2FL4A

The crystal structure of the spermine/spermidine acetyltransferase from enterococcus faecalis
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
147
structure length
147
Chain Sequence
GMEIHFEKVTSDNRKAVENLQVFAEQQAFIESMAENLKESDQFPEWESAGIYDGNQLIGYAMYGRWQDGRVWLDRFLIDQRFQGQGYGKAACRLLMLKLIEKYQTNKLYLSVYDTNSSAIRLYQQLGFVFNGELDTNGERVMEWTHQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords spermine/spermidine acetyltransferase
publication title The crystal structure of the spermine/spermidine acetyltransferase from Enterococcus faecalis
rcsb
source organism Enterococcus faecalis
molecule tags Transferase
total genus 36
structure length 147
sequence length 147
ec nomenclature
pdb deposition date 2006-01-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.900 Mainly Alpha Orthogonal Bundle Helix Hairpins The crystal structure of the spermine/spermidine acetyltransferase from enterococcus faecali 2fl4A01
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 2fl4A02
1I1DA 3FXTA 2R8VA 2Q4YA 1YLEA 1P4NA 3OWCA 4F6AA 3FIXA 4UWJA 1Z4EA 3BLNA 3R1KA 1U6MA 2VEZA 3FB3A 2D4OA 1XIXA 2OH1A 4CAWA 1M44A 4IF5A 4AG9A 2ARHA 1S7FA 1VKCA 2Q7BA 4BMHA 4L89A 2EUIA 4M3SA 5FVJA 4FD6A 1S7LA 5H84A 4CAVA 1YGHA 4MY0A 1Y9WA 5KTAA 3E0KA 1ON0A 3TO7A 2Z10A 4KOVA 1I21A 2QMLA 4YFJA 4R9MA 5C82A 3EO4A 3UY5A 5JQ4A 4MJ8A 3JVNA 2B4DA 2P6EA 2VQYA 2HUZA 3CXSA 3TTHA 4MI4A 3TOAA 1S60A 4R57A 3DDDA 3P2FA 2J8MA 2B4BA 2ZXVA 2WPXA 4ORFA 2ZPAA 4LX9A 3CXQA 3FBUA 3S6KA 3T9YA 3G8WA 4KUAA 1XF8A 2QIRA 2JDDA 5C88A 3B8GA 4LUAA 2I00A 3W91A 1P0HA 1QSRA 4NF1A 4JXRA 2PR8A 3K9UA 2G3AA 5F46A 2Y0MA 4KOYA 4Y49B 4F0YA 2FCKA 2G0BA 4AVBA 2PSWA 4B5PB 2EVNA 3R9GA 1Y7RA 4NSQA 1L0CA 1Z4RA 3LD2A 4MY3A 3D2MA 3BJ7A 4JLYA 4FD4A 2D4PA 1Q2DA 2B58A 4JWPA 4PSXA 3GY9A 3F5BA 2VBQA 2PQ8A 4QUSA 2Q0YA 2B5GA 3NE7A 1Z9UA 4R3KA 3JUWA 1XEBA 2DXQA 3H4QA 4E8OA 4U9YA 5HH1A 2VZYA 3TFYA 3TOBA 5DWNA 4OAEA 1NSLA 1B6BA 2R98A 4B5OA 2FIAA 2BL1A 3TE4A 1YVOA 3FYNA 3ZJ0A 4CS0B 1MJAA 1K4JA 5F48A 1Q2CA 4KVOE 2REFA 1M4GA 3I3GA 2PR1A 4M85A 2OZHA 3I9SA 4XNHB 1PUAA 4K30A 4UA3A 4CAXA 3R95A 4PK3A 2VI7A 2BEIA 4KOWA 4KLWA 4I49A 4PSWA 3SXOA 1WK4A 3DR8A 1YREA 4KZTA 4ONUA 3C26A 2OZGA 4OADA 4JXQA 5ISVA 5GCNA 1M4DA 4NCZA 2FIWA 1M1DA 2X7BA 3CXPA 1SQHA 3FRMA 4GS4A 3S6HA 3D8PA 1XE4A 4AG7A 3R9FA 2B3UA 5CNPA 4FD7A 4NXYA 3S6GA 3TCVA 4KOSA 5IX3A 2R1IA 1CJWA 1S5KA 5IB0A 2OZUA 1R57A 1V0CA 1LRZA 4R3LA 3V8IA 4KOUA 2Z11A 2J8NA 1BOBA 3F0AA 2FL4A 1KUVA 3N7ZA 5DWMA 1OZPA 3T90A 2PDOA 4QBJA 1J4JA 5KTCA 1QSTA 3EXNA 1B87A 2PC1A 3RYOA 5J8CA 4E0AA 2RC4A 4XPKA 2NMTA 2Q04A 3EY5A 3TT2A 3G3SA 2CY2A 3D3SA 2AJ6A 1BO4A 2ZW5A 3FNCA 3R96A 1NE9A 3DR6A 2HQYA 3ZZIA 4KORA 4XPDB 3KKWA 2G3TA 4L8AA 1UFHA 2Q44A 2HV2A 3LODA 2OU2A 1YR0A 5IV0A 2A4NA 2FE7A 1KUYA 2JEVA 4IUSA 2QECA 4U9ZA 4QVTA 1N71A 1YK3A 2AE6A 5E96A 2PRBA 3P2HA 5F47A 2Z0ZA 2FS5A 4KUBA 2ZW4A 4UBRA 4NEXA 2ZW6A 4J3GA 2VZZA 2IL4A 4H6UA 4XPLA 2GE3A 4YGOA 4EVYA 4QB9A 2FXFA 4HNXB 2KCWA 1XMTA 4H89A 4KLVA 1NMTA 4PK2A 2VXKA 5EC4A 3S6FA 2P6GA 1FY7A 1QSNA 4RI1A 1QSMA 4H6ZA 3IWGA 2JLMA 2BUEA 2CNMA 2B5GB 3EC4A 1YX0A 5EBVA 2GANA 3PZJA 3QAHA 1YVKA 1VHSA 4AB7A 3BJ8A 4KOTA 4JD6A 2ZW7A 5KTDA 4UWIA 1TIQA 4RS2A 2J8RA 1IICA 3F8KA 2R7HA 2FSRA 4KVXA 4Y49C 4FD5A 2WPWA 2F5IA 3GYAA 4PV6A 4AVCA 3DSBA 2P0WA 3TO9A 1KZFA 2I79A 2H5MA 4B5PA 3IGRA 3EFAA 1RXTA 2CNTA 3R9EA 1KUXA 1S3ZA 3D2PA 3SHPA 4XPDC 4CRYB 2REEA 1S7KA 4HNYB 4HKFA 3PP9A 4II9A 1IB1E 3GKRA 5I0CA 1S7NA 3SXNA 3W6SA 3PGPA 3MGDA 2B4DB 4JJXA 4U5YA 2Q4VA 5H86A 4MBUA 3W6XA 4MHDA 2ATRA 4DNCA 1QSOA 1MJBA 2BSWA 4CRZB 2JDCA 4X5KA 5HMNA 2CNSA 1WWZA 4OLLA 4ZBGA 4HNWB 5JPHA 1MJ9A 4R87A 3VWEA 3WR7A 1IIDA 1MK4A 2GIVA 4AVAA 2OB0A 2O28A 3QB8A 2C27A 4XNHC 3DNSA 3TO6A 3VWDA 1IYKA 2FT0A 2P6FA 1CM0A 4QC6A 1Y9KA 5J8FA 4E2AA 1Q2YA 1PU9A 1I12A 2B3VA 1IYLA 4KVME 1M4IA 4YRHA 1RO5A 4KOXA 2K5TA 1GHEA 5F49A
chains in the Genus database with same CATH superfamily
1W2BU 3JD3A 3FXTA 1PCAA 1TKJA 3G6BA 2Q4YA 3VOUA 2B9ZA 2PYJA 4KSIA 3OWCA 4BIZA 3PEIA 3H1JH 1PL0A 4F6AA 2PTMA 3TETA 3A0BZ 5JQGB 3B40A 5JJEB 1Z4EA 2KSDA 3K04A 3BABA 2OH1A 1YDXA 2UXCO 3NH4A 1M44A 4ONWA 4CAWA 5JWPA 2JEUA 1AR4A 4DV6B 2VWKA 1GM7A 1S7FA 2A0LA 1AP6A 5IE9A 4EMEA 3CC2V 2CE4A 2PI5A 3ASNB 4TT3G 2ZEEA 4JI8O 1HDJA 1ELMP 2EUIA 4CGOA 1JQGA 1JX9A 3G6EV 1S7LA 4MFZA 2JGDB 1XNQB 4CAVA 1YGHA 3C90A 4JI3B 4C7IA 1Z2GA 1WLEA 3JALB 2CDYA 4M6HA 1ON0A 2Z10A 2QMLA 3D67A 3G67A 3ZJZA 5C82A 4OP4A 1XNRO 4O4JB 4MJ8A 1QNMA 1OHHG 3AG3C 3L72H 4IIJB 1YIJV 4JI0B 5K8PA 4EKWA 2HUZA 3CXSA 4J9YB 1SZTA 4B7EA 2X6BA 3JCZA 4I7ZB 1ZLIA 4LF4B 4XDJA 2QKCA 2KQXA 2Q51A 3F5TA 1NTMH 5JVDB 3RYCA 2P67A 2J9AA 4MVQA 2KG7B 4FUUA 4NGNA 4ORFA 4B3RB 2ZDIC 4LX9A 4P2ZA 1A2ZA 3FBUA 5BXZA 2JEXA 2FVGA 4X62B 3G8WA 4X1IB 1FPOA 1XF8A 4TNUA 3SI0A 5KA5A 2AFXA 3ETQA 3DSQA 3H1KH 4GCZA 4MVSA 3ETGA 4PD4F 2JEWA 3SJGA 1Q8IA 4HYOA 2HHHB 4NF1A 1ZX3A 1EBOA 1HW7A 4LNUB 2PZSA 4K0KO 1CPXA 3K9UA 3BY6A 1YVWA 5LRGA 3D7DA 4KOYA 4Y49B 2CF4A 2E76B 4LCUC 3CCRV 2FCKA 2PSWA 1YEWA 1AR1B 2EVNA 1PL4A 1Y7RA 2OOTA 5EYPB 1DF4A 2PJ9A 1Z4RA 5LGNA 4X66B 4UCSA 2DQ3A 4TQDA 5EBWC 1VQ4V 1CP6A 3B3TA 3BJ7A 3AG1B 4D7TA 3PB9X 4J7JA 5J2TA 1LFWA 2D4PA 5B3SB 3IWWA 1GM9A 3NH8A 2BOCC 4CH4A 2AFUA 2GUZA 2VBQA 2POKA 4TV9B 3LDCA 4YIOA 1FJGO 2F8HA 5LL6Y 3NE7A 3BI0A 3JARB 4PDLA 3TCUA 5D5PA 2IW5A 3HR0A 2HG5C 2EIJB 4E8OA 1ARMA 3UO2A 3W7SA 2OTJV 5KX5B 1OCCB 2M6YA 4U9YA 1UFIA 2VZYA 3FEDA 1S5HC 2EO8A 1EFRG 3WG7C 3CPWU 3LUTB 3I1UA 1IDSA 4CZZA 3EVKA 4B5OA 3T1HB 3TE4A 2PJBA 2Q6AA 3KKYA 4MHZA 2NN4A 1BL8A 4O2AB 3FB7C 1YVOA 1ZO0A 3IJ4A 1MJAA 1XJOA 1K4JA 5F48A 4KVOE 2C6GA 2BSKB 1Z5RA 1FFXA 4WFHA 3I9SA 1OJHA 3ZMSA 1VARA 4NTWA 4CPAA 1W0KG 4CAXA 2PRQA 4B10A 3H8FA 2DYSB 2Y69B 2EZPA 4DV7O 4PSWA 1JR9A 4IAVA 3KHXA 1YREA 1H8HG 1I5YA 3QAYA 1Q43A 1XMOO 4AXVA 4ONUA 1EE3P 3C26A 1PNLA 3JCUZ 3J81N 4OADA 4RUHA 3K0DA 2PIYA 2EX3A 3QNVA 5FPOA 4R50A 4OC2A 4G28B 2YXHA 3CCVV 2Q0OC 4L87A 3RT3C 4DUYO 4I9WA 1F2OA 1M4DA 5GCNA 4CGMA 5HVFA 3SPHA 2WYRA 3ZRVA 4LQ6A 5BY1A 3FB8C 2ADQB 4LH7A 3CXPA 4F4LA 3FAVA 4YHHB 3DGEA 4KSAA 1F4NA 4Z1MG 3SJBC 3OMAB 4E4EA 5H6RA 1H2KA 1CG2A 4C68A 1NU1H 3CP1A 3H1IH 4NTXA 2R1IA 4UCNA 3SYAA 2F4VB 2Q43A 2EIMB 2OZUA 4RQEA 4A94A 1LRZA 3ABLB 5EK0A 3F7VC 2Q7SA 3NFZA 2Z11A 2J8NA 3STLC 2P22C 3D3QA 2FL4A 3H1LH 5LMNO 3CRMA 2AZ2A 1K4CC 3RGBA 1DK1A 3N7ZA 5B3SC 1N32O 1OZPA 2IM9A 3KI9A 1J4JA 1CEZA 2GSMB 5KTCA 1QSTA 4NGQA 3EXNA 5LBQA 3OMNB 1GH6A 3OTOB 1P4RA 2IH3C 4DV0B 1NH2D 4XPKA 1XUQA 3OGIB 1COWG 3PB4X 4CYPA 2CTBA 1FXKB 3TT2A 3ZHUA 1BT8A 2ZEOA 2EIJC 1HDUA 1SETA 4I0XA 4MHNA 4JZGA 4FLYA 2ZW5A 2HFEC 1OCCC 4LBEC 2IU3A 5CBGA 1HNXB 1DTDA 3FNCA 3CJHB 3T4DA 2HQYA 4IHJA 1IX9A 4BINA 2VQFB 1ZSPA 4MTXA 2UUAO 5CPAA 4A95A 2G3TA 3V7ZA 3SI1A 1R6TA 2PYLA 4BR6A 2WLLA 3LODA 2OU2A 4FLWA 3PJSK 2A4NA 2P7TC 1AI5A 3KQZA 3KL9A 4LH6A 1KUYA 3UCSC 1YLOA 2Q0AA 1CPSA 1L1FA 3G71V 3JD4A 2QECA 1GAXA 3IFXA 5K1XA 4U9ZA 5B66Z 1XFOA 3CCEV 3B3CA 5D8NA 2EJ7A 3MD0A 1YK3A 2AE6A 3GUXA 1M9NA 4X8IA 2DN9A 2EWBA 1XDCA 4ZI7B 3IEHA 1TKHA 4KUBA 4UBRA 2DYSC 2Y69C 3DC5A 1AJPA 3L70H 4GM5A 2JS5A 3EXAA 2ZW6A 4JYWA 1ZG8A 5LRJA 1BQ0A 5BMVB 4HNAA 1P7BA 1ZL8A 1WB7A 3QO7A 3EHBB 4QB9A 2HB6A 4HNXB 1VP7A 4RQFA 5KHGA 2UUBB 4RUFA 4MW3A 3I55V 5CMUA 2VXKA 2CAZC 2PJ5A 1VIXA 3WABA 4ZKIA 1KMIZ 2JJ1G 2DYRC 3D7GA 3PRTA 5J2TB 3R65A 3VBBA 5H9CA 3WC7A 4NGSA 1EN6A 1R73A 4IL6Z 4BIUA 4FIPC 3IWGA 4H6ZA 2GUZB 1JPXA 3SPJA 4CH6A 1LNQA 3ZHQA 4O23A 3D7HA 3VQYA 4CC6A 1NH2B 2CNMA 1RPRA 3ABLC 3VQVA 5EBVA 1HNZO 2PF4E 3PZJA 1GM8A 2XT9A 2GLJA 3QAHA 5B1NA 2V1DA 2O53A 5L3DA 4AB7A 1Q90D 3UM7A 4B3TB 2OIGA 2ZW7A 5KTDA 4J10A 4FWUA 1DE4C 4RS2A 3KASA 2AFMA 2R7HA 2W6JG 2FSRA 5J1QA 3GLJA 2I3CA 1Z2LA 5KMGA 2AFZA 3DGVA 4FK5C 3E35A 3PBBA 2WPWA 1FXKC 2F5IA 2OT5A 4JI5O 1AP5A 1XHXA 3GYAA 4PV6A 4F8ZA 3P3NA 1FFXB 1YW6A 2P0WA 1KZFA 2H5MA 3IGRA 5BZBA 3K57A 4UCMA 3PN1A 2GTSA 1ZLHA 2CH7A 1MG1A 1RXTA 2CNTA 2Z3OA 2GREA 2ITCC 2PGGA 3D2PA 4WFAV 3PB8X 5E1AC 3E83A 3OMIB 4B14A 1IVSA 4DR5O 4HKFA 4NJRA 1OCZB 5FL7G 1I0HA 3CXHF 3GKRA 3SXNA 1WB8A 2PJCA 3K59A 3A8TA 3CYOA 3AK2A 5LGTA 5FPRA 4DR1B 3THOA 2B4DB 4DR7B 4DV2O 4PA6A 5KAFZ 1Z5VA 4BW5A 4MBUA 3FAVB 4A30A 4DNCA 1XRYA 4DV5B 4UXNA 2HC9A 4LR3A 5ITZA 1YTFD 1AI4A 3LWUA 3FEEA 4U3JA 1MJ9A 4UVCA 4UFVA 4WFBV 3MN8A 3VWEA 3APOA 3WR7A 3EFFK 3ZN1A 4AVAA 4RWUA 5EZYB 4CS2A 2O28A 4DR6O 1VMGA 1BGYH 5IJ9A 1QLNA 4UVBA 1K97A 2R9IA 4I55B 3SJQC 1RPOA 2XAQA 2V8VA 1CM0A 1QLEB 4N23A 3JTKA 4LC1A 1VF6A 2LJ2A 1KKCA 4I9QA 1SC5B 1D5AA 2ANPA 1ZWIC 3CX5F 4Z1VA 4P4FA 3FYEB 1PU9A 1I12A 3S9NA 1GMGA 2ODMA 4MFLA 4KVME 5IYZB 2CK3G 4YRHA 2WLHA 2IJHA 3OM3B 4KOXA 4D7SA 1GHEA 1VGYA 3L75H 1YSCA 4LF7B 1R3JC 1QCEA 5G21A 2ZR2A 4JTAB 5IY5B 2IJKA 4TV8A 3ZEDA 2ZNIA 4KL1A 3UT5A 5LXTB 2BO9A 4OXSA 1M57C 4PELA 3R1KA 1U6MA 4GUNA 1J95A 2WA4A 1JCHA 3FFQA 4FM0A 4K35A 5LP6C 4AG9A 4OC5A 2ARHA 1VKCA 1V55B 4L89A 5IWAO 4UVAA 1IBKB 2ZEMA 2IJIA 5L3FA 5EIBD 4GKJB 4M3SA 4AQYO 4FD6A 2RMKB 2A7WA 3D66A 4DW1A 3HLPA 4MT8A 4EFBA 4PHZA 1YTFB 4LWSB 3MRUA 4MY0A 2WLKA 1ZL8B 3BA9A 4X64B 3RBZA 1QBZA 3TO7A 4K3NA 4OPHA 1XREA 1SA0A 4HBNA 4CS3A 1F4MA 3K03A 4LFBB 2YI8A 2OCHA 3UY5A 3OTFA 1K73W 5JQ4A 4OMEA 3CXCU 3F5WC 2P4VA 1SQVH 1N34B 2F23A 4HAMA 4Q6GA 2VS0A 1AB3A 4XDKA 2P6EA 2VQYA 2GU2A 1Q7YW 1BZKA 3AK3A 2EK8A 1FYJA 4MI4A 3CPXA 1S76D 4KUMA 4WFGA 4R57A 4BIOA 3OT7A 4YU9A 4O2BB 2J8MA 5LHHA 3BRCA 2B4BA 1Q6HA 3SDLA 4ASUG 1X4TA 4O4IA 4BWAA 4JI6O 4C2YA 2BCCH 2WPXA 3E89A 4UCTA 1NVPD 1QU7A 1G4YB 3E22A 3KR5A 2AZ0A 3VQXA 3RVYA 4PXEA 4PA9A 1VQ6V 4KUAA 2QIRA 4MFQA 2QR4A 3E8FA 4DRXA 5C88A 1BMFG 5LMUB 1SQXH 4DV3B 3WC5A 1FXHA 2YIAA 1P0HA 2VL1A 4GX5A 2XTAA 3IO1A 4DUZO 3SYQA 2YIBD 3TXSA 4LF8B 1IY7A 1YJWV 1X10A 5ELYA 5F46A 4UF4A 1M56B 3D68A 2GBOA 2G0BA 4AVBA 3B3VA 3U0ZA 2N04A 4P9OA 1TUBA 4B08A 1H8LA 4DR4O 2B1GA 3ZX6A 4EWTA 5IY5C 1TVKB 1WN7A 4D6TH 5KLVH 2CTPA 3JAKA 1RM1B 1XL6A 2QM7A 4ZOLA 2PJ1A 2YNEA 3BFRA 2QVPA 2ZIOA 4NR1A 3C3SA 4UEFA 4F9UA 4B13A 4CAFA 4UIBA 4PI2A 2ZNJA 2B58A 2UUCB 3RYIB 3ZMVA 1ENVA 4DV1O 1GN2A 1DF5A 4WF9V 4HPSA 2Q0YA 3HUVA 1Y67A 1Z8LA 4FJCC 3SYOA 4C2ZA 3ZBHA 5F09A 2CGOA 4MTOA 2X0LA 3B8MA 2PJ8A 2DXQA 1PYTB 2M7WA 4X20A 5B1OA 1J5EB 4QJFB 2PVWA 1N36O 4NGPA 1EN4A 2R9RB 4CGLA 2PJ0A 4F6RB 4QE9A 3ABKC 3W7XA 3O9OA 5DWNA 5ITZB 4LFAO 1IXMA 1NSLA 4IHMA 1XOVA 2BL1A 2N74A 3WT4A 1MSWD 4XBFA 2QM8A 1JMKC 4PI0A 4YJ2B 1N8RW 2WLJA 1R6KA 3FYNA 1NVPB 3IAYA 2ETNA 4EEQA 5L3GA 4YWYA 1Q2CA 5IYDO 2RNBA 3ZMUA 4J42A 4M85A 2L6LA 1XNQO 1LUWA 5LOVA 2OZHA 1TGOA 1E1QG 2ZEPA 4G1PA 3HPLC 1WA8B 4PV1B 1PV0A 4UA3A 1XQ8A 1PD3A 3U10A 3R95A 3SPGA 3L9DA 5AG4A 1OCRC 5LYJB 2JK5C 3B3WA 3CSXA 2QWRB 4OIDA 2Q73A 4YIPA 4JXQA 1A32A 4X2TA 4JPRA 1QMUA 3LDEA 3T2MA 2YEVA 3J80N 3CHXA 2HVJC 1M1DA 2X7BA 4JI8B 4UCRA 2IH1C 4EFDA 1SRYA 1VEWA 1H2GA 1SQHA 3G4SV 1TF8A 2PJ6A 2WSSG 3CT9A 3S6HA 4ZI6A 1IU8A 2Q67A 2JBKA 2PJ2A 2CTQA 3D8PA 4Z65A 2RQ6A 5LA6A 2IJZA 1M56C 1QVGU 4FD7A 3BI1A 1R43A 3M99B 4B3RO 3TCVA 4KOSA 5IX3A 3VH9A 1SQBH 5EIBC 4X62O 1JJ2U 1V0CA 3LMSA 3OE7G 2XAJA 4OC3A 3ZRWB 3FKSG 2WAMA 4JYBA 2UXDO 3K9TA 1BE3H 4X1KB 1RM1C 3QTCA 1BOBA 3E8BA 4DUKA 4H0LB 3FVLA 1OZ0A 1F2PA 4MMOA 2ZENA 3MDSA 2UXNA 5DWMA 3GVMA 3T90A 4TUYA 4DXWA 3ABMB 2PDOA 2WSAA 3ABTA 5JH7A 4X9QA 1NI8A 1SA0B 1ELLP 2HVKC 2QWOB 4B6ZA 5KUMA 2Q04A 4X66O 1GN3A 1BO4A 4U7OA 2HJDA 2CIJA 1R1BA 3ML0A 4B3SB 3DR6A 4JI4O 4H44B 2MK3A 4K8XA 2YXLA 3IU1A 4R8FA 3BHPA 4F0XA 4KORA 1H2MA 2OR4A 4L8AA 2IU0A 1UFHA 4O4IB 4P4BA 4C2XA 2Q5ZA 2ILMA 1M90W 1JVMA 5KHHA 4JYAO 3JD0A 5IV0A 2BTQB 3AG2B 3H01A 2JEVA 3FX6A 3E22B 3ASNC 2KKWA 3ZMTA 3TC8A 1I7FA 4QVTA 4DRXB 3E8GA 5BR8B 2P6JA 3J7AU 1B3QA 1YXBA 3L73H 2PRBA 3K5OA 5CBHA 2Z0ZA 1I94B 5EC2C 5EBMC 3JATB 3K5MA 3ZS8C 4NEXA 2EBJA 1PNMA 2E75B 3ASOB 2VZZA 2DMXA 4X65O 2IL4A 4H6UA 3ZHSA 2P5OA 3PFOA 2Q8VA 2MW2B 1TUBB 2XHBA 1FAFA 5GONB 3L2NA 4L8JA 4YGOA 4EVYA 3VATA 5CA1B 1XMTA 2JVDA 1NMTA 4MCSA 3H1HH 3SR2C 3OAAG 2ATKC 4JGSA 1R6NA 3BXMA 3OEEG 1FY7A 1YSJA 5DN6G 4MCPA 2G9DA 3OEHG 3E8HA 3HKBA 2V77A 5B5EZ 2VRZA 2EBOA 4JYCA 5KHKA 4JI2O 2QM4A 3S9MA 4RUEA 2F66C 1L0LH 3LDDA 2GANA 2XAGA 5J9PC 2AHZA 1QR8A 3PB7X 3GB0A 4DV4O 5JCOA 1YMEA 4X89A 4IYIA 2PJ7A 4YHHO 3BJ8A 4KOTA 1CP9A 1JFFA 1QR9A 4UWIA 1OCOB 3KZWA 3ABMC 3ETEA 4A31A 2J8RA 2RN9A 1V54B 4H2KA 1RFYA 4MCQA 2FKXA 4KVXA 4Y49C 2F4VO 2AW9A 4HZ3A 4ZY0A 2RDCA 4DV7B 1I5XA 2Q68A 4LF6B 2ZM6O 1XMOB 2I79A 4B5PA 4NGTA 5C8YA 1NT2B 3T8WA 4W9YA 4ZX9A 1KUXA 4CRYB 2JIZG 3AG1C 3B09A 2REEA 1S7KA 1HR0O 1F7YA 3JAWA 5IDJA 2OWOA 4MSWC 1VQ5V 4II9A 1IB1E 2AGAA 1AJNA 2LQTA 4JAVA 5I0CA 1S7NA 3SJAC 3PGPA 4GLXA 1TKFA 3IC9A 2YEVB 2H8PC 3KCYA 4UB6Z 1SKVA 3RNZA 1EN5A 1AUGA 1WJZA 4MHDA 2OTLV 2ATRA 1JA8A 1MJBA 5B1BB 4I50A 3ASOC 1YCIA 2FB5A 4ICGA 1YQEA 4UV9A 4ZBGA 4HNWB 3RYCB 5JPHA 4OKOA 1SQGA 4R87A 5BWAB 1JWQA 3GWKC 1K92A 4PQAA 5EBLC 4NYKA 1Z8XA 4P4DA 2WLIA 1IIDA 1KU9A 2Y0PA 4BW9A 3AG7A 1WAZA 4GT1A 1PNKA 2RFHA 2F1MA 1GN4A 1KWMA 5AGEA 3MHSC 1UJWB 4JI7B 2WWWA 1HP8A 3DNSA 4NXMB 4P4JA 3VWDA 1SQFA 4CBCA 1U97A 1MZFA 2FT0A 2P6FA 4QC6A 1G6UA 1O9GA 5J8FA 2QSAA 4FFKA 1SZXA 1P7GA 2AHYA 4IGGA 1VQ9V 4W4KA 1NZ6A 1FXVA 3N2KA 1K34A 4NTYA 1ZAUA 2ZE8A 1Y0YA 1IYLA 2ZD9A 4P4IA 4CS4A 3CCQV 1M4IA 5AG7A 5KA6A 1SQPH 2DJVA 1K5QA 3QO5A 5CA0A 1BHBA 1I1DA 1OBRA 1V9PA 1OCOC 2R8VA 5FLXN 3A2FA 1Y6XA 2X6AA 5CA3A 3CRRA 1TF9A 3L71H 4LF9O 3FD9A 1BQZA 3FIXA 3TGUH 5L3CA 3P32A 3CCSV 2D4OA 4B11A 4FBEA 5KHIA 4GX2A 1EZVH 1VF7A 4JV5O 3B8NA 4TWEA 2EIMC 4O4HA 3JRUA 4FVMA 1Y76A 2YGWA 3CE2A 1THZA 2Q7BA 4BMHA 1FD9A 1ROPA 4JI1O 2AFWA 3N2GA 3UQ8A 1ZG9A 5H84A 1PP9H 3SGIA 2D3OW 1XBUA 4TSFG 5LYLA 1TA8A 5JJJB 2P06A 3DTUB 3BVOA 3APQA 3K5LA 4AHCA 6CPAA 5H5NA 2FTKA 1VQLV 4WJBA 5KTAA 4E2LA 2H94A 2PCUA 1FT7A 1NJIW 2DPSA 2ZR3A 3B35A 4YFJA 1SQQH 3EO4A 5LRKA 2GTAA 2UXBO 1E79G 1HNZB 1Q3EA 1M1KW 1IOIA 5CBMA 1YI2V 1SF9A 3P3PA 5HFMA 3FMCA 3K79A 2AXTZ 3S3WA 5CBFA 1RSOA 2EIKB 2KB1A 4PJ0Z 4FLUA 2IMOA 3RBUA 4RO2A 3TTHA 2Z5UA 3RVZA 5IJ0A 2YICA 1K8AW 2HEPA 4YY3B 3AEIA 1XEQA 3JASA 1YW4A 3P2FA 3K3WA 2JGUA 2YSUB 1AYEA 4LFCO 3CDXA 3ETDA 4DR3O 1L8DA 2ZE7A 4DR1O 2UU9B 1JQ0A 1LUVA 2ZE5A 3FYIB 3H9VA 3T9YA 4GZRB 3RYFA 3B2YA 3CD6V 3QG5A 1MSDA 2ZDIA 3OUSA 1IBLB 4UEEA 4Q7AA 1XL4A 1HNWO 2JDDA 3SYCA 3B8GA 4LUAA 3T1YO 2I00A 3A0HZ 4H37A 4UV8A 1QSRA 1Q5OA 2PR8A 2Z3NA 2O57A 3W7WA 4F0YA 4DR5B 1FFTB 2PJ4A 1MABG 1R3IC 4GXHA 4PXDA 4B5PB 5A28A 3R9GA 2D2CB 4EB6A 5JJNB 1ZTEA 4J11A 1Z5WA 4IT5A 3LD2A 4I4TA 4MY3A 1KECA 4KFMA 1AJQA 5E79Z 2DWEC 5A2QN 3D2MA 3TK1A 2UXXA 4X8AA 2X6CA 3JYCA 3K9SA 2VQEB 4A32A 3M7MX 4R7MA 5JQGA 1Q2DA 4P44A 4MTGA 4J80A 2R9AA 4PSXA 3GY9A 3F5BA 4A33A 1N33O 2ZKOA 4QUSA 4LF7O 4N21A 4KHPB 2ZT9B 4I0XB 4TOIA 4UCVA 4MCRA 1Z9UA 4MFKA 4R3KA 4UCPA 1S77D 3VQWA 1XEBA 1AR5A 3GWOA 3QF7A 3IJ3A 3NH5A 5HVHA 4IHJB 1BAVA 3M8AA 5HH1A 2JDIG 1PKXA 3TFYA 2QWQB 3OR7C 4CGPA 1FS0G 2C2AA 4OAEA 2QYVA 5LHIA 4K8ZA 2R98A 2WLLB 1K33A 1M4UA 3JALA 1YJ9V 4UEZA 3CC7V 5H2FZ 2EULA 2ZIMA 1IBKO 1CX8A 2HKOA 4OIWA 3RFRA 2A3QA 4CS0B 4QIWF 4R7CA 2REFA 1M4GA 2CTRA 3I3GA 2EIKC 2V7QG 5IYCO 4XNHB 4ZHQA 1S5JA 4K30A 1GN6A 3SJXA 2XEGA 3I56V 5DM6V 3MAQA 4X64O 1IBMB 3N2KB 1OCZC 3T1CA 1AVMA 1JOYA 2BEIA 3NXSA 2EZOA 4HNAB 2YDEA 3SXOA 3DR8A 2YC0A 1XILA 4X3RA 2WZNA 2LP7A 2LFSA 1H38A 4GKKO 4NCZA 4X1YA 2FIWA 2ZINA 5IWAB 1SESA 3WB1A 2LO1A 3OFNG 4AQYB 2XUMA 3P30A 4AG7A 3JSLA 3R9FA 5CNPA 3B2EE 5G22A 1XMQO 3CS5A 2E5LO 1CJWA 1S5KA 2DW4A 4P30A 2N05A 4P9PA 3SJFA 4ZGYB 4MVRA 3T4ZA 5C93A 7CPAA 4WBNA 5LYDA 3V8IA 2RCVA 4DV3O 2DE0X 4MVOA 2PJAA 2CTCA 2Z3MA 2QE7G 1QLEC 3WFVA 3E86A 4LF8O 1KUVA 3K08A 1W59A 1M5IA 5K1PA 3KR4A 4QBJA 5KMGB 1B87A 4Q38A 3RYOA 5FNVA 5JM6A 4E0AA 4OX9B 4NGRA 3HKDA 3X2QB 4NXNO 4B3MB 1MOFA 5G20A 4EFEA 3SJEA 2NMTA 4PA7A 4JI6B 3G3SA 1HEEA 2XASA 4J41A 3KQXA 2CH7B 3D3SA 2HP8A 3AG3B 3ISZA 1Y7EA 1S72V 4OGQB 3K58A 1NE9A 3IFEA 1CXZB 1RP3B 2G38A 4J7KA 1R3NA 2F43G 5G1ZA 2UUCO 3D36C 4XPDB 4IK2A 2QJ1A 3KKWA 4JTCB 2Y4TA 2Q44A 2HV2A 4DUZB 2LGWA 2PE3A 1YR0A 5DECA 5HXDA 3N27A 4O2AA 1BSMA 1V55C 3RYFB 1Y4MA 2A79B 3ZHRA 2WA3A 1VQMV 4JZ2A 2BSKA 4DYLA 2BOAA 5E96A 5F47A 4DR2B 3LSQA 4F6EA 2FS5A 2OIEA 5A9GA 2ZW4A 4U3JB 4H33A 4NB5A 4QGPA 4QE7A 4J3GA 3OD4A 1P49A 5IYBO 3FB5C 4DV6O 4YJ3A 4XPLA 4FPPA 4CAEA 1Q86W 2GE3A 4ZX8A 2Z3PA 4LF5B 1NR7A 4DV1B 2FXFA 2KCWA 2E3CA 5IJ9B 5HFLA 2Z3LA 4RAIA 1R3LC 4MFPA 4PK2A 4JI3O 1QSNA 2Y48A 4O4LA 3W7UA 2GV9A 1N36B 4KSFA 5EMIA 2XEFA 5DS0A 1QSMA 4LFAB 2CTWA 4G27B 2BUEA 3B77A 3DLJA 1RTQA 4KP4A 3EC4A 4NFRA 1YX0A 3CEIA 1F51A 1ORQC 3LSUA 5IT9N 1N0NA 5F2VO 3D8CA 3B7IA 2JS3A 2QTSA 5KHJA 3D3IA 3CCMV 2UXCB 4MVUA 4JI0O 4A38A 2QGNA 3IU2A 1PPJH 3NA6A 1YVKA 3TXQA 4TV8B 2XNDG 2YNCC 3UKMA 4AILC 3UT5B 3HKEA 1TIQA 1S5LZ 2QKSA 1K4DC 4JASA 4LF4O 2GDSA 5L3BA 1TAEA 2E74B 1IICA 4WCEV 1QHTA 5KAIZ 3WG7B 3FX7A 2PY5A 3X2QC 1KBHA 1W0JG 4FD5A 2JBJA 1AI7A 1JJOA 1KUQA 2F7VA 2V8GA 4FFBA 4AVCA 1XI1A 3DSBA 1EM1A 1FXKA 4KXRA 2RJZA 4LQGA 3HKCA 4ZHQB 5LHGA 2PI4A 1XNRB 3ZHTA 2ODFA 2PIZA 3SHPA 5K8NA 4XPDC 1NTKH 1K3EA 3CJHA 2HHHO 2P90A 3CMEV 1AROP 1IZ3A 4HNYB 4DW0A 3ZN0A 1IOFA 2ZEDA 2LW7A 5B1AB 3AG4B 3W6SA 5TISZ 4P6YA 1KP2A 1ZLZA 1WP7A 4BBHA 2Z3KA 4B3SO 4X1YB 2ZCEA 3UO3A 3CCLV 2Q4VA 5H86A 1KKDA 2UXDB 2OCCB 3W7TA 2YNDA 1GYTA 3W6XA 3S3XA 4GX1A 2BSWA 4CRZB 4ZI7A 3U11A 2JDCA 4MXUA 4X5KA 5HMNA 3S9LA 3BA8A 3BAAA 4OLLA 2ZEGA 2IJJA 2DQ0A 1VQKV 1WP8A 3CMAV 2DF5A 4K0KB 3A9LA 1MNGA 5BMVA 3C3TA 2GIVA 4WBNB 3FF3A 5BR8O 4P10A 3KZIZ 1DTOA 3F7YC 1UPGA 2C27A 4R76A 1I94O 3IC1A 3RYHA 3OGCC 1VF6C 2Q9LA 1URFA 3TO6A 2PJ3A 1YZBA 4FLZA 3K06A 3RN4A 1IYKA 1M4LA 3WB0A 3T1HO 3E2EA 1Y9KA 4JI4B 5FNVB 1G8MA 4UFWA 3HKDB 4E2AA 2B3VA 1SS3A 4NJQA 2IBZH 1G1XB 4JAUA 4JYAB 1LAMA 2K5TA 1NQTA 2LW1A 2C6PA 3JAKB 1S3JA 1FJGB 1XBLA 2R70A 4ZOLB 1YLEA 1ZG7A 1P4NA 3Q4HA 4IYHA 3JAMN 4ZIBA 1VQ7V 5CN0A 1BS3A 4UWJA 2NSMA 3BLNA 4M6IA 2EJRA 2VEZA 3FB3A 2DOSA 1XIXA 3LACA 1TXRA 3HB3B 1WNSA 4JTDB 4C7UA 4IF5A 4X65B 3BEHA 1SERA 4DYOA 3CRAA 5LP6A 4X20B 1H2LA 5GW7A 5FVJA 3D7FA 2AFOA 1L0NH 1VQOV 2Z0AA 3LNNA 3IC7A 2HLDG 3K0GA 3FECA 3KG2A 2O4HA 2GHYA 4FZ0A 1M93A 1NKDA 2YS8A 4K3AA 1Y9WA 4YJ3B 3QNEA 2W6IG 3WB2A 5EC1C 5H6QA 3E0KA 5B1AC 1Y74A 2LFRA 4LF6O 1X59A 3AG4C 1I21A 4JI2B 1Q7LA 4KOVA 4FAIA 3O65A 4B7KA 2NYQA 4R9MA 2Q4ZA 2A9HA 3D4UA 4PDMA 4LP8A 2QKAA 4JF3A 4AI8A 5LOVB 2QWNB 3RW0A 3JVNA 1DLBA 2OCCC 2B4DA 4DV4B 4O4LB 1OV9A 4DUYB 1LCPA 2RB7A 1K7DA 2DYRB 1Z8WA 2NNUA 2EILB 2K1EA 1VQPV 2ZXWB 3TOAA 4DO2A 1S60A 4FLTA 1LOKA 2EK9A 3OTOO 3DDDA 2CXAA 4DV0O 1HDQA 3LSSA 2V4DA 1XOUA 3WU2Z 1XMBA 3AG2C 4CYNA 1IURA 2ZXVA 4MFJA 2YIDA 3B4SA 4MTFA 3B3SA 3RAMA 4A37A 3ABUA 3OUFA 2XEIA 1MA1A 2ZPAA 3CXQA 3SI2A 3S6KA 5EZYA 4J7ZA 3BCCH 1HNXO 3STZC 3ZRSA 2ZM6B 1KYOF 3FH4A 1BPNA 3HKEB 5K8MA 3VARA 4I55A 2VQFO 3R66A 1S0VA 5LMNB 3W91A 1GO3F 5LA6B 3SPCA 4JXRA 2NR5A 1X12A 2G3AA 1N32B 1AMPA 4XDLA 2HR3A 5AG2A 1HR0B 2Y0MA 4UFZA 4UCOA 3K5NA 4FFBB 1Z8TA 1NBMG 5IYZA 1FKAO 4JI7O 3HKCB 3FB6C 4NXMO 4NSQA 2DWDC 4A39A 4CYOA 1L0CA 4FMTA 3MHHC 2ZEFA 2AFSA 3I5DA 1F23A 5D5QA 1I08A 1NTZH 5CB4A 4MS2A 4FM2A 4TUYB 4RN7A 4JLYA 4BD9A 5LXTA 4G2KA 1B06A 4FD4A 5JH7B 3RZAA 4OC0A 4JWPA 3AK1A 2CGNA 3D36A 4QPJA 4MVMA 1H2NA 2UUAB 1QVFU 2QA4V 5HVGA 2PQ8A 4ZBMA 4C7HA 4TWKA 2UUBO 2B5GA 2XAHA 4ZY2A 4OC1A 2K9PA 2OYQA 3JUWA 1YF2A 3DXRA 2ZEHA 3H4QA 1Q82W 4M6GA 3TOBA 2PUSA 4PPZA 5JH9A 1V54C 1K9MW 1Q6IA 1B6BA 4GX0A 1BHAA 4LWSA 2FIAA 2V8DA 2Q4PA 2QTOA 3CZXA 4R6TA 4PXCA 2QDOA 2VWJA 2X7RB 3KGQA 3ZJ0A 1B04A 5J2UA 3GB7C 4CGNA 3RYHB 4B3TO 2XAFA 1KB9F 2CUGA 2Q7GA 2PR1A 8CPAA 4FZ1A 4A5UB 3ICXA 2HJFC 1PUAA 2EILC 2ZXWC 4NGMA 4A2ZA 4PK3A 2VI7A 3PFEA 4LF9B 4KOWA 4KLWA 4I49A 5JGFA 3IGAC 2Y4UA 4O2BA 1WK4A 4KZTA 1E1RG 2GLFA 5LGUA 4JV5B 2DPTA 2OZGA 1P84F 4ZYQA 3RO0A 5ISVA 2PVVA 1GK9A 4PA4A 2P4KA 3Q4HB 4J9ZB 5GTIZ 4JI1B 1LAPA 2LGQA 1WPBA 1YHQV 1ZUQA 3JD2A 3HKBB 4YY3O 3FRMA 2YNCA 1XHZA 1B6QA 3PBEA 4GS4A 5B1BC 2Z3YA 3SJCC 3RWRD 1XE4A 1NSAA 2B3UA 1M57B 3BPZA 3JD1A 1CP7A 4NXYA 3CWBH 3S6GA 2UU9O 3GIUA 2Q69A 1VHEA 1H8EG 5IB0A 2QEXV 3NR7A 5LP6B 1R57A 2EINB 4R3LA 4DR7O 1IBLO 1R3KC 4JI5B 1MMMA 4TQFA 4KOUA 4MRIA 2UXBB 5D29A 1JFFB 3F0AA 1TVKA 2V8HA 4DV5O 3ISXA 4P4EA 4U3FH 1Y74B 2PC1A 3V38A 5A27A 5J8CA 4NKGB 1H2SB 1D5NA 2RC4A 3RYIA 2GFQA 2Q7EA 4CC5A 1BLLE 4P45A 4U7NA 4LFCB 1PM9A 3EY5A 4FM1A 4DR3B 4UB8Z 5C8YB 1GTOA 2CY2A 2AJ6A 2F95B 1DGSA 1BPMA 1Y66A 3NE8A 1VQ8V 4ZY1A 1MZEA 2XOKG 4PDRA 3A0RA 3ZRXA 2VQEO 1IGBA 3R96A 3ZZIA 4DV2B 4FLVA 3L74H 4F6RA 1HNWB 5I4MA 4ABMA 3JAWB 4Q36A 3CPAA 1VHOA 3T1YB 3FJUA 3KHZA 2W0FC 1Q6UA 4KHPO 4MVZA 3CB2A 2FE7A 5IB9A 4YJ2A 1GRJA 3WC6A 4IUSA 2YUAA 4UUJC 3TX8A 4DK0A 5GTHZ 5KUKA 4DR6B 1N71A 1Y0RA 3H8EA 1VF5B 3P2HA 4KS9A 1WA8A 3CCUV 3OW2U 4MW8A 1BCCH 2JGDA 2ZE6A 4I50B 4X88A 1KP3A 2YIBA 3G80A 4BAYA 4WWVA 4CH3A 2A06H 1IXBA 3ZHVA 5LYJA 4OC4A 3BHXA 2WLIB 3ZIAG 3IIBA 4WFFA 4GKJO 1N33B 2BTOA 2W0XA 4H89A 4KLVA 3CC4V 5CB4B 1NR1A 4O4JA 4PA3A 3N5FA 5EC4A 3S6FA 3CCJV 2XEJA 1IBMO 4IIJA 2P6GA 5K8OA 4I5SA 2B1IA 2R72A 4W4LA 4RI1A 4QPKA 4UFXA 2QJ8A 3SPIA 4FLXA 3QVNA 4UIAA 2JLMA 1T5EA 2ZOFA 4Z2WA 2B5GB 1Q81W 4LFBO 5JVDA 2EINC 2BCOA 5JCOC 1N34O 5AG5A 2Q7HA 3DXRB 2FMLA 1UWYA 5CA0B 2ITDC 2KG7A 1LANA 2ABZA 3ZRWA 1VHSA 2ADPA 4X1KA 4MHYA 4CH5A 4JD6A 1CPYA 4X1IA 1GKFA 1F57A 1FNOA 2BOBC 3ABKB 4DK1A 1K5SA 3F8KA 2H3OA 4PXBA 3QO8A 4B12A 4JZ0A 1D2DA 4LNUA 4O4HB 5J2UB 1Y76B 4QNHB 1KQSU 2WPDG 1AILA 1N0JA 5LYFA 1NS1A 3CRQA 3TO9A 4UCUA 2IQ6A 3N2GB 5AG6A 3EFAA 4DJLA 5EYPA 4F9VA 5LMUO 3H5ZA 3R9EA 4GKKB 1S3ZA 1YITV 4MHPA 2YI9A 4OX9O 1QQ9A 5THWA 1AI6A 3ZCCA 1WPXA 4JAAA 4B3MO 3PP9A 3KCXA 1OCRB 3K9AA 2B5UA 1O9HA 3TJTA 5LYIA 2BTQA 3MGDA 3H8GA 1XMQB 4R8CA 2E5LB 4TV9A 1KC8W 1ARLA 2C1CA 3IWEA 4CYQA 4JJXA 3JARA 4U5YA 2JRIA 1RSOB 4GYCB 3JSNA 5L3EA 1YJNV 4JYYA 2WLNA 5KX5A 1US6A 5IJ0B 1QSOA 3ZMZA 3JASB 4YXWG 1HWYA 1WWZA 2CNSA 3JATA 2ZELA 2L35A 2DEAA 4OPAA 1LR1A 2C6CA 2Y0IA 1VIBA 1EZJA 2JJ2G 5DEDA 2WUUA 1MK4A 2ZQMA 4NXNB 2OB0A 5GONA 1N4CA 1J5EO 4NVPA 2WLMA 3QB8A 5CA1A 3K2KA 4H13B 2QWPB 4DR2O 1VQNV 4XNHC 3OR6C 4DR4B 2F93B 2FYUH 1QQCA 1U96A 3SYPA 3DC6A 3LNMB 4R6ZA 4Q20A 3PB6X 4WFEA 1KD1W 2NLJC 1Q2YA 4LF5O 4PDVA 2BE3A 2YXYA 1CBXA 3CRCA 1RO5A 4EB6B 1TUEB 2ZOGA 4I4TB 5F49A
chains in the Genus database with same CATH topology
1I1DA 3FXTA 5G21A 2R8VA 2Q4YA 1YLEA 1P4NA 3OWCA 4F6AA 3FIXA 4UWJA 1Z4EA 3BLNA 3R1KA 1U6MA 2VEZA 3FB3A 2D4OA 4B11A 1XIXA 2OH1A 4CAWA 1M44A 4IF5A 4AG9A 2ARHA 1S7FA 1VKCA 2YGWA 2Q7BA 4BMHA 4L89A 4CGOA 2EUIA 4M3SA 5FVJA 4FD6A 1S7LA 4MFZA 5H84A 4CAVA 1YGHA 4C7IA 4MY0A 1Y9WA 5KTAA 3E0KA 1ON0A 3TO7A 2Z10A 4KOVA 1I21A 2QMLA 2DPSA 4YFJA 4R9MA 5C82A 3EO4A 3UY5A 5JQ4A 4MJ8A 3JVNA 2B4DA 2P6EA 2VQYA 2HUZA 3CXSA 3TTHA 4MI4A 3TOAA 1S60A 4R57A 3DDDA 3P2FA 2CXAA 2J8MA 2B4BA 4CYNA 2ZXVA 4MFJA 4C2YA 2WPXA 4ORFA 2ZPAA 4LX9A 3CXQA 3FBUA 3S6KA 3T9YA 3G8WA 4KUAA 1XF8A 2QIRA 4MFQA 2JDDA 5C88A 3B8GA 4LUAA 2I00A 3W91A 1P0HA 1QSRA 4NF1A 4JXRA 2PR8A 3K9UA 2G3AA 2Z3NA 5F46A 2Y0MA 4KOYA 4Y49B 4F0YA 2FCKA 2G0BA 4AVBA 2PSWA 4B5PB 2EVNA 5A28A 3R9GA 1Y7RA 4NSQA 4CYOA 1L0CA 1Z4RA 3LD2A 4MY3A 3D2MA 2YNEA 3BJ7A 4JLYA 4FD4A 4B13A 4A32A 4CAFA 2D4PA 1Q2DA 2B58A 4JWPA 4PSXA 3GY9A 3F5BA 4A33A 2VBQA 2PQ8A 4QUSA 4C7HA 2Q0YA 2B5GA 4C2ZA 3NE7A 1Z9UA 4MFKA 4R3KA 3JUWA 4UCPA 1XEBA 2DXQA 3H4QA 4E8OA 4CGLA 4U9YA 5HH1A 2VZYA 3TFYA 3TOBA 5DWNA 4CGPA 4OAEA 1NSLA 1B6BA 2R98A 4B5OA 2FIAA 2BL1A 3TE4A 1ZO0A 1YVOA 3FYNA 3ZJ0A 4CS0B 1MJAA 1K4JA 5F48A 1Q2CA 4CGNA 4KVOE 2REFA 1M4GA 3I3GA 2PR1A 4M85A 2OZHA 3I9SA 4XNHB 1PUAA 4K30A 4UA3A 4CAXA 4B10A 3R95A 4A2ZA 4PK3A 2VI7A 5AG4A 2BEIA 4KOWA 4KLWA 4I49A 4PSWA 3SXOA 1WK4A 3DR8A 1YREA 4KZTA 4ONUA 2DPTA 3C26A 2OZGA 4OADA 4JXQA 5ISVA 5GCNA 1M4DA 4NCZA 2FIWA 4CGMA 1M1DA 2X7BA 3CXPA 1SQHA 3FRMA 2YNCA 4GS4A 3S6HA 3D8PA 4KSAA 1XE4A 4AG7A 3R9FA 2B3UA 5CNPA 4FD7A 4C68A 4NXYA 3S6GA 3TCVA 4KOSA 4UCNA 2R1IA 5IX3A 5G22A 1CJWA 1S5KA 5IB0A 2OZUA 1R57A 1V0CA 1LRZA 4R3LA 4ZGYB 3V8IA 4KOUA 2Z11A 2J8NA 1BOBA 3F0AA 2FL4A 2Z3MA 1KUVA 3N7ZA 5DWMA 1OZPA 3T90A 2PDOA 4QBJA 1J4JA 5KTCA 2WSAA 1QSTA 3EXNA 1B87A 4Q38A 2PC1A 3RYOA 5A27A 5J8CA 4E0AA 2RC4A 4XPKA 5G20A 4CYPA 2NMTA 2Q04A 3EY5A 3TT2A 3G3SA 2CY2A 3D3SA 2AJ6A 1BO4A 2ZW5A 3FNCA 3R96A 1NE9A 3DR6A 2HQYA 3ZZIA 3IU1A 5G1ZA 4F0XA 4KORA 4XPDB 4Q36A 4A95A 3KKWA 2G3TA 4L8AA 1UFHA 4C2XA 2Q44A 2HV2A 3LODA 2OU2A 1YR0A 5IV0A 2A4NA 2FE7A 1KUYA 2JEVA 4IUSA 2QECA 4U9ZA 4QVTA 1N71A 1YK3A 2AE6A 5E96A 2PRBA 3P2HA 5F47A 2Z0ZA 4KS9A 2FS5A 4KUBA 2ZW4A 4UBRA 4NEXA 2ZW6A 4J3GA 2VZZA 2IL4A 4H6UA 4XPLA 4CAEA 2GE3A 2Z3PA 4YGOA 4EVYA 4QB9A 2FXFA 4HNXB 2KCWA 1XMTA 4H89A 4KLVA 1NMTA 2Z3LA 4PK2A 2VXKA 4MFPA 5EC4A 3S6FA 2P6GA 1FY7A 1QSNA 4RI1A 4UFXA 4KSFA 1QSMA 4H6ZA 3IWGA 2JLMA 2BUEA 2CNMA 2B5GB 3EC4A 1YX0A 5EBVA 2GANA 3PZJA 5AG5A 3QAHA 3IU2A 1YVKA 1VHSA 4AB7A 3BJ8A 4KOTA 2YNCC 4JD6A 2ZW7A 5KTDA 4UWIA 1TIQA 4RS2A 4A31A 2J8RA 1IICA 3F8KA 2R7HA 2FSRA 4KVXA 4Y49C 4B12A 4FD5A 2WPWA 2F5IA 3GYAA 4PV6A 4AVCA 3DSBA 2P0WA 3TO9A 1KZFA 2I79A 2H5MA 4B5PA 3IGRA 5AG6A 3EFAA 4UCMA 1RXTA 2CNTA 2Z3OA 3H5ZA 3R9EA 1KUXA 1S3ZA 3D2PA 3SHPA 4XPDC 4CRYB 2REEA 1S7KA 4HNYB 4B14A 4HKFA 3PP9A 4II9A 1IB1E 3GKRA 5I0CA 1S7NA 3SXNA 3W6SA 3PGPA 3MGDA 4BBHA 2Z3KA 3IWEA 4CYQA 2B4DB 4JJXA 4U5YA 2Q4VA 5H86A 4MBUA 2YNDA 3W6XA 4A30A 4MHDA 2ATRA 4DNCA 1QSOA 1MJBA 2BSWA 4CRZB 2JDCA 4X5KA 5HMNA 2CNSA 1WWZA 4OLLA 4ZBGA 4HNWB 5JPHA 1MJ9A 4R87A 5BWAB 4UFVA 3VWEA 3WR7A 3A9LA 2WUUA 1IIDA 1MK4A 2GIVA 2OB0A 4AVAA 2O28A 3QB8A 2C27A 5AGEA 4XNHC 3DNSA 3TO6A 3VWDA 1IYKA 2FT0A 2P6FA 1CM0A 3JTKA 4QC6A 1Y9KA 5J8FA 4UFWA 4E2AA 1Q2YA 1PU9A 1I12A 2B3VA 1IYLA 4MFLA 4KVME 1M4IA 4YRHA 1RO5A 5AG7A 4KOXA 2K5TA 1GHEA 5F49A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1I1D A;  3FXT A;  2R8V A;  2Q4Y A;  1YLE A;  1P4N A;  3OWC A;  4F6A A;  3FIX A;  4UWJ A;  1Z4E A;  3BLN A;  3R1K A;  1U6M A;  2VEZ A;  3FB3 A;  2D4O A;  1XIX A;  2OH1 A;  4CAW A;  1M44 A;  4IF5 A;  4AG9 A;  2ARH A;  1S7F A;  1VKC A;  2Q7B A;  4BMH A;  4L89 A;  2EUI A;  4M3S A;  5FVJ A;  4FD6 A;  1S7L A;  5H84 A;  4CAV A;  1YGH A;  4MY0 A;  1Y9W A;  5KTA A;  3E0K A;  1ON0 A;  3TO7 A;  2Z10 A;  4KOV A;  1I21 A;  2QML A;  4YFJ A;  4R9M A;  5C82 A;  3EO4 A;  3UY5 A;  5JQ4 A;  4MJ8 A;  3JVN A;  2B4D A;  2P6E A;  2VQY A;  2HUZ A;  3CXS A;  3TTH A;  4MI4 A;  3TOA A;  1S60 A;  4R57 A;  3DDD A;  3P2F A;  2J8M A;  2B4B A;  2ZXV A;  2WPX A;  4ORF A;  2ZPA A;  4LX9 A;  3CXQ A;  3FBU A;  3S6K A;  3T9Y A;  3G8W A;  4KUA A;  1XF8 A;  2QIR A;  2JDD A;  5C88 A;  3B8G A;  4LUA A;  2I00 A;  3W91 A;  1P0H A;  1QSR A;  4NF1 A;  4JXR A;  2PR8 A;  3K9U A;  2G3A A;  5F46 A;  2Y0M A;  4KOY A;  4Y49 B;  4F0Y A;  2FCK A;  2G0B A;  4AVB A;  2PSW A;  4B5P B;  2EVN A;  3R9G A;  1Y7R A;  4NSQ A;  1L0C A;  1Z4R A;  3LD2 A;  4MY3 A;  3D2M A;  3BJ7 A;  4JLY A;  4FD4 A;  2D4P A;  1Q2D A;  2B58 A;  4JWP A;  4PSX A;  3GY9 A;  3F5B A;  2VBQ A;  2PQ8 A;  4QUS A;  2Q0Y A;  2B5G A;  3NE7 A;  1Z9U A;  4R3K A;  3JUW A;  1XEB A;  2DXQ A;  3H4Q A;  4E8O A;  4U9Y A;  5HH1 A;  2VZY A;  3TFY A;  3TOB A;  5DWN A;  4OAE A;  1NSL A;  1B6B A;  2R98 A;  4B5O A;  2FIA A;  2BL1 A;  3TE4 A;  1YVO A;  3FYN A;  3ZJ0 A;  4CS0 B;  1MJA A;  1K4J A;  5F48 A;  1Q2C A;  4KVO E;  2REF A;  1M4G A;  3I3G A;  2PR1 A;  4M85 A;  2OZH A;  3I9S A;  4XNH B;  1PUA A;  4K30 A;  4UA3 A;  4CAX A;  3R95 A;  4PK3 A;  2VI7 A;  2BEI A;  4KOW A;  4KLW A;  4I49 A;  4PSW A;  3SXO A;  1WK4 A;  3DR8 A;  1YRE A;  4KZT A;  4ONU A;  3C26 A;  2OZG A;  4OAD A;  4JXQ A;  5ISV A;  5GCN A;  1M4D A;  4NCZ A;  2FIW A;  1M1D A;  2X7B A;  3CXP A;  1SQH A;  3FRM A;  4GS4 A;  3S6H A;  3D8P A;  1XE4 A;  4AG7 A;  3R9F A;  2B3U A;  5CNP A;  4FD7 A;  4NXY A;  3S6G A;  3TCV A;  4KOS A;  5IX3 A;  2R1I A;  1CJW A;  1S5K A;  5IB0 A;  2OZU A;  1R57 A;  1V0C A;  1LRZ A;  4R3L A;  3V8I A;  4KOU A;  2Z11 A;  2J8N A;  1BOB A;  3F0A A;  2FL4 A;  1KUV A;  3N7Z A;  5DWM A;  1OZP A;  3T90 A;  2PDO A;  4QBJ A;  1J4J A;  5KTC A;  1QST A;  3EXN A;  1B87 A;  2PC1 A;  3RYO A;  5J8C A;  4E0A A;  2RC4 A;  4XPK A;  2NMT A;  2Q04 A;  3EY5 A;  3TT2 A;  3G3S A;  2CY2 A;  3D3S A;  2AJ6 A;  1BO4 A;  2ZW5 A;  3FNC A;  3R96 A;  1NE9 A;  3DR6 A;  2HQY A;  3ZZI A;  4KOR A;  4XPD B;  3KKW A;  2G3T A;  4L8A A;  1UFH A;  2Q44 A;  2HV2 A;  3LOD A;  2OU2 A;  1YR0 A;  5IV0 A;  2A4N A;  2FE7 A;  1KUY A;  2JEV A;  4IUS A;  2QEC A;  4U9Z A;  4QVT A;  1N71 A;  1YK3 A;  2AE6 A;  5E96 A;  2PRB A;  3P2H A;  5F47 A;  2Z0Z A;  2FS5 A;  4KUB A;  2ZW4 A;  4UBR A;  4NEX A;  2ZW6 A;  4J3G A;  2VZZ A;  2IL4 A;  4H6U A;  4XPL A;  2GE3 A;  4YGO A;  4EVY A;  4QB9 A;  2FXF A;  4HNX B;  2KCW A;  1XMT A;  4H89 A;  4KLV A;  1NMT A;  4PK2 A;  2VXK A;  5EC4 A;  3S6F A;  2P6G A;  1FY7 A;  1QSN A;  4RI1 A;  1QSM A;  4H6Z A;  3IWG A;  2JLM A;  2BUE A;  2CNM A;  2B5G B;  3EC4 A;  1YX0 A;  5EBV A;  2GAN A;  3PZJ A;  3QAH A;  1YVK A;  1VHS A;  4AB7 A;  3BJ8 A;  4KOT A;  4JD6 A;  2ZW7 A;  5KTD A;  4UWI A;  1TIQ A;  4RS2 A;  2J8R A;  1IIC A;  3F8K A;  2R7H A;  2FSR A;  4KVX A;  4Y49 C;  4FD5 A;  2WPW A;  2F5I A;  3GYA A;  4PV6 A;  4AVC A;  3DSB A;  2P0W A;  3TO9 A;  1KZF A;  2I79 A;  2H5M A;  4B5P A;  3IGR A;  3EFA A;  1RXT A;  2CNT A;  3R9E A;  1KUX A;  1S3Z A;  3D2P A;  3SHP A;  4XPD C;  4CRY B;  2REE A;  1S7K A;  4HNY B;  4HKF A;  3PP9 A;  4II9 A;  1IB1 E;  3GKR A;  5I0C A;  1S7N A;  3SXN A;  3W6S A;  3PGP A;  3MGD A;  2B4D B;  4JJX A;  4U5Y A;  2Q4V A;  5H86 A;  4MBU A;  3W6X A;  4MHD A;  2ATR A;  4DNC A;  1QSO A;  1MJB A;  2BSW A;  4CRZ B;  2JDC A;  4X5K A;  5HMN A;  2CNS A;  1WWZ A;  4OLL A;  4ZBG A;  4HNW B;  5JPH A;  1MJ9 A;  4R87 A;  3VWE A;  3WR7 A;  1IID A;  1MK4 A;  2GIV A;  4AVA A;  2OB0 A;  2O28 A;  3QB8 A;  2C27 A;  4XNH C;  3DNS A;  3TO6 A;  3VWD A;  1IYK A;  2FT0 A;  2P6F A;  1CM0 A;  4QC6 A;  1Y9K A;  5J8F A;  4E2A A;  1Q2Y A;  1PU9 A;  1I12 A;  2B3V A;  1IYL A;  4KVM E;  1M4I A;  4YRH A;  1RO5 A;  4KOX A;  2K5T A;  1GHE A;  5F49 A; 
#chains in the Genus database with same CATH topology
 1W2B U;  3JD3 A;  3FXT A;  1PCA A;  1TKJ A;  3G6B A;  2Q4Y A;  3VOU A;  2B9Z A;  2PYJ A;  4KSI A;  3OWC A;  4BIZ A;  3PEI A;  3H1J H;  1PL0 A;  4F6A A;  2PTM A;  3TET A;  3A0B Z;  5JQG B;  3B40 A;  5JJE B;  1Z4E A;  2KSD A;  3K04 A;  3BAB A;  2OH1 A;  1YDX A;  2UXC O;  3NH4 A;  1M44 A;  4ONW A;  4CAW A;  5JWP A;  2JEU A;  1AR4 A;  4DV6 B;  2VWK A;  1GM7 A;  1S7F A;  2A0L A;  1AP6 A;  5IE9 A;  4EME A;  3CC2 V;  2CE4 A;  2PI5 A;  3ASN B;  4TT3 G;  2ZEE A;  4JI8 O;  1HDJ A;  1ELM P;  2EUI A;  4CGO A;  1JQG A;  1JX9 A;  3G6E V;  1S7L A;  4MFZ A;  2JGD B;  1XNQ B;  4CAV A;  1YGH A;  3C90 A;  4JI3 B;  4C7I A;  1Z2G A;  1WLE A;  3JAL B;  2CDY A;  4M6H A;  1ON0 A;  2Z10 A;  2QML A;  3D67 A;  3G67 A;  3ZJZ A;  5C82 A;  4OP4 A;  1XNR O;  4O4J B;  4MJ8 A;  1QNM A;  1OHH G;  3AG3 C;  3L72 H;  4IIJ B;  1YIJ V;  4JI0 B;  5K8P A;  4EKW A;  2HUZ A;  3CXS A;  4J9Y B;  1SZT A;  4B7E A;  2X6B A;  3JCZ A;  4I7Z B;  1ZLI A;  4LF4 B;  4XDJ A;  2QKC A;  2KQX A;  2Q51 A;  3F5T A;  1NTM H;  5JVD B;  3RYC A;  2P67 A;  2J9A A;  4MVQ A;  2KG7 B;  4FUU A;  4NGN A;  4ORF A;  4B3R B;  2ZDI C;  4LX9 A;  4P2Z A;  1A2Z A;  3FBU A;  5BXZ A;  2JEX A;  2FVG A;  4X62 B;  3G8W A;  4X1I B;  1FPO A;  1XF8 A;  4TNU A;  3SI0 A;  5KA5 A;  2AFX A;  3ETQ A;  3DSQ A;  3H1K H;  4GCZ A;  4MVS A;  3ETG A;  4PD4 F;  2JEW A;  3SJG A;  1Q8I A;  4HYO A;  2HHH B;  4NF1 A;  1ZX3 A;  1EBO A;  1HW7 A;  4LNU B;  2PZS A;  4K0K O;  1CPX A;  3K9U A;  3BY6 A;  1YVW A;  5LRG A;  3D7D A;  4KOY A;  4Y49 B;  2CF4 A;  2E76 B;  4LCU C;  3CCR V;  2FCK A;  2PSW A;  1YEW A;  1AR1 B;  2EVN A;  1PL4 A;  1Y7R A;  2OOT A;  5EYP B;  1DF4 A;  2PJ9 A;  1Z4R A;  5LGN A;  4X66 B;  4UCS A;  2DQ3 A;  4TQD A;  5EBW C;  1VQ4 V;  1CP6 A;  3B3T A;  3BJ7 A;  3AG1 B;  4D7T A;  3PB9 X;  4J7J A;  5J2T A;  1LFW A;  2D4P A;  5B3S B;  3IWW A;  1GM9 A;  3NH8 A;  2BOC C;  4CH4 A;  2AFU A;  2GUZ A;  2VBQ A;  2POK A;  4TV9 B;  3LDC A;  4YIO A;  1FJG O;  2F8H A;  5LL6 Y;  3NE7 A;  3BI0 A;  3JAR B;  4PDL A;  3TCU A;  5D5P A;  2IW5 A;  3HR0 A;  2HG5 C;  2EIJ B;  4E8O A;  1ARM A;  3UO2 A;  3W7S A;  2OTJ V;  5KX5 B;  1OCC B;  2M6Y A;  4U9Y A;  1UFI A;  2VZY A;  3FED A;  1S5H C;  2EO8 A;  1EFR G;  3WG7 C;  3CPW U;  3LUT B;  3I1U A;  1IDS A;  4CZZ A;  3EVK A;  4B5O A;  3T1H B;  3TE4 A;  2PJB A;  2Q6A A;  3KKY A;  4MHZ A;  2NN4 A;  1BL8 A;  4O2A B;  3FB7 C;  1YVO A;  1ZO0 A;  3IJ4 A;  1MJA A;  1XJO A;  1K4J A;  5F48 A;  4KVO E;  2C6G A;  2BSK B;  1Z5R A;  1FFX A;  4WFH A;  3I9S A;  1OJH A;  3ZMS A;  1VAR A;  4NTW A;  4CPA A;  1W0K G;  4CAX A;  2PRQ A;  4B10 A;  3H8F A;  2DYS B;  2Y69 B;  2EZP A;  4DV7 O;  4PSW A;  1JR9 A;  4IAV A;  3KHX A;  1YRE A;  1H8H G;  1I5Y A;  3QAY A;  1Q43 A;  1XMO O;  4AXV A;  4ONU A;  1EE3 P;  3C26 A;  1PNL A;  3JCU Z;  3J81 N;  4OAD A;  4RUH A;  3K0D A;  2PIY A;  2EX3 A;  3QNV A;  5FPO A;  4R50 A;  4OC2 A;  4G28 B;  2YXH A;  3CCV V;  2Q0O C;  4L87 A;  3RT3 C;  4DUY O;  4I9W A;  1F2O A;  1M4D A;  5GCN A;  4CGM A;  5HVF A;  3SPH A;  2WYR A;  3ZRV A;  4LQ6 A;  5BY1 A;  3FB8 C;  2ADQ B;  4LH7 A;  3CXP A;  4F4L A;  3FAV A;  4YHH B;  3DGE A;  4KSA A;  1F4N A;  4Z1M G;  3SJB C;  3OMA B;  4E4E A;  5H6R A;  1H2K A;  1CG2 A;  4C68 A;  1NU1 H;  3CP1 A;  3H1I H;  4NTX A;  2R1I A;  4UCN A;  3SYA A;  2F4V B;  2Q43 A;  2EIM B;  2OZU A;  4RQE A;  4A94 A;  1LRZ A;  3ABL B;  5EK0 A;  3F7V C;  2Q7S A;  3NFZ A;  2Z11 A;  2J8N A;  3STL C;  2P22 C;  3D3Q A;  2FL4 A;  3H1L H;  5LMN O;  3CRM A;  2AZ2 A;  1K4C C;  3RGB A;  1DK1 A;  3N7Z A;  5B3S C;  1N32 O;  1OZP A;  2IM9 A;  3KI9 A;  1J4J A;  1CEZ A;  2GSM B;  5KTC A;  1QST A;  4NGQ A;  3EXN A;  5LBQ A;  3OMN B;  1GH6 A;  3OTO B;  1P4R A;  2IH3 C;  4DV0 B;  1NH2 D;  4XPK A;  1XUQ A;  3OGI B;  1COW G;  3PB4 X;  4CYP A;  2CTB A;  1FXK B;  3TT2 A;  3ZHU A;  1BT8 A;  2ZEO A;  2EIJ C;  1HDU A;  1SET A;  4I0X A;  4MHN A;  4JZG A;  4FLY A;  2ZW5 A;  2HFE C;  1OCC C;  4LBE C;  2IU3 A;  5CBG A;  1HNX B;  1DTD A;  3FNC A;  3CJH B;  3T4D A;  2HQY A;  4IHJ A;  1IX9 A;  4BIN A;  2VQF B;  1ZSP A;  4MTX A;  2UUA O;  5CPA A;  4A95 A;  2G3T A;  3V7Z A;  3SI1 A;  1R6T A;  2PYL A;  4BR6 A;  2WLL A;  3LOD A;  2OU2 A;  4FLW A;  3PJS K;  2A4N A;  2P7T C;  1AI5 A;  3KQZ A;  3KL9 A;  4LH6 A;  1KUY A;  3UCS C;  1YLO A;  2Q0A A;  1CPS A;  1L1F A;  3G71 V;  3JD4 A;  2QEC A;  1GAX A;  3IFX A;  5K1X A;  4U9Z A;  5B66 Z;  1XFO A;  3CCE V;  3B3C A;  5D8N A;  2EJ7 A;  3MD0 A;  1YK3 A;  2AE6 A;  3GUX A;  1M9N A;  4X8I A;  2DN9 A;  2EWB A;  1XDC A;  4ZI7 B;  3IEH A;  1TKH A;  4KUB A;  4UBR A;  2DYS C;  2Y69 C;  3DC5 A;  1AJP A;  3L70 H;  4GM5 A;  2JS5 A;  3EXA A;  2ZW6 A;  4JYW A;  1ZG8 A;  5LRJ A;  1BQ0 A;  5BMV B;  4HNA A;  1P7B A;  1ZL8 A;  1WB7 A;  3QO7 A;  3EHB B;  4QB9 A;  2HB6 A;  4HNX B;  1VP7 A;  4RQF A;  5KHG A;  2UUB B;  4RUF A;  4MW3 A;  3I55 V;  5CMU A;  2VXK A;  2CAZ C;  2PJ5 A;  1VIX A;  3WAB A;  4ZKI A;  1KMI Z;  2JJ1 G;  2DYR C;  3D7G A;  3PRT A;  5J2T B;  3R65 A;  3VBB A;  5H9C A;  3WC7 A;  4NGS A;  1EN6 A;  1R73 A;  4IL6 Z;  4BIU A;  4FIP C;  3IWG A;  4H6Z A;  2GUZ B;  1JPX A;  3SPJ A;  4CH6 A;  1LNQ A;  3ZHQ A;  4O23 A;  3D7H A;  3VQY A;  4CC6 A;  1NH2 B;  2CNM A;  1RPR A;  3ABL C;  3VQV A;  5EBV A;  1HNZ O;  2PF4 E;  3PZJ A;  1GM8 A;  2XT9 A;  2GLJ A;  3QAH A;  5B1N A;  2V1D A;  2O53 A;  5L3D A;  4AB7 A;  1Q90 D;  3UM7 A;  4B3T B;  2OIG A;  2ZW7 A;  5KTD A;  4J10 A;  4FWU A;  1DE4 C;  4RS2 A;  3KAS A;  2AFM A;  2R7H A;  2W6J G;  2FSR A;  5J1Q A;  3GLJ A;  2I3C A;  1Z2L A;  5KMG A;  2AFZ A;  3DGV A;  4FK5 C;  3E35 A;  3PBB A;  2WPW A;  1FXK C;  2F5I A;  2OT5 A;  4JI5 O;  1AP5 A;  1XHX A;  3GYA A;  4PV6 A;  4F8Z A;  3P3N A;  1FFX B;  1YW6 A;  2P0W A;  1KZF A;  2H5M A;  3IGR A;  5BZB A;  3K57 A;  4UCM A;  3PN1 A;  2GTS A;  1ZLH A;  2CH7 A;  1MG1 A;  1RXT A;  2CNT A;  2Z3O A;  2GRE A;  2ITC C;  2PGG A;  3D2P A;  4WFA V;  3PB8 X;  5E1A C;  3E83 A;  3OMI B;  4B14 A;  1IVS A;  4DR5 O;  4HKF A;  4NJR A;  1OCZ B;  5FL7 G;  1I0H A;  3CXH F;  3GKR A;  3SXN A;  1WB8 A;  2PJC A;  3K59 A;  3A8T A;  3CYO A;  3AK2 A;  5LGT A;  5FPR A;  4DR1 B;  3THO A;  2B4D B;  4DR7 B;  4DV2 O;  4PA6 A;  5KAF Z;  1Z5V A;  4BW5 A;  4MBU A;  3FAV B;  4A30 A;  4DNC A;  1XRY A;  4DV5 B;  4UXN A;  2HC9 A;  4LR3 A;  5ITZ A;  1YTF D;  1AI4 A;  3LWU A;  3FEE A;  4U3J A;  1MJ9 A;  4UVC A;  4UFV A;  4WFB V;  3MN8 A;  3VWE A;  3APO A;  3WR7 A;  3EFF K;  3ZN1 A;  4AVA A;  4RWU A;  5EZY B;  4CS2 A;  2O28 A;  4DR6 O;  1VMG A;  1BGY H;  5IJ9 A;  1QLN A;  4UVB A;  1K97 A;  2R9I A;  4I55 B;  3SJQ C;  1RPO A;  2XAQ A;  2V8V A;  1CM0 A;  1QLE B;  4N23 A;  3JTK A;  4LC1 A;  1VF6 A;  2LJ2 A;  1KKC A;  4I9Q A;  1SC5 B;  1D5A A;  2ANP A;  1ZWI C;  3CX5 F;  4Z1V A;  4P4F A;  3FYE B;  1PU9 A;  1I12 A;  3S9N A;  1GMG A;  2ODM A;  4MFL A;  4KVM E;  5IYZ B;  2CK3 G;  4YRH A;  2WLH A;  2IJH A;  3OM3 B;  4KOX A;  4D7S A;  1GHE A;  1VGY A;  3L75 H;  1YSC A;  4LF7 B;  1R3J C;  1QCE A;  5G21 A;  2ZR2 A;  4JTA B;  5IY5 B;  2IJK A;  4TV8 A;  3ZED A;  2ZNI A;  4KL1 A;  3UT5 A;  5LXT B;  2BO9 A;  4OXS A;  1M57 C;  4PEL A;  3R1K A;  1U6M A;  4GUN A;  1J95 A;  2WA4 A;  1JCH A;  3FFQ A;  4FM0 A;  4K35 A;  5LP6 C;  4AG9 A;  4OC5 A;  2ARH A;  1VKC A;  1V55 B;  4L89 A;  5IWA O;  4UVA A;  1IBK B;  2ZEM A;  2IJI A;  5L3F A;  5EIB D;  4GKJ B;  4M3S A;  4AQY O;  4FD6 A;  2RMK B;  2A7W A;  3D66 A;  4DW1 A;  3HLP A;  4MT8 A;  4EFB A;  4PHZ A;  1YTF B;  4LWS B;  3MRU A;  4MY0 A;  2WLK A;  1ZL8 B;  3BA9 A;  4X64 B;  3RBZ A;  1QBZ A;  3TO7 A;  4K3N A;  4OPH A;  1XRE A;  1SA0 A;  4HBN A;  4CS3 A;  1F4M A;  3K03 A;  4LFB B;  2YI8 A;  2OCH A;  3UY5 A;  3OTF A;  1K73 W;  5JQ4 A;  4OME A;  3CXC U;  3F5W C;  2P4V A;  1SQV H;  1N34 B;  2F23 A;  4HAM A;  4Q6G A;  2VS0 A;  1AB3 A;  4XDK A;  2P6E A;  2VQY A;  2GU2 A;  1Q7Y W;  1BZK A;  3AK3 A;  2EK8 A;  1FYJ A;  4MI4 A;  3CPX A;  1S76 D;  4KUM A;  4WFG A;  4R57 A;  4BIO A;  3OT7 A;  4YU9 A;  4O2B B;  2J8M A;  5LHH A;  3BRC A;  2B4B A;  1Q6H A;  3SDL A;  4ASU G;  1X4T A;  4O4I A;  4BWA A;  4JI6 O;  4C2Y A;  2BCC H;  2WPX A;  3E89 A;  4UCT A;  1NVP D;  1QU7 A;  1G4Y B;  3E22 A;  3KR5 A;  2AZ0 A;  3VQX A;  3RVY A;  4PXE A;  4PA9 A;  1VQ6 V;  4KUA A;  2QIR A;  4MFQ A;  2QR4 A;  3E8F A;  4DRX A;  5C88 A;  1BMF G;  5LMU B;  1SQX H;  4DV3 B;  3WC5 A;  1FXH A;  2YIA A;  1P0H A;  2VL1 A;  4GX5 A;  2XTA A;  3IO1 A;  4DUZ O;  3SYQ A;  2YIB D;  3TXS A;  4LF8 B;  1IY7 A;  1YJW V;  1X10 A;  5ELY A;  5F46 A;  4UF4 A;  1M56 B;  3D68 A;  2GBO A;  2G0B A;  4AVB A;  3B3V A;  3U0Z A;  2N04 A;  4P9O A;  1TUB A;  4B08 A;  1H8L A;  4DR4 O;  2B1G A;  3ZX6 A;  4EWT A;  5IY5 C;  1TVK B;  1WN7 A;  4D6T H;  5KLV H;  2CTP A;  3JAK A;  1RM1 B;  1XL6 A;  2QM7 A;  4ZOL A;  2PJ1 A;  2YNE A;  3BFR A;  2QVP A;  2ZIO A;  4NR1 A;  3C3S A;  4UEF A;  4F9U A;  4B13 A;  4CAF A;  4UIB A;  4PI2 A;  2ZNJ A;  2B58 A;  2UUC B;  3RYI B;  3ZMV A;  1ENV A;  4DV1 O;  1GN2 A;  1DF5 A;  4WF9 V;  4HPS A;  2Q0Y A;  3HUV A;  1Y67 A;  1Z8L A;  4FJC C;  3SYO A;  4C2Z A;  3ZBH A;  5F09 A;  2CGO A;  4MTO A;  2X0L A;  3B8M A;  2PJ8 A;  2DXQ A;  1PYT B;  2M7W A;  4X20 A;  5B1O A;  1J5E B;  4QJF B;  2PVW A;  1N36 O;  4NGP A;  1EN4 A;  2R9R B;  4CGL A;  2PJ0 A;  4F6R B;  4QE9 A;  3ABK C;  3W7X A;  3O9O A;  5DWN A;  5ITZ B;  4LFA O;  1IXM A;  1NSL A;  4IHM A;  1XOV A;  2BL1 A;  2N74 A;  3WT4 A;  1MSW D;  4XBF A;  2QM8 A;  1JMK C;  4PI0 A;  4YJ2 B;  1N8R W;  2WLJ A;  1R6K A;  3FYN A;  1NVP B;  3IAY A;  2ETN A;  4EEQ A;  5L3G A;  4YWY A;  1Q2C A;  5IYD O;  2RNB A;  3ZMU A;  4J42 A;  4M85 A;  2L6L A;  1XNQ O;  1LUW A;  5LOV A;  2OZH A;  1TGO A;  1E1Q G;  2ZEP A;  4G1P A;  3HPL C;  1WA8 B;  4PV1 B;  1PV0 A;  4UA3 A;  1XQ8 A;  1PD3 A;  3U10 A;  3R95 A;  3SPG A;  3L9D A;  5AG4 A;  1OCR C;  5LYJ B;  2JK5 C;  3B3W A;  3CSX A;  2QWR B;  4OID A;  2Q73 A;  4YIP A;  4JXQ A;  1A32 A;  4X2T A;  4JPR A;  1QMU A;  3LDE A;  3T2M A;  2YEV A;  3J80 N;  3CHX A;  2HVJ C;  1M1D A;  2X7B A;  4JI8 B;  4UCR A;  2IH1 C;  4EFD A;  1SRY A;  1VEW A;  1H2G A;  1SQH A;  3G4S V;  1TF8 A;  2PJ6 A;  2WSS G;  3CT9 A;  3S6H A;  4ZI6 A;  1IU8 A;  2Q67 A;  2JBK A;  2PJ2 A;  2CTQ A;  3D8P A;  4Z65 A;  2RQ6 A;  5LA6 A;  2IJZ A;  1M56 C;  1QVG U;  4FD7 A;  3BI1 A;  1R43 A;  3M99 B;  4B3R O;  3TCV A;  4KOS A;  5IX3 A;  3VH9 A;  1SQB H;  5EIB C;  4X62 O;  1JJ2 U;  1V0C A;  3LMS A;  3OE7 G;  2XAJ A;  4OC3 A;  3ZRW B;  3FKS G;  2WAM A;  4JYB A;  2UXD O;  3K9T A;  1BE3 H;  4X1K B;  1RM1 C;  3QTC A;  1BOB A;  3E8B A;  4DUK A;  4H0L B;  3FVL A;  1OZ0 A;  1F2P A;  4MMO A;  2ZEN A;  3MDS A;  2UXN A;  5DWM A;  3GVM A;  3T90 A;  4TUY A;  4DXW A;  3ABM B;  2PDO A;  2WSA A;  3ABT A;  5JH7 A;  4X9Q A;  1NI8 A;  1SA0 B;  1ELL P;  2HVK C;  2QWO B;  4B6Z A;  5KUM A;  2Q04 A;  4X66 O;  1GN3 A;  1BO4 A;  4U7O A;  2HJD A;  2CIJ A;  1R1B A;  3ML0 A;  4B3S B;  3DR6 A;  4JI4 O;  4H44 B;  2MK3 A;  4K8X A;  2YXL A;  3IU1 A;  4R8F A;  3BHP A;  4F0X A;  4KOR A;  1H2M A;  2OR4 A;  4L8A A;  2IU0 A;  1UFH A;  4O4I B;  4P4B A;  4C2X A;  2Q5Z A;  2ILM A;  1M90 W;  1JVM A;  5KHH A;  4JYA O;  3JD0 A;  5IV0 A;  2BTQ B;  3AG2 B;  3H01 A;  2JEV A;  3FX6 A;  3E22 B;  3ASN C;  2KKW A;  3ZMT A;  3TC8 A;  1I7F A;  4QVT A;  4DRX B;  3E8G A;  5BR8 B;  2P6J A;  3J7A U;  1B3Q A;  1YXB A;  3L73 H;  2PRB A;  3K5O A;  5CBH A;  2Z0Z A;  1I94 B;  5EC2 C;  5EBM C;  3JAT B;  3K5M A;  3ZS8 C;  4NEX A;  2EBJ A;  1PNM A;  2E75 B;  3ASO B;  2VZZ A;  2DMX A;  4X65 O;  2IL4 A;  4H6U A;  3ZHS A;  2P5O A;  3PFO A;  2Q8V A;  2MW2 B;  1TUB B;  2XHB A;  1FAF A;  5GON B;  3L2N A;  4L8J A;  4YGO A;  4EVY A;  3VAT A;  5CA1 B;  1XMT A;  2JVD A;  1NMT A;  4MCS A;  3H1H H;  3SR2 C;  3OAA G;  2ATK C;  4JGS A;  1R6N A;  3BXM A;  3OEE G;  1FY7 A;  1YSJ A;  5DN6 G;  4MCP A;  2G9D A;  3OEH G;  3E8H A;  3HKB A;  2V77 A;  5B5E Z;  2VRZ A;  2EBO A;  4JYC A;  5KHK A;  4JI2 O;  2QM4 A;  3S9M A;  4RUE A;  2F66 C;  1L0L H;  3LDD A;  2GAN A;  2XAG A;  5J9P C;  2AHZ A;  1QR8 A;  3PB7 X;  3GB0 A;  4DV4 O;  5JCO A;  1YME A;  4X89 A;  4IYI A;  2PJ7 A;  4YHH O;  3BJ8 A;  4KOT A;  1CP9 A;  1JFF A;  1QR9 A;  4UWI A;  1OCO B;  3KZW A;  3ABM C;  3ETE A;  4A31 A;  2J8R A;  2RN9 A;  1V54 B;  4H2K A;  1RFY A;  4MCQ A;  2FKX A;  4KVX A;  4Y49 C;  2F4V O;  2AW9 A;  4HZ3 A;  4ZY0 A;  2RDC A;  4DV7 B;  1I5X A;  2Q68 A;  4LF6 B;  2ZM6 O;  1XMO B;  2I79 A;  4B5P A;  4NGT A;  5C8Y A;  1NT2 B;  3T8W A;  4W9Y A;  4ZX9 A;  1KUX A;  4CRY B;  2JIZ G;  3AG1 C;  3B09 A;  2REE A;  1S7K A;  1HR0 O;  1F7Y A;  3JAW A;  5IDJ A;  2OWO A;  4MSW C;  1VQ5 V;  4II9 A;  1IB1 E;  2AGA A;  1AJN A;  2LQT A;  4JAV A;  5I0C A;  1S7N A;  3SJA C;  3PGP A;  4GLX A;  1TKF A;  3IC9 A;  2YEV B;  2H8P C;  3KCY A;  4UB6 Z;  1SKV A;  3RNZ A;  1EN5 A;  1AUG A;  1WJZ A;  4MHD A;  2OTL V;  2ATR A;  1JA8 A;  1MJB A;  5B1B B;  4I50 A;  3ASO C;  1YCI A;  2FB5 A;  4ICG A;  1YQE A;  4UV9 A;  4ZBG A;  4HNW B;  3RYC B;  5JPH A;  4OKO A;  1SQG A;  4R87 A;  5BWA B;  1JWQ A;  3GWK C;  1K92 A;  4PQA A;  5EBL C;  4NYK A;  1Z8X A;  4P4D A;  2WLI A;  1IID A;  1KU9 A;  2Y0P A;  4BW9 A;  3AG7 A;  1WAZ A;  4GT1 A;  1PNK A;  2RFH A;  2F1M A;  1GN4 A;  1KWM A;  5AGE A;  3MHS C;  1UJW B;  4JI7 B;  2WWW A;  1HP8 A;  3DNS A;  4NXM B;  4P4J A;  3VWD A;  1SQF A;  4CBC A;  1U97 A;  1MZF A;  2FT0 A;  2P6F A;  4QC6 A;  1G6U A;  1O9G A;  5J8F A;  2QSA A;  4FFK A;  1SZX A;  1P7G A;  2AHY A;  4IGG A;  1VQ9 V;  4W4K A;  1NZ6 A;  1FXV A;  3N2K A;  1K34 A;  4NTY A;  1ZAU A;  2ZE8 A;  1Y0Y A;  1IYL A;  2ZD9 A;  4P4I A;  4CS4 A;  3CCQ V;  1M4I A;  5AG7 A;  5KA6 A;  1SQP H;  2DJV A;  1K5Q A;  3QO5 A;  5CA0 A;  1BHB A;  1I1D A;  1OBR A;  1V9P A;  1OCO C;  2R8V A;  5FLX N;  3A2F A;  1Y6X A;  2X6A A;  5CA3 A;  3CRR A;  1TF9 A;  3L71 H;  4LF9 O;  3FD9 A;  1BQZ A;  3FIX A;  3TGU H;  5L3C A;  3P32 A;  3CCS V;  2D4O A;  4B11 A;  4FBE A;  5KHI A;  4GX2 A;  1EZV H;  1VF7 A;  4JV5 O;  3B8N A;  4TWE A;  2EIM C;  4O4H A;  3JRU A;  4FVM A;  1Y76 A;  2YGW A;  3CE2 A;  1THZ A;  2Q7B A;  4BMH A;  1FD9 A;  1ROP A;  4JI1 O;  2AFW A;  3N2G A;  3UQ8 A;  1ZG9 A;  5H84 A;  1PP9 H;  3SGI A;  2D3O W;  1XBU A;  4TSF G;  5LYL A;  1TA8 A;  5JJJ B;  2P06 A;  3DTU B;  3BVO A;  3APQ A;  3K5L A;  4AHC A;  6CPA A;  5H5N A;  2FTK A;  1VQL V;  4WJB A;  5KTA A;  4E2L A;  2H94 A;  2PCU A;  1FT7 A;  1NJI W;  2DPS A;  2ZR3 A;  3B35 A;  4YFJ A;  1SQQ H;  3EO4 A;  5LRK A;  2GTA A;  2UXB O;  1E79 G;  1HNZ B;  1Q3E A;  1M1K W;  1IOI A;  5CBM A;  1YI2 V;  1SF9 A;  3P3P A;  5HFM A;  3FMC A;  3K79 A;  2AXT Z;  3S3W A;  5CBF A;  1RSO A;  2EIK B;  2KB1 A;  4PJ0 Z;  4FLU A;  2IMO A;  3RBU A;  4RO2 A;  3TTH A;  2Z5U A;  3RVZ A;  5IJ0 A;  2YIC A;  1K8A W;  2HEP A;  4YY3 B;  3AEI A;  1XEQ A;  3JAS A;  1YW4 A;  3P2F A;  3K3W A;  2JGU A;  2YSU B;  1AYE A;  4LFC O;  3CDX A;  3ETD A;  4DR3 O;  1L8D A;  2ZE7 A;  4DR1 O;  2UU9 B;  1JQ0 A;  1LUV A;  2ZE5 A;  3FYI B;  3H9V A;  3T9Y A;  4GZR B;  3RYF A;  3B2Y A;  3CD6 V;  3QG5 A;  1MSD A;  2ZDI A;  3OUS A;  1IBL B;  4UEE A;  4Q7A A;  1XL4 A;  1HNW O;  2JDD A;  3SYC A;  3B8G A;  4LUA A;  3T1Y O;  2I00 A;  3A0H Z;  4H37 A;  4UV8 A;  1QSR A;  1Q5O A;  2PR8 A;  2Z3N A;  2O57 A;  3W7W A;  4F0Y A;  4DR5 B;  1FFT B;  2PJ4 A;  1MAB G;  1R3I C;  4GXH A;  4PXD A;  4B5P B;  5A28 A;  3R9G A;  2D2C B;  4EB6 A;  5JJN B;  1ZTE A;  4J11 A;  1Z5W A;  4IT5 A;  3LD2 A;  4I4T A;  4MY3 A;  1KEC A;  4KFM A;  1AJQ A;  5E79 Z;  2DWE C;  5A2Q N;  3D2M A;  3TK1 A;  2UXX A;  4X8A A;  2X6C A;  3JYC A;  3K9S A;  2VQE B;  4A32 A;  3M7M X;  4R7M A;  5JQG A;  1Q2D A;  4P44 A;  4MTG A;  4J80 A;  2R9A A;  4PSX A;  3GY9 A;  3F5B A;  4A33 A;  1N33 O;  2ZKO A;  4QUS A;  4LF7 O;  4N21 A;  4KHP B;  2ZT9 B;  4I0X B;  4TOI A;  4UCV A;  4MCR A;  1Z9U A;  4MFK A;  4R3K A;  4UCP A;  1S77 D;  3VQW A;  1XEB A;  1AR5 A;  3GWO A;  3QF7 A;  3IJ3 A;  3NH5 A;  5HVH A;  4IHJ B;  1BAV A;  3M8A A;  5HH1 A;  2JDI G;  1PKX A;  3TFY A;  2QWQ B;  3OR7 C;  4CGP A;  1FS0 G;  2C2A A;  4OAE A;  2QYV A;  5LHI A;  4K8Z A;  2R98 A;  2WLL B;  1K33 A;  1M4U A;  3JAL A;  1YJ9 V;  4UEZ A;  3CC7 V;  5H2F Z;  2EUL A;  2ZIM A;  1IBK O;  1CX8 A;  2HKO A;  4OIW A;  3RFR A;  2A3Q A;  4CS0 B;  4QIW F;  4R7C A;  2REF A;  1M4G A;  2CTR A;  3I3G A;  2EIK C;  2V7Q G;  5IYC O;  4XNH B;  4ZHQ A;  1S5J A;  4K30 A;  1GN6 A;  3SJX A;  2XEG A;  3I56 V;  5DM6 V;  3MAQ A;  4X64 O;  1IBM B;  3N2K B;  1OCZ C;  3T1C A;  1AVM A;  1JOY A;  2BEI A;  3NXS A;  2EZO A;  4HNA B;  2YDE A;  3SXO A;  3DR8 A;  2YC0 A;  1XIL A;  4X3R A;  2WZN A;  2LP7 A;  2LFS A;  1H38 A;  4GKK O;  4NCZ A;  4X1Y A;  2FIW A;  2ZIN A;  5IWA B;  1SES A;  3WB1 A;  2LO1 A;  3OFN G;  4AQY B;  2XUM A;  3P30 A;  4AG7 A;  3JSL A;  3R9F A;  5CNP A;  3B2E E;  5G22 A;  1XMQ O;  3CS5 A;  2E5L O;  1CJW A;  1S5K A;  2DW4 A;  4P30 A;  2N05 A;  4P9P A;  3SJF A;  4ZGY B;  4MVR A;  3T4Z A;  5C93 A;  7CPA A;  4WBN A;  5LYD A;  3V8I A;  2RCV A;  4DV3 O;  2DE0 X;  4MVO A;  2PJA A;  2CTC A;  2Z3M A;  2QE7 G;  1QLE C;  3WFV A;  3E86 A;  4LF8 O;  1KUV A;  3K08 A;  1W59 A;  1M5I A;  5K1P A;  3KR4 A;  4QBJ A;  5KMG B;  1B87 A;  4Q38 A;  3RYO A;  5FNV A;  5JM6 A;  4E0A A;  4OX9 B;  4NGR A;  3HKD A;  3X2Q B;  4NXN O;  4B3M B;  1MOF A;  5G20 A;  4EFE A;  3SJE A;  2NMT A;  4PA7 A;  4JI6 B;  3G3S A;  1HEE A;  2XAS A;  4J41 A;  3KQX A;  2CH7 B;  3D3S A;  2HP8 A;  3AG3 B;  3ISZ A;  1Y7E A;  1S72 V;  4OGQ B;  3K58 A;  1NE9 A;  3IFE A;  1CXZ B;  1RP3 B;  2G38 A;  4J7K A;  1R3N A;  2F43 G;  5G1Z A;  2UUC O;  3D36 C;  4XPD B;  4IK2 A;  2QJ1 A;  3KKW A;  4JTC B;  2Y4T A;  2Q44 A;  2HV2 A;  4DUZ B;  2LGW A;  2PE3 A;  1YR0 A;  5DEC A;  5HXD A;  3N27 A;  4O2A A;  1BSM A;  1V55 C;  3RYF B;  1Y4M A;  2A79 B;  3ZHR A;  2WA3 A;  1VQM V;  4JZ2 A;  2BSK A;  4DYL A;  2BOA A;  5E96 A;  5F47 A;  4DR2 B;  3LSQ A;  4F6E A;  2FS5 A;  2OIE A;  5A9G A;  2ZW4 A;  4U3J B;  4H33 A;  4NB5 A;  4QGP A;  4QE7 A;  4J3G A;  3OD4 A;  1P49 A;  5IYB O;  3FB5 C;  4DV6 O;  4YJ3 A;  4XPL A;  4FPP A;  4CAE A;  1Q86 W;  2GE3 A;  4ZX8 A;  2Z3P A;  4LF5 B;  1NR7 A;  4DV1 B;  2FXF A;  2KCW A;  2E3C A;  5IJ9 B;  5HFL A;  2Z3L A;  4RAI A;  1R3L C;  4MFP A;  4PK2 A;  4JI3 O;  1QSN A;  2Y48 A;  4O4L A;  3W7U A;  2GV9 A;  1N36 B;  4KSF A;  5EMI A;  2XEF A;  5DS0 A;  1QSM A;  4LFA B;  2CTW A;  4G27 B;  2BUE A;  3B77 A;  3DLJ A;  1RTQ A;  4KP4 A;  3EC4 A;  4NFR A;  1YX0 A;  3CEI A;  1F51 A;  1ORQ C;  3LSU A;  5IT9 N;  1N0N A;  5F2V O;  3D8C A;  3B7I A;  2JS3 A;  2QTS A;  5KHJ A;  3D3I A;  3CCM V;  2UXC B;  4MVU A;  4JI0 O;  4A38 A;  2QGN A;  3IU2 A;  1PPJ H;  3NA6 A;  1YVK A;  3TXQ A;  4TV8 B;  2XND G;  2YNC C;  3UKM A;  4AIL C;  3UT5 B;  3HKE A;  1TIQ A;  1S5L Z;  2QKS A;  1K4D C;  4JAS A;  4LF4 O;  2GDS A;  5L3B A;  1TAE A;  2E74 B;  1IIC A;  4WCE V;  1QHT A;  5KAI Z;  3WG7 B;  3FX7 A;  2PY5 A;  3X2Q C;  1KBH A;  1W0J G;  4FD5 A;  2JBJ A;  1AI7 A;  1JJO A;  1KUQ A;  2F7V A;  2V8G A;  4FFB A;  4AVC A;  1XI1 A;  3DSB A;  1EM1 A;  1FXK A;  4KXR A;  2RJZ A;  4LQG A;  3HKC A;  4ZHQ B;  5LHG A;  2PI4 A;  1XNR B;  3ZHT A;  2ODF A;  2PIZ A;  3SHP A;  5K8N A;  4XPD C;  1NTK H;  1K3E A;  3CJH A;  2HHH O;  2P90 A;  3CME V;  1ARO P;  1IZ3 A;  4HNY B;  4DW0 A;  3ZN0 A;  1IOF A;  2ZED A;  2LW7 A;  5B1A B;  3AG4 B;  3W6S A;  5TIS Z;  4P6Y A;  1KP2 A;  1ZLZ A;  1WP7 A;  4BBH A;  2Z3K A;  4B3S O;  4X1Y B;  2ZCE A;  3UO3 A;  3CCL V;  2Q4V A;  5H86 A;  1KKD A;  2UXD B;  2OCC B;  3W7T A;  2YND A;  1GYT A;  3W6X A;  3S3X A;  4GX1 A;  2BSW A;  4CRZ B;  4ZI7 A;  3U11 A;  2JDC A;  4MXU A;  4X5K A;  5HMN A;  3S9L A;  3BA8 A;  3BAA A;  4OLL A;  2ZEG A;  2IJJ A;  2DQ0 A;  1VQK V;  1WP8 A;  3CMA V;  2DF5 A;  4K0K B;  3A9L A;  1MNG A;  5BMV A;  3C3T A;  2GIV A;  4WBN B;  3FF3 A;  5BR8 O;  4P10 A;  3KZI Z;  1DTO A;  3F7Y C;  1UPG A;  2C27 A;  4R76 A;  1I94 O;  3IC1 A;  3RYH A;  3OGC C;  1VF6 C;  2Q9L A;  1URF A;  3TO6 A;  2PJ3 A;  1YZB A;  4FLZ A;  3K06 A;  3RN4 A;  1IYK A;  1M4L A;  3WB0 A;  3T1H O;  3E2E A;  1Y9K A;  4JI4 B;  5FNV B;  1G8M A;  4UFW A;  3HKD B;  4E2A A;  2B3V A;  1SS3 A;  4NJQ A;  2IBZ H;  1G1X B;  4JAU A;  4JYA B;  1LAM A;  2K5T A;  1NQT A;  2LW1 A;  2C6P A;  3JAK B;  1S3J A;  1FJG B;  1XBL A;  2R70 A;  4ZOL B;  1YLE A;  1ZG7 A;  1P4N A;  3Q4H A;  4IYH A;  3JAM N;  4ZIB A;  1VQ7 V;  5CN0 A;  1BS3 A;  4UWJ A;  2NSM A;  3BLN A;  4M6I A;  2EJR A;  2VEZ A;  3FB3 A;  2DOS A;  1XIX A;  3LAC A;  1TXR A;  3HB3 B;  1WNS A;  4JTD B;  4C7U A;  4IF5 A;  4X65 B;  3BEH A;  1SER A;  4DYO A;  3CRA A;  5LP6 A;  4X20 B;  1H2L A;  5GW7 A;  5FVJ A;  3D7F A;  2AFO A;  1L0N H;  1VQO V;  2Z0A A;  3LNN A;  3IC7 A;  2HLD G;  3K0G A;  3FEC A;  3KG2 A;  2O4H A;  2GHY A;  4FZ0 A;  1M93 A;  1NKD A;  2YS8 A;  4K3A A;  1Y9W A;  4YJ3 B;  3QNE A;  2W6I G;  3WB2 A;  5EC1 C;  5H6Q A;  3E0K A;  5B1A C;  1Y74 A;  2LFR A;  4LF6 O;  1X59 A;  3AG4 C;  1I21 A;  4JI2 B;  1Q7L A;  4KOV A;  4FAI A;  3O65 A;  4B7K A;  2NYQ A;  4R9M A;  2Q4Z A;  2A9H A;  3D4U A;  4PDM A;  4LP8 A;  2QKA A;  4JF3 A;  4AI8 A;  5LOV B;  2QWN B;  3RW0 A;  3JVN A;  1DLB A;  2OCC C;  2B4D A;  4DV4 B;  4O4L B;  1OV9 A;  4DUY B;  1LCP A;  2RB7 A;  1K7D A;  2DYR B;  1Z8W A;  2NNU A;  2EIL B;  2K1E A;  1VQP V;  2ZXW B;  3TOA A;  4DO2 A;  1S60 A;  4FLT A;  1LOK A;  2EK9 A;  3OTO O;  3DDD A;  2CXA A;  4DV0 O;  1HDQ A;  3LSS A;  2V4D A;  1XOU A;  3WU2 Z;  1XMB A;  3AG2 C;  4CYN A;  1IUR A;  2ZXV A;  4MFJ A;  2YID A;  3B4S A;  4MTF A;  3B3S A;  3RAM A;  4A37 A;  3ABU A;  3OUF A;  2XEI A;  1MA1 A;  2ZPA A;  3CXQ A;  3SI2 A;  3S6K A;  5EZY A;  4J7Z A;  3BCC H;  1HNX O;  3STZ C;  3ZRS A;  2ZM6 B;  1KYO F;  3FH4 A;  1BPN A;  3HKE B;  5K8M A;  3VAR A;  4I55 A;  2VQF O;  3R66 A;  1S0V A;  5LMN B;  3W91 A;  1GO3 F;  5LA6 B;  3SPC A;  4JXR A;  2NR5 A;  1X12 A;  2G3A A;  1N32 B;  1AMP A;  4XDL A;  2HR3 A;  5AG2 A;  1HR0 B;  2Y0M A;  4UFZ A;  4UCO A;  3K5N A;  4FFB B;  1Z8T A;  1NBM G;  5IYZ A;  1FKA O;  4JI7 O;  3HKC B;  3FB6 C;  4NXM O;  4NSQ A;  2DWD C;  4A39 A;  4CYO A;  1L0C A;  4FMT A;  3MHH C;  2ZEF A;  2AFS A;  3I5D A;  1F23 A;  5D5Q A;  1I08 A;  1NTZ H;  5CB4 A;  4MS2 A;  4FM2 A;  4TUY B;  4RN7 A;  4JLY A;  4BD9 A;  5LXT A;  4G2K A;  1B06 A;  4FD4 A;  5JH7 B;  3RZA A;  4OC0 A;  4JWP A;  3AK1 A;  2CGN A;  3D36 A;  4QPJ A;  4MVM A;  1H2N A;  2UUA B;  1QVF U;  2QA4 V;  5HVG A;  2PQ8 A;  4ZBM A;  4C7H A;  4TWK A;  2UUB O;  2B5G A;  2XAH A;  4ZY2 A;  4OC1 A;  2K9P A;  2OYQ A;  3JUW A;  1YF2 A;  3DXR A;  2ZEH A;  3H4Q A;  1Q82 W;  4M6G A;  3TOB A;  2PUS A;  4PPZ A;  5JH9 A;  1V54 C;  1K9M W;  1Q6I A;  1B6B A;  4GX0 A;  1BHA A;  4LWS A;  2FIA A;  2V8D A;  2Q4P A;  2QTO A;  3CZX A;  4R6T A;  4PXC A;  2QDO A;  2VWJ A;  2X7R B;  3KGQ A;  3ZJ0 A;  1B04 A;  5J2U A;  3GB7 C;  4CGN A;  3RYH B;  4B3T O;  2XAF A;  1KB9 F;  2CUG A;  2Q7G A;  2PR1 A;  8CPA A;  4FZ1 A;  4A5U B;  3ICX A;  2HJF C;  1PUA A;  2EIL C;  2ZXW C;  4NGM A;  4A2Z A;  4PK3 A;  2VI7 A;  3PFE A;  4LF9 B;  4KOW A;  4KLW A;  4I49 A;  5JGF A;  3IGA C;  2Y4U A;  4O2B A;  1WK4 A;  4KZT A;  1E1R G;  2GLF A;  5LGU A;  4JV5 B;  2DPT A;  2OZG A;  1P84 F;  4ZYQ A;  3RO0 A;  5ISV A;  2PVV A;  1GK9 A;  4PA4 A;  2P4K A;  3Q4H B;  4J9Z B;  5GTI Z;  4JI1 B;  1LAP A;  2LGQ A;  1WPB A;  1YHQ V;  1ZUQ A;  3JD2 A;  3HKB B;  4YY3 O;  3FRM A;  2YNC A;  1XHZ A;  1B6Q A;  3PBE A;  4GS4 A;  5B1B C;  2Z3Y A;  3SJC C;  3RWR D;  1XE4 A;  1NSA A;  2B3U A;  1M57 B;  3BPZ A;  3JD1 A;  1CP7 A;  4NXY A;  3CWB H;  3S6G A;  2UU9 O;  3GIU A;  2Q69 A;  1VHE A;  1H8E G;  5IB0 A;  2QEX V;  3NR7 A;  5LP6 B;  1R57 A;  2EIN B;  4R3L A;  4DR7 O;  1IBL O;  1R3K C;  4JI5 B;  1MMM A;  4TQF A;  4KOU A;  4MRI A;  2UXB B;  5D29 A;  1JFF B;  3F0A A;  1TVK A;  2V8H A;  4DV5 O;  3ISX A;  4P4E A;  4U3F H;  1Y74 B;  2PC1 A;  3V38 A;  5A27 A;  5J8C A;  4NKG B;  1H2S B;  1D5N A;  2RC4 A;  3RYI A;  2GFQ A;  2Q7E A;  4CC5 A;  1BLL E;  4P45 A;  4U7N A;  4LFC B;  1PM9 A;  3EY5 A;  4FM1 A;  4DR3 B;  4UB8 Z;  5C8Y B;  1GTO A;  2CY2 A;  2AJ6 A;  2F95 B;  1DGS A;  1BPM A;  1Y66 A;  3NE8 A;  1VQ8 V;  4ZY1 A;  1MZE A;  2XOK G;  4PDR A;  3A0R A;  3ZRX A;  2VQE O;  1IGB A;  3R96 A;  3ZZI A;  4DV2 B;  4FLV A;  3L74 H;  4F6R A;  1HNW B;  5I4M A;  4ABM A;  3JAW B;  4Q36 A;  3CPA A;  1VHO A;  3T1Y B;  3FJU A;  3KHZ A;  2W0F C;  1Q6U A;  4KHP O;  4MVZ A;  3CB2 A;  2FE7 A;  5IB9 A;  4YJ2 A;  1GRJ A;  3WC6 A;  4IUS A;  2YUA A;  4UUJ C;  3TX8 A;  4DK0 A;  5GTH Z;  5KUK A;  4DR6 B;  1N71 A;  1Y0R A;  3H8E A;  1VF5 B;  3P2H A;  4KS9 A;  1WA8 A;  3CCU V;  3OW2 U;  4MW8 A;  1BCC H;  2JGD A;  2ZE6 A;  4I50 B;  4X88 A;  1KP3 A;  2YIB A;  3G80 A;  4BAY A;  4WWV A;  4CH3 A;  2A06 H;  1IXB A;  3ZHV A;  5LYJ A;  4OC4 A;  3BHX A;  2WLI B;  3ZIA G;  3IIB A;  4WFF A;  4GKJ O;  1N33 B;  2BTO A;  2W0X A;  4H89 A;  4KLV A;  3CC4 V;  5CB4 B;  1NR1 A;  4O4J A;  4PA3 A;  3N5F A;  5EC4 A;  3S6F A;  3CCJ V;  2XEJ A;  1IBM O;  4IIJ A;  2P6G A;  5K8O A;  4I5S A;  2B1I A;  2R72 A;  4W4L A;  4RI1 A;  4QPK A;  4UFX A;  2QJ8 A;  3SPI A;  4FLX A;  3QVN A;  4UIA A;  2JLM A;  1T5E A;  2ZOF A;  4Z2W A;  2B5G B;  1Q81 W;  4LFB O;  5JVD A;  2EIN C;  2BCO A;  5JCO C;  1N34 O;  5AG5 A;  2Q7H A;  3DXR B;  2FML A;  1UWY A;  5CA0 B;  2ITD C;  2KG7 A;  1LAN A;  2ABZ A;  3ZRW A;  1VHS A;  2ADP A;  4X1K A;  4MHY A;  4CH5 A;  4JD6 A;  1CPY A;  4X1I A;  1GKF A;  1F57 A;  1FNO A;  2BOB C;  3ABK B;  4DK1 A;  1K5S A;  3F8K A;  2H3O A;  4PXB A;  3QO8 A;  4B12 A;  4JZ0 A;  1D2D A;  4LNU A;  4O4H B;  5J2U B;  1Y76 B;  4QNH B;  1KQS U;  2WPD G;  1AIL A;  1N0J A;  5LYF A;  1NS1 A;  3CRQ A;  3TO9 A;  4UCU A;  2IQ6 A;  3N2G B;  5AG6 A;  3EFA A;  4DJL A;  5EYP A;  4F9V A;  5LMU O;  3H5Z A;  3R9E A;  4GKK B;  1S3Z A;  1YIT V;  4MHP A;  2YI9 A;  4OX9 O;  1QQ9 A;  5THW A;  1AI6 A;  3ZCC A;  1WPX A;  4JAA A;  4B3M O;  3PP9 A;  3KCX A;  1OCR B;  3K9A A;  2B5U A;  1O9H A;  3TJT A;  5LYI A;  2BTQ A;  3MGD A;  3H8G A;  1XMQ B;  4R8C A;  2E5L B;  4TV9 A;  1KC8 W;  1ARL A;  2C1C A;  3IWE A;  4CYQ A;  4JJX A;  3JAR A;  4U5Y A;  2JRI A;  1RSO B;  4GYC B;  3JSN A;  5L3E A;  1YJN V;  4JYY A;  2WLN A;  5KX5 A;  1US6 A;  5IJ0 B;  1QSO A;  3ZMZ A;  3JAS B;  4YXW G;  1HWY A;  1WWZ A;  2CNS A;  3JAT A;  2ZEL A;  2L35 A;  2DEA A;  4OPA A;  1LR1 A;  2C6C A;  2Y0I A;  1VIB A;  1EZJ A;  2JJ2 G;  5DED A;  2WUU A;  1MK4 A;  2ZQM A;  4NXN B;  2OB0 A;  5GON A;  1N4C A;  1J5E O;  4NVP A;  2WLM A;  3QB8 A;  5CA1 A;  3K2K A;  4H13 B;  2QWP B;  4DR2 O;  1VQN V;  4XNH C;  3OR6 C;  4DR4 B;  2F93 B;  2FYU H;  1QQC A;  1U96 A;  3SYP A;  3DC6 A;  3LNM B;  4R6Z A;  4Q20 A;  3PB6 X;  4WFE A;  1KD1 W;  2NLJ C;  1Q2Y A;  4LF5 O;  4PDV A;  2BE3 A;  2YXY A;  1CBX A;  3CRC A;  1RO5 A;  4EB6 B;  1TUE B;  2ZOG A;  4I4T B;  5F49 A; 
#chains in the Genus database with same CATH homology
 1I1D A;  3FXT A;  5G21 A;  2R8V A;  2Q4Y A;  1YLE A;  1P4N A;  3OWC A;  4F6A A;  3FIX A;  4UWJ A;  1Z4E A;  3BLN A;  3R1K A;  1U6M A;  2VEZ A;  3FB3 A;  2D4O A;  4B11 A;  1XIX A;  2OH1 A;  4CAW A;  1M44 A;  4IF5 A;  4AG9 A;  2ARH A;  1S7F A;  1VKC A;  2YGW A;  2Q7B A;  4BMH A;  4L89 A;  4CGO A;  2EUI A;  4M3S A;  5FVJ A;  4FD6 A;  1S7L A;  4MFZ A;  5H84 A;  4CAV A;  1YGH A;  4C7I A;  4MY0 A;  1Y9W A;  5KTA A;  3E0K A;  1ON0 A;  3TO7 A;  2Z10 A;  4KOV A;  1I21 A;  2QML A;  2DPS A;  4YFJ A;  4R9M A;  5C82 A;  3EO4 A;  3UY5 A;  5JQ4 A;  4MJ8 A;  3JVN A;  2B4D A;  2P6E A;  2VQY A;  2HUZ A;  3CXS A;  3TTH A;  4MI4 A;  3TOA A;  1S60 A;  4R57 A;  3DDD A;  3P2F A;  2CXA A;  2J8M A;  2B4B A;  4CYN A;  2ZXV A;  4MFJ A;  4C2Y A;  2WPX A;  4ORF A;  2ZPA A;  4LX9 A;  3CXQ A;  3FBU A;  3S6K A;  3T9Y A;  3G8W A;  4KUA A;  1XF8 A;  2QIR A;  4MFQ A;  2JDD A;  5C88 A;  3B8G A;  4LUA A;  2I00 A;  3W91 A;  1P0H A;  1QSR A;  4NF1 A;  4JXR A;  2PR8 A;  3K9U A;  2G3A A;  2Z3N A;  5F46 A;  2Y0M A;  4KOY A;  4Y49 B;  4F0Y A;  2FCK A;  2G0B A;  4AVB A;  2PSW A;  4B5P B;  2EVN A;  5A28 A;  3R9G A;  1Y7R A;  4NSQ A;  4CYO A;  1L0C A;  1Z4R A;  3LD2 A;  4MY3 A;  3D2M A;  2YNE A;  3BJ7 A;  4JLY A;  4FD4 A;  4B13 A;  4A32 A;  4CAF A;  2D4P A;  1Q2D A;  2B58 A;  4JWP A;  4PSX A;  3GY9 A;  3F5B A;  4A33 A;  2VBQ A;  2PQ8 A;  4QUS A;  4C7H A;  2Q0Y A;  2B5G A;  4C2Z A;  3NE7 A;  1Z9U A;  4MFK A;  4R3K A;  3JUW A;  4UCP A;  1XEB A;  2DXQ A;  3H4Q A;  4E8O A;  4CGL A;  4U9Y A;  5HH1 A;  2VZY A;  3TFY A;  3TOB A;  5DWN A;  4CGP A;  4OAE A;  1NSL A;  1B6B A;  2R98 A;  4B5O A;  2FIA A;  2BL1 A;  3TE4 A;  1ZO0 A;  1YVO A;  3FYN A;  3ZJ0 A;  4CS0 B;  1MJA A;  1K4J A;  5F48 A;  1Q2C A;  4CGN A;  4KVO E;  2REF A;  1M4G A;  3I3G A;  2PR1 A;  4M85 A;  2OZH A;  3I9S A;  4XNH B;  1PUA A;  4K30 A;  4UA3 A;  4CAX A;  4B10 A;  3R95 A;  4A2Z A;  4PK3 A;  2VI7 A;  5AG4 A;  2BEI A;  4KOW A;  4KLW A;  4I49 A;  4PSW A;  3SXO A;  1WK4 A;  3DR8 A;  1YRE A;  4KZT A;  4ONU A;  2DPT A;  3C26 A;  2OZG A;  4OAD A;  4JXQ A;  5ISV A;  5GCN A;  1M4D A;  4NCZ A;  2FIW A;  4CGM A;  1M1D A;  2X7B A;  3CXP A;  1SQH A;  3FRM A;  2YNC A;  4GS4 A;  3S6H A;  3D8P A;  4KSA A;  1XE4 A;  4AG7 A;  3R9F A;  2B3U A;  5CNP A;  4FD7 A;  4C68 A;  4NXY A;  3S6G A;  3TCV A;  4KOS A;  4UCN A;  2R1I A;  5IX3 A;  5G22 A;  1CJW A;  1S5K A;  5IB0 A;  2OZU A;  1R57 A;  1V0C A;  1LRZ A;  4R3L A;  4ZGY B;  3V8I A;  4KOU A;  2Z11 A;  2J8N A;  1BOB A;  3F0A A;  2FL4 A;  2Z3M A;  1KUV A;  3N7Z A;  5DWM A;  1OZP A;  3T90 A;  2PDO A;  4QBJ A;  1J4J A;  5KTC A;  2WSA A;  1QST A;  3EXN A;  1B87 A;  4Q38 A;  2PC1 A;  3RYO A;  5A27 A;  5J8C A;  4E0A A;  2RC4 A;  4XPK A;  5G20 A;  4CYP A;  2NMT A;  2Q04 A;  3EY5 A;  3TT2 A;  3G3S A;  2CY2 A;  3D3S A;  2AJ6 A;  1BO4 A;  2ZW5 A;  3FNC A;  3R96 A;  1NE9 A;  3DR6 A;  2HQY A;  3ZZI A;  3IU1 A;  5G1Z A;  4F0X A;  4KOR A;  4XPD B;  4Q36 A;  4A95 A;  3KKW A;  2G3T A;  4L8A A;  1UFH A;  4C2X A;  2Q44 A;  2HV2 A;  3LOD A;  2OU2 A;  1YR0 A;  5IV0 A;  2A4N A;  2FE7 A;  1KUY A;  2JEV A;  4IUS A;  2QEC A;  4U9Z A;  4QVT A;  1N71 A;  1YK3 A;  2AE6 A;  5E96 A;  2PRB A;  3P2H A;  5F47 A;  2Z0Z A;  4KS9 A;  2FS5 A;  4KUB A;  2ZW4 A;  4UBR A;  4NEX A;  2ZW6 A;  4J3G A;  2VZZ A;  2IL4 A;  4H6U A;  4XPL A;  4CAE A;  2GE3 A;  2Z3P A;  4YGO A;  4EVY A;  4QB9 A;  2FXF A;  4HNX B;  2KCW A;  1XMT A;  4H89 A;  4KLV A;  1NMT A;  2Z3L A;  4PK2 A;  2VXK A;  4MFP A;  5EC4 A;  3S6F A;  2P6G A;  1FY7 A;  1QSN A;  4RI1 A;  4UFX A;  4KSF A;  1QSM A;  4H6Z A;  3IWG A;  2JLM A;  2BUE A;  2CNM A;  2B5G B;  3EC4 A;  1YX0 A;  5EBV A;  2GAN A;  3PZJ A;  5AG5 A;  3QAH A;  3IU2 A;  1YVK A;  1VHS A;  4AB7 A;  3BJ8 A;  4KOT A;  2YNC C;  4JD6 A;  2ZW7 A;  5KTD A;  4UWI A;  1TIQ A;  4RS2 A;  4A31 A;  2J8R A;  1IIC A;  3F8K A;  2R7H A;  2FSR A;  4KVX A;  4Y49 C;  4B12 A;  4FD5 A;  2WPW A;  2F5I A;  3GYA A;  4PV6 A;  4AVC A;  3DSB A;  2P0W A;  3TO9 A;  1KZF A;  2I79 A;  2H5M A;  4B5P A;  3IGR A;  5AG6 A;  3EFA A;  4UCM A;  1RXT A;  2CNT A;  2Z3O A;  3H5Z A;  3R9E A;  1KUX A;  1S3Z A;  3D2P A;  3SHP A;  4XPD C;  4CRY B;  2REE A;  1S7K A;  4HNY B;  4B14 A;  4HKF A;  3PP9 A;  4II9 A;  1IB1 E;  3GKR A;  5I0C A;  1S7N A;  3SXN A;  3W6S A;  3PGP A;  3MGD A;  4BBH A;  2Z3K A;  3IWE A;  4CYQ A;  2B4D B;  4JJX A;  4U5Y A;  2Q4V A;  5H86 A;  4MBU A;  2YND A;  3W6X A;  4A30 A;  4MHD A;  2ATR A;  4DNC A;  1QSO A;  1MJB A;  2BSW A;  4CRZ B;  2JDC A;  4X5K A;  5HMN A;  2CNS A;  1WWZ A;  4OLL A;  4ZBG A;  4HNW B;  5JPH A;  1MJ9 A;  4R87 A;  5BWA B;  4UFV A;  3VWE A;  3WR7 A;  3A9L A;  2WUU A;  1IID A;  1MK4 A;  2GIV A;  2OB0 A;  4AVA A;  2O28 A;  3QB8 A;  2C27 A;  5AGE A;  4XNH C;  3DNS A;  3TO6 A;  3VWD A;  1IYK A;  2FT0 A;  2P6F A;  1CM0 A;  3JTK A;  4QC6 A;  1Y9K A;  5J8F A;  4UFW A;  4E2A A;  1Q2Y A;  1PU9 A;  1I12 A;  2B3V A;  1IYL A;  4MFL A;  4KVM E;  1M4I A;  4YRH A;  1RO5 A;  5AG7 A;  4KOX A;  2K5T A;  1GHE A;  5F49 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...