2FL4A

The crystal structure of the spermine/spermidine acetyltransferase from enterococcus faecalis
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
147
structure length
147
Chain Sequence
GMEIHFEKVTSDNRKAVENLQVFAEQQAFIESMAENLKESDQFPEWESAGIYDGNQLIGYAMYGRWQDGRVWLDRFLIDQRFQGQGYGKAACRLLMLKLIEKYQTNKLYLSVYDTNSSAIRLYQQLGFVFNGELDTNGERVMEWTHQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords spermine/spermidine acetyltransferase
publication title The crystal structure of the spermine/spermidine acetyltransferase from Enterococcus faecalis
rcsb
source organism Enterococcus faecalis
molecule tags Transferase
total genus 36
structure length 147
sequence length 147
ec nomenclature
pdb deposition date 2006-01-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.900 Mainly Alpha Orthogonal Bundle Helix Hairpins The crystal structure of the spermine/spermidine acetyltransferase from enterococcus faecali 2fl4A01
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 2fl4A02
4IF5A 2R7HA 3D2MA 2KCWA 4MHDA 2D4PA 3TOAA 2HV2A 3FBUA 1J4JA 3F5BA 4YGOA 4DNCA 3OWCA 1UFHA 1SQHA 1R57A 4UWJA 2JEVA 3UY5A 4H89A 2I79A 3EFAA 3EY5A 4AVAA 1RXTA 2G3TA 4KLWA 4U9YA 4YFJA 4EVYA 3BJ7A 1Z9UA 3V8IA 2ZPAA 3JVNA 5KTCA 3W6XA 1S60A 2OH1A 3RYOA 3TCVA 1B6BA 2R8VA 1K4JA 4ORFA 3S6GA 1TIQA 2HUZA 2PQ8A 1M1DA 4JD6A 1NMTA 1XEBA 4PK2A 4IUSA 4QUSA 2FL4A 4L89A 1QSTA 4NCZA 2J8RA 4QB9A 5DWNA 1IB1E 1IYKA 2B3VA 2P6EA 2VZYA 3R9FA 2FE7A 5F47A 1MJAA 4LX9A 2Z11A 3E0KA 4B5PB 1KUYA 3VWDA 3WR7A 3FXTA 4H6UA 3SHPA 4KVME 2CY2A 4RI1A 3LODA 5IX3A 2C27A 3EXNA 3CXQA 4KUAA 4KOSA 1S7FA 2CNMA 4MI4A 1YK3A 4OAEA 4KOWA 1XE4A 2OZUA 2P6GA 3NE7A 2Z10A 1I21A 2QECA 2PDOA 4CS0B 5F49A 4E2AA 4NXYA 2B3UA 2FIAA 3G3SA 2D4OA 2O28A 2Q4YA 5HMNA 3TOBA 2VXKA 5GCNA 4I49A 5FVJA 4R87A 4JXRA 4MY3A 1S7LA 1V0CA 2I00A 5CNPA 1M4GA 5F46A 3MGDA 4B5PA 4M85A 1Q2YA 5EC4A 2PC1A 5H86A 5HH1A 3VWEA 2FSRA 1VHSA 2R98A 2P0WA 2H5MA 5KTAA 4CAXA 3IWGA 1BO4A 4H6ZA 1M4DA 2G0BA 3KKWA 4RS2A 5J8FA 5C82A 4LUAA 1Y9KA 3TE4A 5H84A 1P0HA 3C26A 4XPKA 1QSNA 2Q4VA 1OZPA 1YLEA 4GS4A 3TO9A 5JPHA 2OZHA 1M4IA 3SXOA 2BEIA 1NE9A 2JLMA 3ZJ0A 3W6SA 2F5IA 4HNXB 2EVNA 2FIWA 2ARHA 2VEZA 2Z0ZA 3FRMA 2B4DB 2PR8A 2OZGA 2DXQA 2ZW6A 3TFYA 2GE3A 1KUXA 3I9SA 1S7KA 4HKFA 2VI7A 3GY9A 4AG7A 3SXNA 2FCKA 4HNYB 2FXFA 2AJ6A 2OU2A 4YRHA 4BMHA 2WPWA 4FD4A 1L0CA 3LD2A 4UWIA 2EUIA 2WPXA 1RO5A 4NF1A 4ZBGA 3W91A 4AVBA 3EO4A 3PGPA 4XNHB 1QSOA 2NMTA 5IB0A 4MY0A 2VZZA 3QB8A 1IIDA 3DNSA 2PR1A 3N7ZA 2G3AA 1YVKA 5DWMA 4FD6A 4CAVA 3F8KA 2CNTA 1XMTA 1YX0A 4XPLA 4R3KA 3S6HA 2AE6A 2X7BA 4ONUA 4JXQA 2A4NA 2B4DA 4U5YA 3FB3A 4JLYA 1KZFA 1MJ9A 3S6FA 4E0AA 5F48A 3B8GA 1GHEA 1I1DA 1YR0A 3QAHA 2ZW7A 1P4NA 1KUVA 2ZXVA 2JDDA 3TO7A 2BL1A 3F0AA 1B87A 3R1KA 1XIXA 4F0YA 2B5GB 2OB0A 2P6FA 5E96A 3T90A 4AG9A 3R9EA 2GANA 4QC6A 1MJBA 4AB7A 4X5KA 4NSQA 4J3GA 1N71A 1S3ZA 2BSWA 2RC4A 3R96A 4K30A 3I3GA 2Q04A 1QSMA 3D3SA 3DR6A 1ON0A 1I12A 1IYLA 1QSRA 3PZJA 4KOYA 2JDCA 2REFA 3TTHA 3BLNA 4PSXA 3DDDA 2HQYA 3FNCA 2PSWA 5KTDA 4UA3A 3GKRA 4XPDB 4Y49B 3JUWA 3S6KA 2BUEA 4KOTA 4CRZB 2IL4A 4HNWB 1Z4RA 1NSLA 2CNSA 4CAWA 4B5OA 4FD5A 4OLLA 5J8CA 3T9YA 2B5GA 4U9ZA 2R1IA 4JJXA 2ZW5A 4KVXA 2Q44A 4KVOE 3DR8A 3BJ8A 1Y7RA 1BOBA 4XNHC 3DSBA 4OADA 3D8PA 2FT0A 1Z4EA 2K5TA 3P2FA 4KLVA 4KOUA 4R3LA 1WK4A 1MK4A 4R57A 1YGHA 5IV0A 1FY7A 2ZW4A 2B58A 3IGRA 4NEXA 3D2PA 5JQ4A 1YREA 4II9A 4PSWA 3H4QA 1Y9WA 4FD7A 4JWPA 1M44A 2PRBA 1IICA 1YVOA 1U6MA 4AVCA 3CXPA 4M3SA 2FS5A 2Q0YA 3TO6A 2B4BA 1VKCA 3R95A 5EBVA 4E8OA 2GIVA 2J8NA 2VQYA 3GYAA 1WWZA 4MBUA 2Q7BA 4KORA 4UBRA 2J8MA 3K9UA 4KZTA 3R9GA 1Q2CA 4L8AA 2VBQA 3FIXA 4QBJA 3CXSA 5I0CA 1XF8A 3EC4A 3TT2A 1S5KA 4KOXA 1PU9A 4KOVA 2QMLA 5C88A 1S7NA 2ATRA 3G8WA 4CRYB 3P2HA 4PK3A 4PV6A 4KUBA 4MJ8A 1LRZA 4F6AA 1CM0A 1PUAA 2Y0MA 5ISVA 3FYNA 4QVTA 4R9MA 3ZZIA 1Q2DA 2QIRA 2REEA 1CJWA 4XPDC 4Y49C 3PP9A
chains in the Genus database with same CATH superfamily
2ZNJA 3APQA 3D2MA 2ZEFA 1YTFD 5JH7A 4X8AA 1KD1W 4MHDA 3TK1A 2A3QA 3CS5A 1YXBA 3F5BA 2ZIOA 1A32A 4DR4O 4OC2A 4YGOA 4FIPC 2OT5A 3UY5A 1R43A 2EZPA 3ZN1A 4A2ZA 3MD0A 1FFXB 3RVYA 2YEVA 2EILB 4I50B 4U9YA 4YFJA 5LYJA 3JD2A 4O4JA 2P5OA 3IWWA 4EVYA 2EIJB 3Q4HB 4KSFA 1BMFG 2H94A 1B6QA 1GAXA 4ZY0A 5G21A 3FX6A 5EBLC 3V7ZA 3AG2B 4PI0A 1S60A 1QMUA 3C3TA 2OH1A 4H13B 3HR0A 1MA1A 3RYOA 3UQ8A 1B6BA 1LCPA 1TAEA 1S3JA 1TIQA 3LMSA 4LFCO 1ZL8B 3B40A 1BHAA 1YZBA 3ZRVA 1M1DA 1NQTA 3KR4A 3LDCA 3B3TA 4XBFA 4FLVA 1YQEA 2ZENA 3JTKA 1K73W 4Z65A 1OCRC 5EBMC 2PGGA 1Z5WA 4K0KB 1QSTA 2C2AA 5DWNA 1IB1E 2B3VA 4GX5A 2P6EA 1DF5A 2OWOA 3V38A 4XDJA 1VF6A 1PL4A 4QIWF 4HPSA 1Q82W 3E0KA 2ZEPA 4PA6A 1KUYA 4X1KB 3CCSV 2E76B 2Y0IA 3ABKB 1XQ8A 5KA5A 5C8YB 2AHYA 5BXZA 1QHTA 3SHPA 4TV9B 2O4HA 3QF7A 2ZE6A 5J2TB 4F9UA 4PD4F 4DV6B 3HKEA 2RN9A 5JCOA 3U10A 1MNGA 3ETGA 1Y4MA 1IURA 2EJRA 4L8JA 3QTCA 3CXQA 4MCRA 1XMQB 4JI6B 4J10A 4CH5A 1TKJA 4OAEA 3B77A 4KSIA 4NVPA 2ZXWB 4KOWA 4MTOA 4JZ0A 4J7JA 1XE4A 5EZYA 2Z10A 4AILC 2PDOA 5KAIZ 4UF4A 5F49A 2IM9A 4DW1A 2B3UA 1UJWB 3K59A 2PRQA 1YSCA 2VS0A 2Q4YA 1ZG9A 3D66A 2F1MA 3IEHA 2HHHB 1QLEC 2PJ7A 2LW1A 2D3OW 4K8ZA 5FVJA 4NXNO 4DW0A 2DW4A 1S5HC 4IHJB 1BZKA 2DWEC 5K8PA 4IGGA 1KKCA 1XI1A 3QG5A 1VF6C 3RFRA 1FXHA 4OC5A 4LFAO 1ZTEA 5HH1A 4WCEV 2ZCEA 1Q7LA 3RVZA 1BGYH 1YDXA 3WC5A 2KB1A 2YIBA 3MDSA 1DLBA 1BO4A 3HKDB 4X1YB 3K58A 2Y69B 4MVZA 5HFMA 2GTAA 4UEFA 5C82A 5JCOC 2QWQB 2YSUB 3N2GA 2WYRA 2RMKB 3TE4A 4TWEA 2YIDA 4XPKA 2L35A 4CH3A 2E5LB 4JI5B 4QE9A 5JPHA 2OZHA 1EN5A 1M4IA 2R9AA 3ZRSA 4DUYB 3ZMZA 3SYAA 2BEIA 2ZEOA 3SXOA 2JLMA 2P4KA 3E35A 4UEEA 4ICGA 3GVMA 3NH5A 1GN2A 1R3IC 1ORQC 1YW4A 2RFHA 3SI1A 2QWNB 4MS2A 2PR8A 2OZGA 2QDOA 2CTQA 1IBMB 3OR7C 4NXMO 1KC8W 3I9SA 3LDDA 3FFQA 1KWMA 5BZBA 4WFGA 2VI7A 5K8MA 4FM2A 3IU2A 2YXLA 2W0XA 2C6CA 1FYJA 2V8GA 1DGSA 2Z0AA 2OU2A 2BCCH 1ROPA 2W0FC 1M9NA 3E89A 4DR3O 1Z8XA 4FD4A 1H8EG 3B8MA 4NF1A 3A0BZ 1HNZO 5CBMA 3K0DA 3AG1B 1ZSPA 2QM4A 3K03A 4FFKA 2IH1C 3QB8A 1LR1A 5KHHA 2Z3KA 1IIDA 4GUNA 2EBJA 2DJVA 1EM1A 5DWMA 3MHSC 2ITDC 3E2EA 4RAIA 1LANA 3BVOA 3RYHA 2CNTA 4ZOLA 4AHCA 2JRIA 4BW5A 2ANPA 3S6HA 2AE6A 1ARLA 3G6EV 5J2UA 4YHHB 4ONUA 5KX5B 3A9LA 3N5FA 1FKAO 2EINC 2BOAA 2A4NA 4B10A 2AFZA 4JTDB 3T1YB 4CYNA 2CH7A 2IU0A 3D7HA 1MJ9A 1ZLZA 1K5SA 1XL4A 4FJCC 4LH7A 1WP8A 1VQMV 4U3JB 4YJ2A 2DWDC 1KUVA 2Z5UA 2VQFO 4OPHA 1G1XB 1B87A 1IXBA 4HNAB 1XIXA 1FXKA 4UXNA 1SQXH 1Y74A 2GDSA 3UO3A 1GH6A 1N34B 4CGLA 2QJ8A 1AI6A 4BWAA 4CS2A 2GHYA 3DC6A 3CPAA 4AG9A 3AG3B 1MJBA 4AB7A 4B3MB 4EMEA 2M6YA 3OW2U 1EZVH 2P4VA 1S3ZA 2PJBA 1IXMA 1IBLO 2BSWA 5L3GA 2P6JA 4Q6GA 3GB7C 4DUZB 4PA3A 3TC8A 2Q04A 3ML0A 1F23A 2JGDB 4FLUA 1OCOC 1QVFU 2AFMA 4MFKA 4X64B 3QVNA 1I12A 2JK5C 4UFVA 1HNXO 4C7HA 3PZJA 2K9PA 1HR0O 4BR6A 1BLLE 5LMNO 4QNHB 1N36O 2Y0PA 3JD4A 5IYZA 2XAGA 2V77A 4PSXA 2V1DA 3EHBB 2O53A 2N04A 4JYAO 3R66A 4MXUA 4ZY1A 1LUWA 3HKBA 1Y67A 4YY3O 2EK9A 5D5PA 4XPDB 2IJKA 3DXRA 5EBWC 2OOTA 3ICXA 1KP3A 1PNMA 4FM0A 2AHZA 4KOTA 3KCYA 4CRZB 4R50A 1NSLA 1K92A 1W0KG 3CHXA 3VQWA 3LUTB 1Y6XA 2BSKA 4P2ZA 1F2PA 4B5OA 4A37A 4OX9B 3ZRWA 2HG5C 2FVGA 5KHKA 2XEGA 2EIKB 3T9YA 2B5GA 4WWVA 3B2EE 1FNOA 3ISXA 2VWKA 1FXKC 2JVDA 1RTQA 3SPHA 1Y7RA 4Z1MG 3OGCC 4NTWA 4PXBA 4MRIA 1BOBA 2RQ6A 2A0LA 4F4LA 3DSBA 1BQ0A 4HBNA 4JTCB 2XAHA 4TUYB 4NFRA 3D8PA 4OADA 4FLZA 4GX2A 5CA0B 2RB7A 4MTFA 4N21A 2UUAO 2K5TA 1M5IA 4R3LA 1VF7A 1H2MA 1MK4A 5LYIA 4FLXA 5IV0A 2W6IG 3H1HH 5JJEB 4NGTA 3KGQA 1H38A 4IL6Z 5LXTA 3FAVA 1YJ9V 1XHZA 2UU9O 4DO2A 3T2MA 2IQ6A 4II9A 3H1KH 4JI8B 4TWKA 1M44A 3DTUB 4EEQA 2PRBA 1GO3F 2YXYA 4F6EA 1X12A 1YHQV 1AYEA 1U6MA 1J5EB 1XNQO 2ZR2A 2HFEC 2RNBA 2C6GA 1ENVA 1NS1A 2B4BA 4MFLA 4TNUA 2BTOA 2Q67A 4GZRB 2CUGA 3ZMTA 1DK1A 2WSAA 4CAEA 6CPAA 3RBZA 2GIVA 2J8NA 3GYAA 1TUEB 3TJTA 2JEWA 4UCMA 5LHGA 4O23A 1NZ6A 2BO9A 2RCVA 4CYOA 4GYCB 1FPOA 3K9UA 4X66O 4F0XA 1Q2CA 2VBQA 4L8AA 2QYVA 1JJOA 3FIXA 5THWA 1F4NA 3CCRV 1BPMA 2WLIA 1P4RA 1AI7A 2Q51A 1S5KA 1QCEA 3TXSA 5LA6A 4ABMA 1RM1B 3IFXA 7CPAA 4R6ZA 4OXSA 3NA6A 5K1XA 5CA1A 2QMLA 5GONA 3S9MA 3G8WA 2YNEA 4JAAA 4J9ZB 4WFHA 1M1KW 4I4TA 5IYBO 1NH2D 3GWKC 1N33B 4KUBA 4X62O 4WFFA 1OCCB 1LRZA 4GKJB 1CM0A 3JARB 1PUAA 4I9WA 1BSMA 2BOCC 3ABLB 3N2KA 3T8WA 5FNVA 4JI0O 2Y4TA 1XILA 1AI5A 4LF7B 2PI5A 1BL8A 4MFQA 2QIRA 3ZRXA 1CJWA 4Y49C 1DF4A 3GB0A 1XFOA 1K5QA 4X20B 1XNRO 2Q7HA 1AR1B 1ZLIA 4A33A 3JYCA 2BE3A 2D4PA 3H1JH 2POKA 1NTKH 4CS4A 4DR1O 3FBUA 3HUVA 4WFEA 4A38A 1AB3A 4A5UB 3OWCA 2XTAA 4ONWA 3CRRA 1R57A 4UWJA 3CPWU 1Q5OA 3C90A 3B3CA 2WA4A 2R70A 4ZX8A 2WLLB 2I79A 1GRJA 1RXTA 4KLWA 2XT9A 2UUCB 1FAFA 5CBFA 1PPJH 3CCVV 2HC9A 2L6LA 4UCVA 4O4IB 2PVWA 1AROP 4KL1A 2KSDA 1CX8A 1BE3H 3W6XA 1YW6A 3X2QB 2ZOGA 2WA3A 1URFA 2ZD9A 4O2BB 3KCXA 4FZ0A 4DV0B 2R8VA 3KHZA 4UB8Z 1K4JA 4ORFA 2PI4A 3SJGA 2GUZB 2HUZA 1IBKO 5B1AC 3IWEA 1WA8B 5HVHA 2IJZA 3ASNB 3JD3A 1XEBA 4MW8A 1VQ6V 2GLJA 4JI4B 4IUSA 3ABMC 1VQ9V 1YITV 2Q73A 3ZMVA 1S5LZ 2VZYA 3TGUH 1CXZB 4LX9A 1LNQA 3IFEA 1KQSU 4EB6A 4B5PB 3BA8A 3VWDA 3IJ3A 4NGSA 4PA4A 2GV9A 5DM6V 3FXTA 1ZX3A 5LOVA 4H6UA 4KVME 5G20A 2X6AA 2AZ2A 3STZC 2C27A 4P9OA 2BTQA 4FWUA 1MABG 4DR4B 4FUUA 1MMMA 3ZHQA 4X2TA 1TA8A 3PN1A 5DEDA 4ZI7B 5IDJA 1S7FA 4KOSA 5IE9A 2CNMA 2A9HA 3L71H 4CS3A 3E22A 5EC2C 2RJZA 3ASOB 4D6TH 2V8HA 2LFSA 5B1OA 2JGUA 1KKDA 2F23A 3LSSA 4ZHQB 1CPXA 3M7MX 2ZQMA 2OZUA 5KMGA 2P6GA 4KP4A 5F2VO 1Y76A 2H8PC 4MT8A 5B3SC 4MHZA 3CD6V 1YJWV 4E2AA 4CC5A 4HAMA 4DRXB 5IWAB 1V55C 5EIBC 1CBXA 2CDYA 4J80A 2Z3MA 3W7SA 2UUBO 3GUXA 4B7EA 3TOBA 1V54B 3JATA 1AJQA 3ZX6A 2PJ2A 2R9IA 4DYOA 5FL7G 4J11A 4JXRA 1I94O 2LGWA 2UXNA 2NYQA 1R3NA 2E75B 1MG1A 2X6BA 5KAFZ 3TXQA 1M4GA 3OM3B 1HNWO 1QU7A 2UXCO 5HVFA 1GM9A 2PCUA 2CXAA 5H86A 4UFZA 3CX5F 3RAMA 1F51A 1ZWIC 3K5MA 3TCUA 1TXRA 2XEFA 1UPGA 4YJ3A 5L3FA 2H5MA 2JS3A 3D7FA 1M4DA 2G0BA 2AXTZ 5J8FA 1US6A 1I5YA 1SC5B 4P4BA 4JI1B 5AG5A 4X65O 4UFXA 3F5WC 1QSNA 4M6IA 3SYOA 1HDUA 1YLEA 3JASB 1A2ZA 2Z3OA 3RYIA 1NE9A 3ZJ0A 3ETQA 4HNXB 1QQCA 4KFMA 3JAMN 1UFIA 3LACA 4OIWA 2ZEGA 2AZ0A 2ARHA 2VEZA 5CBHA 2Z0ZA 3K5LA 4LFBO 2XNDG 3PB6X 3W7UA 3WC7A 2ZW6A 4C7IA 3G6BA 3G4SV 3TFYA 2GE3A 1KUXA 3P3PA 4EFDA 4TQDA 1NBMG 3GY9A 1W0JG 4AG7A 1AMPA 1IU8A 5ITZB 1KYOF 4B12A 3KL9A 4EFBA 2ZKOA 4LNUB 1H2GA 5JM6A 3CRAA 4YRHA 4BMHA 4AQYO 1XBLA 2WPWA 3H8FA 4A32A 1YTFB 4ZBGA 3W91A 4FBEA 3ETEA 4BIOA 3EO4A 1E1RG 5JQGB 4QPKA 3GIUA 2EWBA 2NMTA 4ZGYB 1THZA 1MSWD 2VZZA 4BIUA 4F6RA 2DEAA 1IDSA 4OGQB 4PDRA 3BPZA 4DR2O 4DR6O 1NTMH 1R6KA 4ZY2A 4AXVA 3K9AA 1ZO0A 2PUSA 3D68A 5K1PA 4LFAB 4FD6A 3IO1A 4CAVA 2EULA 1JMKC 5IJ9B 4Q7AA 5LRJA 4LF6B 1I08A 4XPLA 3VBBA 2DYSC 4R3KA 2Q43A 2Z3LA 3P32A 1PP9H 4B13A 1QBZA 5KUKA 2DE0X 4Q36A 3VQXA 4WBNB 1LAPA 2IJHA 4CPAA 3W7XA 3U11A 2P90A 4UEZA 1B06A 2B4DA 3L72H 4A95A 1WPBA 5EYPA 1PM9A 4JLYA 2KG7B 5IB9A 4GX1A 3LSUA 4JZGA 1XEQA 5AG2A 5KHJA 4PXEA 1M90W 1M56C 2YNDA 1K7DA 3RN4A 4E0AA 1GN4A 3JSNA 3B8GA 1N32B 1R1BA 1GTOA 1YSJA 2A06H 4O2AB 2OIGA 1P4NA 3OEEG 1SZTA 3T1CA 3KQXA 1XJOA 3TO7A 4FLWA 3AG3C 5IYCO 4A94A 4P4JA 2QEXV 4F0YA 1MZEA 2PYLA 4NXMB 3FB5C 4DV5O 1Q6IA 2OYQA 2P6FA 1NSAA 4BBHA 3LNMB 2OCHA 3R9EA 3CJHB 2GANA 2AFSA 3JD1A 4X5KA 4NSQA 2UXDB 4J3GA 4O4LB 3OE7G 5BMVB 3EFFK 1HW7A 2MW2B 3GWOA 4K0KO 1CP9A 5LYLA 1PCAA 3R96A 4LC1A 4K30A 2FTKA 2ZE7A 2NSMA 1PKXA 2VQEO 1QSMA 3D3SA 1TUBA 5IJ0B 3DR6A 1IYLA 3JALA 1N8RW 1XMBA 1D5AA 4LF5B 1GKFA 4PA7A 1DE4C 5LBQA 1EN6A 1VHOA 1S76D 5CB4B 4LWSB 2REFA 1KECA 1JR9A 1VQOV 2IH3C 4CGMA 1OBRA 3QAYA 5D5QA 1M4LA 3DDDA 3FNCA 2WLNA 4DV6O 5KHIA 1EBOA 2R9RB 4JF3A 4J9YB 5KTDA 1GM8A 1Z5VA 3GKRA 1JX9A 3JUWA 3FEDA 3S6KA 3STLC 4MW3A 4OIDA 2WWWA 4HNWB 4DR7B 3CPXA 2CGOA 2XASA 4JI6O 4CAWA 1K97A 3JCUZ 2D2CB 5J8CA 4EWTA 3JAKB 3H1LH 4IIJB 4PDLA 4UIBA 3CYOA 4DV2O 5LMUB 4CH6A 3FKSG 3SJXA 4U9ZA 2R1IA 3RYFA 3HPLC 1XOUA 3BY6A 5JGFA 2ZINA 4B11A 5LYFA 3I56V 3B4SA 1XRYA 1K8AW 1NU1H 2Q44A 4OC1A 4UV9A 4CC6A 1WB8A 4XNHC 2VQFB 4WJBA 4KXRA 2Y4UA 4O4HA 1KBHA 4UFWA 2HHHO 4NGQA 2VRZA 1LOKA 2CGNA 3H9VA 1RSOA 5JVDB 1Y66A 4DR5O 1YCIA 3P2FA 2Z3PA 1EZJA 5K8OA 1VQKV 3SPJA 1YGHA 2ITCC 1FXVA 2C6PA 3RYCB 5CBGA 3H1IH 2HLDG 3NH4A 3I55V 1IBLB 4DV7O 1LAMA 5L3DA 4YIOA 2ABZA 3AEIA 3VQYA 2X7RB 4JYCA 2X6CA 1XREA 1S5JA 4G28B 1PV0A 1Y9WA 4OP4A 3MN8A 3FB7C 1L0LH 1OCRB 4DK1A 1YVOA 2EX3A 4NYKA 4G1PA 1WLEA 1NJIW 2DMXA 3UT5B 1KMIZ 2LP7A 1HNXB 4PELA 4I55B 1YMEA 4I0XB 1HR0B 5LMNB 2CAZC 1QQ9A 2Q0YA 3LSQA 4PDVA 4LF8O 1VKCA 3R95A 1NVPD 2F4VB 2HKOA 5AGEA 4E8OA 1SA0A 5BR8O 4JI5O 2VQYA 4JYAB 4CYQA 5JH7B 4JYBA 1S77D 5LP6B 4MBUA 4KORA 3B8NA 1WB7A 2OCCC 3HB3B 2J8MA 4R8CA 4BINA 3K2KA 4O4IA 5I4MA 2DQ3A 4OPAA 4UCOA 4JV5O 2YICA 4QBJA 1IBMO 2F95B 3CXSA 1K3EA 2YEVB 4FVMA 5LGTA 3EC4A 4O2BA 5LYJB 4O4JB 3WFVA 1SQGA 2EK8A 4PXDA 4KOXA 5B5EZ 4A31A 1XBUA 4KOVA 1R6TA 1ZAUA 2AFXA 3SJAC 4CH4A 1WP7A 4MMOA 3CCEV 1M57C 1R6NA 2YDEA 3OMAB 1S7NA 2F43G 4X88A 4PK3A 2ZEHA 4PV6A 2ZEEA 2HB6A 1QNMA 2V4DA 2UUAB 2WPDG 3CRMA 3JAWA 3ZN0A 1JA8A 1Q8IA 1QLEB 2QKSA 1G6UA 5IYDO 1M4UA 2YUAA 4GLXA 1Q2DA 3OEHG 1Z2LA 4JYYA 3L75H 2UU9B 4NR1A 1YF2A 1NVPB 2GTSA 3EVKA 4YU9A 2JBJA 3K08A 2R7HA 4L87A 2KCWA 4DV1B 1ZLHA 1Q7YW 4LF9B 3TOAA 2HV2A 1J4JA 2ZIMA 2UXBO 2IBZH 3WC6A 3FYIB 3RGBA 2DPSA 4DNCA 1SQHA 4CBCA 1VEWA 3HKCA 3SPIA 3WB0A 3CCQV 3EFAA 4BD9A 2PJ9A 3D7GA 4MFPA 1U97A 3CRCA 2G3TA 4AVAA 2IJIA 2YS8A 3HKEB 1W2BU 1ZUQA 3BJ7A 3TETA 3BRCA 2Q5ZA 2PJ8A 3V8IA 2YIBD 1LUVA 4PPZA 3P30A 3JVNA 5KTCA 4X66B 2Z3NA 2FYUH 4XDLA 3F5TA 3BA9A 3IAYA 5A2QN 3TCVA 3ASNC 1Y0RA 4ZKIA 4GX0A 1N34O 1AILA 4X1IA 1Z2GA 5L3EA 2PQ8A 5EZYB 1JFFA 5E79Z 3H01A 5IY5B 4TV8A 1NMTA 3D67A 4MVUA 2PJ1A 4FAIA 1EFRG 4PK2A 3AG4C 3WABA 1TKHA 4QUSA 2FL4A 3B3VA 2IU3A 3K3WA 3CRQA 5H5NA 4X62B 3W7WA 3CXCU 1IYKA 4C2ZA 3R9FA 4RQEA 2FE7A 5F47A 2V8DA 4X64O 1KP2A 4JI2O 4FLTA 3UM7A 5JWPA 3KASA 3PJSK 2JDIG 3FYEB 1WPXA 2FKXA 1VQ7V 1PYTB 1B3QA 1FFXA 2QWPB 4I50A 4P6YA 3Q4HA 2F8HA 2AFWA 4P4IA 4P44A 4DR1B 3B09A 4MHNA 2ZEMA 4C2XA 3N2GB 3OT7A 2B1IA 1VIXA 4KUAA 3K9TA 4MI4A 1JPXA 4X8IA 3A2FA 1VQLV 2QKAA 4OX9O 4LBEC 4OC3A 3ISZA 3IC9A 3OMNB 4TQFA 1K34A 3PBBA 5F09A 1Q6HA 5B1BC 1K4CC 3WG7C 2EINB 3NE7A 5D8NA 3LDEA 1ZL8A 1I21A 2QECA 4P4DA 3CB2A 1S72V 3JD0A 4OC0A 4DV3B 1DTDA 4NXYA 2FIAA 3A8TA 4JI7B 2D4OA 4B3TB 5CA3A 2M7WA 4P4EA 3IIBA 4TSFG 1AP5A 4B3SO 1NTZH 1H8HG 1IBKB 4R87A 2QKCA 1SESA 1S7LA 1V0CA 3IU1A 2HR3A 4B3RO 4P30A 2F66C 4Z1VA 5F46A 3PB9X 3B3WA 4X1KA 4ZIBA 2WLJA 1Q2YA 1P7GA 4A39A 1OCZB 4E4EA 5C8YA 1E1QG 3VWEA 1K4DC 4RO2A 3BFRA 5A9GA 2FSRA 4TV9A 3ZS8C 1VHSA 4JI8O 5J2TA 2VL1A 2P0WA 3G80A 1GK9A 4CAXA 4YIPA 1FJGO 2EILC 2ODMA 5KA6A 1J5EO 4LP8A 2EIJC 2BCOA 4LUAA 1Y9KA 4IAVA 4OKOA 1WAZA 1OCOB 2LO1A 2OR4A 5H84A 1JWQA 3GLJA 1P0HA 4FZ1A 2Q4VA 3AG2C 3ZEDA 3RYHB 1OZPA 1VMGA 2NR5A 4ZOLB 3SPCA 4C68A 3TO9A 1IOFA 3OTOO 1D2DA 3CC2V 2ZM6O 2PY5A 2F5IA 3CMAV 4NJQA 3FH4A 3DGVA 3PFEA 5J9PC 1M93A 3A0HZ 2FIWA 1NH2B 4GKKB 3FRMA 2K1EA 2GFQA 4CGOA 2ZDIA 5FPOA 3SI0A 3C3SA 1XMOO 3FVLA 1U96A 2CH7B 1P84F 2Q68A 1VGYA 1RP3B 3OAAG 4PJ0Z 1BPNA 4IHJA 2FCKA 4WFAV 2YNCA 4HNYB 3KG2A 4YJ2B 1SQPH 3U0ZA 4DV4B 2FXFA 2AJ6A 1Q86W 4MTGA 1VF5B 1SERA 2Q69A 1FXKB 1L0CA 3LD2A 2EUIA 3CXHF 1RO5A 3T1HO 1ZG8A 2Q4PA 4KHPO 4C2YA 4AVBA 1F4MA 3ABKC 3PGPA 4JI3B 1TKFA 1QR9A 2QTOA 1H8LA 5IB0A 3HKDA 4X1YA 2W6JG 4BAYA 3T4ZA 1P49A 5HVGA 3DNSA 1HDQA 2PR1A 4B7KA 1HNWB 1YVKA 1XHXA 2ZE5A 2UXCB 1SZXA 1OZ0A 2XEJA 2PYJA 3D8CA 1VIBA 3ZBHA 4NB5A 4JGSA 2HEPA 2YC0A 5LYDA 3F8KA 3FB8C 3UCSC 1SQVH 1YX0A 2QVPA 2X7BA 3CCLV 4P9PA 2ZXWC 3B3SA 4JXQA 5IYZB 4NGMA 3ZHSA 1TF9A 5TISZ 5LRGA 2I3CA 3DSQA 1QVGU 1H2LA 3SJCC 4JAUA 2PTMA 3HKBB 2UUCO 3S6FA 4UV8A 4JAVA 3DXRB 2ZDIC 1I1DA 1YR0A 3RO0A 2ZXVA 2JDDA 3I1UA 2EBOA 3VOUA 2EO8A 2BSKB 3F0AA 3L9DA 3ZRWB 4LFBB 2YNCC 3R1KA 1SETA 2E74B 1VARA 2B5GB 4TT3G 3IC1A 3MRUA 1XDCA 1NR7A 4JPRA 4LH6A 3MAQA 1VQNV 5E96A 4LFCB 4B08A 3SJEA 4QC6A 2Q8VA 4DJLA 2NLJC 1YVWA 4EKWA 5IT9N 1N71A 3F7VC 5J1QA 1PD3A 2RC4A 4X3RA 2YIAA 2Y69C 5DS0A 2C1CA 1O9HA 1QSRA 4KSAA 2CTCA 2B5UA 4KOYA 3N27A 5LXTB 3FAVB 5KX5A 1HDJA 3PB4X 4WFBV 4CAFA 1R73A 3BLNA 4QGPA 4HYOA 2DF5A 3NFZA 4RWUA 4K35A 4NKGB 1AJNA 4LF4O 2PSWA 5A28A 5LP6A 4UA3A 5L3CA 4Y49B 5CPAA 4MHYA 1GMGA 1D5NA 2GU2A 1JCHA 4U3JA 2IL4A 3ZCCA 5ELYA 1Z4RA 2CNSA 3FEEA 1BAVA 3PEIA 2JS5A 4FD5A 5H2FZ 3ZMSA 3RZAA 4OLLA 1EN4A 4HNAA 1XL6A 5GW7A 4JJXA 2ZW5A 4RQFA 4KVXA 4MVSA 3BJ8A 1Q6UA 1L0NH 2AFOA 5IWAO 1Y0YA 1YJNV 3M99B 3AG1C 2LGQA 1HWYA 1NKDA 2PVVA 5FLXN 2WLIB 2FT0A 2YI9A 4IT5A 4KLVA 1IOIA 4NTYA 5LA6B 4DV5B 3CCJV 2JGDA 4NXNB 3SYPA 4G2KA 4B14A 1R3KC 4R57A 1GN6A 1SQBH 3K04A 4HZ3A 4UUJC 5CA1B 1FY7A 3IGRA 3SI2A 5GONB 1RPOA 4MFJA 3CWBH 5B1AB 4PI2A 4I4TB 3D2PA 3FF3A 5EMIA 3QO7A 4IYHA 2PIZA 2PJ5A 4PSWA 3W7TA 2JJ2G 3H4QA 2DYRB 2VQEB 1AR5A 1OHHG 1X59A 3KZWA 2Y48A 1IGBA 4JZ2A 3LWUA 3N2KB 5EIBD 5FNVB 3ABMB 1SF9A 3VARA 1VHEA 1BS3A 5EC1C 3CXPA 4ZX9A 2P7TC 4AVCA 2DOSA 5LRKA 4FFBB 5LP6C 3OUSA 4JI1O 2ZEDA 3OR6C 3ABUA 5EBVA 3E8GA 2WLMA 3MHHC 3OMIB 4PXCA 3JSLA 2JBKA 3PFOA 3E8HA 3H5ZA 2ADQB 1ELLP 4E2LA 4UBRA 5C93A 3L70H 4C7UA 2F7VA 4KZTA 2G38A 4D7TA 1YI2V 1TF8A 4R76A 3CEIA 3O9OA 4F8ZA 3KI9A 1SRYA 3QNVA 3SYQA 5I0CA 4TUYA 4JYWA 3BEHA 3TT2A 4OC4A 5CA0A 2P22C 3F7YC 4DV2B 1TGOA 4MVRA 2Q0OC 2Q0AA 2JJ1G 1PU9A 1FS0G 2P06A 4R7CA 4I9QA 4GCZA 1FFTB 4PHZA 1AUGA 4CRYB 3KHXA 2HP8A 4DR3B 2AGAA 4MCSA 4UCNA 4MJ8A 5B3SB 3WU2Z 1RPRA 4DR5B 2QWOB 4NGRA 1PNLA 1HNZB 1K9MW 3SR2C 1R3JC 1SKVA 1V55B 2Y0MA 1PNKA 3WB2A 5DECA 4TOIA 2QWRB 5ISVA 1RFYA 4W4LA 3K5OA 4DK0A 2GLFA 4H37A 1Y7EA 4XPDC 5K8NA 2CE4A 3A0RA 1AVMA 4UB6Z 1NR1A 4K3AA 2EIMB 2DPTA 4DV7B 2PJ4A 1Q81W 1XUQA 5LHIA 4IF5A 1BT8A 3KQZA 4LF6O 2O57A 4J41A 4JASA 4CZZA 4RUHA 4FK5C 4MHPA 4EB6B 2B9ZA 3SGIA 2EIKC 2XOKG 1UFHA 2OTJV 4PA9A 4MVMA 1L8DA 2NN4A 1XMQO 2JEVA 1P7BA 2ODFA 2XAFA 3SJQC 5KHGA 5LOVB 4LF8B 5H9CA 4H89A 3EY5A 2CIJA 5BR8B 3J7AU 2AFUA 4AI8A 2ZNIA 1Z9UA 2A7WA 2PJ3A 2WSSG 2BTQB 2R72A 2QGNA 1N32O 2ZPAA 3D36A 5KUMA 4LQGA 4NGPA 5A27A 2JEXA 2GSMB 4P4FA 1KUQA 2KKWA 2XEIA 3AK1A 3E22B 3PB8X 4JV5B 5IY5C 3R65A 4K8XA 2JIZG 1FT7A 4J42A 4J7KA 1BQZA 1VP7A 3S6GA 5KMGB 2EJ7A 3B35A 3JARA 2ETNA 1Y76B 4MVQA 3BXMA 4JD6A 2XAQA 1TVKB 1OJHA 2UXDO 3CCMV 2ZT9B 3JATB 4J7ZA 1Z8LA 4L89A 4NCZA 4A30A 4XDKA 2J8RA 3ETDA 3IGAC 4QB9A 4X20A 2XHBA 1I0HA 2ADPA 2Z3YA 3SYCA 1JOYA 2GREA 5E1AC 1OV9A 3AG7A 3E8FA 1Q3EA 2LQTA 1MJAA 4U7OA 3TX8A 4QJFB 2Z11A 4LF5O 1NT2B 1KU9A 2E3CA 1Q90D 3QO5A 3VH9A 3WR7A 3B7IA 1N36B 3D3IA 1UWYA 2V8VA 2E5LO 2WLLA 5CMUA 2A79B 2IJJA 2CY2A 4W9YA 2HJDA 1JQ0A 3RNZA 2DQ0A 4YJ3B 4RI1A 3LODA 4DUYO 1ZG7A 4YY3B 4P45A 5IX3A 3FJUA 2UXXA 2CTBA 3EXNA 4Q20A 4OMEA 3AK2A 2UXBB 4I7ZB 4LCUC 2ZE8A 2WAMA 4H0LB 1AI4A 1N0JA 3QNEA 4U7NA 4UIAA 3IC7A 1RM1C 4DR7O 4IK2A 2DYSB 1YK3A 1V9PA 3D36C 5H6QA 2G9DA 3FX7A 4Q38A 2Q7GA 5LMUO 3OFNG 3ZHUA 1J95A 3CP1A 2GUZA 3P3NA 3RYIB 3CE2A 1WA8A 3L73H 3CMEV 3THOA 2PF4E 2WUUA 4CS0B 1Z5RA 2OTLV 3SJFA 1CEZA 1OCCC 3BABA 4FM1A 2F93B 5B66Z 1ARMA 3G3SA 3I5DA 3JCZA 1M56B 1L1FA 2O28A 5HMNA 3ABLC 4H44B 3CZXA 2VXKA 4UCUA 4DUKA 2CTWA 5GCNA 4I49A 1HEEA 3G71V 1N4CA 1K33A 2IW5A 4WF9V 3JRUA 1OCZC 4MY3A 4LQ6A 3OTFA 2I00A 5CNPA 8CPAA 2KQXA 2Q6AA 3MGDA 4B5PA 4M85A 2ZELA 5EC4A 1QLNA 5LGNA 2PC1A 2PE3A 4Z2WA 2JEUA 4UVBA 2R98A 4PDMA 4RUEA 5JJJB 2XAJA 1VQ8V 2P67A 5GTHZ 2WZNA 5KTAA 3ZMUA 3IWGA 4F6RB 4YHHO 3KR5A 4H2KA 4H6ZA 1XNQB 3BAAA 3M8AA 4JI2B 2PJAA 1LFWA 3KKWA 4RS2A 4X89A 3APOA 3BCCH 3EXAA 4ZI7A 4KUMA 5JH9A 4QE7A 3T1YO 3S9NA 3C26A 3D4UA 2F4VO 4W4KA 3X2QC 2N05A 4GS4A 1WN7A 2QM7A 4ZHQA 5GTIZ 2ZR3A 2VWJA 3W6SA 2BOBC 4NGNA 2EVNA 5AG6A 4DRXA 1H2NA 2B4DB 4FMTA 5EYPB 2DXQA 2PJ6A 2V7QG 4EFEA 2CF4A 3K06A 2LFRA 2IMOA 1S7KA 2MK3A 4HKFA 4B3MO 1YLOA 3SXNA 3RWRD 2CK3G 4H33A 2QA4V 2PJCA 2DN9A 2AW9A 3H8GA 4PV1B 4UWIA 4DUZO 2WPXA 4G27B 3FB6C 4B3SB 1CPSA 1F57A 4XNHB 4ZYQA 1QSOA 3NXSA 4MY0A 4JI0B 2FB5A 5BY1A 5AG4A 4B3RB 3AK3A 1CG2A 2G3AA 3N7ZA 2HJFC 5KLVH 3NE8A 1CPYA 3SPGA 4PQAA 2J9AA 4UCPA 1XNRB 3K79A 2H3OA 1XMTA 1TUBB 4R8FA 3JASA 4DV1O 3E8BA 1XOVA 1AR4A 4LF9O 3ASOC 3JALB 3CSXA 4IHMA 1SS3A 1FJGB 3RBUA 4F9VA 1GM7A 3ZHTA 3WB1A 3OD4A 1COWG 3ZHVA 4U5YA 3FB3A 3PBEA 2OIEA 1FD9A 3DLJA 3ZHRA 1KZFA 3OTOB 3UKMA 3CC7V 4GM5A 1B04A 1V54C 3DGEA 3T4DA 5F48A 2ZM6B 1GHEA 5ITZA 3QAHA 3K5NA 2ZW7A 3NR7A 2FMLA 3PB7X 3O65A 4LNUA 4BIZA 4M6HA 4ZI6A 2RDCA 2BL1A 5AG7A 1AJPA 3G67A 2OCCB 4GXHA 2YXHA 2WLKA 4N23A 2HVJC 3BHPA 1XMOB 1E79G 3RYFB 3PRTA 2EZOA 2OB0A 1SQFA 3T90A 4LR3A 1MOFA 2B1GA 4R7MA 3CDXA 5JQGA 4MFZA 1JQGA 4FPPA 3CT9A 2X0LA 3DC5A 1IX9A 3CCUV 4UVCA 4O4HB 3L2NA 4UCSA 1RSOB 2QR4A 1WNSA 4QPJA 3KKYA 3SDLA 3SJBC 3T1HB 4BW9A 1M57B 4KHPB 3I3GA 5IJ9A 4K3NA 4KS9A 1MSDA 1X10A 3CC4V 1ON0A 1DTOA 1GN3A 4I5SA 1KB9F 5FPRA 4M6GA 1S0VA 3BI0A 5HFLA 3ZJZA 2N74A 4IYIA 4D7SA 1R3LC 5L3BA 2JDCA 1Z8TA 3LNNA 3TTHA 4FFBA 4WBNA 3J81N 3FECA 5B1NA 4DYLA 3K57A 3VQVA 2HQYA 4MSWC 1G8MA 2CTPA 3VATA 3E83A 5EK0A 2KG7A 4YWYA 2Q9LA 4MTXA 3J80N 4FLYA 2QSAA 1F7YA 4ZBMA 5J2UB 3K9SA 3K0GA 4RN7A 5LGUA 2BUEA 3ABTA 2CTRA 2Q7SA 4O2AA 1O9GA 1IY7A 3IJ4A 2QE7G 3FD9A 1SA0B 1I7FA 1CP7A 1QR8A 1F2OA 2Q7EA 2Q4ZA 5LL6Y 1W59A 2PIYA 4KVOE 4R6TA 3CJHA 3DR8A 4MVOA 4DV3O 2LJ2A 3S3XA 4JI7O 1H2KA 1CP6A 4O4LA 5LHHA 1IVSA 5BMVA 2UUBB 4B3TO 1Y74B 1N33O 3BI1A 3S3WA 1Z4EA 2GBOA 3KZIZ 4UCTA 1HP8A 4GKJO 1ELMP 1Q43A 4KOUA 5G22A 3OUFA 5DN6G 1G4YB 1YEWA 5IJ0A 1I94B 1WK4A 1SQQH 2ZW4A 3UO2A 3B2YA 3E86A 2B58A 3D7DA 2NNUA 4LF7O 1YIJV 4B6ZA 2DYRC 2ILMA 4GT1A 1I5XA 1JJ2U 4CYPA 5CB4A 4LWSA 4NEXA 2QM8A 3ZIAG 5JQ4A 1YREA 1T5EA 5D29A 1BCCH 4FD7A 3OGIB 4JWPA 2WLHA 3JAWB 3AG4B 5JJNB 1IICA 1VQPV 3NH8A 1MZFA 5CN0A 2ZOFA 3H8EA 3S9LA 4M3SA 1IZ3A 4MCPA 2FS5A 3TO6A 4MCQA 3HLPA 2QTSA 4X65B 4UVAA 3JAKA 4IIJA 3RT3C 1WWZA 2PJ0A 1BHBA 5G1ZA 4NTXA 4LF4B 2LW7A 2Q7BA 2YGWA 1WJZA 5H6RA 4DXWA 3R9GA 3L74H 4X9QA 4GKKO 2YI8A 3HKCB 4DV0O 1XF8A 5JVDA 2ATKC 2XUMA 1NI8A 5C88A 3FMCA 1X4TA 4DV4O 2ATRA 3RYCA 1TVKA 4JI4O 3P2HA 5B1BB 4JTAB 3WG7B 1AP6A 4AQYB 1VQ4V 3D3QA 1Z8WA 3QO8A 3BHXA 4U3FH 2HVKC 3WT4A 4X1IB 2QJ1A 4F6AA 5HXDA 4JI3O 1JFFB 3RW0A 1PL0A 2PZSA 1H2SB 1N0NA 4P10A 4TV8B 4CGPA 4UCRA 2EIMC 5BWAB 3FYNA 3UT5A 4NJRA 1JVMA 4RUFA 1VQ5V 1EE3P 1GYTA 4QVTA 4DR2B 4I55A 4YXWG 4I0XA 4DR6B 4R9MA 3ZZIA 4CGNA 2REEA 3PP9A 4ASUG
chains in the Genus database with same CATH topology
2DPTA 4IF5A 2R7HA 3D2MA 4A33A 2KCWA 4MHDA 2D4PA 3TOAA 2HV2A 3FBUA 1J4JA 3F5BA 4YGOA 4DNCA 2DPSA 3OWCA 1UFHA 1SQHA 1R57A 4UWJA 2JEVA 3UY5A 4A2ZA 4H89A 2I79A 3EFAA 3EY5A 4MFPA 4AVAA 1RXTA 2G3TA 4KLWA 4U9YA 4YFJA 4EVYA 3BJ7A 4KSFA 1Z9UA 3V8IA 2ZPAA 5G21A 3JVNA 5A27A 3W6XA 5KTCA 1S60A 2Z3NA 2OH1A 3RYOA 3TCVA 1B6BA 2R8VA 1K4JA 4ORFA 3S6GA 1TIQA 2HUZA 2PQ8A 3IWEA 1M1DA 4JD6A 1NMTA 1XEBA 3JTKA 4PK2A 4IUSA 4QUSA 2FL4A 4L89A 1QSTA 4NCZA 4A30A 2J8RA 4QB9A 5DWNA 1IB1E 1IYKA 4C2ZA 2B3VA 2P6EA 2VZYA 3R9FA 2FE7A 5F47A 1MJAA 4LX9A 2Z11A 3E0KA 4B5PB 1KUYA 3VWDA 3WR7A 3FXTA 4H6UA 3SHPA 4KVME 2CY2A 5G20A 4RI1A 3LODA 5IX3A 2C27A 3EXNA 4C2XA 3CXQA 4KOSA 1S7FA 4KUAA 2CNMA 4MI4A 1YK3A 4OAEA 4Q38A 4KOWA 1XE4A 2OZUA 2P6GA 3NE7A 2Z10A 1I21A 2QECA 2PDOA 2WUUA 4CS0B 5F49A 4E2AA 4NXYA 2B3UA 2FIAA 3G3SA 2D4OA 2O28A 2Z3MA 2Q4YA 5HMNA 3TOBA 2VXKA 5GCNA 4I49A 5FVJA 4R87A 4JXRA 4MY3A 1S7LA 1V0CA 3IU1A 2I00A 5CNPA 1M4GA 5F46A 3MGDA 4B5PA 4M85A 1Q2YA 5EC4A 2CXAA 2PC1A 5H86A 5HH1A 3VWEA 2FSRA 1VHSA 2R98A 2P0WA 2H5MA 5KTAA 4CAXA 3IWGA 1BO4A 4H6ZA 1M4DA 2G0BA 3KKWA 4RS2A 5J8FA 5C82A 4LUAA 1Y9KA 3TE4A 5H84A 5AG5A 1P0HA 3C26A 4UFXA 4XPKA 1QSNA 2Q4VA 1OZPA 1YLEA 4C68A 4GS4A 3TO9A 5JPHA 2OZHA 1M4IA 2Z3OA 3SXOA 2BEIA 1NE9A 2JLMA 3ZJ0A 3W6SA 2F5IA 4HNXB 2EVNA 5AG6A 2FIWA 2ARHA 2VEZA 2Z0ZA 3FRMA 2B4DB 2PR8A 2OZGA 4CGOA 2DXQA 2ZW6A 4C7IA 3TFYA 2GE3A 1KUXA 3I9SA 1S7KA 4HKFA 2VI7A 3GY9A 3IU2A 4AG7A 3SXNA 2FCKA 2YNCA 4HNYB 4B12A 2FXFA 2AJ6A 2OU2A 4YRHA 4BMHA 2WPWA 4A32A 4FD4A 1L0CA 3LD2A 4UWIA 2EUIA 2WPXA 1RO5A 4NF1A 4ZBGA 4C2YA 3W91A 4AVBA 3EO4A 3PGPA 4XNHB 1QSOA 2NMTA 4ZGYB 5IB0A 4MY0A 2VZZA 3QB8A 5AG4A 2Z3KA 1IIDA 3DNSA 2PR1A 3N7ZA 2G3AA 1YVKA 5DWMA 1ZO0A 4FD6A 4UCPA 4CAVA 3F8KA 2CNTA 1XMTA 1YX0A 4XPLA 4R3KA 3S6HA 2AE6A 2X7BA 2Z3LA 4ONUA 4B13A 3A9LA 4Q36A 4JXQA 4B10A 2A4NA 2B4DA 4U5YA 3FB3A 4CYNA 4A95A 4JLYA 1KZFA 1MJ9A 2YNDA 3S6FA 4E0AA 5F48A 3B8GA 1GHEA 1I1DA 1YR0A 3QAHA 2ZW7A 1P4NA 1KUVA 2ZXVA 2JDDA 3TO7A 2BL1A 5AG7A 3F0AA 1B87A 2YNCC 3R1KA 1XIXA 4F0YA 2B5GB 4CGLA 2OB0A 2P6FA 5E96A 3T90A 4BBHA 4AG9A 3R9EA 4MFZA 2GANA 4QC6A 1MJBA 4AB7A 4X5KA 4NSQA 4J3GA 1N71A 1S3ZA 2BSWA 2RC4A 3R96A 4K30A 3I3GA 2Q04A 4KS9A 1QSMA 3D3SA 3DR6A 1ON0A 4MFKA 1I12A 1IYLA 4UFVA 1QSRA 4KSAA 4C7HA 3PZJA 4KOYA 2JDCA 4CAFA 2REFA 3TTHA 3BLNA 4PSXA 4CGMA 3DDDA 2HQYA 3FNCA 2PSWA 5A28A 5KTDA 4UA3A 3GKRA 4XPDB 4Y49B 3JUWA 3S6KA 2BUEA 4KOTA 4CRZB 2IL4A 4HNWB 1Z4RA 1NSLA 2CNSA 4CAWA 4B5OA 4FD5A 4OLLA 5J8CA 3T9YA 2B5GA 4U9ZA 2R1IA 4B11A 4JJXA 2ZW5A 2Q44A 4KVXA 4KVOE 3DR8A 3BJ8A 1Y7RA 1BOBA 4XNHC 3DSBA 4UFWA 4OADA 3D8PA 2FT0A 1Z4EA 2K5TA 5G22A 3P2FA 4KLVA 4KOUA 2Z3PA 4R3LA 4B14A 1WK4A 1MK4A 4R57A 1YGHA 5IV0A 1FY7A 2ZW4A 2B58A 3IGRA 4MFJA 4CYPA 4NEXA 3D2PA 5JQ4A 1YREA 4II9A 4PSWA 3H4QA 1Y9WA 4FD7A 4JWPA 1M44A 2PRBA 1IICA 1YVOA 1U6MA 4AVCA 3CXPA 4M3SA 2FS5A 2Q0YA 3TO6A 2B4BA 4MFLA 1VKCA 3R95A 5EBVA 2WSAA 5AGEA 4CAEA 4E8OA 2GIVA 2J8NA 2VQYA 3GYAA 1WWZA 4CYQA 5G1ZA 4UCMA 3H5ZA 4MBUA 4CYOA 2Q7BA 4KORA 2YGWA 4UBRA 2J8MA 3K9UA 4KZTA 4F0XA 3R9GA 1Q2CA 2VBQA 4L8AA 3FIXA 4QBJA 3CXSA 5I0CA 1XF8A 3EC4A 3TT2A 1S5KA 4KOXA 4A31A 1PU9A 4KOVA 2QMLA 5C88A 1S7NA 2ATRA 3G8WA 2YNEA 4CRYB 3P2HA 4PK3A 4PV6A 4UCNA 4KUBA 4MJ8A 1LRZA 4F6AA 1CM0A 1PUAA 2Y0MA 4CGPA 5ISVA 5BWAB 3FYNA 4QVTA 4R9MA 4MFQA 3ZZIA 4CGNA 1Q2DA 2QIRA 2REEA 1CJWA 4XPDC 4Y49C 3PP9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IF5 A;  2R7H A;  3D2M A;  2KCW A;  4MHD A;  2D4P A;  3TOA A;  2HV2 A;  3FBU A;  1J4J A;  3F5B A;  4YGO A;  4DNC A;  3OWC A;  1UFH A;  1SQH A;  1R57 A;  4UWJ A;  2JEV A;  3UY5 A;  4H89 A;  2I79 A;  3EFA A;  3EY5 A;  4AVA A;  1RXT A;  2G3T A;  4KLW A;  4U9Y A;  4YFJ A;  4EVY A;  3BJ7 A;  1Z9U A;  3V8I A;  2ZPA A;  3JVN A;  5KTC A;  3W6X A;  1S60 A;  2OH1 A;  3RYO A;  3TCV A;  1B6B A;  2R8V A;  1K4J A;  4ORF A;  3S6G A;  1TIQ A;  2HUZ A;  2PQ8 A;  1M1D A;  4JD6 A;  1NMT A;  1XEB A;  4PK2 A;  4IUS A;  4QUS A;  2FL4 A;  4L89 A;  1QST A;  4NCZ A;  2J8R A;  4QB9 A;  5DWN A;  1IB1 E;  1IYK A;  2B3V A;  2P6E A;  2VZY A;  3R9F A;  2FE7 A;  5F47 A;  1MJA A;  4LX9 A;  2Z11 A;  3E0K A;  4B5P B;  1KUY A;  3VWD A;  3WR7 A;  3FXT A;  4H6U A;  3SHP A;  4KVM E;  2CY2 A;  4RI1 A;  3LOD A;  5IX3 A;  2C27 A;  3EXN A;  3CXQ A;  4KUA A;  4KOS A;  1S7F A;  2CNM A;  4MI4 A;  1YK3 A;  4OAE A;  4KOW A;  1XE4 A;  2OZU A;  2P6G A;  3NE7 A;  2Z10 A;  1I21 A;  2QEC A;  2PDO A;  4CS0 B;  5F49 A;  4E2A A;  4NXY A;  2B3U A;  2FIA A;  3G3S A;  2D4O A;  2O28 A;  2Q4Y A;  5HMN A;  3TOB A;  2VXK A;  5GCN A;  4I49 A;  5FVJ A;  4R87 A;  4JXR A;  4MY3 A;  1S7L A;  1V0C A;  2I00 A;  5CNP A;  1M4G A;  5F46 A;  3MGD A;  4B5P A;  4M85 A;  1Q2Y A;  5EC4 A;  2PC1 A;  5H86 A;  5HH1 A;  3VWE A;  2FSR A;  1VHS A;  2R98 A;  2P0W A;  2H5M A;  5KTA A;  4CAX A;  3IWG A;  1BO4 A;  4H6Z A;  1M4D A;  2G0B A;  3KKW A;  4RS2 A;  5J8F A;  5C82 A;  4LUA A;  1Y9K A;  3TE4 A;  5H84 A;  1P0H A;  3C26 A;  4XPK A;  1QSN A;  2Q4V A;  1OZP A;  1YLE A;  4GS4 A;  3TO9 A;  5JPH A;  2OZH A;  1M4I A;  3SXO A;  2BEI A;  1NE9 A;  2JLM A;  3ZJ0 A;  3W6S A;  2F5I A;  4HNX B;  2EVN A;  2FIW A;  2ARH A;  2VEZ A;  2Z0Z A;  3FRM A;  2B4D B;  2PR8 A;  2OZG A;  2DXQ A;  2ZW6 A;  3TFY A;  2GE3 A;  1KUX A;  3I9S A;  1S7K A;  4HKF A;  2VI7 A;  3GY9 A;  4AG7 A;  3SXN A;  2FCK A;  4HNY B;  2FXF A;  2AJ6 A;  2OU2 A;  4YRH A;  4BMH A;  2WPW A;  4FD4 A;  1L0C A;  3LD2 A;  4UWI A;  2EUI A;  2WPX A;  1RO5 A;  4NF1 A;  4ZBG A;  3W91 A;  4AVB A;  3EO4 A;  3PGP A;  4XNH B;  1QSO A;  2NMT A;  5IB0 A;  4MY0 A;  2VZZ A;  3QB8 A;  1IID A;  3DNS A;  2PR1 A;  3N7Z A;  2G3A A;  1YVK A;  5DWM A;  4FD6 A;  4CAV A;  3F8K A;  2CNT A;  1XMT A;  1YX0 A;  4XPL A;  4R3K A;  3S6H A;  2AE6 A;  2X7B A;  4ONU A;  4JXQ A;  2A4N A;  2B4D A;  4U5Y A;  3FB3 A;  4JLY A;  1KZF A;  1MJ9 A;  3S6F A;  4E0A A;  5F48 A;  3B8G A;  1GHE A;  1I1D A;  1YR0 A;  3QAH A;  2ZW7 A;  1P4N A;  1KUV A;  2ZXV A;  2JDD A;  3TO7 A;  2BL1 A;  3F0A A;  1B87 A;  3R1K A;  1XIX A;  4F0Y A;  2B5G B;  2OB0 A;  2P6F A;  5E96 A;  3T90 A;  4AG9 A;  3R9E A;  2GAN A;  4QC6 A;  1MJB A;  4AB7 A;  4X5K A;  4NSQ A;  4J3G A;  1N71 A;  1S3Z A;  2BSW A;  2RC4 A;  3R96 A;  4K30 A;  3I3G A;  2Q04 A;  1QSM A;  3D3S A;  3DR6 A;  1ON0 A;  1I12 A;  1IYL A;  1QSR A;  3PZJ A;  4KOY A;  2JDC A;  2REF A;  3TTH A;  3BLN A;  4PSX A;  3DDD A;  2HQY A;  3FNC A;  2PSW A;  5KTD A;  4UA3 A;  3GKR A;  4XPD B;  4Y49 B;  3JUW A;  3S6K A;  2BUE A;  4KOT A;  4CRZ B;  2IL4 A;  4HNW B;  1Z4R A;  1NSL A;  2CNS A;  4CAW A;  4B5O A;  4FD5 A;  4OLL A;  5J8C A;  3T9Y A;  2B5G A;  4U9Z A;  2R1I A;  4JJX A;  2ZW5 A;  4KVX A;  2Q44 A;  4KVO E;  3DR8 A;  3BJ8 A;  1Y7R A;  1BOB A;  4XNH C;  3DSB A;  4OAD A;  3D8P A;  2FT0 A;  1Z4E A;  2K5T A;  3P2F A;  4KLV A;  4KOU A;  4R3L A;  1WK4 A;  1MK4 A;  4R57 A;  1YGH A;  5IV0 A;  1FY7 A;  2ZW4 A;  2B58 A;  3IGR A;  4NEX A;  3D2P A;  5JQ4 A;  1YRE A;  4II9 A;  4PSW A;  3H4Q A;  1Y9W A;  4FD7 A;  4JWP A;  1M44 A;  2PRB A;  1IIC A;  1YVO A;  1U6M A;  4AVC A;  3CXP A;  4M3S A;  2FS5 A;  2Q0Y A;  3TO6 A;  2B4B A;  1VKC A;  3R95 A;  5EBV A;  4E8O A;  2GIV A;  2J8N A;  2VQY A;  3GYA A;  1WWZ A;  4MBU A;  2Q7B A;  4KOR A;  4UBR A;  2J8M A;  3K9U A;  4KZT A;  3R9G A;  1Q2C A;  4L8A A;  2VBQ A;  3FIX A;  4QBJ A;  3CXS A;  5I0C A;  1XF8 A;  3EC4 A;  3TT2 A;  1S5K A;  4KOX A;  1PU9 A;  4KOV A;  2QML A;  5C88 A;  1S7N A;  2ATR A;  3G8W A;  4CRY B;  3P2H A;  4PK3 A;  4PV6 A;  4KUB A;  4MJ8 A;  1LRZ A;  4F6A A;  1CM0 A;  1PUA A;  2Y0M A;  5ISV A;  3FYN A;  4QVT A;  4R9M A;  3ZZI A;  1Q2D A;  2QIR A;  2REE A;  1CJW A;  4XPD C;  4Y49 C;  3PP9 A; 
#chains in the Genus database with same CATH topology
 2ZNJ A;  3APQ A;  3D2M A;  2ZEF A;  1YTF D;  5JH7 A;  4X8A A;  1KD1 W;  4MHD A;  3TK1 A;  2A3Q A;  3CS5 A;  1YXB A;  3F5B A;  2ZIO A;  1A32 A;  4DR4 O;  4OC2 A;  4YGO A;  4FIP C;  2OT5 A;  3UY5 A;  1R43 A;  2EZP A;  3ZN1 A;  4A2Z A;  3MD0 A;  1FFX B;  3RVY A;  2YEV A;  2EIL B;  4I50 B;  4U9Y A;  4YFJ A;  5LYJ A;  3JD2 A;  4O4J A;  2P5O A;  3IWW A;  4EVY A;  2EIJ B;  3Q4H B;  4KSF A;  1BMF G;  2H94 A;  1B6Q A;  1GAX A;  4ZY0 A;  5G21 A;  3FX6 A;  5EBL C;  3V7Z A;  3AG2 B;  4PI0 A;  1S60 A;  1QMU A;  3C3T A;  2OH1 A;  4H13 B;  3HR0 A;  1MA1 A;  3RYO A;  3UQ8 A;  1B6B A;  1LCP A;  1TAE A;  1S3J A;  1TIQ A;  3LMS A;  4LFC O;  1ZL8 B;  3B40 A;  1BHA A;  1YZB A;  3ZRV A;  1M1D A;  1NQT A;  3KR4 A;  3LDC A;  3B3T A;  4XBF A;  4FLV A;  1YQE A;  2ZEN A;  3JTK A;  1K73 W;  4Z65 A;  1OCR C;  5EBM C;  2PGG A;  1Z5W A;  4K0K B;  1QST A;  2C2A A;  5DWN A;  1IB1 E;  2B3V A;  4GX5 A;  2P6E A;  1DF5 A;  2OWO A;  3V38 A;  4XDJ A;  1VF6 A;  1PL4 A;  4QIW F;  4HPS A;  1Q82 W;  3E0K A;  2ZEP A;  4PA6 A;  1KUY A;  4X1K B;  3CCS V;  2E76 B;  2Y0I A;  3ABK B;  1XQ8 A;  5KA5 A;  5C8Y B;  2AHY A;  5BXZ A;  1QHT A;  3SHP A;  4TV9 B;  2O4H A;  3QF7 A;  2ZE6 A;  5J2T B;  4F9U A;  4PD4 F;  4DV6 B;  3HKE A;  2RN9 A;  5JCO A;  3U10 A;  1MNG A;  3ETG A;  1Y4M A;  1IUR A;  2EJR A;  4L8J A;  3QTC A;  3CXQ A;  4MCR A;  1XMQ B;  4JI6 B;  4J10 A;  4CH5 A;  1TKJ A;  4OAE A;  3B77 A;  4KSI A;  4NVP A;  2ZXW B;  4KOW A;  4MTO A;  4JZ0 A;  4J7J A;  1XE4 A;  5EZY A;  2Z10 A;  4AIL C;  2PDO A;  5KAI Z;  4UF4 A;  5F49 A;  2IM9 A;  4DW1 A;  2B3U A;  1UJW B;  3K59 A;  2PRQ A;  1YSC A;  2VS0 A;  2Q4Y A;  1ZG9 A;  3D66 A;  2F1M A;  3IEH A;  2HHH B;  1QLE C;  2PJ7 A;  2LW1 A;  2D3O W;  4K8Z A;  5FVJ A;  4NXN O;  4DW0 A;  2DW4 A;  1S5H C;  4IHJ B;  1BZK A;  2DWE C;  5K8P A;  4IGG A;  1KKC A;  1XI1 A;  3QG5 A;  1VF6 C;  3RFR A;  1FXH A;  4OC5 A;  4LFA O;  1ZTE A;  5HH1 A;  4WCE V;  2ZCE A;  1Q7L A;  3RVZ A;  1BGY H;  1YDX A;  3WC5 A;  2KB1 A;  2YIB A;  3MDS A;  1DLB A;  1BO4 A;  3HKD B;  4X1Y B;  3K58 A;  2Y69 B;  4MVZ A;  5HFM A;  2GTA A;  4UEF A;  5C82 A;  5JCO C;  2QWQ B;  2YSU B;  3N2G A;  2WYR A;  2RMK B;  3TE4 A;  4TWE A;  2YID A;  4XPK A;  2L35 A;  4CH3 A;  2E5L B;  4JI5 B;  4QE9 A;  5JPH A;  2OZH A;  1EN5 A;  1M4I A;  2R9A A;  3ZRS A;  4DUY B;  3ZMZ A;  3SYA A;  2BEI A;  2ZEO A;  3SXO A;  2JLM A;  2P4K A;  3E35 A;  4UEE A;  4ICG A;  3GVM A;  3NH5 A;  1GN2 A;  1R3I C;  1ORQ C;  1YW4 A;  2RFH A;  3SI1 A;  2QWN B;  4MS2 A;  2PR8 A;  2OZG A;  2QDO A;  2CTQ A;  1IBM B;  3OR7 C;  4NXM O;  1KC8 W;  3I9S A;  3LDD A;  3FFQ A;  1KWM A;  5BZB A;  4WFG A;  2VI7 A;  5K8M A;  4FM2 A;  3IU2 A;  2YXL A;  2W0X A;  2C6C A;  1FYJ A;  2V8G A;  1DGS A;  2Z0A A;  2OU2 A;  2BCC H;  1ROP A;  2W0F C;  1M9N A;  3E89 A;  4DR3 O;  1Z8X A;  4FD4 A;  1H8E G;  3B8M A;  4NF1 A;  3A0B Z;  1HNZ O;  5CBM A;  3K0D A;  3AG1 B;  1ZSP A;  2QM4 A;  3K03 A;  4FFK A;  2IH1 C;  3QB8 A;  1LR1 A;  5KHH A;  2Z3K A;  1IID A;  4GUN A;  2EBJ A;  2DJV A;  1EM1 A;  5DWM A;  3MHS C;  2ITD C;  3E2E A;  4RAI A;  1LAN A;  3BVO A;  3RYH A;  2CNT A;  4ZOL A;  4AHC A;  2JRI A;  4BW5 A;  2ANP A;  3S6H A;  2AE6 A;  1ARL A;  3G6E V;  5J2U A;  4YHH B;  4ONU A;  5KX5 B;  3A9L A;  3N5F A;  1FKA O;  2EIN C;  2BOA A;  2A4N A;  4B10 A;  2AFZ A;  4JTD B;  3T1Y B;  4CYN A;  2CH7 A;  2IU0 A;  3D7H A;  1MJ9 A;  1ZLZ A;  1K5S A;  1XL4 A;  4FJC C;  4LH7 A;  1WP8 A;  1VQM V;  4U3J B;  4YJ2 A;  2DWD C;  1KUV A;  2Z5U A;  2VQF O;  4OPH A;  1G1X B;  1B87 A;  1IXB A;  4HNA B;  1XIX A;  1FXK A;  4UXN A;  1SQX H;  1Y74 A;  2GDS A;  3UO3 A;  1GH6 A;  1N34 B;  4CGL A;  2QJ8 A;  1AI6 A;  4BWA A;  4CS2 A;  2GHY A;  3DC6 A;  3CPA A;  4AG9 A;  3AG3 B;  1MJB A;  4AB7 A;  4B3M B;  4EME A;  2M6Y A;  3OW2 U;  1EZV H;  2P4V A;  1S3Z A;  2PJB A;  1IXM A;  1IBL O;  2BSW A;  5L3G A;  2P6J A;  4Q6G A;  3GB7 C;  4DUZ B;  4PA3 A;  3TC8 A;  2Q04 A;  3ML0 A;  1F23 A;  2JGD B;  4FLU A;  1OCO C;  1QVF U;  2AFM A;  4MFK A;  4X64 B;  3QVN A;  1I12 A;  2JK5 C;  4UFV A;  1HNX O;  4C7H A;  3PZJ A;  2K9P A;  1HR0 O;  4BR6 A;  1BLL E;  5LMN O;  4QNH B;  1N36 O;  2Y0P A;  3JD4 A;  5IYZ A;  2XAG A;  2V77 A;  4PSX A;  2V1D A;  3EHB B;  2O53 A;  2N04 A;  4JYA O;  3R66 A;  4MXU A;  4ZY1 A;  1LUW A;  3HKB A;  1Y67 A;  4YY3 O;  2EK9 A;  5D5P A;  4XPD B;  2IJK A;  3DXR A;  5EBW C;  2OOT A;  3ICX A;  1KP3 A;  1PNM A;  4FM0 A;  2AHZ A;  4KOT A;  3KCY A;  4CRZ B;  4R50 A;  1NSL A;  1K92 A;  1W0K G;  3CHX A;  3VQW A;  3LUT B;  1Y6X A;  2BSK A;  4P2Z A;  1F2P A;  4B5O A;  4A37 A;  4OX9 B;  3ZRW A;  2HG5 C;  2FVG A;  5KHK A;  2XEG A;  2EIK B;  3T9Y A;  2B5G A;  4WWV A;  3B2E E;  1FNO A;  3ISX A;  2VWK A;  1FXK C;  2JVD A;  1RTQ A;  3SPH A;  1Y7R A;  4Z1M G;  3OGC C;  4NTW A;  4PXB A;  4MRI A;  1BOB A;  2RQ6 A;  2A0L A;  4F4L A;  3DSB A;  1BQ0 A;  4HBN A;  4JTC B;  2XAH A;  4TUY B;  4NFR A;  3D8P A;  4OAD A;  4FLZ A;  4GX2 A;  5CA0 B;  2RB7 A;  4MTF A;  4N21 A;  2UUA O;  2K5T A;  1M5I A;  4R3L A;  1VF7 A;  1H2M A;  1MK4 A;  5LYI A;  4FLX A;  5IV0 A;  2W6I G;  3H1H H;  5JJE B;  4NGT A;  3KGQ A;  1H38 A;  4IL6 Z;  5LXT A;  3FAV A;  1YJ9 V;  1XHZ A;  2UU9 O;  4DO2 A;  3T2M A;  2IQ6 A;  4II9 A;  3H1K H;  4JI8 B;  4TWK A;  1M44 A;  3DTU B;  4EEQ A;  2PRB A;  1GO3 F;  2YXY A;  4F6E A;  1X12 A;  1YHQ V;  1AYE A;  1U6M A;  1J5E B;  1XNQ O;  2ZR2 A;  2HFE C;  2RNB A;  2C6G A;  1ENV A;  1NS1 A;  2B4B A;  4MFL A;  4TNU A;  2BTO A;  2Q67 A;  4GZR B;  2CUG A;  3ZMT A;  1DK1 A;  2WSA A;  4CAE A;  6CPA A;  3RBZ A;  2GIV A;  2J8N A;  3GYA A;  1TUE B;  3TJT A;  2JEW A;  4UCM A;  5LHG A;  4O23 A;  1NZ6 A;  2BO9 A;  2RCV A;  4CYO A;  4GYC B;  1FPO A;  3K9U A;  4X66 O;  4F0X A;  1Q2C A;  2VBQ A;  4L8A A;  2QYV A;  1JJO A;  3FIX A;  5THW A;  1F4N A;  3CCR V;  1BPM A;  2WLI A;  1P4R A;  1AI7 A;  2Q51 A;  1S5K A;  1QCE A;  3TXS A;  5LA6 A;  4ABM A;  1RM1 B;  3IFX A;  7CPA A;  4R6Z A;  4OXS A;  3NA6 A;  5K1X A;  5CA1 A;  2QML A;  5GON A;  3S9M A;  3G8W A;  2YNE A;  4JAA A;  4J9Z B;  4WFH A;  1M1K W;  4I4T A;  5IYB O;  1NH2 D;  3GWK C;  1N33 B;  4KUB A;  4X62 O;  4WFF A;  1OCC B;  1LRZ A;  4GKJ B;  1CM0 A;  3JAR B;  1PUA A;  4I9W A;  1BSM A;  2BOC C;  3ABL B;  3N2K A;  3T8W A;  5FNV A;  4JI0 O;  2Y4T A;  1XIL A;  1AI5 A;  4LF7 B;  2PI5 A;  1BL8 A;  4MFQ A;  2QIR A;  3ZRX A;  1CJW A;  4Y49 C;  1DF4 A;  3GB0 A;  1XFO A;  1K5Q A;  4X20 B;  1XNR O;  2Q7H A;  1AR1 B;  1ZLI A;  4A33 A;  3JYC A;  2BE3 A;  2D4P A;  3H1J H;  2POK A;  1NTK H;  4CS4 A;  4DR1 O;  3FBU A;  3HUV A;  4WFE A;  4A38 A;  1AB3 A;  4A5U B;  3OWC A;  2XTA A;  4ONW A;  3CRR A;  1R57 A;  4UWJ A;  3CPW U;  1Q5O A;  3C90 A;  3B3C A;  2WA4 A;  2R70 A;  4ZX8 A;  2WLL B;  2I79 A;  1GRJ A;  1RXT A;  4KLW A;  2XT9 A;  2UUC B;  1FAF A;  5CBF A;  1PPJ H;  3CCV V;  2HC9 A;  2L6L A;  4UCV A;  4O4I B;  2PVW A;  1ARO P;  4KL1 A;  2KSD A;  1CX8 A;  1BE3 H;  3W6X A;  1YW6 A;  3X2Q B;  2ZOG A;  2WA3 A;  1URF A;  2ZD9 A;  4O2B B;  3KCX A;  4FZ0 A;  4DV0 B;  2R8V A;  3KHZ A;  4UB8 Z;  1K4J A;  4ORF A;  2PI4 A;  3SJG A;  2GUZ B;  2HUZ A;  1IBK O;  5B1A C;  3IWE A;  1WA8 B;  5HVH A;  2IJZ A;  3ASN B;  3JD3 A;  1XEB A;  4MW8 A;  1VQ6 V;  2GLJ A;  4JI4 B;  4IUS A;  3ABM C;  1VQ9 V;  1YIT V;  2Q73 A;  3ZMV A;  1S5L Z;  2VZY A;  3TGU H;  1CXZ B;  4LX9 A;  1LNQ A;  3IFE A;  1KQS U;  4EB6 A;  4B5P B;  3BA8 A;  3VWD A;  3IJ3 A;  4NGS A;  4PA4 A;  2GV9 A;  5DM6 V;  3FXT A;  1ZX3 A;  5LOV A;  4H6U A;  4KVM E;  5G20 A;  2X6A A;  2AZ2 A;  3STZ C;  2C27 A;  4P9O A;  2BTQ A;  4FWU A;  1MAB G;  4DR4 B;  4FUU A;  1MMM A;  3ZHQ A;  4X2T A;  1TA8 A;  3PN1 A;  5DED A;  4ZI7 B;  5IDJ A;  1S7F A;  4KOS A;  5IE9 A;  2CNM A;  2A9H A;  3L71 H;  4CS3 A;  3E22 A;  5EC2 C;  2RJZ A;  3ASO B;  4D6T H;  2V8H A;  2LFS A;  5B1O A;  2JGU A;  1KKD A;  2F23 A;  3LSS A;  4ZHQ B;  1CPX A;  3M7M X;  2ZQM A;  2OZU A;  5KMG A;  2P6G A;  4KP4 A;  5F2V O;  1Y76 A;  2H8P C;  4MT8 A;  5B3S C;  4MHZ A;  3CD6 V;  1YJW V;  4E2A A;  4CC5 A;  4HAM A;  4DRX B;  5IWA B;  1V55 C;  5EIB C;  1CBX A;  2CDY A;  4J80 A;  2Z3M A;  3W7S A;  2UUB O;  3GUX A;  4B7E A;  3TOB A;  1V54 B;  3JAT A;  1AJQ A;  3ZX6 A;  2PJ2 A;  2R9I A;  4DYO A;  5FL7 G;  4J11 A;  4JXR A;  1I94 O;  2LGW A;  2UXN A;  2NYQ A;  1R3N A;  2E75 B;  1MG1 A;  2X6B A;  5KAF Z;  3TXQ A;  1M4G A;  3OM3 B;  1HNW O;  1QU7 A;  2UXC O;  5HVF A;  1GM9 A;  2PCU A;  2CXA A;  5H86 A;  4UFZ A;  3CX5 F;  3RAM A;  1F51 A;  1ZWI C;  3K5M A;  3TCU A;  1TXR A;  2XEF A;  1UPG A;  4YJ3 A;  5L3F A;  2H5M A;  2JS3 A;  3D7F A;  1M4D A;  2G0B A;  2AXT Z;  5J8F A;  1US6 A;  1I5Y A;  1SC5 B;  4P4B A;  4JI1 B;  5AG5 A;  4X65 O;  4UFX A;  3F5W C;  1QSN A;  4M6I A;  3SYO A;  1HDU A;  1YLE A;  3JAS B;  1A2Z A;  2Z3O A;  3RYI A;  1NE9 A;  3ZJ0 A;  3ETQ A;  4HNX B;  1QQC A;  4KFM A;  3JAM N;  1UFI A;  3LAC A;  4OIW A;  2ZEG A;  2AZ0 A;  2ARH A;  2VEZ A;  5CBH A;  2Z0Z A;  3K5L A;  4LFB O;  2XND G;  3PB6 X;  3W7U A;  3WC7 A;  2ZW6 A;  4C7I A;  3G6B A;  3G4S V;  3TFY A;  2GE3 A;  1KUX A;  3P3P A;  4EFD A;  4TQD A;  1NBM G;  3GY9 A;  1W0J G;  4AG7 A;  1AMP A;  1IU8 A;  5ITZ B;  1KYO F;  4B12 A;  3KL9 A;  4EFB A;  2ZKO A;  4LNU B;  1H2G A;  5JM6 A;  3CRA A;  4YRH A;  4BMH A;  4AQY O;  1XBL A;  2WPW A;  3H8F A;  4A32 A;  1YTF B;  4ZBG A;  3W91 A;  4FBE A;  3ETE A;  4BIO A;  3EO4 A;  1E1R G;  5JQG B;  4QPK A;  3GIU A;  2EWB A;  2NMT A;  4ZGY B;  1THZ A;  1MSW D;  2VZZ A;  4BIU A;  4F6R A;  2DEA A;  1IDS A;  4OGQ B;  4PDR A;  3BPZ A;  4DR2 O;  4DR6 O;  1NTM H;  1R6K A;  4ZY2 A;  4AXV A;  3K9A A;  1ZO0 A;  2PUS A;  3D68 A;  5K1P A;  4LFA B;  4FD6 A;  3IO1 A;  4CAV A;  2EUL A;  1JMK C;  5IJ9 B;  4Q7A A;  5LRJ A;  4LF6 B;  1I08 A;  4XPL A;  3VBB A;  2DYS C;  4R3K A;  2Q43 A;  2Z3L A;  3P32 A;  1PP9 H;  4B13 A;  1QBZ A;  5KUK A;  2DE0 X;  4Q36 A;  3VQX A;  4WBN B;  1LAP A;  2IJH A;  4CPA A;  3W7X A;  3U11 A;  2P90 A;  4UEZ A;  1B06 A;  2B4D A;  3L72 H;  4A95 A;  1WPB A;  5EYP A;  1PM9 A;  4JLY A;  2KG7 B;  5IB9 A;  4GX1 A;  3LSU A;  4JZG A;  1XEQ A;  5AG2 A;  5KHJ A;  4PXE A;  1M90 W;  1M56 C;  2YND A;  1K7D A;  3RN4 A;  4E0A A;  1GN4 A;  3JSN A;  3B8G A;  1N32 B;  1R1B A;  1GTO A;  1YSJ A;  2A06 H;  4O2A B;  2OIG A;  1P4N A;  3OEE G;  1SZT A;  3T1C A;  3KQX A;  1XJO A;  3TO7 A;  4FLW A;  3AG3 C;  5IYC O;  4A94 A;  4P4J A;  2QEX V;  4F0Y A;  1MZE A;  2PYL A;  4NXM B;  3FB5 C;  4DV5 O;  1Q6I A;  2OYQ A;  2P6F A;  1NSA A;  4BBH A;  3LNM B;  2OCH A;  3R9E A;  3CJH B;  2GAN A;  2AFS A;  3JD1 A;  4X5K A;  4NSQ A;  2UXD B;  4J3G A;  4O4L B;  3OE7 G;  5BMV B;  3EFF K;  1HW7 A;  2MW2 B;  3GWO A;  4K0K O;  1CP9 A;  5LYL A;  1PCA A;  3R96 A;  4LC1 A;  4K30 A;  2FTK A;  2ZE7 A;  2NSM A;  1PKX A;  2VQE O;  1QSM A;  3D3S A;  1TUB A;  5IJ0 B;  3DR6 A;  1IYL A;  3JAL A;  1N8R W;  1XMB A;  1D5A A;  4LF5 B;  1GKF A;  4PA7 A;  1DE4 C;  5LBQ A;  1EN6 A;  1VHO A;  1S76 D;  5CB4 B;  4LWS B;  2REF A;  1KEC A;  1JR9 A;  1VQO V;  2IH3 C;  4CGM A;  1OBR A;  3QAY A;  5D5Q A;  1M4L A;  3DDD A;  3FNC A;  2WLN A;  4DV6 O;  5KHI A;  1EBO A;  2R9R B;  4JF3 A;  4J9Y B;  5KTD A;  1GM8 A;  1Z5V A;  3GKR A;  1JX9 A;  3JUW A;  3FED A;  3S6K A;  3STL C;  4MW3 A;  4OID A;  2WWW A;  4HNW B;  4DR7 B;  3CPX A;  2CGO A;  2XAS A;  4JI6 O;  4CAW A;  1K97 A;  3JCU Z;  2D2C B;  5J8C A;  4EWT A;  3JAK B;  3H1L H;  4IIJ B;  4PDL A;  4UIB A;  3CYO A;  4DV2 O;  5LMU B;  4CH6 A;  3FKS G;  3SJX A;  4U9Z A;  2R1I A;  3RYF A;  3HPL C;  1XOU A;  3BY6 A;  5JGF A;  2ZIN A;  4B11 A;  5LYF A;  3I56 V;  3B4S A;  1XRY A;  1K8A W;  1NU1 H;  2Q44 A;  4OC1 A;  4UV9 A;  4CC6 A;  1WB8 A;  4XNH C;  2VQF B;  4WJB A;  4KXR A;  2Y4U A;  4O4H A;  1KBH A;  4UFW A;  2HHH O;  4NGQ A;  2VRZ A;  1LOK A;  2CGN A;  3H9V A;  1RSO A;  5JVD B;  1Y66 A;  4DR5 O;  1YCI A;  3P2F A;  2Z3P A;  1EZJ A;  5K8O A;  1VQK V;  3SPJ A;  1YGH A;  2ITC C;  1FXV A;  2C6P A;  3RYC B;  5CBG A;  3H1I H;  2HLD G;  3NH4 A;  3I55 V;  1IBL B;  4DV7 O;  1LAM A;  5L3D A;  4YIO A;  2ABZ A;  3AEI A;  3VQY A;  2X7R B;  4JYC A;  2X6C A;  1XRE A;  1S5J A;  4G28 B;  1PV0 A;  1Y9W A;  4OP4 A;  3MN8 A;  3FB7 C;  1L0L H;  1OCR B;  4DK1 A;  1YVO A;  2EX3 A;  4NYK A;  4G1P A;  1WLE A;  1NJI W;  2DMX A;  3UT5 B;  1KMI Z;  2LP7 A;  1HNX B;  4PEL A;  4I55 B;  1YME A;  4I0X B;  1HR0 B;  5LMN B;  2CAZ C;  1QQ9 A;  2Q0Y A;  3LSQ A;  4PDV A;  4LF8 O;  1VKC A;  3R95 A;  1NVP D;  2F4V B;  2HKO A;  5AGE A;  4E8O A;  1SA0 A;  5BR8 O;  4JI5 O;  2VQY A;  4JYA B;  4CYQ A;  5JH7 B;  4JYB A;  1S77 D;  5LP6 B;  4MBU A;  4KOR A;  3B8N A;  1WB7 A;  2OCC C;  3HB3 B;  2J8M A;  4R8C A;  4BIN A;  3K2K A;  4O4I A;  5I4M A;  2DQ3 A;  4OPA A;  4UCO A;  4JV5 O;  2YIC A;  4QBJ A;  1IBM O;  2F95 B;  3CXS A;  1K3E A;  2YEV B;  4FVM A;  5LGT A;  3EC4 A;  4O2B A;  5LYJ B;  4O4J B;  3WFV A;  1SQG A;  2EK8 A;  4PXD A;  4KOX A;  5B5E Z;  4A31 A;  1XBU A;  4KOV A;  1R6T A;  1ZAU A;  2AFX A;  3SJA C;  4CH4 A;  1WP7 A;  4MMO A;  3CCE V;  1M57 C;  1R6N A;  2YDE A;  3OMA B;  1S7N A;  2F43 G;  4X88 A;  4PK3 A;  2ZEH A;  4PV6 A;  2ZEE A;  2HB6 A;  1QNM A;  2V4D A;  2UUA B;  2WPD G;  3CRM A;  3JAW A;  3ZN0 A;  1JA8 A;  1Q8I A;  1QLE B;  2QKS A;  1G6U A;  5IYD O;  1M4U A;  2YUA A;  4GLX A;  1Q2D A;  3OEH G;  1Z2L A;  4JYY A;  3L75 H;  2UU9 B;  4NR1 A;  1YF2 A;  1NVP B;  2GTS A;  3EVK A;  4YU9 A;  2JBJ A;  3K08 A;  2R7H A;  4L87 A;  2KCW A;  4DV1 B;  1ZLH A;  1Q7Y W;  4LF9 B;  3TOA A;  2HV2 A;  1J4J A;  2ZIM A;  2UXB O;  2IBZ H;  3WC6 A;  3FYI B;  3RGB A;  2DPS A;  4DNC A;  1SQH A;  4CBC A;  1VEW A;  3HKC A;  3SPI A;  3WB0 A;  3CCQ V;  3EFA A;  4BD9 A;  2PJ9 A;  3D7G A;  4MFP A;  1U97 A;  3CRC A;  2G3T A;  4AVA A;  2IJI A;  2YS8 A;  3HKE B;  1W2B U;  1ZUQ A;  3BJ7 A;  3TET A;  3BRC A;  2Q5Z A;  2PJ8 A;  3V8I A;  2YIB D;  1LUV A;  4PPZ A;  3P30 A;  3JVN A;  5KTC A;  4X66 B;  2Z3N A;  2FYU H;  4XDL A;  3F5T A;  3BA9 A;  3IAY A;  5A2Q N;  3TCV A;  3ASN C;  1Y0R A;  4ZKI A;  4GX0 A;  1N34 O;  1AIL A;  4X1I A;  1Z2G A;  5L3E A;  2PQ8 A;  5EZY B;  1JFF A;  5E79 Z;  3H01 A;  5IY5 B;  4TV8 A;  1NMT A;  3D67 A;  4MVU A;  2PJ1 A;  4FAI A;  1EFR G;  4PK2 A;  3AG4 C;  3WAB A;  1TKH A;  4QUS A;  2FL4 A;  3B3V A;  2IU3 A;  3K3W A;  3CRQ A;  5H5N A;  4X62 B;  3W7W A;  3CXC U;  1IYK A;  4C2Z A;  3R9F A;  4RQE A;  2FE7 A;  5F47 A;  2V8D A;  4X64 O;  1KP2 A;  4JI2 O;  4FLT A;  3UM7 A;  5JWP A;  3KAS A;  3PJS K;  2JDI G;  3FYE B;  1WPX A;  2FKX A;  1VQ7 V;  1PYT B;  1B3Q A;  1FFX A;  2QWP B;  4I50 A;  4P6Y A;  3Q4H A;  2F8H A;  2AFW A;  4P4I A;  4P44 A;  4DR1 B;  3B09 A;  4MHN A;  2ZEM A;  4C2X A;  3N2G B;  3OT7 A;  2B1I A;  1VIX A;  4KUA A;  3K9T A;  4MI4 A;  1JPX A;  4X8I A;  3A2F A;  1VQL V;  2QKA A;  4OX9 O;  4LBE C;  4OC3 A;  3ISZ A;  3IC9 A;  3OMN B;  4TQF A;  1K34 A;  3PBB A;  5F09 A;  1Q6H A;  5B1B C;  1K4C C;  3WG7 C;  2EIN B;  3NE7 A;  5D8N A;  3LDE A;  1ZL8 A;  1I21 A;  2QEC A;  4P4D A;  3CB2 A;  1S72 V;  3JD0 A;  4OC0 A;  4DV3 B;  1DTD A;  4NXY A;  2FIA A;  3A8T A;  4JI7 B;  2D4O A;  4B3T B;  5CA3 A;  2M7W A;  4P4E A;  3IIB A;  4TSF G;  1AP5 A;  4B3S O;  1NTZ H;  1H8H G;  1IBK B;  4R87 A;  2QKC A;  1SES A;  1S7L A;  1V0C A;  3IU1 A;  2HR3 A;  4B3R O;  4P30 A;  2F66 C;  4Z1V A;  5F46 A;  3PB9 X;  3B3W A;  4X1K A;  4ZIB A;  2WLJ A;  1Q2Y A;  1P7G A;  4A39 A;  1OCZ B;  4E4E A;  5C8Y A;  1E1Q G;  3VWE A;  1K4D C;  4RO2 A;  3BFR A;  5A9G A;  2FSR A;  4TV9 A;  3ZS8 C;  1VHS A;  4JI8 O;  5J2T A;  2VL1 A;  2P0W A;  3G80 A;  1GK9 A;  4CAX A;  4YIP A;  1FJG O;  2EIL C;  2ODM A;  5KA6 A;  1J5E O;  4LP8 A;  2EIJ C;  2BCO A;  4LUA A;  1Y9K A;  4IAV A;  4OKO A;  1WAZ A;  1OCO B;  2LO1 A;  2OR4 A;  5H84 A;  1JWQ A;  3GLJ A;  1P0H A;  4FZ1 A;  2Q4V A;  3AG2 C;  3ZED A;  3RYH B;  1OZP A;  1VMG A;  2NR5 A;  4ZOL B;  3SPC A;  4C68 A;  3TO9 A;  1IOF A;  3OTO O;  1D2D A;  3CC2 V;  2ZM6 O;  2PY5 A;  2F5I A;  3CMA V;  4NJQ A;  3FH4 A;  3DGV A;  3PFE A;  5J9P C;  1M93 A;  3A0H Z;  2FIW A;  1NH2 B;  4GKK B;  3FRM A;  2K1E A;  2GFQ A;  4CGO A;  2ZDI A;  5FPO A;  3SI0 A;  3C3S A;  1XMO O;  3FVL A;  1U96 A;  2CH7 B;  1P84 F;  2Q68 A;  1VGY A;  1RP3 B;  3OAA G;  4PJ0 Z;  1BPN A;  4IHJ A;  2FCK A;  4WFA V;  2YNC A;  4HNY B;  3KG2 A;  4YJ2 B;  1SQP H;  3U0Z A;  4DV4 B;  2FXF A;  2AJ6 A;  1Q86 W;  4MTG A;  1VF5 B;  1SER A;  2Q69 A;  1FXK B;  1L0C A;  3LD2 A;  2EUI A;  3CXH F;  1RO5 A;  3T1H O;  1ZG8 A;  2Q4P A;  4KHP O;  4C2Y A;  4AVB A;  1F4M A;  3ABK C;  3PGP A;  4JI3 B;  1TKF A;  1QR9 A;  2QTO A;  1H8L A;  5IB0 A;  3HKD A;  4X1Y A;  2W6J G;  4BAY A;  3T4Z A;  1P49 A;  5HVG A;  3DNS A;  1HDQ A;  2PR1 A;  4B7K A;  1HNW B;  1YVK A;  1XHX A;  2ZE5 A;  2UXC B;  1SZX A;  1OZ0 A;  2XEJ A;  2PYJ A;  3D8C A;  1VIB A;  3ZBH A;  4NB5 A;  4JGS A;  2HEP A;  2YC0 A;  5LYD A;  3F8K A;  3FB8 C;  3UCS C;  1SQV H;  1YX0 A;  2QVP A;  2X7B A;  3CCL V;  4P9P A;  2ZXW C;  3B3S A;  4JXQ A;  5IYZ B;  4NGM A;  3ZHS A;  1TF9 A;  5TIS Z;  5LRG A;  2I3C A;  3DSQ A;  1QVG U;  1H2L A;  3SJC C;  4JAU A;  2PTM A;  3HKB B;  2UUC O;  3S6F A;  4UV8 A;  4JAV A;  3DXR B;  2ZDI C;  1I1D A;  1YR0 A;  3RO0 A;  2ZXV A;  2JDD A;  3I1U A;  2EBO A;  3VOU A;  2EO8 A;  2BSK B;  3F0A A;  3L9D A;  3ZRW B;  4LFB B;  2YNC C;  3R1K A;  1SET A;  2E74 B;  1VAR A;  2B5G B;  4TT3 G;  3IC1 A;  3MRU A;  1XDC A;  1NR7 A;  4JPR A;  4LH6 A;  3MAQ A;  1VQN V;  5E96 A;  4LFC B;  4B08 A;  3SJE A;  4QC6 A;  2Q8V A;  4DJL A;  2NLJ C;  1YVW A;  4EKW A;  5IT9 N;  1N71 A;  3F7V C;  5J1Q A;  1PD3 A;  2RC4 A;  4X3R A;  2YIA A;  2Y69 C;  5DS0 A;  2C1C A;  1O9H A;  1QSR A;  4KSA A;  2CTC A;  2B5U A;  4KOY A;  3N27 A;  5LXT B;  3FAV B;  5KX5 A;  1HDJ A;  3PB4 X;  4WFB V;  4CAF A;  1R73 A;  3BLN A;  4QGP A;  4HYO A;  2DF5 A;  3NFZ A;  4RWU A;  4K35 A;  4NKG B;  1AJN A;  4LF4 O;  2PSW A;  5A28 A;  5LP6 A;  4UA3 A;  5L3C A;  4Y49 B;  5CPA A;  4MHY A;  1GMG A;  1D5N A;  2GU2 A;  1JCH A;  4U3J A;  2IL4 A;  3ZCC A;  5ELY A;  1Z4R A;  2CNS A;  3FEE A;  1BAV A;  3PEI A;  2JS5 A;  4FD5 A;  5H2F Z;  3ZMS A;  3RZA A;  4OLL A;  1EN4 A;  4HNA A;  1XL6 A;  5GW7 A;  4JJX A;  2ZW5 A;  4RQF A;  4KVX A;  4MVS A;  3BJ8 A;  1Q6U A;  1L0N H;  2AFO A;  5IWA O;  1Y0Y A;  1YJN V;  3M99 B;  3AG1 C;  2LGQ A;  1HWY A;  1NKD A;  2PVV A;  5FLX N;  2WLI B;  2FT0 A;  2YI9 A;  4IT5 A;  4KLV A;  1IOI A;  4NTY A;  5LA6 B;  4DV5 B;  3CCJ V;  2JGD A;  4NXN B;  3SYP A;  4G2K A;  4B14 A;  1R3K C;  4R57 A;  1GN6 A;  1SQB H;  3K04 A;  4HZ3 A;  4UUJ C;  5CA1 B;  1FY7 A;  3IGR A;  3SI2 A;  5GON B;  1RPO A;  4MFJ A;  3CWB H;  5B1A B;  4PI2 A;  4I4T B;  3D2P A;  3FF3 A;  5EMI A;  3QO7 A;  4IYH A;  2PIZ A;  2PJ5 A;  4PSW A;  3W7T A;  2JJ2 G;  3H4Q A;  2DYR B;  2VQE B;  1AR5 A;  1OHH G;  1X59 A;  3KZW A;  2Y48 A;  1IGB A;  4JZ2 A;  3LWU A;  3N2K B;  5EIB D;  5FNV B;  3ABM B;  1SF9 A;  3VAR A;  1VHE A;  1BS3 A;  5EC1 C;  3CXP A;  4ZX9 A;  2P7T C;  4AVC A;  2DOS A;  5LRK A;  4FFB B;  5LP6 C;  3OUS A;  4JI1 O;  2ZED A;  3OR6 C;  3ABU A;  5EBV A;  3E8G A;  2WLM A;  3MHH C;  3OMI B;  4PXC A;  3JSL A;  2JBK A;  3PFO A;  3E8H A;  3H5Z A;  2ADQ B;  1ELL P;  4E2L A;  4UBR A;  5C93 A;  3L70 H;  4C7U A;  2F7V A;  4KZT A;  2G38 A;  4D7T A;  1YI2 V;  1TF8 A;  4R76 A;  3CEI A;  3O9O A;  4F8Z A;  3KI9 A;  1SRY A;  3QNV A;  3SYQ A;  5I0C A;  4TUY A;  4JYW A;  3BEH A;  3TT2 A;  4OC4 A;  5CA0 A;  2P22 C;  3F7Y C;  4DV2 B;  1TGO A;  4MVR A;  2Q0O C;  2Q0A A;  2JJ1 G;  1PU9 A;  1FS0 G;  2P06 A;  4R7C A;  4I9Q A;  4GCZ A;  1FFT B;  4PHZ A;  1AUG A;  4CRY B;  3KHX A;  2HP8 A;  4DR3 B;  2AGA A;  4MCS A;  4UCN A;  4MJ8 A;  5B3S B;  3WU2 Z;  1RPR A;  4DR5 B;  2QWO B;  4NGR A;  1PNL A;  1HNZ B;  1K9M W;  3SR2 C;  1R3J C;  1SKV A;  1V55 B;  2Y0M A;  1PNK A;  3WB2 A;  5DEC A;  4TOI A;  2QWR B;  5ISV A;  1RFY A;  4W4L A;  3K5O A;  4DK0 A;  2GLF A;  4H37 A;  1Y7E A;  4XPD C;  5K8N A;  2CE4 A;  3A0R A;  1AVM A;  4UB6 Z;  1NR1 A;  4K3A A;  2EIM B;  2DPT A;  4DV7 B;  2PJ4 A;  1Q81 W;  1XUQ A;  5LHI A;  4IF5 A;  1BT8 A;  3KQZ A;  4LF6 O;  2O57 A;  4J41 A;  4JAS A;  4CZZ A;  4RUH A;  4FK5 C;  4MHP A;  4EB6 B;  2B9Z A;  3SGI A;  2EIK C;  2XOK G;  1UFH A;  2OTJ V;  4PA9 A;  4MVM A;  1L8D A;  2NN4 A;  1XMQ O;  2JEV A;  1P7B A;  2ODF A;  2XAF A;  3SJQ C;  5KHG A;  5LOV B;  4LF8 B;  5H9C A;  4H89 A;  3EY5 A;  2CIJ A;  5BR8 B;  3J7A U;  2AFU A;  4AI8 A;  2ZNI A;  1Z9U A;  2A7W A;  2PJ3 A;  2WSS G;  2BTQ B;  2R72 A;  2QGN A;  1N32 O;  2ZPA A;  3D36 A;  5KUM A;  4LQG A;  4NGP A;  5A27 A;  2JEX A;  2GSM B;  4P4F A;  1KUQ A;  2KKW A;  2XEI A;  3AK1 A;  3E22 B;  3PB8 X;  4JV5 B;  5IY5 C;  3R65 A;  4K8X A;  2JIZ G;  1FT7 A;  4J42 A;  4J7K A;  1BQZ A;  1VP7 A;  3S6G A;  5KMG B;  2EJ7 A;  3B35 A;  3JAR A;  2ETN A;  1Y76 B;  4MVQ A;  3BXM A;  4JD6 A;  2XAQ A;  1TVK B;  1OJH A;  2UXD O;  3CCM V;  2ZT9 B;  3JAT B;  4J7Z A;  1Z8L A;  4L89 A;  4NCZ A;  4A30 A;  4XDK A;  2J8R A;  3ETD A;  3IGA C;  4QB9 A;  4X20 A;  2XHB A;  1I0H A;  2ADP A;  2Z3Y A;  3SYC A;  1JOY A;  2GRE A;  5E1A C;  1OV9 A;  3AG7 A;  3E8F A;  1Q3E A;  2LQT A;  1MJA A;  4U7O A;  3TX8 A;  4QJF B;  2Z11 A;  4LF5 O;  1NT2 B;  1KU9 A;  2E3C A;  1Q90 D;  3QO5 A;  3VH9 A;  3WR7 A;  3B7I A;  1N36 B;  3D3I A;  1UWY A;  2V8V A;  2E5L O;  2WLL A;  5CMU A;  2A79 B;  2IJJ A;  2CY2 A;  4W9Y A;  2HJD A;  1JQ0 A;  3RNZ A;  2DQ0 A;  4YJ3 B;  4RI1 A;  3LOD A;  4DUY O;  1ZG7 A;  4YY3 B;  4P45 A;  5IX3 A;  3FJU A;  2UXX A;  2CTB A;  3EXN A;  4Q20 A;  4OME A;  3AK2 A;  2UXB B;  4I7Z B;  4LCU C;  2ZE8 A;  2WAM A;  4H0L B;  1AI4 A;  1N0J A;  3QNE A;  4U7N A;  4UIA A;  3IC7 A;  1RM1 C;  4DR7 O;  4IK2 A;  2DYS B;  1YK3 A;  1V9P A;  3D36 C;  5H6Q A;  2G9D A;  3FX7 A;  4Q38 A;  2Q7G A;  5LMU O;  3OFN G;  3ZHU A;  1J95 A;  3CP1 A;  2GUZ A;  3P3N A;  3RYI B;  3CE2 A;  1WA8 A;  3L73 H;  3CME V;  3THO A;  2PF4 E;  2WUU A;  4CS0 B;  1Z5R A;  2OTL V;  3SJF A;  1CEZ A;  1OCC C;  3BAB A;  4FM1 A;  2F93 B;  5B66 Z;  1ARM A;  3G3S A;  3I5D A;  3JCZ A;  1M56 B;  1L1F A;  2O28 A;  5HMN A;  3ABL C;  4H44 B;  3CZX A;  2VXK A;  4UCU A;  4DUK A;  2CTW A;  5GCN A;  4I49 A;  1HEE A;  3G71 V;  1N4C A;  1K33 A;  2IW5 A;  4WF9 V;  3JRU A;  1OCZ C;  4MY3 A;  4LQ6 A;  3OTF A;  2I00 A;  5CNP A;  8CPA A;  2KQX A;  2Q6A A;  3MGD A;  4B5P A;  4M85 A;  2ZEL A;  5EC4 A;  1QLN A;  5LGN A;  2PC1 A;  2PE3 A;  4Z2W A;  2JEU A;  4UVB A;  2R98 A;  4PDM A;  4RUE A;  5JJJ B;  2XAJ A;  1VQ8 V;  2P67 A;  5GTH Z;  2WZN A;  5KTA A;  3ZMU A;  3IWG A;  4F6R B;  4YHH O;  3KR5 A;  4H2K A;  4H6Z A;  1XNQ B;  3BAA A;  3M8A A;  4JI2 B;  2PJA A;  1LFW A;  3KKW A;  4RS2 A;  4X89 A;  3APO A;  3BCC H;  3EXA A;  4ZI7 A;  4KUM A;  5JH9 A;  4QE7 A;  3T1Y O;  3S9N A;  3C26 A;  3D4U A;  2F4V O;  4W4K A;  3X2Q C;  2N05 A;  4GS4 A;  1WN7 A;  2QM7 A;  4ZHQ A;  5GTI Z;  2ZR3 A;  2VWJ A;  3W6S A;  2BOB C;  4NGN A;  2EVN A;  5AG6 A;  4DRX A;  1H2N A;  2B4D B;  4FMT A;  5EYP B;  2DXQ A;  2PJ6 A;  2V7Q G;  4EFE A;  2CF4 A;  3K06 A;  2LFR A;  2IMO A;  1S7K A;  2MK3 A;  4HKF A;  4B3M O;  1YLO A;  3SXN A;  3RWR D;  2CK3 G;  4H33 A;  2QA4 V;  2PJC A;  2DN9 A;  2AW9 A;  3H8G A;  4PV1 B;  4UWI A;  4DUZ O;  2WPX A;  4G27 B;  3FB6 C;  4B3S B;  1CPS A;  1F57 A;  4XNH B;  4ZYQ A;  1QSO A;  3NXS A;  4MY0 A;  4JI0 B;  2FB5 A;  5BY1 A;  5AG4 A;  4B3R B;  3AK3 A;  1CG2 A;  2G3A A;  3N7Z A;  2HJF C;  5KLV H;  3NE8 A;  1CPY A;  3SPG A;  4PQA A;  2J9A A;  4UCP A;  1XNR B;  3K79 A;  2H3O A;  1XMT A;  1TUB B;  4R8F A;  3JAS A;  4DV1 O;  3E8B A;  1XOV A;  1AR4 A;  4LF9 O;  3ASO C;  3JAL B;  3CSX A;  4IHM A;  1SS3 A;  1FJG B;  3RBU A;  4F9V A;  1GM7 A;  3ZHT A;  3WB1 A;  3OD4 A;  1COW G;  3ZHV A;  4U5Y A;  3FB3 A;  3PBE A;  2OIE A;  1FD9 A;  3DLJ A;  3ZHR A;  1KZF A;  3OTO B;  3UKM A;  3CC7 V;  4GM5 A;  1B04 A;  1V54 C;  3DGE A;  3T4D A;  5F48 A;  2ZM6 B;  1GHE A;  5ITZ A;  3QAH A;  3K5N A;  2ZW7 A;  3NR7 A;  2FML A;  3PB7 X;  3O65 A;  4LNU A;  4BIZ A;  4M6H A;  4ZI6 A;  2RDC A;  2BL1 A;  5AG7 A;  1AJP A;  3G67 A;  2OCC B;  4GXH A;  2YXH A;  2WLK A;  4N23 A;  2HVJ C;  3BHP A;  1XMO B;  1E79 G;  3RYF B;  3PRT A;  2EZO A;  2OB0 A;  1SQF A;  3T90 A;  4LR3 A;  1MOF A;  2B1G A;  4R7M A;  3CDX A;  5JQG A;  4MFZ A;  1JQG A;  4FPP A;  3CT9 A;  2X0L A;  3DC5 A;  1IX9 A;  3CCU V;  4UVC A;  4O4H B;  3L2N A;  4UCS A;  1RSO B;  2QR4 A;  1WNS A;  4QPJ A;  3KKY A;  3SDL A;  3SJB C;  3T1H B;  4BW9 A;  1M57 B;  4KHP B;  3I3G A;  5IJ9 A;  4K3N A;  4KS9 A;  1MSD A;  1X10 A;  3CC4 V;  1ON0 A;  1DTO A;  1GN3 A;  4I5S A;  1KB9 F;  5FPR A;  4M6G A;  1S0V A;  3BI0 A;  5HFL A;  3ZJZ A;  2N74 A;  4IYI A;  4D7S A;  1R3L C;  5L3B A;  2JDC A;  1Z8T A;  3LNN A;  3TTH A;  4FFB A;  4WBN A;  3J81 N;  3FEC A;  5B1N A;  4DYL A;  3K57 A;  3VQV A;  2HQY A;  4MSW C;  1G8M A;  2CTP A;  3VAT A;  3E83 A;  5EK0 A;  2KG7 A;  4YWY A;  2Q9L A;  4MTX A;  3J80 N;  4FLY A;  2QSA A;  1F7Y A;  4ZBM A;  5J2U B;  3K9S A;  3K0G A;  4RN7 A;  5LGU A;  2BUE A;  3ABT A;  2CTR A;  2Q7S A;  4O2A A;  1O9G A;  1IY7 A;  3IJ4 A;  2QE7 G;  3FD9 A;  1SA0 B;  1I7F A;  1CP7 A;  1QR8 A;  1F2O A;  2Q7E A;  2Q4Z A;  5LL6 Y;  1W59 A;  2PIY A;  4KVO E;  4R6T A;  3CJH A;  3DR8 A;  4MVO A;  4DV3 O;  2LJ2 A;  3S3X A;  4JI7 O;  1H2K A;  1CP6 A;  4O4L A;  5LHH A;  1IVS A;  5BMV A;  2UUB B;  4B3T O;  1Y74 B;  1N33 O;  3BI1 A;  3S3W A;  1Z4E A;  2GBO A;  3KZI Z;  4UCT A;  1HP8 A;  4GKJ O;  1ELM P;  1Q43 A;  4KOU A;  5G22 A;  3OUF A;  5DN6 G;  1G4Y B;  1YEW A;  5IJ0 A;  1I94 B;  1WK4 A;  1SQQ H;  2ZW4 A;  3UO2 A;  3B2Y A;  3E86 A;  2B58 A;  3D7D A;  2NNU A;  4LF7 O;  1YIJ V;  4B6Z A;  2DYR C;  2ILM A;  4GT1 A;  1I5X A;  1JJ2 U;  4CYP A;  5CB4 A;  4LWS A;  4NEX A;  2QM8 A;  3ZIA G;  5JQ4 A;  1YRE A;  1T5E A;  5D29 A;  1BCC H;  4FD7 A;  3OGI B;  4JWP A;  2WLH A;  3JAW B;  3AG4 B;  5JJN B;  1IIC A;  1VQP V;  3NH8 A;  1MZF A;  5CN0 A;  2ZOF A;  3H8E A;  3S9L A;  4M3S A;  1IZ3 A;  4MCP A;  2FS5 A;  3TO6 A;  4MCQ A;  3HLP A;  2QTS A;  4X65 B;  4UVA A;  3JAK A;  4IIJ A;  3RT3 C;  1WWZ A;  2PJ0 A;  1BHB A;  5G1Z A;  4NTX A;  4LF4 B;  2LW7 A;  2Q7B A;  2YGW A;  1WJZ A;  5H6R A;  4DXW A;  3R9G A;  3L74 H;  4X9Q A;  4GKK O;  2YI8 A;  3HKC B;  4DV0 O;  1XF8 A;  5JVD A;  2ATK C;  2XUM A;  1NI8 A;  5C88 A;  3FMC A;  1X4T A;  4DV4 O;  2ATR A;  3RYC A;  1TVK A;  4JI4 O;  3P2H A;  5B1B B;  4JTA B;  3WG7 B;  1AP6 A;  4AQY B;  1VQ4 V;  3D3Q A;  1Z8W A;  3QO8 A;  3BHX A;  4U3F H;  2HVK C;  3WT4 A;  4X1I B;  2QJ1 A;  4F6A A;  5HXD A;  4JI3 O;  1JFF B;  3RW0 A;  1PL0 A;  2PZS A;  1H2S B;  1N0N A;  4P10 A;  4TV8 B;  4CGP A;  4UCR A;  2EIM C;  5BWA B;  3FYN A;  3UT5 A;  4NJR A;  1JVM A;  4RUF A;  1VQ5 V;  1EE3 P;  1GYT A;  4QVT A;  4DR2 B;  4I55 A;  4YXW G;  4I0X A;  4DR6 B;  4R9M A;  3ZZI A;  4CGN A;  2REE A;  3PP9 A;  4ASU G; 
#chains in the Genus database with same CATH homology
 2DPT A;  4IF5 A;  2R7H A;  3D2M A;  4A33 A;  2KCW A;  4MHD A;  2D4P A;  3TOA A;  2HV2 A;  3FBU A;  1J4J A;  3F5B A;  4YGO A;  4DNC A;  2DPS A;  3OWC A;  1UFH A;  1SQH A;  1R57 A;  4UWJ A;  2JEV A;  3UY5 A;  4A2Z A;  4H89 A;  2I79 A;  3EFA A;  3EY5 A;  4MFP A;  4AVA A;  1RXT A;  2G3T A;  4KLW A;  4U9Y A;  4YFJ A;  4EVY A;  3BJ7 A;  4KSF A;  1Z9U A;  3V8I A;  2ZPA A;  5G21 A;  3JVN A;  5A27 A;  3W6X A;  5KTC A;  1S60 A;  2Z3N A;  2OH1 A;  3RYO A;  3TCV A;  1B6B A;  2R8V A;  1K4J A;  4ORF A;  3S6G A;  1TIQ A;  2HUZ A;  2PQ8 A;  3IWE A;  1M1D A;  4JD6 A;  1NMT A;  1XEB A;  3JTK A;  4PK2 A;  4IUS A;  4QUS A;  2FL4 A;  4L89 A;  1QST A;  4NCZ A;  4A30 A;  2J8R A;  4QB9 A;  5DWN A;  1IB1 E;  1IYK A;  4C2Z A;  2B3V A;  2P6E A;  2VZY A;  3R9F A;  2FE7 A;  5F47 A;  1MJA A;  4LX9 A;  2Z11 A;  3E0K A;  4B5P B;  1KUY A;  3VWD A;  3WR7 A;  3FXT A;  4H6U A;  3SHP A;  4KVM E;  2CY2 A;  5G20 A;  4RI1 A;  3LOD A;  5IX3 A;  2C27 A;  3EXN A;  4C2X A;  3CXQ A;  4KOS A;  1S7F A;  4KUA A;  2CNM A;  4MI4 A;  1YK3 A;  4OAE A;  4Q38 A;  4KOW A;  1XE4 A;  2OZU A;  2P6G A;  3NE7 A;  2Z10 A;  1I21 A;  2QEC A;  2PDO A;  2WUU A;  4CS0 B;  5F49 A;  4E2A A;  4NXY A;  2B3U A;  2FIA A;  3G3S A;  2D4O A;  2O28 A;  2Z3M A;  2Q4Y A;  5HMN A;  3TOB A;  2VXK A;  5GCN A;  4I49 A;  5FVJ A;  4R87 A;  4JXR A;  4MY3 A;  1S7L A;  1V0C A;  3IU1 A;  2I00 A;  5CNP A;  1M4G A;  5F46 A;  3MGD A;  4B5P A;  4M85 A;  1Q2Y A;  5EC4 A;  2CXA A;  2PC1 A;  5H86 A;  5HH1 A;  3VWE A;  2FSR A;  1VHS A;  2R98 A;  2P0W A;  2H5M A;  5KTA A;  4CAX A;  3IWG A;  1BO4 A;  4H6Z A;  1M4D A;  2G0B A;  3KKW A;  4RS2 A;  5J8F A;  5C82 A;  4LUA A;  1Y9K A;  3TE4 A;  5H84 A;  5AG5 A;  1P0H A;  3C26 A;  4UFX A;  4XPK A;  1QSN A;  2Q4V A;  1OZP A;  1YLE A;  4C68 A;  4GS4 A;  3TO9 A;  5JPH A;  2OZH A;  1M4I A;  2Z3O A;  3SXO A;  2BEI A;  1NE9 A;  2JLM A;  3ZJ0 A;  3W6S A;  2F5I A;  4HNX B;  2EVN A;  5AG6 A;  2FIW A;  2ARH A;  2VEZ A;  2Z0Z A;  3FRM A;  2B4D B;  2PR8 A;  2OZG A;  4CGO A;  2DXQ A;  2ZW6 A;  4C7I A;  3TFY A;  2GE3 A;  1KUX A;  3I9S A;  1S7K A;  4HKF A;  2VI7 A;  3GY9 A;  3IU2 A;  4AG7 A;  3SXN A;  2FCK A;  2YNC A;  4HNY B;  4B12 A;  2FXF A;  2AJ6 A;  2OU2 A;  4YRH A;  4BMH A;  2WPW A;  4A32 A;  4FD4 A;  1L0C A;  3LD2 A;  4UWI A;  2EUI A;  2WPX A;  1RO5 A;  4NF1 A;  4ZBG A;  4C2Y A;  3W91 A;  4AVB A;  3EO4 A;  3PGP A;  4XNH B;  1QSO A;  2NMT A;  4ZGY B;  5IB0 A;  4MY0 A;  2VZZ A;  3QB8 A;  5AG4 A;  2Z3K A;  1IID A;  3DNS A;  2PR1 A;  3N7Z A;  2G3A A;  1YVK A;  5DWM A;  1ZO0 A;  4FD6 A;  4UCP A;  4CAV A;  3F8K A;  2CNT A;  1XMT A;  1YX0 A;  4XPL A;  4R3K A;  3S6H A;  2AE6 A;  2X7B A;  2Z3L A;  4ONU A;  4B13 A;  3A9L A;  4Q36 A;  4JXQ A;  4B10 A;  2A4N A;  2B4D A;  4U5Y A;  3FB3 A;  4CYN A;  4A95 A;  4JLY A;  1KZF A;  1MJ9 A;  2YND A;  3S6F A;  4E0A A;  5F48 A;  3B8G A;  1GHE A;  1I1D A;  1YR0 A;  3QAH A;  2ZW7 A;  1P4N A;  1KUV A;  2ZXV A;  2JDD A;  3TO7 A;  2BL1 A;  5AG7 A;  3F0A A;  1B87 A;  2YNC C;  3R1K A;  1XIX A;  4F0Y A;  2B5G B;  4CGL A;  2OB0 A;  2P6F A;  5E96 A;  3T90 A;  4BBH A;  4AG9 A;  3R9E A;  4MFZ A;  2GAN A;  4QC6 A;  1MJB A;  4AB7 A;  4X5K A;  4NSQ A;  4J3G A;  1N71 A;  1S3Z A;  2BSW A;  2RC4 A;  3R96 A;  4K30 A;  3I3G A;  2Q04 A;  4KS9 A;  1QSM A;  3D3S A;  3DR6 A;  1ON0 A;  4MFK A;  1I12 A;  1IYL A;  4UFV A;  1QSR A;  4KSA A;  4C7H A;  3PZJ A;  4KOY A;  2JDC A;  4CAF A;  2REF A;  3TTH A;  3BLN A;  4PSX A;  4CGM A;  3DDD A;  2HQY A;  3FNC A;  2PSW A;  5A28 A;  5KTD A;  4UA3 A;  3GKR A;  4XPD B;  4Y49 B;  3JUW A;  3S6K A;  2BUE A;  4KOT A;  4CRZ B;  2IL4 A;  4HNW B;  1Z4R A;  1NSL A;  2CNS A;  4CAW A;  4B5O A;  4FD5 A;  4OLL A;  5J8C A;  3T9Y A;  2B5G A;  4U9Z A;  2R1I A;  4B11 A;  4JJX A;  2ZW5 A;  2Q44 A;  4KVX A;  4KVO E;  3DR8 A;  3BJ8 A;  1Y7R A;  1BOB A;  4XNH C;  3DSB A;  4UFW A;  4OAD A;  3D8P A;  2FT0 A;  1Z4E A;  2K5T A;  5G22 A;  3P2F A;  4KLV A;  4KOU A;  2Z3P A;  4R3L A;  4B14 A;  1WK4 A;  1MK4 A;  4R57 A;  1YGH A;  5IV0 A;  1FY7 A;  2ZW4 A;  2B58 A;  3IGR A;  4MFJ A;  4CYP A;  4NEX A;  3D2P A;  5JQ4 A;  1YRE A;  4II9 A;  4PSW A;  3H4Q A;  1Y9W A;  4FD7 A;  4JWP A;  1M44 A;  2PRB A;  1IIC A;  1YVO A;  1U6M A;  4AVC A;  3CXP A;  4M3S A;  2FS5 A;  2Q0Y A;  3TO6 A;  2B4B A;  4MFL A;  1VKC A;  3R95 A;  5EBV A;  2WSA A;  5AGE A;  4CAE A;  4E8O A;  2GIV A;  2J8N A;  2VQY A;  3GYA A;  1WWZ A;  4CYQ A;  5G1Z A;  4UCM A;  3H5Z A;  4MBU A;  4CYO A;  2Q7B A;  4KOR A;  2YGW A;  4UBR A;  2J8M A;  3K9U A;  4KZT A;  4F0X A;  3R9G A;  1Q2C A;  2VBQ A;  4L8A A;  3FIX A;  4QBJ A;  3CXS A;  5I0C A;  1XF8 A;  3EC4 A;  3TT2 A;  1S5K A;  4KOX A;  4A31 A;  1PU9 A;  4KOV A;  2QML A;  5C88 A;  1S7N A;  2ATR A;  3G8W A;  2YNE A;  4CRY B;  3P2H A;  4PK3 A;  4PV6 A;  4UCN A;  4KUB A;  4MJ8 A;  1LRZ A;  4F6A A;  1CM0 A;  1PUA A;  2Y0M A;  4CGP A;  5ISV A;  5BWA B;  3FYN A;  4QVT A;  4R9M A;  4MFQ A;  3ZZI A;  4CGN A;  1Q2D A;  2QIR A;  2REE A;  1CJW A;  4XPD C;  4Y49 C;  3PP9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...