2FL4A

The crystal structure of the spermine/spermidine acetyltransferase from enterococcus faecalis
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
147
structure length
147
Chain Sequence
GMEIHFEKVTSDNRKAVENLQVFAEQQAFIESMAENLKESDQFPEWESAGIYDGNQLIGYAMYGRWQDGRVWLDRFLIDQRFQGQGYGKAACRLLMLKLIEKYQTNKLYLSVYDTNSSAIRLYQQLGFVFNGELDTNGERVMEWTHQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of the spermine/spermidine acetyltransferase from Enterococcus faecalis
rcsb
source organism Enterococcus faecalis
molecule tags Transferase
molecule keywords spermine/spermidine acetyltransferase
total genus 36
structure length 147
sequence length 147
ec nomenclature
pdb deposition date 2006-01-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.900 Mainly Alpha Orthogonal Bundle Helix Hairpins The crystal structure of the spermine/spermidine acetyltransferase from enterococcus faecali 2fl4A01
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 2fl4A02
3EXNA 4MI4A 5JQ4A 1S60A 4PV6A 4KORA 5J8FA 1CJWA 2VZYA 2VXKA 4HNYB 3TO9A 3F0AA 1I1DA 4HKFA 2PR1A 1QSOA 2R7HA 2VBQA 1QSTA 1KUXA 3QB8A 2WPXA 3LODA 3TTHA 3CXQA 4UA3A 2Q0YA 4KOSA 3SXOA 2EUIA 3S6FA 4CAXA 5GCNA 1U6MA 2FIAA 4XPDB 3EC4A 2BSWA 4MY0A 3BJ7A 1PUAA 2C27A 5J8CA 1L0CA 2P6GA 4KUAA 2BL1A 4GS4A 4B5PA 3TOAA 1TIQA 2VQYA 3KKWA 4NXYA 3R9EA 4CRZB 2ZW7A 4H89A 5C88A 2PC1A 3G3SA 3F8KA 3T9YA 4F0YA 5F47A 1M4DA 1Z4RA 1OZPA 4J3GA 3UY5A 4KVME 1K4JA 3RYOA 1XEBA 4KOXA 4PSXA 4M3SA 3S6GA 2OB0A 1KUYA 1YVOA 2Z0ZA 4AG7A 3CXPA 3TFYA 2WPWA 2CNSA 3EO4A 4JXQA 4AVBA 2B3UA 2ZXVA 4QC6A 3D2MA 1NE9A 3WR7A 2G3AA 3R9FA 5JPHA 4CS0B 2G3TA 3PZJA 2VZZA 4KVOE 5HH1A 3TO7A 2X7BA 3PP9A 1WK4A 4AG9A 2Q4YA 2Y0MA 3SHPA 1MJAA 4H6ZA 1Y9KA 4AVCA 4LUAA 2I00A 2CY2A 3FYNA 4MY3A 4NF1A 4XPKA 5EBVA 4LX9A 4NSQA 1FY7A 2O28A 2P6FA 3N7ZA 1IIDA 4ORFA 4RS2A 1V0CA 4KOTA 2PR8A 3FNCA 5KTAA 1YREA 1SQHA 3K9UA 5C82A 3DR6A 2Q4VA 1UFHA 4R9MA 1WWZA 4E0AA 1M4GA 5KTCA 1YR0A 4KLWA 4YRHA 3DDDA 1GHEA 1M44A 4KUBA 2J8NA 4NCZA 4Y49B 4H6UA 1B87A 3CXSA 1NMTA 2J8MA 5IV0A 2REFA 3NE7A 1BO4A 1PU9A 2HUZA 4KOWA 1BOBA 2R1IA 3MGDA 2FS5A 5H84A 3P2FA 3VWEA 1LRZA 5EC4A 5DWMA 4OLLA 3C26A 1Q2CA 3D2PA 1R57A 2JDDA 2GE3A 1RO5A 3IGRA 3TO6A 4UWJA 2CNTA 3V8IA 4AB7A 2QIRA 1M4IA 2G0BA 3TE4A 1Z9UA 1QSRA 5ISVA 4HNXB 2JEVA 4I49A 4E8OA 1MK4A 2B5GA 1YVKA 4UWIA 1S7KA 2D4PA 1Y7RA 2P6EA 3W6XA 1Q2YA 4PK2A 2OZHA 3IWGA 4KOUA 4MJ8A 2RC4A 1S7FA 3LD2A 1Y9WA 3B8GA 2P0WA 4OAEA 4JWPA 1QSMA 4K30A 2ATRA 4KOVA 3VWDA 4YGOA 3R9GA 2D4OA 1KUVA 3R1KA 3BJ8A 1S7NA 2FE7A 5FVJA 4QBJA 4IUSA 1P4NA 3FB3A 2ZPAA 4AVAA 4F6AA 2FIWA 2B4DB 1IB1E 4JLYA 4JXRA 2IL4A 1MJ9A 2B5GB 4UBRA 4U9YA 4R3KA 5IB0A 5IX3A 3DSBA 3ZZIA 4E2AA 5KTDA 2FSRA 1IYKA 1YK3A 3FRMA 2JDCA 2QECA 2FXFA 2H5MA 5H86A 2HV2A 4FD5A 4XPDC 4OADA 1CM0A 3R95A 4KVXA 2OZGA 3TOBA 3OWCA 4HNWB 1Q2DA 4KLVA 5HMNA 1KZFA 2GANA 1MJBA 2B3VA 2B4BA 2Q7BA 3D3SA 3EY5A 2ZW4A 3FBUA 4II9A 3S6KA 3W91A 4ZBGA 2VI7A 1S5KA 3TCVA 3SXNA 1IYLA 4R3LA 4X5KA 2PRBA 2AJ6A 2REEA 4YFJA 1RXTA 4ONUA 1NSLA 3FIXA 3GKRA 3JUWA 4CRYB 4PSWA 1YGHA 1S7LA 4KZTA 1XE4A 2A4NA 5F49A 1XIXA 5DWNA 1VHSA 4L89A 5CNPA 3S6HA 4U5YA 3E0KA 2EVNA 1I21A 1YX0A 4R87A 1IICA 4XPLA 2OZUA 1ON0A 3R96A 3GY9A 4JJXA 4XNHC 5F48A 2J8RA 4QB9A 1M1DA 2HQYA 4BMHA 3BLNA 2ZW6A 4QUSA 2OU2A 1P0HA 4XNHB 4KOYA 2F5IA 1VKCA 2CNMA 3P2HA 4RI1A 4MHDA 4Y49C 1I12A 3JVNA 4L8AA 4CAVA 4IF5A 2Z11A 1XF8A 2BUEA 4MBUA 2GIVA 4CAWA 2PDOA 2R8VA 2Z10A 3ZJ0A 4QVTA 2JLMA 3G8WA 3TT2A 2ARHA 1XMTA 2FCKA 2R98A 2QMLA 2AE6A 2PSWA 2FT0A 1N71A 3PGPA 4B5OA 3I3GA 3FXTA 1YLEA 2FL4A 2PQ8A 4JD6A 3H4QA 3GYAA 1B6BA 3QAHA 3D8PA 4FD7A 5F46A 2BEIA 5I0CA 4EVYA 5E96A 2K5TA 2B58A 4DNCA 3T90A 3DR8A 1QSNA 2VEZA 4FD4A 2NMTA 3DNSA 2OH1A 4M85A 4FD6A 4U9ZA 2B4DA 2KCWA 3F5BA 4R57A 4PK3A 1J4JA 2I79A 4B5PB 1S3ZA 2DXQA 1Z4EA 2Q44A 3W6SA 4NEXA 2Q04A 3I9SA 3EFAA 2ZW5A
chains in the Genus database with same CATH superfamily
2HVKC 3EXNA 2LP7A 4N21A 2WLJA 4MVZA 4YY3B 3HKCA 3OR6C 2DWEC 1CJWA 4KP4A 4MSWC 3BHPA 1I1DA 3ZRWA 4NKGB 5FNVB 2AFXA 2RB7A 2R7HA 1IBLO 4FM0A 3ABLC 3VQWA 3PFOA 5K1PA 2V8GA 4UA3A 2YXLA 1OCCB 1MMMA 3ABMB 3CD6V 4DW1A 2Q73A 1MZEA 3L9DA 5THWA 2VQEO 1Q86W 1ZWIC 2PY5A 3ZHUA 2A79B 4TV9B 5H2FZ 1WA8B 4CAXA 4CGOA 5IDJA 4CGMA 4UB6Z 2OTJV 1YHQV 4P4IA 1OJHA 2PIZA 2DOSA 4E4EA 3BJ7A 1AI5A 2C27A 3LACA 2CE4A 2P6GA 1N0NA 1BT8A 2PJ5A 4H2KA 4DJLA 4WCEV 1XMOB 1LAPA 2VQYA 1W59A 2PF4E 4PI0A 2Q8VA 2P67A 4LF4O 4LBEC 5LBQA 3PN1A 4EFDA 5LOVB 3I1UA 1US6A 4X2TA 1E1RG 3N27A 1OZPA 4J7ZA 3RT3C 3SPGA 4DV1O 3PB7X 4OC3A 2ZIMA 4TWEA 3CRMA 3K57A 3RYOA 1AJPA 1XEBA 1JQ0A 3K79A 4CGPA 3EVKA 4DR3B 1Y7EA 2YIBA 2WAMA 2HHHB 3SJGA 4G1PA 1K5SA 1PKXA 2EK8A 2Q6AA 5B1BB 1CPSA 5BWAB 3LNNA 2WPWA 3ETQA 3CEIA 3W7WA 3AG7A 3F5WC 3C3TA 3CCSV 2P06A 2CIJA 1R1BA 5B1BC 2ADPA 2B3UA 4KUMA 5J9PC 5A9GA 3AG2C 1R6TA 2KB1A 1NE9A 5JPHA 3GB7C 4UCTA 1ORQC 2EK9A 4C68A 1U96A 5LOVA 2VZZA 4KVOE 4LQ6A 1KKCA 3ZMUA 1SERA 3CB2A 4WFHA 2UXBO 2X7BA 3CPAA 2YI8A 4DV2O 4PXBA 1FAFA 3FMCA 5LYLA 4CH6A 2ZT9B 1ZO0A 1I5XA 2Y0MA 3HLPA 3SHPA 3SI1A 4HZ3A 1QLNA 1Y9KA 3T1YO 3PB8X 4Q7AA 5G22A 3W7XA 1GM9A 1IOFA 3FYNA 1FS0G 1SESA 4J7KA 4BINA 4DR3O 4WBNA 1FY7A 1IIDA 4ORFA 3AK1A 1W0JG 4ZOLB 1TKJA 1BPNA 3B35A 3FNCA 1IX9A 3I55V 5B1OA 1SA0A 3NE8A 4FUUA 2ZEGA 2JJ2G 1V54B 2VQEB 1ELMP 3CPWU 4MT8A 1WWZA 4E0AA 1M4GA 4KLWA 3UT5B 2UU9B 3DDDA 3APOA 3OUFA 4X1KA 1YXBA 1DF4A 2J8NA 3T4ZA 3IC9A 4Y49B 4LR3A 4LF6B 2OOTA 3JRUA 2N04A 1NMTA 3TETA 4WJBA 1H2KA 3FB5C 2AHYA 2REFA 4I55A 4PD4F 1Y74A 5KAIZ 4B3TO 1QQCA 3RVZA 4LH6A 5BZBA 3D4UA 2IBZH 1TUEB 4CS3A 5KUKA 2F4VB 5JCOC 1WN7A 2FVGA 4LFAO 5LXTA 2AFZA 4LC1A 4NGTA 1H2GA 3ZBHA 4LNUA 3WB0A 2F4VO 4PA3A 4XDLA 4K0KO 1S3JA 3RVYA 1YW4A 3BRCA 4UCVA 5AG5A 1R43A 5G1ZA 4A37A 3JSNA 2YNCC 3CRAA 4H13B 4D7SA 1HR0O 4KHPO 4B10A 3F7YC 2JDDA 3IGRA 3V8IA 4JTDB 2IW5A 1HR0B 4KHPB 2P7TC 1M4IA 3QVNA 2G0BA 3TE4A 3JALA 3CCVV 4QGPA 2AFWA 2XEJA 2UU9O 4HNXB 1BL8A 3ZMTA 4X3RA 4DR2B 4E8OA 1XILA 2B5GA 1YVKA 2WWWA 4UWIA 1AJQA 3ZMVA 4HPSA 1S7KA 4K35A 1P49A 4WFEA 2P90A 3UCSC 2P6EA 4DR1O 1ZG7A 1Q2YA 2NN4A 4EB6A 1PL4A 1N32O 1M57B 4MJ8A 1XJOA 2RC4A 3D36C 3P32A 4WF9V 2PVVA 1A32A 1Q90D 3CSXA 1GN2A 1GTOA 5KHKA 2IM9A 2QM7A 4JWPA 4OAEA 4EWTA 3MN8A 1EZJA 3D8CA 3H8GA 1QSMA 4UVBA 4BW5A 4PI2A 4HNAA 3VWDA 2D4OA 3R1KA 4RAIA 4OC2A 4DUKA 1K34A 2B9ZA 1URFA 4Z2WA 2FE7A 1L0LH 1E79G 2ZPAA 4F6AA 3S9NA 4GKKB 4DV3O 2Z3YA 2AZ2A 3K5OA 1PP9H 1PNLA 2KG7B 3G80A 4JI7B 2J9AA 1M56B 1Z8LA 1H8EG 5EIBD 4JV5B 3KQZA 1G8MA 4O4LA 4P6YA 5ITZB 1AB3A 3B3SA 2VQFB 2JDCA 4JYAB 1XNRO 3H8EA 3E8GA 4I0XA 4YXWG 1Y0YA 4FZ0A 2YNDA 4FD5A 2Y4TA 1ZL8B 2V8DA 1HWYA 1CP6A 1VEWA 4XPDC 5H5NA 3CT9A 2ZNIA 3B8NA 3NH8A 2IJJA 2XAJA 1Y67A 1S76D 1SZXA 2ZXWC 4Q20A 4LFCO 3GWOA 4RUEA 3IU2A 2HHHO 4DR5B 1IXBA 2PVWA 3RAMA 3KG2A 3WB1A 2PJ4A 2PJBA 3D3SA 4TV8B 2H3OA 1CG2A 3FBUA 3S9MA 4B08A 5G20A 4II9A 4MCSA 3PRTA 3ABKC 3RYHA 3SJQC 3CE2A 1PM9A 1VIXA 4FVMA 4HNAB 1DGSA 1HDQA 4MVMA 4LFCB 4DV3B 2EULA 1S5KA 2QWRB 2EJ7A 3LWUA 2UUBB 5IT9N 3E35A 3HPLC 3G6EV 1VQPV 4UXNA 5A28A 1Z8TA 4JI5O 1O9HA 4YFJA 4ONUA 1SF9A 4UVCA 4ZY2A 3I56V 1R3NA 4FFBA 3KHXA 4FLZA 2ZCEA 3IC1A 2DJVA 2PGGA 1J95A 4X65O 1YGHA 4AQYO 3SJAC 1Z2LA 2F8HA 2IH1C 1XE4A 2CTCA 2IJZA 3AG4C 4IIJB 4K8ZA 2E74B 5DWNA 3N2KB 2ODFA 3THOA 4PA9A 4YHHO 1SA0B 5CNPA 4LF4B 1XMBA 1YX0A 5JVDB 3ZN1A 1JCHA 3RYHB 1OCZB 3S3WA 5IY5B 4LFBO 2N74A 1XNQO 2OZUA 1ON0A 1UWYA 4JJXA 3DTUB 4OC5A 2E5LO 4GM5A 2IJHA 3ZHTA 1XNQB 5E1AC 2ZW6A 2ATKC 1P0HA 3D67A 2Q4ZA 2DN9A 4TOIA 2DYRC 4DUZB 3Q4HA 5EZYA 4PDMA 3LMSA 4I4TB 4Y49C 1SQGA 2WLMA 3JVNA 1IBKB 4CAVA 3KKYA 1XF8A 3KGQA 4OC0A 1Q6IA 4CS2A 1F51A 5LHIA 3CP1A 4NFRA 1WP8A 2Z5UA 2R8VA 1Q6UA 3BAAA 4X1IB 4B6ZA 3BFRA 2PZSA 2Z3OA 4DW0A 1XHZA 3TT2A 2QMLA 4AHCA 4L87A 3RO0A 2XASA 1DLBA 2AW9A 3PGPA 4TQDA 4Z65A 2AXTZ 2E75B 3I3GA 3D3QA 3ML0A 1UFIA 1H2SB 3BY6A 2HKOA 5FL7G 1M5IA 2ZM6B 3JATB 2GTSA 5C8YA 5B1NA 4P30A 2UUCO 4ONWA 3JATA 1AR5A 1MOFA 2HG5C 3AEIA 5LXTB 2VWKA 2PQ8A 3JASA 3QAHA 5F46A 2X7RB 4U7OA 3OD4A 3FECA 4MCPA 4EVYA 4P4DA 2ZEDA 3EXAA 5CA1B 4DUZO 2K5TA 4DUYO 1OCOC 2B58A 4DNCA 4GX2A 2W0FC 1H8LA 2P22C 3IWWA 4B3TB 3SYPA 1QSNA 2NSMA 4DR7B 1MNGA 4BIOA 2NMTA 3SGIA 4M85A 4UCOA 2ANPA 1V55C 1QR8A 2ZR2A 5JCOA 4JAVA 1N33B 1XNRB 4IT5A 2I79A 1XREA 3T1YB 3AG3C 5L3DA 1WPBA 1Z4EA 2Q44A 3W6SA 1KUQA 4JYBA 1AP5A 2LFSA 1TUBA 2RQ6A 3CRCA 4GKJO 4MI4A 3MD0A 4QE7A 4XDKA 1N36B 4B3SO 5IB9A 1YJNV 4MMOA 3JAKA 2ETNA 4TV8A 2O53A 1Y0RA 4DR6O 4NJRA 4HNYB 3E8FA 4X66O 3TO9A 1J5EB 5IE9A 4HKFA 3ZRVA 4JV5O 4CC6A 5LRKA 2PR1A 1KWMA 5FNVA 2YSUB 4PV1B 2LQTA 2WPXA 1AP6A 4FK5C 2BOAA 3TK1A 3L72H 3CXQA 5IYBO 3TX8A 2P5OA 2C1CA 2ZQMA 3KCXA 4C7IA 1I0HA 2B5UA 2RDCA 2HEPA 4U3FH 4PA7A 2PJCA 5CMUA 4E2LA 4A94A 4P4JA 2Q7HA 3D36A 2Q69A 4UEEA 1XBUA 2EUIA 4F6RB 4LF7B 4UCMA 2OCCC 1EN5A 1LAMA 4XPDB 2ZE5A 4I0XB 4MY0A 1TA8A 4Q6GA 4DRXA 1QNMA 4GS4A 2Z3KA 3BA8A 1IOIA 3T8WA 1CX8A 2NR5A 4NXYA 1AI6A 3R9EA 1HW7A 4CRZB 3R66A 2ZE6A 1KKDA 3F8KA 1R6NA 3FH4A 3B8MA 3T9YA 4YJ3B 2BOCC 1SQFA 3MHHC 4JI2O 3N2GB 3CC7V 2BSKB 2VRZA 1D5NA 3V7ZA 4JPRA 4UEZA 1I7FA 1M4DA 4ZX9A 2ZR3A 2VWJA 2E5LB 2Q0AA 2WLKA 2V4DA 3QO5A 3ZMZA 1K5QA 1KD1W 1K4JA 2RN9A 4U3JA 3CCRV 3KZWA 4FBEA 1XHXA 4K8XA 3D68A 5K8NA 1TAEA 2HVJC 3S6GA 1T5EA 1GAXA 3T1HO 2ZDIA 5LMUO 4YIPA 2PYJA 2A0LA 4GKKO 2OB0A 2CTQA 2WLLA 3ICXA 1R6KA 1PD3A 3CCMV 4B3MO 1YVOA 2ITCC 4BR6A 3CXPA 3U10A 3AG2B 2AFSA 3G71V 4NTXA 1K7DA 4LQGA 4Z1MG 3D7DA 3EO4A 4NGSA 4R8CA 5LGNA 3AK2A 2ZXVA 4X65B 1HP8A 1CBXA 2JEWA 3WR7A 1FJGB 4LP8A 3CZXA 4CS0B 3FJUA 3PZJA 3FD9A 4ZOLA 5IWAB 4CC5A 2AZ0A 3TO7A 3VQYA 4YIOA 5IY5C 3SYOA 3SYQA 4MHZA 4AG9A 1B06A 4NJQA 1MJAA 4R7CA 3CCEV 5AGEA 1KECA 4JTAB 5CBMA 3AG4B 4QIWF 1B6QA 2QWQB 4JI5B 1BS3A 4MY3A 4NF1A 5GTIZ 1Z5WA 3I5DA 3OT7A 3N7ZA 3NH4A 1V0CA 4RS2A 5KHGA 5CPAA 2PR8A 1M4UA 1SZTA 2OR4A 1MZFA 2QSAA 3K9UA 5CA0B 4YU9A 1R73A 4JGSA 2CTRA 5F09A 2Q4VA 4R8FA 1ZLHA 4MVRA 3HUVA 4A31A 1F4NA 2ODMA 4P4EA 4PDRA 1GN6A 3BI0A 2V1DA 1GHEA 3RZAA 4GZRB 4TQFA 4KUBA 4LF8B 3JALB 4DV6B 4ZGYB 1TF8A 5LYFA 2JDIG 2YUAA 2E76B 3CXSA 1HNZO 2N05A 1IDSA 4I7ZB 1CXZB 4MHYA 3P30A 2QJ8A 4EEQA 3NE7A 4JASA 5KMGA 3FYEB 2R1IA 1JR9A 4KFMA 4PPZA 1EZVH 3CWBH 3B77A 3W7TA 1F2OA 4HBNA 4W9YA 3LSQA 2YEVB 3CRQA 3S3XA 3O9OA 3D66A 2ZE7A 2Q0OC 2W0XA 2FS5A 5EMIA 1IU8A 3M99B 5EC4A 2EJRA 2LO1A 3IEHA 3W7SA 4OLLA 5J2TB 2GLJA 3VATA 1OHHG 2BOBC 2B1GA 3SR2C 1YEWA 3IFEA 1R57A 4RQEA 2CF4A 2ZEMA 5KA6A 5LGTA 1SQVH 1Z5RA 5B66Z 3TO6A 3STZC 2CNTA 2OTLV 2DQ0A 2YDEA 3C3SA 3CPXA 4B7EA 4O2AB 4EFEA 5DEDA 5ISVA 2AFUA 2KQXA 3J80N 1JFFB 1DE4C 4I49A 4CPAA 1MK4A 2EIJC 3ETDA 3LUTB 1P4RA 1SQXH 1QCEA 1NBMG 5L3BA 4DR1B 3SI2A 3OMNB 4ZI7B 4FAIA 3ABLB 4JI0O 2OYQA 1Y7RA 5A27A 2EBJA 4NGRA 2Q67A 1K4DC 3W6XA 1M93A 2OZHA 2UXBB 1SKVA 3QAYA 2Y69B 1QLEC 4UV8A 3J7AU 3IWGA 4O2BA 4B12A 1S7FA 3LD2A 4H37A 1N0JA 4NTWA 1Y9WA 1OCOB 3HKEB 3A2FA 4HAMA 2PJ9A 3WB2A 1EE3P 3ZHVA 3K3WA 2ZKOA 5BR8O 4LH7A 4IHJB 5KX5B 4CS4A 1F57A 2CH7B 1YSCA 1TGOA 4A30A 5FVJA 4DV5O 2FTKA 3RYFB 2A06H 4OP4A 4O4HB 2B4DB 2Q4PA 3SJFA 1QLEB 2IL4A 2B5GB 4UBRA 1EFRG 4QPJA 1IBMO 4U9YA 2WA3A 3QG5A 2DWDC 3DSBA 3ZZIA 2ZE8A 3ABMC 5KTDA 2FSRA 4R6TA 1AR1B 1FYJA 4LF6O 1ZTEA 3P3NA 3FRMA 2QECA 3EFFK 4JAUA 2YGWA 2NNUA 1AVMA 2D2CB 2RFHA 5H86A 3R65A 3H5ZA 2HV2A 1Y6XA 1CM0A 2F95B 2YIBD 2EO8A 3R95A 1AYEA 4UFVA 4PJ0Z 4G28B 4HNWB 3ETGA 2R70A 3CC4V 4CH5A 4JF3A 2QM4A 3N2GA 1AJNA 3PB6X 3B3WA 3RBUA 3JCUZ 2B4BA 2DMXA 4GT1A 1EBOA 4NGNA 4N23A 1K9MW 2IQ6A 1OZ0A 1VIBA 2ZW4A 1EM1A 3ZRXA 4I9WA 1Y76A 2EIMC 1BPMA 3CRRA 3K5NA 1K33A 2QWOB 4OC4A 1FFXB 3W91A 1NSAA 4ZYQA 2QTOA 3KCYA 1G1XB 2XEIA 5EC1C 3N5FA 4JZ0A 1NTKH 3OMIB 4X1IA 4FLYA 5JJNB 2ZEHA 2CUGA 2MW2B 1KC8W 4DV2B 4JZ2A 2FKXA 3ETEA 4MFPA 3OEEG 1NSLA 3ZHQA 4YHHB 4MTOA 5LRGA 4P9PA 2EIKB 1M1KW 3DLJA 4QPKA 1NI8A 1BAVA 2Y0PA 1NZ6A 3OTOO 4UFWA 2GLFA 3FB8C 1Q3EA 5KA5A 1ROPA 5C8YB 2G9DA 4UFXA 4GYCB 1XIXA 4EKWA 1WNSA 4K3NA 1BCCH 2GDSA 2ZDIC 4FM1A 2CTBA 4ZX8A 1I21A 2JGDA 5LYJA 3K06A 2BTQB 4JI2B 1IICA 2PJ0A 2E3CA 2UXDO 4MW8A 5CBGA 4FM2A 1PYTB 5IYZA 1Q81W 4CAEA 4HYOA 2A9HA 4OIWA 2F7VA 2QGNA 4UUJC 4QB9A 2HQYA 4BMHA 2ZD9A 2PJ7A 3CX5F 3BLNA 4ZIBA 4FLXA 4DXWA 2LGQA 4QUSA 4PA6A 3RWRD 2A7WA 4KOYA 4EFBA 4XNHB 4RUFA 4CYQA 4AI8A 3E22B 1VKCA 2CNMA 2C6PA 4W4LA 2H8PC 2LGWA 4RI1A 5EC2C 4BIUA 4MHDA 4J10A 2JJ1G 1I12A 3SJXA 3U11A 2Q43A 2HJFC 4DR5O 4J9ZB 2GIVA 1GN3A 3VH9A 4GLXA 2QKSA 1VQOV 3H8FA 3RYIB 2Z10A 3CHXA 3ZJ0A 5LHHA 5BXZA 3A0BZ 4QVTA 2ARHA 4W4KA 5KMGB 2JS5A 2XAHA 3CMEV 1NT2B 4RQFA 4F9UA 4MHPA 5IWAO 1N71A 4B5OA 1Q7LA 4IHJA 3QTCA 2Q5ZA 4FLVA 2Q9LA 1AROP 2DPSA 2LJ2A 2BCOA 3NFZA 3HKDA 2ABZA 1U97A 1V54C 1XRYA 2Y0IA 2Z3PA 4IAVA 1HDJA 1S72V 5IJ0B 3FXTA 3QNVA 3OUSA 2P4KA 2JS3A 2FL4A 5H6RA 3ISXA 1BHAA 1B6BA 3D8PA 2B1IA 3WG7B 3B3VA 1XFOA 3BEHA 1YDXA 1NVPB 2O57A 1OV9A 3D7GA 4YY3O 2H94A 1YQEA 2EIJB 1BE3H 4TUYB 1N32B 1ZLIA 4JI3O 4FLWA 1B04A 4FD6A 2ZM6O 2CAZC 2B4DA 5LGUA 2EILB 3ZHRA 4IGGA 4R57A 1DF5A 3BHXA 3ABTA 3ZMSA 4PDVA 1CP7A 2ZELA 1N34B 2DXQA 2X6BA 3DC6A 2WSAA 2Q04A 1NR7A 5GONA 4NEXA 1ZSPA 4O2BB 4UIBA 2P6JA 4CBCA 4OMEA 4FLUA 3IWEA 1VMGA 5JQ4A 1S60A 1M56C 3BI1A 4PV6A 4MVSA 4YWYA 4X8AA 4KORA 5J8FA 4X8IA 2GV9A 5GW7A 2QR4A 2VXKA 4H33A 2HB6A 3E8BA 5ELYA 5HVGA 3ZRWB 1K92A 3L2NA 1DTOA 2M7WA 4UCRA 4I5SA 2JGUA 2QM8A 3T1CA 1QSOA 3DXRB 2DPTA 1QSTA 4A5UB 5TISZ 1KUXA 3VQVA 4F9VA 3QB8A 5LA6B 1YITV 3TTHA 1B3QA 2Q7EA 3ZN0A 5IJ9B 5KAFZ 1JFFA 3B2EE 2Q0YA 2PJ2A 2FYUH 3ZX6A 5LMNO 5AG7A 1IBKO 4UF4A 3CMAV 3B3TA 1CPYA 4P4BA 5AG2A 2XTAA 4J9YB 4JI8B 3D7HA 3SXOA 2Y4UA 1U6MA 2WLLB 1OBRA 4ZI6A 2GBOA 1I5YA 4LFBB 3EC4A 2DF5A 4UVAA 1FXVA 1NTMH 1A2ZA 1L0CA 2BL1A 1K3EA 4P45A 1S77D 4B5PA 2KSDA 2AFOA 3SPIA 1TKFA 1OCCC 3KKWA 5JQGB 2ZW7A 1RSOB 3G3SA 1P7GA 3HKBA 4OPHA 3SYAA 3JARA 5BMVB 4A38A 4PELA 5LYDA 5JWPA 2UUBO 4F0YA 3LDCA 1YI2V 3ABKB 5LRJA 4K3AA 3ZIAG 2R9RB 3FEDA 3OFNG 1XOVA 3BXMA 2XAQA 4DRXB 4KOXA 4P9OA 1R3LC 4DUYB 2CGNA 4LCUC 3K2KA 5CN0A 3SJCC 4H0LB 1Y4MA 1JOYA 2Z0ZA 4AG7A 3SDLA 4PXDA 2M6YA 4CZZA 3ABUA 2ZOGA 4ZY0A 1P84F 2WA4A 1QBZA 3KL9A 2YXHA 4JXQA 4AVBA 1JJ2U 5IYZB 1PPJH 1ZAUA 1VF7A 2G3AA 4NXMO 1VQ9V 3IAYA 3ASOB 5HFLA 1R3JC 1I08A 2XNDG 3VQXA 4GKJB 1S0VA 3RGBA 1KBHA 2EIKC 1RM1C 2C6CA 3RBZA 1GM7A 1ZUQA 1XMQB 5EBLC 1WK4A 4OIDA 2Q4YA 1ZLZA 2EZOA 5I4MA 2EZPA 5AG4A 3WT4A 1LANA 1H2LA 4LUAA 2I00A 2V8VA 1LFWA 2C6GA 2CTWA 5EBVA 1RP3B 1RFYA 3PJSK 5FLXN 3AG1B 5KTAA 1YREA 2C2AA 1KB9F 4DYLA 3MRUA 2QVPA 1HNXB 4NVPA 1SQHA 1N8RW 1Y76B 5C82A 3DR6A 4JYYA 1AI4A 4JI8O 4CGLA 5EBWC 3T2MA 4R9MA 1LUWA 4X20B 1LNQA 2R9IA 5H9CA 1LUVA 2Q68A 1YR0A 2P4VA 4YRHA 3OEHG 3CCJV 1Q82W 1M44A 1N4CA 4NCZA 1J5EO 3UQ8A 4H6UA 1B87A 4B3RB 5DECA 2AFMA 2J8MA 4M6HA 5IV0A 3QF7A 3JD2A 2HJDA 1ZG8A 2YICA 2YC0A 2HC9A 2HUZA 4KOWA 4RWUA 5D5QA 3WABA 4WWVA 4JI1O 4UIAA 2WZNA 3LSUA 4X88A 4JI4B 3A0HZ 2YEVA 2QJ1A 4FJCC 5JH7A 2JBKA 2EILC 4TUYA 1F7YA 4ZKIA 1JVMA 3B09A 3NH5A 4P10A 3MGDA 5H84A 3P2FA 4LF7O 3CJHA 3E22A 3TJTA 3FKSG 4X1YA 1W2BU 2YNEA 1IGBA 4X1YB 2XAGA 2POKA 1Q2CA 4C2ZA 3E89A 4CAFA 4OKOA 3K5LA 3K04A 2X6CA 4UWJA 3DXRA 5JH9A 3K08A 2QIRA 3G6BA 4WFGA 1QSRA 3IFXA 3KZIZ 1F2PA 2HLDG 5B1AB 3J81N 1L1FA 4R6ZA 5JGFA 2X0LA 3V38A 2PE3A 4KL1A 5CBFA 1YSJA 2D4PA 2OIEA 2F66C 3ASNC 2OCHA 1XBLA 4FMTA 4YJ3A 3WG7C 4KOUA 2F23A 2L6LA 4P4FA 3B2YA 4D6TH 3X2QC 3B8GA 1LCPA 3D3IA 5HXDA 2WLNA 3S9LA 4R76A 4F6EA 4JI3B 1HDUA 4K30A 3X2QB 4YGOA 4A39A 3OM3B 1KUVA 3PB4X 4FPPA 1S7NA 1N34O 5LHGA 4MFKA 1P4NA 3FB3A 4AVAA 1S5JA 2CGOA 1IB1E 4LF5O 2Q7GA 2JEUA 4JLYA 4JXRA 3KR5A 4R3KA 1VQ4V 5IB0A 4U7NA 5IX3A 4C2YA 3KR4A 1GM8A 4IYHA 3RN4A 1X10A 3ZCCA 4P44A 4JI0B 1G6UA 3UO3A 4JTCB 4X66B 3SPJA 1QQ9A 3JCZA 1VARA 3KQXA 1Z8XA 2R72A 4JYWA 4TWKA 4AXVA 2G38A 4G2KA 1X12A 4NYKA 4Z1VA 4CH3A 2WLIA 3NXSA 4A33A 1V9PA 3MAQA 2OZGA 3TOBA 1KP3A 1Q2DA 3T1HB 1VQ5V 3GIUA 1VQ7V 2ZEEA 4RN7A 4X62B 1N33O 3P3PA 2B3VA 4PXEA 3EY5A 1TVKB 4LWSB 4WFBV 5CBHA 1GH6A 1NS1A 1GRJA 3IJ4A 5H6QA 3H1JH 4YJ2A 1RTQA 3WU2Z 3H1LH 4TV9A 4NXMB 4BD9A 2VI7A 3TCVA 3SXNA 1GK9A 2PJ1A 4CYNA 1Q8IA 1SC5B 1IYLA 4X64B 4R3LA 4X9QA 1WPXA 3KHZA 3KI9A 2ZXWB 4R50A 2QEXV 4MVQA 2REEA 1RXTA 1IY7A 2ITDC 4LFAB 1CEZA 4B11A 2IU0A 4NXNB 4IHMA 3RYCA 1SQBH 5KHHA 4EMEA 3A8TA 4I50A 3RYCB 4RUHA 8CPAA 3VARA 2A4NA 1QHTA 1FXKC 1L8DA 1OCZC 3VOUA 2UXCB 3ZJZA 4L89A 5LMUB 3S6HA 3H1IH 3TCUA 2GUZA 2Y48A 2HFEC 1Y74B 4R87A 3RFRA 1Y66A 2VL1A 5B3SB 1YJ9V 4PDLA 2Z3MA 1FXHA 4F4LA 3WFVA 4LF9O 3GY9A 4NGMA 4XNHC 5F48A 4UFZA 4XBFA 5BMVA 1M1DA 2Z3NA 3W7UA 1VF5B 1NQTA 1HNWO 2QYVA 2Q7SA 3QNEA 3B7IA 4CGNA 2OU2A 3FF3A 1TVKA 4LWSA 2F5IA 1FD9A 5DN6G 3P2HA 1WAZA 2GUZB 3JD3A 2X6AA 1M90W 3L70H 2BTQA 3E8HA 2Q51A 3PBEA 4L8AA 1MABG 4IF5A 5L3GA 2Z11A 2BUEA 2PUSA 3JD1A 3MDSA 1YCIA 2DE0X 1BZKA 2PCUA 4DV7B 5B3SC 2K9PA 4J7JA 5B5EZ 1VHEA 2JLMA 1OCRB 4KXRA 2JEXA 5HVHA 5A2QN 1XMTA 4O4JB 4DV0O 2FCKA 2R98A 4OPAA 2AE6A 4Q36A 3FB6C 2FT0A 3VBBA 5BY1A 1PCAA 4PXCA 1XQ8A 2UXNA 4MCQA 1THZA 4ZI7A 2DYRB 1FPOA 1S5LZ 2BCCH 4R7MA 1QVGU 1AUGA 3CC2V 3TC8A 4P2ZA 4IL6Z 1K97A 3L73H 5LL6Y 5LA6A 5EIBC 3APQA 1YLEA 4ZHQA 4L8JA 4JD6A 1Z2GA 3A0RA 3OGIB 3RW0A 5KUMA 4TNUA 4H44B 1H2MA 3JTKA 5J2UA 4AILC 5I0CA 2DQ3A 5KX5A 2L35A 5E96A 1IURA 1PV0A 3CXCU 1WA8A 4X1KB 3T90A 3L74H 3IC7A 4MVOA 2BTOA 1AMPA 2YI9A 3DR8A 2VEZA 1W0KG 3STLC 3CCQV 3PBBA 1EN4A 3HR0A 3K0DA 2ILMA 4U9ZA 5LYIA 2KCWA 2XHBA 3E83A 2XOKG 1F4MA 1WB8A 1WB7A 3B40A 3MHSC 5J2TA 4PK3A 4B14A 3BVOA 4B5PB 4MFZA 4KSIA 4DO2A 3H1KH 1K8AW 2ZOFA 3I9SA 3UKMA 5KLVH 1XMQO 4B7KA 3EFAA 3KASA 2A3QA 1LOKA 4CYOA 3LDDA 1Z8WA 4JI6B 1JX9A 2ADQB 4EB6B 3C90A 4MFQA 4B3MB 2UXXA 5K1XA 2VZYA 3GWKC 1HNXO 1E1QG 1NH2B 3F0AA 4M6IA 3JAWA 5EYPA 1H2NA 2OIGA 2YIAA 3E2EA 1HNWB 3DGVA 1VGYA 5B1AC 1VQKV 1VQ6V 1SETA 5ITZA 2JBJA 2VBQA 4UCSA 2MK3A 2UUCB 2WYRA 4FWUA 3QO7A 4O4IA 3LODA 5LMNB 5LP6C 1NKDA 3CJHB 1VF6A 1BHBA 2WLIB 2KG7A 3M8AA 4KOSA 1YZBA 1BQZA 4A2ZA 2VS0A 2PI5A 1MA1A 5CA1A 5JQGA 2RNBA 2EX3A 2JK5C 4JAAA 1Q5OA 4K0KB 1SQQH 1RPRA 2BE3A 5GCNA 4I50B 4GUNA 1QU7A 3S6FA 2FIAA 2BSKA 1YJWV 4X62O 1TXRA 2BSWA 3HKCB 1PUAA 3K03A 1UPGA 5J8CA 4KUAA 3PFEA 4MTFA 5JVDA 3TOAA 4FFBB 1TIQA 4KSAA 1XUQA 1AR4A 2IJIA 5EYPB 1MSWD 2XEFA 2JRIA 4NB5A 4H89A 4PQAA 4LF5B 5C88A 2PC1A 4BW9A 4F6RA 4JYCA 4X89A 3UO2A 1IVSA 1BLLE 4MCRA 4JYAO 1X4TA 2QWPB 4O4IB 4A95A 1L0NH 1QVFU 5IJ9A 3GVMA 4M6GA 4IYIA 5JJEB 1Z4RA 2W6IG 4O4HA 5F47A 1P7BA 3L71H 4DR4B 3GUXA 4J3GA 3UM7A 4KVME 3UY5A 2DW4A 5CA0A 4I4TA 5DM6V 3JAWB 4U3JB 4PSXA 3BABA 4M3SA 2D3OW 5J1QA 2XAFA 1LR1A 4O4LB 3DSQA 1GO3F 3OAAG 2K1EA 1KUYA 3JSLA 4UCNA 4QNHB 1TKHA 2WUUA 3JYCA 2QE7G 3TXQA 2O4HA 3TFYA 2CNSA 1I94B 1XOUA 1QR9A 5K8PA 4O4JA 3LSSA 1RM1B 4QC6A 3D2MA 2QWNB 3R9FA 2PIYA 4MRIA 3O65A 1H38A 2G3TA 6CPAA 5DS0A 5HH1A 1KQSU 1FFTB 4GX0A 4I9QA 3OMAB 1KU9A 3LNMB 4FLTA 3PP9A 4D7TA 4KS9A 3FYIB 1X59A 4H6ZA 3SPHA 4FFKA 4AVCA 2CY2A 3AG1C 1K4CC 2LW7A 3G67A 5IYCO 1XL4A 4DR2O 3GB0A 1VQLV 1QMUA 4DR4O 4XPKA 3HKBB 4LX9A 4GCZA 1COWG 4NSQA 2O28A 2P6FA 3WC5A 1O9GA 4KOTA 4DV4B 3HB3B 2IH3C 5HVFA 2NLJC 1YTFB 1IXMA 4FIPC 3CYOA 2RJZA 1I94O 2JIZG 5AG6A 3NR7A 5BR8B 4UB8Z 1FXKB 1UFHA 1NVPD 1CP9A 4X64O 4MS2A 4F8ZA 1FXKA 4B3SB 2CXAA 5KTCA 1OCRC 2WLHA 3OW2U 4OX9B 3TXSA 3OR7C 4WBNB 2CDYA 4TT3G 4NXNO 3FB7C 3M7MX 4IIJA 3FX6A 1JMKC 4I55B 1ARMA 4RO2A 4UEFA 1BO4A 4FZ1A 5L3CA 5J2UB 4J42A 1BOBA 1PU9A 5G21A 4JI7O 1KP2A 2GTAA 1ARLA 1BMFG 1KYOF 4BIZA 4X20A 3E86A 2JVDA 1DTDA 2XT9A 4JZGA 2CH7A 2VQFO 4MW3A 2UUAO 2ZINA 1R3IC 2WPDG 2XUMA 3RYFA 1G4YB 3VWEA 2RMKB 3JD4A 1LRZA 4PHZA 2GU2A 5DWMA 2F93B 2ZEOA 5GTHZ 3C26A 1YW6A 2Y69C 3D2PA 2GE3A 1RO5A 5K8OA 1N36O 2ZENA 2GHYA 1YF2A 1R3KC 3U0ZA 4AB7A 3K9TA 3F5TA 4Q38A 2QKCA 2YIDA 4JI6O 5C93A 1ZX3A 5EBMC 1Z9UA 5F2VO 4DV1B 3G4SV 4UCUA 2EINC 1M9NA 2JEVA 3GLJA 4B13A 2PJ6A 5JJJB 3FX7A 3K0GA 5EK0A 1IZ3A 2PTMA 4ABMA 4DK1A 5GONB 1V55B 3NA6A 1DK1A 1NH2D 3OGCC 4DK0A 2OT5A 4PK2A 1XMOO 2ZNJA 4CYPA 5CA3A 4A32A 1NJIW 2UUAB 2PI4A 4O2AA 1HEEA 2R9AA 2P0WA 3ASNB 1JQGA 4MHNA 2CK3G 1JWQA 3LDEA 2ATRA 2EINB 1Q7YW 4KOVA 2HR3A 1K73W 1FFXA 3R9GA 3HKDB 2AHZA 4ZBMA 3JARB 4DV4O 1D5AA 3TGUH 1HNZB 3BJ8A 5HFMA 1MG1A 5L3FA 2OWOA 4MFLA 4QBJA 3ZRSA 4LF8O 5FPOA 4IUSA 3OTOB 1FJGO 1VQMV 3B4SA 1ENVA 2FIWA 3ISZA 4JI4O 4KSFA 1MJ9A 3FVLA 1JPXA 5CB4B 3IIBA 4OX9O 2V8HA 1XEQA 5CB4A 1Q6HA 4WFFA 4E2AA 2KKWA 3ZEDA 3IGAC 3CDXA 3K9AA 1Z5VA 4B3RO 1IYKA 1YK3A 2FMLA 2F43G 4DV0B 1PNMA 3K58A 2FXFA 4ASUG 2H5MA 2YS8A 3SJBC 1PNKA 4YJ2B 4OADA 1S5HC 1ZL8A 2QKAA 1AI7A 3ZHSA 2LFRA 1YIJV 4GX1A 4KVXA 5LP6A 1VHOA 1H8HG 3H1HH 2IU3A 3OWCA 4F0XA 5IYDO 1NTZH 1VF6C 2YXYA 4LF9B 4KLVA 5HMNA 2FB5A 3EHBB 3ZS8C 1KZFA 2GANA 1MJBA 3CXHF 3BPZA 2V77A 2Q7BA 2ZEFA 4IK2A 2ZIOA 4PA4A 2OCCB 3DGEA 3Q4HB 5EZYB 1D2DA 3D7FA 3WC7A 3QO8A 4DYOA 3K9SA 2CTPA 2GFQA 3S6KA 2GSMB 4G27B 2PJAA 2ZEPA 4ZBGA 1RSOA 5D29A 3CS5A 4JI1B 4DV5B 4GXHA 1VQ8V 2AGAA 3N2KA 4X5KA 2PRBA 3WC6A 1SQPH 1FT7A 2AJ6A 1ELLP 2UXCO 2NYQA 5FPRA 2UXDB 3JD0A 3PEIA 3FIXA 1Q43A 1IBMB 7CPAA 1WLEA 3GKRA 5KHIA 4OGQB 2F1MA 1YVWA 3JUWA 1M4LA 4CRYB 5D8NA 2GREA 2EBOA 1EN6A 4PSWA 2HP8A 1S7LA 4KZTA 2EIMB 2PJ3A 2QDOA 3IO1A 3DC5A 3SYCA 5F49A 4WFAV 2DYSC 1BSMA 2WSSG 1F23A 1VHSA 4ZHQB 2QA4V 2W6JG 4U5YA 3E0KA 1PL0A 2EVNA 1XL6A 3H9VA 1YMEA 3T4DA 2JGDB 4XDJA 5LYJB 2DYSB 3IU1A 4XPLA 3H01A 4NGPA 3R96A 2PJ8A 4AQYB 2J8RA 3B3CA 5JH7B 1MSDA 1NR1A 2XEGA 3BA9A 3FAVA 4NTYA 1FKAO 4J11A 3SI0A 5KHJA 1CPXA 5IJ0A 3K59A 1SS3A 3ASOC 1BQ0A 3BCCH 4BWAA 5L3EA 1KMIZ 3CCLV 3SPCA 1VQNV 4QE9A 2V7QG 4J41A 1JJOA 2RCVA 1GKFA 3CCUV 4C7UA 5E79Z 2I3CA 1JA8A 2IJKA 4CH4A 2PYLA 4MBUA 4MXUA 5JM6A 4CAWA 1AILA 2PDOA 4OC1A 4C2XA 2YNCA 1UJWB 4C7HA 4ZY1A 1TUBB 3RNZA 3RYIA 4MTGA 3G8WA 4OXSA 4ICGA 4MTXA 2PRQA 4QJFB 2PSWA 2QTSA 5K8MA 3OE7G 4UCPA 4NGQA 1VP7A 3K5MA 2Z0AA 3L75H 3JAMN 4NR1A 3UT5A 1GN4A 4DV6O 2BO9A 1TF9A 4MFJA 3A9LA 4MVUA 4UV9A 1BGYH 1ZG9A 3H4QA 1RPOA 3JAKB 2IMOA 3FEEA 3GYAA 1NU1H 1IBLB 3JASB 4FD7A 2BEIA 3SJEA 1GYTA 1M57C 3AK3A 4BAYA 2LW1A 3FAVB 4O23A 3OTFA 2DEAA 4TSFG 1WP7A 1YLOA 4DV7O 4FD4A 1YTFD 3FFQA 2EWBA 2OH1A 3DNSA 4DR6B 3IJ3A 3AG3B 3HKEA 4LNUB 3F5BA 1SRYA 4DR7O 1XDCA 4GX5A 4J80A 1FNOA 1J4JA 1S3ZA 3F7VC 1WJZA 5D5PA 1XI1A 4BBHA 5LP6B 1GMGA 3PB9X 2Z3LA 2ZW5A
chains in the Genus database with same CATH topology
3EXNA 4MI4A 3IWEA 4MFQA 1S60A 5JQ4A 4PV6A 4KORA 5J8FA 1CJWA 2VZYA 2VXKA 4HNYB 3TO9A 3F0AA 1I1DA 4HKFA 2PR1A 1QSOA 2DPTA 2R7HA 2VBQA 1QSTA 1KUXA 3QB8A 2WPXA 3LODA 3TTHA 3CXQA 4UA3A 2Q0YA 4C7IA 4KOSA 5AG7A 4A2ZA 3SXOA 2EUIA 4UCMA 3S6FA 4CAXA 5GCNA 4CGOA 1U6MA 4CGMA 2FIAA 4XPDB 3EC4A 2BSWA 4MY0A 3BJ7A 1PUAA 2C27A 5J8CA 1L0CA 2P6GA 4KUAA 2BL1A 4GS4A 4B5PA 2Z3KA 3TOAA 1TIQA 2VQYA 4KSAA 3KKWA 4NXYA 3R9EA 4CRZB 2ZW7A 4H89A 5C88A 2PC1A 3G3SA 3F8KA 3T9YA 4F0YA 4A95A 5F47A 1M4DA 1Z4RA 1OZPA 4J3GA 3UY5A 4KVME 1K4JA 3RYOA 1XEBA 4KOXA 4PSXA 4M3SA 4CGPA 3S6GA 2OB0A 1KUYA 1YVOA 2Z0ZA 4UCNA 4AG7A 2WUUA 3CXPA 5BWAB 3TFYA 2WPWA 2CNSA 3EO4A 4JXQA 4AVBA 2B3UA 2ZXVA 4QC6A 3D2MA 1NE9A 3WR7A 2G3AA 3R9FA 5JPHA 4CS0B 2G3TA 3PZJA 4C68A 2VZZA 4KVOE 5HH1A 3TO7A 2X7BA 3PP9A 1WK4A 4KS9A 4AG9A 2Q4YA 1ZO0A 2Y0MA 3SHPA 1MJAA 4H6ZA 5AG4A 1Y9KA 5AGEA 5G22A 4AVCA 4LUAA 2I00A 2CY2A 3FYNA 4MY3A 4NF1A 4XPKA 5EBVA 4LX9A 4NSQA 1FY7A 2O28A 2P6FA 3N7ZA 1IIDA 4ORFA 4RS2A 1V0CA 4KOTA 2PR8A 3FNCA 5KTAA 1YREA 1SQHA 3K9UA 5C82A 5AG6A 3DR6A 2Q4VA 4CGLA 1UFHA 4R9MA 1WWZA 4A31A 4E0AA 2CXAA 1M4GA 5KTCA 1YR0A 4KLWA 4YRHA 3DDDA 1GHEA 1M44A 4KUBA 2J8NA 4NCZA 4Y49B 4H6UA 1B87A 4ZGYB 3CXSA 1NMTA 2J8MA 5IV0A 2REFA 3NE7A 1BO4A 1PU9A 2HUZA 4KOWA 1BOBA 5G21A 2R1IA 3MGDA 2FS5A 5H84A 3P2FA 3VWEA 1LRZA 5EC4A 5DWMA 5AG5A 4OLLA 5G1ZA 2YNEA 3C26A 2YNCC 1Q2CA 4C2ZA 3D2PA 1R57A 4CAFA 4B10A 2JDDA 2GE3A 1RO5A 3IGRA 3TO6A 4UWJA 2CNTA 3V8IA 4AB7A 2QIRA 1M4IA 2G0BA 4Q38A 3TE4A 1Z9UA 1QSRA 5ISVA 4HNXB 2JEVA 4I49A 4B13A 1MK4A 4E8OA 2B5GA 1YVKA 4UWIA 1S7KA 2D4PA 1Y7RA 5A27A 2P6EA 3W6XA 1Q2YA 4PK2A 2OZHA 3IWGA 4KOUA 4CYPA 4MJ8A 4A32A 4B12A 2RC4A 1S7FA 3LD2A 1Y9WA 3B8GA 2P0WA 4OAEA 4JWPA 1QSMA 4K30A 2ATRA 4KOVA 3VWDA 4YGOA 3R9GA 2D4OA 1KUVA 3R1KA 3BJ8A 4A30A 1S7NA 2FE7A 5FVJA 4MFLA 4QBJA 4MFKA 4IUSA 1P4NA 3FB3A 2ZPAA 4AVAA 4F6AA 2FIWA 2B4DB 1IB1E 4JLYA 4JXRA 4KSFA 2IL4A 1MJ9A 2B5GB 4UBRA 4U9YA 4R3KA 5IB0A 5IX3A 4C2YA 3DSBA 3ZZIA 4E2AA 5KTDA 2FSRA 1IYKA 1YK3A 3FRMA 2JDCA 2QECA 2YGWA 2FXFA 2H5MA 5H86A 3H5ZA 2HV2A 2YNDA 4FD5A 4XPDC 4OADA 1CM0A 4A33A 3R95A 4KVXA 4UFVA 2OZGA 3TOBA 3OWCA 4F0XA 4HNWB 1Q2DA 4KLVA 5HMNA 1KZFA 3IU2A 2GANA 1MJBA 2B3VA 2B4BA 2Q7BA 3D3SA 3EY5A 2ZW4A 3FBUA 5G20A 4II9A 3S6KA 3W91A 4ZBGA 2VI7A 1S5KA 3TCVA 3SXNA 4CYNA 1IYLA 4R3LA 4X5KA 2PRBA 5A28A 2AJ6A 2REEA 4YFJA 1RXTA 4MFPA 4ONUA 1NSLA 3FIXA 4B11A 3GKRA 3JUWA 4CRYB 4PSWA 1YGHA 1S7LA 4KZTA 4UFWA 1XE4A 2A4NA 5F49A 4UFXA 1XIXA 5DWNA 1VHSA 4L89A 5CNPA 3S6HA 4U5YA 3E0KA 2EVNA 1I21A 1YX0A 4R87A 1IICA 3IU1A 4XPLA 2OZUA 1ON0A 2Z3MA 3R96A 3GY9A 4JJXA 4CAEA 4XNHC 5F48A 2J8RA 4QB9A 1M1DA 2Z3NA 2HQYA 4BMHA 3BLNA 2ZW6A 4CGNA 4QUSA 2OU2A 1P0HA 4XNHB 4KOYA 2F5IA 4CYQA 1VKCA 2CNMA 3P2HA 4RI1A 4MHDA 4Y49C 1I12A 3JVNA 4L8AA 4CAVA 4IF5A 2Z11A 1XF8A 2BUEA 4MBUA 2GIVA 4CAWA 2PDOA 2R8VA 4C2XA 2YNCA 2Z10A 4C7HA 3ZJ0A 2Z3OA 4QVTA 2JLMA 3G8WA 3TT2A 2ARHA 1XMTA 2FCKA 2R98A 2QMLA 2AE6A 2PSWA 4Q36A 2FT0A 1N71A 3PGPA 4B5OA 4UCPA 2DPSA 3I3GA 2Z3PA 3FXTA 1YLEA 4MFJA 3A9LA 2FL4A 2PQ8A 4JD6A 3H4QA 3GYAA 1B6BA 3QAHA 3D8PA 4FD7A 3JTKA 5F46A 2BEIA 5I0CA 4EVYA 5E96A 2K5TA 2B58A 4DNCA 3T90A 3DR8A 1QSNA 2VEZA 4FD4A 2NMTA 3DNSA 2OH1A 4M85A 4FD6A 4U9ZA 2B4DA 2KCWA 3F5BA 4R57A 4B14A 4PK3A 1J4JA 2I79A 4B5PB 4MFZA 1S3ZA 2DXQA 4BBHA 1Z4EA 2Q44A 3W6SA 2WSAA 2Q04A 4NEXA 3I9SA 3EFAA 2Z3LA 2ZW5A 4CYOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EXN A;  4MI4 A;  5JQ4 A;  1S60 A;  4PV6 A;  4KOR A;  5J8F A;  1CJW A;  2VZY A;  2VXK A;  4HNY B;  3TO9 A;  3F0A A;  1I1D A;  4HKF A;  2PR1 A;  1QSO A;  2R7H A;  2VBQ A;  1QST A;  1KUX A;  3QB8 A;  2WPX A;  3LOD A;  3TTH A;  3CXQ A;  4UA3 A;  2Q0Y A;  4KOS A;  3SXO A;  2EUI A;  3S6F A;  4CAX A;  5GCN A;  1U6M A;  2FIA A;  4XPD B;  3EC4 A;  2BSW A;  4MY0 A;  3BJ7 A;  1PUA A;  2C27 A;  5J8C A;  1L0C A;  2P6G A;  4KUA A;  2BL1 A;  4GS4 A;  4B5P A;  3TOA A;  1TIQ A;  2VQY A;  3KKW A;  4NXY A;  3R9E A;  4CRZ B;  2ZW7 A;  4H89 A;  5C88 A;  2PC1 A;  3G3S A;  3F8K A;  3T9Y A;  4F0Y A;  5F47 A;  1M4D A;  1Z4R A;  1OZP A;  4J3G A;  3UY5 A;  4KVM E;  1K4J A;  3RYO A;  1XEB A;  4KOX A;  4PSX A;  4M3S A;  3S6G A;  2OB0 A;  1KUY A;  1YVO A;  2Z0Z A;  4AG7 A;  3CXP A;  3TFY A;  2WPW A;  2CNS A;  3EO4 A;  4JXQ A;  4AVB A;  2B3U A;  2ZXV A;  4QC6 A;  3D2M A;  1NE9 A;  3WR7 A;  2G3A A;  3R9F A;  5JPH A;  4CS0 B;  2G3T A;  3PZJ A;  2VZZ A;  4KVO E;  5HH1 A;  3TO7 A;  2X7B A;  3PP9 A;  1WK4 A;  4AG9 A;  2Q4Y A;  2Y0M A;  3SHP A;  1MJA A;  4H6Z A;  1Y9K A;  4AVC A;  4LUA A;  2I00 A;  2CY2 A;  3FYN A;  4MY3 A;  4NF1 A;  4XPK A;  5EBV A;  4LX9 A;  4NSQ A;  1FY7 A;  2O28 A;  2P6F A;  3N7Z A;  1IID A;  4ORF A;  4RS2 A;  1V0C A;  4KOT A;  2PR8 A;  3FNC A;  5KTA A;  1YRE A;  1SQH A;  3K9U A;  5C82 A;  3DR6 A;  2Q4V A;  1UFH A;  4R9M A;  1WWZ A;  4E0A A;  1M4G A;  5KTC A;  1YR0 A;  4KLW A;  4YRH A;  3DDD A;  1GHE A;  1M44 A;  4KUB A;  2J8N A;  4NCZ A;  4Y49 B;  4H6U A;  1B87 A;  3CXS A;  1NMT A;  2J8M A;  5IV0 A;  2REF A;  3NE7 A;  1BO4 A;  1PU9 A;  2HUZ A;  4KOW A;  1BOB A;  2R1I A;  3MGD A;  2FS5 A;  5H84 A;  3P2F A;  3VWE A;  1LRZ A;  5EC4 A;  5DWM A;  4OLL A;  3C26 A;  1Q2C A;  3D2P A;  1R57 A;  2JDD A;  2GE3 A;  1RO5 A;  3IGR A;  3TO6 A;  4UWJ A;  2CNT A;  3V8I A;  4AB7 A;  2QIR A;  1M4I A;  2G0B A;  3TE4 A;  1Z9U A;  1QSR A;  5ISV A;  4HNX B;  2JEV A;  4I49 A;  4E8O A;  1MK4 A;  2B5G A;  1YVK A;  4UWI A;  1S7K A;  2D4P A;  1Y7R A;  2P6E A;  3W6X A;  1Q2Y A;  4PK2 A;  2OZH A;  3IWG A;  4KOU A;  4MJ8 A;  2RC4 A;  1S7F A;  3LD2 A;  1Y9W A;  3B8G A;  2P0W A;  4OAE A;  4JWP A;  1QSM A;  4K30 A;  2ATR A;  4KOV A;  3VWD A;  4YGO A;  3R9G A;  2D4O A;  1KUV A;  3R1K A;  3BJ8 A;  1S7N A;  2FE7 A;  5FVJ A;  4QBJ A;  4IUS A;  1P4N A;  3FB3 A;  2ZPA A;  4AVA A;  4F6A A;  2FIW A;  2B4D B;  1IB1 E;  4JLY A;  4JXR A;  2IL4 A;  1MJ9 A;  2B5G B;  4UBR A;  4U9Y A;  4R3K A;  5IB0 A;  5IX3 A;  3DSB A;  3ZZI A;  4E2A A;  5KTD A;  2FSR A;  1IYK A;  1YK3 A;  3FRM A;  2JDC A;  2QEC A;  2FXF A;  2H5M A;  5H86 A;  2HV2 A;  4FD5 A;  4XPD C;  4OAD A;  1CM0 A;  3R95 A;  4KVX A;  2OZG A;  3TOB A;  3OWC A;  4HNW B;  1Q2D A;  4KLV A;  5HMN A;  1KZF A;  2GAN A;  1MJB A;  2B3V A;  2B4B A;  2Q7B A;  3D3S A;  3EY5 A;  2ZW4 A;  3FBU A;  4II9 A;  3S6K A;  3W91 A;  4ZBG A;  2VI7 A;  1S5K A;  3TCV A;  3SXN A;  1IYL A;  4R3L A;  4X5K A;  2PRB A;  2AJ6 A;  2REE A;  4YFJ A;  1RXT A;  4ONU A;  1NSL A;  3FIX A;  3GKR A;  3JUW A;  4CRY B;  4PSW A;  1YGH A;  1S7L A;  4KZT A;  1XE4 A;  2A4N A;  5F49 A;  1XIX A;  5DWN A;  1VHS A;  4L89 A;  5CNP A;  3S6H A;  4U5Y A;  3E0K A;  2EVN A;  1I21 A;  1YX0 A;  4R87 A;  1IIC A;  4XPL A;  2OZU A;  1ON0 A;  3R96 A;  3GY9 A;  4JJX A;  4XNH C;  5F48 A;  2J8R A;  4QB9 A;  1M1D A;  2HQY A;  4BMH A;  3BLN A;  2ZW6 A;  4QUS A;  2OU2 A;  1P0H A;  4XNH B;  4KOY A;  2F5I A;  1VKC A;  2CNM A;  3P2H A;  4RI1 A;  4MHD A;  4Y49 C;  1I12 A;  3JVN A;  4L8A A;  4CAV A;  4IF5 A;  2Z11 A;  1XF8 A;  2BUE A;  4MBU A;  2GIV A;  4CAW A;  2PDO A;  2R8V A;  2Z10 A;  3ZJ0 A;  4QVT A;  2JLM A;  3G8W A;  3TT2 A;  2ARH A;  1XMT A;  2FCK A;  2R98 A;  2QML A;  2AE6 A;  2PSW A;  2FT0 A;  1N71 A;  3PGP A;  4B5O A;  3I3G A;  3FXT A;  1YLE A;  2FL4 A;  2PQ8 A;  4JD6 A;  3H4Q A;  3GYA A;  1B6B A;  3QAH A;  3D8P A;  4FD7 A;  5F46 A;  2BEI A;  5I0C A;  4EVY A;  5E96 A;  2K5T A;  2B58 A;  4DNC A;  3T90 A;  3DR8 A;  1QSN A;  2VEZ A;  4FD4 A;  2NMT A;  3DNS A;  2OH1 A;  4M85 A;  4FD6 A;  4U9Z A;  2B4D A;  2KCW A;  3F5B A;  4R57 A;  4PK3 A;  1J4J A;  2I79 A;  4B5P B;  1S3Z A;  2DXQ A;  1Z4E A;  2Q44 A;  3W6S A;  4NEX A;  2Q04 A;  3I9S A;  3EFA A;  2ZW5 A; 
#chains in the Genus database with same CATH topology
 2HVK C;  3EXN A;  2LP7 A;  4N21 A;  2WLJ A;  4MVZ A;  4YY3 B;  3HKC A;  3OR6 C;  2DWE C;  1CJW A;  4KP4 A;  4MSW C;  3BHP A;  1I1D A;  3ZRW A;  4NKG B;  5FNV B;  2AFX A;  2RB7 A;  2R7H A;  1IBL O;  4FM0 A;  3ABL C;  3VQW A;  3PFO A;  5K1P A;  2V8G A;  4UA3 A;  2YXL A;  1OCC B;  1MMM A;  3ABM B;  3CD6 V;  4DW1 A;  2Q73 A;  1MZE A;  3L9D A;  5THW A;  2VQE O;  1Q86 W;  1ZWI C;  2PY5 A;  3ZHU A;  2A79 B;  4TV9 B;  5H2F Z;  1WA8 B;  4CAX A;  4CGO A;  5IDJ A;  4CGM A;  4UB6 Z;  2OTJ V;  1YHQ V;  4P4I A;  1OJH A;  2PIZ A;  2DOS A;  4E4E A;  3BJ7 A;  1AI5 A;  2C27 A;  3LAC A;  2CE4 A;  2P6G A;  1N0N A;  1BT8 A;  2PJ5 A;  4H2K A;  4DJL A;  4WCE V;  1XMO B;  1LAP A;  2VQY A;  1W59 A;  2PF4 E;  4PI0 A;  2Q8V A;  2P67 A;  4LF4 O;  4LBE C;  5LBQ A;  3PN1 A;  4EFD A;  5LOV B;  3I1U A;  1US6 A;  4X2T A;  1E1R G;  3N27 A;  1OZP A;  4J7Z A;  3RT3 C;  3SPG A;  4DV1 O;  3PB7 X;  4OC3 A;  2ZIM A;  4TWE A;  3CRM A;  3K57 A;  3RYO A;  1AJP A;  1XEB A;  1JQ0 A;  3K79 A;  4CGP A;  3EVK A;  4DR3 B;  1Y7E A;  2YIB A;  2WAM A;  2HHH B;  3SJG A;  4G1P A;  1K5S A;  1PKX A;  2EK8 A;  2Q6A A;  5B1B B;  1CPS A;  5BWA B;  3LNN A;  2WPW A;  3ETQ A;  3CEI A;  3W7W A;  3AG7 A;  3F5W C;  3C3T A;  3CCS V;  2P06 A;  2CIJ A;  1R1B A;  5B1B C;  2ADP A;  2B3U A;  4KUM A;  5J9P C;  5A9G A;  3AG2 C;  1R6T A;  2KB1 A;  1NE9 A;  5JPH A;  3GB7 C;  4UCT A;  1ORQ C;  2EK9 A;  4C68 A;  1U96 A;  5LOV A;  2VZZ A;  4KVO E;  4LQ6 A;  1KKC A;  3ZMU A;  1SER A;  3CB2 A;  4WFH A;  2UXB O;  2X7B A;  3CPA A;  2YI8 A;  4DV2 O;  4PXB A;  1FAF A;  3FMC A;  5LYL A;  4CH6 A;  2ZT9 B;  1ZO0 A;  1I5X A;  2Y0M A;  3HLP A;  3SHP A;  3SI1 A;  4HZ3 A;  1QLN A;  1Y9K A;  3T1Y O;  3PB8 X;  4Q7A A;  5G22 A;  3W7X A;  1GM9 A;  1IOF A;  3FYN A;  1FS0 G;  1SES A;  4J7K A;  4BIN A;  4DR3 O;  4WBN A;  1FY7 A;  1IID A;  4ORF A;  3AK1 A;  1W0J G;  4ZOL B;  1TKJ A;  1BPN A;  3B35 A;  3FNC A;  1IX9 A;  3I55 V;  5B1O A;  1SA0 A;  3NE8 A;  4FUU A;  2ZEG A;  2JJ2 G;  1V54 B;  2VQE B;  1ELM P;  3CPW U;  4MT8 A;  1WWZ A;  4E0A A;  1M4G A;  4KLW A;  3UT5 B;  2UU9 B;  3DDD A;  3APO A;  3OUF A;  4X1K A;  1YXB A;  1DF4 A;  2J8N A;  3T4Z A;  3IC9 A;  4Y49 B;  4LR3 A;  4LF6 B;  2OOT A;  3JRU A;  2N04 A;  1NMT A;  3TET A;  4WJB A;  1H2K A;  3FB5 C;  2AHY A;  2REF A;  4I55 A;  4PD4 F;  1Y74 A;  5KAI Z;  4B3T O;  1QQC A;  3RVZ A;  4LH6 A;  5BZB A;  3D4U A;  2IBZ H;  1TUE B;  4CS3 A;  5KUK A;  2F4V B;  5JCO C;  1WN7 A;  2FVG A;  4LFA O;  5LXT A;  2AFZ A;  4LC1 A;  4NGT A;  1H2G A;  3ZBH A;  4LNU A;  3WB0 A;  2F4V O;  4PA3 A;  4XDL A;  4K0K O;  1S3J A;  3RVY A;  1YW4 A;  3BRC A;  4UCV A;  5AG5 A;  1R43 A;  5G1Z A;  4A37 A;  3JSN A;  2YNC C;  3CRA A;  4H13 B;  4D7S A;  1HR0 O;  4KHP O;  4B10 A;  3F7Y C;  2JDD A;  3IGR A;  3V8I A;  4JTD B;  2IW5 A;  1HR0 B;  4KHP B;  2P7T C;  1M4I A;  3QVN A;  2G0B A;  3TE4 A;  3JAL A;  3CCV V;  4QGP A;  2AFW A;  2XEJ A;  2UU9 O;  4HNX B;  1BL8 A;  3ZMT A;  4X3R A;  4DR2 B;  4E8O A;  1XIL A;  2B5G A;  1YVK A;  2WWW A;  4UWI A;  1AJQ A;  3ZMV A;  4HPS A;  1S7K A;  4K35 A;  1P49 A;  4WFE A;  2P90 A;  3UCS C;  2P6E A;  4DR1 O;  1ZG7 A;  1Q2Y A;  2NN4 A;  4EB6 A;  1PL4 A;  1N32 O;  1M57 B;  4MJ8 A;  1XJO A;  2RC4 A;  3D36 C;  3P32 A;  4WF9 V;  2PVV A;  1A32 A;  1Q90 D;  3CSX A;  1GN2 A;  1GTO A;  5KHK A;  2IM9 A;  2QM7 A;  4JWP A;  4OAE A;  4EWT A;  3MN8 A;  1EZJ A;  3D8C A;  3H8G A;  1QSM A;  4UVB A;  4BW5 A;  4PI2 A;  4HNA A;  3VWD A;  2D4O A;  3R1K A;  4RAI A;  4OC2 A;  4DUK A;  1K34 A;  2B9Z A;  1URF A;  4Z2W A;  2FE7 A;  1L0L H;  1E79 G;  2ZPA A;  4F6A A;  3S9N A;  4GKK B;  4DV3 O;  2Z3Y A;  2AZ2 A;  3K5O A;  1PP9 H;  1PNL A;  2KG7 B;  3G80 A;  4JI7 B;  2J9A A;  1M56 B;  1Z8L A;  1H8E G;  5EIB D;  4JV5 B;  3KQZ A;  1G8M A;  4O4L A;  4P6Y A;  5ITZ B;  1AB3 A;  3B3S A;  2VQF B;  2JDC A;  4JYA B;  1XNR O;  3H8E A;  3E8G A;  4I0X A;  4YXW G;  1Y0Y A;  4FZ0 A;  2YND A;  4FD5 A;  2Y4T A;  1ZL8 B;  2V8D A;  1HWY A;  1CP6 A;  1VEW A;  4XPD C;  5H5N A;  3CT9 A;  2ZNI A;  3B8N A;  3NH8 A;  2IJJ A;  2XAJ A;  1Y67 A;  1S76 D;  1SZX A;  2ZXW C;  4Q20 A;  4LFC O;  3GWO A;  4RUE A;  3IU2 A;  2HHH O;  4DR5 B;  1IXB A;  2PVW A;  3RAM A;  3KG2 A;  3WB1 A;  2PJ4 A;  2PJB A;  3D3S A;  4TV8 B;  2H3O A;  1CG2 A;  3FBU A;  3S9M A;  4B08 A;  5G20 A;  4II9 A;  4MCS A;  3PRT A;  3ABK C;  3RYH A;  3SJQ C;  3CE2 A;  1PM9 A;  1VIX A;  4FVM A;  4HNA B;  1DGS A;  1HDQ A;  4MVM A;  4LFC B;  4DV3 B;  2EUL A;  1S5K A;  2QWR B;  2EJ7 A;  3LWU A;  2UUB B;  5IT9 N;  3E35 A;  3HPL C;  3G6E V;  1VQP V;  4UXN A;  5A28 A;  1Z8T A;  4JI5 O;  1O9H A;  4YFJ A;  4ONU A;  1SF9 A;  4UVC A;  4ZY2 A;  3I56 V;  1R3N A;  4FFB A;  3KHX A;  4FLZ A;  2ZCE A;  3IC1 A;  2DJV A;  2PGG A;  1J95 A;  4X65 O;  1YGH A;  4AQY O;  3SJA C;  1Z2L A;  2F8H A;  2IH1 C;  1XE4 A;  2CTC A;  2IJZ A;  3AG4 C;  4IIJ B;  4K8Z A;  2E74 B;  5DWN A;  3N2K B;  2ODF A;  3THO A;  4PA9 A;  4YHH O;  1SA0 B;  5CNP A;  4LF4 B;  1XMB A;  1YX0 A;  5JVD B;  3ZN1 A;  1JCH A;  3RYH B;  1OCZ B;  3S3W A;  5IY5 B;  4LFB O;  2N74 A;  1XNQ O;  2OZU A;  1ON0 A;  1UWY A;  4JJX A;  3DTU B;  4OC5 A;  2E5L O;  4GM5 A;  2IJH A;  3ZHT A;  1XNQ B;  5E1A C;  2ZW6 A;  2ATK C;  1P0H A;  3D67 A;  2Q4Z A;  2DN9 A;  4TOI A;  2DYR C;  4DUZ B;  3Q4H A;  5EZY A;  4PDM A;  3LMS A;  4I4T B;  4Y49 C;  1SQG A;  2WLM A;  3JVN A;  1IBK B;  4CAV A;  3KKY A;  1XF8 A;  3KGQ A;  4OC0 A;  1Q6I A;  4CS2 A;  1F51 A;  5LHI A;  3CP1 A;  4NFR A;  1WP8 A;  2Z5U A;  2R8V A;  1Q6U A;  3BAA A;  4X1I B;  4B6Z A;  3BFR A;  2PZS A;  2Z3O A;  4DW0 A;  1XHZ A;  3TT2 A;  2QML A;  4AHC A;  4L87 A;  3RO0 A;  2XAS A;  1DLB A;  2AW9 A;  3PGP A;  4TQD A;  4Z65 A;  2AXT Z;  2E75 B;  3I3G A;  3D3Q A;  3ML0 A;  1UFI A;  1H2S B;  3BY6 A;  2HKO A;  5FL7 G;  1M5I A;  2ZM6 B;  3JAT B;  2GTS A;  5C8Y A;  5B1N A;  4P30 A;  2UUC O;  4ONW A;  3JAT A;  1AR5 A;  1MOF A;  2HG5 C;  3AEI A;  5LXT B;  2VWK A;  2PQ8 A;  3JAS A;  3QAH A;  5F46 A;  2X7R B;  4U7O A;  3OD4 A;  3FEC A;  4MCP A;  4EVY A;  4P4D A;  2ZED A;  3EXA A;  5CA1 B;  4DUZ O;  2K5T A;  4DUY O;  1OCO C;  2B58 A;  4DNC A;  4GX2 A;  2W0F C;  1H8L A;  2P22 C;  3IWW A;  4B3T B;  3SYP A;  1QSN A;  2NSM A;  4DR7 B;  1MNG A;  4BIO A;  2NMT A;  3SGI A;  4M85 A;  4UCO A;  2ANP A;  1V55 C;  1QR8 A;  2ZR2 A;  5JCO A;  4JAV A;  1N33 B;  1XNR B;  4IT5 A;  2I79 A;  1XRE A;  3T1Y B;  3AG3 C;  5L3D A;  1WPB A;  1Z4E A;  2Q44 A;  3W6S A;  1KUQ A;  4JYB A;  1AP5 A;  2LFS A;  1TUB A;  2RQ6 A;  3CRC A;  4GKJ O;  4MI4 A;  3MD0 A;  4QE7 A;  4XDK A;  1N36 B;  4B3S O;  5IB9 A;  1YJN V;  4MMO A;  3JAK A;  2ETN A;  4TV8 A;  2O53 A;  1Y0R A;  4DR6 O;  4NJR A;  4HNY B;  3E8F A;  4X66 O;  3TO9 A;  1J5E B;  5IE9 A;  4HKF A;  3ZRV A;  4JV5 O;  4CC6 A;  5LRK A;  2PR1 A;  1KWM A;  5FNV A;  2YSU B;  4PV1 B;  2LQT A;  2WPX A;  1AP6 A;  4FK5 C;  2BOA A;  3TK1 A;  3L72 H;  3CXQ A;  5IYB O;  3TX8 A;  2P5O A;  2C1C A;  2ZQM A;  3KCX A;  4C7I A;  1I0H A;  2B5U A;  2RDC A;  2HEP A;  4U3F H;  4PA7 A;  2PJC A;  5CMU A;  4E2L A;  4A94 A;  4P4J A;  2Q7H A;  3D36 A;  2Q69 A;  4UEE A;  1XBU A;  2EUI A;  4F6R B;  4LF7 B;  4UCM A;  2OCC C;  1EN5 A;  1LAM A;  4XPD B;  2ZE5 A;  4I0X B;  4MY0 A;  1TA8 A;  4Q6G A;  4DRX A;  1QNM A;  4GS4 A;  2Z3K A;  3BA8 A;  1IOI A;  3T8W A;  1CX8 A;  2NR5 A;  4NXY A;  1AI6 A;  3R9E A;  1HW7 A;  4CRZ B;  3R66 A;  2ZE6 A;  1KKD A;  3F8K A;  1R6N A;  3FH4 A;  3B8M A;  3T9Y A;  4YJ3 B;  2BOC C;  1SQF A;  3MHH C;  4JI2 O;  3N2G B;  3CC7 V;  2BSK B;  2VRZ A;  1D5N A;  3V7Z A;  4JPR A;  4UEZ A;  1I7F A;  1M4D A;  4ZX9 A;  2ZR3 A;  2VWJ A;  2E5L B;  2Q0A A;  2WLK A;  2V4D A;  3QO5 A;  3ZMZ A;  1K5Q A;  1KD1 W;  1K4J A;  2RN9 A;  4U3J A;  3CCR V;  3KZW A;  4FBE A;  1XHX A;  4K8X A;  3D68 A;  5K8N A;  1TAE A;  2HVJ C;  3S6G A;  1T5E A;  1GAX A;  3T1H O;  2ZDI A;  5LMU O;  4YIP A;  2PYJ A;  2A0L A;  4GKK O;  2OB0 A;  2CTQ A;  2WLL A;  3ICX A;  1R6K A;  1PD3 A;  3CCM V;  4B3M O;  1YVO A;  2ITC C;  4BR6 A;  3CXP A;  3U10 A;  3AG2 B;  2AFS A;  3G71 V;  4NTX A;  1K7D A;  4LQG A;  4Z1M G;  3D7D A;  3EO4 A;  4NGS A;  4R8C A;  5LGN A;  3AK2 A;  2ZXV A;  4X65 B;  1HP8 A;  1CBX A;  2JEW A;  3WR7 A;  1FJG B;  4LP8 A;  3CZX A;  4CS0 B;  3FJU A;  3PZJ A;  3FD9 A;  4ZOL A;  5IWA B;  4CC5 A;  2AZ0 A;  3TO7 A;  3VQY A;  4YIO A;  5IY5 C;  3SYO A;  3SYQ A;  4MHZ A;  4AG9 A;  1B06 A;  4NJQ A;  1MJA A;  4R7C A;  3CCE V;  5AGE A;  1KEC A;  4JTA B;  5CBM A;  3AG4 B;  4QIW F;  1B6Q A;  2QWQ B;  4JI5 B;  1BS3 A;  4MY3 A;  4NF1 A;  5GTI Z;  1Z5W A;  3I5D A;  3OT7 A;  3N7Z A;  3NH4 A;  1V0C A;  4RS2 A;  5KHG A;  5CPA A;  2PR8 A;  1M4U A;  1SZT A;  2OR4 A;  1MZF A;  2QSA A;  3K9U A;  5CA0 B;  4YU9 A;  1R73 A;  4JGS A;  2CTR A;  5F09 A;  2Q4V A;  4R8F A;  1ZLH A;  4MVR A;  3HUV A;  4A31 A;  1F4N A;  2ODM A;  4P4E A;  4PDR A;  1GN6 A;  3BI0 A;  2V1D A;  1GHE A;  3RZA A;  4GZR B;  4TQF A;  4KUB A;  4LF8 B;  3JAL B;  4DV6 B;  4ZGY B;  1TF8 A;  5LYF A;  2JDI G;  2YUA A;  2E76 B;  3CXS A;  1HNZ O;  2N05 A;  1IDS A;  4I7Z B;  1CXZ B;  4MHY A;  3P30 A;  2QJ8 A;  4EEQ A;  3NE7 A;  4JAS A;  5KMG A;  3FYE B;  2R1I A;  1JR9 A;  4KFM A;  4PPZ A;  1EZV H;  3CWB H;  3B77 A;  3W7T A;  1F2O A;  4HBN A;  4W9Y A;  3LSQ A;  2YEV B;  3CRQ A;  3S3X A;  3O9O A;  3D66 A;  2ZE7 A;  2Q0O C;  2W0X A;  2FS5 A;  5EMI A;  1IU8 A;  3M99 B;  5EC4 A;  2EJR A;  2LO1 A;  3IEH A;  3W7S A;  4OLL A;  5J2T B;  2GLJ A;  3VAT A;  1OHH G;  2BOB C;  2B1G A;  3SR2 C;  1YEW A;  3IFE A;  1R57 A;  4RQE A;  2CF4 A;  2ZEM A;  5KA6 A;  5LGT A;  1SQV H;  1Z5R A;  5B66 Z;  3TO6 A;  3STZ C;  2CNT A;  2OTL V;  2DQ0 A;  2YDE A;  3C3S A;  3CPX A;  4B7E A;  4O2A B;  4EFE A;  5DED A;  5ISV A;  2AFU A;  2KQX A;  3J80 N;  1JFF B;  1DE4 C;  4I49 A;  4CPA A;  1MK4 A;  2EIJ C;  3ETD A;  3LUT B;  1P4R A;  1SQX H;  1QCE A;  1NBM G;  5L3B A;  4DR1 B;  3SI2 A;  3OMN B;  4ZI7 B;  4FAI A;  3ABL B;  4JI0 O;  2OYQ A;  1Y7R A;  5A27 A;  2EBJ A;  4NGR A;  2Q67 A;  1K4D C;  3W6X A;  1M93 A;  2OZH A;  2UXB B;  1SKV A;  3QAY A;  2Y69 B;  1QLE C;  4UV8 A;  3J7A U;  3IWG A;  4O2B A;  4B12 A;  1S7F A;  3LD2 A;  4H37 A;  1N0J A;  4NTW A;  1Y9W A;  1OCO B;  3HKE B;  3A2F A;  4HAM A;  2PJ9 A;  3WB2 A;  1EE3 P;  3ZHV A;  3K3W A;  2ZKO A;  5BR8 O;  4LH7 A;  4IHJ B;  5KX5 B;  4CS4 A;  1F57 A;  2CH7 B;  1YSC A;  1TGO A;  4A30 A;  5FVJ A;  4DV5 O;  2FTK A;  3RYF B;  2A06 H;  4OP4 A;  4O4H B;  2B4D B;  2Q4P A;  3SJF A;  1QLE B;  2IL4 A;  2B5G B;  4UBR A;  1EFR G;  4QPJ A;  1IBM O;  4U9Y A;  2WA3 A;  3QG5 A;  2DWD C;  3DSB A;  3ZZI A;  2ZE8 A;  3ABM C;  5KTD A;  2FSR A;  4R6T A;  1AR1 B;  1FYJ A;  4LF6 O;  1ZTE A;  3P3N A;  3FRM A;  2QEC A;  3EFF K;  4JAU A;  2YGW A;  2NNU A;  1AVM A;  2D2C B;  2RFH A;  5H86 A;  3R65 A;  3H5Z A;  2HV2 A;  1Y6X A;  1CM0 A;  2F95 B;  2YIB D;  2EO8 A;  3R95 A;  1AYE A;  4UFV A;  4PJ0 Z;  4G28 B;  4HNW B;  3ETG A;  2R70 A;  3CC4 V;  4CH5 A;  4JF3 A;  2QM4 A;  3N2G A;  1AJN A;  3PB6 X;  3B3W A;  3RBU A;  3JCU Z;  2B4B A;  2DMX A;  4GT1 A;  1EBO A;  4NGN A;  4N23 A;  1K9M W;  2IQ6 A;  1OZ0 A;  1VIB A;  2ZW4 A;  1EM1 A;  3ZRX A;  4I9W A;  1Y76 A;  2EIM C;  1BPM A;  3CRR A;  3K5N A;  1K33 A;  2QWO B;  4OC4 A;  1FFX B;  3W91 A;  1NSA A;  4ZYQ A;  2QTO A;  3KCY A;  1G1X B;  2XEI A;  5EC1 C;  3N5F A;  4JZ0 A;  1NTK H;  3OMI B;  4X1I A;  4FLY A;  5JJN B;  2ZEH A;  2CUG A;  2MW2 B;  1KC8 W;  4DV2 B;  4JZ2 A;  2FKX A;  3ETE A;  4MFP A;  3OEE G;  1NSL A;  3ZHQ A;  4YHH B;  4MTO A;  5LRG A;  4P9P A;  2EIK B;  1M1K W;  3DLJ A;  4QPK A;  1NI8 A;  1BAV A;  2Y0P A;  1NZ6 A;  3OTO O;  4UFW A;  2GLF A;  3FB8 C;  1Q3E A;  5KA5 A;  1ROP A;  5C8Y B;  2G9D A;  4UFX A;  4GYC B;  1XIX A;  4EKW A;  1WNS A;  4K3N A;  1BCC H;  2GDS A;  2ZDI C;  4FM1 A;  2CTB A;  4ZX8 A;  1I21 A;  2JGD A;  5LYJ A;  3K06 A;  2BTQ B;  4JI2 B;  1IIC A;  2PJ0 A;  2E3C A;  2UXD O;  4MW8 A;  5CBG A;  4FM2 A;  1PYT B;  5IYZ A;  1Q81 W;  4CAE A;  4HYO A;  2A9H A;  4OIW A;  2F7V A;  2QGN A;  4UUJ C;  4QB9 A;  2HQY A;  4BMH A;  2ZD9 A;  2PJ7 A;  3CX5 F;  3BLN A;  4ZIB A;  4FLX A;  4DXW A;  2LGQ A;  4QUS A;  4PA6 A;  3RWR D;  2A7W A;  4KOY A;  4EFB A;  4XNH B;  4RUF A;  4CYQ A;  4AI8 A;  3E22 B;  1VKC A;  2CNM A;  2C6P A;  4W4L A;  2H8P C;  2LGW A;  4RI1 A;  5EC2 C;  4BIU A;  4MHD A;  4J10 A;  2JJ1 G;  1I12 A;  3SJX A;  3U11 A;  2Q43 A;  2HJF C;  4DR5 O;  4J9Z B;  2GIV A;  1GN3 A;  3VH9 A;  4GLX A;  2QKS A;  1VQO V;  3H8F A;  3RYI B;  2Z10 A;  3CHX A;  3ZJ0 A;  5LHH A;  5BXZ A;  3A0B Z;  4QVT A;  2ARH A;  4W4K A;  5KMG B;  2JS5 A;  2XAH A;  3CME V;  1NT2 B;  4RQF A;  4F9U A;  4MHP A;  5IWA O;  1N71 A;  4B5O A;  1Q7L A;  4IHJ A;  3QTC A;  2Q5Z A;  4FLV A;  2Q9L A;  1ARO P;  2DPS A;  2LJ2 A;  2BCO A;  3NFZ A;  3HKD A;  2ABZ A;  1U97 A;  1V54 C;  1XRY A;  2Y0I A;  2Z3P A;  4IAV A;  1HDJ A;  1S72 V;  5IJ0 B;  3FXT A;  3QNV A;  3OUS A;  2P4K A;  2JS3 A;  2FL4 A;  5H6R A;  3ISX A;  1BHA A;  1B6B A;  3D8P A;  2B1I A;  3WG7 B;  3B3V A;  1XFO A;  3BEH A;  1YDX A;  1NVP B;  2O57 A;  1OV9 A;  3D7G A;  4YY3 O;  2H94 A;  1YQE A;  2EIJ B;  1BE3 H;  4TUY B;  1N32 B;  1ZLI A;  4JI3 O;  4FLW A;  1B04 A;  4FD6 A;  2ZM6 O;  2CAZ C;  2B4D A;  5LGU A;  2EIL B;  3ZHR A;  4IGG A;  4R57 A;  1DF5 A;  3BHX A;  3ABT A;  3ZMS A;  4PDV A;  1CP7 A;  2ZEL A;  1N34 B;  2DXQ A;  2X6B A;  3DC6 A;  2WSA A;  2Q04 A;  1NR7 A;  5GON A;  4NEX A;  1ZSP A;  4O2B B;  4UIB A;  2P6J A;  4CBC A;  4OME A;  4FLU A;  3IWE A;  1VMG A;  5JQ4 A;  1S60 A;  1M56 C;  3BI1 A;  4PV6 A;  4MVS A;  4YWY A;  4X8A A;  4KOR A;  5J8F A;  4X8I A;  2GV9 A;  5GW7 A;  2QR4 A;  2VXK A;  4H33 A;  2HB6 A;  3E8B A;  5ELY A;  5HVG A;  3ZRW B;  1K92 A;  3L2N A;  1DTO A;  2M7W A;  4UCR A;  4I5S A;  2JGU A;  2QM8 A;  3T1C A;  1QSO A;  3DXR B;  2DPT A;  1QST A;  4A5U B;  5TIS Z;  1KUX A;  3VQV A;  4F9V A;  3QB8 A;  5LA6 B;  1YIT V;  3TTH A;  1B3Q A;  2Q7E A;  3ZN0 A;  5IJ9 B;  5KAF Z;  1JFF A;  3B2E E;  2Q0Y A;  2PJ2 A;  2FYU H;  3ZX6 A;  5LMN O;  5AG7 A;  1IBK O;  4UF4 A;  3CMA V;  3B3T A;  1CPY A;  4P4B A;  5AG2 A;  2XTA A;  4J9Y B;  4JI8 B;  3D7H A;  3SXO A;  2Y4U A;  1U6M A;  2WLL B;  1OBR A;  4ZI6 A;  2GBO A;  1I5Y A;  4LFB B;  3EC4 A;  2DF5 A;  4UVA A;  1FXV A;  1NTM H;  1A2Z A;  1L0C A;  2BL1 A;  1K3E A;  4P45 A;  1S77 D;  4B5P A;  2KSD A;  2AFO A;  3SPI A;  1TKF A;  1OCC C;  3KKW A;  5JQG B;  2ZW7 A;  1RSO B;  3G3S A;  1P7G A;  3HKB A;  4OPH A;  3SYA A;  3JAR A;  5BMV B;  4A38 A;  4PEL A;  5LYD A;  5JWP A;  2UUB O;  4F0Y A;  3LDC A;  1YI2 V;  3ABK B;  5LRJ A;  4K3A A;  3ZIA G;  2R9R B;  3FED A;  3OFN G;  1XOV A;  3BXM A;  2XAQ A;  4DRX B;  4KOX A;  4P9O A;  1R3L C;  4DUY B;  2CGN A;  4LCU C;  3K2K A;  5CN0 A;  3SJC C;  4H0L B;  1Y4M A;  1JOY A;  2Z0Z A;  4AG7 A;  3SDL A;  4PXD A;  2M6Y A;  4CZZ A;  3ABU A;  2ZOG A;  4ZY0 A;  1P84 F;  2WA4 A;  1QBZ A;  3KL9 A;  2YXH A;  4JXQ A;  4AVB A;  1JJ2 U;  5IYZ B;  1PPJ H;  1ZAU A;  1VF7 A;  2G3A A;  4NXM O;  1VQ9 V;  3IAY A;  3ASO B;  5HFL A;  1R3J C;  1I08 A;  2XND G;  3VQX A;  4GKJ B;  1S0V A;  3RGB A;  1KBH A;  2EIK C;  1RM1 C;  2C6C A;  3RBZ A;  1GM7 A;  1ZUQ A;  1XMQ B;  5EBL C;  1WK4 A;  4OID A;  2Q4Y A;  1ZLZ A;  2EZO A;  5I4M A;  2EZP A;  5AG4 A;  3WT4 A;  1LAN A;  1H2L A;  4LUA A;  2I00 A;  2V8V A;  1LFW A;  2C6G A;  2CTW A;  5EBV A;  1RP3 B;  1RFY A;  3PJS K;  5FLX N;  3AG1 B;  5KTA A;  1YRE A;  2C2A A;  1KB9 F;  4DYL A;  3MRU A;  2QVP A;  1HNX B;  4NVP A;  1SQH A;  1N8R W;  1Y76 B;  5C82 A;  3DR6 A;  4JYY A;  1AI4 A;  4JI8 O;  4CGL A;  5EBW C;  3T2M A;  4R9M A;  1LUW A;  4X20 B;  1LNQ A;  2R9I A;  5H9C A;  1LUV A;  2Q68 A;  1YR0 A;  2P4V A;  4YRH A;  3OEH G;  3CCJ V;  1Q82 W;  1M44 A;  1N4C A;  4NCZ A;  1J5E O;  3UQ8 A;  4H6U A;  1B87 A;  4B3R B;  5DEC A;  2AFM A;  2J8M A;  4M6H A;  5IV0 A;  3QF7 A;  3JD2 A;  2HJD A;  1ZG8 A;  2YIC A;  2YC0 A;  2HC9 A;  2HUZ A;  4KOW A;  4RWU A;  5D5Q A;  3WAB A;  4WWV A;  4JI1 O;  4UIA A;  2WZN A;  3LSU A;  4X88 A;  4JI4 B;  3A0H Z;  2YEV A;  2QJ1 A;  4FJC C;  5JH7 A;  2JBK A;  2EIL C;  4TUY A;  1F7Y A;  4ZKI A;  1JVM A;  3B09 A;  3NH5 A;  4P10 A;  3MGD A;  5H84 A;  3P2F A;  4LF7 O;  3CJH A;  3E22 A;  3TJT A;  3FKS G;  4X1Y A;  1W2B U;  2YNE A;  1IGB A;  4X1Y B;  2XAG A;  2POK A;  1Q2C A;  4C2Z A;  3E89 A;  4CAF A;  4OKO A;  3K5L A;  3K04 A;  2X6C A;  4UWJ A;  3DXR A;  5JH9 A;  3K08 A;  2QIR A;  3G6B A;  4WFG A;  1QSR A;  3IFX A;  3KZI Z;  1F2P A;  2HLD G;  5B1A B;  3J81 N;  1L1F A;  4R6Z A;  5JGF A;  2X0L A;  3V38 A;  2PE3 A;  4KL1 A;  5CBF A;  1YSJ A;  2D4P A;  2OIE A;  2F66 C;  3ASN C;  2OCH A;  1XBL A;  4FMT A;  4YJ3 A;  3WG7 C;  4KOU A;  2F23 A;  2L6L A;  4P4F A;  3B2Y A;  4D6T H;  3X2Q C;  3B8G A;  1LCP A;  3D3I A;  5HXD A;  2WLN A;  3S9L A;  4R76 A;  4F6E A;  4JI3 B;  1HDU A;  4K30 A;  3X2Q B;  4YGO A;  4A39 A;  3OM3 B;  1KUV A;  3PB4 X;  4FPP A;  1S7N A;  1N34 O;  5LHG A;  4MFK A;  1P4N A;  3FB3 A;  4AVA A;  1S5J A;  2CGO A;  1IB1 E;  4LF5 O;  2Q7G A;  2JEU A;  4JLY A;  4JXR A;  3KR5 A;  4R3K A;  1VQ4 V;  5IB0 A;  4U7N A;  5IX3 A;  4C2Y A;  3KR4 A;  1GM8 A;  4IYH A;  3RN4 A;  1X10 A;  3ZCC A;  4P44 A;  4JI0 B;  1G6U A;  3UO3 A;  4JTC B;  4X66 B;  3SPJ A;  1QQ9 A;  3JCZ A;  1VAR A;  3KQX A;  1Z8X A;  2R72 A;  4JYW A;  4TWK A;  4AXV A;  2G38 A;  4G2K A;  1X12 A;  4NYK A;  4Z1V A;  4CH3 A;  2WLI A;  3NXS A;  4A33 A;  1V9P A;  3MAQ A;  2OZG A;  3TOB A;  1KP3 A;  1Q2D A;  3T1H B;  1VQ5 V;  3GIU A;  1VQ7 V;  2ZEE A;  4RN7 A;  4X62 B;  1N33 O;  3P3P A;  2B3V A;  4PXE A;  3EY5 A;  1TVK B;  4LWS B;  4WFB V;  5CBH A;  1GH6 A;  1NS1 A;  1GRJ A;  3IJ4 A;  5H6Q A;  3H1J H;  4YJ2 A;  1RTQ A;  3WU2 Z;  3H1L H;  4TV9 A;  4NXM B;  4BD9 A;  2VI7 A;  3TCV A;  3SXN A;  1GK9 A;  2PJ1 A;  4CYN A;  1Q8I A;  1SC5 B;  1IYL A;  4X64 B;  4R3L A;  4X9Q A;  1WPX A;  3KHZ A;  3KI9 A;  2ZXW B;  4R50 A;  2QEX V;  4MVQ A;  2REE A;  1RXT A;  1IY7 A;  2ITD C;  4LFA B;  1CEZ A;  4B11 A;  2IU0 A;  4NXN B;  4IHM A;  3RYC A;  1SQB H;  5KHH A;  4EME A;  3A8T A;  4I50 A;  3RYC B;  4RUH A;  8CPA A;  3VAR A;  2A4N A;  1QHT A;  1FXK C;  1L8D A;  1OCZ C;  3VOU A;  2UXC B;  3ZJZ A;  4L89 A;  5LMU B;  3S6H A;  3H1I H;  3TCU A;  2GUZ A;  2Y48 A;  2HFE C;  1Y74 B;  4R87 A;  3RFR A;  1Y66 A;  2VL1 A;  5B3S B;  1YJ9 V;  4PDL A;  2Z3M A;  1FXH A;  4F4L A;  3WFV A;  4LF9 O;  3GY9 A;  4NGM A;  4XNH C;  5F48 A;  4UFZ A;  4XBF A;  5BMV A;  1M1D A;  2Z3N A;  3W7U A;  1VF5 B;  1NQT A;  1HNW O;  2QYV A;  2Q7S A;  3QNE A;  3B7I A;  4CGN A;  2OU2 A;  3FF3 A;  1TVK A;  4LWS A;  2F5I A;  1FD9 A;  5DN6 G;  3P2H A;  1WAZ A;  2GUZ B;  3JD3 A;  2X6A A;  1M90 W;  3L70 H;  2BTQ A;  3E8H A;  2Q51 A;  3PBE A;  4L8A A;  1MAB G;  4IF5 A;  5L3G A;  2Z11 A;  2BUE A;  2PUS A;  3JD1 A;  3MDS A;  1YCI A;  2DE0 X;  1BZK A;  2PCU A;  4DV7 B;  5B3S C;  2K9P A;  4J7J A;  5B5E Z;  1VHE A;  2JLM A;  1OCR B;  4KXR A;  2JEX A;  5HVH A;  5A2Q N;  1XMT A;  4O4J B;  4DV0 O;  2FCK A;  2R98 A;  4OPA A;  2AE6 A;  4Q36 A;  3FB6 C;  2FT0 A;  3VBB A;  5BY1 A;  1PCA A;  4PXC A;  1XQ8 A;  2UXN A;  4MCQ A;  1THZ A;  4ZI7 A;  2DYR B;  1FPO A;  1S5L Z;  2BCC H;  4R7M A;  1QVG U;  1AUG A;  3CC2 V;  3TC8 A;  4P2Z A;  4IL6 Z;  1K97 A;  3L73 H;  5LL6 Y;  5LA6 A;  5EIB C;  3APQ A;  1YLE A;  4ZHQ A;  4L8J A;  4JD6 A;  1Z2G A;  3A0R A;  3OGI B;  3RW0 A;  5KUM A;  4TNU A;  4H44 B;  1H2M A;  3JTK A;  5J2U A;  4AIL C;  5I0C A;  2DQ3 A;  5KX5 A;  2L35 A;  5E96 A;  1IUR A;  1PV0 A;  3CXC U;  1WA8 A;  4X1K B;  3T90 A;  3L74 H;  3IC7 A;  4MVO A;  2BTO A;  1AMP A;  2YI9 A;  3DR8 A;  2VEZ A;  1W0K G;  3STL C;  3CCQ V;  3PBB A;  1EN4 A;  3HR0 A;  3K0D A;  2ILM A;  4U9Z A;  5LYI A;  2KCW A;  2XHB A;  3E83 A;  2XOK G;  1F4M A;  1WB8 A;  1WB7 A;  3B40 A;  3MHS C;  5J2T A;  4PK3 A;  4B14 A;  3BVO A;  4B5P B;  4MFZ A;  4KSI A;  4DO2 A;  3H1K H;  1K8A W;  2ZOF A;  3I9S A;  3UKM A;  5KLV H;  1XMQ O;  4B7K A;  3EFA A;  3KAS A;  2A3Q A;  1LOK A;  4CYO A;  3LDD A;  1Z8W A;  4JI6 B;  1JX9 A;  2ADQ B;  4EB6 B;  3C90 A;  4MFQ A;  4B3M B;  2UXX A;  5K1X A;  2VZY A;  3GWK C;  1HNX O;  1E1Q G;  1NH2 B;  3F0A A;  4M6I A;  3JAW A;  5EYP A;  1H2N A;  2OIG A;  2YIA A;  3E2E A;  1HNW B;  3DGV A;  1VGY A;  5B1A C;  1VQK V;  1VQ6 V;  1SET A;  5ITZ A;  2JBJ A;  2VBQ A;  4UCS A;  2MK3 A;  2UUC B;  2WYR A;  4FWU A;  3QO7 A;  4O4I A;  3LOD A;  5LMN B;  5LP6 C;  1NKD A;  3CJH B;  1VF6 A;  1BHB A;  2WLI B;  2KG7 A;  3M8A A;  4KOS A;  1YZB A;  1BQZ A;  4A2Z A;  2VS0 A;  2PI5 A;  1MA1 A;  5CA1 A;  5JQG A;  2RNB A;  2EX3 A;  2JK5 C;  4JAA A;  1Q5O A;  4K0K B;  1SQQ H;  1RPR A;  2BE3 A;  5GCN A;  4I50 B;  4GUN A;  1QU7 A;  3S6F A;  2FIA A;  2BSK A;  1YJW V;  4X62 O;  1TXR A;  2BSW A;  3HKC B;  1PUA A;  3K03 A;  1UPG A;  5J8C A;  4KUA A;  3PFE A;  4MTF A;  5JVD A;  3TOA A;  4FFB B;  1TIQ A;  4KSA A;  1XUQ A;  1AR4 A;  2IJI A;  5EYP B;  1MSW D;  2XEF A;  2JRI A;  4NB5 A;  4H89 A;  4PQA A;  4LF5 B;  5C88 A;  2PC1 A;  4BW9 A;  4F6R A;  4JYC A;  4X89 A;  3UO2 A;  1IVS A;  1BLL E;  4MCR A;  4JYA O;  1X4T A;  2QWP B;  4O4I B;  4A95 A;  1L0N H;  1QVF U;  5IJ9 A;  3GVM A;  4M6G A;  4IYI A;  5JJE B;  1Z4R A;  2W6I G;  4O4H A;  5F47 A;  1P7B A;  3L71 H;  4DR4 B;  3GUX A;  4J3G A;  3UM7 A;  4KVM E;  3UY5 A;  2DW4 A;  5CA0 A;  4I4T A;  5DM6 V;  3JAW B;  4U3J B;  4PSX A;  3BAB A;  4M3S A;  2D3O W;  5J1Q A;  2XAF A;  1LR1 A;  4O4L B;  3DSQ A;  1GO3 F;  3OAA G;  2K1E A;  1KUY A;  3JSL A;  4UCN A;  4QNH B;  1TKH A;  2WUU A;  3JYC A;  2QE7 G;  3TXQ A;  2O4H A;  3TFY A;  2CNS A;  1I94 B;  1XOU A;  1QR9 A;  5K8P A;  4O4J A;  3LSS A;  1RM1 B;  4QC6 A;  3D2M A;  2QWN B;  3R9F A;  2PIY A;  4MRI A;  3O65 A;  1H38 A;  2G3T A;  6CPA A;  5DS0 A;  5HH1 A;  1KQS U;  1FFT B;  4GX0 A;  4I9Q A;  3OMA B;  1KU9 A;  3LNM B;  4FLT A;  3PP9 A;  4D7T A;  4KS9 A;  3FYI B;  1X59 A;  4H6Z A;  3SPH A;  4FFK A;  4AVC A;  2CY2 A;  3AG1 C;  1K4C C;  2LW7 A;  3G67 A;  5IYC O;  1XL4 A;  4DR2 O;  3GB0 A;  1VQL V;  1QMU A;  4DR4 O;  4XPK A;  3HKB B;  4LX9 A;  4GCZ A;  1COW G;  4NSQ A;  2O28 A;  2P6F A;  3WC5 A;  1O9G A;  4KOT A;  4DV4 B;  3HB3 B;  2IH3 C;  5HVF A;  2NLJ C;  1YTF B;  1IXM A;  4FIP C;  3CYO A;  2RJZ A;  1I94 O;  2JIZ G;  5AG6 A;  3NR7 A;  5BR8 B;  4UB8 Z;  1FXK B;  1UFH A;  1NVP D;  1CP9 A;  4X64 O;  4MS2 A;  4F8Z A;  1FXK A;  4B3S B;  2CXA A;  5KTC A;  1OCR C;  2WLH A;  3OW2 U;  4OX9 B;  3TXS A;  3OR7 C;  4WBN B;  2CDY A;  4TT3 G;  4NXN O;  3FB7 C;  3M7M X;  4IIJ A;  3FX6 A;  1JMK C;  4I55 B;  1ARM A;  4RO2 A;  4UEF A;  1BO4 A;  4FZ1 A;  5L3C A;  5J2U B;  4J42 A;  1BOB A;  1PU9 A;  5G21 A;  4JI7 O;  1KP2 A;  2GTA A;  1ARL A;  1BMF G;  1KYO F;  4BIZ A;  4X20 A;  3E86 A;  2JVD A;  1DTD A;  2XT9 A;  4JZG A;  2CH7 A;  2VQF O;  4MW3 A;  2UUA O;  2ZIN A;  1R3I C;  2WPD G;  2XUM A;  3RYF A;  1G4Y B;  3VWE A;  2RMK B;  3JD4 A;  1LRZ A;  4PHZ A;  2GU2 A;  5DWM A;  2F93 B;  2ZEO A;  5GTH Z;  3C26 A;  1YW6 A;  2Y69 C;  3D2P A;  2GE3 A;  1RO5 A;  5K8O A;  1N36 O;  2ZEN A;  2GHY A;  1YF2 A;  1R3K C;  3U0Z A;  4AB7 A;  3K9T A;  3F5T A;  4Q38 A;  2QKC A;  2YID A;  4JI6 O;  5C93 A;  1ZX3 A;  5EBM C;  1Z9U A;  5F2V O;  4DV1 B;  3G4S V;  4UCU A;  2EIN C;  1M9N A;  2JEV A;  3GLJ A;  4B13 A;  2PJ6 A;  5JJJ B;  3FX7 A;  3K0G A;  5EK0 A;  1IZ3 A;  2PTM A;  4ABM A;  4DK1 A;  5GON B;  1V55 B;  3NA6 A;  1DK1 A;  1NH2 D;  3OGC C;  4DK0 A;  2OT5 A;  4PK2 A;  1XMO O;  2ZNJ A;  4CYP A;  5CA3 A;  4A32 A;  1NJI W;  2UUA B;  2PI4 A;  4O2A A;  1HEE A;  2R9A A;  2P0W A;  3ASN B;  1JQG A;  4MHN A;  2CK3 G;  1JWQ A;  3LDE A;  2ATR A;  2EIN B;  1Q7Y W;  4KOV A;  2HR3 A;  1K73 W;  1FFX A;  3R9G A;  3HKD B;  2AHZ A;  4ZBM A;  3JAR B;  4DV4 O;  1D5A A;  3TGU H;  1HNZ B;  3BJ8 A;  5HFM A;  1MG1 A;  5L3F A;  2OWO A;  4MFL A;  4QBJ A;  3ZRS A;  4LF8 O;  5FPO A;  4IUS A;  3OTO B;  1FJG O;  1VQM V;  3B4S A;  1ENV A;  2FIW A;  3ISZ A;  4JI4 O;  4KSF A;  1MJ9 A;  3FVL A;  1JPX A;  5CB4 B;  3IIB A;  4OX9 O;  2V8H A;  1XEQ A;  5CB4 A;  1Q6H A;  4WFF A;  4E2A A;  2KKW A;  3ZED A;  3IGA C;  3CDX A;  3K9A A;  1Z5V A;  4B3R O;  1IYK A;  1YK3 A;  2FML A;  2F43 G;  4DV0 B;  1PNM A;  3K58 A;  2FXF A;  4ASU G;  2H5M A;  2YS8 A;  3SJB C;  1PNK A;  4YJ2 B;  4OAD A;  1S5H C;  1ZL8 A;  2QKA A;  1AI7 A;  3ZHS A;  2LFR A;  1YIJ V;  4GX1 A;  4KVX A;  5LP6 A;  1VHO A;  1H8H G;  3H1H H;  2IU3 A;  3OWC A;  4F0X A;  5IYD O;  1NTZ H;  1VF6 C;  2YXY A;  4LF9 B;  4KLV A;  5HMN A;  2FB5 A;  3EHB B;  3ZS8 C;  1KZF A;  2GAN A;  1MJB A;  3CXH F;  3BPZ A;  2V77 A;  2Q7B A;  2ZEF A;  4IK2 A;  2ZIO A;  4PA4 A;  2OCC B;  3DGE A;  3Q4H B;  5EZY B;  1D2D A;  3D7F A;  3WC7 A;  3QO8 A;  4DYO A;  3K9S A;  2CTP A;  2GFQ A;  3S6K A;  2GSM B;  4G27 B;  2PJA A;  2ZEP A;  4ZBG A;  1RSO A;  5D29 A;  3CS5 A;  4JI1 B;  4DV5 B;  4GXH A;  1VQ8 V;  2AGA A;  3N2K A;  4X5K A;  2PRB A;  3WC6 A;  1SQP H;  1FT7 A;  2AJ6 A;  1ELL P;  2UXC O;  2NYQ A;  5FPR A;  2UXD B;  3JD0 A;  3PEI A;  3FIX A;  1Q43 A;  1IBM B;  7CPA A;  1WLE A;  3GKR A;  5KHI A;  4OGQ B;  2F1M A;  1YVW A;  3JUW A;  1M4L A;  4CRY B;  5D8N A;  2GRE A;  2EBO A;  1EN6 A;  4PSW A;  2HP8 A;  1S7L A;  4KZT A;  2EIM B;  2PJ3 A;  2QDO A;  3IO1 A;  3DC5 A;  3SYC A;  5F49 A;  4WFA V;  2DYS C;  1BSM A;  2WSS G;  1F23 A;  1VHS A;  4ZHQ B;  2QA4 V;  2W6J G;  4U5Y A;  3E0K A;  1PL0 A;  2EVN A;  1XL6 A;  3H9V A;  1YME A;  3T4D A;  2JGD B;  4XDJ A;  5LYJ B;  2DYS B;  3IU1 A;  4XPL A;  3H01 A;  4NGP A;  3R96 A;  2PJ8 A;  4AQY B;  2J8R A;  3B3C A;  5JH7 B;  1MSD A;  1NR1 A;  2XEG A;  3BA9 A;  3FAV A;  4NTY A;  1FKA O;  4J11 A;  3SI0 A;  5KHJ A;  1CPX A;  5IJ0 A;  3K59 A;  1SS3 A;  3ASO C;  1BQ0 A;  3BCC H;  4BWA A;  5L3E A;  1KMI Z;  3CCL V;  3SPC A;  1VQN V;  4QE9 A;  2V7Q G;  4J41 A;  1JJO A;  2RCV A;  1GKF A;  3CCU V;  4C7U A;  5E79 Z;  2I3C A;  1JA8 A;  2IJK A;  4CH4 A;  2PYL A;  4MBU A;  4MXU A;  5JM6 A;  4CAW A;  1AIL A;  2PDO A;  4OC1 A;  4C2X A;  2YNC A;  1UJW B;  4C7H A;  4ZY1 A;  1TUB B;  3RNZ A;  3RYI A;  4MTG A;  3G8W A;  4OXS A;  4ICG A;  4MTX A;  2PRQ A;  4QJF B;  2PSW A;  2QTS A;  5K8M A;  3OE7 G;  4UCP A;  4NGQ A;  1VP7 A;  3K5M A;  2Z0A A;  3L75 H;  3JAM N;  4NR1 A;  3UT5 A;  1GN4 A;  4DV6 O;  2BO9 A;  1TF9 A;  4MFJ A;  3A9L A;  4MVU A;  4UV9 A;  1BGY H;  1ZG9 A;  3H4Q A;  1RPO A;  3JAK B;  2IMO A;  3FEE A;  3GYA A;  1NU1 H;  1IBL B;  3JAS B;  4FD7 A;  2BEI A;  3SJE A;  1GYT A;  1M57 C;  3AK3 A;  4BAY A;  2LW1 A;  3FAV B;  4O23 A;  3OTF A;  2DEA A;  4TSF G;  1WP7 A;  1YLO A;  4DV7 O;  4FD4 A;  1YTF D;  3FFQ A;  2EWB A;  2OH1 A;  3DNS A;  4DR6 B;  3IJ3 A;  3AG3 B;  3HKE A;  4LNU B;  3F5B A;  1SRY A;  4DR7 O;  1XDC A;  4GX5 A;  4J80 A;  1FNO A;  1J4J A;  1S3Z A;  3F7V C;  1WJZ A;  5D5P A;  1XI1 A;  4BBH A;  5LP6 B;  1GMG A;  3PB9 X;  2Z3L A;  2ZW5 A; 
#chains in the Genus database with same CATH homology
 3EXN A;  4MI4 A;  3IWE A;  4MFQ A;  1S60 A;  5JQ4 A;  4PV6 A;  4KOR A;  5J8F A;  1CJW A;  2VZY A;  2VXK A;  4HNY B;  3TO9 A;  3F0A A;  1I1D A;  4HKF A;  2PR1 A;  1QSO A;  2DPT A;  2R7H A;  2VBQ A;  1QST A;  1KUX A;  3QB8 A;  2WPX A;  3LOD A;  3TTH A;  3CXQ A;  4UA3 A;  2Q0Y A;  4C7I A;  4KOS A;  5AG7 A;  4A2Z A;  3SXO A;  2EUI A;  4UCM A;  3S6F A;  4CAX A;  5GCN A;  4CGO A;  1U6M A;  4CGM A;  2FIA A;  4XPD B;  3EC4 A;  2BSW A;  4MY0 A;  3BJ7 A;  1PUA A;  2C27 A;  5J8C A;  1L0C A;  2P6G A;  4KUA A;  2BL1 A;  4GS4 A;  4B5P A;  2Z3K A;  3TOA A;  1TIQ A;  2VQY A;  4KSA A;  3KKW A;  4NXY A;  3R9E A;  4CRZ B;  2ZW7 A;  4H89 A;  5C88 A;  2PC1 A;  3G3S A;  3F8K A;  3T9Y A;  4F0Y A;  4A95 A;  5F47 A;  1M4D A;  1Z4R A;  1OZP A;  4J3G A;  3UY5 A;  4KVM E;  1K4J A;  3RYO A;  1XEB A;  4KOX A;  4PSX A;  4M3S A;  4CGP A;  3S6G A;  2OB0 A;  1KUY A;  1YVO A;  2Z0Z A;  4UCN A;  4AG7 A;  2WUU A;  3CXP A;  5BWA B;  3TFY A;  2WPW A;  2CNS A;  3EO4 A;  4JXQ A;  4AVB A;  2B3U A;  2ZXV A;  4QC6 A;  3D2M A;  1NE9 A;  3WR7 A;  2G3A A;  3R9F A;  5JPH A;  4CS0 B;  2G3T A;  3PZJ A;  4C68 A;  2VZZ A;  4KVO E;  5HH1 A;  3TO7 A;  2X7B A;  3PP9 A;  1WK4 A;  4KS9 A;  4AG9 A;  2Q4Y A;  1ZO0 A;  2Y0M A;  3SHP A;  1MJA A;  4H6Z A;  5AG4 A;  1Y9K A;  5AGE A;  5G22 A;  4AVC A;  4LUA A;  2I00 A;  2CY2 A;  3FYN A;  4MY3 A;  4NF1 A;  4XPK A;  5EBV A;  4LX9 A;  4NSQ A;  1FY7 A;  2O28 A;  2P6F A;  3N7Z A;  1IID A;  4ORF A;  4RS2 A;  1V0C A;  4KOT A;  2PR8 A;  3FNC A;  5KTA A;  1YRE A;  1SQH A;  3K9U A;  5C82 A;  5AG6 A;  3DR6 A;  2Q4V A;  4CGL A;  1UFH A;  4R9M A;  1WWZ A;  4A31 A;  4E0A A;  2CXA A;  1M4G A;  5KTC A;  1YR0 A;  4KLW A;  4YRH A;  3DDD A;  1GHE A;  1M44 A;  4KUB A;  2J8N A;  4NCZ A;  4Y49 B;  4H6U A;  1B87 A;  4ZGY B;  3CXS A;  1NMT A;  2J8M A;  5IV0 A;  2REF A;  3NE7 A;  1BO4 A;  1PU9 A;  2HUZ A;  4KOW A;  1BOB A;  5G21 A;  2R1I A;  3MGD A;  2FS5 A;  5H84 A;  3P2F A;  3VWE A;  1LRZ A;  5EC4 A;  5DWM A;  5AG5 A;  4OLL A;  5G1Z A;  2YNE A;  3C26 A;  2YNC C;  1Q2C A;  4C2Z A;  3D2P A;  1R57 A;  4CAF A;  4B10 A;  2JDD A;  2GE3 A;  1RO5 A;  3IGR A;  3TO6 A;  4UWJ A;  2CNT A;  3V8I A;  4AB7 A;  2QIR A;  1M4I A;  2G0B A;  4Q38 A;  3TE4 A;  1Z9U A;  1QSR A;  5ISV A;  4HNX B;  2JEV A;  4I49 A;  4B13 A;  1MK4 A;  4E8O A;  2B5G A;  1YVK A;  4UWI A;  1S7K A;  2D4P A;  1Y7R A;  5A27 A;  2P6E A;  3W6X A;  1Q2Y A;  4PK2 A;  2OZH A;  3IWG A;  4KOU A;  4CYP A;  4MJ8 A;  4A32 A;  4B12 A;  2RC4 A;  1S7F A;  3LD2 A;  1Y9W A;  3B8G A;  2P0W A;  4OAE A;  4JWP A;  1QSM A;  4K30 A;  2ATR A;  4KOV A;  3VWD A;  4YGO A;  3R9G A;  2D4O A;  1KUV A;  3R1K A;  3BJ8 A;  4A30 A;  1S7N A;  2FE7 A;  5FVJ A;  4MFL A;  4QBJ A;  4MFK A;  4IUS A;  1P4N A;  3FB3 A;  2ZPA A;  4AVA A;  4F6A A;  2FIW A;  2B4D B;  1IB1 E;  4JLY A;  4JXR A;  4KSF A;  2IL4 A;  1MJ9 A;  2B5G B;  4UBR A;  4U9Y A;  4R3K A;  5IB0 A;  5IX3 A;  4C2Y A;  3DSB A;  3ZZI A;  4E2A A;  5KTD A;  2FSR A;  1IYK A;  1YK3 A;  3FRM A;  2JDC A;  2QEC A;  2YGW A;  2FXF A;  2H5M A;  5H86 A;  3H5Z A;  2HV2 A;  2YND A;  4FD5 A;  4XPD C;  4OAD A;  1CM0 A;  4A33 A;  3R95 A;  4KVX A;  4UFV A;  2OZG A;  3TOB A;  3OWC A;  4F0X A;  4HNW B;  1Q2D A;  4KLV A;  5HMN A;  1KZF A;  3IU2 A;  2GAN A;  1MJB A;  2B3V A;  2B4B A;  2Q7B A;  3D3S A;  3EY5 A;  2ZW4 A;  3FBU A;  5G20 A;  4II9 A;  3S6K A;  3W91 A;  4ZBG A;  2VI7 A;  1S5K A;  3TCV A;  3SXN A;  4CYN A;  1IYL A;  4R3L A;  4X5K A;  2PRB A;  5A28 A;  2AJ6 A;  2REE A;  4YFJ A;  1RXT A;  4MFP A;  4ONU A;  1NSL A;  3FIX A;  4B11 A;  3GKR A;  3JUW A;  4CRY B;  4PSW A;  1YGH A;  1S7L A;  4KZT A;  4UFW A;  1XE4 A;  2A4N A;  5F49 A;  4UFX A;  1XIX A;  5DWN A;  1VHS A;  4L89 A;  5CNP A;  3S6H A;  4U5Y A;  3E0K A;  2EVN A;  1I21 A;  1YX0 A;  4R87 A;  1IIC A;  3IU1 A;  4XPL A;  2OZU A;  1ON0 A;  2Z3M A;  3R96 A;  3GY9 A;  4JJX A;  4CAE A;  4XNH C;  5F48 A;  2J8R A;  4QB9 A;  1M1D A;  2Z3N A;  2HQY A;  4BMH A;  3BLN A;  2ZW6 A;  4CGN A;  4QUS A;  2OU2 A;  1P0H A;  4XNH B;  4KOY A;  2F5I A;  4CYQ A;  1VKC A;  2CNM A;  3P2H A;  4RI1 A;  4MHD A;  4Y49 C;  1I12 A;  3JVN A;  4L8A A;  4CAV A;  4IF5 A;  2Z11 A;  1XF8 A;  2BUE A;  4MBU A;  2GIV A;  4CAW A;  2PDO A;  2R8V A;  4C2X A;  2YNC A;  2Z10 A;  4C7H A;  3ZJ0 A;  2Z3O A;  4QVT A;  2JLM A;  3G8W A;  3TT2 A;  2ARH A;  1XMT A;  2FCK A;  2R98 A;  2QML A;  2AE6 A;  2PSW A;  4Q36 A;  2FT0 A;  1N71 A;  3PGP A;  4B5O A;  4UCP A;  2DPS A;  3I3G A;  2Z3P A;  3FXT A;  1YLE A;  4MFJ A;  3A9L A;  2FL4 A;  2PQ8 A;  4JD6 A;  3H4Q A;  3GYA A;  1B6B A;  3QAH A;  3D8P A;  4FD7 A;  3JTK A;  5F46 A;  2BEI A;  5I0C A;  4EVY A;  5E96 A;  2K5T A;  2B58 A;  4DNC A;  3T90 A;  3DR8 A;  1QSN A;  2VEZ A;  4FD4 A;  2NMT A;  3DNS A;  2OH1 A;  4M85 A;  4FD6 A;  4U9Z A;  2B4D A;  2KCW A;  3F5B A;  4R57 A;  4B14 A;  4PK3 A;  1J4J A;  2I79 A;  4B5P B;  4MFZ A;  1S3Z A;  2DXQ A;  4BBH A;  1Z4E A;  2Q44 A;  3W6S A;  2WSA A;  2Q04 A;  4NEX A;  3I9S A;  3EFA A;  2Z3L A;  2ZW5 A;  4CYO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...