2FL4A

The crystal structure of the spermine/spermidine acetyltransferase from enterococcus faecalis
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
147
structure length
147
Chain Sequence
GMEIHFEKVTSDNRKAVENLQVFAEQQAFIESMAENLKESDQFPEWESAGIYDGNQLIGYAMYGRWQDGRVWLDRFLIDQRFQGQGYGKAACRLLMLKLIEKYQTNKLYLSVYDTNSSAIRLYQQLGFVFNGELDTNGERVMEWTHQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of the spermine/spermidine acetyltransferase from Enterococcus faecalis
rcsb
source organism Enterococcus faecalis
molecule tags Transferase
molecule keywords spermine/spermidine acetyltransferase
total genus 36
structure length 147
sequence length 147
ec nomenclature
pdb deposition date 2006-01-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.900 Mainly Alpha Orthogonal Bundle Helix Hairpins The crystal structure of the spermine/spermidine acetyltransferase from enterococcus faecali 2fl4A01
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 2fl4A02
4KVOE 2BSWA 2WPWA 1S7KA 1MJBA 1GHEA 2FIWA 5C82A 2R7HA 2Q7BA 3R9EA 1I21A 3F0AA 4R9MA 4KOVA 1MJAA 2I79A 2QIRA 4GS4A 4H6UA 2VBQA 3SXNA 1Q2YA 2Q04A 2I00A 4KOYA 1NSLA 3QAHA 2EVNA 4KUBA 3CXPA 5GCNA 4KOWA 3RYOA 3TFYA 5IB0A 4MBUA 2NMTA 3BJ8A 3G3SA 1B87A 2IL4A 2OZUA 3EXNA 2CNSA 4E8OA 2Q44A 3TT2A 1XE4A 3D3SA 2JDDA 1Y9WA 4B5PB 4R3LA 3FNCA 3S6FA 4HNXB 1MJ9A 2JDCA 5E96A 2ZPAA 2OZGA 1YVOA 1I12A 4ZBGA 3VWEA 1M4DA 2JLMA 1YVKA 2WPXA 4XPDB 5IX3A 1S3ZA 2O28A 3I3GA 3BJ7A 3E0KA 4QUSA 4UBRA 3ZZIA 3DNSA 2ATRA 4AB7A 4B5OA 3EY5A 4AG7A 1S7NA 4CRZB 4PK3A 4NSQA 3K9UA 1J4JA 3V8IA 1CJWA 4YGOA 5FVJA 5JQ4A 4E0AA 3GYAA 2FXFA 4AVBA 4FD7A 1UFHA 2PR1A 2FE7A 5JPHA 4JXQA 2ZXVA 3DR6A 2F5IA 1PUAA 2KCWA 1QSRA 3R9GA 4XPKA 3R9FA 4JD6A 1S5KA 4CS0B 3W6XA 2VZZA 2ZW7A 2P0WA 4OADA 5C88A 1RO5A 2Z0ZA 1XEBA 4ONUA 2Y0MA 2JEVA 2B58A 2REEA 2VEZA 5F47A 5I0CA 2GIVA 4RS2A 2ZW6A 5H86A 2P6GA 4KOXA 2QECA 3FBUA 4CRYB 4H6ZA 1KUYA 3D8PA 1M4GA 4OLLA 1QSOA 3MGDA 1I1DA 2VZYA 4X5KA 1XIXA 2DXQA 3T9YA 1L0CA 4JLYA 1Z4RA 4MHDA 1SQHA 1YR0A 4XNHB 4U9YA 4I49A 4CAVA 3R1KA 2B3VA 2FIAA 2GE3A 5HH1A 4L8AA 4KVXA 1TIQA 4XPLA 1YREA 1Y9KA 1BO4A 3C26A 1WWZA 2Z10A 1M44A 3PP9A 2ARHA 2CNMA 1YK3A 2FSRA 5KTDA 1IICA 3N7ZA 3TO7A 2R98A 2A4NA 2CNTA 5KTAA 4BMHA 1VKCA 3FIXA 1U6MA 1Z4EA 2Z11A 5DWMA 1VHSA 3H4QA 2FT0A 4HNYB 3TOBA 1NMTA 3PZJA 2PSWA 2B5GA 1XMTA 4KVME 3FRMA 2REFA 3VWDA 2R8VA 5EBVA 4R57A 3F8KA 3B8GA 2Q4YA 1Q2DA 2GANA 2HV2A 2QMLA 4U5YA 2VQYA 5EC4A 1QSNA 3DSBA 4NXYA 3D2PA 4LUAA 4H89A 4QC6A 3LD2A 4ORFA 4FD6A 3T90A 2J8NA 4RI1A 4KUAA 2B5GB 1LRZA 1YLEA 1K4JA 1S60A 1Q2CA 1WK4A 1CM0A 1XF8A 4E2AA 5ISVA 3FB3A 1QSTA 2FCKA 3KKWA 3DDDA 4PSWA 4QB9A 5KTCA 1YX0A 3QB8A 5F49A 4PSXA 5DWNA 3S6GA 2J8MA 4XNHC 3P2HA 2D4PA 1IYLA 1V0CA 1Z9UA 1KUVA 2G0BA 3GY9A 2BL1A 2G3AA 3NE7A 4JJXA 4XPDC 3JUWA 2EUIA 2X7BA 4IUSA 4UA3A 3UY5A 4M3SA 2B4BA 4MY3A 4DNCA 1RXTA 3CXSA 1IYKA 5J8FA 3TO9A 3WR7A 4PK2A 2CY2A 2AJ6A 2B4DB 3FYNA 1MK4A 2FS5A 3PGPA 1IIDA 2B4DA 2G3TA 4KOTA 4M85A 1ON0A 2PC1A 3EC4A 2R1IA 4YRHA 5H84A 4KOUA 3OWCA 4QBJA 2B3UA 3R95A 2RC4A 3DR8A 2P6EA 4KLWA 3IGRA 3LODA 3EO4A 2PRBA 3S6KA 3EFAA 4JXRA 5CNPA 4OAEA 4R3KA 3S6HA 4JWPA 4MY0A 5F46A 2BEIA 2OZHA 4NEXA 4KORA 2P6FA 5HMNA 4QVTA 1NE9A 2AE6A 3I9SA 1BOBA 2FL4A 2C27A 3IWGA 4FD4A 4UWIA 1OZPA 2ZW5A 2Q4VA 1S7FA 1M4IA 3JVNA 2PR8A 4R87A 4NF1A 4CAXA 4MI4A 1Y7RA 4K30A 4AVAA 4EVYA 4NCZA 1IB1E 3GKRA 2HQYA 3F5BA 1M1DA 1R57A 4Y49B 1KUXA 4MJ8A 3W91A 2PQ8A 4CAWA 5J8CA 2BUEA 3ZJ0A 4L89A 3FXTA 4II9A 1P4NA 3TOAA 3W6SA 4AVCA 4FD5A 2HUZA 2VXKA 5IV0A 1N71A 4Y49C 2OB0A 4PV6A 2H5MA 4B5PA 2J8RA 2OU2A 4YFJA 3G8WA 3CXQA 3R96A 3TE4A 1YGHA 4HKFA 4UWJA 4HNWB 3SHPA 3P2FA 2ZW4A 4KOSA 4J3GA 2OH1A 1P0HA 2Q0YA 4AG9A 4F6AA 4U9ZA 2VI7A 1B6BA 1FY7A 4KZTA 2D4OA 1PU9A 1QSMA 3TTHA 3D2MA 3TO6A 1S7LA 4LX9A 4IF5A 3SXOA 1KZFA 4F0YA 5F48A 4KLVA 2PDOA 2K5TA 3TCVA 3BLNA
chains in the Genus database with same CATH superfamily
4KVOE 2Z3YA 1L1FA 4LF5O 3CRCA 2QWPB 5HFMA 5L3DA 4IK2A 1MJBA 2YICA 2PJ0A 3VQWA 1VHEA 3ZX6A 2R7HA 3OEHG 1X10A 4JI6B 3K57A 1K33A 5G22A 3R9EA 1I21A 3F0AA 5AG7A 3UO2A 3ZHVA 2PY5A 2ZEHA 4D7SA 2QIRA 3K9SA 3ZIAG 1IDSA 5AGEA 4L8JA 2ZKOA 2LW1A 3D3IA 2I00A 1TAEA 4NVPA 5GCNA 1TUBB 4PDVA 4DYOA 2HVKC 3A0RA 5GTHZ 3ABUA 2HR3A 4CYPA 3U10A 4FJCC 4X88A 4RQFA 2N05A 4PJ0Z 4X20B 4PD4F 2Q51A 2JBJA 4UCPA 1DTDA 2P4KA 4QPKA 3G3SA 3Q4HA 3KGQA 1B87A 2WA3A 4EFBA 3ASOC 1Q7YW 1IXBA 1ARMA 4X3RA 1CPYA 1AILA 3T4DA 2YIDA 4C7UA 3LWUA 3PBEA 2B9ZA 1Q82W 1KYOF 4Q20A 2LO1A 2UUBO 1Y9WA 4B5PB 1OCCC 2AFXA 3CCUV 2QA4V 2JDCA 4JI8B 4MTFA 4OX9B 1JVMA 1Z5VA 5LYJA 1NQTA 4ZBGA 1R3KC 2B1IA 1CEZA 2DQ3A 4IYHA 4WFFA 2WPDG 1Q3EA 3ZMUA 5LXTB 1S3ZA 3K04A 2JEXA 4CYQA 1TUEB 1HWYA 2P7TC 1XBLA 3CCVV 3T1YB 3ZN1A 3VQYA 4F6RA 2OYQA 4MRIA 3H01A 1KP2A 4HNAB 1S7NA 2ZM6B 3CE2A 4MTOA 5KLVH 4B3RB 4M6HA 3SYOA 3V8IA 3SJGA 1Z5RA 4CBCA 2UXBO 4CGMA 3FAVA 2ZE6A 2QDOA 5FVJA 3ETQA 2E76B 4O4HA 5LA6A 5JJJB 4CYOA 5E79Z 3ZRXA 4B6ZA 1WB8A 1KP3A 2YUAA 4JZ2A 3DR6A 4C7IA 4LNUB 5IY5C 3N2GA 2YIAA 5ITZA 4U7OA 3SI1A 3WC7A 2HFEC 1B04A 2WWWA 3K5NA 1TA8A 4DR2O 4O23A 1XDCA 4XPKA 4DV2B 2V4DA 1S77D 3R9FA 3OEEG 2IJJA 2OT5A 1OCZC 3M99B 4R50A 4DR3O 2AFZA 4MFLA 2EO8A 2VZZA 2PUSA 3JD4A 1ZAUA 2ZW7A 1K5SA 3E86A 1BHAA 3CPXA 4P44A 3ABLC 4JAAA 5C88A 1RO5A 3RGBA 1UPGA 2LP7A 2YI8A 3ISXA 3PN1A 1F2OA 3KZIZ 1N4CA 3K9TA 4OC4A 2R9IA 1HNXO 1BPMA 3N27A 3H1JH 3B77A 4LF9B 1THZA 3ETEA 4LF9O 2R70A 4KOXA 2YXLA 2C2AA 3TK1A 1L0LH 2Z3PA 3VH9A 5IT9N 1TKJA 5KAIZ 3DGVA 3UCSC 7CPAA 4LH7A 1KUYA 1RP3B 3K9AA 4X89A 4UFWA 1PM9A 4BIOA 4BIUA 1F4MA 2FYUH 2DXQA 3JYCA 3T9YA 1NBMG 5LRJA 4DR3B 4JLYA 3ZHQA 3FD9A 2CAZC 1GN3A 5FNVB 4NR1A 3JSLA 1AR4A 4XNHB 4KUMA 4PA6A 2P5OA 4A39A 3PB6X 4OIWA 3H8GA 1JQ0A 3K0DA 1RPRA 2UXDO 4GKKB 1SS3A 3B7IA 4R6ZA 5L3FA 3JATB 4XPLA 1YREA 1Y9KA 1BO4A 1YCIA 1S5JA 5JQGB 2QE7G 2AHYA 3SPHA 5BMVB 4NGTA 1P49A 4UV8A 1FXKC 2XAFA 3C3SA 1XOVA 3PP9A 1W2BU 1HNZO 1YK3A 1G8MA 1JX9A 2FSRA 5B1OA 5KTDA 4A38A 3B8MA 2R98A 1VGYA 3CC4V 2JS5A 2WLMA 2CNTA 3W7TA 1VIXA 1EFRG 4FFBA 4UVBA 4NTXA 5H6RA 3M8AA 5KTAA 2ZM6O 1FJGO 5LHIA 4BMHA 2JEUA 1N33O 2Y0IA 4MVMA 4DUZO 1U6MA 3ISZA 1Z8LA 2Z11A 5DWMA 3AG4B 2PZSA 1G6UA 4MHNA 5JWPA 2FT0A 2EILC 4JI5B 4FLUA 4NXNB 3JD1A 1YMEA 1YITV 4PXDA 3BPZA 1QR8A 3MN8A 4DR2B 3JARB 3FRMA 2REFA 5EYPA 1BGYH 1VQ8V 3RFRA 3B3VA 3ZHTA 3F8KA 4DO2A 3K5OA 3G6EV 2W6IG 2Q4YA 3HKDB 4MHYA 4NXMO 3CXHF 2I3CA 2X0LA 3RN4A 3H9VA 1CPSA 2PJ1A 2GANA 2HV2A 1N36B 2QMLA 5KUKA 5EC4A 5CB4B 1OHHG 5FPRA 3DSBA 1TVKB 4ZY2A 1HNZB 3NH5A 4UFXA 2WSSG 3X2QC 5IWAO 3PB8X 4QC6A 5LYLA 5K8PA 4ORFA 2J8NA 1SA0B 4J80A 3P3NA 2B5GB 2ADPA 1GN2A 4B3RO 5D5QA 1WK4A 1YJ9V 4YXWG 5LMUO 1RPOA 5ISVA 4LC1A 1SF9A 2XAHA 4TT3G 2OIEA 1R6NA 5GONB 2E75B 4X2TA 1XMQO 3CCRV 1A2ZA 1VQ9V 1CBXA 4B3MB 2J8MA 4XNHC 2HLDG 5D5PA 4DXWA 1YIJV 1S0VA 1Q5OA 4N21A 3IJ3A 4B13A 4JI8O 1FD9A 5G1ZA 2JJ1G 3UT5A 3KKYA 4PA4A 1V0CA 1AJQA 1NT2B 5JVDA 1KUVA 2CH7A 1WN7A 4LH6A 3GY9A 2GUZA 4A30A 1IBLB 4QNHB 4BBHA 4M3SA 3OTOO 1W0KG 3MAQA 5LMNO 1IYKA 4M6GA 4D6TH 1OV9A 4J9ZB 2QVPA 2C6CA 3IC7A 1JMKC 2UU9B 4PK2A 4YIOA 2AJ6A 4I50B 4I4TA 2GTSA 2KG7B 1MK4A 1BE3H 2B4DA 4ZOLB 1RSOA 2ZDIC 3K06A 3DSQA 4KXRA 4KOTA 3EC4A 1XHXA 2R1IA 4UVAA 3LMSA 4KOUA 1X59A 4PXEA 4DR5B 3D7FA 2XNDG 1QNMA 5BWAB 1K97A 2P6EA 2ODMA 3LODA 4BIZA 4P6YA 2RFHA 3CJHA 3EO4A 3NH8A 4ZGYB 3SJAC 5J2TB 4K0KB 2PRBA 5J1QA 3ML0A 1VQPV 4LFCO 3EFAA 3SYAA 1ZO0A 3A2FA 1GN6A 2JDIG 4JXRA 3DLJA 2YS8A 1SRYA 5H6QA 1PL4A 4GM5A 3DC6A 3DXRB 4R3KA 1M93A 5EBLC 1AJPA 3AG3B 3V7ZA 1NR1A 2AHZA 2UUCB 4CH6A 5CA1B 3W7SA 5F46A 1ROPA 4O4LA 5LP6A 4KORA 1PL0A 4KHPO 2WSAA 2EINC 3I9SA 2P22C 2YDEA 1BOBA 3IWGA 1OZPA 4OC5A 4CZZA 4ZX9A 1BAVA 4CAEA 2ZW5A 4YY3O 1ZLHA 4DV0B 3ZBHA 1YJNV 3D68A 3JVNA 2PR8A 4R87A 4NF1A 4YIPA 4E2LA 4X1YB 4JYAO 4Z1VA 1QQCA 1BSMA 1CP6A 1LANA 4X1YA 2PJ3A 1O9HA 3GWKC 1VQOV 2AFMA 4E4EA 1Y0RA 2ZXWB 4DR1O 4AQYO 3UM7A 4F9VA 3I1UA 3K5MA 3JSNA 3B4SA 2C1CA 4R8FA 4ZYQA 4GT1A 1M1DA 5L3CA 1BQ0A 3FJUA 4Y49B 3DGEA 3W91A 3S9MA 2PQ8A 3E83A 1PV0A 2BOCC 1ENVA 3GVMA 1Q8IA 4L89A 3ZJ0A 4B11A 2D2CB 2VS0A 3W6SA 4MVUA 3E8GA 1WAZA 3DXRA 4HBNA 3ZJZA 4FD5A 2VXKA 5IV0A 4JZ0A 5KX5A 1N34B 2CXAA 5IYZA 3O65A 2F8HA 2AFSA 3WB0A 2OU2A 5IJ9A 1DTOA 3G8WA 4YFJA 2DYSB 2Y69B 2ZINA 2GSMB 1Z2LA 2OCCC 4NKGB 1LUWA 4HKFA 1V55B 4P4BA 1F2PA 5LMUB 4UWJA 4CC5A 1R3LC 3PEIA 1IGBA 1VP7A 4HNWB 2UXNA 2JEWA 1CG2A 3P2FA 5G20A 4C7HA 1K73W 2X7RB 4MVRA 4CGPA 2P67A 2OH1A 3BCCH 4DR5O 4AG9A 5EC1C 3RYCB 3FH4A 1ELMP 1B6BA 2PJBA 1FAFA 4ZOLA 2RCVA 3JCZA 4JGSA 1CP7A 3T4ZA 4OXSA 5LGUA 2KG7A 5B3SB 1HDJA 3TX8A 1DK1A 2JJ2G 3WABA 3CEIA 4LX9A 4IF5A 3SXOA 2J9AA 5H9CA 3OFNG 3OGIB 1Q81W 3KI9A 5K1XA 4DV4O 5EBWC 4EEQA 4TWEA 1CX8A 4UCOA 2CTQA 4CS4A 1QVGU 4QE9A 3FX7A 4IHMA 4MCPA 4H37A 2GUZB 2ZEEA 1S7KA 2X6CA 3D36A 4IL6Z 2YEVB 4U7NA 4NGNA 3TJTA 1T5EA 5K8OA 1GHEA 5JVDB 5C82A 2A3QA 2UU9O 2Q7BA 4AI8A 2RB7A 2QKSA 4ZI6A 3ABLB 1Y76B 1EE3P 1ORQC 4WFEA 2I79A 5A28A 1ARLA 2NNUA 3EVKA 3E35A 2VBQA 4MFJA 1NSLA 3SPGA 2ABZA 4CH4A 3TGUH 4RN7A 3OTFA 4TSFG 3T2MA 3RYCA 5IB0A 2IJKA 2QKAA 3BAAA 3GB7C 4BW9A 5JH7B 4DUZB 3TETA 4CGOA 1V54B 3BABA 2QWQB 1AP5A 3EXNA 1GH6A 3RW0A 3G80A 1F51A 3TT2A 2VL1A 5KHGA 4P2ZA 3D3SA 1OCCB 1WA8B 4RWUA 3RYIB 5DM6V 4PDLA 3SDLA 1SA0A 3FNCA 1MNGA 5L3BA 5E96A 2ZPAA 4DR1B 4WFBV 1SQGA 3AK1A 3VWEA 3ZMSA 1F57A 1YVKA 5K8NA 2WPXA 3SYQA 1E79G 2YXHA 2XHBA 5IX3A 4IT5A 2FKXA 2ZR3A 5D8NA 1YQEA 3OW2U 3BHPA 4J41A 2RNBA 4TUYB 3E0KA 3IU2A 3ZZIA 2ATRA 4B5OA 4R6TA 3EY5A 5EYPB 5CMUA 1QLEC 3C3TA 3JARA 3ZHUA 4JYAB 2X6BA 5LYDA 3RWRD 3E22B 1QR9A 1L8DA 1I5XA 4ICGA 4LF8B 4PK3A 2YI9A 1J4JA 1K9MW 2ANPA 2QJ8A 1OCOC 2BCOA 3B09A 2BSKB 2F43G 1CJWA 4JTCB 2YXYA 2HVJC 3VQXA 3OT7A 2UXBB 3D66A 1FFXA 2R72A 1BZKA 1ZG9A 2BOBC 2OR4A 1IBKO 4WFGA 2ILMA 1LAPA 1Z5WA 5HFLA 3QAYA 4BAYA 4I55B 5JCOA 4DV1B 3D7HA 1JFFB 4W4KA 4JI2B 1NI8A 4DV3O 2QM7A 5BMVA 4K3AA 2IM9A 3G67A 3E8BA 4MVQA 4LFAO 4FM1A 3JATA 2XT9A 4CS0B 3W6XA 2PVVA 3R66A 5E1AC 4FLXA 4D7TA 2ODFA 4PI2A 4G28B 1XBUA 4OC0A 4FAIA 1AI6A 2EILB 2B58A 2BOAA 5F09A 3TXQA 1HR0B 5I0CA 2DF5A 4MHZA 5GTIZ 2P4VA 3J7AU 5H86A 1U97A 1LR1A 2F7VA 1NVPB 3IJ4A 1P84F 1R3IC 4OC2A 4B3TO 1NH2D 3H1IH 5CA0A 4H6ZA 2WLLA 1M4GA 2V8VA 4LFBB 1NTZH 4YJ2A 1AYEA 3MGDA 2VZYA 3ABTA 4X66O 3T8WA 4I4TB 2E5LB 2DPTA 4FLTA 4L87A 4MW8A 1X4TA 4JI5O 1XOUA 2V8HA 1MA1A 4PXBA 3ABKB 2Y69C 2PI5A 1IXMA 2GE3A 5JJNB 5EMIA 2PJ4A 4KVXA 4JI7O 2D3OW 5IJ0A 3IAYA 4KP4A 3E8FA 1F7YA 4DK0A 1AVMA 1Y4MA 3UT5B 2WYRA 3C26A 1YEWA 4PA7A 3JAMN 2Z10A 3OR6C 4PDRA 2EZPA 4WFHA 2Q4PA 1H2LA 2QEXV 4BWAA 4LNUA 1V55C 2ZCEA 2VRZA 2NLJC 4PA9A 4KSAA 1H38A 1B06A 5GONA 4O4HB 3JAKA 4JASA 4JPRA 3SJCC 5GW7A 1VKCA 2DEAA 2K9PA 5F2VO 3SJFA 1Z4EA 5C93A 4DR6O 1SZTA 1GK9A 2GU2A 3B3TA 4MMOA 3ASNC 3D7DA 1SQVH 4B10A 3TOBA 4H2KA 4LQ6A 2VWJA 3K08A 4JI0O 4ONWA 4UVCA 2Y4UA 2PSWA 2B5GA 2Q7EA 4IIJA 3VWDA 3HR0A 1IY7A 1EZJA 2YGWA 3LNMB 3B8GA 2EBJA 4GZRB 2DW4A 1TVKA 5LOVB 5LXTA 2AFWA 4UEEA 3KR4A 3LNNA 2Q0OC 4MVOA 1HDUA 3F5TA 1VHOA 5CBMA 1M56B 2CUGA 4H89A 3KASA 1B3QA 5B1BC 1Y74B 3T90A 2QM8A 4CGLA 2NR5A 1H2SB 2AW9A 1Z8TA 1YLEA 3CC2V 1VF6A 3FB7C 1K4JA 4DR7O 1BLLE 2A79B 1S60A 4UCMA 3QNEA 5J9PC 3RYFB 3ETDA 3X2QB 3STZC 4CPAA 1H8LA 3FB3A 5ELYA 4B3TB 2KQXA 1QSTA 3IO1A 3PFOA 4WBNB 3KKWA 1BQZA 1VQLV 4UEFA 1MZFA 2Q4ZA 1YX0A 3QB8A 5F49A 5CBGA 4HYOA 5DWNA 4PI0A 3S6GA 3BY6A 4EB6B 4FBEA 5C8YB 3CRQA 4XDKA 1WP7A 1ZL8B 4IAVA 3RYHB 4ZHQB 4J7JA 1SKVA 4GLXA 1WJZA 3FFQA 3OD4A 2G0BA 2EK8A 4DV4B 1K34A 2G3AA 3NE7A 4JJXA 4KSIA 1JOYA 3CPWU 2P6JA 2EUIA 4IUSA 1OCOB 3FEDA 3CXSA 1K7DA 1QCEA 5FNVA 3DTUB 3K79A 1UWYA 5KHJA 2UUCO 1DE4C 1Y66A 4F6EA 1IBMO 1IIDA 4XDJA 3S9NA 5DN6G 2XAGA 1ON0A 3ZEDA 5KAFZ 5H84A 4QBJA 4WF9V 3FVLA 3R95A 3H8FA 1TXRA 3SI2A 2GTAA 1ZG8A 1K8AW 4J11A 3OR7C 1FFTB 3SYPA 3S6KA 1OCRC 1ZL8A 4JI0B 2LW7A 4X9QA 4JYBA 1LFWA 2JGUA 4MW3A 4A95A 2GLFA 1WPXA 2F1MA 4OAEA 2CTRA 4U3JA 1VQ7V 3VBBA 4HZ3A 3KG2A 4JWPA 1JPXA 4MY0A 4G2KA 3HKBB 2PE3A 1N36O 2BEIA 1SQPH 4MS2A 4NEXA 5AG5A 3CCLV 3BFRA 1S76D 2P6FA 3HUVA 3JTKA 3AG1B 3C90A 4P45A 2Q68A 2BTQB 4I9WA 2ZD9A 2AE6A 3O9OA 1EM1A 3AG2B 3MRUA 3N2GB 5B3SC 2XASA 3A8TA 4JYCA 4XDLA 3OTOB 4W4LA 1M4IA 5IYCO 5B1NA 1WNSA 1TF8A 2DPSA 1A32A 1H2KA 3WB1A 2GREA 4PXCA 5LA6B 1KC8W 1NU1H 5CBHA 1XHZA 1B6QA 4MI4A 4OC1A 3FAVB 1Q6UA 2PF4E 3ABKC 4EVYA 2A7WA 3CSXA 1GM8A 1IB1E 1I0HA 4FZ1A 4JF3A 4DR7B 2P06A 1SQFA 2Q43A 3GKRA 2HQYA 1KECA 1Z8WA 3SI0A 3B2EE 4LWSA 2ZOFA 4IIJB 1Q43A 4HNAA 1CP9A 4UXNA 1R57A 3B35A 2DYRC 4LWSB 1I08A 2JBKA 2DWDC 3S3XA 3CMEV 2PI4A 1JR9A 1N0JA 3FXTA 3B3CA 4AVCA 3CCEV 3JAKB 4DW1A 3N2KB 4Y49C 2H5MA 4B5PA 2J8RA 5LRKA 5BXZA 3CHXA 1Z8XA 2Q7GA 3WB2A 3R96A 5IWAB 1F4NA 1HR0O 4KL1A 2HP8A 4PV1B 3SPIA 2BTQA 3CZXA 3UQ8A 4H0LB 2OTLV 2YNEA 2PCUA 1M5IA 2ZW4A 4KOSA 4ZI7B 4F6AA 5CBFA 1OCRB 1TUBA 4G27B 2VI7A 4U3JB 4DV6B 1FY7A 3TTHA 1EBOA 2B1GA 2IH3C 4UCRA 2XEFA 3TO6A 1KZFA 4F0YA 2ZE5A 4UIAA 1JCHA 3RT3C 3FB5C 4KSFA 1XFOA 1IBKB 1VQ4V 2OWOA 3WG7B 2FB5A 2WLLB 3U0ZA 2BSWA 2WPWA 4JI7B 1YHQV 3P3PA 2RQ6A 4X62B 5A27A 3JASA 2L35A 3ZCCA 2BO9A 4KOVA 4DV5B 1MJAA 3RAMA 1HW7A 4H6UA 4FFKA 4P30A 5I4MA 1M90W 2AGAA 4P10A 3V38A 2R9AA 3KQZA 4DUYO 4X66B 3CXPA 4KOWA 1KWMA 4TQFA 3TFYA 2IW5A 4GKJB 1MG1A 1S3JA 2QSAA 4UCTA 4NGSA 3PFEA 2CGOA 3ZHSA 2IMOA 1FXVA 4DV7B 5HVFA 2IL4A 2OZUA 3BVOA 4ZHQA 2CNSA 1JA8A 2MK3A 3RYHA 1TKHA 1JJ2U 1QMUA 3S3WA 1XE4A 2JDDA 4PDMA 1JFFA 5C8YA 1O9GA 4R3LA 3S6FA 4EB6A 1YZBA 4U3FH 3B3SA 1MJ9A 3VARA 1KU9A 2N04A 3PBBA 1I12A 1GAXA 2JGDB 1EN4A 1FFXB 2JLMA 2GFQA 5DS0A 2KKWA 4WBNA 3LSUA 4B12A 1GN4A 1NH2B 2BE3A 2O28A 2Y0PA 2ETNA 2ZR2A 2GDSA 4QUSA 1H8EG 1QLEB 3A0BZ 3RYFA 4AG7A 2EIJC 2F93B 4B08A 5JM6A 3ICXA 3UO3A 1FT7A 1S72V 2HEPA 1Q6IA 3E22A 2W6JG 4TV9A 3U11A 2F4VO 3K9UA 4NSQA 5BR8B 1N34O 4CRZB 2WLIA 4JAUA 5LYFA 4NYKA 1Y74A 1YW4A 3IFEA 4TUYA 4FPPA 2X6AA 4YGOA 3D3QA 4E0AA 3GYAA 2FXFA 4R7MA 4K8XA 3JALB 1CPXA 2ZENA 1OCZB 4FD7A 5LOVA 3AG3C 2FE7A 4JXQA 2ZXVA 2IU0A 1K3EA 2F5IA 1FKAO 1PUAA 2M6YA 1WA8A 1QBZA 3RYIA 2ITCC 4LR3A 4FZ0A 2KCWA 1QSRA 3R9GA 4JI6O 3L72H 3CD6V 3TXSA 3JAWA 1UFIA 2ZIMA 2POKA 2IBZH 1K4CC 1M1KW 4OADA 1Y7EA 5JH7A 1ZLIA 2PIZA 1FXHA 1XEBA 2PJ2A 4JI1B 3AG1C 1JJOA 3ASNB 4XBFA 2KB1A 4FM2A 2E74B 1QU7A 2UUAB 2Y0MA 4P4IA 2JEVA 2REEA 4PQAA 1M56C 5EZYB 2QGNA 1VQMV 3APOA 2O4HA 4I5SA 1LAMA 2GIVA 2DN9A 4X8AA 4RS2A 3K59A 2YNDA 4TV8A 1H2NA 3T1CA 5IJ0B 2YEVA 2ZELA 4GUNA 3FEEA 1PYTB 4C2XA 4OP4A 4DV7O 1KQSU 3K5LA 4OLLA 1RTQA 1QSOA 1I1DA 5CA3A 1YF2A 4X1KB 5KHKA 1XIXA 1GO3F 1KKCA 4GKJO 1YTFB 4AHCA 4LF7O 4DRXA 2HB6A 1SQHA 3QO8A 1WLEA 1LUVA 4P4EA 4P4FA 5LHGA 4U9YA 4UB8Z 1H2GA 4C2YA 4B7EA 4I49A 4YJ2B 1NSAA 4CAVA 3CC7V 3R1KA 3BXMA 1EZVH 2B3VA 2FIAA 3EFFK 3L2NA 4L8AA 1HNWO 4JV5B 4CS2A 3NH4A 5CA0B 3K3WA 2AFUA 2P90A 2CGNA 3HPLC 4ZBMA 3CCMV 1Q86W 3B8NA 2JIZG 3NR7A 1XJOA 3FECA 4X64B 3CMAV 3IEHA 4LF5B 2Q0AA 3K2KA 2ARHA 5EC2C 1FXKB 2XOKG 2CNMA 4YY3B 2Q7HA 3QF7A 2WAMA 4KS9A 3N7ZA 2Q67A 1HDQA 1YXBA 4QGPA 5EIBD 5AG6A 3S9LA 4NJQA 2OOTA 4GX1A 4UCSA 1Q7LA 2QWOB 4IYIA 1I94B 3NA6A 5BR8O 2YNCC 3FB8C 1K4DC 4UCUA 2CK3G 1XI1A 1S5HC 4EMEA 1R3NA 3A9LA 2Q6AA 1D2DA 4I55A 3JRUA 4KVME 4H33A 3T1HB 4MCQA 2RMKB 4MHPA 4FLZA 2R8VA 5EBVA 2RJZA 4MCSA 1ZX3A 2EIMB 1PNKA 4J7ZA 1MSDA 4B3SO 1W59A 2GHYA 2LQTA 1Q2DA 4X64O 3CCQV 2AZ0A 3AK2A 4C2ZA 1QSNA 4YU9A 3D2PA 2QJ1A 4LUAA 3LDCA 1XMOO 2BSKA 3CRAA 1ZTEA 5K8MA 2ZEMA 4RI1A 3LDEA 2Z0AA 2PYJA 1IOIA 5IY5B 1ZLZA 3JD3A 3FB6C 1YVWA 4FK5C 1XILA 3D4UA 4JI4O 3L73H 3OGCC 2HKOA 1CM0A 3IIBA 3W7WA 1MOFA 1XF8A 3ZRSA 4UCNA 1VMGA 4A2ZA 4O4LB 4JTDB 5CA1A 4IGGA 1SZXA 3PJSK 3J81N 2ZDIA 4JZGA 2FCKA 1RFYA 1IVSA 3DDDA 4FLWA 4HAMA 5KTCA 2WUUA 2HHHO 3TCUA 3OM3B 3A0HZ 3FYEB 4JYYA 3RNZA 4AXVA 2R9RB 1MMMA 1XL6A 4WCEV 2MW2B 2OCCB 2YSUB 1H2MA 4F9UA 1Z9UA 4GX0A 2Y48A 1J95A 4JYWA 4O4JA 2XAQA 4DV1O 4GYCB 2BL1A 3JUWA 3RBUA 2QM4A 4FM0A 3QG5A 2X7BA 4UA3A 4R8CA 2B4BA 1XUQA 3PB4X 4MY3A 4DNCA 1RXTA 2VQEO 1PNMA 1AMPA 4Z2WA 1XRYA 2EBOA 3WR7A 2CY2A 4UB6Z 2B4DB 3D7GA 3B2YA 3APQA 3PGPA 4UUJC 4I0XB 4P4JA 1KMIZ 1Y76A 4WFAV 3MDSA 1P4RA 2G3TA 4MFKA 4M85A 2PC1A 4DR6B 4X1IB 4R7CA 3PRTA 4ZX8A 2ZIOA 2CTBA 2B3UA 4JI3O 3J80N 3DC5A 2PVWA 3CPAA 4MT8A 5J2UB 2RC4A 3DR8A 4KLWA 4MTGA 5KA5A 1I5YA 2ITDC 2XUMA 2CH7B 3IGRA 3PB7X 1SC5B 4O4IA 1P7GA 4P9OA 4DUKA 3RVZA 4GXHA 3B40A 4LP8A 5CN0A 3L70H 1GTOA 4DV3B 2FMLA 4MVZA 3B3WA 3KHZA 3IFXA 1TKFA 2EINB 1IX9A 3OUFA 4OKOA 3G71V 2LFSA 4F4LA 5CNPA 3VATA 2DQ0A 1W0JG 2QWNB 3S6HA 2CTWA 2Z3KA 1HEEA 5L3GA 2QKCA 4UF4A 2EULA 2OZHA 2ZEFA 1NVPD 2AFOA 3SJXA 1IBLO 4ZKIA 1GM7A 2DMXA 3KCXA 5HMNA 3BI1A 4LBEC 3P32A 1NE9A 4FD4A 4UWIA 1XMBA 3QO5A 3MD0A 5LRGA 2Q4VA 5IJ9B 3N5FA 1S7FA 4CH3A 1R43A 2A06H 2ADQB 5IYZB 3FF3A 3HKCB 4K8ZA 4I9QA 1BT8A 5KX5B 1IZ3A 2QR4A 3L9DA 3FYIB 3CX5F 5A9GA 1J5EB 5THWA 4CAXA 5LHHA 4ZY1A 2Q9LA 5CB4A 1U96A 4K30A 1XNRO 2UUBB 1M4LA 2V1DA 4NB5A 3CCSV 1SERA 3HKDA 1URFA 4DYLA 5KMGA 1XNRB 4TNUA 2CF4A 3QNVA 5LGTA 1AROP 1DF5A 2K1EA 3ZN0A 4QE7A 5IYDO 4O2BA 1Y0YA 4PHZA 5L3EA 2UXCB 4CAWA 5J8CA 2ZOGA 3ZMZA 2PJAA 1WB7A 2WLJA 1TF9A 1AUGA 4MFZA 1P4NA 3TOAA 5G21A 4K35A 3ZMVA 3KCYA 2HUZA 1SESA 4NXMB 4FFBB 2WLHA 4R76A 4RUHA 2DYRB 4X65O 1PPJH 4KHPB 2OCHA 3THOA 2EJRA 4HPSA 1NZ6A 4NGRA 1YDXA 1YTFD 1YGHA 4FIPC 4MFPA 4O4IB 3ABMB 5JJEB 5J2UA 2ZQMA 2WLNA 5LP6B 2PIYA 1R73A 4K0KO 4J3GA 2F66C 1FJGB 3CS5A 4JI3B 1M57B 2Q0YA 4Q7AA 2YC0A 5D29A 3SJEA 4U9ZA 4X1IA 2W0XA 2IJZA 2BTOA 1NKDA 5EIBC 5BY1A 1R1BA 2UXCO 2D4OA 4KZTA 1PU9A 1QSMA 5KHHA 2HJFC 3KZWA 1AR5A 1S7LA 3IC9A 5CPAA 3WC5A 2E3CA 3JD0A 4IHJA 5LL6Y 3E8HA 4P9PA 3L74H 4OPHA 5J2TA 3GLJA 4KLVA 5F48A 4TOIA 2GLJA 2PDOA 3CJHB 1LOKA 3WG7C 1Y67A 2K5TA 3TCVA 4B14A 3BLNA 4J42A 3SGIA 4RQEA 2QYVA 1V9PA 4O4JB 3GWOA 2FIWA 2FTKA 2RN9A 1R6KA 1BMFG 3BEHA 3SPCA 4YHHB 4IHJB 1RSOB 4R9MA 2EK9A 2DE0X 2C6PA 2F4VB 3SPJA 4DK1A 4GS4A 2F95B 2VQFB 1FPOA 2Q73A 2ZNJA 4DV5O 1G1XB 4I50A 3MHHC 1Q2YA 2Q04A 3SXNA 1N33B 4KOYA 3JCUZ 4EFEA 4NTYA 3QAHA 2EVNA 4KUBA 4DW0A 1VQ5V 3KL9A 3RYOA 1XNQO 4MBUA 1V54C 2NMTA 1XNQB 1NTKH 2O53A 3BJ8A 4NFRA 1AB3A 3CB2A 3CYOA 3PB9X 2BCCH 3M7MX 1LNQA 3OE7G 2CDYA 1MZEA 2PRQA 4E8OA 4OPAA 2Q44A 2ZEGA 3CWBH 3FKSG 5ITZB 4LFCB 3H5ZA 3H1LH 2QWRB 4HNXB 2NSMA 2OZGA 1YVOA 2IU3A 4LFBO 1M4DA 1WPBA 1GMGA 3ZHRA 2AZ2A 4XPDB 2LGQA 1F23A 4BD9A 3LSSA 4TQDA 4MFQA 2ZT9B 1N0NA 1IOFA 3I3GA 3BJ7A 4UBRA 3NFZA 4AB7A 3RBZA 3DNSA 1KB9F 2EZOA 5B66Z 2OIGA 4O2BB 3CP1A 2H8PC 5JGFA 1YLOA 2JRIA 3SR2C 1WP8A 5KUMA 5DECA 4K3NA 5A2QN 1X12A 5KMGB 1XQ8A 3KR5A 1OBRA 5LGNA 3T1HO 5JQ4A 2V7QG 5H5NA 4AVBA 1VARA 3D8CA 3HKCA 1UFHA 2PR1A 4C68A 2ZNIA 5JPHA 3TC8A 3E89A 2Z3NA 1N32O 5IDJA 3CT9A 1BHBA 3H8EA 1IU8A 4UIBA 2DYSC 2A9HA 3NXSA 2GV9A 4N23A 3VOUA 4DV6O 1FNOA 3GIUA 2Z5UA 2A0LA 1YW6A 2HHHB 5FL7G 1SQXH 3ZMTA 4JD6A 2M7WA 1S5KA 3W7XA 2P0WA 4MVSA 1HNWB 1E1RG 4JV5O 1XREA 4X20A 2Z0ZA 3G6BA 4RO2A 3HLPA 2O57A 4NTWA 1CXZB 3ZS8C 3G4SV 3BA8A 4ONUA 2XEJA 1AI7A 2VEZA 5F47A 3MHSC 2YIBA 1JWQA 2DJVA 4Z1MG 3IGAC 2ZW6A 1LCPA 2P6GA 3BI0A 4CS3A 5HVGA 2H3OA 1XL4A 5JQGA 2QECA 3FBUA 3KQXA 2IQ6A 2WLKA 4EFDA 1KKDA 3KHXA 5H2FZ 3BRCA 1Y6XA 1BPNA 4DR4O 4CRYB 3SJQC 1M4UA 4LF6B 4QJFB 1Q90D 1SQQH 2C6GA 2ZE7A 3D8PA 3OMIB 4DUYB 3CXCU 4X8IA 4ABMA 4TV8B 1GRJA 4X5KA 2ATKC 4I0XA 2PJ8A 3L75H 2XEIA 5HXDA 1L0CA 2Q5ZA 4CC6A 5EZYA 2NYQA 2ZE8A 1Z2GA 1Z4RA 4A37A 4MHDA 1AR1B 1YR0A 2HJDA 3QVNA 1OZ0A 4UV9A 4B3MO 4Q38A 4A32A 4H44B 2EIKB 5IE9A 4CH5A 2IH1C 3HKEB 3IU1A 5HH1A 1RM1C 4P4DA 1TIQA 1TGOA 2Z3MA 1NJIW 2HG5C 5B1AC 4LF4B 1S5LZ 1WWZA 1M44A 4B7KA 3EXAA 2Y4TA 4PPZA 1IICA 4MCRA 2XEGA 3TO7A 3SYCA 2A4NA 3ABMC 2Z3OA 4JI1O 1PCAA 2IJIA 4AQYB 3JALA 3HB3B 4PELA 3E2EA 1MSWD 3OUSA 1HP8A 1SQBH 4FMTA 3FIXA 3OMAB 4F8ZA 1Q6HA 4QPJA 2B5UA 1AI5A 2ZEOA 4JTAB 1JQGA 2WLIB 1VHSA 3H4QA 4HNYB 4DJLA 4TV9B 4ASUG 3ZRWA 1ZWIC 1NMTA 3K58A 5EK0A 1PKXA 2PJ6A 3CRMA 3PZJA 4BR6A 4CGNA 4FUUA 1YSJA 4KFMA 2H94A 1XMTA 3FMCA 4CAFA 2EIMC 5FLXN 5IB9A 3RVYA 4R57A 4A94A 4LF4O 1ZUQA 4FVMA 1EN6A 5EBMC 4UCVA 4WWVA 4U5YA 2VQYA 3GB0A 1DF4A 2VQEB 4O2AB 1ZG7A 4NXYA 2JVDA 2JGDA 1VEWA 8CPAA 1QLNA 3LD2A 2FVGA 4UEZA 4FD6A 2OTJV 1VIBA 1M9NA 3D67A 2LFRA 4X65B 4KUAA 1LRZA 2YIBD 3BHXA 2QTOA 1KD1W 4FWUA 4M6IA 5DEDA 3BA9A 2DOSA 1KUQA 3QO7A 1H8HG 1Q2CA 2KSDA 4F6RB 1DGSA 2EIKC 3I5DA 4J10A 1ELLP 3ETGA 2RDCA 4E2AA 3LUTB 3QTCA 1N8RW 2G38A 4J7KA 4LF8O 4DR4B 4A33A 1XMQB 1VF7A 2E5LO 4PSWA 4QB9A 1IURA 5KHIA 5LYJB 4PSXA 1GM9A 1AI4A 4LCUC 3ASOB 1GKFA 4QIWF 1FYJA 2PJCA 4LF7B 3P2HA 3F7YC 1J5EO 1FXKA 3RZAA 5LBQA 2Z3LA 4Q6GA 2D4PA 1NTMH 4LF6O 1QQ9A 1IYLA 2CTCA 4OGQB 4YJ3B 2JS3A 4FLVA 4BINA 4X62O 1L0NH 2F23A 2XTAA 3Q4HB 3RO0A 4A31A 4XPDC 4EWTA 3F7VC 4NGMA 4J9YB 3UY5A 1COWG 4DV0O 4GX2A 4OMEA 1VF6C 4YWYA 2YNCA 3OMNB 4LFAB 4OIDA 5J8FA 2UXXA 3TO9A 3I55V 1E1QG 2CE4A 5K1PA 2PGGA 3R65A 5FPOA 3FYNA 4DRXB 3LACA 4MXUA 1HNXB 2EWBA 2FS5A 1YSCA 3CRRA 3WU2Z 4X1KA 3CDXA 2UUAO 4MSWC 4NXNO 4H13B 4YRHA 2CTPA 3OWCA 4OC3A 4LQGA 4ZI7A 5B5EZ 4CYNA 3SJBC 2W0FC 3VQVA 3K03A 5TISZ 1I94O 2LJ2A 2VQFO 2PJ9A 4RUFA 2HC9A 1AJNA 5LP6C 1N32B 2DWEC 4JI4B 4YJ3A 1M57C 3LSQA 5IYBO 3WC6A 4EKWA 4F0XA 1US6A 1K92A 3N2KA 4Z65A 2PYLA 2Q7SA 5KA6A 1XMOB 2WZNA 1VQ6V 3WFVA 3I56V 3JAWB 4RUEA 4BW5A 1NR7A 4B3SB 4QVTA 2GBOA 2C27A 2FL4A 3JD2A 3AG2C 3AK3A 4NGPA 2EX3A 1QHTA 3UKMA 3T1YO 1R6TA 1AP6A 1BCCH 3IWWA 1KBHA 2QTSA 2ZEDA 5BZBA 1Y7RA 4O2AA 2WA4A 2VWKA 3W7UA 1SETA 1OJHA 1IBMB 4AVAA 2PTMA 4NCZA 4OX9O 2ZEPA 1P7BA 4RAIA 2ZXWC 4NGQA 4I7ZB 3WT4A 5B1BB 4ZY0A 5HVHA 2PJ7A 5AG4A 3F5BA 2PJ5A 1KUXA 4MJ8A 3GUXA 2N74A 3ZRWB 2IJHA 1VF5B 1PP9H 4NJRA 4FLYA 4ZIBA 1I7FA 2BUEA 4AILC 3NE8A 3HKBA 4W9YA 4GCZA 1RM1B 3LDDA 4II9A 2EIJB 4GKKO 2UXDB 1DLBA 1EN5A 4G1PA 3P30A 1PNLA 2AXTZ 3STLC 2LGWA 3K0GA 2CIJA 1PD3A 1GYTA 5B1AB 1N71A 1VQKV 3FX6A 2V8GA 4UFZA 3AG7A 4DV2O 2OB0A 4YHHO 3IC1A 4PV6A 3IWEA 4MTXA 3AEIA 5JH9A 3ZRVA 3CXQA 4UFVA 2NN4A 3TE4A 5LYIA 2G9DA 4WJBA 2EJ7A 3EHBB 3H1HH 4PA3A 3SHPA 1VQNV 5JCOC 1MABG 3F5WC 3H1KH 5AG2A 1NS1A 1P0HA 3L71H 2Q8VA 3CCJV 3HKEA 2L6LA 4JI2O 3D36C 1BS3A 3OAAG 4JAVA 1YJWV 1D5AA 1YI2V 1D5NA 3D2MA 6CPAA 1ZSPA 4Q36A 2JK5C 1K5QA 5LMNB 1FS0G 2XAJA 1R3JC 4A5UB 2V77A 1QVFU 1BL8A 3JASB 4TWKA 1G4YB 4GX5A 2Q69A 2V8DA 1UJWB 3AG4C 1XEQA
chains in the Genus database with same CATH topology
4KVOE 2BSWA 2WPWA 1S7KA 1MJBA 1GHEA 2FIWA 5C82A 5A27A 2R7HA 2Q7BA 5G22A 3R9EA 1I21A 3F0AA 4KOVA 4R9MA 5AG7A 1MJAA 2I79A 2QIRA 5A28A 4GS4A 4H6UA 5AGEA 2VBQA 3SXNA 1Q2YA 2Q04A 2I00A 4KOYA 4MFJA 1NSLA 3QAHA 2EVNA 4KUBA 3CXPA 5GCNA 4KOWA 3RYOA 3TFYA 5IB0A 4CYPA 4MBUA 4CGOA 2NMTA 4UCPA 3BJ8A 3G3SA 1B87A 2IL4A 2OZUA 3EXNA 2CNSA 4E8OA 2Q44A 3TT2A 1XE4A 3D3SA 2JDDA 1Y9WA 4B5PB 3H5ZA 4R3LA 3FNCA 3S6FA 4HNXB 1MJ9A 2JDCA 5E96A 2ZPAA 2OZGA 1YVOA 1I12A 4ZBGA 3VWEA 1M4DA 2JLMA 1YVKA 2WPXA 4XPDB 5IX3A 1S3ZA 4B12A 4MFQA 2O28A 4CYQA 3I3GA 3BJ7A 3E0KA 4QUSA 4UBRA 3IU2A 3DNSA 2ATRA 3ZZIA 4AB7A 3EY5A 4B5OA 4AG7A 1S7NA 4CRZB 4PK3A 4NSQA 3K9UA 1J4JA 3V8IA 1CJWA 4CGMA 4YGOA 5FVJA 5JQ4A 4E0AA 3GYAA 2FXFA 4AVBA 4FD7A 4CYOA 1UFHA 2PR1A 2FE7A 4C68A 5JPHA 4JXQA 2ZXVA 3DR6A 2Z3NA 4C7IA 2F5IA 1PUAA 2KCWA 1QSRA 3R9GA 4XPKA 3R9FA 4JD6A 1S5KA 4CS0B 3W6XA 4MFLA 2VZZA 2ZW7A 2P0WA 4OADA 5C88A 1RO5A 2Z0ZA 1XEBA 4ONUA 2Y0MA 2JEVA 2B58A 2REEA 2VEZA 5F47A 5I0CA 2GIVA 4RS2A 2ZW6A 2YNDA 5H86A 2P6GA 4KOXA 2QECA 3FBUA 2Z3PA 4CRYB 4C2XA 4H6ZA 1KUYA 3D8PA 1M4GA 4OLLA 4UFWA 1QSOA 3MGDA 1I1DA 2VZYA 4X5KA 1XIXA 2DXQA 3T9YA 1L0CA 4JLYA 2DPTA 1Z4RA 4MHDA 1SQHA 1YR0A 4XNHB 4U9YA 4Q38A 4A32A 4C2YA 4I49A 4CAVA 3R1KA 2B3VA 2FIAA 2GE3A 3IU1A 5HH1A 4L8AA 4KVXA 1TIQA 2Z3MA 4XPLA 1YREA 1Y9KA 1BO4A 3C26A 1WWZA 2Z10A 1M44A 3PP9A 2ARHA 2CNMA 1YK3A 2FSRA 5KTDA 1IICA 4KS9A 3N7ZA 3TO7A 2R98A 2A4NA 4KSAA 2Z3OA 5AG6A 2CNTA 5KTAA 4BMHA 1VKCA 3FIXA 1U6MA 1Z4EA 2YNCC 2Z11A 5DWMA 4B10A 1VHSA 3H4QA 2FT0A 4HNYB 3A9LA 3TOBA 1NMTA 3PZJA 2PSWA 2B5GA 4CGNA 1XMTA 4KVME 3FRMA 2REFA 3VWDA 2R8VA 5EBVA 4CAFA 2YGWA 4R57A 3F8KA 3B8GA 2Q4YA 1Q2DA 2GANA 2HV2A 2QMLA 4U5YA 2VQYA 5EC4A 1QSNA 4C2ZA 3DSBA 4NXYA 4UFXA 3D2PA 4LUAA 4H89A 4QC6A 3LD2A 4ORFA 4FD6A 3T90A 2J8NA 4CGLA 4RI1A 4KUAA 2B5GB 1LRZA 1YLEA 1K4JA 1S60A 1Q2CA 4UCMA 1WK4A 1CM0A 1XF8A 4UCNA 4E2AA 5ISVA 4A2ZA 3FB3A 4A33A 1QSTA 2FCKA 3KKWA 3DDDA 4PSWA 4QB9A 5KTCA 2WUUA 1YX0A 3QB8A 5F49A 4PSXA 5DWNA 3S6GA 2J8MA 4XNHC 3P2HA 2Z3LA 2D4PA 4B13A 5G1ZA 1IYLA 1V0CA 1Z9UA 1KUVA 2G0BA 3GY9A 4A31A 2BL1A 2G3AA 3NE7A 4JJXA 4XPDC 4A30A 3JUWA 4BBHA 2EUIA 2X7BA 4IUSA 4UA3A 3UY5A 4M3SA 2B4BA 4MY3A 4DNCA 1RXTA 3CXSA 1IYKA 2YNCA 5J8FA 3TO9A 3WR7A 4PK2A 2CY2A 2AJ6A 2B4DB 3FYNA 1MK4A 2FS5A 3PGPA 1IIDA 2B4DA 4MFKA 2G3TA 4KOTA 4M85A 1ON0A 2PC1A 3EC4A 2R1IA 4YRHA 5H84A 4KOUA 3OWCA 4QBJA 2B3UA 3R95A 4CYNA 5BWAB 2RC4A 3DR8A 2P6EA 4KLWA 3IGRA 3LODA 4ZGYB 3EO4A 2PRBA 3S6KA 3EFAA 1ZO0A 4JXRA 4F0XA 4A95A 5CNPA 4OAEA 4R3KA 3S6HA 4JWPA 2Z3KA 4MY0A 5F46A 2BEIA 2OZHA 4NEXA 5AG5A 4KORA 2P6FA 3JTKA 5HMNA 4QVTA 2WSAA 1NE9A 2AE6A 3I9SA 1BOBA 2FL4A 2C27A 3IWGA 4FD4A 4UWIA 1OZPA 4CAEA 2ZW5A 2Q4VA 1S7FA 1M4IA 2DPSA 3JVNA 2PR8A 4R87A 4NF1A 4CAXA 4MI4A 1Y7RA 4K30A 4AVAA 4EVYA 4NCZA 1IB1E 3GKRA 2HQYA 5AG4A 3F5BA 1M1DA 1R57A 4Y49B 1KUXA 4MJ8A 3W91A 2PQ8A 4CAWA 5J8CA 2BUEA 3ZJ0A 4L89A 3FXTA 4II9A 4MFZA 4B11A 1P4NA 3TOAA 3W6SA 4AVCA 5G21A 4FD5A 2HUZA 2VXKA 5IV0A 1N71A 4Y49C 2CXAA 2OB0A 4PV6A 2H5MA 3IWEA 4B5PA 2J8RA 2OU2A 4YFJA 3G8WA 4UFVA 3CXQA 3R96A 3TE4A 1YGHA 4HKFA 4MFPA 4UWJA 4HNWB 3SHPA 2YNEA 3P2FA 5G20A 4C7HA 2ZW4A 4CGPA 4KOSA 4J3GA 2OH1A 1P0HA 2Q0YA 4AG9A 4F6AA 4U9ZA 2VI7A 1B6BA 1FY7A 4KZTA 2D4OA 1PU9A 1QSMA 3TTHA 3D2MA 3TO6A 1S7LA 4Q36A 4LX9A 4IF5A 3SXOA 1KZFA 4F0YA 5F48A 4KLVA 2PDOA 4KSFA 2K5TA 3TCVA 4B14A 3BLNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KVO E;  2BSW A;  2WPW A;  1S7K A;  1MJB A;  1GHE A;  2FIW A;  5C82 A;  2R7H A;  2Q7B A;  3R9E A;  1I21 A;  3F0A A;  4R9M A;  4KOV A;  1MJA A;  2I79 A;  2QIR A;  4GS4 A;  4H6U A;  2VBQ A;  3SXN A;  1Q2Y A;  2Q04 A;  2I00 A;  4KOY A;  1NSL A;  3QAH A;  2EVN A;  4KUB A;  3CXP A;  5GCN A;  4KOW A;  3RYO A;  3TFY A;  5IB0 A;  4MBU A;  2NMT A;  3BJ8 A;  3G3S A;  1B87 A;  2IL4 A;  2OZU A;  3EXN A;  2CNS A;  4E8O A;  2Q44 A;  3TT2 A;  1XE4 A;  3D3S A;  2JDD A;  1Y9W A;  4B5P B;  4R3L A;  3FNC A;  3S6F A;  4HNX B;  1MJ9 A;  2JDC A;  5E96 A;  2ZPA A;  2OZG A;  1YVO A;  1I12 A;  4ZBG A;  3VWE A;  1M4D A;  2JLM A;  1YVK A;  2WPX A;  4XPD B;  5IX3 A;  1S3Z A;  2O28 A;  3I3G A;  3BJ7 A;  3E0K A;  4QUS A;  4UBR A;  3ZZI A;  3DNS A;  2ATR A;  4AB7 A;  4B5O A;  3EY5 A;  4AG7 A;  1S7N A;  4CRZ B;  4PK3 A;  4NSQ A;  3K9U A;  1J4J A;  3V8I A;  1CJW A;  4YGO A;  5FVJ A;  5JQ4 A;  4E0A A;  3GYA A;  2FXF A;  4AVB A;  4FD7 A;  1UFH A;  2PR1 A;  2FE7 A;  5JPH A;  4JXQ A;  2ZXV A;  3DR6 A;  2F5I A;  1PUA A;  2KCW A;  1QSR A;  3R9G A;  4XPK A;  3R9F A;  4JD6 A;  1S5K A;  4CS0 B;  3W6X A;  2VZZ A;  2ZW7 A;  2P0W A;  4OAD A;  5C88 A;  1RO5 A;  2Z0Z A;  1XEB A;  4ONU A;  2Y0M A;  2JEV A;  2B58 A;  2REE A;  2VEZ A;  5F47 A;  5I0C A;  2GIV A;  4RS2 A;  2ZW6 A;  5H86 A;  2P6G A;  4KOX A;  2QEC A;  3FBU A;  4CRY B;  4H6Z A;  1KUY A;  3D8P A;  1M4G A;  4OLL A;  1QSO A;  3MGD A;  1I1D A;  2VZY A;  4X5K A;  1XIX A;  2DXQ A;  3T9Y A;  1L0C A;  4JLY A;  1Z4R A;  4MHD A;  1SQH A;  1YR0 A;  4XNH B;  4U9Y A;  4I49 A;  4CAV A;  3R1K A;  2B3V A;  2FIA A;  2GE3 A;  5HH1 A;  4L8A A;  4KVX A;  1TIQ A;  4XPL A;  1YRE A;  1Y9K A;  1BO4 A;  3C26 A;  1WWZ A;  2Z10 A;  1M44 A;  3PP9 A;  2ARH A;  2CNM A;  1YK3 A;  2FSR A;  5KTD A;  1IIC A;  3N7Z A;  3TO7 A;  2R98 A;  2A4N A;  2CNT A;  5KTA A;  4BMH A;  1VKC A;  3FIX A;  1U6M A;  1Z4E A;  2Z11 A;  5DWM A;  1VHS A;  3H4Q A;  2FT0 A;  4HNY B;  3TOB A;  1NMT A;  3PZJ A;  2PSW A;  2B5G A;  1XMT A;  4KVM E;  3FRM A;  2REF A;  3VWD A;  2R8V A;  5EBV A;  4R57 A;  3F8K A;  3B8G A;  2Q4Y A;  1Q2D A;  2GAN A;  2HV2 A;  2QML A;  4U5Y A;  2VQY A;  5EC4 A;  1QSN A;  3DSB A;  4NXY A;  3D2P A;  4LUA A;  4H89 A;  4QC6 A;  3LD2 A;  4ORF A;  4FD6 A;  3T90 A;  2J8N A;  4RI1 A;  4KUA A;  2B5G B;  1LRZ A;  1YLE A;  1K4J A;  1S60 A;  1Q2C A;  1WK4 A;  1CM0 A;  1XF8 A;  4E2A A;  5ISV A;  3FB3 A;  1QST A;  2FCK A;  3KKW A;  3DDD A;  4PSW A;  4QB9 A;  5KTC A;  1YX0 A;  3QB8 A;  5F49 A;  4PSX A;  5DWN A;  3S6G A;  2J8M A;  4XNH C;  3P2H A;  2D4P A;  1IYL A;  1V0C A;  1Z9U A;  1KUV A;  2G0B A;  3GY9 A;  2BL1 A;  2G3A A;  3NE7 A;  4JJX A;  4XPD C;  3JUW A;  2EUI A;  2X7B A;  4IUS A;  4UA3 A;  3UY5 A;  4M3S A;  2B4B A;  4MY3 A;  4DNC A;  1RXT A;  3CXS A;  1IYK A;  5J8F A;  3TO9 A;  3WR7 A;  4PK2 A;  2CY2 A;  2AJ6 A;  2B4D B;  3FYN A;  1MK4 A;  2FS5 A;  3PGP A;  1IID A;  2B4D A;  2G3T A;  4KOT A;  4M85 A;  1ON0 A;  2PC1 A;  3EC4 A;  2R1I A;  4YRH A;  5H84 A;  4KOU A;  3OWC A;  4QBJ A;  2B3U A;  3R95 A;  2RC4 A;  3DR8 A;  2P6E A;  4KLW A;  3IGR A;  3LOD A;  3EO4 A;  2PRB A;  3S6K A;  3EFA A;  4JXR A;  5CNP A;  4OAE A;  4R3K A;  3S6H A;  4JWP A;  4MY0 A;  5F46 A;  2BEI A;  2OZH A;  4NEX A;  4KOR A;  2P6F A;  5HMN A;  4QVT A;  1NE9 A;  2AE6 A;  3I9S A;  1BOB A;  2FL4 A;  2C27 A;  3IWG A;  4FD4 A;  4UWI A;  1OZP A;  2ZW5 A;  2Q4V A;  1S7F A;  1M4I A;  3JVN A;  2PR8 A;  4R87 A;  4NF1 A;  4CAX A;  4MI4 A;  1Y7R A;  4K30 A;  4AVA A;  4EVY A;  4NCZ A;  1IB1 E;  3GKR A;  2HQY A;  3F5B A;  1M1D A;  1R57 A;  4Y49 B;  1KUX A;  4MJ8 A;  3W91 A;  2PQ8 A;  4CAW A;  5J8C A;  2BUE A;  3ZJ0 A;  4L89 A;  3FXT A;  4II9 A;  1P4N A;  3TOA A;  3W6S A;  4AVC A;  4FD5 A;  2HUZ A;  2VXK A;  5IV0 A;  1N71 A;  4Y49 C;  2OB0 A;  4PV6 A;  2H5M A;  4B5P A;  2J8R A;  2OU2 A;  4YFJ A;  3G8W A;  3CXQ A;  3R96 A;  3TE4 A;  1YGH A;  4HKF A;  4UWJ A;  4HNW B;  3SHP A;  3P2F A;  2ZW4 A;  4KOS A;  4J3G A;  2OH1 A;  1P0H A;  2Q0Y A;  4AG9 A;  4F6A A;  4U9Z A;  2VI7 A;  1B6B A;  1FY7 A;  4KZT A;  2D4O A;  1PU9 A;  1QSM A;  3TTH A;  3D2M A;  3TO6 A;  1S7L A;  4LX9 A;  4IF5 A;  3SXO A;  1KZF A;  4F0Y A;  5F48 A;  4KLV A;  2PDO A;  2K5T A;  3TCV A;  3BLN A; 
#chains in the Genus database with same CATH topology
 4KVO E;  2Z3Y A;  1L1F A;  4LF5 O;  3CRC A;  2QWP B;  5HFM A;  5L3D A;  4IK2 A;  1MJB A;  2YIC A;  2PJ0 A;  3VQW A;  1VHE A;  3ZX6 A;  2R7H A;  3OEH G;  1X10 A;  4JI6 B;  3K57 A;  1K33 A;  5G22 A;  3R9E A;  1I21 A;  3F0A A;  5AG7 A;  3UO2 A;  3ZHV A;  2PY5 A;  2ZEH A;  4D7S A;  2QIR A;  3K9S A;  3ZIA G;  1IDS A;  5AGE A;  4L8J A;  2ZKO A;  2LW1 A;  3D3I A;  2I00 A;  1TAE A;  4NVP A;  5GCN A;  1TUB B;  4PDV A;  4DYO A;  2HVK C;  3A0R A;  5GTH Z;  3ABU A;  2HR3 A;  4CYP A;  3U10 A;  4FJC C;  4X88 A;  4RQF A;  2N05 A;  4PJ0 Z;  4X20 B;  4PD4 F;  2Q51 A;  2JBJ A;  4UCP A;  1DTD A;  2P4K A;  4QPK A;  3G3S A;  3Q4H A;  3KGQ A;  1B87 A;  2WA3 A;  4EFB A;  3ASO C;  1Q7Y W;  1IXB A;  1ARM A;  4X3R A;  1CPY A;  1AIL A;  3T4D A;  2YID A;  4C7U A;  3LWU A;  3PBE A;  2B9Z A;  1Q82 W;  1KYO F;  4Q20 A;  2LO1 A;  2UUB O;  1Y9W A;  4B5P B;  1OCC C;  2AFX A;  3CCU V;  2QA4 V;  2JDC A;  4JI8 B;  4MTF A;  4OX9 B;  1JVM A;  1Z5V A;  5LYJ A;  1NQT A;  4ZBG A;  1R3K C;  2B1I A;  1CEZ A;  2DQ3 A;  4IYH A;  4WFF A;  2WPD G;  1Q3E A;  3ZMU A;  5LXT B;  1S3Z A;  3K04 A;  2JEX A;  4CYQ A;  1TUE B;  1HWY A;  2P7T C;  1XBL A;  3CCV V;  3T1Y B;  3ZN1 A;  3VQY A;  4F6R A;  2OYQ A;  4MRI A;  3H01 A;  1KP2 A;  4HNA B;  1S7N A;  2ZM6 B;  3CE2 A;  4MTO A;  5KLV H;  4B3R B;  4M6H A;  3SYO A;  3V8I A;  3SJG A;  1Z5R A;  4CBC A;  2UXB O;  4CGM A;  3FAV A;  2ZE6 A;  2QDO A;  5FVJ A;  3ETQ A;  2E76 B;  4O4H A;  5LA6 A;  5JJJ B;  4CYO A;  5E79 Z;  3ZRX A;  4B6Z A;  1WB8 A;  1KP3 A;  2YUA A;  4JZ2 A;  3DR6 A;  4C7I A;  4LNU B;  5IY5 C;  3N2G A;  2YIA A;  5ITZ A;  4U7O A;  3SI1 A;  3WC7 A;  2HFE C;  1B04 A;  2WWW A;  3K5N A;  1TA8 A;  4DR2 O;  4O23 A;  1XDC A;  4XPK A;  4DV2 B;  2V4D A;  1S77 D;  3R9F A;  3OEE G;  2IJJ A;  2OT5 A;  1OCZ C;  3M99 B;  4R50 A;  4DR3 O;  2AFZ A;  4MFL A;  2EO8 A;  2VZZ A;  2PUS A;  3JD4 A;  1ZAU A;  2ZW7 A;  1K5S A;  3E86 A;  1BHA A;  3CPX A;  4P44 A;  3ABL C;  4JAA A;  5C88 A;  1RO5 A;  3RGB A;  1UPG A;  2LP7 A;  2YI8 A;  3ISX A;  3PN1 A;  1F2O A;  3KZI Z;  1N4C A;  3K9T A;  4OC4 A;  2R9I A;  1HNX O;  1BPM A;  3N27 A;  3H1J H;  3B77 A;  4LF9 B;  1THZ A;  3ETE A;  4LF9 O;  2R70 A;  4KOX A;  2YXL A;  2C2A A;  3TK1 A;  1L0L H;  2Z3P A;  3VH9 A;  5IT9 N;  1TKJ A;  5KAI Z;  3DGV A;  3UCS C;  7CPA A;  4LH7 A;  1KUY A;  1RP3 B;  3K9A A;  4X89 A;  4UFW A;  1PM9 A;  4BIO A;  4BIU A;  1F4M A;  2FYU H;  2DXQ A;  3JYC A;  3T9Y A;  1NBM G;  5LRJ A;  4DR3 B;  4JLY A;  3ZHQ A;  3FD9 A;  2CAZ C;  1GN3 A;  5FNV B;  4NR1 A;  3JSL A;  1AR4 A;  4XNH B;  4KUM A;  4PA6 A;  2P5O A;  4A39 A;  3PB6 X;  4OIW A;  3H8G A;  1JQ0 A;  3K0D A;  1RPR A;  2UXD O;  4GKK B;  1SS3 A;  3B7I A;  4R6Z A;  5L3F A;  3JAT B;  4XPL A;  1YRE A;  1Y9K A;  1BO4 A;  1YCI A;  1S5J A;  5JQG B;  2QE7 G;  2AHY A;  3SPH A;  5BMV B;  4NGT A;  1P49 A;  4UV8 A;  1FXK C;  2XAF A;  3C3S A;  1XOV A;  3PP9 A;  1W2B U;  1HNZ O;  1YK3 A;  1G8M A;  1JX9 A;  2FSR A;  5B1O A;  5KTD A;  4A38 A;  3B8M A;  2R98 A;  1VGY A;  3CC4 V;  2JS5 A;  2WLM A;  2CNT A;  3W7T A;  1VIX A;  1EFR G;  4FFB A;  4UVB A;  4NTX A;  5H6R A;  3M8A A;  5KTA A;  2ZM6 O;  1FJG O;  5LHI A;  4BMH A;  2JEU A;  1N33 O;  2Y0I A;  4MVM A;  4DUZ O;  1U6M A;  3ISZ A;  1Z8L A;  2Z11 A;  5DWM A;  3AG4 B;  2PZS A;  1G6U A;  4MHN A;  5JWP A;  2FT0 A;  2EIL C;  4JI5 B;  4FLU A;  4NXN B;  3JD1 A;  1YME A;  1YIT V;  4PXD A;  3BPZ A;  1QR8 A;  3MN8 A;  4DR2 B;  3JAR B;  3FRM A;  2REF A;  5EYP A;  1BGY H;  1VQ8 V;  3RFR A;  3B3V A;  3ZHT A;  3F8K A;  4DO2 A;  3K5O A;  3G6E V;  2W6I G;  2Q4Y A;  3HKD B;  4MHY A;  4NXM O;  3CXH F;  2I3C A;  2X0L A;  3RN4 A;  3H9V A;  1CPS A;  2PJ1 A;  2GAN A;  2HV2 A;  1N36 B;  2QML A;  5KUK A;  5EC4 A;  5CB4 B;  1OHH G;  5FPR A;  3DSB A;  1TVK B;  4ZY2 A;  1HNZ B;  3NH5 A;  4UFX A;  2WSS G;  3X2Q C;  5IWA O;  3PB8 X;  4QC6 A;  5LYL A;  5K8P A;  4ORF A;  2J8N A;  1SA0 B;  4J80 A;  3P3N A;  2B5G B;  2ADP A;  1GN2 A;  4B3R O;  5D5Q A;  1WK4 A;  1YJ9 V;  4YXW G;  5LMU O;  1RPO A;  5ISV A;  4LC1 A;  1SF9 A;  2XAH A;  4TT3 G;  2OIE A;  1R6N A;  5GON B;  2E75 B;  4X2T A;  1XMQ O;  3CCR V;  1A2Z A;  1VQ9 V;  1CBX A;  4B3M B;  2J8M A;  4XNH C;  2HLD G;  5D5P A;  4DXW A;  1YIJ V;  1S0V A;  1Q5O A;  4N21 A;  3IJ3 A;  4B13 A;  4JI8 O;  1FD9 A;  5G1Z A;  2JJ1 G;  3UT5 A;  3KKY A;  4PA4 A;  1V0C A;  1AJQ A;  1NT2 B;  5JVD A;  1KUV A;  2CH7 A;  1WN7 A;  4LH6 A;  3GY9 A;  2GUZ A;  4A30 A;  1IBL B;  4QNH B;  4BBH A;  4M3S A;  3OTO O;  1W0K G;  3MAQ A;  5LMN O;  1IYK A;  4M6G A;  4D6T H;  1OV9 A;  4J9Z B;  2QVP A;  2C6C A;  3IC7 A;  1JMK C;  2UU9 B;  4PK2 A;  4YIO A;  2AJ6 A;  4I50 B;  4I4T A;  2GTS A;  2KG7 B;  1MK4 A;  1BE3 H;  2B4D A;  4ZOL B;  1RSO A;  2ZDI C;  3K06 A;  3DSQ A;  4KXR A;  4KOT A;  3EC4 A;  1XHX A;  2R1I A;  4UVA A;  3LMS A;  4KOU A;  1X59 A;  4PXE A;  4DR5 B;  3D7F A;  2XND G;  1QNM A;  5BWA B;  1K97 A;  2P6E A;  2ODM A;  3LOD A;  4BIZ A;  4P6Y A;  2RFH A;  3CJH A;  3EO4 A;  3NH8 A;  4ZGY B;  3SJA C;  5J2T B;  4K0K B;  2PRB A;  5J1Q A;  3ML0 A;  1VQP V;  4LFC O;  3EFA A;  3SYA A;  1ZO0 A;  3A2F A;  1GN6 A;  2JDI G;  4JXR A;  3DLJ A;  2YS8 A;  1SRY A;  5H6Q A;  1PL4 A;  4GM5 A;  3DC6 A;  3DXR B;  4R3K A;  1M93 A;  5EBL C;  1AJP A;  3AG3 B;  3V7Z A;  1NR1 A;  2AHZ A;  2UUC B;  4CH6 A;  5CA1 B;  3W7S A;  5F46 A;  1ROP A;  4O4L A;  5LP6 A;  4KOR A;  1PL0 A;  4KHP O;  2WSA A;  2EIN C;  3I9S A;  2P22 C;  2YDE A;  1BOB A;  3IWG A;  1OZP A;  4OC5 A;  4CZZ A;  4ZX9 A;  1BAV A;  4CAE A;  2ZW5 A;  4YY3 O;  1ZLH A;  4DV0 B;  3ZBH A;  1YJN V;  3D68 A;  3JVN A;  2PR8 A;  4R87 A;  4NF1 A;  4YIP A;  4E2L A;  4X1Y B;  4JYA O;  4Z1V A;  1QQC A;  1BSM A;  1CP6 A;  1LAN A;  4X1Y A;  2PJ3 A;  1O9H A;  3GWK C;  1VQO V;  2AFM A;  4E4E A;  1Y0R A;  2ZXW B;  4DR1 O;  4AQY O;  3UM7 A;  4F9V A;  3I1U A;  3K5M A;  3JSN A;  3B4S A;  2C1C A;  4R8F A;  4ZYQ A;  4GT1 A;  1M1D A;  5L3C A;  1BQ0 A;  3FJU A;  4Y49 B;  3DGE A;  3W91 A;  3S9M A;  2PQ8 A;  3E83 A;  1PV0 A;  2BOC C;  1ENV A;  3GVM A;  1Q8I A;  4L89 A;  3ZJ0 A;  4B11 A;  2D2C B;  2VS0 A;  3W6S A;  4MVU A;  3E8G A;  1WAZ A;  3DXR A;  4HBN A;  3ZJZ A;  4FD5 A;  2VXK A;  5IV0 A;  4JZ0 A;  5KX5 A;  1N34 B;  2CXA A;  5IYZ A;  3O65 A;  2F8H A;  2AFS A;  3WB0 A;  2OU2 A;  5IJ9 A;  1DTO A;  3G8W A;  4YFJ A;  2DYS B;  2Y69 B;  2ZIN A;  2GSM B;  1Z2L A;  2OCC C;  4NKG B;  1LUW A;  4HKF A;  1V55 B;  4P4B A;  1F2P A;  5LMU B;  4UWJ A;  4CC5 A;  1R3L C;  3PEI A;  1IGB A;  1VP7 A;  4HNW B;  2UXN A;  2JEW A;  1CG2 A;  3P2F A;  5G20 A;  4C7H A;  1K73 W;  2X7R B;  4MVR A;  4CGP A;  2P67 A;  2OH1 A;  3BCC H;  4DR5 O;  4AG9 A;  5EC1 C;  3RYC B;  3FH4 A;  1ELM P;  1B6B A;  2PJB A;  1FAF A;  4ZOL A;  2RCV A;  3JCZ A;  4JGS A;  1CP7 A;  3T4Z A;  4OXS A;  5LGU A;  2KG7 A;  5B3S B;  1HDJ A;  3TX8 A;  1DK1 A;  2JJ2 G;  3WAB A;  3CEI A;  4LX9 A;  4IF5 A;  3SXO A;  2J9A A;  5H9C A;  3OFN G;  3OGI B;  1Q81 W;  3KI9 A;  5K1X A;  4DV4 O;  5EBW C;  4EEQ A;  4TWE A;  1CX8 A;  4UCO A;  2CTQ A;  4CS4 A;  1QVG U;  4QE9 A;  3FX7 A;  4IHM A;  4MCP A;  4H37 A;  2GUZ B;  2ZEE A;  1S7K A;  2X6C A;  3D36 A;  4IL6 Z;  2YEV B;  4U7N A;  4NGN A;  3TJT A;  1T5E A;  5K8O A;  1GHE A;  5JVD B;  5C82 A;  2A3Q A;  2UU9 O;  2Q7B A;  4AI8 A;  2RB7 A;  2QKS A;  4ZI6 A;  3ABL B;  1Y76 B;  1EE3 P;  1ORQ C;  4WFE A;  2I79 A;  5A28 A;  1ARL A;  2NNU A;  3EVK A;  3E35 A;  2VBQ A;  4MFJ A;  1NSL A;  3SPG A;  2ABZ A;  4CH4 A;  3TGU H;  4RN7 A;  3OTF A;  4TSF G;  3T2M A;  3RYC A;  5IB0 A;  2IJK A;  2QKA A;  3BAA A;  3GB7 C;  4BW9 A;  5JH7 B;  4DUZ B;  3TET A;  4CGO A;  1V54 B;  3BAB A;  2QWQ B;  1AP5 A;  3EXN A;  1GH6 A;  3RW0 A;  3G80 A;  1F51 A;  3TT2 A;  2VL1 A;  5KHG A;  4P2Z A;  3D3S A;  1OCC B;  1WA8 B;  4RWU A;  3RYI B;  5DM6 V;  4PDL A;  3SDL A;  1SA0 A;  3FNC A;  1MNG A;  5L3B A;  5E96 A;  2ZPA A;  4DR1 B;  4WFB V;  1SQG A;  3AK1 A;  3VWE A;  3ZMS A;  1F57 A;  1YVK A;  5K8N A;  2WPX A;  3SYQ A;  1E79 G;  2YXH A;  2XHB A;  5IX3 A;  4IT5 A;  2FKX A;  2ZR3 A;  5D8N A;  1YQE A;  3OW2 U;  3BHP A;  4J41 A;  2RNB A;  4TUY B;  3E0K A;  3IU2 A;  3ZZI A;  2ATR A;  4B5O A;  4R6T A;  3EY5 A;  5EYP B;  5CMU A;  1QLE C;  3C3T A;  3JAR A;  3ZHU A;  4JYA B;  2X6B A;  5LYD A;  3RWR D;  3E22 B;  1QR9 A;  1L8D A;  1I5X A;  4ICG A;  4LF8 B;  4PK3 A;  2YI9 A;  1J4J A;  1K9M W;  2ANP A;  2QJ8 A;  1OCO C;  2BCO A;  3B09 A;  2BSK B;  2F43 G;  1CJW A;  4JTC B;  2YXY A;  2HVJ C;  3VQX A;  3OT7 A;  2UXB B;  3D66 A;  1FFX A;  2R72 A;  1BZK A;  1ZG9 A;  2BOB C;  2OR4 A;  1IBK O;  4WFG A;  2ILM A;  1LAP A;  1Z5W A;  5HFL A;  3QAY A;  4BAY A;  4I55 B;  5JCO A;  4DV1 B;  3D7H A;  1JFF B;  4W4K A;  4JI2 B;  1NI8 A;  4DV3 O;  2QM7 A;  5BMV A;  4K3A A;  2IM9 A;  3G67 A;  3E8B A;  4MVQ A;  4LFA O;  4FM1 A;  3JAT A;  2XT9 A;  4CS0 B;  3W6X A;  2PVV A;  3R66 A;  5E1A C;  4FLX A;  4D7T A;  2ODF A;  4PI2 A;  4G28 B;  1XBU A;  4OC0 A;  4FAI A;  1AI6 A;  2EIL B;  2B58 A;  2BOA A;  5F09 A;  3TXQ A;  1HR0 B;  5I0C A;  2DF5 A;  4MHZ A;  5GTI Z;  2P4V A;  3J7A U;  5H86 A;  1U97 A;  1LR1 A;  2F7V A;  1NVP B;  3IJ4 A;  1P84 F;  1R3I C;  4OC2 A;  4B3T O;  1NH2 D;  3H1I H;  5CA0 A;  4H6Z A;  2WLL A;  1M4G A;  2V8V A;  4LFB B;  1NTZ H;  4YJ2 A;  1AYE A;  3MGD A;  2VZY A;  3ABT A;  4X66 O;  3T8W A;  4I4T B;  2E5L B;  2DPT A;  4FLT A;  4L87 A;  4MW8 A;  1X4T A;  4JI5 O;  1XOU A;  2V8H A;  1MA1 A;  4PXB A;  3ABK B;  2Y69 C;  2PI5 A;  1IXM A;  2GE3 A;  5JJN B;  5EMI A;  2PJ4 A;  4KVX A;  4JI7 O;  2D3O W;  5IJ0 A;  3IAY A;  4KP4 A;  3E8F A;  1F7Y A;  4DK0 A;  1AVM A;  1Y4M A;  3UT5 B;  2WYR A;  3C26 A;  1YEW A;  4PA7 A;  3JAM N;  2Z10 A;  3OR6 C;  4PDR A;  2EZP A;  4WFH A;  2Q4P A;  1H2L A;  2QEX V;  4BWA A;  4LNU A;  1V55 C;  2ZCE A;  2VRZ A;  2NLJ C;  4PA9 A;  4KSA A;  1H38 A;  1B06 A;  5GON A;  4O4H B;  3JAK A;  4JAS A;  4JPR A;  3SJC C;  5GW7 A;  1VKC A;  2DEA A;  2K9P A;  5F2V O;  3SJF A;  1Z4E A;  5C93 A;  4DR6 O;  1SZT A;  1GK9 A;  2GU2 A;  3B3T A;  4MMO A;  3ASN C;  3D7D A;  1SQV H;  4B10 A;  3TOB A;  4H2K A;  4LQ6 A;  2VWJ A;  3K08 A;  4JI0 O;  4ONW A;  4UVC A;  2Y4U A;  2PSW A;  2B5G A;  2Q7E A;  4IIJ A;  3VWD A;  3HR0 A;  1IY7 A;  1EZJ A;  2YGW A;  3LNM B;  3B8G A;  2EBJ A;  4GZR B;  2DW4 A;  1TVK A;  5LOV B;  5LXT A;  2AFW A;  4UEE A;  3KR4 A;  3LNN A;  2Q0O C;  4MVO A;  1HDU A;  3F5T A;  1VHO A;  5CBM A;  1M56 B;  2CUG A;  4H89 A;  3KAS A;  1B3Q A;  5B1B C;  1Y74 B;  3T90 A;  2QM8 A;  4CGL A;  2NR5 A;  1H2S B;  2AW9 A;  1Z8T A;  1YLE A;  3CC2 V;  1VF6 A;  3FB7 C;  1K4J A;  4DR7 O;  1BLL E;  2A79 B;  1S60 A;  4UCM A;  3QNE A;  5J9P C;  3RYF B;  3ETD A;  3X2Q B;  3STZ C;  4CPA A;  1H8L A;  3FB3 A;  5ELY A;  4B3T B;  2KQX A;  1QST A;  3IO1 A;  3PFO A;  4WBN B;  3KKW A;  1BQZ A;  1VQL V;  4UEF A;  1MZF A;  2Q4Z A;  1YX0 A;  3QB8 A;  5F49 A;  5CBG A;  4HYO A;  5DWN A;  4PI0 A;  3S6G A;  3BY6 A;  4EB6 B;  4FBE A;  5C8Y B;  3CRQ A;  4XDK A;  1WP7 A;  1ZL8 B;  4IAV A;  3RYH B;  4ZHQ B;  4J7J A;  1SKV A;  4GLX A;  1WJZ A;  3FFQ A;  3OD4 A;  2G0B A;  2EK8 A;  4DV4 B;  1K34 A;  2G3A A;  3NE7 A;  4JJX A;  4KSI A;  1JOY A;  3CPW U;  2P6J A;  2EUI A;  4IUS A;  1OCO B;  3FED A;  3CXS A;  1K7D A;  1QCE A;  5FNV A;  3DTU B;  3K79 A;  1UWY A;  5KHJ A;  2UUC O;  1DE4 C;  1Y66 A;  4F6E A;  1IBM O;  1IID A;  4XDJ A;  3S9N A;  5DN6 G;  2XAG A;  1ON0 A;  3ZED A;  5KAF Z;  5H84 A;  4QBJ A;  4WF9 V;  3FVL A;  3R95 A;  3H8F A;  1TXR A;  3SI2 A;  2GTA A;  1ZG8 A;  1K8A W;  4J11 A;  3OR7 C;  1FFT B;  3SYP A;  3S6K A;  1OCR C;  1ZL8 A;  4JI0 B;  2LW7 A;  4X9Q A;  4JYB A;  1LFW A;  2JGU A;  4MW3 A;  4A95 A;  2GLF A;  1WPX A;  2F1M A;  4OAE A;  2CTR A;  4U3J A;  1VQ7 V;  3VBB A;  4HZ3 A;  3KG2 A;  4JWP A;  1JPX A;  4MY0 A;  4G2K A;  3HKB B;  2PE3 A;  1N36 O;  2BEI A;  1SQP H;  4MS2 A;  4NEX A;  5AG5 A;  3CCL V;  3BFR A;  1S76 D;  2P6F A;  3HUV A;  3JTK A;  3AG1 B;  3C90 A;  4P45 A;  2Q68 A;  2BTQ B;  4I9W A;  2ZD9 A;  2AE6 A;  3O9O A;  1EM1 A;  3AG2 B;  3MRU A;  3N2G B;  5B3S C;  2XAS A;  3A8T A;  4JYC A;  4XDL A;  3OTO B;  4W4L A;  1M4I A;  5IYC O;  5B1N A;  1WNS A;  1TF8 A;  2DPS A;  1A32 A;  1H2K A;  3WB1 A;  2GRE A;  4PXC A;  5LA6 B;  1KC8 W;  1NU1 H;  5CBH A;  1XHZ A;  1B6Q A;  4MI4 A;  4OC1 A;  3FAV B;  1Q6U A;  2PF4 E;  3ABK C;  4EVY A;  2A7W A;  3CSX A;  1GM8 A;  1IB1 E;  1I0H A;  4FZ1 A;  4JF3 A;  4DR7 B;  2P06 A;  1SQF A;  2Q43 A;  3GKR A;  2HQY A;  1KEC A;  1Z8W A;  3SI0 A;  3B2E E;  4LWS A;  2ZOF A;  4IIJ B;  1Q43 A;  4HNA A;  1CP9 A;  4UXN A;  1R57 A;  3B35 A;  2DYR C;  4LWS B;  1I08 A;  2JBK A;  2DWD C;  3S3X A;  3CME V;  2PI4 A;  1JR9 A;  1N0J A;  3FXT A;  3B3C A;  4AVC A;  3CCE V;  3JAK B;  4DW1 A;  3N2K B;  4Y49 C;  2H5M A;  4B5P A;  2J8R A;  5LRK A;  5BXZ A;  3CHX A;  1Z8X A;  2Q7G A;  3WB2 A;  3R96 A;  5IWA B;  1F4N A;  1HR0 O;  4KL1 A;  2HP8 A;  4PV1 B;  3SPI A;  2BTQ A;  3CZX A;  3UQ8 A;  4H0L B;  2OTL V;  2YNE A;  2PCU A;  1M5I A;  2ZW4 A;  4KOS A;  4ZI7 B;  4F6A A;  5CBF A;  1OCR B;  1TUB A;  4G27 B;  2VI7 A;  4U3J B;  4DV6 B;  1FY7 A;  3TTH A;  1EBO A;  2B1G A;  2IH3 C;  4UCR A;  2XEF A;  3TO6 A;  1KZF A;  4F0Y A;  2ZE5 A;  4UIA A;  1JCH A;  3RT3 C;  3FB5 C;  4KSF A;  1XFO A;  1IBK B;  1VQ4 V;  2OWO A;  3WG7 B;  2FB5 A;  2WLL B;  3U0Z A;  2BSW A;  2WPW A;  4JI7 B;  1YHQ V;  3P3P A;  2RQ6 A;  4X62 B;  5A27 A;  3JAS A;  2L35 A;  3ZCC A;  2BO9 A;  4KOV A;  4DV5 B;  1MJA A;  3RAM A;  1HW7 A;  4H6U A;  4FFK A;  4P30 A;  5I4M A;  1M90 W;  2AGA A;  4P10 A;  3V38 A;  2R9A A;  3KQZ A;  4DUY O;  4X66 B;  3CXP A;  4KOW A;  1KWM A;  4TQF A;  3TFY A;  2IW5 A;  4GKJ B;  1MG1 A;  1S3J A;  2QSA A;  4UCT A;  4NGS A;  3PFE A;  2CGO A;  3ZHS A;  2IMO A;  1FXV A;  4DV7 B;  5HVF A;  2IL4 A;  2OZU A;  3BVO A;  4ZHQ A;  2CNS A;  1JA8 A;  2MK3 A;  3RYH A;  1TKH A;  1JJ2 U;  1QMU A;  3S3W A;  1XE4 A;  2JDD A;  4PDM A;  1JFF A;  5C8Y A;  1O9G A;  4R3L A;  3S6F A;  4EB6 A;  1YZB A;  4U3F H;  3B3S A;  1MJ9 A;  3VAR A;  1KU9 A;  2N04 A;  3PBB A;  1I12 A;  1GAX A;  2JGD B;  1EN4 A;  1FFX B;  2JLM A;  2GFQ A;  5DS0 A;  2KKW A;  4WBN A;  3LSU A;  4B12 A;  1GN4 A;  1NH2 B;  2BE3 A;  2O28 A;  2Y0P A;  2ETN A;  2ZR2 A;  2GDS A;  4QUS A;  1H8E G;  1QLE B;  3A0B Z;  3RYF A;  4AG7 A;  2EIJ C;  2F93 B;  4B08 A;  5JM6 A;  3ICX A;  3UO3 A;  1FT7 A;  1S72 V;  2HEP A;  1Q6I A;  3E22 A;  2W6J G;  4TV9 A;  3U11 A;  2F4V O;  3K9U A;  4NSQ A;  5BR8 B;  1N34 O;  4CRZ B;  2WLI A;  4JAU A;  5LYF A;  4NYK A;  1Y74 A;  1YW4 A;  3IFE A;  4TUY A;  4FPP A;  2X6A A;  4YGO A;  3D3Q A;  4E0A A;  3GYA A;  2FXF A;  4R7M A;  4K8X A;  3JAL B;  1CPX A;  2ZEN A;  1OCZ B;  4FD7 A;  5LOV A;  3AG3 C;  2FE7 A;  4JXQ A;  2ZXV A;  2IU0 A;  1K3E A;  2F5I A;  1FKA O;  1PUA A;  2M6Y A;  1WA8 A;  1QBZ A;  3RYI A;  2ITC C;  4LR3 A;  4FZ0 A;  2KCW A;  1QSR A;  3R9G A;  4JI6 O;  3L72 H;  3CD6 V;  3TXS A;  3JAW A;  1UFI A;  2ZIM A;  2POK A;  2IBZ H;  1K4C C;  1M1K W;  4OAD A;  1Y7E A;  5JH7 A;  1ZLI A;  2PIZ A;  1FXH A;  1XEB A;  2PJ2 A;  4JI1 B;  3AG1 C;  1JJO A;  3ASN B;  4XBF A;  2KB1 A;  4FM2 A;  2E74 B;  1QU7 A;  2UUA B;  2Y0M A;  4P4I A;  2JEV A;  2REE A;  4PQA A;  1M56 C;  5EZY B;  2QGN A;  1VQM V;  3APO A;  2O4H A;  4I5S A;  1LAM A;  2GIV A;  2DN9 A;  4X8A A;  4RS2 A;  3K59 A;  2YND A;  4TV8 A;  1H2N A;  3T1C A;  5IJ0 B;  2YEV A;  2ZEL A;  4GUN A;  3FEE A;  1PYT B;  4C2X A;  4OP4 A;  4DV7 O;  1KQS U;  3K5L A;  4OLL A;  1RTQ A;  1QSO A;  1I1D A;  5CA3 A;  1YF2 A;  4X1K B;  5KHK A;  1XIX A;  1GO3 F;  1KKC A;  4GKJ O;  1YTF B;  4AHC A;  4LF7 O;  4DRX A;  2HB6 A;  1SQH A;  3QO8 A;  1WLE A;  1LUV A;  4P4E A;  4P4F A;  5LHG A;  4U9Y A;  4UB8 Z;  1H2G A;  4C2Y A;  4B7E A;  4I49 A;  4YJ2 B;  1NSA A;  4CAV A;  3CC7 V;  3R1K A;  3BXM A;  1EZV H;  2B3V A;  2FIA A;  3EFF K;  3L2N A;  4L8A A;  1HNW O;  4JV5 B;  4CS2 A;  3NH4 A;  5CA0 B;  3K3W A;  2AFU A;  2P90 A;  2CGN A;  3HPL C;  4ZBM A;  3CCM V;  1Q86 W;  3B8N A;  2JIZ G;  3NR7 A;  1XJO A;  3FEC A;  4X64 B;  3CMA V;  3IEH A;  4LF5 B;  2Q0A A;  3K2K A;  2ARH A;  5EC2 C;  1FXK B;  2XOK G;  2CNM A;  4YY3 B;  2Q7H A;  3QF7 A;  2WAM A;  4KS9 A;  3N7Z A;  2Q67 A;  1HDQ A;  1YXB A;  4QGP A;  5EIB D;  5AG6 A;  3S9L A;  4NJQ A;  2OOT A;  4GX1 A;  4UCS A;  1Q7L A;  2QWO B;  4IYI A;  1I94 B;  3NA6 A;  5BR8 O;  2YNC C;  3FB8 C;  1K4D C;  4UCU A;  2CK3 G;  1XI1 A;  1S5H C;  4EME A;  1R3N A;  3A9L A;  2Q6A A;  1D2D A;  4I55 A;  3JRU A;  4KVM E;  4H33 A;  3T1H B;  4MCQ A;  2RMK B;  4MHP A;  4FLZ A;  2R8V A;  5EBV A;  2RJZ A;  4MCS A;  1ZX3 A;  2EIM B;  1PNK A;  4J7Z A;  1MSD A;  4B3S O;  1W59 A;  2GHY A;  2LQT A;  1Q2D A;  4X64 O;  3CCQ V;  2AZ0 A;  3AK2 A;  4C2Z A;  1QSN A;  4YU9 A;  3D2P A;  2QJ1 A;  4LUA A;  3LDC A;  1XMO O;  2BSK A;  3CRA A;  1ZTE A;  5K8M A;  2ZEM A;  4RI1 A;  3LDE A;  2Z0A A;  2PYJ A;  1IOI A;  5IY5 B;  1ZLZ A;  3JD3 A;  3FB6 C;  1YVW A;  4FK5 C;  1XIL A;  3D4U A;  4JI4 O;  3L73 H;  3OGC C;  2HKO A;  1CM0 A;  3IIB A;  3W7W A;  1MOF A;  1XF8 A;  3ZRS A;  4UCN A;  1VMG A;  4A2Z A;  4O4L B;  4JTD B;  5CA1 A;  4IGG A;  1SZX A;  3PJS K;  3J81 N;  2ZDI A;  4JZG A;  2FCK A;  1RFY A;  1IVS A;  3DDD A;  4FLW A;  4HAM A;  5KTC A;  2WUU A;  2HHH O;  3TCU A;  3OM3 B;  3A0H Z;  3FYE B;  4JYY A;  3RNZ A;  4AXV A;  2R9R B;  1MMM A;  1XL6 A;  4WCE V;  2MW2 B;  2OCC B;  2YSU B;  1H2M A;  4F9U A;  1Z9U A;  4GX0 A;  2Y48 A;  1J95 A;  4JYW A;  4O4J A;  2XAQ A;  4DV1 O;  4GYC B;  2BL1 A;  3JUW A;  3RBU A;  2QM4 A;  4FM0 A;  3QG5 A;  2X7B A;  4UA3 A;  4R8C A;  2B4B A;  1XUQ A;  3PB4 X;  4MY3 A;  4DNC A;  1RXT A;  2VQE O;  1PNM A;  1AMP A;  4Z2W A;  1XRY A;  2EBO A;  3WR7 A;  2CY2 A;  4UB6 Z;  2B4D B;  3D7G A;  3B2Y A;  3APQ A;  3PGP A;  4UUJ C;  4I0X B;  4P4J A;  1KMI Z;  1Y76 A;  4WFA V;  3MDS A;  1P4R A;  2G3T A;  4MFK A;  4M85 A;  2PC1 A;  4DR6 B;  4X1I B;  4R7C A;  3PRT A;  4ZX8 A;  2ZIO A;  2CTB A;  2B3U A;  4JI3 O;  3J80 N;  3DC5 A;  2PVW A;  3CPA A;  4MT8 A;  5J2U B;  2RC4 A;  3DR8 A;  4KLW A;  4MTG A;  5KA5 A;  1I5Y A;  2ITD C;  2XUM A;  2CH7 B;  3IGR A;  3PB7 X;  1SC5 B;  4O4I A;  1P7G A;  4P9O A;  4DUK A;  3RVZ A;  4GXH A;  3B40 A;  4LP8 A;  5CN0 A;  3L70 H;  1GTO A;  4DV3 B;  2FML A;  4MVZ A;  3B3W A;  3KHZ A;  3IFX A;  1TKF A;  2EIN B;  1IX9 A;  3OUF A;  4OKO A;  3G71 V;  2LFS A;  4F4L A;  5CNP A;  3VAT A;  2DQ0 A;  1W0J G;  2QWN B;  3S6H A;  2CTW A;  2Z3K A;  1HEE A;  5L3G A;  2QKC A;  4UF4 A;  2EUL A;  2OZH A;  2ZEF A;  1NVP D;  2AFO A;  3SJX A;  1IBL O;  4ZKI A;  1GM7 A;  2DMX A;  3KCX A;  5HMN A;  3BI1 A;  4LBE C;  3P32 A;  1NE9 A;  4FD4 A;  4UWI A;  1XMB A;  3QO5 A;  3MD0 A;  5LRG A;  2Q4V A;  5IJ9 B;  3N5F A;  1S7F A;  4CH3 A;  1R43 A;  2A06 H;  2ADQ B;  5IYZ B;  3FF3 A;  3HKC B;  4K8Z A;  4I9Q A;  1BT8 A;  5KX5 B;  1IZ3 A;  2QR4 A;  3L9D A;  3FYI B;  3CX5 F;  5A9G A;  1J5E B;  5THW A;  4CAX A;  5LHH A;  4ZY1 A;  2Q9L A;  5CB4 A;  1U96 A;  4K30 A;  1XNR O;  2UUB B;  1M4L A;  2V1D A;  4NB5 A;  3CCS V;  1SER A;  3HKD A;  1URF A;  4DYL A;  5KMG A;  1XNR B;  4TNU A;  2CF4 A;  3QNV A;  5LGT A;  1ARO P;  1DF5 A;  2K1E A;  3ZN0 A;  4QE7 A;  5IYD O;  4O2B A;  1Y0Y A;  4PHZ A;  5L3E A;  2UXC B;  4CAW A;  5J8C A;  2ZOG A;  3ZMZ A;  2PJA A;  1WB7 A;  2WLJ A;  1TF9 A;  1AUG A;  4MFZ A;  1P4N A;  3TOA A;  5G21 A;  4K35 A;  3ZMV A;  3KCY A;  2HUZ A;  1SES A;  4NXM B;  4FFB B;  2WLH A;  4R76 A;  4RUH A;  2DYR B;  4X65 O;  1PPJ H;  4KHP B;  2OCH A;  3THO A;  2EJR A;  4HPS A;  1NZ6 A;  4NGR A;  1YDX A;  1YTF D;  1YGH A;  4FIP C;  4MFP A;  4O4I B;  3ABM B;  5JJE B;  5J2U A;  2ZQM A;  2WLN A;  5LP6 B;  2PIY A;  1R73 A;  4K0K O;  4J3G A;  2F66 C;  1FJG B;  3CS5 A;  4JI3 B;  1M57 B;  2Q0Y A;  4Q7A A;  2YC0 A;  5D29 A;  3SJE A;  4U9Z A;  4X1I A;  2W0X A;  2IJZ A;  2BTO A;  1NKD A;  5EIB C;  5BY1 A;  1R1B A;  2UXC O;  2D4O A;  4KZT A;  1PU9 A;  1QSM A;  5KHH A;  2HJF C;  3KZW A;  1AR5 A;  1S7L A;  3IC9 A;  5CPA A;  3WC5 A;  2E3C A;  3JD0 A;  4IHJ A;  5LL6 Y;  3E8H A;  4P9P A;  3L74 H;  4OPH A;  5J2T A;  3GLJ A;  4KLV A;  5F48 A;  4TOI A;  2GLJ A;  2PDO A;  3CJH B;  1LOK A;  3WG7 C;  1Y67 A;  2K5T A;  3TCV A;  4B14 A;  3BLN A;  4J42 A;  3SGI A;  4RQE A;  2QYV A;  1V9P A;  4O4J B;  3GWO A;  2FIW A;  2FTK A;  2RN9 A;  1R6K A;  1BMF G;  3BEH A;  3SPC A;  4YHH B;  4IHJ B;  1RSO B;  4R9M A;  2EK9 A;  2DE0 X;  2C6P A;  2F4V B;  3SPJ A;  4DK1 A;  4GS4 A;  2F95 B;  2VQF B;  1FPO A;  2Q73 A;  2ZNJ A;  4DV5 O;  1G1X B;  4I50 A;  3MHH C;  1Q2Y A;  2Q04 A;  3SXN A;  1N33 B;  4KOY A;  3JCU Z;  4EFE A;  4NTY A;  3QAH A;  2EVN A;  4KUB A;  4DW0 A;  1VQ5 V;  3KL9 A;  3RYO A;  1XNQ O;  4MBU A;  1V54 C;  2NMT A;  1XNQ B;  1NTK H;  2O53 A;  3BJ8 A;  4NFR A;  1AB3 A;  3CB2 A;  3CYO A;  3PB9 X;  2BCC H;  3M7M X;  1LNQ A;  3OE7 G;  2CDY A;  1MZE A;  2PRQ A;  4E8O A;  4OPA A;  2Q44 A;  2ZEG A;  3CWB H;  3FKS G;  5ITZ B;  4LFC B;  3H5Z A;  3H1L H;  2QWR B;  4HNX B;  2NSM A;  2OZG A;  1YVO A;  2IU3 A;  4LFB O;  1M4D A;  1WPB A;  1GMG A;  3ZHR A;  2AZ2 A;  4XPD B;  2LGQ A;  1F23 A;  4BD9 A;  3LSS A;  4TQD A;  4MFQ A;  2ZT9 B;  1N0N A;  1IOF A;  3I3G A;  3BJ7 A;  4UBR A;  3NFZ A;  4AB7 A;  3RBZ A;  3DNS A;  1KB9 F;  2EZO A;  5B66 Z;  2OIG A;  4O2B B;  3CP1 A;  2H8P C;  5JGF A;  1YLO A;  2JRI A;  3SR2 C;  1WP8 A;  5KUM A;  5DEC A;  4K3N A;  5A2Q N;  1X12 A;  5KMG B;  1XQ8 A;  3KR5 A;  1OBR A;  5LGN A;  3T1H O;  5JQ4 A;  2V7Q G;  5H5N A;  4AVB A;  1VAR A;  3D8C A;  3HKC A;  1UFH A;  2PR1 A;  4C68 A;  2ZNI A;  5JPH A;  3TC8 A;  3E89 A;  2Z3N A;  1N32 O;  5IDJ A;  3CT9 A;  1BHB A;  3H8E A;  1IU8 A;  4UIB A;  2DYS C;  2A9H A;  3NXS A;  2GV9 A;  4N23 A;  3VOU A;  4DV6 O;  1FNO A;  3GIU A;  2Z5U A;  2A0L A;  1YW6 A;  2HHH B;  5FL7 G;  1SQX H;  3ZMT A;  4JD6 A;  2M7W A;  1S5K A;  3W7X A;  2P0W A;  4MVS A;  1HNW B;  1E1R G;  4JV5 O;  1XRE A;  4X20 A;  2Z0Z A;  3G6B A;  4RO2 A;  3HLP A;  2O57 A;  4NTW A;  1CXZ B;  3ZS8 C;  3G4S V;  3BA8 A;  4ONU A;  2XEJ A;  1AI7 A;  2VEZ A;  5F47 A;  3MHS C;  2YIB A;  1JWQ A;  2DJV A;  4Z1M G;  3IGA C;  2ZW6 A;  1LCP A;  2P6G A;  3BI0 A;  4CS3 A;  5HVG A;  2H3O A;  1XL4 A;  5JQG A;  2QEC A;  3FBU A;  3KQX A;  2IQ6 A;  2WLK A;  4EFD A;  1KKD A;  3KHX A;  5H2F Z;  3BRC A;  1Y6X A;  1BPN A;  4DR4 O;  4CRY B;  3SJQ C;  1M4U A;  4LF6 B;  4QJF B;  1Q90 D;  1SQQ H;  2C6G A;  2ZE7 A;  3D8P A;  3OMI B;  4DUY B;  3CXC U;  4X8I A;  4ABM A;  4TV8 B;  1GRJ A;  4X5K A;  2ATK C;  4I0X A;  2PJ8 A;  3L75 H;  2XEI A;  5HXD A;  1L0C A;  2Q5Z A;  4CC6 A;  5EZY A;  2NYQ A;  2ZE8 A;  1Z2G A;  1Z4R A;  4A37 A;  4MHD A;  1AR1 B;  1YR0 A;  2HJD A;  3QVN A;  1OZ0 A;  4UV9 A;  4B3M O;  4Q38 A;  4A32 A;  4H44 B;  2EIK B;  5IE9 A;  4CH5 A;  2IH1 C;  3HKE B;  3IU1 A;  5HH1 A;  1RM1 C;  4P4D A;  1TIQ A;  1TGO A;  2Z3M A;  1NJI W;  2HG5 C;  5B1A C;  4LF4 B;  1S5L Z;  1WWZ A;  1M44 A;  4B7K A;  3EXA A;  2Y4T A;  4PPZ A;  1IIC A;  4MCR A;  2XEG A;  3TO7 A;  3SYC A;  2A4N A;  3ABM C;  2Z3O A;  4JI1 O;  1PCA A;  2IJI A;  4AQY B;  3JAL A;  3HB3 B;  4PEL A;  3E2E A;  1MSW D;  3OUS A;  1HP8 A;  1SQB H;  4FMT A;  3FIX A;  3OMA B;  4F8Z A;  1Q6H A;  4QPJ A;  2B5U A;  1AI5 A;  2ZEO A;  4JTA B;  1JQG A;  2WLI B;  1VHS A;  3H4Q A;  4HNY B;  4DJL A;  4TV9 B;  4ASU G;  3ZRW A;  1ZWI C;  1NMT A;  3K58 A;  5EK0 A;  1PKX A;  2PJ6 A;  3CRM A;  3PZJ A;  4BR6 A;  4CGN A;  4FUU A;  1YSJ A;  4KFM A;  2H94 A;  1XMT A;  3FMC A;  4CAF A;  2EIM C;  5FLX N;  5IB9 A;  3RVY A;  4R57 A;  4A94 A;  4LF4 O;  1ZUQ A;  4FVM A;  1EN6 A;  5EBM C;  4UCV A;  4WWV A;  4U5Y A;  2VQY A;  3GB0 A;  1DF4 A;  2VQE B;  4O2A B;  1ZG7 A;  4NXY A;  2JVD A;  2JGD A;  1VEW A;  8CPA A;  1QLN A;  3LD2 A;  2FVG A;  4UEZ A;  4FD6 A;  2OTJ V;  1VIB A;  1M9N A;  3D67 A;  2LFR A;  4X65 B;  4KUA A;  1LRZ A;  2YIB D;  3BHX A;  2QTO A;  1KD1 W;  4FWU A;  4M6I A;  5DED A;  3BA9 A;  2DOS A;  1KUQ A;  3QO7 A;  1H8H G;  1Q2C A;  2KSD A;  4F6R B;  1DGS A;  2EIK C;  3I5D A;  4J10 A;  1ELL P;  3ETG A;  2RDC A;  4E2A A;  3LUT B;  3QTC A;  1N8R W;  2G38 A;  4J7K A;  4LF8 O;  4DR4 B;  4A33 A;  1XMQ B;  1VF7 A;  2E5L O;  4PSW A;  4QB9 A;  1IUR A;  5KHI A;  5LYJ B;  4PSX A;  1GM9 A;  1AI4 A;  4LCU C;  3ASO B;  1GKF A;  4QIW F;  1FYJ A;  2PJC A;  4LF7 B;  3P2H A;  3F7Y C;  1J5E O;  1FXK A;  3RZA A;  5LBQ A;  2Z3L A;  4Q6G A;  2D4P A;  1NTM H;  4LF6 O;  1QQ9 A;  1IYL A;  2CTC A;  4OGQ B;  4YJ3 B;  2JS3 A;  4FLV A;  4BIN A;  4X62 O;  1L0N H;  2F23 A;  2XTA A;  3Q4H B;  3RO0 A;  4A31 A;  4XPD C;  4EWT A;  3F7V C;  4NGM A;  4J9Y B;  3UY5 A;  1COW G;  4DV0 O;  4GX2 A;  4OME A;  1VF6 C;  4YWY A;  2YNC A;  3OMN B;  4LFA B;  4OID A;  5J8F A;  2UXX A;  3TO9 A;  3I55 V;  1E1Q G;  2CE4 A;  5K1P A;  2PGG A;  3R65 A;  5FPO A;  3FYN A;  4DRX B;  3LAC A;  4MXU A;  1HNX B;  2EWB A;  2FS5 A;  1YSC A;  3CRR A;  3WU2 Z;  4X1K A;  3CDX A;  2UUA O;  4MSW C;  4NXN O;  4H13 B;  4YRH A;  2CTP A;  3OWC A;  4OC3 A;  4LQG A;  4ZI7 A;  5B5E Z;  4CYN A;  3SJB C;  2W0F C;  3VQV A;  3K03 A;  5TIS Z;  1I94 O;  2LJ2 A;  2VQF O;  2PJ9 A;  4RUF A;  2HC9 A;  1AJN A;  5LP6 C;  1N32 B;  2DWE C;  4JI4 B;  4YJ3 A;  1M57 C;  3LSQ A;  5IYB O;  3WC6 A;  4EKW A;  4F0X A;  1US6 A;  1K92 A;  3N2K A;  4Z65 A;  2PYL A;  2Q7S A;  5KA6 A;  1XMO B;  2WZN A;  1VQ6 V;  3WFV A;  3I56 V;  3JAW B;  4RUE A;  4BW5 A;  1NR7 A;  4B3S B;  4QVT A;  2GBO A;  2C27 A;  2FL4 A;  3JD2 A;  3AG2 C;  3AK3 A;  4NGP A;  2EX3 A;  1QHT A;  3UKM A;  3T1Y O;  1R6T A;  1AP6 A;  1BCC H;  3IWW A;  1KBH A;  2QTS A;  2ZED A;  5BZB A;  1Y7R A;  4O2A A;  2WA4 A;  2VWK A;  3W7U A;  1SET A;  1OJH A;  1IBM B;  4AVA A;  2PTM A;  4NCZ A;  4OX9 O;  2ZEP A;  1P7B A;  4RAI A;  2ZXW C;  4NGQ A;  4I7Z B;  3WT4 A;  5B1B B;  4ZY0 A;  5HVH A;  2PJ7 A;  5AG4 A;  3F5B A;  2PJ5 A;  1KUX A;  4MJ8 A;  3GUX A;  2N74 A;  3ZRW B;  2IJH A;  1VF5 B;  1PP9 H;  4NJR A;  4FLY A;  4ZIB A;  1I7F A;  2BUE A;  4AIL C;  3NE8 A;  3HKB A;  4W9Y A;  4GCZ A;  1RM1 B;  3LDD A;  4II9 A;  2EIJ B;  4GKK O;  2UXD B;  1DLB A;  1EN5 A;  4G1P A;  3P30 A;  1PNL A;  2AXT Z;  3STL C;  2LGW A;  3K0G A;  2CIJ A;  1PD3 A;  1GYT A;  5B1A B;  1N71 A;  1VQK V;  3FX6 A;  2V8G A;  4UFZ A;  3AG7 A;  4DV2 O;  2OB0 A;  4YHH O;  3IC1 A;  4PV6 A;  3IWE A;  4MTX A;  3AEI A;  5JH9 A;  3ZRV A;  3CXQ A;  4UFV A;  2NN4 A;  3TE4 A;  5LYI A;  2G9D A;  4WJB A;  2EJ7 A;  3EHB B;  3H1H H;  4PA3 A;  3SHP A;  1VQN V;  5JCO C;  1MAB G;  3F5W C;  3H1K H;  5AG2 A;  1NS1 A;  1P0H A;  3L71 H;  2Q8V A;  3CCJ V;  3HKE A;  2L6L A;  4JI2 O;  3D36 C;  1BS3 A;  3OAA G;  4JAV A;  1YJW V;  1D5A A;  1YI2 V;  1D5N A;  3D2M A;  6CPA A;  1ZSP A;  4Q36 A;  2JK5 C;  1K5Q A;  5LMN B;  1FS0 G;  2XAJ A;  1R3J C;  4A5U B;  2V77 A;  1QVF U;  1BL8 A;  3JAS B;  4TWK A;  1G4Y B;  4GX5 A;  2Q69 A;  2V8D A;  1UJW B;  3AG4 C;  1XEQ A; 
#chains in the Genus database with same CATH homology
 4KVO E;  2BSW A;  2WPW A;  1S7K A;  1MJB A;  1GHE A;  2FIW A;  5C82 A;  5A27 A;  2R7H A;  2Q7B A;  5G22 A;  3R9E A;  1I21 A;  3F0A A;  4KOV A;  4R9M A;  5AG7 A;  1MJA A;  2I79 A;  2QIR A;  5A28 A;  4GS4 A;  4H6U A;  5AGE A;  2VBQ A;  3SXN A;  1Q2Y A;  2Q04 A;  2I00 A;  4KOY A;  4MFJ A;  1NSL A;  3QAH A;  2EVN A;  4KUB A;  3CXP A;  5GCN A;  4KOW A;  3RYO A;  3TFY A;  5IB0 A;  4CYP A;  4MBU A;  4CGO A;  2NMT A;  4UCP A;  3BJ8 A;  3G3S A;  1B87 A;  2IL4 A;  2OZU A;  3EXN A;  2CNS A;  4E8O A;  2Q44 A;  3TT2 A;  1XE4 A;  3D3S A;  2JDD A;  1Y9W A;  4B5P B;  3H5Z A;  4R3L A;  3FNC A;  3S6F A;  4HNX B;  1MJ9 A;  2JDC A;  5E96 A;  2ZPA A;  2OZG A;  1YVO A;  1I12 A;  4ZBG A;  3VWE A;  1M4D A;  2JLM A;  1YVK A;  2WPX A;  4XPD B;  5IX3 A;  1S3Z A;  4B12 A;  4MFQ A;  2O28 A;  4CYQ A;  3I3G A;  3BJ7 A;  3E0K A;  4QUS A;  4UBR A;  3IU2 A;  3DNS A;  2ATR A;  3ZZI A;  4AB7 A;  3EY5 A;  4B5O A;  4AG7 A;  1S7N A;  4CRZ B;  4PK3 A;  4NSQ A;  3K9U A;  1J4J A;  3V8I A;  1CJW A;  4CGM A;  4YGO A;  5FVJ A;  5JQ4 A;  4E0A A;  3GYA A;  2FXF A;  4AVB A;  4FD7 A;  4CYO A;  1UFH A;  2PR1 A;  2FE7 A;  4C68 A;  5JPH A;  4JXQ A;  2ZXV A;  3DR6 A;  2Z3N A;  4C7I A;  2F5I A;  1PUA A;  2KCW A;  1QSR A;  3R9G A;  4XPK A;  3R9F A;  4JD6 A;  1S5K A;  4CS0 B;  3W6X A;  4MFL A;  2VZZ A;  2ZW7 A;  2P0W A;  4OAD A;  5C88 A;  1RO5 A;  2Z0Z A;  1XEB A;  4ONU A;  2Y0M A;  2JEV A;  2B58 A;  2REE A;  2VEZ A;  5F47 A;  5I0C A;  2GIV A;  4RS2 A;  2ZW6 A;  2YND A;  5H86 A;  2P6G A;  4KOX A;  2QEC A;  3FBU A;  2Z3P A;  4CRY B;  4C2X A;  4H6Z A;  1KUY A;  3D8P A;  1M4G A;  4OLL A;  4UFW A;  1QSO A;  3MGD A;  1I1D A;  2VZY A;  4X5K A;  1XIX A;  2DXQ A;  3T9Y A;  1L0C A;  4JLY A;  2DPT A;  1Z4R A;  4MHD A;  1SQH A;  1YR0 A;  4XNH B;  4U9Y A;  4Q38 A;  4A32 A;  4C2Y A;  4I49 A;  4CAV A;  3R1K A;  2B3V A;  2FIA A;  2GE3 A;  3IU1 A;  5HH1 A;  4L8A A;  4KVX A;  1TIQ A;  2Z3M A;  4XPL A;  1YRE A;  1Y9K A;  1BO4 A;  3C26 A;  1WWZ A;  2Z10 A;  1M44 A;  3PP9 A;  2ARH A;  2CNM A;  1YK3 A;  2FSR A;  5KTD A;  1IIC A;  4KS9 A;  3N7Z A;  3TO7 A;  2R98 A;  2A4N A;  4KSA A;  2Z3O A;  5AG6 A;  2CNT A;  5KTA A;  4BMH A;  1VKC A;  3FIX A;  1U6M A;  1Z4E A;  2YNC C;  2Z11 A;  5DWM A;  4B10 A;  1VHS A;  3H4Q A;  2FT0 A;  4HNY B;  3A9L A;  3TOB A;  1NMT A;  3PZJ A;  2PSW A;  2B5G A;  4CGN A;  1XMT A;  4KVM E;  3FRM A;  2REF A;  3VWD A;  2R8V A;  5EBV A;  4CAF A;  2YGW A;  4R57 A;  3F8K A;  3B8G A;  2Q4Y A;  1Q2D A;  2GAN A;  2HV2 A;  2QML A;  4U5Y A;  2VQY A;  5EC4 A;  1QSN A;  4C2Z A;  3DSB A;  4NXY A;  4UFX A;  3D2P A;  4LUA A;  4H89 A;  4QC6 A;  3LD2 A;  4ORF A;  4FD6 A;  3T90 A;  2J8N A;  4CGL A;  4RI1 A;  4KUA A;  2B5G B;  1LRZ A;  1YLE A;  1K4J A;  1S60 A;  1Q2C A;  4UCM A;  1WK4 A;  1CM0 A;  1XF8 A;  4UCN A;  4E2A A;  5ISV A;  4A2Z A;  3FB3 A;  4A33 A;  1QST A;  2FCK A;  3KKW A;  3DDD A;  4PSW A;  4QB9 A;  5KTC A;  2WUU A;  1YX0 A;  3QB8 A;  5F49 A;  4PSX A;  5DWN A;  3S6G A;  2J8M A;  4XNH C;  3P2H A;  2Z3L A;  2D4P A;  4B13 A;  5G1Z A;  1IYL A;  1V0C A;  1Z9U A;  1KUV A;  2G0B A;  3GY9 A;  4A31 A;  2BL1 A;  2G3A A;  3NE7 A;  4JJX A;  4XPD C;  4A30 A;  3JUW A;  4BBH A;  2EUI A;  2X7B A;  4IUS A;  4UA3 A;  3UY5 A;  4M3S A;  2B4B A;  4MY3 A;  4DNC A;  1RXT A;  3CXS A;  1IYK A;  2YNC A;  5J8F A;  3TO9 A;  3WR7 A;  4PK2 A;  2CY2 A;  2AJ6 A;  2B4D B;  3FYN A;  1MK4 A;  2FS5 A;  3PGP A;  1IID A;  2B4D A;  4MFK A;  2G3T A;  4KOT A;  4M85 A;  1ON0 A;  2PC1 A;  3EC4 A;  2R1I A;  4YRH A;  5H84 A;  4KOU A;  3OWC A;  4QBJ A;  2B3U A;  3R95 A;  4CYN A;  5BWA B;  2RC4 A;  3DR8 A;  2P6E A;  4KLW A;  3IGR A;  3LOD A;  4ZGY B;  3EO4 A;  2PRB A;  3S6K A;  3EFA A;  1ZO0 A;  4JXR A;  4F0X A;  4A95 A;  5CNP A;  4OAE A;  4R3K A;  3S6H A;  4JWP A;  2Z3K A;  4MY0 A;  5F46 A;  2BEI A;  2OZH A;  4NEX A;  5AG5 A;  4KOR A;  2P6F A;  3JTK A;  5HMN A;  4QVT A;  2WSA A;  1NE9 A;  2AE6 A;  3I9S A;  1BOB A;  2FL4 A;  2C27 A;  3IWG A;  4FD4 A;  4UWI A;  1OZP A;  4CAE A;  2ZW5 A;  2Q4V A;  1S7F A;  1M4I A;  2DPS A;  3JVN A;  2PR8 A;  4R87 A;  4NF1 A;  4CAX A;  4MI4 A;  1Y7R A;  4K30 A;  4AVA A;  4EVY A;  4NCZ A;  1IB1 E;  3GKR A;  2HQY A;  5AG4 A;  3F5B A;  1M1D A;  1R57 A;  4Y49 B;  1KUX A;  4MJ8 A;  3W91 A;  2PQ8 A;  4CAW A;  5J8C A;  2BUE A;  3ZJ0 A;  4L89 A;  3FXT A;  4II9 A;  4MFZ A;  4B11 A;  1P4N A;  3TOA A;  3W6S A;  4AVC A;  5G21 A;  4FD5 A;  2HUZ A;  2VXK A;  5IV0 A;  1N71 A;  4Y49 C;  2CXA A;  2OB0 A;  4PV6 A;  2H5M A;  3IWE A;  4B5P A;  2J8R A;  2OU2 A;  4YFJ A;  3G8W A;  4UFV A;  3CXQ A;  3R96 A;  3TE4 A;  1YGH A;  4HKF A;  4MFP A;  4UWJ A;  4HNW B;  3SHP A;  2YNE A;  3P2F A;  5G20 A;  4C7H A;  2ZW4 A;  4CGP A;  4KOS A;  4J3G A;  2OH1 A;  1P0H A;  2Q0Y A;  4AG9 A;  4F6A A;  4U9Z A;  2VI7 A;  1B6B A;  1FY7 A;  4KZT A;  2D4O A;  1PU9 A;  1QSM A;  3TTH A;  3D2M A;  3TO6 A;  1S7L A;  4Q36 A;  4LX9 A;  4IF5 A;  3SXO A;  1KZF A;  4F0Y A;  5F48 A;  4KLV A;  2PDO A;  4KSF A;  2K5T A;  3TCV A;  4B14 A;  3BLN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...