2FL4A

The crystal structure of the spermine/spermidine acetyltransferase from enterococcus faecalis
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
147
structure length
147
Chain Sequence
b'GMEIHFEKVTSDNRKAVENLQVFAEQQAFIESMAENLKESDQFPEWESAGIYDGNQLIGYAMYGRWQDGRVWLDRFLIDQRFQGQGYGKAACRLLMLKLIEKYQTNKLYLSVYDTNSSAIRLYQQLGFVFNGELDTNGERVMEWTHQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords spermine/spermidine acetyltransferase
publication title The crystal structure of the spermine/spermidine acetyltransferase from Enterococcus faecalis
rcsb
source organism Enterococcus faecalis
molecule tags Transferase
total genus 36
structure length 147
sequence length 147
ec nomenclature
pdb deposition date 2006-01-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.900 Mainly Alpha Orthogonal Bundle Helix Hairpins The crystal structure of the spermine/spermidine acetyltransferase from enterococcus faecali 2fl4A01
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 2fl4A02
2GE3A 3IGRA 5I0CA 2BSWA 5C82A 4E0AA 2D4OA 3TOAA 4FD4A 2O28A 2ATRA 4FD7A 3EFAA 3KKWA 4XPDB 4QBJA 2R7HA 1I1DA 2B5GA 5HH1A 5KTCA 3DNSA 2EVNA 3BJ8A 3TO7A 2F5IA 2J8MA 4DNCA 3N7ZA 4JLYA 2FCKA 4AG7A 5C88A 4J3GA 5JQ4A 1OZPA 2G3AA 2Q4YA 1YLEA 3TO9A 3TE4A 5E96A 3S6HA 4JXQA 1NE9A 2Q0YA 4AVCA 1U6MA 4NF1A 1P0HA 2HUZA 2VQYA 3FXTA 1KUVA 2G0BA 4AG9A 2QECA 4IUSA 3DR6A 4XPDC 3QAHA 3SXOA 4RS2A 3P2FA 1Q2CA 3D8PA 1XMTA 4HNWB 2RC4A 4QUSA 3D2MA 3PZJA 1IYLA 3QB8A 4CAVA 2B3UA 2Z10A 2QIRA 5EBVA 2FL4A 2J8RA 5H84A 1S7LA 4B5PA 2FIAA 3S6FA 4GS4A 1QSRA 2JEVA 3G3SA 4H6UA 2OZHA 4R9MA 4UWIA 1IYKA 4KZTA 3B8GA 4RI1A 2KCWA 5DWMA 4U5YA 3F5BA 4F6AA 1B6BA 3OWCA 4M3SA 4NEXA 4MY3A 3F0AA 3W6XA 2P6GA 2X7BA 4BMHA 3DDDA 1FY7A 1S7KA 1M4IA 1WK4A 2WPXA 2K5TA 4OLLA 4U9YA 4XPLA 2A4NA 4XNHC 1J4JA 2CNTA 2PR1A 1Y7RA 2Q7BA 1MJBA 2B5GB 3MGDA 2IL4A 2Y0MA 2OZUA 4M85A 1BOBA 1UFHA 4MI4A 4PK3A 3S6GA 4HNXB 1I21A 1Q2YA 4PSXA 3ZJ0A 3JVNA 4F0YA 3TT2A 3VWDA 1GHEA 4YFJA 1QSNA 2CNSA 3R9GA 4HKFA 4PK2A 3TCVA 1Z9UA 5KTDA 4AVBA 1Z4EA 3SHPA 1NMTA 4B5OA 3EO4A 3FB3A 3SXNA 3DR8A 2C27A 3WR7A 2PRBA 1CM0A 5F46A 1PU9A 4AB7A 1IB1E 4R3LA 4XPKA 1RO5A 4YRHA 3C26A 1S60A 1Y9KA 4JWPA 4FD6A 4E8OA 4ONUA 1XF8A 1CJWA 4YGOA 3TO6A 4KUAA 2PR8A 4U9ZA 4FD5A 1TIQA 3V8IA 2FSRA 4UBRA 4JXRA 4QB9A 4B5PB 1KUXA 4LUAA 4UWJA 2G3TA 2NMTA 2QMLA 4PV6A 4KOXA 1XE4A 3TFYA 1KUYA 2Q44A 5DWNA 2WPWA 1L0CA 2D4PA 3F8KA 2VEZA 5CNPA 1S7FA 4HNYB 1M4DA 5KTAA 2AE6A 5IV0A 2HQYA 1P4NA 4XNHB 5JPHA 1LRZA 4LX9A 4CS0B 4KVXA 2B3VA 3ZZIA 2AJ6A 2Z11A 2Z0ZA 2OH1A 2BEIA 2ZW6A 4OAEA 4R3KA 3E0KA 3I9SA 1VKCA 3RYOA 1YREA 2B4DA 2P0WA 4X5KA 1S3ZA 3FIXA 3D2PA 5F48A 4R57A 1ON0A 2Q04A 2ZXVA 2VI7A 1Z4RA 4MHDA 1Q2DA 5ISVA 3T9YA 5IB0A 3W6SA 3EC4A 2FT0A 5EC4A 4L8AA 3LODA 2P6FA 4ZBGA 4L89A 5H86A 2Q4VA 1YVOA 2PSWA 1SQHA 4II9A 1YVKA 3CXPA 1YK3A 3PGPA 4QC6A 2OU2A 3W91A 2I79A 3FRMA 4KORA 4KUBA 2FS5A 3EY5A 2H5MA 3UY5A 4KOYA 4ORFA 2EUIA 4JJXA 3GKRA 1S7NA 5F47A 1YGHA 4IF5A 3DSBA 4KOUA 2BL1A 1NSLA 2I00A 3BLNA 3R1KA 3GYAA 2VXKA 2CY2A 4CAXA 3BJ7A 4EVYA 3JUWA 4JD6A 4NCZA 2R8VA 1I12A 3D3SA 2GIVA 3R96A 4UA3A 4Y49C 4NXYA 2OZGA 4MY0A 3LD2A 1XIXA 3R9FA 3IWGA 2J8NA 5FVJA 1M4GA 1Y9WA 4I49A 5GCNA 3R95A 3NE7A 4MJ8A 3TTHA 4CRZB 3R9EA 4K30A 2BUEA 4KOVA 2VZYA 2VBQA 4QVTA 4KOSA 4R87A 3FYNA 2B4DB 3G8WA 1PUAA 4CAWA 5J8CA 1V0CA 4KVME 2REFA 4KLVA 2PQ8A 2JLMA 3P2HA 1MJ9A 4KVOE 3CXQA 4CRYB 1IICA 2VZZA 4MBUA 2ZW4A 2HV2A 4PSWA 2OB0A 1K4JA 3H4QA 2GANA 1IIDA 5HMNA 1WWZA 3FNCA 2CNMA 2ZW7A 3VWEA 2R98A 2B58A 3FBUA 3GY9A 2R1IA 1QSOA 2JDCA 4OADA 4H6ZA 1B87A 1XEBA 3CXSA 3K9UA 3S6KA 5J8FA 2PC1A 1YR0A 4H89A 1M1DA 2FE7A 4NSQA 3T90A 3I3GA 1S5KA 1N71A 1QSMA 2PDOA 2P6EA 3TOBA 3EXNA 5F49A 2ARHA 2JDDA 5IX3A 1KZFA 1YX0A 2FIWA 1MJAA 2FXFA 4KLWA 1R57A 4KOTA 4Y49B 2ZPAA 2REEA 2DXQA 1VHSA 1RXTA 1M44A 1QSTA 4KOWA 1BO4A 2ZW5A 2B4BA 1MK4A 4AVAA 3PP9A 4E2AA
chains in the Genus database with same CATH superfamily
3D8CA 4TT3G 5C8YA 2EO8A 5C82A 2UXBO 3KCYA 2FTKA 5JJJB 4I0XB 4UF4A 4LQ6A 4MFJA 4XPDB 2UXCB 4I50A 2EILC 1K5QA 1K7DA 3DNSA 2IU0A 1K5SA 4QPJA 3DTUB 4D7SA 1QLNA 2KQXA 2WLLA 2ZM6O 4UCMA 3SJXA 3TO7A 2J8MA 1BZKA 1KU9A 3N7ZA 1ARMA 3I55V 1XMBA 1F4NA 1VEWA 3E8HA 5LP6A 1OBRA 2ZIOA 2G3AA 2EK9A 4R8FA 5CA1A 1Z8XA 3WC5A 2OCCB 3OR6C 2CXAA 1TF8A 4JI2O 2Q7EA 2HVKC 1P4RA 3W7SA 2YSUB 2D3OW 1NE9A 2JEXA 3U0ZA 1H2KA 2JGDB 2Q0YA 1XQ8A 3CXCU 3BHXA 3B3CA 4KHPO 4U3FH 4GKJO 5DM6V 4ZX8A 3VQWA 1KUVA 1Z8LA 2NNUA 2AFUA 1SQVH 4WFEA 1GM7A 1JQ0A 1Q90D 3SJGA 2ZD9A 5LYIA 5LA6A 1Q6HA 4UIBA 2QJ1A 1CP6A 1VGYA 4H33A 5A9GA 4ZOLB 4CC5A 4PI0A 3KCXA 3DC5A 2ZEHA 2AFZA 4KSIA 4A31A 4J41A 3D8PA 3B4SA 3OEHG 1XMTA 4F8ZA 2V8DA 1H8HG 3KG2A 4QPKA 4UIAA 5BMVB 1AP5A 3K5NA 4UB6Z 2RC4A 3CMEV 1RPOA 1V54B 4CAVA 1EN6A 4CH4A 1SA0B 1S0VA 2Z10A 2FL4A 4Z1VA 4CGMA 2RB7A 2UUCB 4NGTA 1WP7A 3RYCA 4CC6A 3SPGA 3HKDA 2ZXWB 4JI6B 3RYHA 4GLXA 2OZHA 3L2NA 3KQZA 5KHIA 3K5LA 4R9MA 3CRCA 4UWIA 3G67A 1IYKA 4JPRA 3B2YA 4FAIA 5K8NA 4CAEA 1TVKA 1P84F 2EZPA 1Y66A 2IH3C 2ZEOA 4PXCA 2V8HA 3V38A 5L3CA 2JRIA 3FB7C 2CTRA 1K4CC 2G9DA 3NE8A 3KHZA 3I5DA 3N2KA 2POKA 3F0AA 3IEHA 2X7BA 2XTAA 3GLJA 4J7JA 2ADPA 3JSNA 3IC7A 1I7FA 5IYZB 1M4IA 3SI1A 1ZAUA 1AMPA 4A37A 4JYAO 1S3JA 3QNVA 1MOFA 4NGNA 4Z2WA 5LYJB 3OW2U 1XUQA 2XEGA 4XPLA 2A4NA 1RSOB 4XNHC 2CNTA 5LXTA 2Z3KA 1HDUA 1MJBA 3D7GA 4I7ZB 4J11A 2Y0MA 5ITZB 3K9SA 2PY5A 2AFMA 1UFHA 4K0KO 3M8AA 1MZEA 1HDQA 4UB8Z 3SJQC 4DR3B 3H1KH 4U3JA 1GHEA 3VWDA 5LOVA 1Y67A 2YIBD 2YIDA 2IM9A 1NU1H 2NSMA 3R9GA 1VF6A 1Y0YA 3BXMA 4HKFA 2DWEC 5FPRA 5CA0B 1Z9UA 2EIMB 5KTDA 3IJ3A 2IQ6A 1Z4EA 3NFZA 1QQ9A 4B5OA 1KP2A 3SXNA 2N74A 4FVMA 4I9WA 4DV0B 5HVGA 2CH7B 3KI9A 1A2ZA 4P10A 1PU9A 1H2GA 2KKWA 1IB1E 1HEEA 1SESA 2VRZA 3LDEA 1OCRB 1W0JG 5CB4A 4DV5B 2UUAO 4W4KA 4E4EA 3JATB 1PD3A 1AJQA 3K79A 3N27A 5CPAA 1KB9F 5KA6A 3K9TA 1JFFB 3FAVA 4FK5C 5LGNA 1Z2LA 3WB2A 2CTBA 2PR8A 2PRQA 1J95A 4FD5A 4U9ZA 1VQMV 4X1KB 4X8IA 4JI1B 5EBLC 1PCAA 1K9MW 2X6AA 1TF9A 3V8IA 4FWUA 4DUKA 4I5SA 1M90W 4ZI6A 4LF6B 4P45A 1KYOF 4RUHA 2HP8A 2Y48A 4UWJA 1HNZB 3PEIA 1K4DC 1FD9A 1OHHG 1VQ5V 3VQVA 5AG7A 4LF9O 2I3CA 1P7BA 2Q4PA 3TFYA 2PF4E 3HLPA 3X2QC 3WB1A 5F2VO 1VQNV 1ZL8B 2ZNIA 4EWTA 8CPAA 3OMIB 1L0CA 1NVPD 2D4PA 3F8KA 4MVOA 4NVPA 4HNYB 1R43A 1L0NH 1IBMB 1M4DA 1UWYA 4FFBA 4LBEC 2UUCO 5H6QA 4LF7B 4XNHB 1LRZA 1CX8A 1Z8TA 4LX9A 3MRUA 1XNQB 2AJ6A 2LFSA 2NN4A 4JI6O 4UFWA 2PE3A 3F7VC 4OAEA 1K33A 3ABLC 4BIUA 3GVMA 1KWMA 3ZMSA 3D4UA 3D7FA 3CYOA 2LGWA 2F7VA 2B4DA 3LMSA 1YJWV 2BOBC 1COWG 1HNWB 4M6IA 3TETA 4R57A 1WA8A 2X0LA 4YJ2A 3ZS8C 4A30A 1M4LA 2BTQA 3AK1A 1VP7A 5H5NA 1IBLB 3N2GB 5C8YB 4Q6GA 1V9PA 1N32B 3FYEB 1XHZA 3NH4A 1AI6A 5AG4A 2EZOA 2FT0A 5EC4A 4TWEA 2VL1A 1H8EG 3VOUA 1NR1A 3STLC 1NR7A 4L8AA 1I0HA 4QNHB 1Z5RA 1ZG9A 4JI5B 5H86A 2Q4VA 4O23A 3E35A 4DR3O 2OCHA 5HVHA 1EZJA 3K3WA 3F5WC 4EMEA 2IJHA 3CCVV 2O57A 2LGQA 5IY5C 1GMGA 3CXPA 3PGPA 3S9LA 1WB7A 2DF5A 1K8AW 4QC6A 2Q8VA 2EWBA 2GLJA 4GZRB 3OE7G 1ELLP 2FS5A 3EY5A 5A2QN 4DV0O 1VF6C 4JJXA 3WABA 2XAJA 4C7HA 1CPSA 4MVZA 4R50A 2VWKA 2ZKOA 1E1RG 1BGYH 3X2QB 4PDLA 1S76D 4B08A 4KOUA 4GX1A 4WBNB 3GB7C 4KP4A 3BLNA 3FX6A 3R1KA 4B11A 4DV6O 5LMNB 3CCSV 1XRYA 1SQFA 3BJ7A 4FIPC 3JUWA 1NSAA 4JD6A 4NCZA 3D3SA 4UV8A 3ETGA 4P4FA 4UA3A 1IOIA 4I0XA 4LF4O 4NXMB 3PFOA 3APOA 5B3SC 1XNRO 1WPXA 4KSFA 4MY0A 3SR2C 4X64B 2ZENA 3ABLB 3ZX6A 2FB5A 2UXDO 2NLJC 1Z8WA 1B6QA 1EZVH 2FMLA 4JF3A 3L75H 4MHNA 4ZI7A 4ONWA 3OEEG 4J42A 3ISXA 3JARB 1HNZO 2QKAA 4R8CA 3UKMA 1TVKB 3R9EA 4Q36A 4EEQA 3MAQA 4XBFA 2JGDA 4TQDA 2VBQA 4QVTA 4KOSA 1XMQB 1AYEA 3FYNA 1RP3B 1V0CA 2BOCC 3ISZA 2Q43A 2REFA 4KVME 2JLMA 1IBMO 4RUEA 5EIBC 2Z3LA 4DUYB 3PB6X 2Q69A 4LF7O 5CMUA 3CXQA 2Q0OC 1JPXA 5K8MA 4PXDA 5KA5A 1L1FA 2PVVA 4ZOLA 1GM8A 4RAIA 2E75B 4A33A 2ZDIA 1AB3A 1N36B 4PSWA 2OB0A 5IWAB 1K4JA 5F09A 4ZBMA 1W2BU 4UUJC 2EIKC 1CP9A 3AG4B 3KZIZ 1CBXA 3CB2A 2GANA 5BMVA 3PB7X 5HMNA 4BR6A 4JI7O 4QE9A 3FNCA 4OIDA 1SA0A 3AG1C 3U11A 3BA8A 1ZWIC 4XDKA 1HNWO 1Q6UA 3I56V 1KMIZ 1NH2B 1QSOA 5KAIZ 4OADA 2ZOFA 1IBLO 3BHPA 3T1CA 1KBHA 1B87A 4B13A 1X10A 2QTSA 3QF7A 3J81N 5KUKA 2LQTA 4K35A 5BZBA 2JVDA 2WLIB 2Z3NA 2AFWA 2QWPB 2R9AA 3T90A 2CGOA 5KHKA 1YEWA 5JM6A 3SI2A 1SZTA 3L74H 2HG5C 3LSSA 2DYRC 2PIYA 2PJ2A 3K58A 2KSDA 4O4JB 2GFQA 1F2PA 3IWWA 3CMAV 1EM1A 1R57A 4C7UA 4KOTA 3KASA 1RXTA 4H2KA 4KOWA 5IYZA 2ZW5A 4AVAA 2VQEO 4JI3B 3CC2V 1VHOA 5I0CA 1QR8A 2W0FC 5LYJA 3KR4A 4E0AA 3TOAA 2DMXA 4FD4A 3H8EA 2ATRA 1YVWA 1RSOA 4FD7A 3CRAA 4QBJA 1S5LZ 1I1DA 5IJ9B 3EXAA 1YW6A 2LO1A 1LNQA 5ITZA 3BJ8A 2B1GA 1ZLIA 4M6GA 4NTYA 1HP8A 5BY1A 2HVJC 4N21A 1RTQA 2CUGA 4TWKA 2FCKA 4JLYA 4H13B 5C88A 1M57B 5IDJA 3OUSA 4YU9A 3B09A 1ZLHA 2Q4YA 4UFZA 5JWPA 4ZY1A 4DV3O 1GRJA 2ODMA 5CA0A 3TE4A 4K3AA 1M93A 2UXXA 1I94B 4FM0A 4DO2A 4JXQA 2ZR3A 1XMOB 3CC7V 1TUBA 1U6MA 1QMUA 1S77D 2CH7A 4YIPA 4TV8B 3K0DA 2EIKB 2QM7A 4X64O 2VQYA 2Y0IA 3GUXA 1YTFB 5FNVB 4JI4B 3E89A 1SQPH 2Q5ZA 2PIZA 2Z3MA 4R6ZA 4XPDC 4O2AB 4OX9B 3JATA 3AG1B 5LHIA 3DGVA 3SXOA 4IHJB 5K1PA 3IGAC 3CRMA 4MVMA 1KKCA 5A27A 1Q2CA 3RT3C 1JFFA 3PBBA 1LOKA 4FBEA 1U97A 2WLKA 2GDSA 2P06A 2BCOA 5IJ0B 4QUSA 3D2MA 1R1BA 3HPLC 2C2AA 4X1KA 1XMQO 1WP8A 3PZJA 1IYLA 1K3EA 3G6BA 5BR8O 2ZELA 1AI7A 4OC3A 1QHTA 3WT4A 2OIGA 2GTAA 3AK2A 1EE3P 2YDEA 4TUYB 3SYQA 3UCSC 4DUYO 4NGQA 1US6A 1SRYA 2IJJA 5H84A 3JTKA 4AILC 3U10A 4IL6Z 1GAXA 2FIAA 1KKDA 4UVBA 2QSAA 3W7XA 3MDSA 3ABMB 2CTQA 1QSRA 4AQYB 3ZIAG 2CTPA 3G3SA 1O9HA 4ZYQA 2RJZA 4X8AA 1AILA 2HJFC 1N36O 1JJOA 1GN3A 4UCPA 5LYLA 2GUZB 5IWAO 4R7MA 4MS2A 4X65O 1XEQA 4L87A 2KCWA 2ZEEA 5DWMA 4MRIA 1ZL8A 4U5YA 3H8GA 4MCPA 4F6AA 3OWCA 1H2LA 1PNLA 3CJHB 4PA4A 4M3SA 1F7YA 4NEXA 4MY3A 1YITV 1M5IA 3L70H 2AHYA 4NGSA 4IT5A 1N4CA 1V54C 5EBMC 3K2KA 4BMHA 4LH7A 4C2YA 3EHBB 3TC8A 2QKCA 3HR0A 4PDVA 5JVDB 1IU8A 3SPHA 1S7KA 5LYDA 1RM1C 1WK4A 2C6CA 2WPXA 3TXQA 2P6JA 2ZQMA 4CH6A 2JBKA 3T4ZA 2Q67A 2PTMA 3JALB 3QO5A 4MT8A 2ZXWC 2ZEDA 4PQAA 1X59A 5H2FZ 2PR1A 4JTAB 1Y7RA 3P30A 4X1IB 1FAFA 4I9QA 1YIJV 1JQGA 1Y4MA 4MFLA 4PK3A 1TKFA 1I21A 1SC5B 4F0YA 3ZJ0A 3JVNA 1R3JC 3TT2A 3N2GA 2OTLV 4GKKB 3CX5F 4YFJA 4UCVA 1QSNA 4DRXB 4GT1A 1R3LC 3OD4A 2WLHA 4JI3O 1Z5WA 2EULA 4PK2A 4LFAB 4DV2O 3LDDA 3MHHC 4WFBV 1THZA 5G20A 3SHPA 3CD6V 3CZXA 2YIAA 2YNDA 3OAAG 3WR7A 4JZGA 4RN7A 4JZ0A 2PRBA 4ICGA 5F46A 1BLLE 4NYKA 4ZI7B 4A32A 1YZBA 3D3IA 4AB7A 4MSWC 3SI0A 4R3LA 1F23A 1RO5A 3CWBH 2B9ZA 5A28A 4P4EA 3RZAA 1ROPA 1IVSA 1Y9KA 4JWPA 1R3KC 3G4SV 4P6YA 4DR2B 5GONB 4E8OA 4CGOA 5LGUA 1WNSA 3JD4A 4OPAA 2Q73A 2HKOA 2NR5A 4X88A 3FFQA 1H2NA 1CJWA 3JRUA 4JAVA 1N34B 5K1XA 3V7ZA 3E8BA 4B3TO 4DV4O 1TIQA 3FH4A 4YXWG 1I5YA 1IBKB 2CTCA 4X66O 2EIMC 1FXVA 2AFSA 1NTKH 4O2BB 3JAWA 3SYOA 4UV9A 3L73H 1JVMA 4JI4O 2E74B 4JXRA 1HW7A 2QWRB 1FJGO 4WBNA 3A9LA 4OC5A 1GKFA 2AFOA 1KUXA 3FF3A 4O4IB 2GV9A 2NMTA 2QMLA 1YDXA 2F23A 4YJ3B 1OCRC 2AFXA 1FXHA 1Q5OA 2XT9A 4P9OA 3AG2B 1RM1B 3SPJA 4LNUB 4MXUA 5DWNA 2WPWA 1BE3H 2JEUA 5B5EZ 4IK2A 5CNPA 2H3OA 4DUZO 5KTAA 2HQYA 3JAMN 4G28B 3HB3B 5EYPB 5JPHA 2LP7A 3ETDA 2JS3A 1AJPA 4NTWA 3JARA 1S5HC 2G38A 2LW1A 4ASUG 2BEIA 3T1HB 2ZW6A 3TCUA 1Q6IA 2LW7A 4HPSA 2ZE8A 4R3KA 3J80N 1F2OA 1U96A 3RYOA 3RFRA 4WF9V 4DR6B 1T5EA 2P0WA 4TNUA 2BTOA 4OP4A 1OCZB 2HFEC 2YXHA 1AI4A 3LNMB 4X1YB 3SJEA 1AR4A 2Q7SA 3ZHUA 3P3NA 1JA8A 4PA3A 2HJDA 4PA6A 1PP9H 1QU7A 2VI7A 3CRRA 2YICA 4M6HA 5IT9N 2OR4A 5G22A 4LF5O 1HDJA 3B3WA 3OFNG 3EFFK 1CPXA 1N0NA 2GU2A 3W7TA 1Q43A 1QQCA 3ABKB 5IB0A 5B66Z 5JQGB 2F95B 2Z3OA 2DQ3A 3IO1A 4YHHO 2B5UA 5LGTA 2PJBA 4BW5A 3F5TA 5LHHA 1I08A 4JV5B 1N33B 2DPSA 4TV9B 3N5FA 4GKKO 4CS2A 1VIBA 5LRJA 2MW2B 3K5MA 5LL6Y 1NTZH 2WLIA 1TUBB 3W91A 3CCEV 2I79A 4LFAO 1E1QG 2UXCO 2CAZC 3LWUA 1OCCC 2FVGA 4KUBA 4MFKA 1AVMA 4R7CA 4NTXA 2H5MA 4IIJB 3KHXA 5CA3A 4O4JA 3ZRWB 4AXVA 2W0XA 4FZ0A 5B1OA 3A0HZ 3FX7A 4MW8A 4MVSA 3B8NA 3DSBA 1CG2A 4MTOA 1NSLA 2I00A 1EBOA 2E5LB 3GYAA 5J1QA 4JAUA 2VXKA 2FYUH 3B3TA 2RNBA 4DR2O 1OZ0A 4CAXA 1YCIA 2R8VA 4A5UB 2F93B 4J9ZB 2CE4A 1Q86W 1N34O 3PRTA 2M6YA 4HNAB 3R96A 1XHXA 1BCCH 4NXYA 4J7KA 3TJTA 2GHYA 4DW0A 2OOTA 1H2SB 1ZX3A 3ZMZA 5IJ9A 3G6EV 5J2TB 3JD0A 4P9PA 2QM4A 1FFTB 3LD2A 5FPOA 4ABMA 1FPOA 4RQFA 2L35A 3NR7A 2J8NA 2XOKG 3HKCB 4I49A 1VMGA 2ITDC 5GCNA 3R95A 4DR7B 3NE7A 1EN4A 3SPCA 3ASNC 2EX3A 5L3BA 2VQFB 4DR1B 4CRZB 4AHCA 5B1BC 3CP1A 5E1AC 2BUEA 5K8PA 2P90A 4K8ZA 3NH5A 3D3QA 4R87A 5LYFA 3G8WA 4CAWA 3VQYA 1RFYA 1V55B 4ZY0A 2F66C 5IYCO 4TV8A 5EMIA 2PJ9A 4KLVA 2L6LA 3P2HA 5FNVA 1B04A 4LQGA 2RCVA 1AJNA 5LRGA 4O2AA 2YEVB 5DS0A 4FJCC 4OGQB 1G8MA 4IHJA 3FECA 4C2XA 3B3SA 4A38A 3CEIA 4P4JA 2DYSB 1IICA 4LP8A 2VZZA 2AXTZ 4MBUA 3LSUA 2ZW4A 2W6JG 4LC1A 1PL0A 3LUTB 1DK1A 2HV2A 4FLYA 2YXLA 4BIOA 1XJOA 2EIJB 2KB1A 3H4QA 4WJBA 1NKDA 1E79G 3JASA 5IJ0A 2YNEA 1PNMA 3IAYA 4DR6O 3K59A 4JI8B 1SQGA 4UXNA 1WWZA 2PJ5A 4B10A 1D5AA 2PJ8A 1OCCB 4NR1A 1M4UA 2A3QA 4TUYA 4H44B 5JH9A 3GY9A 1QBZA 4LF8B 2JDCA 1SKVA 2QEXV 4GUNA 4FM1A 4ZY2A 4H6ZA 3HKEA 2Z0AA 5D5QA 2BE3A 1NJIW 1TAEA 2XEFA 2XEJA 4F6RB 2GUZA 4PXBA 4G2KA 1M1DA 1BS3A 1M9NA 1XFOA 5F49A 2GSMB 4F9UA 4CS3A 3CCLV 4DR5B 5KX5B 3CJHA 4MFQA 3AG4C 4QIWF 1MJAA 3T4DA 2E76B 2KG7B 3ZN0A 4X2TA 4JYWA 2HEPA 3ZBHA 3KKYA 1N33O 2YNCA 2DXQA 1VHSA 2P22C 4MHYA 1QSTA 5JVDA 1BO4A 2J9AA 3PP9A 4L8JA 4OC2A 1BT8A 2DOSA 4NXNB 5EIBD 2UUBB 2GE3A 3JALA 3W7UA 2YI9A 4JTCB 3IFEA 3ASNB 3FB5C 5L3DA 3ZCCA 1YW4A 3EFAA 1GK9A 4HBNA 2R7HA 2EBOA 3BABA 3JAWB 3HKBB 4MW3A 5B1BB 1LUWA 4X1IA 4DV5O 4NGRA 2ZCEA 3M7MX 5D29A 4DYOA 3FMCA 2EVNA 4DV1B 2HHHB 1NQTA 3SJBC 1Y76B 2QKSA 5I4MA 4UVAA 4J3GA 2A0LA 4MVUA 3ETEA 4DRXA 1XREA 5DEDA 1OZPA 2YS8A 3KL9A 3OR7C 3KZWA 4CGPA 3S3XA 3TO9A 3IU2A 1Q3EA 4HZ3A 4JI1O 4G1PA 5E96A 3S6HA 3SYCA 4C2ZA 1ZUQA 3WC7A 3H1LH 2PJAA 1FFXB 5J2UB 2JJ2G 4CYPA 4NF1A 4LF6O 3FYIB 4FLZA 1QNMA 3FXTA 3DSQA 2HR3A 4AG9A 1Z2GA 3DR6A 4DK0A 1KP3A 5LMUB 4UCSA 3CCQV 1K34A 2WA3A 1GYTA 2F4VB 3B40A 1HNXB 2P5OA 1R6KA 2D2CB 1XBUA 4DR7O 3ABUA 3K0GA 5GONA 4DR1O 1ZSPA 1VQ6V 3P2FA 4HNWB 3AG3C 1M57C 5ELYA 3P3PA 2OT5A 3K9AA 2IBZH 1VF5B 3QB8A 2P4KA 3CXHF 2CTWA 4TQFA 1XI1A 4B3MB 3VH9A 1X4TA 1YQEA 5EBVA 4O2BA 1Z5VA 2CDYA 1XNQO 1LANA 4OC4A 2M7WA 5GTHZ 4Q7AA 1KUQA 4PJ0Z 1B06A 2X6BA 2XASA 4D6TH 3S6FA 4CYQA 2EBJA 1VQ4V 4O4IA 2JEVA 5H6RA 4X62B 4YJ3A 2RFHA 4H6UA 1UJWB 4GXHA 4OC1A 3H1HH 3ASOB 5G21A 4KZTA 1YXBA 1KD1W 4PA9A 1BAVA 2PJ3A 4LNUA 3TX8A 4JI8O 3OTOB 3UO3A 3F5BA 5JCOA 1ZO0A 4PA7A 1KQSU 3PFEA 5JH7A 2Q68A 5DN6G 5AG5A 1NVPB 2P6GA 4MVQA 3VARA 3QTCA 5EYPA 4LF8O 1FNOA 1N32O 2Q51A 3DDDA 3ZN1A 1OV9A 1YMEA 1FY7A 4LFCB 3K5OA 3BFRA 2ZE6A 4OLLA 4DV7B 3CRQA 4UCOA 4B6ZA 1WLEA 3ABMC 1AUGA 1YSJA 2XAFA 2YI8A 4JI5O 3E22B 4X1YA 2R70A 4FLTA 1F57A 2Q7BA 2B5GB 2AZ0A 2IL4A 4M85A 2ADQB 3KGQA 3PBEA 4JYCA 1Q2YA 4PSXA 1TKHA 1MSWD 3PB4X 3C3SA 3RVZA 3LSQA 3GIUA 4MCRA 3DC6A 2UUBO 2YNCC 1YLOA 3JD3A 3R65A 3R66A 4AVBA 2V8GA 1QVGU 5JQGA 1NMTA 4MVRA 3NA6A 3EO4A 1GN2A 4O4LA 5TISZ 4R76A 4IHMA 4MFPA 3DR8A 2C27A 2N05A 1Q7YW 1L0LH 2JEWA 1KECA 1CM0A 4LWSB 3CCRV 3J7AU 3AG3B 4DV1O 2QVPA 4XPKA 5LMNO 4FLVA 2PJ0A 3FJUA 4DJLA 4TV9A 4YRHA 3L71H 3C26A 3DLJA 2YC0A 1YSCA 1S60A 1YF2A 3H1IH 4FD6A 3TXSA 5KMGB 3JD2A 4U7NA 2EINB 1VARA 4ONUA 3WG7B 4J7ZA 4NXMO 3F7YC 4KFMA 3IJ4A 3TO6A 1VIXA 5CBMA 1PKXA 2GREA 2YXYA 2A79B 2ZOGA 2AHZA 2XNDG 4IIJA 3UT5B 2P7TC 3CCMV 3ZRWA 4JI2B 4BD9A 3CE2A 5IYBO 2PJ6A 2FSRA 4UBRA 4MCQA 3JSLA 5B1AC 3E2EA 5HVFA 4KUMA 5LMUO 4I4TB 4QB9A 4GKJB 2JIZG 1HNXO 3ZHVA 2LFRA 2PVWA 4B5PB 3WFVA 2G3TA 3UO2A 3JASB 2IJIA 1J5EB 4PV6A 4HNAA 1NZ6A 3D66A 3GWKC 1XE4A 2ODFA 1LAPA 3FD9A 4MHPA 3LACA 3AEIA 5J2TA 4B3MO 2VEZA 1KC8W 1S7FA 3D36A 3HKEB 3BAAA 5IV0A 3HKCA 4D7TA 1IXBA 4ZGYB 2GTSA 3QNEA 4LCUC 1IXMA 4CS0B 2B3VA 2ZNJA 3APQA 1XOUA 3VQXA 1G4YB 2K1EA 4FLWA 4EFDA 4X89A 2Z0ZA 2OH1A 3H5ZA 3H1JH 3FVLA 4GCZA 2A9HA 3E0KA 1L8DA 3DXRB 1Y6XA 4F6EA 5GTIZ 1QLEC 4JYYA 3K57A 4FUUA 3B77A 4FPPA 1EN5A 4A39A 4CAFA 5KUMA 1S3ZA 1H38A 3BVOA 3D2PA 3K03A 1DLBA 3ZHTA 3BPZA 3SJCC 3O9OA 1ON0A 3AG2C 3IFXA 3T2MA 1OCOB 2YEVA 1XILA 5EZYB 1VQ7V 4IGGA 2QWQB 3M99B 5JCOC 2QA4V 1Z4RA 4LFCO 5LHGA 4IYHA 4B7KA 3Q4HB 2QE7G 3W7WA 3T9YA 1S5JA 3BCCH 1K92A 4JYAB 3W6SA 4X3RA 1VQLV 3BA9A 1JWQA 1W59A 2P6FA 4ZBGA 2Q7GA 2QYVA 4CYNA 4A94A 2PSWA 1OCZC 1SQHA 2RDCA 5LBQA 3E86A 1Q82W 4F6RA 5B1AB 5J9PC 2V4DA 2F8HA 1BHBA 1JCHA 3DGEA 4PELA 2EK8A 2QGNA 3FRMA 1VHEA 1W0KG 1BSMA 1S72V 4FM2A 4A95A 3UY5A 4KOYA 4ORFA 4CBCA 4W9YA 5KX5A 3GKRA 1S7NA 1YGHA 2KG7A 1R6TA 1QCEA 3ABKC 4OC0A 2OTJV 1VQOV 3ZMTA 2YGWA 1TUEB 4UCUA 3SYPA 2BL1A 1FS0G 3C90A 1I94O 4LFBB 4K3NA 1XMOO 1FXKB 3ML0A 2UUAB 3O65A 1DGSA 2ABZA 1I12A 2Q9LA 4B3RB 2GIVA 2WZNA 3GB0A 4RQEA 3OTFA 2XUMA 3HKBA 3QO8A 3ZRVA 2GBOA 4OX9O 4TSFG 3IWGA 1QLEB 3JAKB 5FVJA 3ZHQA 4MMOA 2Q6AA 1XOVA 1Y76A 2JGUA 4XDJA 3A0RA 4MJ8A 4UCTA 4JI0B 5E79Z 1YJNV 4PV1B 2AGAA 1J5EO 3A0BZ 2DE0X 2YIBA 5JJNB 3RYIB 4U7OA 1NBMG 5FL7G 2PI4A 2BSKB 1G1XB 5JH7B 1WJZA 1FFXA 4JAAA 5J2UA 1PUAA 5J8CA 4LF9B 1G6UA 2ATKC 4ZHQB 2DN9A 3FB8C 2Q4ZA 3JYCA 3SDLA 4AQYO 1MJ9A 1BPMA 4KVOE 1WB8A 3ZEDA 4CS4A 4EFEA 2V1DA 1JOYA 2H8PC 3D36C 4F0XA 2A06H 2JDIG 5EC1C 4P4IA 1X12A 4ZX9A 3E8GA 1Q8IA 2ANPA 7CPAA 3S9MA 1IIDA 2QWNB 2CNMA 1VQ9V 3RO0A 2ZW7A 2ETNA 2Y69B 2QTOA 3EVKA 3ZHSA 2R98A 3OGIB 2B58A 4NGMA 3FBUA 5CBGA 5L3GA 2R1IA 3OGCC 2CF4A 1V55C 1OJHA 4PDRA 4OKOA 1WN7A 3CXSA 1XEBA 3OMAB 3PN1A 2E3CA 1XL6A 2V8VA 3S6KA 5J8FA 3S3WA 2ZEGA 3RWRD 4EB6B 2PC1A 4LH6A 1YR0A 2ZEFA 3RW0A 1MZFA 3SYAA 2EILB 4O4LB 4WFHA 2FE7A 4NSQA 3BEHA 5AGEA 1Q81W 1GN6A 2DYSC 1QSMA 1S5KA 4BWAA 2PDOA 5DECA 2F1MA 1P49A 5IX3A 3ICXA 1KZFA 2PJ1A 4CGNA 1YX0A 2EIJC 4KLWA 4DK1A 2IU3A 4JASA 1JX9A 4NJQA 4KXRA 4CH3A 2B4BA 1MK4A 4J80A 4KSAA 2DEAA 3IGRA 1FKAO 1D5NA 2BSWA 1CP7A 3QAYA 2D4OA 3S9NA 3D68A 2V77A 2O28A 2BO9A 3FEEA 3KKWA 3E22A 4I55B 3FEDA 1HR0B 2B5GA 5HH1A 1QVFU 5KTCA 4UEFA 3B3VA 2VWJA 3BI0A 3NXSA 2F5IA 5IYDO 2HC9A 4DNCA 2Z3YA 2WUUA 2XEIA 4PDMA 3ETQA 4AG7A 4JYBA 2IH1C 1EFRG 4CGLA 5CBHA 4LFBO 5JQ4A 1YLEA 3IIBA 4J10A 4GX0A 1Y74B 5D5PA 4CPAA 5D8NA 2Z3PA 3VBBA 2C6GA 2Y0PA 3RYFB 4DV6B 3CC4V 4B3RO 4BBHA 1IBKO 3H01A 1ORQC 2R9IA 4AVCA 4UEEA 1CXZB 3OM3B 5HFLA 4P2ZA 1IY7A 1P0HA 4LWSA 2HUZA 5LP6C 4Q20A 2QJ8A 5JGFA 4LF4B 1F4MA 4YIOA 2G0BA 2ILMA 1PYTB 2QECA 4IUSA 3CS5A 1XNRB 5FLXN 5KAFZ 3B2EE 2PZSA 3E83A 4BW9A 3OMNB 3QAHA 4HAMA 3PJSK 4RS2A 2UXDB 1SQBH 5KMGA 3PB9X 1RPRA 4JI0O 4B12A 1YHQV 4O4HB 1I5XA 2BCCH 3CPWU 4MTXA 2YUAA 5CN0A 3RNZA 4X20B 3K08A 3UT5A 5KLVH 4WCEV 3G80A 4GYCB 2B3UA 3KR5A 1MNGA 1AR5A 1HWYA 4KL1A 5IE9A 3RAMA 1NH2D 5EC2C 2EJ7A 2QIRA 4B7EA 4NGPA 1NT2B 4MFZA 3P32A 1R73A 4EKWA 2H94A 2WPDG 4I4TA 2J8RA 3CPXA 1S7LA 5C93A 4B5PA 2RMKB 3T8WA 3ABTA 3T1HO 1CPYA 2EJRA 1AR1B 4GS4A 1NS1A 4PPZA 3G71V 2P67A 1R3NA 4C68A 1NI8A 2IJZA 4ZIBA 2WLJA 1D2DA 3I1UA 4C7IA 4ZKIA 4J9YB 4E2LA 3B8GA 4RI1A 1TXRA 4UFXA 1O9GA 3TK1A 3OUFA 1DF4A 1AP6A 1B6BA 4PXEA 2R72A 3FB6C 4JI7B 2WSSG 3W6XA 1GM9A 1A32A 2MK3A 4CYOA 1TA8A 5BXZA 1IDSA 1BPNA 1Y0RA 4OPHA 3CDXA 4OMEA 3B7IA 3TGUH 2PI5A 1N8RW 2K5TA 2QR4A 1IOFA 4U9YA 4QGPA 5AG2A 1FYJA 1PV0A 3DXRA 2PYLA 2WAMA 1TKJA 3IC1A 2CGNA 4TOIA 1SERA 4GX5A 3IWEA 1ZTEA 1J4JA 3GWOA 1ZG7A 2WSAA 4JV5O 2PJCA 1WAZA 2FKXA 4I50B 3ASOC 3MGDA 2QDOA 2JS5A 2OZUA 2AZ2A 1BOBA 4MI4A 3WC6A 2WLLB 2X6CA 5EZYA 3S6GA 1Y7EA 4HNXB 2X7RB 1PPJH 4B3SB 5LP6B 2ZE7A 1H8LA 1JMKC 4UCRA 4H0LB 4DR4B 2CNSA 2CK3G 2WLNA 3MD0A 3Q4HA 5CA1B 1SETA 3TCVA 3RBUA 1M56C 3ZRSA 1FT7A 3T1YB 3IU1A 3ZHRA 1TGOA 2VQEB 3FB3A 1MG1A 1YTFD 1HR0O 4BAYA 2E5LO 4FFKA 4EFBA 2Z5UA 5LA6B 3AK3A 3QVNA 4UEZA 2GLFA 2C1CA 1VF7A 1XF8A 1LR1A 4DW1A 4YGOA 2QM8A 4CH5A 1IGBA 4YY3B 4KUAA 1LAMA 1AROP 4DV3B 1R6NA 1QR9A 3IC9A 2DPTA 1PNKA 4NKGB 1SF9A 1BHAA 4DXWA 2VQFO 3SPIA 1PM9A 1SZXA 3RYCB 4LUAA 2HLDG 1GTOA 2AW9A 1FXKA 3HKDB 3CCJV 3RYHB 5K8OA 1LFWA 4NJRA 3JCZA 2PCUA 2JJ1G 4PI2A 4KOXA 2ZIMA 4XDLA 3SGIA 1KUYA 2ZE5A 2Q44A 2EINC 3WG7C 6CPAA 1SS3A 1LCPA 3CHXA 1DTOA 2Y4TA 2F43G 2ZT9B 3ZJZA 4GM5A 3JAKA 2AE6A 2IW5A 3N2KB 4IYIA 5BR8B 1P4NA 3FKSG 2VS0A 4KVXA 3LDCA 3ZZIA 2Z11A 4OIWA 3A8TA 2Q7HA 5B1NA 5HFMA 1N0JA 3RYIA 2BSKA 3I9SA 1VKCA 4JZ2A 3VATA 4F9VA 1GO3F 1YREA 3K04A 4X5KA 1BQZA 3FIXA 1DF5A 1MABG 1ZLZA 5LXTB 4RWUA 3D7HA 2B1IA 4ZHQA 5F48A 1JR9A 4X65B 3OT7A 4MTFA 5L3FA 5AG6A 1M56B 5IY5B 1XDCA 1F51A 4X9QA 4P44A 1IX9A 4PHZA 2Q04A 4MHZA 3ZRXA 3D67A 4FLUA 1B3QA 4UVCA 1XBLA 2ZXVA 2N04A 3L9DA 4U3JB 3RBZA 3SJFA 4MHDA 5LOVB 4MTGA 2WYRA 1R3IC 2XAGA 2PGGA 1URFA 1WPBA 2V7QG 1Q2DA 3HUVA 5ISVA 4WWVA 4WFFA 4DR5O 2UU9B 3EC4A 1DTDA 3MHSC 5CBFA 3QO7A 5G1ZA 4W4LA 4BINA 3LODA 1NTMH 4L89A 5GW7A 1MSDA 4P4BA 5CB4B 1SQQH 1YVOA 4II9A 4NXNO 1ELMP 3THOA 2Y4UA 3BRCA 3CSXA 3CCUV 4B3SO 4YWYA 2QWOB 1YVKA 4EB6A 4DR4O 2O4HA 1YK3A 2WA4A 2WLMA 2DJVA 5B3SB 1OCOC 5KHJA 1K73W 2OU2A 3FAVB 2UXBB 4KORA 3H8FA 3T1YO 1ZG8A 2PYJA 2HHHO 1JJ2U 3KQXA 2XHBA 4DV2B 4MCSA 3E8FA 2XAQA 2EUIA 5F47A 2ZR2A 3NH8A 2IMOA 3ZMVA 2OYQA 4IF5A 2ZM6B 1K97A 2JBJA 2DWDC 1AI5A 2ITCC 4PD4F 1VQKV 4DYLA 4LR3A 3JCUZ 4NFRA 2CY2A 5BWAB 1ENVA 4EVYA 5HXDA 3STZC 3RGBA 3CPAA 2NYQA 3QG5A 4KS9A 2PJ7A 1YJ9V 4YY3O 4BIZA 4Y49C 5THWA 5KHGA 1MA1A 4JGSA 4FLXA 2OZGA 4I55A 4KHPB 2R9RB 3ZMUA 4B3TB 2F4VO 1UFIA 3JD1A 2IJKA 4DV4B 1XIXA 3R9FA 4UCNA 1MMMA 4FFBB 2BOAA 2PUSA 1Q7LA 4K8XA 1M4GA 1Y9WA 4P4DA 4X66B 2RQ6A 4GX2A 1IZ3A 3SJAC 3A2FA 4FMTA 4H37A 5L3EA 2PJ4A 3B8MA 1FJGB 1Y74A 3TTHA 1IURA 4K30A 2JK5C 3RYFA 4CZZA 1SQXH 1DE4C 3K06A 4KOVA 5IB9A 2VZYA 2ZEPA 1FXKC 4HYOA 3AG7A 4RO2A 1XL4A 2B4DB 4AI8A 3UM7A 2PQ8A 1WA8B 4X62O 4YJ2B 2OCCC 2BTQB 4DUZB 4CRYB 2A7WA 2WWWA 2C6PA 4Q38A 4R6TA 2DYRB 4O4HA 4A2ZA 1GH6A 3OTOO 2ZINA 5LRKA 2CIJA 3RVYA 3H9VA 4X20A 2DW4A 2HB6A 4JTDB 1VQ8V 4WFAV 5KHHA 3UQ8A 2LJ2A 3PB8X 3VWEA 1VQPV 5JJEB 4QE7A 4WFGA 1BMFG 2ZDIC 3B35A 4P30A 1M1KW 1GN4A 3D7DA 2K9PA 1PL4A 2OIEA 3K9UA 2O53A 4DV7O 4H89A 1ARLA 3RN4A 4IAVA 3BI1A 3BY6A 2RN9A 4FZ1A 4F4LA 3I3GA 3MN8A 1N71A 4Z65A 2UU9O 2P6EA 4G27B 3TOBA 4LF5B 1CEZA 3CT9A 4Z1MG 3LNNA 3EXNA 1P7GA 3L72H 4B14A 2ARHA 2JDDA 5H9CA 1BL8A 2XAHA 4NB5A 1UPGA 2FIWA 2FXFA 1YI2V 2P4VA 2Q0AA 2UXNA 4YHHB 2DQ0A 2OWOA 4K0KB 2ZPAA 4Y49B 4N23A 2REEA 1H2MA 5EK0A 4OXSA 2ZEMA 4RUFA 1M44A 1LUVA 3WU2Z 2Y69C 3C3TA 5EBWC 4QJFB 2W6IG 1BQ0A 3WB0A 4UFVA 4E2AA
chains in the Genus database with same CATH topology
2GE3A 3IGRA 5I0CA 2BSWA 5C82A 4E0AA 2D4OA 3TOAA 4FD4A 2O28A 2ATRA 4FD7A 3EFAA 3KKWA 4MFJA 4XPDB 4QBJA 2R7HA 1I1DA 2B5GA 5HH1A 5KTCA 3DNSA 2EVNA 3BJ8A 4UCMA 3TO7A 2F5IA 2J8MA 4DNCA 2WUUA 3N7ZA 4JLYA 2FCKA 4AG7A 5C88A 4CGLA 4J3GA 4CGPA 1OZPA 2G3AA 5JQ4A 2Q4YA 1YLEA 3TO9A 2Z3PA 3IU2A 3TE4A 2CXAA 4BBHA 5E96A 3S6HA 4JXQA 1NE9A 4C2ZA 2Q0YA 4AVCA 1U6MA 4CYPA 4NF1A 1P0HA 2HUZA 2VQYA 3FXTA 1KUVA 2G0BA 4AG9A 2QECA 4IUSA 3DR6A 2Z3MA 4XPDC 3QAHA 3SXOA 4RS2A 4B12A 3P2FA 5A27A 4A31A 1Q2CA 3D8PA 1XMTA 4HNWB 2RC4A 4QUSA 3D2MA 3PZJA 1IYLA 3QB8A 4CAVA 2B3UA 2Z10A 2QIRA 5EBVA 2FL4A 4MFZA 4CGMA 2J8RA 5H84A 3JTKA 1S7LA 4B5PA 2FIAA 3S6FA 4CYQA 4GS4A 1QSRA 2JEVA 3G3SA 4H6UA 2OZHA 4C68A 4R9MA 4UCPA 4UWIA 1IYKA 4C7IA 5G21A 4KZTA 3B8GA 4RI1A 4CAEA 2KCWA 5DWMA 4UFXA 4U5YA 3F5BA 1ZO0A 4F6AA 1B6BA 3OWCA 4M3SA 4NEXA 4MY3A 5AG5A 3F0AA 3W6XA 2P6GA 2X7BA 4CYOA 4BMHA 4C2YA 3DDDA 1FY7A 1S7KA 1M4IA 1WK4A 2WPXA 2K5TA 4OLLA 4U9YA 4XPLA 3IWEA 2A4NA 4XNHC 1J4JA 2CNTA 2PR1A 2Z3KA 2WSAA 1Y7RA 2Q7BA 1MJBA 2B5GB 3MGDA 2IL4A 2Y0MA 2OZUA 4M85A 1BOBA 1UFHA 4MI4A 4MFLA 4PK3A 3S6GA 4HNXB 1I21A 1Q2YA 4PSXA 3ZJ0A 3JVNA 4F0YA 3TT2A 3VWDA 1GHEA 4YFJA 1QSNA 2CNSA 3R9GA 4HKFA 4PK2A 2YNCC 3TCVA 1Z9UA 5KTDA 4AVBA 5G20A 1Z4EA 3SHPA 3IU1A 1NMTA 2YNDA 4B5OA 3EO4A 3FB3A 3SXNA 4MFPA 3DR8A 2C27A 3WR7A 2PRBA 1CM0A 5F46A 4A32A 1PU9A 4AB7A 1IB1E 4R3LA 4XPKA 1RO5A 5A28A 4YRHA 3C26A 1S60A 1Y9KA 4JWPA 4FD6A 4E8OA 4CGOA 4ONUA 1XF8A 1CJWA 4YGOA 3TO6A 4KUAA 2PR8A 4U9ZA 4FD5A 1TIQA 3V8IA 2DPTA 2FSRA 4UBRA 4JXRA 4QB9A 3A9LA 4B5PB 1KUXA 4LUAA 4UWJA 2G3TA 2NMTA 2QMLA 5AG7A 4PV6A 4KOXA 1XE4A 3TFYA 1KUYA 2Q44A 5DWNA 2WPWA 1L0CA 2D4PA 3F8KA 2VEZA 5CNPA 1S7FA 4HNYB 1M4DA 5KTAA 2AE6A 5IV0A 2HQYA 1P4NA 4XNHB 4ZGYB 5JPHA 1LRZA 4LX9A 4CS0B 4KVXA 2B3VA 3ZZIA 2AJ6A 2Z11A 4UFWA 2Z0ZA 2OH1A 3H5ZA 2BEIA 2ZW6A 4OAEA 4R3KA 3E0KA 3I9SA 1VKCA 3RYOA 1YREA 2B4DA 2P0WA 4X5KA 4CAFA 1S3ZA 3FIXA 3D2PA 5F48A 4R57A 5AG6A 1ON0A 4A30A 2Q04A 2ZXVA 2VI7A 1Z4RA 4MHDA 5G22A 1Q2DA 5ISVA 5AG4A 3T9YA 5IB0A 3W6SA 3EC4A 2FT0A 2Z3OA 5EC4A 5G1ZA 4L8AA 3LODA 2P6FA 4ZBGA 4L89A 5H86A 2Q4VA 4CYNA 2DPSA 1YVOA 2PSWA 1SQHA 4II9A 1YVKA 3CXPA 1YK3A 3PGPA 4QC6A 2OU2A 3W91A 2I79A 3FRMA 4KORA 4KUBA 2FS5A 4MFKA 3EY5A 4A95A 2H5MA 3UY5A 4KOYA 4ORFA 2EUIA 4JJXA 3GKRA 1S7NA 5F47A 4C7HA 1YGHA 4IF5A 2YGWA 3DSBA 4KOUA 2BL1A 1NSLA 2I00A 3BLNA 3R1KA 3GYAA 4B11A 2VXKA 2CY2A 4CAXA 5BWAB 3BJ7A 4EVYA 3JUWA 4JD6A 4NCZA 2R8VA 1I12A 3D3SA 4KS9A 2GIVA 3R96A 4UA3A 4Y49C 4NXYA 2OZGA 4KSFA 4MY0A 3LD2A 1XIXA 3R9FA 4UCNA 3IWGA 2J8NA 5FVJA 1M4GA 1Y9WA 4I49A 5GCNA 3R95A 3NE7A 4MJ8A 3TTHA 4CRZB 3R9EA 4K30A 4Q36A 2BUEA 4KOVA 2VZYA 2VBQA 4QVTA 4KOSA 4R87A 3FYNA 2B4DB 3G8WA 1PUAA 4CAWA 5J8CA 1V0CA 4KVME 2REFA 4KLVA 2PQ8A 2JLMA 3P2HA 2Z3LA 1MJ9A 4KVOE 3CXQA 4C2XA 4CRYB 1IICA 2VZZA 4Q38A 4MBUA 4A33A 2ZW4A 2HV2A 4A2ZA 4F0XA 4PSWA 2OB0A 1K4JA 3H4QA 2GANA 2YNEA 1IIDA 5HMNA 1WWZA 3FNCA 2CNMA 2ZW7A 3VWEA 4B10A 2R98A 2B58A 3FBUA 3GY9A 2R1IA 1QSOA 2JDCA 4OADA 4H6ZA 4B13A 1B87A 1XEBA 3CXSA 3K9UA 3S6KA 5J8FA 2PC1A 1YR0A 4H89A 2Z3NA 1M1DA 2FE7A 4NSQA 3T90A 3I3GA 5AGEA 1S5KA 1N71A 1QSMA 2PDOA 2P6EA 3TOBA 3EXNA 5F49A 4B14A 2ARHA 2JDDA 5IX3A 1KZFA 4CGNA 1YX0A 2FIWA 1MJAA 2FXFA 4KLWA 4MFQA 1R57A 4KOTA 4Y49B 2ZPAA 2YNCA 2REEA 2DXQA 1VHSA 1RXTA 1M44A 1QSTA 4KOWA 1BO4A 2ZW5A 2B4BA 1MK4A 4KSAA 4AVAA 3PP9A 4UFVA 4E2AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GE3 A;  3IGR A;  5I0C A;  2BSW A;  5C82 A;  4E0A A;  2D4O A;  3TOA A;  4FD4 A;  2O28 A;  2ATR A;  4FD7 A;  3EFA A;  3KKW A;  4XPD B;  4QBJ A;  2R7H A;  1I1D A;  2B5G A;  5HH1 A;  5KTC A;  3DNS A;  2EVN A;  3BJ8 A;  3TO7 A;  2F5I A;  2J8M A;  4DNC A;  3N7Z A;  4JLY A;  2FCK A;  4AG7 A;  5C88 A;  4J3G A;  5JQ4 A;  1OZP A;  2G3A A;  2Q4Y A;  1YLE A;  3TO9 A;  3TE4 A;  5E96 A;  3S6H A;  4JXQ A;  1NE9 A;  2Q0Y A;  4AVC A;  1U6M A;  4NF1 A;  1P0H A;  2HUZ A;  2VQY A;  3FXT A;  1KUV A;  2G0B A;  4AG9 A;  2QEC A;  4IUS A;  3DR6 A;  4XPD C;  3QAH A;  3SXO A;  4RS2 A;  3P2F A;  1Q2C A;  3D8P A;  1XMT A;  4HNW B;  2RC4 A;  4QUS A;  3D2M A;  3PZJ A;  1IYL A;  3QB8 A;  4CAV A;  2B3U A;  2Z10 A;  2QIR A;  5EBV A;  2FL4 A;  2J8R A;  5H84 A;  1S7L A;  4B5P A;  2FIA A;  3S6F A;  4GS4 A;  1QSR A;  2JEV A;  3G3S A;  4H6U A;  2OZH A;  4R9M A;  4UWI A;  1IYK A;  4KZT A;  3B8G A;  4RI1 A;  2KCW A;  5DWM A;  4U5Y A;  3F5B A;  4F6A A;  1B6B A;  3OWC A;  4M3S A;  4NEX A;  4MY3 A;  3F0A A;  3W6X A;  2P6G A;  2X7B A;  4BMH A;  3DDD A;  1FY7 A;  1S7K A;  1M4I A;  1WK4 A;  2WPX A;  2K5T A;  4OLL A;  4U9Y A;  4XPL A;  2A4N A;  4XNH C;  1J4J A;  2CNT A;  2PR1 A;  1Y7R A;  2Q7B A;  1MJB A;  2B5G B;  3MGD A;  2IL4 A;  2Y0M A;  2OZU A;  4M85 A;  1BOB A;  1UFH A;  4MI4 A;  4PK3 A;  3S6G A;  4HNX B;  1I21 A;  1Q2Y A;  4PSX A;  3ZJ0 A;  3JVN A;  4F0Y A;  3TT2 A;  3VWD A;  1GHE A;  4YFJ A;  1QSN A;  2CNS A;  3R9G A;  4HKF A;  4PK2 A;  3TCV A;  1Z9U A;  5KTD A;  4AVB A;  1Z4E A;  3SHP A;  1NMT A;  4B5O A;  3EO4 A;  3FB3 A;  3SXN A;  3DR8 A;  2C27 A;  3WR7 A;  2PRB A;  1CM0 A;  5F46 A;  1PU9 A;  4AB7 A;  1IB1 E;  4R3L A;  4XPK A;  1RO5 A;  4YRH A;  3C26 A;  1S60 A;  1Y9K A;  4JWP A;  4FD6 A;  4E8O A;  4ONU A;  1XF8 A;  1CJW A;  4YGO A;  3TO6 A;  4KUA A;  2PR8 A;  4U9Z A;  4FD5 A;  1TIQ A;  3V8I A;  2FSR A;  4UBR A;  4JXR A;  4QB9 A;  4B5P B;  1KUX A;  4LUA A;  4UWJ A;  2G3T A;  2NMT A;  2QML A;  4PV6 A;  4KOX A;  1XE4 A;  3TFY A;  1KUY A;  2Q44 A;  5DWN A;  2WPW A;  1L0C A;  2D4P A;  3F8K A;  2VEZ A;  5CNP A;  1S7F A;  4HNY B;  1M4D A;  5KTA A;  2AE6 A;  5IV0 A;  2HQY A;  1P4N A;  4XNH B;  5JPH A;  1LRZ A;  4LX9 A;  4CS0 B;  4KVX A;  2B3V A;  3ZZI A;  2AJ6 A;  2Z11 A;  2Z0Z A;  2OH1 A;  2BEI A;  2ZW6 A;  4OAE A;  4R3K A;  3E0K A;  3I9S A;  1VKC A;  3RYO A;  1YRE A;  2B4D A;  2P0W A;  4X5K A;  1S3Z A;  3FIX A;  3D2P A;  5F48 A;  4R57 A;  1ON0 A;  2Q04 A;  2ZXV A;  2VI7 A;  1Z4R A;  4MHD A;  1Q2D A;  5ISV A;  3T9Y A;  5IB0 A;  3W6S A;  3EC4 A;  2FT0 A;  5EC4 A;  4L8A A;  3LOD A;  2P6F A;  4ZBG A;  4L89 A;  5H86 A;  2Q4V A;  1YVO A;  2PSW A;  1SQH A;  4II9 A;  1YVK A;  3CXP A;  1YK3 A;  3PGP A;  4QC6 A;  2OU2 A;  3W91 A;  2I79 A;  3FRM A;  4KOR A;  4KUB A;  2FS5 A;  3EY5 A;  2H5M A;  3UY5 A;  4KOY A;  4ORF A;  2EUI A;  4JJX A;  3GKR A;  1S7N A;  5F47 A;  1YGH A;  4IF5 A;  3DSB A;  4KOU A;  2BL1 A;  1NSL A;  2I00 A;  3BLN A;  3R1K A;  3GYA A;  2VXK A;  2CY2 A;  4CAX A;  3BJ7 A;  4EVY A;  3JUW A;  4JD6 A;  4NCZ A;  2R8V A;  1I12 A;  3D3S A;  2GIV A;  3R96 A;  4UA3 A;  4Y49 C;  4NXY A;  2OZG A;  4MY0 A;  3LD2 A;  1XIX A;  3R9F A;  3IWG A;  2J8N A;  5FVJ A;  1M4G A;  1Y9W A;  4I49 A;  5GCN A;  3R95 A;  3NE7 A;  4MJ8 A;  3TTH A;  4CRZ B;  3R9E A;  4K30 A;  2BUE A;  4KOV A;  2VZY A;  2VBQ A;  4QVT A;  4KOS A;  4R87 A;  3FYN A;  2B4D B;  3G8W A;  1PUA A;  4CAW A;  5J8C A;  1V0C A;  4KVM E;  2REF A;  4KLV A;  2PQ8 A;  2JLM A;  3P2H A;  1MJ9 A;  4KVO E;  3CXQ A;  4CRY B;  1IIC A;  2VZZ A;  4MBU A;  2ZW4 A;  2HV2 A;  4PSW A;  2OB0 A;  1K4J A;  3H4Q A;  2GAN A;  1IID A;  5HMN A;  1WWZ A;  3FNC A;  2CNM A;  2ZW7 A;  3VWE A;  2R98 A;  2B58 A;  3FBU A;  3GY9 A;  2R1I A;  1QSO A;  2JDC A;  4OAD A;  4H6Z A;  1B87 A;  1XEB A;  3CXS A;  3K9U A;  3S6K A;  5J8F A;  2PC1 A;  1YR0 A;  4H89 A;  1M1D A;  2FE7 A;  4NSQ A;  3T90 A;  3I3G A;  1S5K A;  1N71 A;  1QSM A;  2PDO A;  2P6E A;  3TOB A;  3EXN A;  5F49 A;  2ARH A;  2JDD A;  5IX3 A;  1KZF A;  1YX0 A;  2FIW A;  1MJA A;  2FXF A;  4KLW A;  1R57 A;  4KOT A;  4Y49 B;  2ZPA A;  2REE A;  2DXQ A;  1VHS A;  1RXT A;  1M44 A;  1QST A;  4KOW A;  1BO4 A;  2ZW5 A;  2B4B A;  1MK4 A;  4AVA A;  3PP9 A;  4E2A A; 
#chains in the Genus database with same CATH topology
 3D8C A;  4TT3 G;  5C8Y A;  2EO8 A;  5C82 A;  2UXB O;  3KCY A;  2FTK A;  5JJJ B;  4I0X B;  4UF4 A;  4LQ6 A;  4MFJ A;  4XPD B;  2UXC B;  4I50 A;  2EIL C;  1K5Q A;  1K7D A;  3DNS A;  2IU0 A;  1K5S A;  4QPJ A;  3DTU B;  4D7S A;  1QLN A;  2KQX A;  2WLL A;  2ZM6 O;  4UCM A;  3SJX A;  3TO7 A;  2J8M A;  1BZK A;  1KU9 A;  3N7Z A;  1ARM A;  3I55 V;  1XMB A;  1F4N A;  1VEW A;  3E8H A;  5LP6 A;  1OBR A;  2ZIO A;  2G3A A;  2EK9 A;  4R8F A;  5CA1 A;  1Z8X A;  3WC5 A;  2OCC B;  3OR6 C;  2CXA A;  1TF8 A;  4JI2 O;  2Q7E A;  2HVK C;  1P4R A;  3W7S A;  2YSU B;  2D3O W;  1NE9 A;  2JEX A;  3U0Z A;  1H2K A;  2JGD B;  2Q0Y A;  1XQ8 A;  3CXC U;  3BHX A;  3B3C A;  4KHP O;  4U3F H;  4GKJ O;  5DM6 V;  4ZX8 A;  3VQW A;  1KUV A;  1Z8L A;  2NNU A;  2AFU A;  1SQV H;  4WFE A;  1GM7 A;  1JQ0 A;  1Q90 D;  3SJG A;  2ZD9 A;  5LYI A;  5LA6 A;  1Q6H A;  4UIB A;  2QJ1 A;  1CP6 A;  1VGY A;  4H33 A;  5A9G A;  4ZOL B;  4CC5 A;  4PI0 A;  3KCX A;  3DC5 A;  2ZEH A;  2AFZ A;  4KSI A;  4A31 A;  4J41 A;  3D8P A;  3B4S A;  3OEH G;  1XMT A;  4F8Z A;  2V8D A;  1H8H G;  3KG2 A;  4QPK A;  4UIA A;  5BMV B;  1AP5 A;  3K5N A;  4UB6 Z;  2RC4 A;  3CME V;  1RPO A;  1V54 B;  4CAV A;  1EN6 A;  4CH4 A;  1SA0 B;  1S0V A;  2Z10 A;  2FL4 A;  4Z1V A;  4CGM A;  2RB7 A;  2UUC B;  4NGT A;  1WP7 A;  3RYC A;  4CC6 A;  3SPG A;  3HKD A;  2ZXW B;  4JI6 B;  3RYH A;  4GLX A;  2OZH A;  3L2N A;  3KQZ A;  5KHI A;  3K5L A;  4R9M A;  3CRC A;  4UWI A;  3G67 A;  1IYK A;  4JPR A;  3B2Y A;  4FAI A;  5K8N A;  4CAE A;  1TVK A;  1P84 F;  2EZP A;  1Y66 A;  2IH3 C;  2ZEO A;  4PXC A;  2V8H A;  3V38 A;  5L3C A;  2JRI A;  3FB7 C;  2CTR A;  1K4C C;  2G9D A;  3NE8 A;  3KHZ A;  3I5D A;  3N2K A;  2POK A;  3F0A A;  3IEH A;  2X7B A;  2XTA A;  3GLJ A;  4J7J A;  2ADP A;  3JSN A;  3IC7 A;  1I7F A;  5IYZ B;  1M4I A;  3SI1 A;  1ZAU A;  1AMP A;  4A37 A;  4JYA O;  1S3J A;  3QNV A;  1MOF A;  4NGN A;  4Z2W A;  5LYJ B;  3OW2 U;  1XUQ A;  2XEG A;  4XPL A;  2A4N A;  1RSO B;  4XNH C;  2CNT A;  5LXT A;  2Z3K A;  1HDU A;  1MJB A;  3D7G A;  4I7Z B;  4J11 A;  2Y0M A;  5ITZ B;  3K9S A;  2PY5 A;  2AFM A;  1UFH A;  4K0K O;  3M8A A;  1MZE A;  1HDQ A;  4UB8 Z;  3SJQ C;  4DR3 B;  3H1K H;  4U3J A;  1GHE A;  3VWD A;  5LOV A;  1Y67 A;  2YIB D;  2YID A;  2IM9 A;  1NU1 H;  2NSM A;  3R9G A;  1VF6 A;  1Y0Y A;  3BXM A;  4HKF A;  2DWE C;  5FPR A;  5CA0 B;  1Z9U A;  2EIM B;  5KTD A;  3IJ3 A;  2IQ6 A;  1Z4E A;  3NFZ A;  1QQ9 A;  4B5O A;  1KP2 A;  3SXN A;  2N74 A;  4FVM A;  4I9W A;  4DV0 B;  5HVG A;  2CH7 B;  3KI9 A;  1A2Z A;  4P10 A;  1PU9 A;  1H2G A;  2KKW A;  1IB1 E;  1HEE A;  1SES A;  2VRZ A;  3LDE A;  1OCR B;  1W0J G;  5CB4 A;  4DV5 B;  2UUA O;  4W4K A;  4E4E A;  3JAT B;  1PD3 A;  1AJQ A;  3K79 A;  3N27 A;  5CPA A;  1KB9 F;  5KA6 A;  3K9T A;  1JFF B;  3FAV A;  4FK5 C;  5LGN A;  1Z2L A;  3WB2 A;  2CTB A;  2PR8 A;  2PRQ A;  1J95 A;  4FD5 A;  4U9Z A;  1VQM V;  4X1K B;  4X8I A;  4JI1 B;  5EBL C;  1PCA A;  1K9M W;  2X6A A;  1TF9 A;  3V8I A;  4FWU A;  4DUK A;  4I5S A;  1M90 W;  4ZI6 A;  4LF6 B;  4P45 A;  1KYO F;  4RUH A;  2HP8 A;  2Y48 A;  4UWJ A;  1HNZ B;  3PEI A;  1K4D C;  1FD9 A;  1OHH G;  1VQ5 V;  3VQV A;  5AG7 A;  4LF9 O;  2I3C A;  1P7B A;  2Q4P A;  3TFY A;  2PF4 E;  3HLP A;  3X2Q C;  3WB1 A;  5F2V O;  1VQN V;  1ZL8 B;  2ZNI A;  4EWT A;  8CPA A;  3OMI B;  1L0C A;  1NVP D;  2D4P A;  3F8K A;  4MVO A;  4NVP A;  4HNY B;  1R43 A;  1L0N H;  1IBM B;  1M4D A;  1UWY A;  4FFB A;  4LBE C;  2UUC O;  5H6Q A;  4LF7 B;  4XNH B;  1LRZ A;  1CX8 A;  1Z8T A;  4LX9 A;  3MRU A;  1XNQ B;  2AJ6 A;  2LFS A;  2NN4 A;  4JI6 O;  4UFW A;  2PE3 A;  3F7V C;  4OAE A;  1K33 A;  3ABL C;  4BIU A;  3GVM A;  1KWM A;  3ZMS A;  3D4U A;  3D7F A;  3CYO A;  2LGW A;  2F7V A;  2B4D A;  3LMS A;  1YJW V;  2BOB C;  1COW G;  1HNW B;  4M6I A;  3TET A;  4R57 A;  1WA8 A;  2X0L A;  4YJ2 A;  3ZS8 C;  4A30 A;  1M4L A;  2BTQ A;  3AK1 A;  1VP7 A;  5H5N A;  1IBL B;  3N2G B;  5C8Y B;  4Q6G A;  1V9P A;  1N32 B;  3FYE B;  1XHZ A;  3NH4 A;  1AI6 A;  5AG4 A;  2EZO A;  2FT0 A;  5EC4 A;  4TWE A;  2VL1 A;  1H8E G;  3VOU A;  1NR1 A;  3STL C;  1NR7 A;  4L8A A;  1I0H A;  4QNH B;  1Z5R A;  1ZG9 A;  4JI5 B;  5H86 A;  2Q4V A;  4O23 A;  3E35 A;  4DR3 O;  2OCH A;  5HVH A;  1EZJ A;  3K3W A;  3F5W C;  4EME A;  2IJH A;  3CCV V;  2O57 A;  2LGQ A;  5IY5 C;  1GMG A;  3CXP A;  3PGP A;  3S9L A;  1WB7 A;  2DF5 A;  1K8A W;  4QC6 A;  2Q8V A;  2EWB A;  2GLJ A;  4GZR B;  3OE7 G;  1ELL P;  2FS5 A;  3EY5 A;  5A2Q N;  4DV0 O;  1VF6 C;  4JJX A;  3WAB A;  2XAJ A;  4C7H A;  1CPS A;  4MVZ A;  4R50 A;  2VWK A;  2ZKO A;  1E1R G;  1BGY H;  3X2Q B;  4PDL A;  1S76 D;  4B08 A;  4KOU A;  4GX1 A;  4WBN B;  3GB7 C;  4KP4 A;  3BLN A;  3FX6 A;  3R1K A;  4B11 A;  4DV6 O;  5LMN B;  3CCS V;  1XRY A;  1SQF A;  3BJ7 A;  4FIP C;  3JUW A;  1NSA A;  4JD6 A;  4NCZ A;  3D3S A;  4UV8 A;  3ETG A;  4P4F A;  4UA3 A;  1IOI A;  4I0X A;  4LF4 O;  4NXM B;  3PFO A;  3APO A;  5B3S C;  1XNR O;  1WPX A;  4KSF A;  4MY0 A;  3SR2 C;  4X64 B;  2ZEN A;  3ABL B;  3ZX6 A;  2FB5 A;  2UXD O;  2NLJ C;  1Z8W A;  1B6Q A;  1EZV H;  2FML A;  4JF3 A;  3L75 H;  4MHN A;  4ZI7 A;  4ONW A;  3OEE G;  4J42 A;  3ISX A;  3JAR B;  1HNZ O;  2QKA A;  4R8C A;  3UKM A;  1TVK B;  3R9E A;  4Q36 A;  4EEQ A;  3MAQ A;  4XBF A;  2JGD A;  4TQD A;  2VBQ A;  4QVT A;  4KOS A;  1XMQ B;  1AYE A;  3FYN A;  1RP3 B;  1V0C A;  2BOC C;  3ISZ A;  2Q43 A;  2REF A;  4KVM E;  2JLM A;  1IBM O;  4RUE A;  5EIB C;  2Z3L A;  4DUY B;  3PB6 X;  2Q69 A;  4LF7 O;  5CMU A;  3CXQ A;  2Q0O C;  1JPX A;  5K8M A;  4PXD A;  5KA5 A;  1L1F A;  2PVV A;  4ZOL A;  1GM8 A;  4RAI A;  2E75 B;  4A33 A;  2ZDI A;  1AB3 A;  1N36 B;  4PSW A;  2OB0 A;  5IWA B;  1K4J A;  5F09 A;  4ZBM A;  1W2B U;  4UUJ C;  2EIK C;  1CP9 A;  3AG4 B;  3KZI Z;  1CBX A;  3CB2 A;  2GAN A;  5BMV A;  3PB7 X;  5HMN A;  4BR6 A;  4JI7 O;  4QE9 A;  3FNC A;  4OID A;  1SA0 A;  3AG1 C;  3U11 A;  3BA8 A;  1ZWI C;  4XDK A;  1HNW O;  1Q6U A;  3I56 V;  1KMI Z;  1NH2 B;  1QSO A;  5KAI Z;  4OAD A;  2ZOF A;  1IBL O;  3BHP A;  3T1C A;  1KBH A;  1B87 A;  4B13 A;  1X10 A;  2QTS A;  3QF7 A;  3J81 N;  5KUK A;  2LQT A;  4K35 A;  5BZB A;  2JVD A;  2WLI B;  2Z3N A;  2AFW A;  2QWP B;  2R9A A;  3T90 A;  2CGO A;  5KHK A;  1YEW A;  5JM6 A;  3SI2 A;  1SZT A;  3L74 H;  2HG5 C;  3LSS A;  2DYR C;  2PIY A;  2PJ2 A;  3K58 A;  2KSD A;  4O4J B;  2GFQ A;  1F2P A;  3IWW A;  3CMA V;  1EM1 A;  1R57 A;  4C7U A;  4KOT A;  3KAS A;  1RXT A;  4H2K A;  4KOW A;  5IYZ A;  2ZW5 A;  4AVA A;  2VQE O;  4JI3 B;  3CC2 V;  1VHO A;  5I0C A;  1QR8 A;  2W0F C;  5LYJ A;  3KR4 A;  4E0A A;  3TOA A;  2DMX A;  4FD4 A;  3H8E A;  2ATR A;  1YVW A;  1RSO A;  4FD7 A;  3CRA A;  4QBJ A;  1S5L Z;  1I1D A;  5IJ9 B;  3EXA A;  1YW6 A;  2LO1 A;  1LNQ A;  5ITZ A;  3BJ8 A;  2B1G A;  1ZLI A;  4M6G A;  4NTY A;  1HP8 A;  5BY1 A;  2HVJ C;  4N21 A;  1RTQ A;  2CUG A;  4TWK A;  2FCK A;  4JLY A;  4H13 B;  5C88 A;  1M57 B;  5IDJ A;  3OUS A;  4YU9 A;  3B09 A;  1ZLH A;  2Q4Y A;  4UFZ A;  5JWP A;  4ZY1 A;  4DV3 O;  1GRJ A;  2ODM A;  5CA0 A;  3TE4 A;  4K3A A;  1M93 A;  2UXX A;  1I94 B;  4FM0 A;  4DO2 A;  4JXQ A;  2ZR3 A;  1XMO B;  3CC7 V;  1TUB A;  1U6M A;  1QMU A;  1S77 D;  2CH7 A;  4YIP A;  4TV8 B;  3K0D A;  2EIK B;  2QM7 A;  4X64 O;  2VQY A;  2Y0I A;  3GUX A;  1YTF B;  5FNV B;  4JI4 B;  3E89 A;  1SQP H;  2Q5Z A;  2PIZ A;  2Z3M A;  4R6Z A;  4XPD C;  4O2A B;  4OX9 B;  3JAT A;  3AG1 B;  5LHI A;  3DGV A;  3SXO A;  4IHJ B;  5K1P A;  3IGA C;  3CRM A;  4MVM A;  1KKC A;  5A27 A;  1Q2C A;  3RT3 C;  1JFF A;  3PBB A;  1LOK A;  4FBE A;  1U97 A;  2WLK A;  2GDS A;  2P06 A;  2BCO A;  5IJ0 B;  4QUS A;  3D2M A;  1R1B A;  3HPL C;  2C2A A;  4X1K A;  1XMQ O;  1WP8 A;  3PZJ A;  1IYL A;  1K3E A;  3G6B A;  5BR8 O;  2ZEL A;  1AI7 A;  4OC3 A;  1QHT A;  3WT4 A;  2OIG A;  2GTA A;  3AK2 A;  1EE3 P;  2YDE A;  4TUY B;  3SYQ A;  3UCS C;  4DUY O;  4NGQ A;  1US6 A;  1SRY A;  2IJJ A;  5H84 A;  3JTK A;  4AIL C;  3U10 A;  4IL6 Z;  1GAX A;  2FIA A;  1KKD A;  4UVB A;  2QSA A;  3W7X A;  3MDS A;  3ABM B;  2CTQ A;  1QSR A;  4AQY B;  3ZIA G;  2CTP A;  3G3S A;  1O9H A;  4ZYQ A;  2RJZ A;  4X8A A;  1AIL A;  2HJF C;  1N36 O;  1JJO A;  1GN3 A;  4UCP A;  5LYL A;  2GUZ B;  5IWA O;  4R7M A;  4MS2 A;  4X65 O;  1XEQ A;  4L87 A;  2KCW A;  2ZEE A;  5DWM A;  4MRI A;  1ZL8 A;  4U5Y A;  3H8G A;  4MCP A;  4F6A A;  3OWC A;  1H2L A;  1PNL A;  3CJH B;  4PA4 A;  4M3S A;  1F7Y A;  4NEX A;  4MY3 A;  1YIT V;  1M5I A;  3L70 H;  2AHY A;  4NGS A;  4IT5 A;  1N4C A;  1V54 C;  5EBM C;  3K2K A;  4BMH A;  4LH7 A;  4C2Y A;  3EHB B;  3TC8 A;  2QKC A;  3HR0 A;  4PDV A;  5JVD B;  1IU8 A;  3SPH A;  1S7K A;  5LYD A;  1RM1 C;  1WK4 A;  2C6C A;  2WPX A;  3TXQ A;  2P6J A;  2ZQM A;  4CH6 A;  2JBK A;  3T4Z A;  2Q67 A;  2PTM A;  3JAL B;  3QO5 A;  4MT8 A;  2ZXW C;  2ZED A;  4PQA A;  1X59 A;  5H2F Z;  2PR1 A;  4JTA B;  1Y7R A;  3P30 A;  4X1I B;  1FAF A;  4I9Q A;  1YIJ V;  1JQG A;  1Y4M A;  4MFL A;  4PK3 A;  1TKF A;  1I21 A;  1SC5 B;  4F0Y A;  3ZJ0 A;  3JVN A;  1R3J C;  3TT2 A;  3N2G A;  2OTL V;  4GKK B;  3CX5 F;  4YFJ A;  4UCV A;  1QSN A;  4DRX B;  4GT1 A;  1R3L C;  3OD4 A;  2WLH A;  4JI3 O;  1Z5W A;  2EUL A;  4PK2 A;  4LFA B;  4DV2 O;  3LDD A;  3MHH C;  4WFB V;  1THZ A;  5G20 A;  3SHP A;  3CD6 V;  3CZX A;  2YIA A;  2YND A;  3OAA G;  3WR7 A;  4JZG A;  4RN7 A;  4JZ0 A;  2PRB A;  4ICG A;  5F46 A;  1BLL E;  4NYK A;  4ZI7 B;  4A32 A;  1YZB A;  3D3I A;  4AB7 A;  4MSW C;  3SI0 A;  4R3L A;  1F23 A;  1RO5 A;  3CWB H;  2B9Z A;  5A28 A;  4P4E A;  3RZA A;  1ROP A;  1IVS A;  1Y9K A;  4JWP A;  1R3K C;  3G4S V;  4P6Y A;  4DR2 B;  5GON B;  4E8O A;  4CGO A;  5LGU A;  1WNS A;  3JD4 A;  4OPA A;  2Q73 A;  2HKO A;  2NR5 A;  4X88 A;  3FFQ A;  1H2N A;  1CJW A;  3JRU A;  4JAV A;  1N34 B;  5K1X A;  3V7Z A;  3E8B A;  4B3T O;  4DV4 O;  1TIQ A;  3FH4 A;  4YXW G;  1I5Y A;  1IBK B;  2CTC A;  4X66 O;  2EIM C;  1FXV A;  2AFS A;  1NTK H;  4O2B B;  3JAW A;  3SYO A;  4UV9 A;  3L73 H;  1JVM A;  4JI4 O;  2E74 B;  4JXR A;  1HW7 A;  2QWR B;  1FJG O;  4WBN A;  3A9L A;  4OC5 A;  1GKF A;  2AFO A;  1KUX A;  3FF3 A;  4O4I B;  2GV9 A;  2NMT A;  2QML A;  1YDX A;  2F23 A;  4YJ3 B;  1OCR C;  2AFX A;  1FXH A;  1Q5O A;  2XT9 A;  4P9O A;  3AG2 B;  1RM1 B;  3SPJ A;  4LNU B;  4MXU A;  5DWN A;  2WPW A;  1BE3 H;  2JEU A;  5B5E Z;  4IK2 A;  5CNP A;  2H3O A;  4DUZ O;  5KTA A;  2HQY A;  3JAM N;  4G28 B;  3HB3 B;  5EYP B;  5JPH A;  2LP7 A;  3ETD A;  2JS3 A;  1AJP A;  4NTW A;  3JAR A;  1S5H C;  2G38 A;  2LW1 A;  4ASU G;  2BEI A;  3T1H B;  2ZW6 A;  3TCU A;  1Q6I A;  2LW7 A;  4HPS A;  2ZE8 A;  4R3K A;  3J80 N;  1F2O A;  1U96 A;  3RYO A;  3RFR A;  4WF9 V;  4DR6 B;  1T5E A;  2P0W A;  4TNU A;  2BTO A;  4OP4 A;  1OCZ B;  2HFE C;  2YXH A;  1AI4 A;  3LNM B;  4X1Y B;  3SJE A;  1AR4 A;  2Q7S A;  3ZHU A;  3P3N A;  1JA8 A;  4PA3 A;  2HJD A;  4PA6 A;  1PP9 H;  1QU7 A;  2VI7 A;  3CRR A;  2YIC A;  4M6H A;  5IT9 N;  2OR4 A;  5G22 A;  4LF5 O;  1HDJ A;  3B3W A;  3OFN G;  3EFF K;  1CPX A;  1N0N A;  2GU2 A;  3W7T A;  1Q43 A;  1QQC A;  3ABK B;  5IB0 A;  5B66 Z;  5JQG B;  2F95 B;  2Z3O A;  2DQ3 A;  3IO1 A;  4YHH O;  2B5U A;  5LGT A;  2PJB A;  4BW5 A;  3F5T A;  5LHH A;  1I08 A;  4JV5 B;  1N33 B;  2DPS A;  4TV9 B;  3N5F A;  4GKK O;  4CS2 A;  1VIB A;  5LRJ A;  2MW2 B;  3K5M A;  5LL6 Y;  1NTZ H;  2WLI A;  1TUB B;  3W91 A;  3CCE V;  2I79 A;  4LFA O;  1E1Q G;  2UXC O;  2CAZ C;  3LWU A;  1OCC C;  2FVG A;  4KUB A;  4MFK A;  1AVM A;  4R7C A;  4NTX A;  2H5M A;  4IIJ B;  3KHX A;  5CA3 A;  4O4J A;  3ZRW B;  4AXV A;  2W0X A;  4FZ0 A;  5B1O A;  3A0H Z;  3FX7 A;  4MW8 A;  4MVS A;  3B8N A;  3DSB A;  1CG2 A;  4MTO A;  1NSL A;  2I00 A;  1EBO A;  2E5L B;  3GYA A;  5J1Q A;  4JAU A;  2VXK A;  2FYU H;  3B3T A;  2RNB A;  4DR2 O;  1OZ0 A;  4CAX A;  1YCI A;  2R8V A;  4A5U B;  2F93 B;  4J9Z B;  2CE4 A;  1Q86 W;  1N34 O;  3PRT A;  2M6Y A;  4HNA B;  3R96 A;  1XHX A;  1BCC H;  4NXY A;  4J7K A;  3TJT A;  2GHY A;  4DW0 A;  2OOT A;  1H2S B;  1ZX3 A;  3ZMZ A;  5IJ9 A;  3G6E V;  5J2T B;  3JD0 A;  4P9P A;  2QM4 A;  1FFT B;  3LD2 A;  5FPO A;  4ABM A;  1FPO A;  4RQF A;  2L35 A;  3NR7 A;  2J8N A;  2XOK G;  3HKC B;  4I49 A;  1VMG A;  2ITD C;  5GCN A;  3R95 A;  4DR7 B;  3NE7 A;  1EN4 A;  3SPC A;  3ASN C;  2EX3 A;  5L3B A;  2VQF B;  4DR1 B;  4CRZ B;  4AHC A;  5B1B C;  3CP1 A;  5E1A C;  2BUE A;  5K8P A;  2P90 A;  4K8Z A;  3NH5 A;  3D3Q A;  4R87 A;  5LYF A;  3G8W A;  4CAW A;  3VQY A;  1RFY A;  1V55 B;  4ZY0 A;  2F66 C;  5IYC O;  4TV8 A;  5EMI A;  2PJ9 A;  4KLV A;  2L6L A;  3P2H A;  5FNV A;  1B04 A;  4LQG A;  2RCV A;  1AJN A;  5LRG A;  4O2A A;  2YEV B;  5DS0 A;  4FJC C;  4OGQ B;  1G8M A;  4IHJ A;  3FEC A;  4C2X A;  3B3S A;  4A38 A;  3CEI A;  4P4J A;  2DYS B;  1IIC A;  4LP8 A;  2VZZ A;  2AXT Z;  4MBU A;  3LSU A;  2ZW4 A;  2W6J G;  4LC1 A;  1PL0 A;  3LUT B;  1DK1 A;  2HV2 A;  4FLY A;  2YXL A;  4BIO A;  1XJO A;  2EIJ B;  2KB1 A;  3H4Q A;  4WJB A;  1NKD A;  1E79 G;  3JAS A;  5IJ0 A;  2YNE A;  1PNM A;  3IAY A;  4DR6 O;  3K59 A;  4JI8 B;  1SQG A;  4UXN A;  1WWZ A;  2PJ5 A;  4B10 A;  1D5A A;  2PJ8 A;  1OCC B;  4NR1 A;  1M4U A;  2A3Q A;  4TUY A;  4H44 B;  5JH9 A;  3GY9 A;  1QBZ A;  4LF8 B;  2JDC A;  1SKV A;  2QEX V;  4GUN A;  4FM1 A;  4ZY2 A;  4H6Z A;  3HKE A;  2Z0A A;  5D5Q A;  2BE3 A;  1NJI W;  1TAE A;  2XEF A;  2XEJ A;  4F6R B;  2GUZ A;  4PXB A;  4G2K A;  1M1D A;  1BS3 A;  1M9N A;  1XFO A;  5F49 A;  2GSM B;  4F9U A;  4CS3 A;  3CCL V;  4DR5 B;  5KX5 B;  3CJH A;  4MFQ A;  3AG4 C;  4QIW F;  1MJA A;  3T4D A;  2E76 B;  2KG7 B;  3ZN0 A;  4X2T A;  4JYW A;  2HEP A;  3ZBH A;  3KKY A;  1N33 O;  2YNC A;  2DXQ A;  1VHS A;  2P22 C;  4MHY A;  1QST A;  5JVD A;  1BO4 A;  2J9A A;  3PP9 A;  4L8J A;  4OC2 A;  1BT8 A;  2DOS A;  4NXN B;  5EIB D;  2UUB B;  2GE3 A;  3JAL A;  3W7U A;  2YI9 A;  4JTC B;  3IFE A;  3ASN B;  3FB5 C;  5L3D A;  3ZCC A;  1YW4 A;  3EFA A;  1GK9 A;  4HBN A;  2R7H A;  2EBO A;  3BAB A;  3JAW B;  3HKB B;  4MW3 A;  5B1B B;  1LUW A;  4X1I A;  4DV5 O;  4NGR A;  2ZCE A;  3M7M X;  5D29 A;  4DYO A;  3FMC A;  2EVN A;  4DV1 B;  2HHH B;  1NQT A;  3SJB C;  1Y76 B;  2QKS A;  5I4M A;  4UVA A;  4J3G A;  2A0L A;  4MVU A;  3ETE A;  4DRX A;  1XRE A;  5DED A;  1OZP A;  2YS8 A;  3KL9 A;  3OR7 C;  3KZW A;  4CGP A;  3S3X A;  3TO9 A;  3IU2 A;  1Q3E A;  4HZ3 A;  4JI1 O;  4G1P A;  5E96 A;  3S6H A;  3SYC A;  4C2Z A;  1ZUQ A;  3WC7 A;  3H1L H;  2PJA A;  1FFX B;  5J2U B;  2JJ2 G;  4CYP A;  4NF1 A;  4LF6 O;  3FYI B;  4FLZ A;  1QNM A;  3FXT A;  3DSQ A;  2HR3 A;  4AG9 A;  1Z2G A;  3DR6 A;  4DK0 A;  1KP3 A;  5LMU B;  4UCS A;  3CCQ V;  1K34 A;  2WA3 A;  1GYT A;  2F4V B;  3B40 A;  1HNX B;  2P5O A;  1R6K A;  2D2C B;  1XBU A;  4DR7 O;  3ABU A;  3K0G A;  5GON A;  4DR1 O;  1ZSP A;  1VQ6 V;  3P2F A;  4HNW B;  3AG3 C;  1M57 C;  5ELY A;  3P3P A;  2OT5 A;  3K9A A;  2IBZ H;  1VF5 B;  3QB8 A;  2P4K A;  3CXH F;  2CTW A;  4TQF A;  1XI1 A;  4B3M B;  3VH9 A;  1X4T A;  1YQE A;  5EBV A;  4O2B A;  1Z5V A;  2CDY A;  1XNQ O;  1LAN A;  4OC4 A;  2M7W A;  5GTH Z;  4Q7A A;  1KUQ A;  4PJ0 Z;  1B06 A;  2X6B A;  2XAS A;  4D6T H;  3S6F A;  4CYQ A;  2EBJ A;  1VQ4 V;  4O4I A;  2JEV A;  5H6R A;  4X62 B;  4YJ3 A;  2RFH A;  4H6U A;  1UJW B;  4GXH A;  4OC1 A;  3H1H H;  3ASO B;  5G21 A;  4KZT A;  1YXB A;  1KD1 W;  4PA9 A;  1BAV A;  2PJ3 A;  4LNU A;  3TX8 A;  4JI8 O;  3OTO B;  3UO3 A;  3F5B A;  5JCO A;  1ZO0 A;  4PA7 A;  1KQS U;  3PFE A;  5JH7 A;  2Q68 A;  5DN6 G;  5AG5 A;  1NVP B;  2P6G A;  4MVQ A;  3VAR A;  3QTC A;  5EYP A;  4LF8 O;  1FNO A;  1N32 O;  2Q51 A;  3DDD A;  3ZN1 A;  1OV9 A;  1YME A;  1FY7 A;  4LFC B;  3K5O A;  3BFR A;  2ZE6 A;  4OLL A;  4DV7 B;  3CRQ A;  4UCO A;  4B6Z A;  1WLE A;  3ABM C;  1AUG A;  1YSJ A;  2XAF A;  2YI8 A;  4JI5 O;  3E22 B;  4X1Y A;  2R70 A;  4FLT A;  1F57 A;  2Q7B A;  2B5G B;  2AZ0 A;  2IL4 A;  4M85 A;  2ADQ B;  3KGQ A;  3PBE A;  4JYC A;  1Q2Y A;  4PSX A;  1TKH A;  1MSW D;  3PB4 X;  3C3S A;  3RVZ A;  3LSQ A;  3GIU A;  4MCR A;  3DC6 A;  2UUB O;  2YNC C;  1YLO A;  3JD3 A;  3R65 A;  3R66 A;  4AVB A;  2V8G A;  1QVG U;  5JQG A;  1NMT A;  4MVR A;  3NA6 A;  3EO4 A;  1GN2 A;  4O4L A;  5TIS Z;  4R76 A;  4IHM A;  4MFP A;  3DR8 A;  2C27 A;  2N05 A;  1Q7Y W;  1L0L H;  2JEW A;  1KEC A;  1CM0 A;  4LWS B;  3CCR V;  3J7A U;  3AG3 B;  4DV1 O;  2QVP A;  4XPK A;  5LMN O;  4FLV A;  2PJ0 A;  3FJU A;  4DJL A;  4TV9 A;  4YRH A;  3L71 H;  3C26 A;  3DLJ A;  2YC0 A;  1YSC A;  1S60 A;  1YF2 A;  3H1I H;  4FD6 A;  3TXS A;  5KMG B;  3JD2 A;  4U7N A;  2EIN B;  1VAR A;  4ONU A;  3WG7 B;  4J7Z A;  4NXM O;  3F7Y C;  4KFM A;  3IJ4 A;  3TO6 A;  1VIX A;  5CBM A;  1PKX A;  2GRE A;  2YXY A;  2A79 B;  2ZOG A;  2AHZ A;  2XND G;  4IIJ A;  3UT5 B;  2P7T C;  3CCM V;  3ZRW A;  4JI2 B;  4BD9 A;  3CE2 A;  5IYB O;  2PJ6 A;  2FSR A;  4UBR A;  4MCQ A;  3JSL A;  5B1A C;  3E2E A;  5HVF A;  4KUM A;  5LMU O;  4I4T B;  4QB9 A;  4GKJ B;  2JIZ G;  1HNX O;  3ZHV A;  2LFR A;  2PVW A;  4B5P B;  3WFV A;  2G3T A;  3UO2 A;  3JAS B;  2IJI A;  1J5E B;  4PV6 A;  4HNA A;  1NZ6 A;  3D66 A;  3GWK C;  1XE4 A;  2ODF A;  1LAP A;  3FD9 A;  4MHP A;  3LAC A;  3AEI A;  5J2T A;  4B3M O;  2VEZ A;  1KC8 W;  1S7F A;  3D36 A;  3HKE B;  3BAA A;  5IV0 A;  3HKC A;  4D7T A;  1IXB A;  4ZGY B;  2GTS A;  3QNE A;  4LCU C;  1IXM A;  4CS0 B;  2B3V A;  2ZNJ A;  3APQ A;  1XOU A;  3VQX A;  1G4Y B;  2K1E A;  4FLW A;  4EFD A;  4X89 A;  2Z0Z A;  2OH1 A;  3H5Z A;  3H1J H;  3FVL A;  4GCZ A;  2A9H A;  3E0K A;  1L8D A;  3DXR B;  1Y6X A;  4F6E A;  5GTI Z;  1QLE C;  4JYY A;  3K57 A;  4FUU A;  3B77 A;  4FPP A;  1EN5 A;  4A39 A;  4CAF A;  5KUM A;  1S3Z A;  1H38 A;  3BVO A;  3D2P A;  3K03 A;  1DLB A;  3ZHT A;  3BPZ A;  3SJC C;  3O9O A;  1ON0 A;  3AG2 C;  3IFX A;  3T2M A;  1OCO B;  2YEV A;  1XIL A;  5EZY B;  1VQ7 V;  4IGG A;  2QWQ B;  3M99 B;  5JCO C;  2QA4 V;  1Z4R A;  4LFC O;  5LHG A;  4IYH A;  4B7K A;  3Q4H B;  2QE7 G;  3W7W A;  3T9Y A;  1S5J A;  3BCC H;  1K92 A;  4JYA B;  3W6S A;  4X3R A;  1VQL V;  3BA9 A;  1JWQ A;  1W59 A;  2P6F A;  4ZBG A;  2Q7G A;  2QYV A;  4CYN A;  4A94 A;  2PSW A;  1OCZ C;  1SQH A;  2RDC A;  5LBQ A;  3E86 A;  1Q82 W;  4F6R A;  5B1A B;  5J9P C;  2V4D A;  2F8H A;  1BHB A;  1JCH A;  3DGE A;  4PEL A;  2EK8 A;  2QGN A;  3FRM A;  1VHE A;  1W0K G;  1BSM A;  1S72 V;  4FM2 A;  4A95 A;  3UY5 A;  4KOY A;  4ORF A;  4CBC A;  4W9Y A;  5KX5 A;  3GKR A;  1S7N A;  1YGH A;  2KG7 A;  1R6T A;  1QCE A;  3ABK C;  4OC0 A;  2OTJ V;  1VQO V;  3ZMT A;  2YGW A;  1TUE B;  4UCU A;  3SYP A;  2BL1 A;  1FS0 G;  3C90 A;  1I94 O;  4LFB B;  4K3N A;  1XMO O;  1FXK B;  3ML0 A;  2UUA B;  3O65 A;  1DGS A;  2ABZ A;  1I12 A;  2Q9L A;  4B3R B;  2GIV A;  2WZN A;  3GB0 A;  4RQE A;  3OTF A;  2XUM A;  3HKB A;  3QO8 A;  3ZRV A;  2GBO A;  4OX9 O;  4TSF G;  3IWG A;  1QLE B;  3JAK B;  5FVJ A;  3ZHQ A;  4MMO A;  2Q6A A;  1XOV A;  1Y76 A;  2JGU A;  4XDJ A;  3A0R A;  4MJ8 A;  4UCT A;  4JI0 B;  5E79 Z;  1YJN V;  4PV1 B;  2AGA A;  1J5E O;  3A0B Z;  2DE0 X;  2YIB A;  5JJN B;  3RYI B;  4U7O A;  1NBM G;  5FL7 G;  2PI4 A;  2BSK B;  1G1X B;  5JH7 B;  1WJZ A;  1FFX A;  4JAA A;  5J2U A;  1PUA A;  5J8C A;  4LF9 B;  1G6U A;  2ATK C;  4ZHQ B;  2DN9 A;  3FB8 C;  2Q4Z A;  3JYC A;  3SDL A;  4AQY O;  1MJ9 A;  1BPM A;  4KVO E;  1WB8 A;  3ZED A;  4CS4 A;  4EFE A;  2V1D A;  1JOY A;  2H8P C;  3D36 C;  4F0X A;  2A06 H;  2JDI G;  5EC1 C;  4P4I A;  1X12 A;  4ZX9 A;  3E8G A;  1Q8I A;  2ANP A;  7CPA A;  3S9M A;  1IID A;  2QWN B;  2CNM A;  1VQ9 V;  3RO0 A;  2ZW7 A;  2ETN A;  2Y69 B;  2QTO A;  3EVK A;  3ZHS A;  2R98 A;  3OGI B;  2B58 A;  4NGM A;  3FBU A;  5CBG A;  5L3G A;  2R1I A;  3OGC C;  2CF4 A;  1V55 C;  1OJH A;  4PDR A;  4OKO A;  1WN7 A;  3CXS A;  1XEB A;  3OMA B;  3PN1 A;  2E3C A;  1XL6 A;  2V8V A;  3S6K A;  5J8F A;  3S3W A;  2ZEG A;  3RWR D;  4EB6 B;  2PC1 A;  4LH6 A;  1YR0 A;  2ZEF A;  3RW0 A;  1MZF A;  3SYA A;  2EIL B;  4O4L B;  4WFH A;  2FE7 A;  4NSQ A;  3BEH A;  5AGE A;  1Q81 W;  1GN6 A;  2DYS C;  1QSM A;  1S5K A;  4BWA A;  2PDO A;  5DEC A;  2F1M A;  1P49 A;  5IX3 A;  3ICX A;  1KZF A;  2PJ1 A;  4CGN A;  1YX0 A;  2EIJ C;  4KLW A;  4DK1 A;  2IU3 A;  4JAS A;  1JX9 A;  4NJQ A;  4KXR A;  4CH3 A;  2B4B A;  1MK4 A;  4J80 A;  4KSA A;  2DEA A;  3IGR A;  1FKA O;  1D5N A;  2BSW A;  1CP7 A;  3QAY A;  2D4O A;  3S9N A;  3D68 A;  2V77 A;  2O28 A;  2BO9 A;  3FEE A;  3KKW A;  3E22 A;  4I55 B;  3FED A;  1HR0 B;  2B5G A;  5HH1 A;  1QVF U;  5KTC A;  4UEF A;  3B3V A;  2VWJ A;  3BI0 A;  3NXS A;  2F5I A;  5IYD O;  2HC9 A;  4DNC A;  2Z3Y A;  2WUU A;  2XEI A;  4PDM A;  3ETQ A;  4AG7 A;  4JYB A;  2IH1 C;  1EFR G;  4CGL A;  5CBH A;  4LFB O;  5JQ4 A;  1YLE A;  3IIB A;  4J10 A;  4GX0 A;  1Y74 B;  5D5P A;  4CPA A;  5D8N A;  2Z3P A;  3VBB A;  2C6G A;  2Y0P A;  3RYF B;  4DV6 B;  3CC4 V;  4B3R O;  4BBH A;  1IBK O;  3H01 A;  1ORQ C;  2R9I A;  4AVC A;  4UEE A;  1CXZ B;  3OM3 B;  5HFL A;  4P2Z A;  1IY7 A;  1P0H A;  4LWS A;  2HUZ A;  5LP6 C;  4Q20 A;  2QJ8 A;  5JGF A;  4LF4 B;  1F4M A;  4YIO A;  2G0B A;  2ILM A;  1PYT B;  2QEC A;  4IUS A;  3CS5 A;  1XNR B;  5FLX N;  5KAF Z;  3B2E E;  2PZS A;  3E83 A;  4BW9 A;  3OMN B;  3QAH A;  4HAM A;  3PJS K;  4RS2 A;  2UXD B;  1SQB H;  5KMG A;  3PB9 X;  1RPR A;  4JI0 O;  4B12 A;  1YHQ V;  4O4H B;  1I5X A;  2BCC H;  3CPW U;  4MTX A;  2YUA A;  5CN0 A;  3RNZ A;  4X20 B;  3K08 A;  3UT5 A;  5KLV H;  4WCE V;  3G80 A;  4GYC B;  2B3U A;  3KR5 A;  1MNG A;  1AR5 A;  1HWY A;  4KL1 A;  5IE9 A;  3RAM A;  1NH2 D;  5EC2 C;  2EJ7 A;  2QIR A;  4B7E A;  4NGP A;  1NT2 B;  4MFZ A;  3P32 A;  1R73 A;  4EKW A;  2H94 A;  2WPD G;  4I4T A;  2J8R A;  3CPX A;  1S7L A;  5C93 A;  4B5P A;  2RMK B;  3T8W A;  3ABT A;  3T1H O;  1CPY A;  2EJR A;  1AR1 B;  4GS4 A;  1NS1 A;  4PPZ A;  3G71 V;  2P67 A;  1R3N A;  4C68 A;  1NI8 A;  2IJZ A;  4ZIB A;  2WLJ A;  1D2D A;  3I1U A;  4C7I A;  4ZKI A;  4J9Y B;  4E2L A;  3B8G A;  4RI1 A;  1TXR A;  4UFX A;  1O9G A;  3TK1 A;  3OUF A;  1DF4 A;  1AP6 A;  1B6B A;  4PXE A;  2R72 A;  3FB6 C;  4JI7 B;  2WSS G;  3W6X A;  1GM9 A;  1A32 A;  2MK3 A;  4CYO A;  1TA8 A;  5BXZ A;  1IDS A;  1BPN A;  1Y0R A;  4OPH A;  3CDX A;  4OME A;  3B7I A;  3TGU H;  2PI5 A;  1N8R W;  2K5T A;  2QR4 A;  1IOF A;  4U9Y A;  4QGP A;  5AG2 A;  1FYJ A;  1PV0 A;  3DXR A;  2PYL A;  2WAM A;  1TKJ A;  3IC1 A;  2CGN A;  4TOI A;  1SER A;  4GX5 A;  3IWE A;  1ZTE A;  1J4J A;  3GWO A;  1ZG7 A;  2WSA A;  4JV5 O;  2PJC A;  1WAZ A;  2FKX A;  4I50 B;  3ASO C;  3MGD A;  2QDO A;  2JS5 A;  2OZU A;  2AZ2 A;  1BOB A;  4MI4 A;  3WC6 A;  2WLL B;  2X6C A;  5EZY A;  3S6G A;  1Y7E A;  4HNX B;  2X7R B;  1PPJ H;  4B3S B;  5LP6 B;  2ZE7 A;  1H8L A;  1JMK C;  4UCR A;  4H0L B;  4DR4 B;  2CNS A;  2CK3 G;  2WLN A;  3MD0 A;  3Q4H A;  5CA1 B;  1SET A;  3TCV A;  3RBU A;  1M56 C;  3ZRS A;  1FT7 A;  3T1Y B;  3IU1 A;  3ZHR A;  1TGO A;  2VQE B;  3FB3 A;  1MG1 A;  1YTF D;  1HR0 O;  4BAY A;  2E5L O;  4FFK A;  4EFB A;  2Z5U A;  5LA6 B;  3AK3 A;  3QVN A;  4UEZ A;  2GLF A;  2C1C A;  1VF7 A;  1XF8 A;  1LR1 A;  4DW1 A;  4YGO A;  2QM8 A;  4CH5 A;  1IGB A;  4YY3 B;  4KUA A;  1LAM A;  1ARO P;  4DV3 B;  1R6N A;  1QR9 A;  3IC9 A;  2DPT A;  1PNK A;  4NKG B;  1SF9 A;  1BHA A;  4DXW A;  2VQF O;  3SPI A;  1PM9 A;  1SZX A;  3RYC B;  4LUA A;  2HLD G;  1GTO A;  2AW9 A;  1FXK A;  3HKD B;  3CCJ V;  3RYH B;  5K8O A;  1LFW A;  4NJR A;  3JCZ A;  2PCU A;  2JJ1 G;  4PI2 A;  4KOX A;  2ZIM A;  4XDL A;  3SGI A;  1KUY A;  2ZE5 A;  2Q44 A;  2EIN C;  3WG7 C;  6CPA A;  1SS3 A;  1LCP A;  3CHX A;  1DTO A;  2Y4T A;  2F43 G;  2ZT9 B;  3ZJZ A;  4GM5 A;  3JAK A;  2AE6 A;  2IW5 A;  3N2K B;  4IYI A;  5BR8 B;  1P4N A;  3FKS G;  2VS0 A;  4KVX A;  3LDC A;  3ZZI A;  2Z11 A;  4OIW A;  3A8T A;  2Q7H A;  5B1N A;  5HFM A;  1N0J A;  3RYI A;  2BSK A;  3I9S A;  1VKC A;  4JZ2 A;  3VAT A;  4F9V A;  1GO3 F;  1YRE A;  3K04 A;  4X5K A;  1BQZ A;  3FIX A;  1DF5 A;  1MAB G;  1ZLZ A;  5LXT B;  4RWU A;  3D7H A;  2B1I A;  4ZHQ A;  5F48 A;  1JR9 A;  4X65 B;  3OT7 A;  4MTF A;  5L3F A;  5AG6 A;  1M56 B;  5IY5 B;  1XDC A;  1F51 A;  4X9Q A;  4P44 A;  1IX9 A;  4PHZ A;  2Q04 A;  4MHZ A;  3ZRX A;  3D67 A;  4FLU A;  1B3Q A;  4UVC A;  1XBL A;  2ZXV A;  2N04 A;  3L9D A;  4U3J B;  3RBZ A;  3SJF A;  4MHD A;  5LOV B;  4MTG A;  2WYR A;  1R3I C;  2XAG A;  2PGG A;  1URF A;  1WPB A;  2V7Q G;  1Q2D A;  3HUV A;  5ISV A;  4WWV A;  4WFF A;  4DR5 O;  2UU9 B;  3EC4 A;  1DTD A;  3MHS C;  5CBF A;  3QO7 A;  5G1Z A;  4W4L A;  4BIN A;  3LOD A;  1NTM H;  4L89 A;  5GW7 A;  1MSD A;  4P4B A;  5CB4 B;  1SQQ H;  1YVO A;  4II9 A;  4NXN O;  1ELM P;  3THO A;  2Y4U A;  3BRC A;  3CSX A;  3CCU V;  4B3S O;  4YWY A;  2QWO B;  1YVK A;  4EB6 A;  4DR4 O;  2O4H A;  1YK3 A;  2WA4 A;  2WLM A;  2DJV A;  5B3S B;  1OCO C;  5KHJ A;  1K73 W;  2OU2 A;  3FAV B;  2UXB B;  4KOR A;  3H8F A;  3T1Y O;  1ZG8 A;  2PYJ A;  2HHH O;  1JJ2 U;  3KQX A;  2XHB A;  4DV2 B;  4MCS A;  3E8F A;  2XAQ A;  2EUI A;  5F47 A;  2ZR2 A;  3NH8 A;  2IMO A;  3ZMV A;  2OYQ A;  4IF5 A;  2ZM6 B;  1K97 A;  2JBJ A;  2DWD C;  1AI5 A;  2ITC C;  4PD4 F;  1VQK V;  4DYL A;  4LR3 A;  3JCU Z;  4NFR A;  2CY2 A;  5BWA B;  1ENV A;  4EVY A;  5HXD A;  3STZ C;  3RGB A;  3CPA A;  2NYQ A;  3QG5 A;  4KS9 A;  2PJ7 A;  1YJ9 V;  4YY3 O;  4BIZ A;  4Y49 C;  5THW A;  5KHG A;  1MA1 A;  4JGS A;  4FLX A;  2OZG A;  4I55 A;  4KHP B;  2R9R B;  3ZMU A;  4B3T B;  2F4V O;  1UFI A;  3JD1 A;  2IJK A;  4DV4 B;  1XIX A;  3R9F A;  4UCN A;  1MMM A;  4FFB B;  2BOA A;  2PUS A;  1Q7L A;  4K8X A;  1M4G A;  1Y9W A;  4P4D A;  4X66 B;  2RQ6 A;  4GX2 A;  1IZ3 A;  3SJA C;  3A2F A;  4FMT A;  4H37 A;  5L3E A;  2PJ4 A;  3B8M A;  1FJG B;  1Y74 A;  3TTH A;  1IUR A;  4K30 A;  2JK5 C;  3RYF A;  4CZZ A;  1SQX H;  1DE4 C;  3K06 A;  4KOV A;  5IB9 A;  2VZY A;  2ZEP A;  1FXK C;  4HYO A;  3AG7 A;  4RO2 A;  1XL4 A;  2B4D B;  4AI8 A;  3UM7 A;  2PQ8 A;  1WA8 B;  4X62 O;  4YJ2 B;  2OCC C;  2BTQ B;  4DUZ B;  4CRY B;  2A7W A;  2WWW A;  2C6P A;  4Q38 A;  4R6T A;  2DYR B;  4O4H A;  4A2Z A;  1GH6 A;  3OTO O;  2ZIN A;  5LRK A;  2CIJ A;  3RVY A;  3H9V A;  4X20 A;  2DW4 A;  2HB6 A;  4JTD B;  1VQ8 V;  4WFA V;  5KHH A;  3UQ8 A;  2LJ2 A;  3PB8 X;  3VWE A;  1VQP V;  5JJE B;  4QE7 A;  4WFG A;  1BMF G;  2ZDI C;  3B35 A;  4P30 A;  1M1K W;  1GN4 A;  3D7D A;  2K9P A;  1PL4 A;  2OIE A;  3K9U A;  2O53 A;  4DV7 O;  4H89 A;  1ARL A;  3RN4 A;  4IAV A;  3BI1 A;  3BY6 A;  2RN9 A;  4FZ1 A;  4F4L A;  3I3G A;  3MN8 A;  1N71 A;  4Z65 A;  2UU9 O;  2P6E A;  4G27 B;  3TOB A;  4LF5 B;  1CEZ A;  3CT9 A;  4Z1M G;  3LNN A;  3EXN A;  1P7G A;  3L72 H;  4B14 A;  2ARH A;  2JDD A;  5H9C A;  1BL8 A;  2XAH A;  4NB5 A;  1UPG A;  2FIW A;  2FXF A;  1YI2 V;  2P4V A;  2Q0A A;  2UXN A;  4YHH B;  2DQ0 A;  2OWO A;  4K0K B;  2ZPA A;  4Y49 B;  4N23 A;  2REE A;  1H2M A;  5EK0 A;  4OXS A;  2ZEM A;  4RUF A;  1M44 A;  1LUV A;  3WU2 Z;  2Y69 C;  3C3T A;  5EBW C;  4QJF B;  2W6I G;  1BQ0 A;  3WB0 A;  4UFV A;  4E2A A; 
#chains in the Genus database with same CATH homology
 2GE3 A;  3IGR A;  5I0C A;  2BSW A;  5C82 A;  4E0A A;  2D4O A;  3TOA A;  4FD4 A;  2O28 A;  2ATR A;  4FD7 A;  3EFA A;  3KKW A;  4MFJ A;  4XPD B;  4QBJ A;  2R7H A;  1I1D A;  2B5G A;  5HH1 A;  5KTC A;  3DNS A;  2EVN A;  3BJ8 A;  4UCM A;  3TO7 A;  2F5I A;  2J8M A;  4DNC A;  2WUU A;  3N7Z A;  4JLY A;  2FCK A;  4AG7 A;  5C88 A;  4CGL A;  4J3G A;  4CGP A;  1OZP A;  2G3A A;  5JQ4 A;  2Q4Y A;  1YLE A;  3TO9 A;  2Z3P A;  3IU2 A;  3TE4 A;  2CXA A;  4BBH A;  5E96 A;  3S6H A;  4JXQ A;  1NE9 A;  4C2Z A;  2Q0Y A;  4AVC A;  1U6M A;  4CYP A;  4NF1 A;  1P0H A;  2HUZ A;  2VQY A;  3FXT A;  1KUV A;  2G0B A;  4AG9 A;  2QEC A;  4IUS A;  3DR6 A;  2Z3M A;  4XPD C;  3QAH A;  3SXO A;  4RS2 A;  4B12 A;  3P2F A;  5A27 A;  4A31 A;  1Q2C A;  3D8P A;  1XMT A;  4HNW B;  2RC4 A;  4QUS A;  3D2M A;  3PZJ A;  1IYL A;  3QB8 A;  4CAV A;  2B3U A;  2Z10 A;  2QIR A;  5EBV A;  2FL4 A;  4MFZ A;  4CGM A;  2J8R A;  5H84 A;  3JTK A;  1S7L A;  4B5P A;  2FIA A;  3S6F A;  4CYQ A;  4GS4 A;  1QSR A;  2JEV A;  3G3S A;  4H6U A;  2OZH A;  4C68 A;  4R9M A;  4UCP A;  4UWI A;  1IYK A;  4C7I A;  5G21 A;  4KZT A;  3B8G A;  4RI1 A;  4CAE A;  2KCW A;  5DWM A;  4UFX A;  4U5Y A;  3F5B A;  1ZO0 A;  4F6A A;  1B6B A;  3OWC A;  4M3S A;  4NEX A;  4MY3 A;  5AG5 A;  3F0A A;  3W6X A;  2P6G A;  2X7B A;  4CYO A;  4BMH A;  4C2Y A;  3DDD A;  1FY7 A;  1S7K A;  1M4I A;  1WK4 A;  2WPX A;  2K5T A;  4OLL A;  4U9Y A;  4XPL A;  3IWE A;  2A4N A;  4XNH C;  1J4J A;  2CNT A;  2PR1 A;  2Z3K A;  2WSA A;  1Y7R A;  2Q7B A;  1MJB A;  2B5G B;  3MGD A;  2IL4 A;  2Y0M A;  2OZU A;  4M85 A;  1BOB A;  1UFH A;  4MI4 A;  4MFL A;  4PK3 A;  3S6G A;  4HNX B;  1I21 A;  1Q2Y A;  4PSX A;  3ZJ0 A;  3JVN A;  4F0Y A;  3TT2 A;  3VWD A;  1GHE A;  4YFJ A;  1QSN A;  2CNS A;  3R9G A;  4HKF A;  4PK2 A;  2YNC C;  3TCV A;  1Z9U A;  5KTD A;  4AVB A;  5G20 A;  1Z4E A;  3SHP A;  3IU1 A;  1NMT A;  2YND A;  4B5O A;  3EO4 A;  3FB3 A;  3SXN A;  4MFP A;  3DR8 A;  2C27 A;  3WR7 A;  2PRB A;  1CM0 A;  5F46 A;  4A32 A;  1PU9 A;  4AB7 A;  1IB1 E;  4R3L A;  4XPK A;  1RO5 A;  5A28 A;  4YRH A;  3C26 A;  1S60 A;  1Y9K A;  4JWP A;  4FD6 A;  4E8O A;  4CGO A;  4ONU A;  1XF8 A;  1CJW A;  4YGO A;  3TO6 A;  4KUA A;  2PR8 A;  4U9Z A;  4FD5 A;  1TIQ A;  3V8I A;  2DPT A;  2FSR A;  4UBR A;  4JXR A;  4QB9 A;  3A9L A;  4B5P B;  1KUX A;  4LUA A;  4UWJ A;  2G3T A;  2NMT A;  2QML A;  5AG7 A;  4PV6 A;  4KOX A;  1XE4 A;  3TFY A;  1KUY A;  2Q44 A;  5DWN A;  2WPW A;  1L0C A;  2D4P A;  3F8K A;  2VEZ A;  5CNP A;  1S7F A;  4HNY B;  1M4D A;  5KTA A;  2AE6 A;  5IV0 A;  2HQY A;  1P4N A;  4XNH B;  4ZGY B;  5JPH A;  1LRZ A;  4LX9 A;  4CS0 B;  4KVX A;  2B3V A;  3ZZI A;  2AJ6 A;  2Z11 A;  4UFW A;  2Z0Z A;  2OH1 A;  3H5Z A;  2BEI A;  2ZW6 A;  4OAE A;  4R3K A;  3E0K A;  3I9S A;  1VKC A;  3RYO A;  1YRE A;  2B4D A;  2P0W A;  4X5K A;  4CAF A;  1S3Z A;  3FIX A;  3D2P A;  5F48 A;  4R57 A;  5AG6 A;  1ON0 A;  4A30 A;  2Q04 A;  2ZXV A;  2VI7 A;  1Z4R A;  4MHD A;  5G22 A;  1Q2D A;  5ISV A;  5AG4 A;  3T9Y A;  5IB0 A;  3W6S A;  3EC4 A;  2FT0 A;  2Z3O A;  5EC4 A;  5G1Z A;  4L8A A;  3LOD A;  2P6F A;  4ZBG A;  4L89 A;  5H86 A;  2Q4V A;  4CYN A;  2DPS A;  1YVO A;  2PSW A;  1SQH A;  4II9 A;  1YVK A;  3CXP A;  1YK3 A;  3PGP A;  4QC6 A;  2OU2 A;  3W91 A;  2I79 A;  3FRM A;  4KOR A;  4KUB A;  2FS5 A;  4MFK A;  3EY5 A;  4A95 A;  2H5M A;  3UY5 A;  4KOY A;  4ORF A;  2EUI A;  4JJX A;  3GKR A;  1S7N A;  5F47 A;  4C7H A;  1YGH A;  4IF5 A;  2YGW A;  3DSB A;  4KOU A;  2BL1 A;  1NSL A;  2I00 A;  3BLN A;  3R1K A;  3GYA A;  4B11 A;  2VXK A;  2CY2 A;  4CAX A;  5BWA B;  3BJ7 A;  4EVY A;  3JUW A;  4JD6 A;  4NCZ A;  2R8V A;  1I12 A;  3D3S A;  4KS9 A;  2GIV A;  3R96 A;  4UA3 A;  4Y49 C;  4NXY A;  2OZG A;  4KSF A;  4MY0 A;  3LD2 A;  1XIX A;  3R9F A;  4UCN A;  3IWG A;  2J8N A;  5FVJ A;  1M4G A;  1Y9W A;  4I49 A;  5GCN A;  3R95 A;  3NE7 A;  4MJ8 A;  3TTH A;  4CRZ B;  3R9E A;  4K30 A;  4Q36 A;  2BUE A;  4KOV A;  2VZY A;  2VBQ A;  4QVT A;  4KOS A;  4R87 A;  3FYN A;  2B4D B;  3G8W A;  1PUA A;  4CAW A;  5J8C A;  1V0C A;  4KVM E;  2REF A;  4KLV A;  2PQ8 A;  2JLM A;  3P2H A;  2Z3L A;  1MJ9 A;  4KVO E;  3CXQ A;  4C2X A;  4CRY B;  1IIC A;  2VZZ A;  4Q38 A;  4MBU A;  4A33 A;  2ZW4 A;  2HV2 A;  4A2Z A;  4F0X A;  4PSW A;  2OB0 A;  1K4J A;  3H4Q A;  2GAN A;  2YNE A;  1IID A;  5HMN A;  1WWZ A;  3FNC A;  2CNM A;  2ZW7 A;  3VWE A;  4B10 A;  2R98 A;  2B58 A;  3FBU A;  3GY9 A;  2R1I A;  1QSO A;  2JDC A;  4OAD A;  4H6Z A;  4B13 A;  1B87 A;  1XEB A;  3CXS A;  3K9U A;  3S6K A;  5J8F A;  2PC1 A;  1YR0 A;  4H89 A;  2Z3N A;  1M1D A;  2FE7 A;  4NSQ A;  3T90 A;  3I3G A;  5AGE A;  1S5K A;  1N71 A;  1QSM A;  2PDO A;  2P6E A;  3TOB A;  3EXN A;  5F49 A;  4B14 A;  2ARH A;  2JDD A;  5IX3 A;  1KZF A;  4CGN A;  1YX0 A;  2FIW A;  1MJA A;  2FXF A;  4KLW A;  4MFQ A;  1R57 A;  4KOT A;  4Y49 B;  2ZPA A;  2YNC A;  2REE A;  2DXQ A;  1VHS A;  1RXT A;  1M44 A;  1QST A;  4KOW A;  1BO4 A;  2ZW5 A;  2B4B A;  1MK4 A;  4KSA A;  4AVA A;  3PP9 A;  4UFV A;  4E2A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...