2FL4A

The crystal structure of the spermine/spermidine acetyltransferase from enterococcus faecalis
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
147
structure length
147
Chain Sequence
GMEIHFEKVTSDNRKAVENLQVFAEQQAFIESMAENLKESDQFPEWESAGIYDGNQLIGYAMYGRWQDGRVWLDRFLIDQRFQGQGYGKAACRLLMLKLIEKYQTNKLYLSVYDTNSSAIRLYQQLGFVFNGELDTNGERVMEWTHQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of the spermine/spermidine acetyltransferase from Enterococcus faecalis
rcsb
source organism Enterococcus faecalis
molecule tags Transferase
molecule keywords spermine/spermidine acetyltransferase
total genus 36
structure length 147
sequence length 147
ec nomenclature
pdb deposition date 2006-01-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.900 Mainly Alpha Orthogonal Bundle Helix Hairpins The crystal structure of the spermine/spermidine acetyltransferase from enterococcus faecali 2fl4A01
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 2fl4A02
2FE7A 3DR6A 3NE7A 2REFA 1CM0A 3D8PA 4OAEA 3FXTA 2B5GA 2WPXA 1QSTA 4KOUA 1S7KA 1B87A 1PU9A 4UA3A 2C27A 4IUSA 5GCNA 4E2AA 1S3ZA 1YREA 2VBQA 1KUXA 4HKFA 3FB3A 1CJWA 4MJ8A 4H6ZA 4HNXB 2F5IA 4FD6A 4LX9A 4MY0A 3UY5A 4CAXA 1M4DA 3C26A 2HV2A 1TIQA 3F0AA 4MBUA 5J8CA 1KZFA 2R7HA 4JWPA 1SQHA 4AVCA 4UWIA 2ZW4A 4MY3A 2K5TA 1VHSA 4NEXA 2ZXVA 4MHDA 2PC1A 2JLMA 4XPDB 5IV0A 2IL4A 3S6HA 3W6SA 1Y9KA 4KOWA 4JXQA 1Q2DA 4NSQA 4QB9A 5KTCA 4ZBGA 1R57A 2I79A 3D3SA 2GANA 4B5OA 3EFAA 1NMTA 2VI7A 5HMNA 3FIXA 2OZHA 3FYNA 4M3SA 5ISVA 4CAVA 1QSOA 3TE4A 3D2PA 2NMTA 2FS5A 4JD6A 5EBVA 5F46A 5IB0A 4R57A 4FD5A 2QECA 2R98A 3PP9A 3BJ7A 1V0CA 3TOBA 4CS0B 2VQYA 2JDDA 4KLVA 1P0HA 2VEZA 4CAWA 1KUVA 1Z4EA 3D2MA 1Q2CA 4RS2A 2Q4YA 2FXFA 4QUSA 4XPLA 3LODA 2PR8A 3E0KA 4II9A 3S6FA 3EC4A 4KUAA 2OB0A 3V8IA 1ON0A 4KVXA 2EUIA 2G3AA 2OZUA 2ZPAA 2H5MA 5DWMA 4JLYA 4UBRA 1N71A 2B3VA 2REEA 1IYKA 2DXQA 1YGHA 4XNHC 3OWCA 2D4PA 4E0AA 1BO4A 1S7LA 2Z11A 1YVKA 4JJXA 2VZZA 1LRZA 2AJ6A 2I00A 5F48A 3KKWA 4JXRA 2CNMA 4PV6A 2KCWA 4U5YA 2HQYA 3DNSA 3ZJ0A 3S6GA 3GYAA 1XEBA 4XPKA 2Z10A 2B4BA 1J4JA 3GY9A 2CNSA 1M44A 2RC4A 2G3TA 3K9UA 4AVBA 1YX0A 1IICA 3TCVA 2AE6A 4L8AA 2Q0YA 4X5KA 4UWJA 4YFJA 1S60A 4B5PA 1K4JA 3TO9A 4PSXA 2CNTA 4ONUA 4K30A 2BEIA 4OLLA 3DR8A 3B8GA 3MGDA 4LUAA 5CNPA 1VKCA 1IB1E 3G3SA 3F5BA 4YGOA 2PQ8A 1YVOA 3ZZIA 1MJBA 4CRZB 1YK3A 3R96A 3QAHA 1WWZA 2B5GB 1YR0A 1KUYA 3F8KA 4NXYA 3TTHA 3I9SA 4F6AA 3CXQA 2JDCA 1M1DA 2OU2A 4RI1A 2CY2A 2R1IA 1MJ9A 4HNYB 4ORFA 2P6FA 2VXKA 5F49A 4EVYA 2QIRA 2ZW5A 2BSWA 4GS4A 4M85A 5JPHA 3SXNA 4BMHA 1Y9WA 4U9YA 3P2HA 3TFYA 4KUBA 2FIAA 2Q44A 4MI4A 3BJ8A 3EO4A 4KVOE 1XIXA 5J8FA 2J8MA 1WK4A 1I1DA 1XE4A 2O28A 4H89A 2GE3A 3PGPA 3TO7A 5EC4A 4E8OA 1IYLA 5I0CA 1B6BA 2WPWA 3R95A 4QC6A 1XMTA 3LD2A 4J3GA 2FCKA 4KOYA 1IIDA 4AG9A 2Q4VA 5C88A 3JUWA 2B3UA 2Y0MA 2ZW6A 3TOAA 3IWGA 5F47A 3DDDA 2JEVA 2OH1A 4KOSA 4KVME 2B4DA 3T9YA 2HUZA 2FIWA 4NF1A 2P0WA 3FNCA 1BOBA 1QSMA 2B4DB 3RYOA 2X7BA 3CXSA 2B58A 1UFHA 3R9EA 4AG7A 4R87A 2GIVA 3WR7A 3I3GA 1QSRA 3CXPA 2VZYA 5HH1A 3QB8A 1QSNA 1M4IA 4PSWA 1Z9UA 3P2FA 4U9ZA 3FRMA 4L89A 4F0YA 2D4OA 3VWEA 4R3LA 1Q2YA 2Q04A 5JQ4A 4YRHA 2QMLA 5KTAA 3TT2A 4R9MA 4I49A 1M4GA 1P4NA 1FY7A 5H86A 4PK2A 2FT0A 4Y49C 5H84A 3DSBA 3EXNA 3BLNA 2Z0ZA 5IX3A 1Z4RA 5KTDA 3N7ZA 2PR1A 2OZGA 3H4QA 4OADA 3R9GA 1OZPA 2PDOA 4XPDC 1S5KA 3SXOA 3GKRA 1RXTA 4XNHB 3TO6A 1XF8A 3JVNA 2A4NA 4NCZA 5DWNA 4Y49B 3R9FA 1I21A 3FBUA 1S7FA 1U6MA 2PRBA 2FL4A 1MJAA 2ATRA 3G8WA 2PSWA 1MK4A 2P6EA 2P6GA 2J8RA 3EY5A 4KLWA 4PK3A 4KOVA 3W6XA 5E96A 2BL1A 4B5PB 4QBJA 2Q7BA 1NE9A 2J8NA 1RO5A 2ARHA 4R3KA 2R8VA 2G0BA 5C82A 1PUAA 4QVTA 2ZW7A 3T90A 4CRYB 4H6UA 1NSLA 4DNCA 1Y7RA 4KOTA 3W91A 3PZJA 1L0CA 3VWDA 5FVJA 1S7NA 4FD7A 2BUEA 3IGRA 2EVNA 4AB7A 4AVAA 1GHEA 1YLEA 3SHPA 4KZTA 4KOXA 3R1KA 4HNWB 4IF5A 3S6KA 2FSRA 4KORA 4FD4A 1I12A
chains in the Genus database with same CATH superfamily
1T5EA 4MFKA 4PA9A 2IJZA 4PI0A 5DN6G 4YWYA 4JPRA 3D8PA 2ZE5A 1NT2B 1HNXO 4D6TH 1RM1B 2WPXA 3ZMUA 4JI7B 3SJXA 3CJHB 2V77A 1UWYA 5CA0B 2Q7SA 1XQ8A 1ZWIC 4X62B 4IUSA 1OZ0A 4J80A 1NH2B 3MHSC 1KP3A 4X62O 5J2UB 2VBQA 4ZI6A 1JQGA 1KUXA 4K3AA 1BPMA 4YJ2A 4FLVA 1H2MA 1FXKC 5FPOA 4H6ZA 4HNXB 4MJ8A 2F5IA 2YEVA 4NB5A 2N05A 4MY0A 3ZMTA 4PDVA 4TUYA 2VRZA 2G9DA 5AG7A 4I50B 4JV5O 2CAZC 2HV2A 1JVMA 3EFFK 5F2VO 3F0AA 5J8CA 1GAXA 2UU9B 1KZFA 2R7HA 3ZBHA 1SQHA 1I7FA 2YXHA 4QNHB 2Q4ZA 2B5UA 4NEXA 2HKOA 5CBFA 2HP8A 1BE3H 2JLMA 4XPDB 1ELLP 2EK9A 4K0KB 5ELYA 4NXNB 3S6HA 4CYNA 2ZIMA 2EULA 4X8IA 4TV9A 4F9UA 4PA7A 1Y9KA 2JJ2G 4I7ZB 2ODMA 3KCYA 1Q2DA 3H8FA 3PRTA 5L3CA 3S3XA 5KTCA 1XDCA 4DR5B 4TUYB 3RYHA 1PV0A 4GLXA 2QJ1A 2I79A 4WFEA 2R72A 4B5OA 1AJNA 1WPBA 5AG4A 5A27A 2OZHA 3K57A 3A8TA 3FYNA 2JJ1G 5ISVA 3MRUA 3TK1A 1BSMA 2NMTA 4WFAV 4YY3O 4OPHA 4JD6A 3K79A 4CS4A 5IJ0B 4MXUA 2YIBA 1I5XA 1E79G 4QPJA 4UB6Z 4B3MO 1WJZA 5KMGB 5A2QN 1XMQB 2R98A 5CB4A 2CTWA 2LFRA 2K1EA 3BEHA 3QVNA 1R3IC 2ZR3A 2JGDB 2XAFA 2ZCEA 3JAWB 4WFGA 2VQEB 4GX2A 3FECA 1BT8A 4JI2B 3E86A 5IYDO 1YTFB 5KAFZ 4QUSA 1MSWD 1TKFA 2PR8A 2F95B 1WPXA 2QVPA 3S6FA 4C68A 2G38A 3EC4A 1GM7A 4DW1A 1KC8W 4I55B 1R3LC 4LC1A 2OB0A 3CC7V 3W7WA 3PB6X 4A30A 4ZHQA 1Q6HA 1FXHA 1K3EA 2A7WA 5JGFA 4B3SO 1MSDA 2Y0PA 2ITDC 3B77A 2PJ0A 3DXRB 5C8YA 4UFZA 1Y7EA 4NTWA 1MOFA 3FYIB 4JLYA 2ZEEA 2B3VA 2REEA 3SI0A 2DXQA 5H6QA 1FFXA 2EBOA 2KG7B 1YGHA 2QKAA 3KHZA 3LDCA 2LFSA 4A33A 1OCRB 3RVZA 4E0AA 3B3TA 2YDEA 3B8NA 2EILB 2Z11A 2WLMA 1YVKA 4JJXA 5B1AC 1P7GA 1BHBA 2UXXA 1VIBA 2AJ6A 5D8NA 2HFEC 5KLVH 5K8NA 3APOA 1IVSA 3KKWA 2QWRB 4X1KA 1RPRA 2VS0A 4ZHQB 4JXRA 4U5YA 3OUFA 2KCWA 2HQYA 4MHZA 3ZJ0A 3S6GA 1SA0A 2JRIA 1XHZA 3JALB 3UKMA 3CC4V 3ISZA 4JI8B 2ZOGA 2Y4TA 3ABTA 4PELA 5EMIA 4GT1A 2MK3A 4W4LA 5KHGA 2P6JA 4AVBA 4UCOA 4D7TA 3FX6A 5IJ9B 2GV9A 3HKEB 1LANA 4NVPA 4X5KA 1NU1H 3ABUA 4B5PA 1XBLA 1I94O 2QE7G 2XOKG 2JDIG 1XL6A 5LXTB 5LBQA 4EB6B 3OMAB 4KSAA 2PJ5A 3JALA 2QTOA 1ZTEA 1IB1E 1P49A 4WCEV 4YGOA 3AK1A 5JH7A 2AFXA 5KX5A 4B10A 3L73H 3H8GA 2B1GA 5B1BC 4C7UA 2PI5A 3BPZA 1ZAUA 1N34B 3QAHA 4MHNA 1WWZA 2HLDG 2FVGA 4JYBA 2JGUA 1YSJA 2B5GB 1VQ9V 2EIMB 1FXVA 1M1DA 2PJ2A 3MDSA 2PE3A 1AR1B 1XMBA 5IB9A 4E2LA 3D4UA 3IJ3A 1NQTA 3STZC 2P7TC 4ORFA 2P6FA 2VXKA 4QE9A 4CAEA 3FMCA 2ZW5A 4O4HB 2XUMA 4GS4A 3CCEV 3E83A 2WLKA 5L3DA 4JYAB 5JPHA 4A37A 5LHGA 1Y9WA 2Q6AA 3JSNA 2LP7A 1KB9F 3OW2U 1OHHG 3K04A 3KQZA 3OGCC 4KVOE 3AG2B 1JR9A 1XIXA 3HUVA 1N8RW 1W0KG 2EINB 1WK4A 1R1BA 1X4TA 3RYIA 4H13B 1M56C 5J2UA 2GE3A 2V7QG 4CGNA 1AILA 3VQWA 1YXBA 1J95A 2QWPB 5I0CA 2QDOA 2YEVB 1SQVH 2WPWA 1XMTA 1S0VA 4K0KO 4KOYA 4AG9A 2Q4VA 5C88A 2UXNA 4WFHA 3D36C 4WFFA 1K7DA 1XOUA 2XEGA 4P30A 3BY6A 2IJIA 4G2KA 2JK5C 3W7SA 1H38A 3IWGA 3ZMSA 4TV8B 2UU9O 4MW8A 2GFQA 2B4DA 3ZEDA 4JV5B 1JMKC 3JSLA 3CCVV 3CCRV 2PI4A 1PL4A 3N2KA 2P0WA 4IT5A 2E5LB 2PRQA 3IAYA 4LFBO 3RYOA 4AHCA 1NKDA 1NR1A 5G20A 3K5MA 1SESA 2DE0X 1SQXH 1UFHA 4P4JA 2EZOA 3EVKA 4LF5B 3WR7A 1QSRA 3KZWA 3O9OA 2VZYA 4X88A 3UT5B 2UXCB 3VQYA 1QSNA 3IWEA 2HHHB 2K9PA 4CGOA 5K8OA 1M4IA 1E1RG 3ABKB 4I4TA 2Q67A 2PJ3A 3VH9A 4CAFA 1XBUA 4G28B 2PJ6A 4MHYA 1ORQC 5CB4B 3VWEA 4FAIA 4YIPA 4DR3O 4R3LA 5HVHA 3JARA 1R3KC 5LHHA 1JWQA 1GN2A 2UUBB 4YRHA 4JYCA 5THWA 4X3RA 3LNMB 1UFIA 1RTQA 4MCRA 3L72H 2C6GA 3ZRXA 4XDJA 1CBXA 3SYAA 5JCOC 2XTAA 2JS3A 1SQPH 1V55B 2YS8A 4UCVA 4MTXA 5JJNB 4JI3O 4FK5C 2BO9A 3JD0A 3PFOA 4DV5O 4ZIBA 3EHBB 3SYOA 3FB7C 3K5OA 5KTDA 4DV5B 4DYOA 1N36O 1TVKB 4I55A 1TAEA 2E76B 3JAWA 2BOBC 1EM1A 2CTCA 3ASOC 1KD1W 3H1KH 3QO7A 1DLBA 2QWOB 4UCRA 3DXRA 5G1ZA 1FFTB 2B9ZA 2QA4V 4DJLA 1IURA 3GKRA 4OKOA 1GYTA 3TO6A 4A31A 3D8CA 3OTOO 5JH9A 2GDSA 5DWNA 4CBCA 1NR7A 3KR5A 4PXDA 4JI0B 2C2AA 5EZYB 1VMGA 2QKSA 1L0LH 4CGLA 4LQ6A 3NE8A 1D5NA 2X6AA 5LRKA 4ZI7B 2POKA 3V7ZA 2IMOA 5LGUA 1ZG7A 4PK3A 4KOVA 1XJOA 1YJ9V 4JYWA 4LR3A 1IY7A 2PIYA 3E8HA 4MCSA 4P2ZA 3PN1A 2R8VA 2LW7A 2XEJA 1Y76A 3PBBA 4GXHA 2PJ7A 2GUZB 1PKXA 1Z5WA 1YEWA 2X6CA 3T90A 2IU3A 3RYCA 4H6UA 5BMVB 4FIPC 3K58A 2Z3MA 4KOTA 2ZEPA 5FVJA 3H9VA 4DRXA 1MG1A 4RQFA 3NH4A 2EIKB 4AB7A 4AVAA 1FYJA 4MVZA 3KHXA 1YTFD 3R1KA 4X20A 4YXWG 1YDXA 5HFMA 2QJ8A 3BCCH 1QR8A 1EFRG 1IZ3A 1PPJH 2EJ7A 4MSWC 2ZM6B 2P4KA 4Z2WA 1I12A 1PNMA 4HYOA 1PP9H 4DR2B 3H1HH 4QJFB 3NE7A 1QR9A 2ZE8A 1AJQA 1CM0A 4R76A 2GLJA 2AFSA 4DV1O 2Y0IA 1KU9A 3CC2V 1NTKH 2O4HA 3CPAA 1K92A 3CP1A 1S7KA 4KOUA 4EFDA 4F6RA 4UA3A 5B3SC 4GKKB 4E2AA 4BINA 5CA3A 4N23A 4GUNA 5EIBD 2HJDA 3K0DA 5B1AB 3FB3A 3G6EV 3ZHSA 2H3OA 4IGGA 4TNUA 4I50A 2IW5A 1U96A 5B1OA 1H8HG 4FD6A 2HVJC 5KA6A 2OIEA 3UY5A 2EINC 4JI6O 3BA9A 4U3FH 4CC5A 3HKBB 1QLEC 5GONB 4DYLA 4MBUA 3CCUV 2ZIOA 4JWPA 5HVFA 4F6RB 5CBMA 3IWWA 3JAMN 1AP5A 1M4LA 2Z3OA 4ZGYB 4MHDA 2DYRB 2PC1A 2RNBA 1H8EG 1IBKO 2D3OW 4J7ZA 3SDLA 2F66C 5L3GA 4B08A 3IC7A 4MVMA 4FM1A 1ARMA 1BMFG 3W6SA 4KXRA 2LGQA 3IJ4A 2P4VA 2WLNA 4P9OA 1H2NA 2WLHA 1LOKA 2AXTZ 3W7TA 3ETGA 2F8HA 4GKKO 3SJGA 5BR8O 1R57A 3D3SA 3G80A 2GANA 1B3QA 1COWG 4A38A 1X12A 3FIXA 1Q86W 1Z8WA 3ZN1A 4M3SA 2JIZG 4B7KA 2KB1A 1UJWB 1PD3A 2LW1A 1L1FA 4DR2O 1ZLHA 4P4FA 1IDSA 1B04A 5EBVA 1YLOA 1PNLA 1E1QG 4F6EA 3BI1A 3PP9A 2D2CB 4TQFA 5I4MA 4CS0B 1K4CC 3NH8A 1Q6IA 2ZR2A 2F23A 1JJOA 1N32O 1P0HA 1IX9A 3O65A 2PF4E 4UEEA 1Z4EA 3D2MA 1Q2CA 2O57A 4YU9A 4XPLA 5LRJA 3JATA 3FFQA 4II9A 4U7OA 3OTFA 3T1HO 1AJPA 2BTOA 3K3WA 2EX3A 1FD9A 3SPIA 4Q38A 4LF7B 3AG4C 4GX1A 4UEZA 3VQXA 2YXYA 2XAGA 1RFYA 2F93B 2WA3A 1ON0A 3D68A 4Q7AA 4O2AB 4TWKA 2G3AA 4J11A 5IYBO 4GM5A 1LFWA 2H5MA 5J2TB 2QWQB 3J80N 4AQYB 1BHAA 1N71A 2FTKA 2ZQMA 3CE2A 5LYIA 4DK1A 3RFRA 4LF9O 2EZPA 1S3JA 3OWCA 1ZG9A 4D7SA 3SJFA 3RBZA 4TT3G 2D4PA 1HEEA 3L74H 1N36B 1FAFA 4A95A 2OCHA 2XAHA 3DC5A 3B3VA 2EO8A 4NGTA 3GWKC 4A2ZA 2VZZA 4H33A 1NZ6A 2I00A 2QM7A 5F48A 3DC6A 4PV6A 3DNSA 4X1IA 4UCUA 4WWVA 4LH6A 1XNRO 1NBMG 4LFCB 4JYYA 4XPKA 4JTAB 2Z10A 4GZRB 2ZXWC 4XBFA 2B4BA 1DTDA 2IQ6A 4NXMB 3GY9A 2CNSA 2RC4A 3AG3B 2G3TA 1XMOO 2VQEO 1NSAA 4CPAA 3ASNC 4LWSA 3RYFA 2P06A 3ETEA 3ZRWA 5B1NA 3E22A 4MW3A 1R6KA 4N21A 5EBLC 4NJQA 1NTZH 2NNUA 1SF9A 1YITV 4X66O 1XMQO 3WABA 4PSXA 4OX9O 5JJEB 2CNTA 2OIGA 1M4UA 3NH5A 2Q7EA 1BAVA 4X1IB 4K30A 3WG7C 4OLLA 3DR8A 1BL8A 1EZJA 3JASB 3D7HA 4CS2A 3MGDA 4LUAA 3WB2A 4MS2A 3L2NA 4A5UB 3LDEA 1A32A 1VF6C 3FX7A 2OCCB 5AG2A 3ZZIA 1F23A 4CRZB 4P4IA 4UCPA 3X2QC 4RWUA 5EC2C 4J9YB 3HKCB 1H2LA 3IU2A 1Y76B 1KUYA 4NXYA 3I9SA 1Y66A 3CXQA 1KKCA 2W0FC 4RUEA 5IYCO 4UV9A 2JBKA 2WA4A 3OM3B 2OU2A 1CP9A 1WP8A 3ZHQA 4JI4B 4G1PA 4CZZA 2R1IA 2ZDIA 4PDMA 1GO3F 3IO1A 1QNMA 2IH1C 2ZNJA 4AI8A 3ZS8C 2GU2A 5DS0A 1DE4C 4X1YB 1F7YA 2PVVA 3P2HA 1EE3P 2FIAA 4CH4A 1S5LZ 3N2GA 4KP4A 3BJ8A 4O4IA 3HKCA 2PJ4A 3DGVA 3QAYA 4DR7B 4TV9B 3FF3A 2J8MA 1R6TA 2ZEFA 1ZO0A 1V54C 2WLIA 3OGIB 4E8OA 1NVPB 4UFVA 2W6IG 5B5EZ 3FAVA 4RO2A 2Q0OC 1K9MW 5LYJB 4JTDB 1GTOA 3EXAA 3KQXA 1VGYA 4TV8A 4DV2B 1G8MA 1VHEA 3BFRA 3IFXA 4IYHA 2ZW6A 2JEWA 4FM0A 4JI4O 3A9LA 2V8HA 3TOAA 3N2GB 2Q0AA 4J7JA 1H2SB 3SJCC 2JEVA 2HR3A 2I3CA 5FNVA 3SR2C 4IYIA 3SPJA 1XOVA 4NGMA 3QF7A 4LNUB 1JPXA 1N34O 1SQQH 2YNDA 1XL4A 4NF1A 1K33A 1WN7A 1BOBA 1QSMA 2QKCA 3RT3C 2B4DB 4X9QA 3SPGA 1ZSPA 1L8DA 1K4DC 4UCSA 3CXSA 3AEIA 3E8BA 3PEIA 3JD1A 1QQCA 1QVGU 1S72V 1Q5OA 4P9PA 2OTJV 4LCUC 5HH1A 3QB8A 1CPSA 2ATKC 2ZDIC 4NKGB 2AGAA 4JI5O 1QU7A 1XREA 4PSWA 1Z9UA 4WBNA 4R8CA 1XNRB 1X59A 2OCCC 2DPSA 1YIJV 3P2FA 4FWUA 3JARB 5K1PA 3D67A 2KSDA 2DOSA 5KHJA 1Q7LA 4MFZA 2PVWA 3RAMA 1VARA 5H9CA 5LL6Y 4FPPA 5BXZA 5J1QA 4L89A 4F0YA 3SJQC 4DV0B 3MN8A 4RUFA 4UUJC 2ZEOA 3RO0A 4PDLA 1YJNV 1XMOB 4MTOA 1SKVA 1XHXA 2EWBA 1DF5A 4ZX8A 4UFWA 4DR4B 5JQ4A 5FPRA 2QMLA 3DSQA 3Q4HA 3I1UA 1K97A 3CDXA 4LFCO 4MHPA 1CXZB 4F9VA 4R9MA 4I49A 4EMEA 4I0XB 4X65O 4FFBB 4R6ZA 2UXBB 4PK2A 4MVQA 1YCIA 1SC5B 4HPSA 2IH3C 2WLLB 3CPXA 3EXNA 5IY5C 3W7UA 4DV7O 4B3TO 4MTFA 2XEIA 1XILA 2PR1A 5EBWC 1SA0B 2OZGA 4J10A 5EYPB 3CRCA 3A0HZ 1OZPA 1OV9A 2PDOA 3CCSV 2WZNA 1LUVA 1SZXA 3KI9A 3R65A 3LMSA 5LA6A 2ZEDA 4B3SB 3FEDA 3AK3A 2R9AA 3LDDA 4UCTA 1BQZA 2Q43A 2C6CA 2RB7A 2A4NA 2QM8A 3PB8X 2CTPA 4QE7A 4PA4A 3PB9X 1F4MA 1S7FA 1U6MA 1LAPA 2DPTA 1Y74A 3G8WA 4EB6A 4P4DA 3AG7A 4K8XA 5HVGA 5J2TA 3CXCU 2J8RA 5JVDB 4UF4A 2PYJA 4CGPA 1AR5A 3JD3A 4KLWA 4DV6B 4NJRA 3W6XA 1XNQB 4B5PB 4QBJA 2C1CA 5JQGB 4PA3A 4PJ0Z 1Z8TA 1H2KA 2DF5A 3OT7A 3FD9A 2ARHA 1RO5A 4F0XA 3T1HB 3SI2A 1W59A 4HZ3A 4TQDA 4DR6B 2G0BA 1PUAA 5IYZB 1VQNV 4DR4O 5DM6V 1YF2A 3E22B 2ZW7A 5K1XA 1VF7A 4DNCA 2YSUB 2H8PC 1Y7RA 4RAIA 3W91A 4BW5A 3PZJA 4CYQA 3GVMA 4MT8A 2UXBO 1BS3A 1K5QA 4FD7A 3T8WA 3DLJA 3ML0A 3IGRA 4JAUA 4LWSB 1GHEA 1YLEA 3SHPA 5DECA 2ZNIA 4KOXA 4BIZA 5IWAO 4O4JA 5LRGA 4IF5A 3AG4B 5BR8B 1ZLIA 3S6KA 3JAKB 3VQVA 1AYEA 4A94A 2IU0A 5FLXN 3PB7X 4OC1A 2FE7A 5EC1C 3DR6A 4TWEA 3K03A 2CF4A 2REFA 2PIZA 2YNEA 3M99B 4OAEA 3FXTA 3JASA 2ETNA 4MRIA 2DEAA 2C6PA 1S77D 1QSTA 1B87A 3W7XA 2CGOA 1JOYA 3HR0A 5KA5A 1PU9A 2C27A 5GCNA 4Q36A 4JZGA 2VWJA 4DV4O 1VQOV 1YREA 1CX8A 3K9AA 1ZL8B 2B1IA 4FVMA 4HKFA 1TF8A 5D5QA 4NFRA 3JAKA 2AHYA 2LGWA 1CJWA 2HG5C 3A0BZ 3ABLB 3CT9A 4NTYA 1A2ZA 4LX9A 1N4CA 3TETA 1KECA 1I08A 1YQEA 2WWWA 4IIJA 1HNZO 4X64B 5CA1A 4LF4O 4MFLA 4CH5A 1TIQA 3PFEA 5D29A 4AVCA 4UWIA 2P22C 3FAVB 3ASNB 4J7KA 1VHSA 4MY3A 3F5WC 3QTCA 2DN9A 4X1YA 1R6NA 1ZL8A 2PYLA 1ROPA 1WP7A 1HNXB 1HDUA 1J5EO 3G67A 4JZ2A 5KMGA 1AROP 3ZX6A 3PJSK 2W6JG 4KSIA 2EIJC 2ZKOA 5AG5A 1OCCC 1RPOA 3FB8C 2YXLA 1N0JA 4PI2A 4E4EA 4O2BA 4DR7O 3L70H 3RGBA 2X7RB 2PY5A 4W4KA 1FJGO 4CAVA 1QSOA 1F51A 1ZX3A 4LF8B 4OC0A 2V8DA 3K5LA 1ELMP 3OR6C 4PXEA 3U11A 3B4SA 1K5SA 5F46A 3L75H 3ABKC 4JI1B 4ASUG 5C93A 4JI7O 4FD5A 2QYVA 1XRYA 4C2XA 2QECA 1OCOB 3SPHA 2Q4PA 3U0ZA 4UB8Z 5IT9N 2BTQA 5B1BB 1AI5A 3RYHB 4CS3A 5H2FZ 1TGOA 2R9RB 3RN4A 3D7GA 3NA6A 4HNAB 4WBNB 4OIWA 2OT5A 3JATB 3ZN0A 4KLVA 5JWPA 3FYEB 3IEHA 5BY1A 1FFXB 2KG7A 3TJTA 4OPAA 4RS2A 3QNVA 1SQGA 4ZYQA 2VQFO 4ZY1A 4DO2A 2A9HA 2FXFA 2VWKA 1V55C 4UIBA 3S9NA 4FUUA 4FJCC 3E0KA 5CBHA 2XNDG 3CMEV 2M7WA 5KAIZ 2VL1A 2JVDA 2GBOA 3P3PA 1AUGA 4FLWA 1V54B 4LF6O 2DYSC 2RN9A 2F4VB 3UCSC 4PXBA 4KVXA 2OOTA 3ASOB 3CHXA 1GMGA 4FFBA 4NXMO 3D36A 2AW9A 4KL1A 2WUUA 2ZPAA 3B35A 4OC5A 4YHHB 4X66B 4NGSA 5E1AC 1IBMB 2YIAA 1P84F 3L9DA 1IYKA 2WAMA 5LYDA 3RVYA 4UVCA 1M1KW 4P4EA 2NLJC 1BO4A 4EFBA 4X89A 1LAMA 2WPDG 2YICA 3ZHUA 5IJ9A 4QGPA 5DEDA 1NH2D 3FVLA 3RNZA 3CRRA 3MAQA 1N33O 1SETA 4DV0O 4C7HA 2GSMB 2IBZH 2A06H 5EBMC 5TISZ 1CPYA 2CNMA 2NR5A 2GUZA 1VQ8V 3IC1A 4F8ZA 3VOUA 4WF9V 2A3QA 3GYAA 3N27A 4X2TA 2PTMA 1KQSU 5LP6B 2UXDO 3SYPA 1J4JA 2HC9A 1QLEB 2HHHO 3ZHVA 5FL7G 2A0LA 1YZBA 5GTHZ 4JI3B 4K8ZA 4R7MA 3WC6A 2IJHA 2QSAA 1IICA 4BR6A 4L8AA 4LF9B 3JTKA 4YFJA 2E74B 2HJFC 1S60A 1HWYA 1HP8A 3TCUA 1GH6A 3IU1A 5JQGA 1K4JA 3L71H 3I56V 4ZKIA 1WB8A 3TO9A 2E5LO 3C3TA 3CPWU 1Y6XA 4X1KB 1CG2A 1NS1A 1R43A 2Z3NA 2YI9A 2BEIA 4DR3B 4LP8A 1KBHA 4JAVA 3B8GA 3H1JH 1TXRA 3KR4A 3G3SA 1G1XB 2XAJA 4X8AA 1YVOA 1N0NA 1VQKV 2YIBD 3IGAC 1HR0O 1AMPA 1MJBA 1YK3A 2V8GA 2FKXA 1Q90D 3ZIAG 1R3JC 3R96A 3AK2A 4GYCB 2N74A 1VHOA 1YR0A 4PV1B 3F8KA 2BOCC 3OAAG 5IY5B 3TC8A 3TTHA 1Q82W 5HXDA 3K9SA 4YIOA 2CTQA 1WNSA 3K06A 3ZJZA 3U10A 1J5EB 1YW4A 3D7FA 4LFBB 2CY2A 5B66Z 4DUYO 1IU8A 2RDCA 1BGYH 5B3SB 2DWDC 4ZOLB 1VIXA 5GONA 1OJHA 2AHZA 2QIRA 2BSWA 3C3SA 4M85A 2OTLV 4O4IB 1LR1A 4BMHA 3CEIA 5CMUA 4U9YA 3GWOA 1DTOA 1ENVA 4JYAO 4KUBA 2ZD9A 2Q44A 4MI4A 1OCZB 3D66A 1AR4A 1ZLZA 3P30A 3EO4A 3GB0A 5J8FA 1IBKB 1I1DA 1XE4A 2O28A 1Y67A 2PJBA 3K08A 1BCCH 3CCQV 4KUMA 5LMUB 3TO7A 5EC4A 4XDLA 1IYLA 1OCRC 2ZE6A 3MHHC 4ZOLA 5A9GA 2PJ9A 3KL9A 4X64O 1XI1A 1B6BA 1F2PA 4UCMA 4QC6A 3LD2A 1HNWB 3ETDA 2JS5A 3JUWA 4MFJA 2Y0MA 5FNVB 2IM9A 3P32A 3GB7C 3RW0A 3J81N 4ZBMA 3JCUZ 1LUWA 3K5NA 2ANPA 1RSOB 1SS3A 4JTCB 5IE9A 3T4DA 3HB3B 3FB6C 2M6YA 2OH1A 8CPAA 4KVME 2CXAA 4O23A 4YJ3B 1HNZB 3T9YA 3SJAC 5ITZB 3LSUA 4CC6A 3KG2A 5A28A 1PM9A 1AI4A 3BVOA 5LGNA 3J7AU 2ODFA 2V1DA 1VQPV 3FNCA 1MNGA 4K3NA 4IHJA 4LBEC 3UQ8A 2Q68A 1BQ0A 2X7BA 4P10A 4GKJO 1SZTA 4L8JA 2ZXWB 2B58A 4CGMA 3LUTB 1FNOA 4R87A 3I3GA 3S9LA 3LNNA 3CXPA 4B11A 5E79Z 4JI8O 1WB7A 4UXNA 4DR6O 2ZT9B 4DUYB 2EIKC 1ZUQA 3KASA 4U9ZA 3HKDA 3FRMA 3IC9A 2AFZA 5LMNO 2XASA 3CB2A 1Q2YA 2JGDA 2ILMA 3LWUA 1HDQA 2YNCC 4H2KA 4DUZB 1K73W 4NR1A 1D5AA 4DK0A 2WLLA 2O53A 4R7CA 3WT4A 3TT2A 1Y4MA 4Q6GA 3UT5A 2BSKA 4B7EA 1M4GA 1P4NA 1R73A 4O2AA 1FY7A 2GTSA 3ABLC 5H86A 5JCOA 3Q4HB 2FT0A 2YC0A 4Y49C 5H84A 4UVAA 4DV6O 4DV7B 3N7ZA 4AXVA 3JCZA 1P7BA 5CN0A 5LYFA 2DYSB 1M93A 1YMEA 4HNAA 2XEFA 4IAVA 3ISXA 1XEQA 3AG2C 4GX0A 3UM7A 3R9GA 3CRAA 1F57A 1R3NA 4XPDC 1SERA 3G4SV 2YGWA 1S5KA 4FLTA 2L35A 4OXSA 3OTOB 3F7VC 3ZCCA 3PB4X 4MFPA 1RXTA 1GN6A 5F09A 3QO8A 4NCZA 1BZKA 4Y49B 2P90A 3R9FA 1TKHA 2A79B 1PCAA 2PRBA 3B40A 2EIJB 2FL4A 2AFWA 1MJAA 2ATRA 4MCQA 4A39A 3CSXA 4JI0O 2Q51A 2QR4A 1TVKA 2QGNA 3WB0A 2P6GA 3TXQA 4DUZO 4KHPO 1Y74B 4LFAB 1THZA 3H1IH 3QG5A 2DMXA 3KZIZ 1D2DA 5LMNB 4CYPA 5E96A 2BL1A 1O9HA 5KUKA 2Q7BA 3OEEG 5KHHA 5LP6A 1NE9A 1Q81W 4RUHA 3LACA 2J8NA 2JEXA 3T1YB 5H6RA 4EFEA 1F2OA 5BWAB 4PDRA 4R3KA 3SJBC 5G22A 1YW6A 4YHHO 2BCCH 2UUBO 1H8LA 2GLFA 4QVTA 3HKEA 2QWNB 2CTBA 4JI2O 4KSFA 5L3BA 2H94A 2ZELA 4R50A 3T1CA 4C2ZA 2DWEC 4DV3O 2CE4A 1CEZA 3UO2A 1L0CA 3X2QB 4X65B 4U3JB 1S7NA 4NGNA 3IFEA 3FJUA 4BWAA 1JX9A 2Y4UA 4M6HA 1KP2A 4B3MB 2VQFB 4KZTA 2FB5A 1SQBH 2ADPA 1JA8A 4MCPA 1JFFB 4QIWF 2FSRA 4KORA 4FD4A 4JF3A 1GM9A 2CTRA 4YY3B 2ZEHA 4O4JB 1IOIA 1GM8A 4NXNO 1Q7YW 1VQ5V 1TUBB 3ZMVA 3K59A 1QQ9A 2B5GA 2Z5UA 3ABMC 5LYJA 2WSAA 4TSFG 3CWBH 1P4RA 7CPAA 1HNWO 1QMUA 1Y0YA 2UUAO 3E2EA 1VQ7V 4B12A 3IIBA 1S3ZA 1Z5VA 3SI1A 3C90A 4X20B 3NFZA 3JYCA 1FJGB 5LMUO 4DR1O 3TXSA 4U7NA 3M7MX 3WFVA 5L3EA 1VQ4V 3OE7G 2V4DA 4J41A 2PUSA 1XFOA 2Q9LA 3S3WA 4DV2O 2YIDA 2RCVA 3D3QA 3D3IA 4MFQA 1EN5A 2Z0AA 4CAXA 1URFA 1W0JG 1M4DA 1PNKA 2BE3A 5LP6C 3C26A 4OMEA 2L6LA 1YSCA 2QEXV 3F5TA 5HFLA 2CGNA 2EK8A 2UUAB 4J42A 1US6A 3PBEA 2ZW4A 4IIJB 2K5TA 1GRJA 2R70A 2ZXVA 3VBBA 5CA1B 2AFUA 3GLJA 1HR0B 5IV0A 1TF9A 4O4LA 2IJKA 2P67A 2RMKB 2AZ0A 3BHPA 2IL4A 1IOFA 4NGQA 4FLUA 1FKAO 4KOWA 4LF4B 3G71V 4JXQA 2XAQA 4NSQA 2CH7B 4QB9A 1EN4A 1RSOA 4ZBGA 4PPZA 1K8AW 1VF5B 3AG1C 3OR7C 3EFAA 4PXCA 3ZHRA 1NMTA 2VI7A 4YJ3A 5HMNA 4DR1B 3K9TA 2Q7HA 2YUAA 5JM6A 1KYOF 3N2KB 3TE4A 1ARLA 3D2PA 4DV3B 1EZVH 1G6UA 3LSQA 4UVBA 4DV4B 2E75B 2EJRA 2FS5A 1NJIW 5IB0A 3S9MA 4O4LB 2ZEGA 3BHXA 1DGSA 3B3SA 2BTQB 3B2YA 4LQGA 4R57A 1QVFU 5AGEA 1IBLB 3CZXA 1PL0A 4HAMA 4TOIA 2CH7A 1WA8B 3VARA 3MD0A 5IJ0A 5ITZA 1V0CA 3BJ7A 2LO1A 3KGQA 4ONWA 3DTUB 3TOBA 3T1YO 2R9IA 2NSMA 2PJ1A 1VEWA 2VQYA 1KMIZ 2JDDA 3E35A 3A0RA 4P45A 2VEZA 4CAWA 1KUVA 3CXHF 4I9WA 4UIAA 4IK2A 1QLNA 1JQ0A 2E3CA 4DXWA 4KHPB 2Q4YA 3OFNG 2UXDB 1Z2GA 3OMIB 2PJ8A 1OCZC 3LODA 2KQXA 3K2KA 3WC7A 4WFBV 5EK0A 2DJVA 3ABMB 4KUAA 2ZENA 2ZEMA 2Q73A 1M56B 1N33B 4PHZA 4OC2A 4R6TA 3V8IA 2FYUH 4I4TB 5EYPA 3CRQA 2X0LA 3V38A 2BSKB 1S5JA 3CD6V 2PGGA 2EUIA 3N5FA 3B7IA 3HKDB 2OZUA 2Y48A 4LF6B 2BCOA 5DWMA 3R66A 4UBRA 5LA6B 2UUCO 4MVSA 2XHBA 4P44A 4XNHC 1HW7A 2OWOA 1WAZA 4A32A 2QM4A 4G27B 3BA8A 1S7LA 1IXBA 1G4YB 4LFAO 3WC5A 3H01A 5LGTA 3FH4A 5K8PA 1Z5RA 2ZINA 2PCUA 1LRZA 4CYOA 1AB3A 5EIBC 3QO5A 3KKYA 2V8VA 2DYRC 2Q8VA 3BABA 4LH7A 1XEBA 4B13A 3WG7B 3CMAV 3B3CA 1YI2V 1AI6A 2XT9A 4BBHA 4MMOA 5EZYA 2F7VA 4PA6A 4JI1O 3RBUA 1M44A 1AP6A 2UXCO 4NYKA 2OYQA 1Z2LA 4ZY2A 4I9QA 4PQAA 3K9UA 4OC3A 2HVKC 3SYCA 1YX0A 1FT7A 1NI8A 3TCVA 5IYZA 2AE6A 2Q0YA 2Q5ZA 3AG1B 3ZHTA 4UWJA 5LYLA 6CPAA 3LSSA 4AQYO 1JJ2U 2Q69A 1WLEA 1OBRA 1KWMA 3E8FA 4F4LA 1FPOA 5H5NA 4H0LB 3JD2A 4ONUA 3H8EA 3H1LH 1TUEB 5KX5B 5AG6A 5CNPA 4LF7O 3K0GA 3SGIA 1QBZA 2DQ0A 3A2FA 4LF8O 1VKCA 3F5BA 4ZY0A 4JASA 2ZE7A 2PQ8A 5LXTA 5CA0A 4UV8A 1VP7A 3RYFB 4FFKA 3QNEA 4FLYA 2YNCA 2W0XA 1Y0RA 3ZMZA 3ETQA 4DRXB 4H37A 2J9AA 1VQ6V 1N32B 1RM1C 4F6AA 2KKWA 2CK3G 1EBOA 2CUGA 4JI6B 2JDCA 2YI8A 4NGRA 2WLJA 3RYCB 3P3NA 5GW7A 4RI1A 4Z1MG 1MJ9A 4HNYB 3SPCA 2CIJA 3WU2Z 1MABG 4JI5B 5F49A 5G21A 1IXMA 4EKWA 4EVYA 1Q8IA 1VQMV 4DR5O 4MVRA 2PJCA 1AVMA 4XDKA 4YJ2B 3SXNA 1GK9A 4BIOA 3TFYA 1CP6A 1JFFA 4GKJB 5LOVA 5CPAA 1KKDA 3FEEA 4M6GA 3CCMV 1H2GA 2RQ6A 1PYTB 2MW2B 1I5YA 3I5DA 4H89A 3APQA 2Z3YA 3PGPA 3TGUH 3RYIB 3THOA 1GN3A 1AI7A 5J9PC 5L3FA 4CH3A 1Z8LA 4OP4A 1S5HC 4EEQA 3R95A 4B6ZA 1KUQA 5GTIZ 3JRUA 1BPNA 4J3GA 3M8AA 1Q43A 2FCKA 1IIDA 1F4NA 5IWAB 2B3UA 3I55V 2WYRA 3GIUA 4OC4A 1MA1A 3RWRD 1Q3EA 4R8FA 2OR4A 1M57B 5LOVB 2ITCC 4JAAA 5F47A 3DDDA 1QHTA 1GKFA 3HPLC 3CYOA 4KOSA 1CP7A 1GN4A 4O2BB 4IHJB 2HUZA 2WLIB 3AG3C 3ZRVA 3DGEA 2FIWA 4NGPA 4C7IA 3UO3A 1NVPD 1M90W 3T2MA 3ICXA 2AFOA 3B8MA 5KUMA 1I94B 4P6YA 3CS5A 3HKBA 4KFMA 2ABZA 2Q7GA 2DQ3A 3OD4A 3R9EA 1X10A 1IGBA 4AG7A 4DW0A 3GUXA 5CBGA 1DF4A 2ZM6O 4FZ1A 2GIVA 4ZX9A 2LQTA 3BXMA 1MZFA 1XNQO 1CPXA 4Z1VA 3RZAA 3CCLV 4FLXA 2GREA 4FMTA 1M9NA 4I5SA 3JD4A 4Z65A 1HDJA 4DV1B 1TA8A 2P5OA 3STLC 2Z3PA 2CDYA 4LNUA 4FBEA 1M5IA 4GCZA 3T4ZA 2D4OA 4JZ0A 2X6BA 4UFXA 3BRCA 2N04A 3OMNB 2Q04A 4B3RO 2LJ2A 1U97A 3B09A 1Z8XA 5KTAA 4H44B 1TKJA 3E8GA 2JBJA 1QCEA 4ICGA 1YHQV 5IDJA 1VF6A 4MVUA 1ZG8A 3VATA 2RFHA 2NYQA 5KHKA 5C8YB 3BI0A 1O9GA 2NN4A 1WA8A 3DSBA 3BLNA 4B3TB 2Z0ZA 5IX3A 4C2YA 1B06A 1Z4RA 2HB6A 5BZBA 4OX9B 2QTSA 2Y69C 4JGSA 2AFMA 3NR7A 3WB1A 1W2BU 3ZRSA 3TX8A 1RP3B 2PJAA 5JVDA 1FXKB 4NTXA 1S76D 2ZOFA 2F43G 3H4QA 2EILC 1MMMA 4OADA 2GTAA 4OGQB 3BAAA 1VQLV 3SJEA 2WSSG 4GX5A 4RQEA 2RJZA 4IL6Z 4BAYA 4RN7A 3SXOA 4Q20A 1NTMH 2PZSA 4FZ0A 4I0XA 4M6IA 4XNHB 1XF8A 3JVNA 3B3WA 3NXSA 4MTGA 2DW4A 4EWTA 3FKSG 1I21A 4QPKA 3FBUA 1LNQA 1FS0G 3CX5F 2Y69B 1DK1A 1I0HA 1SQFA 1V9PA 2UUCB 2PSWA 1MK4A 1JCHA 4K35A 1IBMO 2P6EA 1Q6UA 1M57C 2AZ2A 3HLPA 3EY5A 4B14A 1FXKA 4UCNA 2BOAA 5K8MA 5JJJB 4WJBA 4AILC 4ABMA 1SRYA 4CH6A 1K34A 1OCCB 5KHIA 4FLZA 1L0NH 4ZI7A 1UPGA 4MVOA 2EBJA 4HBNA 3OUSA 4DUKA 5BMVA 2ADQB 3OEHG 4PD4F 1XUQA 4B3RB 2F1MA 5C82A 3ZRWB 4BD9A 1EN6A 3H5ZA 3E89A 2JEUA 3CCJV 3B2EE 4L87A 4FM2A 4CRYB 5JH7B 2F4VO 1NSLA 3KCXA 4LF5O 4W9YA 4OIDA 4IHMA 3VWDA 1OCOC 3D7DA 1B6QA 4O4HA 4BW9A 3G6BA 1YJWV 3SYQA 2Z3KA 1YVWA 2HEPA 3CJHA 3FB5C 5LHIA 4KS9A 2BUEA 1MZEA 2EVNA 4J9ZB 2FMLA 2IJJA 1IBLO 4BIUA 3F7YC 2Z3LA 4HNWB 2EIMC 2GHYA 4U3JA 3CRMA 1BLLE 1LCPA 4UEFA 5D5PA 1TUBA 4P4BA
chains in the Genus database with same CATH topology
4MFKA 2FE7A 3DR6A 3NE7A 2REFA 1CM0A 2YNEA 3D8PA 4OAEA 3FXTA 2B5GA 2WPXA 2WSAA 1QSTA 4KOUA 1S7KA 1B87A 1PU9A 4UA3A 2C27A 4IUSA 5GCNA 4E2AA 4B12A 4Q36A 1S3ZA 1YREA 2VBQA 1KUXA 4HKFA 3FB3A 1CJWA 4MJ8A 4H6ZA 4HNXB 2F5IA 4FD6A 4LX9A 4MY0A 4MFQA 3UY5A 4CAXA 1M4DA 3C26A 5AG7A 2HV2A 4MFLA 1TIQA 3F0AA 4MBUA 5J8CA 1KZFA 2R7HA 4JWPA 1SQHA 4AVCA 4UWIA 2ZW4A 4MY3A 2K5TA 1VHSA 4NEXA 2Z3OA 2ZXVA 4ZGYB 4MHDA 2PC1A 2JLMA 4XPDB 5IV0A 2IL4A 3S6HA 4CYNA 3W6SA 1Y9KA 4KOWA 4JXQA 1Q2DA 4NSQA 4QB9A 5KTCA 4ZBGA 1R57A 5AG5A 2I79A 3D3SA 2GANA 4B5OA 3EFAA 1NMTA 2VI7A 5HMNA 5AG4A 3FIXA 5A27A 2OZHA 3FYNA 4M3SA 5ISVA 4CAVA 1QSOA 3TE4A 3D2PA 2NMTA 2FS5A 4JD6A 5EBVA 5F46A 5IB0A 4R57A 5AGEA 4FD5A 4C2XA 2QECA 2R98A 3PP9A 3BJ7A 1V0CA 3TOBA 4CS0B 2VQYA 2JDDA 4KLVA 1P0HA 2VEZA 4CAWA 1KUVA 1Z4EA 3D2MA 1Q2CA 4RS2A 2Q4YA 2FXFA 4QUSA 4XPLA 3LODA 2PR8A 3E0KA 4II9A 3S6FA 4C68A 3EC4A 4KUAA 4Q38A 2OB0A 3V8IA 4A30A 1ON0A 4KVXA 2EUIA 2G3AA 2OZUA 2WUUA 2ZPAA 2H5MA 5DWMA 4JLYA 4UBRA 1N71A 2B3VA 2REEA 1IYKA 2DXQA 1YGHA 4XNHC 3OWCA 4A33A 2D4PA 4A32A 4E0AA 1BO4A 1S7LA 4A95A 2Z11A 1YVKA 4JJXA 4A2ZA 2VZZA 1LRZA 4CYOA 4C7HA 2AJ6A 2I00A 5F48A 3KKWA 4JXRA 2CNMA 4PV6A 2KCWA 4U5YA 2HQYA 3DNSA 3ZJ0A 3S6GA 3GYAA 1XEBA 4B13A 4XPKA 2Z10A 2B4BA 4BBHA 1J4JA 3GY9A 2CNSA 1M44A 2RC4A 2G3TA 3K9UA 4AVBA 1YX0A 1IICA 3TCVA 2AE6A 4L8AA 2Q0YA 4X5KA 3JTKA 4UWJA 4YFJA 1S60A 4B5PA 3IU1A 1K4JA 3TO9A 4PSXA 2CNTA 4ONUA 4K30A 2Z3NA 2BEIA 4OLLA 3DR8A 3B8GA 4KSAA 5AG6A 3MGDA 4LUAA 5CNPA 1VKCA 1IB1E 3G3SA 3F5BA 4YGOA 2PQ8A 1YVOA 3ZZIA 4B10A 1MJBA 4CRZB 2YNCA 1YK3A 4UCPA 3R96A 3QAHA 1WWZA 3IU2A 2B5GB 1YR0A 1KUYA 3F8KA 4NXYA 3TTHA 3I9SA 4F6AA 3CXQA 2JDCA 1M1DA 2OU2A 4RI1A 2CY2A 2R1IA 1MJ9A 4HNYB 4ORFA 2P6FA 2VXKA 5F49A 5G21A 4CAEA 4EVYA 2QIRA 2ZW5A 2BSWA 4GS4A 4M85A 5JPHA 3SXNA 4BMHA 1Y9WA 4U9YA 3P2HA 3TFYA 4KUBA 2FIAA 2Q44A 4MI4A 3BJ8A 3EO4A 4KVOE 1XIXA 5J8FA 2J8MA 1WK4A 1I1DA 1XE4A 2O28A 4H89A 1ZO0A 2GE3A 3PGPA 4CGNA 3TO7A 5EC4A 4E8OA 1IYLA 4UFVA 5I0CA 1B6BA 2WPWA 4UCMA 3R95A 4QC6A 1XMTA 3LD2A 4J3GA 2FCKA 4KOYA 1IIDA 4AG9A 2Q4VA 5C88A 3JUWA 2B3UA 4MFJA 2Y0MA 2ZW6A 3A9LA 3TOAA 3IWGA 5F47A 3DDDA 2JEVA 2OH1A 4KOSA 4KVME 2B4DA 2CXAA 3T9YA 2HUZA 2FIWA 2YNDA 5A28A 4NF1A 2P0WA 4C7IA 3FNCA 1BOBA 1QSMA 2B4DB 3RYOA 5G20A 2X7BA 3CXSA 2B58A 1UFHA 4CGMA 3R9EA 4AG7A 4R87A 2GIVA 3WR7A 3I3GA 1QSRA 3CXPA 2VZYA 5HH1A 3QB8A 1QSNA 4B11A 3IWEA 4CGOA 1M4IA 4PSWA 1Z9UA 2Z3PA 2DPSA 3P2FA 4CAFA 4MFZA 4U9ZA 3FRMA 4L89A 4F0YA 2D4OA 3VWEA 4UFXA 4R3LA 1Q2YA 2Q04A 5JQ4A 4UFWA 2YNCC 4YRHA 2QMLA 5KTAA 3TT2A 4R9MA 4I49A 1M4GA 1P4NA 1FY7A 5H86A 4PK2A 2FT0A 4Y49C 5H84A 3DSBA 3EXNA 3BLNA 2Z0ZA 5IX3A 4C2YA 1Z4RA 5KTDA 3N7ZA 2PR1A 2OZGA 3H4QA 4OADA 3R9GA 1OZPA 2PDOA 4XPDC 5G1ZA 2YGWA 1S5KA 3SXOA 3GKRA 4MFPA 1RXTA 4XNHB 3TO6A 4A31A 1XF8A 3JVNA 2A4NA 4NCZA 5DWNA 4Y49B 3R9FA 1I21A 3FBUA 1S7FA 1U6MA 2PRBA 2FL4A 2DPTA 1MJAA 2ATRA 4CGLA 3G8WA 2PSWA 1MK4A 2P6EA 2P6GA 4B14A 2J8RA 3EY5A 4UCNA 4CGPA 4KLWA 4PK3A 4KOVA 3W6XA 4CYPA 5E96A 2BL1A 4B5PB 4QBJA 2Q7BA 1NE9A 2J8NA 1RO5A 2ARHA 4F0XA 5BWAB 4R3KA 5G22A 2R8VA 2G0BA 5C82A 1PUAA 4QVTA 3H5ZA 2ZW7A 3T90A 4CRYB 4KSFA 4H6UA 1NSLA 4DNCA 1Y7RA 2Z3MA 4KOTA 3W91A 4C2ZA 3PZJA 4CYQA 1L0CA 3VWDA 5FVJA 2Z3KA 1S7NA 4FD7A 4KS9A 2BUEA 3IGRA 2EVNA 4AB7A 4AVAA 1GHEA 1YLEA 3SHPA 4KZTA 4KOXA 2Z3LA 3R1KA 4HNWB 4IF5A 3S6KA 2FSRA 4KORA 4FD4A 1I12A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FE7 A;  3DR6 A;  3NE7 A;  2REF A;  1CM0 A;  3D8P A;  4OAE A;  3FXT A;  2B5G A;  2WPX A;  1QST A;  4KOU A;  1S7K A;  1B87 A;  1PU9 A;  4UA3 A;  2C27 A;  4IUS A;  5GCN A;  4E2A A;  1S3Z A;  1YRE A;  2VBQ A;  1KUX A;  4HKF A;  3FB3 A;  1CJW A;  4MJ8 A;  4H6Z A;  4HNX B;  2F5I A;  4FD6 A;  4LX9 A;  4MY0 A;  3UY5 A;  4CAX A;  1M4D A;  3C26 A;  2HV2 A;  1TIQ A;  3F0A A;  4MBU A;  5J8C A;  1KZF A;  2R7H A;  4JWP A;  1SQH A;  4AVC A;  4UWI A;  2ZW4 A;  4MY3 A;  2K5T A;  1VHS A;  4NEX A;  2ZXV A;  4MHD A;  2PC1 A;  2JLM A;  4XPD B;  5IV0 A;  2IL4 A;  3S6H A;  3W6S A;  1Y9K A;  4KOW A;  4JXQ A;  1Q2D A;  4NSQ A;  4QB9 A;  5KTC A;  4ZBG A;  1R57 A;  2I79 A;  3D3S A;  2GAN A;  4B5O A;  3EFA A;  1NMT A;  2VI7 A;  5HMN A;  3FIX A;  2OZH A;  3FYN A;  4M3S A;  5ISV A;  4CAV A;  1QSO A;  3TE4 A;  3D2P A;  2NMT A;  2FS5 A;  4JD6 A;  5EBV A;  5F46 A;  5IB0 A;  4R57 A;  4FD5 A;  2QEC A;  2R98 A;  3PP9 A;  3BJ7 A;  1V0C A;  3TOB A;  4CS0 B;  2VQY A;  2JDD A;  4KLV A;  1P0H A;  2VEZ A;  4CAW A;  1KUV A;  1Z4E A;  3D2M A;  1Q2C A;  4RS2 A;  2Q4Y A;  2FXF A;  4QUS A;  4XPL A;  3LOD A;  2PR8 A;  3E0K A;  4II9 A;  3S6F A;  3EC4 A;  4KUA A;  2OB0 A;  3V8I A;  1ON0 A;  4KVX A;  2EUI A;  2G3A A;  2OZU A;  2ZPA A;  2H5M A;  5DWM A;  4JLY A;  4UBR A;  1N71 A;  2B3V A;  2REE A;  1IYK A;  2DXQ A;  1YGH A;  4XNH C;  3OWC A;  2D4P A;  4E0A A;  1BO4 A;  1S7L A;  2Z11 A;  1YVK A;  4JJX A;  2VZZ A;  1LRZ A;  2AJ6 A;  2I00 A;  5F48 A;  3KKW A;  4JXR A;  2CNM A;  4PV6 A;  2KCW A;  4U5Y A;  2HQY A;  3DNS A;  3ZJ0 A;  3S6G A;  3GYA A;  1XEB A;  4XPK A;  2Z10 A;  2B4B A;  1J4J A;  3GY9 A;  2CNS A;  1M44 A;  2RC4 A;  2G3T A;  3K9U A;  4AVB A;  1YX0 A;  1IIC A;  3TCV A;  2AE6 A;  4L8A A;  2Q0Y A;  4X5K A;  4UWJ A;  4YFJ A;  1S60 A;  4B5P A;  1K4J A;  3TO9 A;  4PSX A;  2CNT A;  4ONU A;  4K30 A;  2BEI A;  4OLL A;  3DR8 A;  3B8G A;  3MGD A;  4LUA A;  5CNP A;  1VKC A;  1IB1 E;  3G3S A;  3F5B A;  4YGO A;  2PQ8 A;  1YVO A;  3ZZI A;  1MJB A;  4CRZ B;  1YK3 A;  3R96 A;  3QAH A;  1WWZ A;  2B5G B;  1YR0 A;  1KUY A;  3F8K A;  4NXY A;  3TTH A;  3I9S A;  4F6A A;  3CXQ A;  2JDC A;  1M1D A;  2OU2 A;  4RI1 A;  2CY2 A;  2R1I A;  1MJ9 A;  4HNY B;  4ORF A;  2P6F A;  2VXK A;  5F49 A;  4EVY A;  2QIR A;  2ZW5 A;  2BSW A;  4GS4 A;  4M85 A;  5JPH A;  3SXN A;  4BMH A;  1Y9W A;  4U9Y A;  3P2H A;  3TFY A;  4KUB A;  2FIA A;  2Q44 A;  4MI4 A;  3BJ8 A;  3EO4 A;  4KVO E;  1XIX A;  5J8F A;  2J8M A;  1WK4 A;  1I1D A;  1XE4 A;  2O28 A;  4H89 A;  2GE3 A;  3PGP A;  3TO7 A;  5EC4 A;  4E8O A;  1IYL A;  5I0C A;  1B6B A;  2WPW A;  3R95 A;  4QC6 A;  1XMT A;  3LD2 A;  4J3G A;  2FCK A;  4KOY A;  1IID A;  4AG9 A;  2Q4V A;  5C88 A;  3JUW A;  2B3U A;  2Y0M A;  2ZW6 A;  3TOA A;  3IWG A;  5F47 A;  3DDD A;  2JEV A;  2OH1 A;  4KOS A;  4KVM E;  2B4D A;  3T9Y A;  2HUZ A;  2FIW A;  4NF1 A;  2P0W A;  3FNC A;  1BOB A;  1QSM A;  2B4D B;  3RYO A;  2X7B A;  3CXS A;  2B58 A;  1UFH A;  3R9E A;  4AG7 A;  4R87 A;  2GIV A;  3WR7 A;  3I3G A;  1QSR A;  3CXP A;  2VZY A;  5HH1 A;  3QB8 A;  1QSN A;  1M4I A;  4PSW A;  1Z9U A;  3P2F A;  4U9Z A;  3FRM A;  4L89 A;  4F0Y A;  2D4O A;  3VWE A;  4R3L A;  1Q2Y A;  2Q04 A;  5JQ4 A;  4YRH A;  2QML A;  5KTA A;  3TT2 A;  4R9M A;  4I49 A;  1M4G A;  1P4N A;  1FY7 A;  5H86 A;  4PK2 A;  2FT0 A;  4Y49 C;  5H84 A;  3DSB A;  3EXN A;  3BLN A;  2Z0Z A;  5IX3 A;  1Z4R A;  5KTD A;  3N7Z A;  2PR1 A;  2OZG A;  3H4Q A;  4OAD A;  3R9G A;  1OZP A;  2PDO A;  4XPD C;  1S5K A;  3SXO A;  3GKR A;  1RXT A;  4XNH B;  3TO6 A;  1XF8 A;  3JVN A;  2A4N A;  4NCZ A;  5DWN A;  4Y49 B;  3R9F A;  1I21 A;  3FBU A;  1S7F A;  1U6M A;  2PRB A;  2FL4 A;  1MJA A;  2ATR A;  3G8W A;  2PSW A;  1MK4 A;  2P6E A;  2P6G A;  2J8R A;  3EY5 A;  4KLW A;  4PK3 A;  4KOV A;  3W6X A;  5E96 A;  2BL1 A;  4B5P B;  4QBJ A;  2Q7B A;  1NE9 A;  2J8N A;  1RO5 A;  2ARH A;  4R3K A;  2R8V A;  2G0B A;  5C82 A;  1PUA A;  4QVT A;  2ZW7 A;  3T90 A;  4CRY B;  4H6U A;  1NSL A;  4DNC A;  1Y7R A;  4KOT A;  3W91 A;  3PZJ A;  1L0C A;  3VWD A;  5FVJ A;  1S7N A;  4FD7 A;  2BUE A;  3IGR A;  2EVN A;  4AB7 A;  4AVA A;  1GHE A;  1YLE A;  3SHP A;  4KZT A;  4KOX A;  3R1K A;  4HNW B;  4IF5 A;  3S6K A;  2FSR A;  4KOR A;  4FD4 A;  1I12 A; 
#chains in the Genus database with same CATH topology
 1T5E A;  4MFK A;  4PA9 A;  2IJZ A;  4PI0 A;  5DN6 G;  4YWY A;  4JPR A;  3D8P A;  2ZE5 A;  1NT2 B;  1HNX O;  4D6T H;  1RM1 B;  2WPX A;  3ZMU A;  4JI7 B;  3SJX A;  3CJH B;  2V77 A;  1UWY A;  5CA0 B;  2Q7S A;  1XQ8 A;  1ZWI C;  4X62 B;  4IUS A;  1OZ0 A;  4J80 A;  1NH2 B;  3MHS C;  1KP3 A;  4X62 O;  5J2U B;  2VBQ A;  4ZI6 A;  1JQG A;  1KUX A;  4K3A A;  1BPM A;  4YJ2 A;  4FLV A;  1H2M A;  1FXK C;  5FPO A;  4H6Z A;  4HNX B;  4MJ8 A;  2F5I A;  2YEV A;  4NB5 A;  2N05 A;  4MY0 A;  3ZMT A;  4PDV A;  4TUY A;  2VRZ A;  2G9D A;  5AG7 A;  4I50 B;  4JV5 O;  2CAZ C;  2HV2 A;  1JVM A;  3EFF K;  5F2V O;  3F0A A;  5J8C A;  1GAX A;  2UU9 B;  1KZF A;  2R7H A;  3ZBH A;  1SQH A;  1I7F A;  2YXH A;  4QNH B;  2Q4Z A;  2B5U A;  4NEX A;  2HKO A;  5CBF A;  2HP8 A;  1BE3 H;  2JLM A;  4XPD B;  1ELL P;  2EK9 A;  4K0K B;  5ELY A;  4NXN B;  3S6H A;  4CYN A;  2ZIM A;  2EUL A;  4X8I A;  4TV9 A;  4F9U A;  4PA7 A;  1Y9K A;  2JJ2 G;  4I7Z B;  2ODM A;  3KCY A;  1Q2D A;  3H8F A;  3PRT A;  5L3C A;  3S3X A;  5KTC A;  1XDC A;  4DR5 B;  4TUY B;  3RYH A;  1PV0 A;  4GLX A;  2QJ1 A;  2I79 A;  4WFE A;  2R72 A;  4B5O A;  1AJN A;  1WPB A;  5AG4 A;  5A27 A;  2OZH A;  3K57 A;  3A8T A;  3FYN A;  2JJ1 G;  5ISV A;  3MRU A;  3TK1 A;  1BSM A;  2NMT A;  4WFA V;  4YY3 O;  4OPH A;  4JD6 A;  3K79 A;  4CS4 A;  5IJ0 B;  4MXU A;  2YIB A;  1I5X A;  1E79 G;  4QPJ A;  4UB6 Z;  4B3M O;  1WJZ A;  5KMG B;  5A2Q N;  1XMQ B;  2R98 A;  5CB4 A;  2CTW A;  2LFR A;  2K1E A;  3BEH A;  3QVN A;  1R3I C;  2ZR3 A;  2JGD B;  2XAF A;  2ZCE A;  3JAW B;  4WFG A;  2VQE B;  4GX2 A;  3FEC A;  1BT8 A;  4JI2 B;  3E86 A;  5IYD O;  1YTF B;  5KAF Z;  4QUS A;  1MSW D;  1TKF A;  2PR8 A;  2F95 B;  1WPX A;  2QVP A;  3S6F A;  4C68 A;  2G38 A;  3EC4 A;  1GM7 A;  4DW1 A;  1KC8 W;  4I55 B;  1R3L C;  4LC1 A;  2OB0 A;  3CC7 V;  3W7W A;  3PB6 X;  4A30 A;  4ZHQ A;  1Q6H A;  1FXH A;  1K3E A;  2A7W A;  5JGF A;  4B3S O;  1MSD A;  2Y0P A;  2ITD C;  3B77 A;  2PJ0 A;  3DXR B;  5C8Y A;  4UFZ A;  1Y7E A;  4NTW A;  1MOF A;  3FYI B;  4JLY A;  2ZEE A;  2B3V A;  2REE A;  3SI0 A;  2DXQ A;  5H6Q A;  1FFX A;  2EBO A;  2KG7 B;  1YGH A;  2QKA A;  3KHZ A;  3LDC A;  2LFS A;  4A33 A;  1OCR B;  3RVZ A;  4E0A A;  3B3T A;  2YDE A;  3B8N A;  2EIL B;  2Z11 A;  2WLM A;  1YVK A;  4JJX A;  5B1A C;  1P7G A;  1BHB A;  2UXX A;  1VIB A;  2AJ6 A;  5D8N A;  2HFE C;  5KLV H;  5K8N A;  3APO A;  1IVS A;  3KKW A;  2QWR B;  4X1K A;  1RPR A;  2VS0 A;  4ZHQ B;  4JXR A;  4U5Y A;  3OUF A;  2KCW A;  2HQY A;  4MHZ A;  3ZJ0 A;  3S6G A;  1SA0 A;  2JRI A;  1XHZ A;  3JAL B;  3UKM A;  3CC4 V;  3ISZ A;  4JI8 B;  2ZOG A;  2Y4T A;  3ABT A;  4PEL A;  5EMI A;  4GT1 A;  2MK3 A;  4W4L A;  5KHG A;  2P6J A;  4AVB A;  4UCO A;  4D7T A;  3FX6 A;  5IJ9 B;  2GV9 A;  3HKE B;  1LAN A;  4NVP A;  4X5K A;  1NU1 H;  3ABU A;  4B5P A;  1XBL A;  1I94 O;  2QE7 G;  2XOK G;  2JDI G;  1XL6 A;  5LXT B;  5LBQ A;  4EB6 B;  3OMA B;  4KSA A;  2PJ5 A;  3JAL A;  2QTO A;  1ZTE A;  1IB1 E;  1P49 A;  4WCE V;  4YGO A;  3AK1 A;  5JH7 A;  2AFX A;  5KX5 A;  4B10 A;  3L73 H;  3H8G A;  2B1G A;  5B1B C;  4C7U A;  2PI5 A;  3BPZ A;  1ZAU A;  1N34 B;  3QAH A;  4MHN A;  1WWZ A;  2HLD G;  2FVG A;  4JYB A;  2JGU A;  1YSJ A;  2B5G B;  1VQ9 V;  2EIM B;  1FXV A;  1M1D A;  2PJ2 A;  3MDS A;  2PE3 A;  1AR1 B;  1XMB A;  5IB9 A;  4E2L A;  3D4U A;  3IJ3 A;  1NQT A;  3STZ C;  2P7T C;  4ORF A;  2P6F A;  2VXK A;  4QE9 A;  4CAE A;  3FMC A;  2ZW5 A;  4O4H B;  2XUM A;  4GS4 A;  3CCE V;  3E83 A;  2WLK A;  5L3D A;  4JYA B;  5JPH A;  4A37 A;  5LHG A;  1Y9W A;  2Q6A A;  3JSN A;  2LP7 A;  1KB9 F;  3OW2 U;  1OHH G;  3K04 A;  3KQZ A;  3OGC C;  4KVO E;  3AG2 B;  1JR9 A;  1XIX A;  3HUV A;  1N8R W;  1W0K G;  2EIN B;  1WK4 A;  1R1B A;  1X4T A;  3RYI A;  4H13 B;  1M56 C;  5J2U A;  2GE3 A;  2V7Q G;  4CGN A;  1AIL A;  3VQW A;  1YXB A;  1J95 A;  2QWP B;  5I0C A;  2QDO A;  2YEV B;  1SQV H;  2WPW A;  1XMT A;  1S0V A;  4K0K O;  4KOY A;  4AG9 A;  2Q4V A;  5C88 A;  2UXN A;  4WFH A;  3D36 C;  4WFF A;  1K7D A;  1XOU A;  2XEG A;  4P30 A;  3BY6 A;  2IJI A;  4G2K A;  2JK5 C;  3W7S A;  1H38 A;  3IWG A;  3ZMS A;  4TV8 B;  2UU9 O;  4MW8 A;  2GFQ A;  2B4D A;  3ZED A;  4JV5 B;  1JMK C;  3JSL A;  3CCV V;  3CCR V;  2PI4 A;  1PL4 A;  3N2K A;  2P0W A;  4IT5 A;  2E5L B;  2PRQ A;  3IAY A;  4LFB O;  3RYO A;  4AHC A;  1NKD A;  1NR1 A;  5G20 A;  3K5M A;  1SES A;  2DE0 X;  1SQX H;  1UFH A;  4P4J A;  2EZO A;  3EVK A;  4LF5 B;  3WR7 A;  1QSR A;  3KZW A;  3O9O A;  2VZY A;  4X88 A;  3UT5 B;  2UXC B;  3VQY A;  1QSN A;  3IWE A;  2HHH B;  2K9P A;  4CGO A;  5K8O A;  1M4I A;  1E1R G;  3ABK B;  4I4T A;  2Q67 A;  2PJ3 A;  3VH9 A;  4CAF A;  1XBU A;  4G28 B;  2PJ6 A;  4MHY A;  1ORQ C;  5CB4 B;  3VWE A;  4FAI A;  4YIP A;  4DR3 O;  4R3L A;  5HVH A;  3JAR A;  1R3K C;  5LHH A;  1JWQ A;  1GN2 A;  2UUB B;  4YRH A;  4JYC A;  5THW A;  4X3R A;  3LNM B;  1UFI A;  1RTQ A;  4MCR A;  3L72 H;  2C6G A;  3ZRX A;  4XDJ A;  1CBX A;  3SYA A;  5JCO C;  2XTA A;  2JS3 A;  1SQP H;  1V55 B;  2YS8 A;  4UCV A;  4MTX A;  5JJN B;  4JI3 O;  4FK5 C;  2BO9 A;  3JD0 A;  3PFO A;  4DV5 O;  4ZIB A;  3EHB B;  3SYO A;  3FB7 C;  3K5O A;  5KTD A;  4DV5 B;  4DYO A;  1N36 O;  1TVK B;  4I55 A;  1TAE A;  2E76 B;  3JAW A;  2BOB C;  1EM1 A;  2CTC A;  3ASO C;  1KD1 W;  3H1K H;  3QO7 A;  1DLB A;  2QWO B;  4UCR A;  3DXR A;  5G1Z A;  1FFT B;  2B9Z A;  2QA4 V;  4DJL A;  1IUR A;  3GKR A;  4OKO A;  1GYT A;  3TO6 A;  4A31 A;  3D8C A;  3OTO O;  5JH9 A;  2GDS A;  5DWN A;  4CBC A;  1NR7 A;  3KR5 A;  4PXD A;  4JI0 B;  2C2A A;  5EZY B;  1VMG A;  2QKS A;  1L0L H;  4CGL A;  4LQ6 A;  3NE8 A;  1D5N A;  2X6A A;  5LRK A;  4ZI7 B;  2POK A;  3V7Z A;  2IMO A;  5LGU A;  1ZG7 A;  4PK3 A;  4KOV A;  1XJO A;  1YJ9 V;  4JYW A;  4LR3 A;  1IY7 A;  2PIY A;  3E8H A;  4MCS A;  4P2Z A;  3PN1 A;  2R8V A;  2LW7 A;  2XEJ A;  1Y76 A;  3PBB A;  4GXH A;  2PJ7 A;  2GUZ B;  1PKX A;  1Z5W A;  1YEW A;  2X6C A;  3T90 A;  2IU3 A;  3RYC A;  4H6U A;  5BMV B;  4FIP C;  3K58 A;  2Z3M A;  4KOT A;  2ZEP A;  5FVJ A;  3H9V A;  4DRX A;  1MG1 A;  4RQF A;  3NH4 A;  2EIK B;  4AB7 A;  4AVA A;  1FYJ A;  4MVZ A;  3KHX A;  1YTF D;  3R1K A;  4X20 A;  4YXW G;  1YDX A;  5HFM A;  2QJ8 A;  3BCC H;  1QR8 A;  1EFR G;  1IZ3 A;  1PPJ H;  2EJ7 A;  4MSW C;  2ZM6 B;  2P4K A;  4Z2W A;  1I12 A;  1PNM A;  4HYO A;  1PP9 H;  4DR2 B;  3H1H H;  4QJF B;  3NE7 A;  1QR9 A;  2ZE8 A;  1AJQ A;  1CM0 A;  4R76 A;  2GLJ A;  2AFS A;  4DV1 O;  2Y0I A;  1KU9 A;  3CC2 V;  1NTK H;  2O4H A;  3CPA A;  1K92 A;  3CP1 A;  1S7K A;  4KOU A;  4EFD A;  4F6R A;  4UA3 A;  5B3S C;  4GKK B;  4E2A A;  4BIN A;  5CA3 A;  4N23 A;  4GUN A;  5EIB D;  2HJD A;  3K0D A;  5B1A B;  3FB3 A;  3G6E V;  3ZHS A;  2H3O A;  4IGG A;  4TNU A;  4I50 A;  2IW5 A;  1U96 A;  5B1O A;  1H8H G;  4FD6 A;  2HVJ C;  5KA6 A;  2OIE A;  3UY5 A;  2EIN C;  4JI6 O;  3BA9 A;  4U3F H;  4CC5 A;  3HKB B;  1QLE C;  5GON B;  4DYL A;  4MBU A;  3CCU V;  2ZIO A;  4JWP A;  5HVF A;  4F6R B;  5CBM A;  3IWW A;  3JAM N;  1AP5 A;  1M4L A;  2Z3O A;  4ZGY B;  4MHD A;  2DYR B;  2PC1 A;  2RNB A;  1H8E G;  1IBK O;  2D3O W;  4J7Z A;  3SDL A;  2F66 C;  5L3G A;  4B08 A;  3IC7 A;  4MVM A;  4FM1 A;  1ARM A;  1BMF G;  3W6S A;  4KXR A;  2LGQ A;  3IJ4 A;  2P4V A;  2WLN A;  4P9O A;  1H2N A;  2WLH A;  1LOK A;  2AXT Z;  3W7T A;  3ETG A;  2F8H A;  4GKK O;  3SJG A;  5BR8 O;  1R57 A;  3D3S A;  3G80 A;  2GAN A;  1B3Q A;  1COW G;  4A38 A;  1X12 A;  3FIX A;  1Q86 W;  1Z8W A;  3ZN1 A;  4M3S A;  2JIZ G;  4B7K A;  2KB1 A;  1UJW B;  1PD3 A;  2LW1 A;  1L1F A;  4DR2 O;  1ZLH A;  4P4F A;  1IDS A;  1B04 A;  5EBV A;  1YLO A;  1PNL A;  1E1Q G;  4F6E A;  3BI1 A;  3PP9 A;  2D2C B;  4TQF A;  5I4M A;  4CS0 B;  1K4C C;  3NH8 A;  1Q6I A;  2ZR2 A;  2F23 A;  1JJO A;  1N32 O;  1P0H A;  1IX9 A;  3O65 A;  2PF4 E;  4UEE A;  1Z4E A;  3D2M A;  1Q2C A;  2O57 A;  4YU9 A;  4XPL A;  5LRJ A;  3JAT A;  3FFQ A;  4II9 A;  4U7O A;  3OTF A;  3T1H O;  1AJP A;  2BTO A;  3K3W A;  2EX3 A;  1FD9 A;  3SPI A;  4Q38 A;  4LF7 B;  3AG4 C;  4GX1 A;  4UEZ A;  3VQX A;  2YXY A;  2XAG A;  1RFY A;  2F93 B;  2WA3 A;  1ON0 A;  3D68 A;  4Q7A A;  4O2A B;  4TWK A;  2G3A A;  4J11 A;  5IYB O;  4GM5 A;  1LFW A;  2H5M A;  5J2T B;  2QWQ B;  3J80 N;  4AQY B;  1BHA A;  1N71 A;  2FTK A;  2ZQM A;  3CE2 A;  5LYI A;  4DK1 A;  3RFR A;  4LF9 O;  2EZP A;  1S3J A;  3OWC A;  1ZG9 A;  4D7S A;  3SJF A;  3RBZ A;  4TT3 G;  2D4P A;  1HEE A;  3L74 H;  1N36 B;  1FAF A;  4A95 A;  2OCH A;  2XAH A;  3DC5 A;  3B3V A;  2EO8 A;  4NGT A;  3GWK C;  4A2Z A;  2VZZ A;  4H33 A;  1NZ6 A;  2I00 A;  2QM7 A;  5F48 A;  3DC6 A;  4PV6 A;  3DNS A;  4X1I A;  4UCU A;  4WWV A;  4LH6 A;  1XNR O;  1NBM G;  4LFC B;  4JYY A;  4XPK A;  4JTA B;  2Z10 A;  4GZR B;  2ZXW C;  4XBF A;  2B4B A;  1DTD A;  2IQ6 A;  4NXM B;  3GY9 A;  2CNS A;  2RC4 A;  3AG3 B;  2G3T A;  1XMO O;  2VQE O;  1NSA A;  4CPA A;  3ASN C;  4LWS A;  3RYF A;  2P06 A;  3ETE A;  3ZRW A;  5B1N A;  3E22 A;  4MW3 A;  1R6K A;  4N21 A;  5EBL C;  4NJQ A;  1NTZ H;  2NNU A;  1SF9 A;  1YIT V;  4X66 O;  1XMQ O;  3WAB A;  4PSX A;  4OX9 O;  5JJE B;  2CNT A;  2OIG A;  1M4U A;  3NH5 A;  2Q7E A;  1BAV A;  4X1I B;  4K30 A;  3WG7 C;  4OLL A;  3DR8 A;  1BL8 A;  1EZJ A;  3JAS B;  3D7H A;  4CS2 A;  3MGD A;  4LUA A;  3WB2 A;  4MS2 A;  3L2N A;  4A5U B;  3LDE A;  1A32 A;  1VF6 C;  3FX7 A;  2OCC B;  5AG2 A;  3ZZI A;  1F23 A;  4CRZ B;  4P4I A;  4UCP A;  3X2Q C;  4RWU A;  5EC2 C;  4J9Y B;  3HKC B;  1H2L A;  3IU2 A;  1Y76 B;  1KUY A;  4NXY A;  3I9S A;  1Y66 A;  3CXQ A;  1KKC A;  2W0F C;  4RUE A;  5IYC O;  4UV9 A;  2JBK A;  2WA4 A;  3OM3 B;  2OU2 A;  1CP9 A;  1WP8 A;  3ZHQ A;  4JI4 B;  4G1P A;  4CZZ A;  2R1I A;  2ZDI A;  4PDM A;  1GO3 F;  3IO1 A;  1QNM A;  2IH1 C;  2ZNJ A;  4AI8 A;  3ZS8 C;  2GU2 A;  5DS0 A;  1DE4 C;  4X1Y B;  1F7Y A;  2PVV A;  3P2H A;  1EE3 P;  2FIA A;  4CH4 A;  1S5L Z;  3N2G A;  4KP4 A;  3BJ8 A;  4O4I A;  3HKC A;  2PJ4 A;  3DGV A;  3QAY A;  4DR7 B;  4TV9 B;  3FF3 A;  2J8M A;  1R6T A;  2ZEF A;  1ZO0 A;  1V54 C;  2WLI A;  3OGI B;  4E8O A;  1NVP B;  4UFV A;  2W6I G;  5B5E Z;  3FAV A;  4RO2 A;  2Q0O C;  1K9M W;  5LYJ B;  4JTD B;  1GTO A;  3EXA A;  3KQX A;  1VGY A;  4TV8 A;  4DV2 B;  1G8M A;  1VHE A;  3BFR A;  3IFX A;  4IYH A;  2ZW6 A;  2JEW A;  4FM0 A;  4JI4 O;  3A9L A;  2V8H A;  3TOA A;  3N2G B;  2Q0A A;  4J7J A;  1H2S B;  3SJC C;  2JEV A;  2HR3 A;  2I3C A;  5FNV A;  3SR2 C;  4IYI A;  3SPJ A;  1XOV A;  4NGM A;  3QF7 A;  4LNU B;  1JPX A;  1N34 O;  1SQQ H;  2YND A;  1XL4 A;  4NF1 A;  1K33 A;  1WN7 A;  1BOB A;  1QSM A;  2QKC A;  3RT3 C;  2B4D B;  4X9Q A;  3SPG A;  1ZSP A;  1L8D A;  1K4D C;  4UCS A;  3CXS A;  3AEI A;  3E8B A;  3PEI A;  3JD1 A;  1QQC A;  1QVG U;  1S72 V;  1Q5O A;  4P9P A;  2OTJ V;  4LCU C;  5HH1 A;  3QB8 A;  1CPS A;  2ATK C;  2ZDI C;  4NKG B;  2AGA A;  4JI5 O;  1QU7 A;  1XRE A;  4PSW A;  1Z9U A;  4WBN A;  4R8C A;  1XNR B;  1X59 A;  2OCC C;  2DPS A;  1YIJ V;  3P2F A;  4FWU A;  3JAR B;  5K1P A;  3D67 A;  2KSD A;  2DOS A;  5KHJ A;  1Q7L A;  4MFZ A;  2PVW A;  3RAM A;  1VAR A;  5H9C A;  5LL6 Y;  4FPP A;  5BXZ A;  5J1Q A;  4L89 A;  4F0Y A;  3SJQ C;  4DV0 B;  3MN8 A;  4RUF A;  4UUJ C;  2ZEO A;  3RO0 A;  4PDL A;  1YJN V;  1XMO B;  4MTO A;  1SKV A;  1XHX A;  2EWB A;  1DF5 A;  4ZX8 A;  4UFW A;  4DR4 B;  5JQ4 A;  5FPR A;  2QML A;  3DSQ A;  3Q4H A;  3I1U A;  1K97 A;  3CDX A;  4LFC O;  4MHP A;  1CXZ B;  4F9V A;  4R9M A;  4I49 A;  4EME A;  4I0X B;  4X65 O;  4FFB B;  4R6Z A;  2UXB B;  4PK2 A;  4MVQ A;  1YCI A;  1SC5 B;  4HPS A;  2IH3 C;  2WLL B;  3CPX A;  3EXN A;  5IY5 C;  3W7U A;  4DV7 O;  4B3T O;  4MTF A;  2XEI A;  1XIL A;  2PR1 A;  5EBW C;  1SA0 B;  2OZG A;  4J10 A;  5EYP B;  3CRC A;  3A0H Z;  1OZP A;  1OV9 A;  2PDO A;  3CCS V;  2WZN A;  1LUV A;  1SZX A;  3KI9 A;  3R65 A;  3LMS A;  5LA6 A;  2ZED A;  4B3S B;  3FED A;  3AK3 A;  2R9A A;  3LDD A;  4UCT A;  1BQZ A;  2Q43 A;  2C6C A;  2RB7 A;  2A4N A;  2QM8 A;  3PB8 X;  2CTP A;  4QE7 A;  4PA4 A;  3PB9 X;  1F4M A;  1S7F A;  1U6M A;  1LAP A;  2DPT A;  1Y74 A;  3G8W A;  4EB6 A;  4P4D A;  3AG7 A;  4K8X A;  5HVG A;  5J2T A;  3CXC U;  2J8R A;  5JVD B;  4UF4 A;  2PYJ A;  4CGP A;  1AR5 A;  3JD3 A;  4KLW A;  4DV6 B;  4NJR A;  3W6X A;  1XNQ B;  4B5P B;  4QBJ A;  2C1C A;  5JQG B;  4PA3 A;  4PJ0 Z;  1Z8T A;  1H2K A;  2DF5 A;  3OT7 A;  3FD9 A;  2ARH A;  1RO5 A;  4F0X A;  3T1H B;  3SI2 A;  1W59 A;  4HZ3 A;  4TQD A;  4DR6 B;  2G0B A;  1PUA A;  5IYZ B;  1VQN V;  4DR4 O;  5DM6 V;  1YF2 A;  3E22 B;  2ZW7 A;  5K1X A;  1VF7 A;  4DNC A;  2YSU B;  2H8P C;  1Y7R A;  4RAI A;  3W91 A;  4BW5 A;  3PZJ A;  4CYQ A;  3GVM A;  4MT8 A;  2UXB O;  1BS3 A;  1K5Q A;  4FD7 A;  3T8W A;  3DLJ A;  3ML0 A;  3IGR A;  4JAU A;  4LWS B;  1GHE A;  1YLE A;  3SHP A;  5DEC A;  2ZNI A;  4KOX A;  4BIZ A;  5IWA O;  4O4J A;  5LRG A;  4IF5 A;  3AG4 B;  5BR8 B;  1ZLI A;  3S6K A;  3JAK B;  3VQV A;  1AYE A;  4A94 A;  2IU0 A;  5FLX N;  3PB7 X;  4OC1 A;  2FE7 A;  5EC1 C;  3DR6 A;  4TWE A;  3K03 A;  2CF4 A;  2REF A;  2PIZ A;  2YNE A;  3M99 B;  4OAE A;  3FXT A;  3JAS A;  2ETN A;  4MRI A;  2DEA A;  2C6P A;  1S77 D;  1QST A;  1B87 A;  3W7X A;  2CGO A;  1JOY A;  3HR0 A;  5KA5 A;  1PU9 A;  2C27 A;  5GCN A;  4Q36 A;  4JZG A;  2VWJ A;  4DV4 O;  1VQO V;  1YRE A;  1CX8 A;  3K9A A;  1ZL8 B;  2B1I A;  4FVM A;  4HKF A;  1TF8 A;  5D5Q A;  4NFR A;  3JAK A;  2AHY A;  2LGW A;  1CJW A;  2HG5 C;  3A0B Z;  3ABL B;  3CT9 A;  4NTY A;  1A2Z A;  4LX9 A;  1N4C A;  3TET A;  1KEC A;  1I08 A;  1YQE A;  2WWW A;  4IIJ A;  1HNZ O;  4X64 B;  5CA1 A;  4LF4 O;  4MFL A;  4CH5 A;  1TIQ A;  3PFE A;  5D29 A;  4AVC A;  4UWI A;  2P22 C;  3FAV B;  3ASN B;  4J7K A;  1VHS A;  4MY3 A;  3F5W C;  3QTC A;  2DN9 A;  4X1Y A;  1R6N A;  1ZL8 A;  2PYL A;  1ROP A;  1WP7 A;  1HNX B;  1HDU A;  1J5E O;  3G67 A;  4JZ2 A;  5KMG A;  1ARO P;  3ZX6 A;  3PJS K;  2W6J G;  4KSI A;  2EIJ C;  2ZKO A;  5AG5 A;  1OCC C;  1RPO A;  3FB8 C;  2YXL A;  1N0J A;  4PI2 A;  4E4E A;  4O2B A;  4DR7 O;  3L70 H;  3RGB A;  2X7R B;  2PY5 A;  4W4K A;  1FJG O;  4CAV A;  1QSO A;  1F51 A;  1ZX3 A;  4LF8 B;  4OC0 A;  2V8D A;  3K5L A;  1ELM P;  3OR6 C;  4PXE A;  3U11 A;  3B4S A;  1K5S A;  5F46 A;  3L75 H;  3ABK C;  4JI1 B;  4ASU G;  5C93 A;  4JI7 O;  4FD5 A;  2QYV A;  1XRY A;  4C2X A;  2QEC A;  1OCO B;  3SPH A;  2Q4P A;  3U0Z A;  4UB8 Z;  5IT9 N;  2BTQ A;  5B1B B;  1AI5 A;  3RYH B;  4CS3 A;  5H2F Z;  1TGO A;  2R9R B;  3RN4 A;  3D7G A;  3NA6 A;  4HNA B;  4WBN B;  4OIW A;  2OT5 A;  3JAT B;  3ZN0 A;  4KLV A;  5JWP A;  3FYE B;  3IEH A;  5BY1 A;  1FFX B;  2KG7 A;  3TJT A;  4OPA A;  4RS2 A;  3QNV A;  1SQG A;  4ZYQ A;  2VQF O;  4ZY1 A;  4DO2 A;  2A9H A;  2FXF A;  2VWK A;  1V55 C;  4UIB A;  3S9N A;  4FUU A;  4FJC C;  3E0K A;  5CBH A;  2XND G;  3CME V;  2M7W A;  5KAI Z;  2VL1 A;  2JVD A;  2GBO A;  3P3P A;  1AUG A;  4FLW A;  1V54 B;  4LF6 O;  2DYS C;  2RN9 A;  2F4V B;  3UCS C;  4PXB A;  4KVX A;  2OOT A;  3ASO B;  3CHX A;  1GMG A;  4FFB A;  4NXM O;  3D36 A;  2AW9 A;  4KL1 A;  2WUU A;  2ZPA A;  3B35 A;  4OC5 A;  4YHH B;  4X66 B;  4NGS A;  5E1A C;  1IBM B;  2YIA A;  1P84 F;  3L9D A;  1IYK A;  2WAM A;  5LYD A;  3RVY A;  4UVC A;  1M1K W;  4P4E A;  2NLJ C;  1BO4 A;  4EFB A;  4X89 A;  1LAM A;  2WPD G;  2YIC A;  3ZHU A;  5IJ9 A;  4QGP A;  5DED A;  1NH2 D;  3FVL A;  3RNZ A;  3CRR A;  3MAQ A;  1N33 O;  1SET A;  4DV0 O;  4C7H A;  2GSM B;  2IBZ H;  2A06 H;  5EBM C;  5TIS Z;  1CPY A;  2CNM A;  2NR5 A;  2GUZ A;  1VQ8 V;  3IC1 A;  4F8Z A;  3VOU A;  4WF9 V;  2A3Q A;  3GYA A;  3N27 A;  4X2T A;  2PTM A;  1KQS U;  5LP6 B;  2UXD O;  3SYP A;  1J4J A;  2HC9 A;  1QLE B;  2HHH O;  3ZHV A;  5FL7 G;  2A0L A;  1YZB A;  5GTH Z;  4JI3 B;  4K8Z A;  4R7M A;  3WC6 A;  2IJH A;  2QSA A;  1IIC A;  4BR6 A;  4L8A A;  4LF9 B;  3JTK A;  4YFJ A;  2E74 B;  2HJF C;  1S60 A;  1HWY A;  1HP8 A;  3TCU A;  1GH6 A;  3IU1 A;  5JQG A;  1K4J A;  3L71 H;  3I56 V;  4ZKI A;  1WB8 A;  3TO9 A;  2E5L O;  3C3T A;  3CPW U;  1Y6X A;  4X1K B;  1CG2 A;  1NS1 A;  1R43 A;  2Z3N A;  2YI9 A;  2BEI A;  4DR3 B;  4LP8 A;  1KBH A;  4JAV A;  3B8G A;  3H1J H;  1TXR A;  3KR4 A;  3G3S A;  1G1X B;  2XAJ A;  4X8A A;  1YVO A;  1N0N A;  1VQK V;  2YIB D;  3IGA C;  1HR0 O;  1AMP A;  1MJB A;  1YK3 A;  2V8G A;  2FKX A;  1Q90 D;  3ZIA G;  1R3J C;  3R96 A;  3AK2 A;  4GYC B;  2N74 A;  1VHO A;  1YR0 A;  4PV1 B;  3F8K A;  2BOC C;  3OAA G;  5IY5 B;  3TC8 A;  3TTH A;  1Q82 W;  5HXD A;  3K9S A;  4YIO A;  2CTQ A;  1WNS A;  3K06 A;  3ZJZ A;  3U10 A;  1J5E B;  1YW4 A;  3D7F A;  4LFB B;  2CY2 A;  5B66 Z;  4DUY O;  1IU8 A;  2RDC A;  1BGY H;  5B3S B;  2DWD C;  4ZOL B;  1VIX A;  5GON A;  1OJH A;  2AHZ A;  2QIR A;  2BSW A;  3C3S A;  4M85 A;  2OTL V;  4O4I B;  1LR1 A;  4BMH A;  3CEI A;  5CMU A;  4U9Y A;  3GWO A;  1DTO A;  1ENV A;  4JYA O;  4KUB A;  2ZD9 A;  2Q44 A;  4MI4 A;  1OCZ B;  3D66 A;  1AR4 A;  1ZLZ A;  3P30 A;  3EO4 A;  3GB0 A;  5J8F A;  1IBK B;  1I1D A;  1XE4 A;  2O28 A;  1Y67 A;  2PJB A;  3K08 A;  1BCC H;  3CCQ V;  4KUM A;  5LMU B;  3TO7 A;  5EC4 A;  4XDL A;  1IYL A;  1OCR C;  2ZE6 A;  3MHH C;  4ZOL A;  5A9G A;  2PJ9 A;  3KL9 A;  4X64 O;  1XI1 A;  1B6B A;  1F2P A;  4UCM A;  4QC6 A;  3LD2 A;  1HNW B;  3ETD A;  2JS5 A;  3JUW A;  4MFJ A;  2Y0M A;  5FNV B;  2IM9 A;  3P32 A;  3GB7 C;  3RW0 A;  3J81 N;  4ZBM A;  3JCU Z;  1LUW A;  3K5N A;  2ANP A;  1RSO B;  1SS3 A;  4JTC B;  5IE9 A;  3T4D A;  3HB3 B;  3FB6 C;  2M6Y A;  2OH1 A;  8CPA A;  4KVM E;  2CXA A;  4O23 A;  4YJ3 B;  1HNZ B;  3T9Y A;  3SJA C;  5ITZ B;  3LSU A;  4CC6 A;  3KG2 A;  5A28 A;  1PM9 A;  1AI4 A;  3BVO A;  5LGN A;  3J7A U;  2ODF A;  2V1D A;  1VQP V;  3FNC A;  1MNG A;  4K3N A;  4IHJ A;  4LBE C;  3UQ8 A;  2Q68 A;  1BQ0 A;  2X7B A;  4P10 A;  4GKJ O;  1SZT A;  4L8J A;  2ZXW B;  2B58 A;  4CGM A;  3LUT B;  1FNO A;  4R87 A;  3I3G A;  3S9L A;  3LNN A;  3CXP A;  4B11 A;  5E79 Z;  4JI8 O;  1WB7 A;  4UXN A;  4DR6 O;  2ZT9 B;  4DUY B;  2EIK C;  1ZUQ A;  3KAS A;  4U9Z A;  3HKD A;  3FRM A;  3IC9 A;  2AFZ A;  5LMN O;  2XAS A;  3CB2 A;  1Q2Y A;  2JGD A;  2ILM A;  3LWU A;  1HDQ A;  2YNC C;  4H2K A;  4DUZ B;  1K73 W;  4NR1 A;  1D5A A;  4DK0 A;  2WLL A;  2O53 A;  4R7C A;  3WT4 A;  3TT2 A;  1Y4M A;  4Q6G A;  3UT5 A;  2BSK A;  4B7E A;  1M4G A;  1P4N A;  1R73 A;  4O2A A;  1FY7 A;  2GTS A;  3ABL C;  5H86 A;  5JCO A;  3Q4H B;  2FT0 A;  2YC0 A;  4Y49 C;  5H84 A;  4UVA A;  4DV6 O;  4DV7 B;  3N7Z A;  4AXV A;  3JCZ A;  1P7B A;  5CN0 A;  5LYF A;  2DYS B;  1M93 A;  1YME A;  4HNA A;  2XEF A;  4IAV A;  3ISX A;  1XEQ A;  3AG2 C;  4GX0 A;  3UM7 A;  3R9G A;  3CRA A;  1F57 A;  1R3N A;  4XPD C;  1SER A;  3G4S V;  2YGW A;  1S5K A;  4FLT A;  2L35 A;  4OXS A;  3OTO B;  3F7V C;  3ZCC A;  3PB4 X;  4MFP A;  1RXT A;  1GN6 A;  5F09 A;  3QO8 A;  4NCZ A;  1BZK A;  4Y49 B;  2P90 A;  3R9F A;  1TKH A;  2A79 B;  1PCA A;  2PRB A;  3B40 A;  2EIJ B;  2FL4 A;  2AFW A;  1MJA A;  2ATR A;  4MCQ A;  4A39 A;  3CSX A;  4JI0 O;  2Q51 A;  2QR4 A;  1TVK A;  2QGN A;  3WB0 A;  2P6G A;  3TXQ A;  4DUZ O;  4KHP O;  1Y74 B;  4LFA B;  1THZ A;  3H1I H;  3QG5 A;  2DMX A;  3KZI Z;  1D2D A;  5LMN B;  4CYP A;  5E96 A;  2BL1 A;  1O9H A;  5KUK A;  2Q7B A;  3OEE G;  5KHH A;  5LP6 A;  1NE9 A;  1Q81 W;  4RUH A;  3LAC A;  2J8N A;  2JEX A;  3T1Y B;  5H6R A;  4EFE A;  1F2O A;  5BWA B;  4PDR A;  4R3K A;  3SJB C;  5G22 A;  1YW6 A;  4YHH O;  2BCC H;  2UUB O;  1H8L A;  2GLF A;  4QVT A;  3HKE A;  2QWN B;  2CTB A;  4JI2 O;  4KSF A;  5L3B A;  2H94 A;  2ZEL A;  4R50 A;  3T1C A;  4C2Z A;  2DWE C;  4DV3 O;  2CE4 A;  1CEZ A;  3UO2 A;  1L0C A;  3X2Q B;  4X65 B;  4U3J B;  1S7N A;  4NGN A;  3IFE A;  3FJU A;  4BWA A;  1JX9 A;  2Y4U A;  4M6H A;  1KP2 A;  4B3M B;  2VQF B;  4KZT A;  2FB5 A;  1SQB H;  2ADP A;  1JA8 A;  4MCP A;  1JFF B;  4QIW F;  2FSR A;  4KOR A;  4FD4 A;  4JF3 A;  1GM9 A;  2CTR A;  4YY3 B;  2ZEH A;  4O4J B;  1IOI A;  1GM8 A;  4NXN O;  1Q7Y W;  1VQ5 V;  1TUB B;  3ZMV A;  3K59 A;  1QQ9 A;  2B5G A;  2Z5U A;  3ABM C;  5LYJ A;  2WSA A;  4TSF G;  3CWB H;  1P4R A;  7CPA A;  1HNW O;  1QMU A;  1Y0Y A;  2UUA O;  3E2E A;  1VQ7 V;  4B12 A;  3IIB A;  1S3Z A;  1Z5V A;  3SI1 A;  3C90 A;  4X20 B;  3NFZ A;  3JYC A;  1FJG B;  5LMU O;  4DR1 O;  3TXS A;  4U7N A;  3M7M X;  3WFV A;  5L3E A;  1VQ4 V;  3OE7 G;  2V4D A;  4J41 A;  2PUS A;  1XFO A;  2Q9L A;  3S3W A;  4DV2 O;  2YID A;  2RCV A;  3D3Q A;  3D3I A;  4MFQ A;  1EN5 A;  2Z0A A;  4CAX A;  1URF A;  1W0J G;  1M4D A;  1PNK A;  2BE3 A;  5LP6 C;  3C26 A;  4OME A;  2L6L A;  1YSC A;  2QEX V;  3F5T A;  5HFL A;  2CGN A;  2EK8 A;  2UUA B;  4J42 A;  1US6 A;  3PBE A;  2ZW4 A;  4IIJ B;  2K5T A;  1GRJ A;  2R70 A;  2ZXV A;  3VBB A;  5CA1 B;  2AFU A;  3GLJ A;  1HR0 B;  5IV0 A;  1TF9 A;  4O4L A;  2IJK A;  2P67 A;  2RMK B;  2AZ0 A;  3BHP A;  2IL4 A;  1IOF A;  4NGQ A;  4FLU A;  1FKA O;  4KOW A;  4LF4 B;  3G71 V;  4JXQ A;  2XAQ A;  4NSQ A;  2CH7 B;  4QB9 A;  1EN4 A;  1RSO A;  4ZBG A;  4PPZ A;  1K8A W;  1VF5 B;  3AG1 C;  3OR7 C;  3EFA A;  4PXC A;  3ZHR A;  1NMT A;  2VI7 A;  4YJ3 A;  5HMN A;  4DR1 B;  3K9T A;  2Q7H A;  2YUA A;  5JM6 A;  1KYO F;  3N2K B;  3TE4 A;  1ARL A;  3D2P A;  4DV3 B;  1EZV H;  1G6U A;  3LSQ A;  4UVB A;  4DV4 B;  2E75 B;  2EJR A;  2FS5 A;  1NJI W;  5IB0 A;  3S9M A;  4O4L B;  2ZEG A;  3BHX A;  1DGS A;  3B3S A;  2BTQ B;  3B2Y A;  4LQG A;  4R57 A;  1QVF U;  5AGE A;  1IBL B;  3CZX A;  1PL0 A;  4HAM A;  4TOI A;  2CH7 A;  1WA8 B;  3VAR A;  3MD0 A;  5IJ0 A;  5ITZ A;  1V0C A;  3BJ7 A;  2LO1 A;  3KGQ A;  4ONW A;  3DTU B;  3TOB A;  3T1Y O;  2R9I A;  2NSM A;  2PJ1 A;  1VEW A;  2VQY A;  1KMI Z;  2JDD A;  3E35 A;  3A0R A;  4P45 A;  2VEZ A;  4CAW A;  1KUV A;  3CXH F;  4I9W A;  4UIA A;  4IK2 A;  1QLN A;  1JQ0 A;  2E3C A;  4DXW A;  4KHP B;  2Q4Y A;  3OFN G;  2UXD B;  1Z2G A;  3OMI B;  2PJ8 A;  1OCZ C;  3LOD A;  2KQX A;  3K2K A;  3WC7 A;  4WFB V;  5EK0 A;  2DJV A;  3ABM B;  4KUA A;  2ZEN A;  2ZEM A;  2Q73 A;  1M56 B;  1N33 B;  4PHZ A;  4OC2 A;  4R6T A;  3V8I A;  2FYU H;  4I4T B;  5EYP A;  3CRQ A;  2X0L A;  3V38 A;  2BSK B;  1S5J A;  3CD6 V;  2PGG A;  2EUI A;  3N5F A;  3B7I A;  3HKD B;  2OZU A;  2Y48 A;  4LF6 B;  2BCO A;  5DWM A;  3R66 A;  4UBR A;  5LA6 B;  2UUC O;  4MVS A;  2XHB A;  4P44 A;  4XNH C;  1HW7 A;  2OWO A;  1WAZ A;  4A32 A;  2QM4 A;  4G27 B;  3BA8 A;  1S7L A;  1IXB A;  1G4Y B;  4LFA O;  3WC5 A;  3H01 A;  5LGT A;  3FH4 A;  5K8P A;  1Z5R A;  2ZIN A;  2PCU A;  1LRZ A;  4CYO A;  1AB3 A;  5EIB C;  3QO5 A;  3KKY A;  2V8V A;  2DYR C;  2Q8V A;  3BAB A;  4LH7 A;  1XEB A;  4B13 A;  3WG7 B;  3CMA V;  3B3C A;  1YI2 V;  1AI6 A;  2XT9 A;  4BBH A;  4MMO A;  5EZY A;  2F7V A;  4PA6 A;  4JI1 O;  3RBU A;  1M44 A;  1AP6 A;  2UXC O;  4NYK A;  2OYQ A;  1Z2L A;  4ZY2 A;  4I9Q A;  4PQA A;  3K9U A;  4OC3 A;  2HVK C;  3SYC A;  1YX0 A;  1FT7 A;  1NI8 A;  3TCV A;  5IYZ A;  2AE6 A;  2Q0Y A;  2Q5Z A;  3AG1 B;  3ZHT A;  4UWJ A;  5LYL A;  6CPA A;  3LSS A;  4AQY O;  1JJ2 U;  2Q69 A;  1WLE A;  1OBR A;  1KWM A;  3E8F A;  4F4L A;  1FPO A;  5H5N A;  4H0L B;  3JD2 A;  4ONU A;  3H8E A;  3H1L H;  1TUE B;  5KX5 B;  5AG6 A;  5CNP A;  4LF7 O;  3K0G A;  3SGI A;  1QBZ A;  2DQ0 A;  3A2F A;  4LF8 O;  1VKC A;  3F5B A;  4ZY0 A;  4JAS A;  2ZE7 A;  2PQ8 A;  5LXT A;  5CA0 A;  4UV8 A;  1VP7 A;  3RYF B;  4FFK A;  3QNE A;  4FLY A;  2YNC A;  2W0X A;  1Y0R A;  3ZMZ A;  3ETQ A;  4DRX B;  4H37 A;  2J9A A;  1VQ6 V;  1N32 B;  1RM1 C;  4F6A A;  2KKW A;  2CK3 G;  1EBO A;  2CUG A;  4JI6 B;  2JDC A;  2YI8 A;  4NGR A;  2WLJ A;  3RYC B;  3P3N A;  5GW7 A;  4RI1 A;  4Z1M G;  1MJ9 A;  4HNY B;  3SPC A;  2CIJ A;  3WU2 Z;  1MAB G;  4JI5 B;  5F49 A;  5G21 A;  1IXM A;  4EKW A;  4EVY A;  1Q8I A;  1VQM V;  4DR5 O;  4MVR A;  2PJC A;  1AVM A;  4XDK A;  4YJ2 B;  3SXN A;  1GK9 A;  4BIO A;  3TFY A;  1CP6 A;  1JFF A;  4GKJ B;  5LOV A;  5CPA A;  1KKD A;  3FEE A;  4M6G A;  3CCM V;  1H2G A;  2RQ6 A;  1PYT B;  2MW2 B;  1I5Y A;  3I5D A;  4H89 A;  3APQ A;  2Z3Y A;  3PGP A;  3TGU H;  3RYI B;  3THO A;  1GN3 A;  1AI7 A;  5J9P C;  5L3F A;  4CH3 A;  1Z8L A;  4OP4 A;  1S5H C;  4EEQ A;  3R95 A;  4B6Z A;  1KUQ A;  5GTI Z;  3JRU A;  1BPN A;  4J3G A;  3M8A A;  1Q43 A;  2FCK A;  1IID A;  1F4N A;  5IWA B;  2B3U A;  3I55 V;  2WYR A;  3GIU A;  4OC4 A;  1MA1 A;  3RWR D;  1Q3E A;  4R8F A;  2OR4 A;  1M57 B;  5LOV B;  2ITC C;  4JAA A;  5F47 A;  3DDD A;  1QHT A;  1GKF A;  3HPL C;  3CYO A;  4KOS A;  1CP7 A;  1GN4 A;  4O2B B;  4IHJ B;  2HUZ A;  2WLI B;  3AG3 C;  3ZRV A;  3DGE A;  2FIW A;  4NGP A;  4C7I A;  3UO3 A;  1NVP D;  1M90 W;  3T2M A;  3ICX A;  2AFO A;  3B8M A;  5KUM A;  1I94 B;  4P6Y A;  3CS5 A;  3HKB A;  4KFM A;  2ABZ A;  2Q7G A;  2DQ3 A;  3OD4 A;  3R9E A;  1X10 A;  1IGB A;  4AG7 A;  4DW0 A;  3GUX A;  5CBG A;  1DF4 A;  2ZM6 O;  4FZ1 A;  2GIV A;  4ZX9 A;  2LQT A;  3BXM A;  1MZF A;  1XNQ O;  1CPX A;  4Z1V A;  3RZA A;  3CCL V;  4FLX A;  2GRE A;  4FMT A;  1M9N A;  4I5S A;  3JD4 A;  4Z65 A;  1HDJ A;  4DV1 B;  1TA8 A;  2P5O A;  3STL C;  2Z3P A;  2CDY A;  4LNU A;  4FBE A;  1M5I A;  4GCZ A;  3T4Z A;  2D4O A;  4JZ0 A;  2X6B A;  4UFX A;  3BRC A;  2N04 A;  3OMN B;  2Q04 A;  4B3R O;  2LJ2 A;  1U97 A;  3B09 A;  1Z8X A;  5KTA A;  4H44 B;  1TKJ A;  3E8G A;  2JBJ A;  1QCE A;  4ICG A;  1YHQ V;  5IDJ A;  1VF6 A;  4MVU A;  1ZG8 A;  3VAT A;  2RFH A;  2NYQ A;  5KHK A;  5C8Y B;  3BI0 A;  1O9G A;  2NN4 A;  1WA8 A;  3DSB A;  3BLN A;  4B3T B;  2Z0Z A;  5IX3 A;  4C2Y A;  1B06 A;  1Z4R A;  2HB6 A;  5BZB A;  4OX9 B;  2QTS A;  2Y69 C;  4JGS A;  2AFM A;  3NR7 A;  3WB1 A;  1W2B U;  3ZRS A;  3TX8 A;  1RP3 B;  2PJA A;  5JVD A;  1FXK B;  4NTX A;  1S76 D;  2ZOF A;  2F43 G;  3H4Q A;  2EIL C;  1MMM A;  4OAD A;  2GTA A;  4OGQ B;  3BAA A;  1VQL V;  3SJE A;  2WSS G;  4GX5 A;  4RQE A;  2RJZ A;  4IL6 Z;  4BAY A;  4RN7 A;  3SXO A;  4Q20 A;  1NTM H;  2PZS A;  4FZ0 A;  4I0X A;  4M6I A;  4XNH B;  1XF8 A;  3JVN A;  3B3W A;  3NXS A;  4MTG A;  2DW4 A;  4EWT A;  3FKS G;  1I21 A;  4QPK A;  3FBU A;  1LNQ A;  1FS0 G;  3CX5 F;  2Y69 B;  1DK1 A;  1I0H A;  1SQF A;  1V9P A;  2UUC B;  2PSW A;  1MK4 A;  1JCH A;  4K35 A;  1IBM O;  2P6E A;  1Q6U A;  1M57 C;  2AZ2 A;  3HLP A;  3EY5 A;  4B14 A;  1FXK A;  4UCN A;  2BOA A;  5K8M A;  5JJJ B;  4WJB A;  4AIL C;  4ABM A;  1SRY A;  4CH6 A;  1K34 A;  1OCC B;  5KHI A;  4FLZ A;  1L0N H;  4ZI7 A;  1UPG A;  4MVO A;  2EBJ A;  4HBN A;  3OUS A;  4DUK A;  5BMV A;  2ADQ B;  3OEH G;  4PD4 F;  1XUQ A;  4B3R B;  2F1M A;  5C82 A;  3ZRW B;  4BD9 A;  1EN6 A;  3H5Z A;  3E89 A;  2JEU A;  3CCJ V;  3B2E E;  4L87 A;  4FM2 A;  4CRY B;  5JH7 B;  2F4V O;  1NSL A;  3KCX A;  4LF5 O;  4W9Y A;  4OID A;  4IHM A;  3VWD A;  1OCO C;  3D7D A;  1B6Q A;  4O4H A;  4BW9 A;  3G6B A;  1YJW V;  3SYQ A;  2Z3K A;  1YVW A;  2HEP A;  3CJH A;  3FB5 C;  5LHI A;  4KS9 A;  2BUE A;  1MZE A;  2EVN A;  4J9Z B;  2FML A;  2IJJ A;  1IBL O;  4BIU A;  3F7Y C;  2Z3L A;  4HNW B;  2EIM C;  2GHY A;  4U3J A;  3CRM A;  1BLL E;  1LCP A;  4UEF A;  5D5P A;  1TUB A;  4P4B A; 
#chains in the Genus database with same CATH homology
 4MFK A;  2FE7 A;  3DR6 A;  3NE7 A;  2REF A;  1CM0 A;  2YNE A;  3D8P A;  4OAE A;  3FXT A;  2B5G A;  2WPX A;  2WSA A;  1QST A;  4KOU A;  1S7K A;  1B87 A;  1PU9 A;  4UA3 A;  2C27 A;  4IUS A;  5GCN A;  4E2A A;  4B12 A;  4Q36 A;  1S3Z A;  1YRE A;  2VBQ A;  1KUX A;  4HKF A;  3FB3 A;  1CJW A;  4MJ8 A;  4H6Z A;  4HNX B;  2F5I A;  4FD6 A;  4LX9 A;  4MY0 A;  4MFQ A;  3UY5 A;  4CAX A;  1M4D A;  3C26 A;  5AG7 A;  2HV2 A;  4MFL A;  1TIQ A;  3F0A A;  4MBU A;  5J8C A;  1KZF A;  2R7H A;  4JWP A;  1SQH A;  4AVC A;  4UWI A;  2ZW4 A;  4MY3 A;  2K5T A;  1VHS A;  4NEX A;  2Z3O A;  2ZXV A;  4ZGY B;  4MHD A;  2PC1 A;  2JLM A;  4XPD B;  5IV0 A;  2IL4 A;  3S6H A;  4CYN A;  3W6S A;  1Y9K A;  4KOW A;  4JXQ A;  1Q2D A;  4NSQ A;  4QB9 A;  5KTC A;  4ZBG A;  1R57 A;  5AG5 A;  2I79 A;  3D3S A;  2GAN A;  4B5O A;  3EFA A;  1NMT A;  2VI7 A;  5HMN A;  5AG4 A;  3FIX A;  5A27 A;  2OZH A;  3FYN A;  4M3S A;  5ISV A;  4CAV A;  1QSO A;  3TE4 A;  3D2P A;  2NMT A;  2FS5 A;  4JD6 A;  5EBV A;  5F46 A;  5IB0 A;  4R57 A;  5AGE A;  4FD5 A;  4C2X A;  2QEC A;  2R98 A;  3PP9 A;  3BJ7 A;  1V0C A;  3TOB A;  4CS0 B;  2VQY A;  2JDD A;  4KLV A;  1P0H A;  2VEZ A;  4CAW A;  1KUV A;  1Z4E A;  3D2M A;  1Q2C A;  4RS2 A;  2Q4Y A;  2FXF A;  4QUS A;  4XPL A;  3LOD A;  2PR8 A;  3E0K A;  4II9 A;  3S6F A;  4C68 A;  3EC4 A;  4KUA A;  4Q38 A;  2OB0 A;  3V8I A;  4A30 A;  1ON0 A;  4KVX A;  2EUI A;  2G3A A;  2OZU A;  2WUU A;  2ZPA A;  2H5M A;  5DWM A;  4JLY A;  4UBR A;  1N71 A;  2B3V A;  2REE A;  1IYK A;  2DXQ A;  1YGH A;  4XNH C;  3OWC A;  4A33 A;  2D4P A;  4A32 A;  4E0A A;  1BO4 A;  1S7L A;  4A95 A;  2Z11 A;  1YVK A;  4JJX A;  4A2Z A;  2VZZ A;  1LRZ A;  4CYO A;  4C7H A;  2AJ6 A;  2I00 A;  5F48 A;  3KKW A;  4JXR A;  2CNM A;  4PV6 A;  2KCW A;  4U5Y A;  2HQY A;  3DNS A;  3ZJ0 A;  3S6G A;  3GYA A;  1XEB A;  4B13 A;  4XPK A;  2Z10 A;  2B4B A;  4BBH A;  1J4J A;  3GY9 A;  2CNS A;  1M44 A;  2RC4 A;  2G3T A;  3K9U A;  4AVB A;  1YX0 A;  1IIC A;  3TCV A;  2AE6 A;  4L8A A;  2Q0Y A;  4X5K A;  3JTK A;  4UWJ A;  4YFJ A;  1S60 A;  4B5P A;  3IU1 A;  1K4J A;  3TO9 A;  4PSX A;  2CNT A;  4ONU A;  4K30 A;  2Z3N A;  2BEI A;  4OLL A;  3DR8 A;  3B8G A;  4KSA A;  5AG6 A;  3MGD A;  4LUA A;  5CNP A;  1VKC A;  1IB1 E;  3G3S A;  3F5B A;  4YGO A;  2PQ8 A;  1YVO A;  3ZZI A;  4B10 A;  1MJB A;  4CRZ B;  2YNC A;  1YK3 A;  4UCP A;  3R96 A;  3QAH A;  1WWZ A;  3IU2 A;  2B5G B;  1YR0 A;  1KUY A;  3F8K A;  4NXY A;  3TTH A;  3I9S A;  4F6A A;  3CXQ A;  2JDC A;  1M1D A;  2OU2 A;  4RI1 A;  2CY2 A;  2R1I A;  1MJ9 A;  4HNY B;  4ORF A;  2P6F A;  2VXK A;  5F49 A;  5G21 A;  4CAE A;  4EVY A;  2QIR A;  2ZW5 A;  2BSW A;  4GS4 A;  4M85 A;  5JPH A;  3SXN A;  4BMH A;  1Y9W A;  4U9Y A;  3P2H A;  3TFY A;  4KUB A;  2FIA A;  2Q44 A;  4MI4 A;  3BJ8 A;  3EO4 A;  4KVO E;  1XIX A;  5J8F A;  2J8M A;  1WK4 A;  1I1D A;  1XE4 A;  2O28 A;  4H89 A;  1ZO0 A;  2GE3 A;  3PGP A;  4CGN A;  3TO7 A;  5EC4 A;  4E8O A;  1IYL A;  4UFV A;  5I0C A;  1B6B A;  2WPW A;  4UCM A;  3R95 A;  4QC6 A;  1XMT A;  3LD2 A;  4J3G A;  2FCK A;  4KOY A;  1IID A;  4AG9 A;  2Q4V A;  5C88 A;  3JUW A;  2B3U A;  4MFJ A;  2Y0M A;  2ZW6 A;  3A9L A;  3TOA A;  3IWG A;  5F47 A;  3DDD A;  2JEV A;  2OH1 A;  4KOS A;  4KVM E;  2B4D A;  2CXA A;  3T9Y A;  2HUZ A;  2FIW A;  2YND A;  5A28 A;  4NF1 A;  2P0W A;  4C7I A;  3FNC A;  1BOB A;  1QSM A;  2B4D B;  3RYO A;  5G20 A;  2X7B A;  3CXS A;  2B58 A;  1UFH A;  4CGM A;  3R9E A;  4AG7 A;  4R87 A;  2GIV A;  3WR7 A;  3I3G A;  1QSR A;  3CXP A;  2VZY A;  5HH1 A;  3QB8 A;  1QSN A;  4B11 A;  3IWE A;  4CGO A;  1M4I A;  4PSW A;  1Z9U A;  2Z3P A;  2DPS A;  3P2F A;  4CAF A;  4MFZ A;  4U9Z A;  3FRM A;  4L89 A;  4F0Y A;  2D4O A;  3VWE A;  4UFX A;  4R3L A;  1Q2Y A;  2Q04 A;  5JQ4 A;  4UFW A;  2YNC C;  4YRH A;  2QML A;  5KTA A;  3TT2 A;  4R9M A;  4I49 A;  1M4G A;  1P4N A;  1FY7 A;  5H86 A;  4PK2 A;  2FT0 A;  4Y49 C;  5H84 A;  3DSB A;  3EXN A;  3BLN A;  2Z0Z A;  5IX3 A;  4C2Y A;  1Z4R A;  5KTD A;  3N7Z A;  2PR1 A;  2OZG A;  3H4Q A;  4OAD A;  3R9G A;  1OZP A;  2PDO A;  4XPD C;  5G1Z A;  2YGW A;  1S5K A;  3SXO A;  3GKR A;  4MFP A;  1RXT A;  4XNH B;  3TO6 A;  4A31 A;  1XF8 A;  3JVN A;  2A4N A;  4NCZ A;  5DWN A;  4Y49 B;  3R9F A;  1I21 A;  3FBU A;  1S7F A;  1U6M A;  2PRB A;  2FL4 A;  2DPT A;  1MJA A;  2ATR A;  4CGL A;  3G8W A;  2PSW A;  1MK4 A;  2P6E A;  2P6G A;  4B14 A;  2J8R A;  3EY5 A;  4UCN A;  4CGP A;  4KLW A;  4PK3 A;  4KOV A;  3W6X A;  4CYP A;  5E96 A;  2BL1 A;  4B5P B;  4QBJ A;  2Q7B A;  1NE9 A;  2J8N A;  1RO5 A;  2ARH A;  4F0X A;  5BWA B;  4R3K A;  5G22 A;  2R8V A;  2G0B A;  5C82 A;  1PUA A;  4QVT A;  3H5Z A;  2ZW7 A;  3T90 A;  4CRY B;  4KSF A;  4H6U A;  1NSL A;  4DNC A;  1Y7R A;  2Z3M A;  4KOT A;  3W91 A;  4C2Z A;  3PZJ A;  4CYQ A;  1L0C A;  3VWD A;  5FVJ A;  2Z3K A;  1S7N A;  4FD7 A;  4KS9 A;  2BUE A;  3IGR A;  2EVN A;  4AB7 A;  4AVA A;  1GHE A;  1YLE A;  3SHP A;  4KZT A;  4KOX A;  2Z3L A;  3R1K A;  4HNW B;  4IF5 A;  3S6K A;  2FSR A;  4KOR A;  4FD4 A;  1I12 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...