJ8A 4ZX8A 4PPZA 2V8DA 4NGRA 1CBXA 2Q51A 4TNUA 2PJ3A 2PVWA 4OC4A 2AFXA 2VL1A 3KQZA 5JGFA 3PB7X 1LAPA 5D8NA 2V77A 3KQXA 4GM5A 3FX6A 2GU2A 3KL9A 3PBEA 1RTQA 1GYTA 1ARMA 4FAIA 1Z8LA 3FJUA 3B2YA 3S9LA 3HUVA 3FF3A 4MCSA 8CPAA 3D7GA 5JM6A 4Z65A 4OIDA 4P44A 1CX8A 2CF4A 2JEWA 4IHMA 4F9VA 3IIBA
chains in the Genus database with same CATH superfamily
2AE6A 4B12A 3EY5A 1M1DA 1R43A 1S7NA 3CXQA 1BAVA 2ABZA 2CNMA 2JDDA 3NA6A 4QVTA 2PIYA 3A9LA 1XOVA 2G3AA 2NSMA 4B6ZA 2FIAA 3BI1A 2FSRA 4B11A 1XIXA 3PB4X 4UFVA 3SJFA 2G9DA 2Q4VA 4UEZA 1Q7LA 3LMSA 2F5IA 4CAVA 5F48A 2ODFA 1N71A 4P4IA 5JH9A 2JEVA 1CP7A 2IJZA 5JQ4A 4FD4A 3TE4A 1I12A 3H8EA 3VATA 1IU8A 4HNYB 2REFA 1IYKA 3D68A 1WK4A 1F2PA 2PQ8A 5FVJA 3D66A 3BI0A 3JUWA 2HB6A 3V8IA 5IV0A 3QAYA 2O4HA 4EVYA 3B8GA 4PQAA 3H4QA 4R57A 4B5PA 4UF4A 2VBQA 3WC6A 4ZY1A 3SXOA 3PGPA 1XMTA 4NFRA 1XBUA 1Q2CA 4NGSA 2J8NA 5K8PA 1IOIA 1OZPA 2B58A 3N7ZA 3KHXA 4GXHA 3DGVA 2J8MA 3NH8A 1ZLHA 4R3KA 3KR4A 4OIWA 3JRUA 4U5YA 4MXUA 3TT2A 3W6SA 4OADA 2CTCA 1IB1E 2ZW7A 3RBUA 4CPAA 4PSWA 4XPDB 4AVAA 5LRKA 3PFOA 3DR8A 4BBHA 3PBBA 4IUSA 1LRZA 2X7BA 4A30A 2C6CA 3VARA 4KLVA 2XEFA 4YFJA 4ORFA 2ZEEA 3KR5A 4DJLA 3TX8A 5LYFA 1PCAA 3LACA 3GUXA 4AXVA 4IF5A 1X12A 3PFEA 4RI1A 1S5KA 5JPHA 1FY7A 4KOUA 4IK2A 1BPNA 2B3UA 1Y7EA 2I3CA 3V38A 2EUIA 1YW4A 4CAEA 1QSMA 3PP9A 4M6IA 5K8MA 4P4JA 1MJ9A 1TF8A 1S3ZA 4PSXA 1TKHA 4U9YA 1F2OA 1JQGA 1Q2YA 1Z2LA 1ZO0A 2Y0MA 4H89A 1LCPA 3T9YA 2RFHA 1VHOA 4GS4A 2FT0A 2B4BA 3FEDA 3GKRA 3IC1A 4G1PA 4UIBA 2P6GA 3ZZIA 1TXRA 4XPKA 2Z3PA 4JWPA 1Y7RA 2Z3OA 4PK3A 5E96A 3CT9A 3GB0A 4UCPA 3H8GA 4MY0A 4YWYA 5AG4A 4OC3A 2BOAA 4JYWA 3IEHA 5F47A 2V8HA 2Z3MA 5HVHA 1BPMA 2PR1A 2AFOA 1OBRA 2Q0YA 4CRZB 4H2KA 3D4UA 3RZAA 2RC4A 3W91A 3SJGA 5F09A 1R3NA 3BLNA 2GLJA 3QNVA 2ATRA 2Q43A 5G21A 3DDDA 2H5MA 2PJ5A 2WZNA 2ZEGA 3OWCA 4JJXA 5C82A 2PJ0A 3B3SA 3LWUA 3S6HA 2QVPA 4QBJA 3IWWA 3CXSA 5HVGA 2Q7SA 3NFZA 5CBMA 2PJ2A 3MN8A 4R8FA 2FXFA 4R76A 1Z8XA 4C2ZA 5AG6A 1VGYA 3D2PA 4NXYA 1Y9WA 1Z8WA 1ZG8A 1YX0A 1M44A 1YQEA 4A39A 1AUGA 1QSNA 5J8FA 1SQHA 2BL1A 2ZEMA 3FBUA 1ELMP 5I0CA 4JXQA 3TC8A 3MRUA 2F8HA 3CXPA 3MGDA 4NGNA 5CNPA 2PE3A 2PJ1A 5LYIA 1YVKA 3FH4A 3GLJA 2FE7A 2ANPA 2IL4A 2Q4ZA 2Q4YA 2QECA 4QUSA 1I21A 4UIAA 3NH4A 2WPXA 2XEJA 2DEAA 4L8AA 3VH9A 4CRYB 2Z3NA 4FD5A 4PK2A 1NE9A 4FWUA 2PJBA 1F57A 3K2KA 3B3TA 3D7HA 4UCNA 2ZEFA 4OC1A 2AFZA 3WR7A 4A37A 4X2TA 4C68A 4NJQA 2PJ7A 4IAVA 2ZW5A 3B35A 2FL4A 3D67A 1S7KA 4UEEA 5EMIA 3VWDA 3I9SA 1Z5RA 4P4BA 4C2YA 1ZLIA 2B3VA 3G3SA 4ZX9A 1QSRA 2ZEPA 5F46A 3ISXA 4E8OA 2V8VA 4WJBA 1AYEA 2BCOA 2CNSA 1YLOA 4NF1A 1DE4C 1XFOA 4MHNA 2ZOFA 4UFWA 5HH1A 5J8CA 1BLLE 4DUKA 4NSQA 1M4IA 2B4DA 4UBRA 3SHPA 1Z4EA 4UCMA 5G20A 2XEGA 3I1UA 4F6AA 3BHXA 3DR6A 1IYLA 5I4MA 4LQ6A 4MRIA 3IWGA 4P45A 1IIDA 2B5GB 2OU2A 4CGLA 4ONUA 4H6UA 2QMLA 3KI9A 4FUUA 4ONWA 1PYTB 1L0CA 3SXNA 4R6TA 2JLMA 4E0AA 2AFUA 4CAXA 1CPSA 2PJCA 1MJBA 4M3SA 3WT4A 2Q7BA 2QIRA 2Q44A 3F8KA 4M85A 5EBVA 2AFSA 2O53A 2R7HA 3IJ3A 4UA3A 4QB9A 1PUAA 4CGNA 4EFDA 1IGBA 2D4OA 3F0AA 3B7IA 3JVNA 5GCNA 3CZXA 4II9A 1YREA 1TF9A 2FVGA 1KUVA 4CS0B 4JD6A 3DNSA 2AJ6A 2R1IA 4MFKA 2ZXVA 4A94A 4BMHA 3FB3A 1WWZA 2CIJA 2PRQA 1CJWA 3LD2A 4MMOA 3H5ZA 1DTDA 2HC9A 2XEIA 4A2ZA 3GIUA 5C88A 3TOBA 3G8WA 2WUUA 4NJRA 3S6GA 2R98A 5DWNA 3TCVA 4CYOA 3NH5A 3N5FA 1VHEA 2PJ8A 4KVOE 2PCUA 1S7FA 3KASA 4H6ZA 3SI0A 4MBUA 3TO6A 4JXRA 5BWAB 1NMTA 3KGQA 3BJ7A 2J8RA 3IO1A 4F8ZA 2EWBA 1YVOA 2DF5A 3EO4A 3EXNA 4MJ8A 3D2MA 3F5BA 3TOAA 4C7IA 1Z9UA 3TFYA 4UFXA 4F9UA 5AGEA 1CP6A 2G0BA 2FS5A 4UWJA 2VEZA 2YNCC 4MHYA 4AG9A 4B10A 4CYPA 1YW6A 5AG7A 3SI2A 4ZYQA 1X10A 2PRBA 3FIXA 4XNHB 4DYOA 4OP4A 1TIQA 4KSIA 3IFEA 4A32A 4AG7A 1YMEA 2AFWA 4MFLA 3IWEA 1LAMA 2A4NA 1EE3P 4UWIA 4KORA 2QYVA 2C1CA 5H86A 2GREA 2PVVA 4M6GA 3WC7A 2ARHA 4Q36A 1M4LA 2BO9A 4XPDC 1TKJA 1VIXA 2ZW4A 2EK9A 3IGRA 2OZUA 4OC5A 4CYNA 5IX3A 1YSJA 3S6FA 4LQGA 2KCWA 2NMTA 2D4PA 2OH1A 3B3WA 2REEA 4AB7A 1AMPA 1HEEA 2Z10A 2EBJA 5LRGA 4CGMA 5KTAA 4PXDA 1MJAA 4YRHA 2VQYA 4Q7AA 2V8GA 5A27A 1M4GA 2GE3A 2VZYA 4PXBA 4KSAA 2HUZA 4ZY2A 1XJOA 2WSAA 1GHEA 4P4DA 3FECA 1LFWA 3LODA 2YNDA 2DXQA 2ZENA 3P2HA 4Y49B 4JLYA 4MCRA 4XNHC 4MFPA 4QC6A 2JBJA 3TTHA 3GYAA 2VXKA 3EFAA 3SI1A 3CPXA 3GY9A 3RO0A 4ZGYB 4OLLA 1QQ9A 1Z4RA 6CPAA 2Z11A 4OMEA 2GANA 4J3GA 4YGOA 3VWEA 4M6HA 3R9EA 2OOTA 4U9ZA 4NEXA 3S9MA 1ELLP 3S9NA 4LUAA 1MK4A 4HKFA 4OAEA 3UY5A 2HQYA 4MCPA 3RAMA 5LYLA 3EC4A 7CPAA 4NGPA 4OKOA 1LANA 2CY2A 3FEEA 3WC5A 1KUXA 4NGTA 4P6YA 3SJXA 1XEBA 2FCKA 2PJAA 4MHDA 5CPAA 4EMEA 1U6MA 1Y0YA 4HNWB 4KOYA 2GFQA 3TO9A 4B14A 4BD9A 1QMUA 1TKFA 1CG2A 3PEIA 3NE8A 5ELYA 1P0HA 3T90A 4A95A 5IB0A 3FVLA 3ISZA 1Z8TA 1CM0A 3FMCA 1XRYA 2YNCA 2CTBA 2Z0ZA 5EC4A 1KZFA 4KOWA 4KZTA 4MY3A 4Y49C 3TO7A 5IB9A 3PRTA 4FBEA 2I79A 1YR0A 4L89A 2NYQA 4MFZA 3R96A 3KHZA 4NCZA 1CPXA 1K4JA 2CXAA 1Q2DA 2ZEDA 4NGQA 4R9MA 4CYQA 4KSFA 3FXTA 1FT7A 4BINA 4B5PB 5K8NA 5H84A 2WPWA 1VHSA 3QAHA 1JWQA 1J4JA 3PB9X 4F0YA 1KWMA 3D8PA 4K3NA 4DNCA 4KVME 4ZI6A 5KTDA 2IMOA 2OZHA 2OR4A 4KOXA 2AFMA 4P4FA 5LRJA 3BXMA 1NSAA 2GIVA 2PIZA 2F7VA 2EK8A 2OB0A 4A31A 2ZOGA 2GLFA 2VI7A 3I3GA 2B4DB 1VKCA 4FD6A 4TWEA 1XE4A 2HV2A 4XPLA 5F49A 1HDUA 2C6GA 2Q04A 4X5KA 1I1DA 1YLEA 2RB7A 4MHPA 4MFJA 2O28A 1Y0RA 2ZEHA 1RO5A 4A38A 1XMBA 1FNOA 4NGMA 1HDQA 4X8IA 4R87A 1B87A 4HPSA 1S7LA 3B3CA 3L2NA 5LYDA 2ZELA 4YU9A 4B5OA 4UEFA 1H8LA 2ZEOA 4JZ0A 4KUBA 4X3RA 3H8FA 5HVFA 2POKA 5THWA 3RNZA 1ZG9A 2PJ6A 4R7MA 4ZY0A 2BUEA 1YK3A 2C6PA 2R8VA 3C26A 2DPTA 3QB8A 4MFQA 5DS0A 1BO4A 2EVNA 4I49A 3SJEA 1Y9KA 5HXDA 1ZG7A 3PB6X 2PJ4A 3CDXA 1IY7A 2PJ9A 1PU9A 4K30A 4MHZA 5D29A 4P4EA 3R9GA 3T8WA 4RS2A 1QSOA 4KVXA 2JBKA 3PB8X 4CGPA 4CAFA 2EO8A 2CNTA 5A28A 1QSTA 1UWYA 2JDCA 2OZGA 1ARLA 2WYRA 4EWTA 2J9AA 2ZPAA 4RN7A 2G3TA 5J1QA 2Z3LA 2C27A 4B13A 1R57A 4MCQA 4KOVA 4AVCA 4A33A 4E2AA 1M4DA 3WABA 2YGWA 3HLPA 3DLJA 1LOKA 3NE7A 3D3SA 2Z3KA 4OC0A 4P10A 4PXEA 3ZJ0A 4PXCA 5AG5A 1ON0A 2FIWA 3CPAA 3D7FA 3D7DA 4OC2A 5DWMA 2K5TA 3V7ZA 4RUHA 4C2XA 4CAWA 3DSBA 2IQ6A 4KS9A 4O23A 5KTCA 3K9TA 4HNXB 3KZWA 1UFHA 3B3VA 4KOTA 4WWVA 3JTKA 4C7HA 5K8OA 4W9YA 2QJ8A 3K9UA 4PPZA 4ZX8A 4AVBA 2V8DA 4NGRA 2I00A 1CBXA 2P6EA 2Q51A 4TNUA 2PJ3A 1IICA 2PVWA 4OC4A 4Q38A 4CGOA 2AFXA 2PDOA 2PSWA 3R9FA 2VL1A 3R1KA 3KQZA 3BJ8A 4ZBGA 4R3LA 5JGFA 3PB7X 3RYOA 1S60A 5HMNA 1LAPA 1P4NA 5D8NA 3S6KA 1NSLA 2P0WA 1B6BA 5ISVA 2V77A 4LX9A 2ZW6A 1RXTA 1A2ZA 3KQXA 4GM5A 3FX6A 2YNEA 2GU2A 3KL9A 3PBEA 1RTQA 3FYNA 4KUAA 4KOSA 1GYTA 2VZZA 2BSWA 1ARMA 3KKWA 5G1ZA 3W6XA 4FAIA 3FNCA 4PV6A 1Z8LA 3FJUA 4MI4A 3B2YA 3S9LA 1KUYA 3P2FA 3HUVA 4FD7A 2DPSA 2PR8A 2B5GA 1YGHA 2BEIA 2PC1A 3FF3A 2P6FA 3PZJA 4MCSA 1V0CA 8CPAA 3D7GA 1IOFA 4F0XA 5JM6A 4Z65A 3R95A 4KLWA 4OIDA 1BOBA 3IU1A 4P44A 3IU2A 5G22A 1CX8A 2CF4A 2JEWA 1XF8A 4IHMA 4F9VA 3E0KA 3IIBA 3FRMA
chains in the Genus database with same CATH topology
1R43A 1BAVA 2ABZA 3NA6A 2PIYA 2NSMA 4B6ZA 3BI1A 3PB4X 3SJFA 2G9DA 4UEZA 1Q7LA 3LMSA 4P4IA 5JH9A 1CP7A 2IJZA 3H8EA 3VATA 3D68A 1F2PA 3D66A 3BI0A 2HB6A 2O4HA 4PQAA 4UF4A 3WC6A 4ZY1A 4NGSA 4NFRA 1XBUA 5K8PA 3KHXA 3DGVA 3NH8A 1ZLHA 3KR4A 4OIWA 3JRUA 4MXUA 2CTCA 4CPAA 3RBUA 5LRKA 3PFOA 3PBBA 2C6CA 3VARA 2XEFA 2ZEEA 3KR5A 4DJLA 3TX8A 5LYFA 1PCAA 3GUXA 4AXVA 3PFEA 4IK2A 1BPNA 2I3CA 1Y7EA 3V38A 1YW4A 5K8MA 4P4JA 1TF8A 1TKHA 1F2OA 1JQGA 1Z2LA 1LCPA 2RFHA 1VHOA 3FEDA 4G1PA 3IC1A 4UIBA 1TXRA 4YWYA 3CT9A 3GB0A 3H8GA 4OC3A 2BOAA 4JYWA 3IEHA 2V8HA 5HVHA 1BPMA 2AFOA 1OBRA 4H2KA 3D4UA 3RZAA 3SJGA 5F09A 1R3NA 2GLJA 3QNVA 2Q43A 2PJ5A 2WZNA 2ZEGA 2PJ0A 3B3SA 3LWUA 2QVPA 3IWWA 5HVGA 3NFZA 5CBMA 2PJ2A 3MN8A 4R8FA 4R76A 1VGYA 1ZG8A 4A39A 2ZEMA 1ELMP 3TC8A 3MRUA 2F8HA 4NGNA 2PE3A 2PJ1A 5LYIA 3GLJA 3FH4A 2ANPA 2Q4ZA 4UIAA 3NH4A 2XEJA 3VH9A 2DEAA 4FWUA 2PJBA 1F57A 3K2KA 3B3TA 3D7HA 2ZEFA 4OC1A 2AFZA 4A37A 4X2TA 4NJQA 2PJ7A 4IAVA 3B35A 3D67A 4UEEA 1Z5RA 4P4BA 1ZLIA 4ZX9A 2ZEPA 3ISXA 2V8VA 4WJBA 1AYEA 2BCOA 1YLOA 1DE4C 1XFOA 4MHNA 2ZOFA 1BLLE 4DUKA 2XEGA 3I1UA 3BHXA 5I4MA 4MRIA 4P45A 3KI9A 4FUUA 4ONWA 1PYTB 4R6TA 2AFUA 1CPSA 2PJCA 3WT4A 2AFSA 2O53A 3IJ3A 4EFDA 1IGBA 3B7IA 1TF9A 2FVGA 4A94A 2CIJA 2PRQA 4MMOA 1DTDA 2HC9A 2XEIA 4NJRA 3NH5A 3N5FA 1VHEA 2PJ8A 2PCUA 3KASA 3SI0A 3KGQA 3IO1A 4F8ZA 2EWBA 4F9UA 1CP6A 4MHYA 1YW6A 3SI2A 4ZYQA 4DYOA 4OP4A 4KSIA 3IFEA 1YMEA 2AFWA 1LAMA 1EE3P 2QYVA 2C1CA 2GREA 2PVVA 3WC7A 1M4LA 2BO9A 1TKJA 1VIXA 2EK9A 4OC5A 1YSJA 4LQGA 3B3WA 1AMPA 1HEEA 5LRGA 4PXDA 4Q7AA 2V8GA 4PXBA 4ZY2A 1XJOA 4P4DA 3FECA 1LFWA 2ZENA 4MCRA 2JBJA 3SI1A 3CPXA 1QQ9A 6CPAA 4OMEA 2OOTA 3S9MA 1ELLP 3S9NA 5LYLA 4MCPA 3RAMA 7CPAA 4NGPA 4OKOA 1LANA 3FEEA 3WC5A 4NGTA 4P6YA 3SJXA 2PJAA 5CPAA 4EMEA 1Y0YA 4BD9A 1QMUA 1TKFA 1CG2A 3PEIA 5ELYA 3FVLA 3ISZA 3FMCA 1XRYA 2CTBA 5IB9A 3PRTA 4FBEA 2NYQA 3KHZA 1CPXA 2ZEDA 4NGQA 1FT7A 5K8NA 3PB9X 1KWMA 4K3NA 4ZI6A 2IMOA 2OR4A 2AFMA 4P4FA 5LRJA 3BXMA 1NSAA 2PIZA 2F7VA 2EK8A 2ZOGA 2GLFA 4TWEA 1HDUA 2C6GA 2RB7A 4MHPA 1Y0RA 2ZEHA 4A38A 1XMBA 1FNOA 4NGMA 1HDQA 4X8IA 3B3CA 3L2NA 5LYDA 2ZELA 4YU9A 4UEFA 1H8LA 2ZEOA 4JZ0A 4X3RA 3H8FA 5HVFA 2POKA 5THWA 1ZG9A 2PJ6A 4R7MA 4ZY0A 2C6PA 5DS0A 3SJEA 5HXDA 1ZG7A 3PB6X 2PJ4A 3CDXA 1IY7A 2PJ9A 5D29A 4MHZA 4P4EA 3T8WA 2JBKA 3PB8X 1UWYA 1ARLA 2WYRA 4EWTA 2J9AA 5J1QA 4MCQA 3WABA 3HLPA 3DLJA 1LOKA 4P10A 4PXEA 4OC0A 4PXCA 3D7DA 3CPAA 3D7FA 4OC2A 3V7ZA 4RUHA 2IQ6A 4O23A 3K9TA 3KZWA 3B3VA 4WWVA 5K8OA 4W9YA 2QJ8A 4ZX8A 4PPZA 2V8DA 4NGRA 1CBXA 2Q51A 4TNUA 2PJ3A 2PVWA 4OC4A 2AFXA 2VL1A 3KQZA 5JGFA 3PB7X 1LAPA 5D8NA 2V77A 3KQXA 4GM5A 3FX6A 2GU2A 3KL9A 3PBEA 1RTQA 1GYTA 1ARMA 4FAIA 1Z8LA 3FJUA 3B2YA 3S9LA 3HUVA 3FF3A 4MCSA 8CPAA 3D7GA 5JM6A 4Z65A 4OIDA 4P44A 1CX8A 2CF4A 2JEWA 4IHMA 4F9VA 3IIBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1R43 A;  1BAV A;  2ABZ A;  3NA6 A;  2PIY A;  2NSM A;  4B6Z A;  3BI1 A;  3PB4 X;  3SJF A;  2G9D A;  4UEZ A;  1Q7L A;  3LMS A;  4P4I A;  5JH9 A;  1CP7 A;  2IJZ A;  3H8E A;  3VAT A;  3D68 A;  1F2P A;  3D66 A;  3BI0 A;  2HB6 A;  2O4H A;  4PQA A;  4UF4 A;  3WC6 A;  4ZY1 A;  4NGS A;  4NFR A;  1XBU A;  5K8P A;  3KHX A;  3DGV A;  3NH8 A;  1ZLH A;  3KR4 A;  4OIW A;  3JRU A;  4MXU A;  2CTC A;  4CPA A;  3RBU A;  5LRK A;  3PFO A;  3PBB A;  2C6C A;  3VAR A;  2XEF A;  2ZEE A;  3KR5 A;  4DJL A;  3TX8 A;  5LYF A;  1PCA A;  3GUX A;  4AXV A;  3PFE A;  4IK2 A;  1BPN A;  2I3C A;  1Y7E A;  3V38 A;  1YW4 A;  5K8M A;  4P4J A;  1TF8 A;  1TKH A;  1F2O A;  1JQG A;  1Z2L A;  1LCP A;  2RFH A;  1VHO A;  3FED A;  4G1P A;  3IC1 A;  4UIB A;  1TXR A;  4YWY A;  3CT9 A;  3GB0 A;  3H8G A;  4OC3 A;  2BOA A;  4JYW A;  3IEH A;  2V8H A;  5HVH A;  1BPM A;  2AFO A;  1OBR A;  4H2K A;  3D4U A;  3RZA A;  3SJG A;  5F09 A;  1R3N A;  2GLJ A;  3QNV A;  2Q43 A;  2PJ5 A;  2WZN A;  2ZEG A;  2PJ0 A;  3B3S A;  3LWU A;  2QVP A;  3IWW A;  5HVG A;  3NFZ A;  5CBM A;  2PJ2 A;  3MN8 A;  4R8F A;  4R76 A;  1VGY A;  1ZG8 A;  4A39 A;  2ZEM A;  1ELM P;  3TC8 A;  3MRU A;  2F8H A;  4NGN A;  2PE3 A;  2PJ1 A;  5LYI A;  3GLJ A;  3FH4 A;  2ANP A;  2Q4Z A;  4UIA A;  3NH4 A;  2XEJ A;  3VH9 A;  2DEA A;  4FWU A;  2PJB A;  1F57 A;  3K2K A;  3B3T A;  3D7H A;  2ZEF A;  4OC1 A;  2AFZ A;  4A37 A;  4X2T A;  4NJQ A;  2PJ7 A;  4IAV A;  3B35 A;  3D67 A;  4UEE A;  1Z5R A;  4P4B A;  1ZLI A;  4ZX9 A;  2ZEP A;  3ISX A;  2V8V A;  4WJB A;  1AYE A;  2BCO A;  1YLO A;  1DE4 C;  1XFO A;  4MHN A;  2ZOF A;  1BLL E;  4DUK A;  2XEG A;  3I1U A;  3BHX A;  5I4M A;  4MRI A;  4P45 A;  3KI9 A;  4FUU A;  4ONW A;  1PYT B;  4R6T A;  2AFU A;  1CPS A;  2PJC A;  3WT4 A;  2AFS A;  2O53 A;  3IJ3 A;  4EFD A;  1IGB A;  3B7I A;  1TF9 A;  2FVG A;  4A94 A;  2CIJ A;  2PRQ A;  4MMO A;  1DTD A;  2HC9 A;  2XEI A;  4NJR A;  3NH5 A;  3N5F A;  1VHE A;  2PJ8 A;  2PCU A;  3KAS A;  3SI0 A;  3KGQ A;  3IO1 A;  4F8Z A;  2EWB A;  4F9U A;  1CP6 A;  4MHY A;  1YW6 A;  3SI2 A;  4ZYQ A;  4DYO A;  4OP4 A;  4KSI A;  3IFE A;  1YME A;  2AFW A;  1LAM A;  1EE3 P;  2QYV A;  2C1C A;  2GRE A;  2PVV A;  3WC7 A;  1M4L A;  2BO9 A;  1TKJ A;  1VIX A;  2EK9 A;  4OC5 A;  1YSJ A;  4LQG A;  3B3W A;  1AMP A;  1HEE A;  5LRG A;  4PXD A;  4Q7A A;  2V8G A;  4PXB A;  4ZY2 A;  1XJO A;  4P4D A;  3FEC A;  1LFW A;  2ZEN A;  4MCR A;  2JBJ A;  3SI1 A;  3CPX A;  1QQ9 A;  6CPA A;  4OME A;  2OOT A;  3S9M A;  1ELL P;  3S9N A;  5LYL A;  4MCP A;  3RAM A;  7CPA A;  4NGP A;  4OKO A;  1LAN A;  3FEE A;  3WC5 A;  4NGT A;  4P6Y A;  3SJX A;  2PJA A;  5CPA A;  4EME A;  1Y0Y A;  4BD9 A;  1QMU A;  1TKF A;  1CG2 A;  3PEI A;  5ELY A;  3FVL A;  3ISZ A;  3FMC A;  1XRY A;  2CTB A;  5IB9 A;  3PRT A;  4FBE A;  2NYQ A;  3KHZ A;  1CPX A;  2ZED A;  4NGQ A;  1FT7 A;  5K8N A;  3PB9 X;  1KWM A;  4K3N A;  4ZI6 A;  2IMO A;  2OR4 A;  2AFM A;  4P4F A;  5LRJ A;  3BXM A;  1NSA A;  2PIZ A;  2F7V A;  2EK8 A;  2ZOG A;  2GLF A;  4TWE A;  1HDU A;  2C6G A;  2RB7 A;  4MHP A;  1Y0R A;  2ZEH A;  4A38 A;  1XMB A;  1FNO A;  4NGM A;  1HDQ A;  4X8I A;  3B3C A;  3L2N A;  5LYD A;  2ZEL A;  4YU9 A;  4UEF A;  1H8L A;  2ZEO A;  4JZ0 A;  4X3R A;  3H8F A;  5HVF A;  2POK A;  5THW A;  1ZG9 A;  2PJ6 A;  4R7M A;  4ZY0 A;  2C6P A;  5DS0 A;  3SJE A;  5HXD A;  1ZG7 A;  3PB6 X;  2PJ4 A;  3CDX A;  1IY7 A;  2PJ9 A;  5D29 A;  4MHZ A;  4P4E A;  3T8W A;  2JBK A;  3PB8 X;  1UWY A;  1ARL A;  2WYR A;  4EWT A;  2J9A A;  5J1Q A;  4MCQ A;  3WAB A;  3HLP A;  3DLJ A;  1LOK A;  4P10 A;  4PXE A;  4OC0 A;  4PXC A;  3D7D A;  3CPA A;  3D7F A;  4OC2 A;  3V7Z A;  4RUH A;  2IQ6 A;  4O23 A;  3K9T A;  3KZW A;  3B3V A;  4WWV A;  5K8O A;  4W9Y A;  2QJ8 A;  4ZX8 A;  4PPZ A;  2V8D A;  4NGR A;  1CBX A;  2Q51 A;  4TNU A;  2PJ3 A;  2PVW A;  4OC4 A;  2AFX A;  2VL1 A;  3KQZ A;  5JGF A;  3PB7 X;  1LAP A;  5D8N A;  2V77 A;  3KQX A;  4GM5 A;  3FX6 A;  2GU2 A;  3KL9 A;  3PBE A;  1RTQ A;  1GYT A;  1ARM A;  4FAI A;  1Z8L A;  3FJU A;  3B2Y A;  3S9L A;  3HUV A;  3FF3 A;  4MCS A;  8CPA A;  3D7G A;  5JM6 A;  4Z65 A;  4OID A;  4P44 A;  1CX8 A;  2CF4 A;  2JEW A;  4IHM A;  4F9V A;  3IIB A; 
#chains in the Genus database with same CATH topology
 2AE6 A;  4B12 A;  3EY5 A;  1M1D A;  1R43 A;  1S7N A;  3CXQ A;  1BAV A;  2ABZ A;  2CNM A;  2JDD A;  3NA6 A;  4QVT A;  2PIY A;  3A9L A;  1XOV A;  2G3A A;  2NSM A;  4B6Z A;  2FIA A;  3BI1 A;  2FSR A;  4B11 A;  1XIX A;  3PB4 X;  4UFV A;  3SJF A;  2G9D A;  2Q4V A;  4UEZ A;  1Q7L A;  3LMS A;  2F5I A;  4CAV A;  5F48 A;  2ODF A;  1N71 A;  4P4I A;  5JH9 A;  2JEV A;  1CP7 A;  2IJZ A;  5JQ4 A;  4FD4 A;  3TE4 A;  1I12 A;  3H8E A;  3VAT A;  1IU8 A;  4HNY B;  2REF A;  1IYK A;  3D68 A;  1WK4 A;  1F2P A;  2PQ8 A;  5FVJ A;  3D66 A;  3BI0 A;  3JUW A;  2HB6 A;  3V8I A;  5IV0 A;  3QAY A;  2O4H A;  4EVY A;  3B8G A;  4PQA A;  3H4Q A;  4R57 A;  4B5P A;  4UF4 A;  2VBQ A;  3WC6 A;  4ZY1 A;  3SXO A;  3PGP A;  1XMT A;  4NFR A;  1XBU A;  1Q2C A;  4NGS A;  2J8N A;  5K8P A;  1IOI A;  1OZP A;  2B58 A;  3N7Z A;  3KHX A;  4GXH A;  3DGV A;  2J8M A;  3NH8 A;  1ZLH A;  4R3K A;  3KR4 A;  4OIW A;  3JRU A;  4U5Y A;  4MXU A;  3TT2 A;  3W6S A;  4OAD A;  2CTC A;  1IB1 E;  2ZW7 A;  3RBU A;  4CPA A;  4PSW A;  4XPD B;  4AVA A;  5LRK A;  3PFO A;  3DR8 A;  4BBH A;  3PBB A;  4IUS A;  1LRZ A;  2X7B A;  4A30 A;  2C6C A;  3VAR A;  4KLV A;  2XEF A;  4YFJ A;  4ORF A;  2ZEE A;  3KR5 A;  4DJL A;  3TX8 A;  5LYF A;  1PCA A;  3LAC A;  3GUX A;  4AXV A;  4IF5 A;  1X12 A;  3PFE A;  4RI1 A;  1S5K A;  5JPH A;  1FY7 A;  4KOU A;  4IK2 A;  1BPN A;  2B3U A;  1Y7E A;  2I3C A;  3V38 A;  2EUI A;  1YW4 A;  4CAE A;  1QSM A;  3PP9 A;  4M6I A;  5K8M A;  4P4J A;  1MJ9 A;  1TF8 A;  1S3Z A;  4PSX A;  1TKH A;  4U9Y A;  1F2O A;  1JQG A;  1Q2Y A;  1Z2L A;  1ZO0 A;  2Y0M A;  4H89 A;  1LCP A;  3T9Y A;  2RFH A;  1VHO A;  4GS4 A;  2FT0 A;  2B4B A;  3FED A;  3GKR A;  3IC1 A;  4G1P A;  4UIB A;  2P6G A;  3ZZI A;  1TXR A;  4XPK A;  2Z3P A;  4JWP A;  1Y7R A;  2Z3O A;  4PK3 A;  5E96 A;  3CT9 A;  3GB0 A;  4UCP A;  3H8G A;  4MY0 A;  4YWY A;  5AG4 A;  4OC3 A;  2BOA A;  4JYW A;  3IEH A;  5F47 A;  2V8H A;  2Z3M A;  5HVH A;  1BPM A;  2PR1 A;  2AFO A;  1OBR A;  2Q0Y A;  4CRZ B;  4H2K A;  3D4U A;  3RZA A;  2RC4 A;  3W91 A;  3SJG A;  5F09 A;  1R3N A;  3BLN A;  2GLJ A;  3QNV A;  2ATR A;  2Q43 A;  5G21 A;  3DDD A;  2H5M A;  2PJ5 A;  2WZN A;  2ZEG A;  3OWC A;  4JJX A;  5C82 A;  2PJ0 A;  3B3S A;  3LWU A;  3S6H A;  2QVP A;  4QBJ A;  3IWW A;  3CXS A;  5HVG A;  2Q7S A;  3NFZ A;  5CBM A;  2PJ2 A;  3MN8 A;  4R8F A;  2FXF A;  4R76 A;  1Z8X A;  4C2Z A;  5AG6 A;  1VGY A;  3D2P A;  4NXY A;  1Y9W A;  1Z8W A;  1ZG8 A;  1YX0 A;  1M44 A;  1YQE A;  4A39 A;  1AUG A;  1QSN A;  5J8F A;  1SQH A;  2BL1 A;  2ZEM A;  3FBU A;  1ELM P;  5I0C A;  4JXQ A;  3TC8 A;  3MRU A;  2F8H A;  3CXP A;  3MGD A;  4NGN A;  5CNP A;  2PE3 A;  2PJ1 A;  5LYI A;  1YVK A;  3FH4 A;  3GLJ A;  2FE7 A;  2ANP A;  2IL4 A;  2Q4Z A;  2Q4Y A;  2QEC A;  4QUS A;  1I21 A;  4UIA A;  3NH4 A;  2WPX A;  2XEJ A;  2DEA A;  4L8A A;  3VH9 A;  4CRY B;  2Z3N A;  4FD5 A;  4PK2 A;  1NE9 A;  4FWU A;  2PJB A;  1F57 A;  3K2K A;  3B3T A;  3D7H A;  4UCN A;  2ZEF A;  4OC1 A;  2AFZ A;  3WR7 A;  4A37 A;  4X2T A;  4C68 A;  4NJQ A;  2PJ7 A;  4IAV A;  2ZW5 A;  3B35 A;  2FL4 A;  3D67 A;  1S7K A;  4UEE A;  5EMI A;  3VWD A;  3I9S A;  1Z5R A;  4P4B A;  4C2Y A;  1ZLI A;  2B3V A;  3G3S A;  4ZX9 A;  1QSR A;  2ZEP A;  5F46 A;  3ISX A;  4E8O A;  2V8V A;  4WJB A;  1AYE A;  2BCO A;  2CNS A;  1YLO A;  4NF1 A;  1DE4 C;  1XFO A;  4MHN A;  2ZOF A;  4UFW A;  5HH1 A;  5J8C A;  1BLL E;  4DUK A;  4NSQ A;  1M4I A;  2B4D A;  4UBR A;  3SHP A;  1Z4E A;  4UCM A;  5G20 A;  2XEG A;  3I1U A;  4F6A A;  3BHX A;  3DR6 A;  1IYL A;  5I4M A;  4LQ6 A;  4MRI A;  3IWG A;  4P45 A;  1IID A;  2B5G B;  2OU2 A;  4CGL A;  4ONU A;  4H6U A;  2QML A;  3KI9 A;  4FUU A;  4ONW A;  1PYT B;  1L0C A;  3SXN A;  4R6T A;  2JLM A;  4E0A A;  2AFU A;  4CAX A;  1CPS A;  2PJC A;  1MJB A;  4M3S A;  3WT4 A;  2Q7B A;  2QIR A;  2Q44 A;  3F8K A;  4M85 A;  5EBV A;  2AFS A;  2O53 A;  2R7H A;  3IJ3 A;  4UA3 A;  4QB9 A;  1PUA A;  4CGN A;  4EFD A;  1IGB A;  2D4O A;  3F0A A;  3B7I A;  3JVN A;  5GCN A;  3CZX A;  4II9 A;  1YRE A;  1TF9 A;  2FVG A;  1KUV A;  4CS0 B;  4JD6 A;  3DNS A;  2AJ6 A;  2R1I A;  4MFK A;  2ZXV A;  4A94 A;  4BMH A;  3FB3 A;  1WWZ A;  2CIJ A;  2PRQ A;  1CJW A;  3LD2 A;  4MMO A;  3H5Z A;  1DTD A;  2HC9 A;  2XEI A;  4A2Z A;  3GIU A;  5C88 A;  3TOB A;  3G8W A;  2WUU A;  4NJR A;  3S6G A;  2R98 A;  5DWN A;  3TCV A;  4CYO A;  3NH5 A;  3N5F A;  1VHE A;  2PJ8 A;  4KVO E;  2PCU A;  1S7F A;  3KAS A;  4H6Z A;  3SI0 A;  4MBU A;  3TO6 A;  4JXR A;  5BWA B;  1NMT A;  3KGQ A;  3BJ7 A;  2J8R A;  3IO1 A;  4F8Z A;  2EWB A;  1YVO A;  2DF5 A;  3EO4 A;  3EXN A;  4MJ8 A;  3D2M A;  3F5B A;  3TOA A;  4C7I A;  1Z9U A;  3TFY A;  4UFX A;  4F9U A;  5AGE A;  1CP6 A;  2G0B A;  2FS5 A;  4UWJ A;  2VEZ A;  2YNC C;  4MHY A;  4AG9 A;  4B10 A;  4CYP A;  1YW6 A;  5AG7 A;  3SI2 A;  4ZYQ A;  1X10 A;  2PRB A;  3FIX A;  4XNH B;  4DYO A;  4OP4 A;  1TIQ A;  4KSI A;  3IFE A;  4A32 A;  4AG7 A;  1YME A;  2AFW A;  4MFL A;  3IWE A;  1LAM A;  2A4N A;  1EE3 P;  4UWI A;  4KOR A;  2QYV A;  2C1C A;  5H86 A;  2GRE A;  2PVV A;  4M6G A;  3WC7 A;  2ARH A;  4Q36 A;  1M4L A;  2BO9 A;  4XPD C;  1TKJ A;  1VIX A;  2ZW4 A;  2EK9 A;  3IGR A;  2OZU A;  4OC5 A;  4CYN A;  5IX3 A;  1YSJ A;  3S6F A;  4LQG A;  2KCW A;  2NMT A;  2D4P A;  2OH1 A;  3B3W A;  2REE A;  4AB7 A;  1AMP A;  1HEE A;  2Z10 A;  2EBJ A;  5LRG A;  4CGM A;  5KTA A;  4PXD A;  1MJA A;  4YRH A;  2VQY A;  4Q7A A;  2V8G A;  5A27 A;  1M4G A;  2GE3 A;  2VZY A;  4PXB A;  4KSA A;  2HUZ A;  4ZY2 A;  1XJO A;  2WSA A;  1GHE A;  4P4D A;  3FEC A;  1LFW A;  3LOD A;  2YND A;  2DXQ A;  2ZEN A;  3P2H A;  4Y49 B;  4JLY A;  4MCR A;  4XNH C;  4MFP A;  4QC6 A;  2JBJ A;  3TTH A;  3GYA A;  2VXK A;  3EFA A;  3SI1 A;  3CPX A;  3GY9 A;  3RO0 A;  4ZGY B;  4OLL A;  1QQ9 A;  1Z4R A;  6CPA A;  2Z11 A;  4OME A;  2GAN A;  4J3G A;  4YGO A;  3VWE A;  4M6H A;  3R9E A;  2OOT A;  4U9Z A;  4NEX A;  3S9M A;  1ELL P;  3S9N A;  4LUA A;  1MK4 A;  4HKF A;  4OAE A;  3UY5 A;  2HQY A;  4MCP A;  3RAM A;  5LYL A;  3EC4 A;  7CPA A;  4NGP A;  4OKO A;  1LAN A;  2CY2 A;  3FEE A;  3WC5 A;  1KUX A;  4NGT A;  4P6Y A;  3SJX A;  1XEB A;  2FCK A;  2PJA A;  4MHD A;  5CPA A;  4EME A;  1U6M A;  1Y0Y A;  4HNW B;  4KOY A;  2GFQ A;  3TO9 A;  4B14 A;  4BD9 A;  1QMU A;  1TKF A;  1CG2 A;  3PEI A;  3NE8 A;  5ELY A;  1P0H A;  3T90 A;  4A95 A;  5IB0 A;  3FVL A;  3ISZ A;  1Z8T A;  1CM0 A;  3FMC A;  1XRY A;  2YNC A;  2CTB A;  2Z0Z A;  5EC4 A;  1KZF A;  4KOW A;  4KZT A;  4MY3 A;  4Y49 C;  3TO7 A;  5IB9 A;  3PRT A;  4FBE A;  2I79 A;  1YR0 A;  4L89 A;  2NYQ A;  4MFZ A;  3R96 A;  3KHZ A;  4NCZ A;  1CPX A;  1K4J A;  2CXA A;  1Q2D A;  2ZED A;  4NGQ A;  4R9M A;  4CYQ A;  4KSF A;  3FXT A;  1FT7 A;  4BIN A;  4B5P B;  5K8N A;  5H84 A;  2WPW A;  1VHS A;  3QAH A;  1JWQ A;  1J4J A;  3PB9 X;  4F0Y A;  1KWM A;  3D8P A;  4K3N A;  4DNC A;  4KVM E;  4ZI6 A;  5KTD A;  2IMO A;  2OZH A;  2OR4 A;  4KOX A;  2AFM A;  4P4F A;  5LRJ A;  3BXM A;  1NSA A;  2GIV A;  2PIZ A;  2F7V A;  2EK8 A;  2OB0 A;  4A31 A;  2ZOG A;  2GLF A;  2VI7 A;  3I3G A;  2B4D B;  1VKC A;  4FD6 A;  4TWE A;  1XE4 A;  2HV2 A;  4XPL A;  5F49 A;  1HDU A;  2C6G A;  2Q04 A;  4X5K A;  1I1D A;  1YLE A;  2RB7 A;  4MHP A;  4MFJ A;  2O28 A;  1Y0R A;  2ZEH A;  1RO5 A;  4A38 A;  1XMB A;  1FNO A;  4NGM A;  1HDQ A;  4X8I A;  4R87 A;  1B87 A;  4HPS A;  1S7L A;  3B3C A;  3L2N A;  5LYD A;  2ZEL A;  4YU9 A;  4B5O A;  4UEF A;  1H8L A;  2ZEO A;  4JZ0 A;  4KUB A;  4X3R A;  3H8F A;  5HVF A;  2POK A;  5THW A;  3RNZ A;  1ZG9 A;  2PJ6 A;  4R7M A;  4ZY0 A;  2BUE A;  1YK3 A;  2C6P A;  2R8V A;  3C26 A;  2DPT A;  3QB8 A;  4MFQ A;  5DS0 A;  1BO4 A;  2EVN A;  4I49 A;  3SJE A;  1Y9K A;  5HXD A;  1ZG7 A;  3PB6 X;  2PJ4 A;  3CDX A;  1IY7 A;  2PJ9 A;  1PU9 A;  4K30 A;  4MHZ A;  5D29 A;  4P4E A;  3R9G A;  3T8W A;  4RS2 A;  1QSO A;  4KVX A;  2JBK A;  3PB8 X;  4CGP A;  4CAF A;  2EO8 A;  2CNT A;  5A28 A;  1QST A;  1UWY A;  2JDC A;  2OZG A;  1ARL A;  2WYR A;  4EWT A;  2J9A A;  2ZPA A;  4RN7 A;  2G3T A;  5J1Q A;  2Z3L A;  2C27 A;  4B13 A;  1R57 A;  4MCQ A;  4KOV A;  4AVC A;  4A33 A;  4E2A A;  1M4D A;  3WAB A;  2YGW A;  3HLP A;  3DLJ A;  1LOK A;  3NE7 A;  3D3S A;  2Z3K A;  4OC0 A;  4P10 A;  4PXE A;  3ZJ0 A;  4PXC A;  5AG5 A;  1ON0 A;  2FIW A;  3CPA A;  3D7F A;  3D7D A;  4OC2 A;  5DWM A;  2K5T A;  3V7Z A;  4RUH A;  4C2X A;  4CAW A;  3DSB A;  2IQ6 A;  4KS9 A;  4O23 A;  5KTC A;  3K9T A;  4HNX B;  3KZW A;  1UFH A;  3B3V A;  4KOT A;  4WWV A;  3JTK A;  4C7H A;  5K8O A;  4W9Y A;  2QJ8 A;  3K9U A;  4PPZ A;  4ZX8 A;  4AVB A;  2V8D A;  4NGR A;  2I00 A;  1CBX A;  2P6E A;  2Q51 A;  4TNU A;  2PJ3 A;  1IIC A;  2PVW A;  4OC4 A;  4Q38 A;  4CGO A;  2AFX A;  2PDO A;  2PSW A;  3R9F A;  2VL1 A;  3R1K A;  3KQZ A;  3BJ8 A;  4ZBG A;  4R3L A;  5JGF A;  3PB7 X;  3RYO A;  1S60 A;  5HMN A;  1LAP A;  1P4N A;  5D8N A;  3S6K A;  1NSL A;  2P0W A;  1B6B A;  5ISV A;  2V77 A;  4LX9 A;  2ZW6 A;  1RXT A;  1A2Z A;  3KQX A;  4GM5 A;  3FX6 A;  2YNE A;  2GU2 A;  3KL9 A;  3PBE A;  1RTQ A;  3FYN A;  4KUA A;  4KOS A;  1GYT A;  2VZZ A;  2BSW A;  1ARM A;  3KKW A;  5G1Z A;  3W6X A;  4FAI A;  3FNC A;  4PV6 A;  1Z8L A;  3FJU A;  4MI4 A;  3B2Y A;  3S9L A;  1KUY A;  3P2F A;  3HUV A;  4FD7 A;  2DPS A;  2PR8 A;  2B5G A;  1YGH A;  2BEI A;  2PC1 A;  3FF3 A;  2P6F A;  3PZJ A;  4MCS A;  1V0C A;  8CPA A;  3D7G A;  1IOF A;  4F0X A;  5JM6 A;  4Z65 A;  3R95 A;  4KLW A;  4OID A;  1BOB A;  3IU1 A;  4P44 A;  3IU2 A;  5G22 A;  1CX8 A;  2CF4 A;  2JEW A;  1XF8 A;  4IHM A;  4F9V A;  3E0K A;  3IIB A;  3FRM A; 
#chains in the Genus database with same CATH homology
 1R43 A;  1BAV A;  2ABZ A;  3NA6 A;  2PIY A;  2NSM A;  4B6Z A;  3BI1 A;  3PB4 X;  3SJF A;  2G9D A;  4UEZ A;  1Q7L A;  3LMS A;  4P4I A;  5JH9 A;  1CP7 A;  2IJZ A;  3H8E A;  3VAT A;  3D68 A;  1F2P A;  3D66 A;  3BI0 A;  2HB6 A;  2O4H A;  4PQA A;  4UF4 A;  3WC6 A;  4ZY1 A;  4NGS A;  4NFR A;  1XBU A;  5K8P A;  3KHX A;  3DGV A;  3NH8 A;  1ZLH A;  3KR4 A;  4OIW A;  3JRU A;  4MXU A;  2CTC A;  4CPA A;  3RBU A;  5LRK A;  3PFO A;  3PBB A;  2C6C A;  3VAR A;  2XEF A;  2ZEE A;  3KR5 A;  4DJL A;  3TX8 A;  5LYF A;  1PCA A;  3GUX A;  4AXV A;  3PFE A;  4IK2 A;  1BPN A;  2I3C A;  1Y7E A;  3V38 A;  1YW4 A;  5K8M A;  4P4J A;  1TF8 A;  1TKH A;  1F2O A;  1JQG A;  1Z2L A;  1LCP A;  2RFH A;  1VHO A;  3FED A;  4G1P A;  3IC1 A;  4UIB A;  1TXR A;  4YWY A;  3CT9 A;  3GB0 A;  3H8G A;  4OC3 A;  2BOA A;  4JYW A;  3IEH A;  2V8H A;  5HVH A;  1BPM A;  2AFO A;  1OBR A;  4H2K A;  3D4U A;  3RZA A;  3SJG A;  5F09 A;  1R3N A;  2GLJ A;  3QNV A;  2Q43 A;  2PJ5 A;  2WZN A;  2ZEG A;  2PJ0 A;  3B3S A;  3LWU A;  2QVP A;  3IWW A;  5HVG A;  3NFZ A;  5CBM A;  2PJ2 A;  3MN8 A;  4R8F A;  4R76 A;  1VGY A;  1ZG8 A;  4A39 A;  2ZEM A;  1ELM P;  3TC8 A;  3MRU A;  2F8H A;  4NGN A;  2PE3 A;  2PJ1 A;  5LYI A;  3GLJ A;  3FH4 A;  2ANP A;  2Q4Z A;  4UIA A;  3NH4 A;  2XEJ A;  3VH9 A;  2DEA A;  4FWU A;  2PJB A;  1F57 A;  3K2K A;  3B3T A;  3D7H A;  2ZEF A;  4OC1 A;  2AFZ A;  4A37 A;  4X2T A;  4NJQ A;  2PJ7 A;  4IAV A;  3B35 A;  3D67 A;  4UEE A;  1Z5R A;  4P4B A;  1ZLI A;  4ZX9 A;  2ZEP A;  3ISX A;  2V8V A;  4WJB A;  1AYE A;  2BCO A;  1YLO A;  1DE4 C;  1XFO A;  4MHN A;  2ZOF A;  1BLL E;  4DUK A;  2XEG A;  3I1U A;  3BHX A;  5I4M A;  4MRI A;  4P45 A;  3KI9 A;  4FUU A;  4ONW A;  1PYT B;  4R6T A;  2AFU A;  1CPS A;  2PJC A;  3WT4 A;  2AFS A;  2O53 A;  3IJ3 A;  4EFD A;  1IGB A;  3B7I A;  1TF9 A;  2FVG A;  4A94 A;  2CIJ A;  2PRQ A;  4MMO A;  1DTD A;  2HC9 A;  2XEI A;  4NJR A;  3NH5 A;  3N5F A;  1VHE A;  2PJ8 A;  2PCU A;  3KAS A;  3SI0 A;  3KGQ A;  3IO1 A;  4F8Z A;  2EWB A;  4F9U A;  1CP6 A;  4MHY A;  1YW6 A;  3SI2 A;  4ZYQ A;  4DYO A;  4OP4 A;  4KSI A;  3IFE A;  1YME A;  2AFW A;  1LAM A;  1EE3 P;  2QYV A;  2C1C A;  2GRE A;  2PVV A;  3WC7 A;  1M4L A;  2BO9 A;  1TKJ A;  1VIX A;  2EK9 A;  4OC5 A;  1YSJ A;  4LQG A;  3B3W A;  1AMP A;  1HEE A;  5LRG A;  4PXD A;  4Q7A A;  2V8G A;  4PXB A;  4ZY2 A;  1XJO A;  4P4D A;  3FEC A;  1LFW A;  2ZEN A;  4MCR A;  2JBJ A;  3SI1 A;  3CPX A;  1QQ9 A;  6CPA A;  4OME A;  2OOT A;  3S9M A;  1ELL P;  3S9N A;  5LYL A;  4MCP A;  3RAM A;  7CPA A;  4NGP A;  4OKO A;  1LAN A;  3FEE A;  3WC5 A;  4NGT A;  4P6Y A;  3SJX A;  2PJA A;  5CPA A;  4EME A;  1Y0Y A;  4BD9 A;  1QMU A;  1TKF A;  1CG2 A;  3PEI A;  5ELY A;  3FVL A;  3ISZ A;  3FMC A;  1XRY A;  2CTB A;  5IB9 A;  3PRT A;  4FBE A;  2NYQ A;  3KHZ A;  1CPX A;  2ZED A;  4NGQ A;  1FT7 A;  5K8N A;  3PB9 X;  1KWM A;  4K3N A;  4ZI6 A;  2IMO A;  2OR4 A;  2AFM A;  4P4F A;  5LRJ A;  3BXM A;  1NSA A;  2PIZ A;  2F7V A;  2EK8 A;  2ZOG A;  2GLF A;  4TWE A;  1HDU A;  2C6G A;  2RB7 A;  4MHP A;  1Y0R A;  2ZEH A;  4A38 A;  1XMB A;  1FNO A;  4NGM A;  1HDQ A;  4X8I A;  3B3C A;  3L2N A;  5LYD A;  2ZEL A;  4YU9 A;  4UEF A;  1H8L A;  2ZEO A;  4JZ0 A;  4X3R A;  3H8F A;  5HVF A;  2POK A;  5THW A;  1ZG9 A;  2PJ6 A;  4R7M A;  4ZY0 A;  2C6P A;  5DS0 A;  3SJE A;  5HXD A;  1ZG7 A;  3PB6 X;  2PJ4 A;  3CDX A;  1IY7 A;  2PJ9 A;  5D29 A;  4MHZ A;  4P4E A;  3T8W A;  2JBK A;  3PB8 X;  1UWY A;  1ARL A;  2WYR A;  4EWT A;  2J9A A;  5J1Q A;  4MCQ A;  3WAB A;  3HLP A;  3DLJ A;  1LOK A;  4P10 A;  4PXE A;  4OC0 A;  4PXC A;  3D7D A;  3CPA A;  3D7F A;  4OC2 A;  3V7Z A;  4RUH A;  2IQ6 A;  4O23 A;  3K9T A;  3KZW A;  3B3V A;  4WWV A;  5K8O A;  4W9Y A;  2QJ8 A;  4ZX8 A;  4PPZ A;  2V8D A;  4NGR A;  1CBX A;  2Q51 A;  4TNU A;  2PJ3 A;  2PVW A;  4OC4 A;  2AFX A;  2VL1 A;  3KQZ A;  5JGF A;  3PB7 X;  1LAP A;  5D8N A;  2V77 A;  3KQX A;  4GM5 A;  3FX6 A;  2GU2 A;  3KL9 A;  3PBE A;  1RTQ A;  1GYT A;  1ARM A;  4FAI A;  1Z8L A;  3FJU A;  3B2Y A;  3S9L A;  3HUV A;  3FF3 A;  4MCS A;  8CPA A;  3D7G A;  5JM6 A;  4Z65 A;  4OID A;  4P44 A;  1CX8 A;  2CF4 A;  2JEW A;  4IHM A;  4F9V A;  3IIB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...