2FL4A

The crystal structure of the spermine/spermidine acetyltransferase from enterococcus faecalis
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
147
structure length
147
Chain Sequence
GMEIHFEKVTSDNRKAVENLQVFAEQQAFIESMAENLKESDQFPEWESAGIYDGNQLIGYAMYGRWQDGRVWLDRFLIDQRFQGQGYGKAACRLLMLKLIEKYQTNKLYLSVYDTNSSAIRLYQQLGFVFNGELDTNGERVMEWTHQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords spermine/spermidine acetyltransferase
publication title The crystal structure of the spermine/spermidine acetyltransferase from Enterococcus faecalis
rcsb
source organism Enterococcus faecalis
total genus 36
structure length 147
sequence length 147
ec nomenclature
pdb deposition date 2006-01-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.900 Mainly Alpha Orthogonal Bundle Helix Hairpins The crystal structure of the spermine/spermidine acetyltransferase from enterococcus faecali 2fl4A01
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 2fl4A02
3GY9A 3CXSA 5C82A 2Z0ZA 2J8RA 2CNTA 2R8VA 3R96A 4XPDC 2FL4A 4B5OA 1BOBA 4FD7A 4KOWA 2ATRA 5KTCA 4LX9A 3W6XA 1M4GA 3CXQA 1K4JA 4KVXA 4PV6A 4R57A 1S7KA 1P4NA 1S3ZA 5EBVA 1J4JA 3S6FA 1Y9WA 2FCKA 3TT2A 4AG7A 5F46A 1KZFA 3I3GA 4E0AA 5FVJA 3VWEA 2VZYA 1V0CA 3OWCA 2Z11A 3FRMA 3P2FA 4QBJA 1ON0A 2PRBA 4UWJA 2IL4A 1TIQA 1IICA 1CM0A 1M1DA 5C88A 2B4DB 4HNWB 5JQ4A 2ZW4A 2Z10A 3D8PA 2R98A 3EC4A 1XE4A 4R87A 2Q04A 3EO4A 4M3SA 4XNHB 3PZJA 4KLWA 2WPXA 4ZBGA 2JDCA 4IF5A 3QAHA 4CAVA 5IX3A 2G3TA 1YGHA 1SQHA 3PGPA 2AJ6A 4KZTA 4PSXA 3TOBA 1PU9A 4Y49B 1KUVA 2P6EA 1Z4RA 2Q4VA 2ZW5A 5HMNA 3V8IA 4R3KA 3C26A 2Q44A 4R9MA 3T90A 4PK2A 4DNCA 1Q2DA 4J3GA 4OLLA 1IYLA 3TO6A 4AVBA 2D4OA 4UBRA 2KCWA 2GANA 3BJ7A 4AB7A 1YREA 4X5KA 1IYKA 3TO7A 3H4QA 4M85A 4KVOE 3R1KA 3WR7A 2FSRA 2D4PA 4YGOA 1B87A 4KOYA 1OZPA 3BJ8A 4QUSA 1QSOA 2FIWA 2B4BA 3S6HA 4NF1A 4NEXA 3W91A 2FXFA 1YX0A 3DDDA 2FT0A 3D3SA 4MY0A 1YVKA 4F0YA 4E2AA 2OB0A 1YK3A 4CRYB 2OZHA 3BLNA 4GS4A 2NMTA 4QC6A 5JPHA 2REEA 1N71A 2VBQA 4R3LA 3I9SA 3KKWA 3LODA 1NSLA 4FD5A 1QSRA 4KLVA 3F8KA 1NMTA 2GE3A 1M4DA 4H6ZA 1CJWA 1S60A 1Q2CA 4HNYB 3P2HA 4FD6A 4QB9A 5DWMA 4MI4A 4B5PB 3FBUA 1MJAA 2P6GA 4KOXA 2Q4YA 3R95A 2WPWA 3F5BA 4L8AA 2QECA 2F5IA 4L89A 2K5TA 1S7FA 4H6UA 4MJ8A 4YFJA 5J8FA 3E0KA 5IB0A 1Z9UA 4UWIA 3TOAA 2BUEA 2BL1A 4AG9A 4KVME 5H86A 3G8WA 1Y7RA 2OH1A 1S7NA 2A4NA 3TTHA 2ZXVA 4U9ZA 4CRZB 2FS5A 1QSTA 1I21A 1RO5A 3IGRA 3S6GA 1FY7A 2Y0MA 3R9FA 4HNXB 2OZUA 3D2MA 2OU2A 1KUYA 3FB3A 1RXTA 2G0BA 5F49A 2P0WA 4FD4A 3CXPA 3G3SA 3DR6A 5EC4A 1S5KA 2QIRA 3TE4A 4KORA 3B8GA 2HQYA 1IB1E 5KTAA 2EUIA 1B6BA 4RI1A 2J8MA 1MJ9A 2OZGA 3JVNA 4LUAA 3UY5A 2I00A 3JUWA 1Q2YA 2AE6A 2FE7A 4B5PA 1YR0A 3F0AA 2O28A 1P0HA 1IIDA 3FIXA 4U9YA 1XMTA 2CY2A 1XF8A 1WWZA 4JXQA 1VKCA 2PR1A 2RC4A 4OAEA 4MHDA 2VQYA 2ZW6A 4II9A 1L0CA 1LRZA 4XNHC 5CNPA 3IWGA 4QVTA 2PR8A 2VI7A 3FYNA 2Q7BA 5F47A 1M4IA 1U6MA 2VXKA 4NXYA 4Y49C 2FIAA 4KOSA 4CS0B 3VWDA 2QMLA 2C27A 2P6FA 5I0CA 1QSNA 1VHSA 1UFHA 2VZZA 3T9YA 2CNMA 3TO9A 3GYAA 4MY3A 2VEZA 2ARHA 2I79A 3DR8A 2BEIA 4IUSA 4KOUA 3RYOA 1GHEA 1I1DA 2JEVA 4U5YA 1MJBA 5DWNA 2HV2A 4H89A 4AVCA 4XPLA 3SHPA 3QB8A 3SXOA 4YRHA 5IV0A 2PSWA 4JD6A 3EY5A 3W6SA 4RS2A 3EFAA 4JWPA 2ZW7A 3GKRA 4OADA 2HUZA 4I49A 1Z4EA 4ORFA 2B5GB 4EVYA 2ZPAA 4F6AA 5H84A 3PP9A 5ISVA 1Y9KA 5J8CA 3SXNA 1MK4A 2PQ8A 4KOVA 1NE9A 5HH1A 2EVNA 3NE7A 2R1IA 4ONUA 2B3UA 1XEBA 1S7LA 2H5MA 2JDDA 3DNSA 2BSWA 4KOTA 2J8NA 4XPKA 2R7HA 4JLYA 2X7BA 3FXTA 2PDOA 4XPDB 4AVAA 3R9GA 5GCNA 4PSWA 1WK4A 4NCZA 3TCVA 4CAXA 5KTDA 5E96A 2Q0YA 4KUBA 2PC1A 3FNCA 3MGDA 3S6KA 1I12A 3TFYA 3DSBA 1QSMA 2DXQA 4E8OA 4PK3A 3ZJ0A 4HKFA 5F48A 2GIVA 2REFA 3D2PA 3LD2A 2G3AA 1BO4A 3EXNA 4JXRA 3K9UA 1R57A 1PUAA 1M44A 1YLEA 4CAWA 2B58A 1KUXA 3N7ZA 4BMHA 1YVOA 4NSQA 3ZZIA 4KUAA 2B5GA 2CNSA 2JLMA 2B3VA 3R9EA 2B4DA 4UA3A 4MBUA 1XIXA 4JJXA 4K30A
chains in the Genus database with same CATH superfamily
3STZC 4JI7B 3KZWA 1M56B 1K7DA 3IC7A 1GN6A 4J7KA 2R8VA 4L87A 3E35A 2VQEB 5LMNB 3RBUA 4B3MB 2OIEA 1ZL8A 4B3RB 1JQ0A 2YIAA 4R50A 4HAMA 1V9PA 3TCUA 1BOBA 4KP4A 4FD7A 2OR4A 3ICXA 5B3SC 2EIJB 3W7WA 3CB2A 2V8VA 4WCEV 3FX6A 1FPOA 4A94A 4DUYO 2P90A 4KVXA 3SJQC 1RSOB 4ABMA 2CTCA 3S6FA 2ZNIA 2Q51A 3ZX6A 3WT4A 2KB1A 2HG5C 3TT2A 4AG7A 5F46A 1KZFA 2E76B 4NGPA 5FVJA 4ZY0A 1R43A 5LGUA 2Y4TA 2PJ2A 3OWCA 1CP9A 1KU9A 2W0FC 3JAKB 2Z11A 3FRMA 3HKEB 4QIWF 3OUFA 4UWJA 2OTLV 1VF6C 4JYBA 1TIQA 2B5UA 3FKSG 1LUVA 1QQ9A 2P4VA 1M1DA 2ZW4A 3N2KB 4EEQA 3SPCA 1BQ0A 2Q7HA 1AB3A 2RB7A 3D67A 2YC0A 2GLFA 3EC4A 3KQXA 3E89A 3UO3A 5A9GA 4A5UB 1TKHA 1ROPA 1BS3A 1SQXH 1IBLB 2Q67A 2EO8A 4KLWA 5J2UA 2JDCA 1NH2D 4IF5A 1N32O 2PCUA 1M56C 3F5WC 1YJ9V 2Q7SA 4O4JA 1VQ4V 4LFBO 1SQHA 3PGPA 2JEWA 3ETEA 4DR3O 3MN8A 3X2QB 4Y49B 5CA1A 1WLEA 4JI0O 1K3EA 5JCOC 4JTAB 1GN4A 2EIJC 1LUWA 3E2EA 2Q44A 4FLZA 1SQGA 1R3JC 4DNCA 1VQ6V 3TO6A 4AVBA 1AP6A 5LMUB 1MABG 4RN7A 1PV0A 3NH5A 4FFBA 2R9RB 1F4MA 2EINB 2V8GA 1Q6IA 4X5KA 1IYKA 1DE4C 1ZG7A 2YSUB 1K33A 2YXHA 2ZEDA 4UCVA 3CS5A 3HKDA 5THWA 1Z8TA 4FIPC 3DGVA 3R1KA 5C8YA 1KUQA 4YGOA 3OT7A 3SPJA 3VQYA 3B3WA 3G71V 3IWWA 3Q4HA 1HR0O 3ISXA 2ZE6A 3AK1A 4KOYA 4P9PA 1I7FA 1VQNV 4PA4A 1PD3A 3LSUA 4P4IA 1DK1A 3DGEA 1M57B 2DOSA 2AXTZ 4NEXA 4I5SA 3W91A 4I4TB 3JRUA 2QM4A 5EBMC 2XNDG 3DDDA 1BHAA 4P4JA 1SA0B 1YK3A 4CRYB 2OZHA 3H8EA 3HUVA 1AR5A 1WA8B 2HJDA 1YIJV 2HC9A 3J81N 3X2QC 4R3LA 2YEVA 4NGQA 2P06A 3KL9A 3LODA 3WC7A 1NSLA 3UO2A 4DV1O 1N34B 3H8GA 1NMTA 4A38A 4LF5O 3H1JH 2AFOA 2GE3A 2KSDA 5HVFA 3T1CA 5K8PA 2VRZA 1SESA 1ELMP 3P32A 4R7MA 1WB7A 4JAVA 4X20B 5H5NA 3OMAB 2ZDIA 4K35A 3FBUA 4NKGB 4AQYB 1OCZB 1Z5VA 2EINC 2WLLA 3AEIA 5L3CA 1AI5A 4K8XA 2RQ6A 4ASUG 4WFBV 3CZXA 3LSQA 1X12A 2HP8A 1FFXA 2Q6AA 3STLC 2QECA 4KS9A 3RYIB 2UUAO 1SQQH 2F5IA 4DW0A 2K5TA 3RZAA 3IJ3A 1Q8IA 4H6UA 4YHHB 3CMAV 3I55V 4WFAV 1FAFA 1K97A 3TOAA 2HHHB 2BL1A 2WLMA 1Q86W 3THOA 4NJRA 1KB9F 3A0BZ 1S7NA 5J2TA 1N8RW 3CE2A 2FS5A 1QSTA 4DW1A 4ZKIA 4XDKA 4R8FA 3PFOA 3BA9A 2JEXA 2GHYA 1VIBA 2QKSA 3O65A 3D2MA 1KUYA 1XMQB 3D7HA 2ZR3A 1LNQA 4YJ3B 3CXPA 3GWOA 5JJJB 3D7GA 1H2GA 4NGRA 3RNZA 4GCZA 2Q0AA 1UJWB 4DR4O 1S5KA 4ZX8A 5JH9A 3OTFA 3B8GA 3RFRA 3CCMV 2JBKA 2HQYA 2CUGA 3LWUA 2OIGA 4H44B 1GN3A 2EUIA 2M6YA 2IH3C 1MJ9A 2JGDB 5IY5B 2F4VO 4KHPO 2OZGA 3JVNA 4LUAA 4EKWA 2QDOA 5JM6A 1GM9A 3LMSA 5HFLA 1RM1B 1YR0A 4TV9A 2DYSB 1YCIA 1N36B 3LNMB 1IIDA 4CS2A 1OZ0A 5KUKA 3GB7C 1R6NA 3H9VA 1XOVA 4MVRA 2Z3KA 2ZEHA 1M90W 1DTDA 1K34A 4NXMO 1E1QG 2OYQA 4UXNA 4JI5O 1L0LH 5L3BA 4DV7B 2DPTA 2DWDC 2PTMA 4JYCA 1H2KA 3T1YO 4UFVA 2PR8A 3O9OA 2VI7A 2Q7BA 3FYEB 5F47A 1VHOA 1U6MA 2X7RB 5A2QN 3KG2A 1NTKH 3E8HA 4DUZO 2FIAA 3PFEA 4GT1A 3RYHA 5I0CA 3K2KA 4JYAO 1Y6XA 1QSNA 2VZZA 4H13B 1LAPA 1D5AA 3T9YA 4HNAA 3NH4A 3B3SA 3H5ZA 5JGFA 2VEZA 2ARHA 3FB5C 3K04A 1FYJA 1DF5A 5B1BB 2PYJA 4MVQA 3WG7B 1H8HG 3DTUB 4KOUA 1AI4A 4Q6GA 3G67A 1YQEA 4CAEA 3PJSK 2RDCA 2QWQB 5FPRA 4AXVA 4ZOLB 4FM1A 2A9HA 2JEVA 5CA3A 3CCSV 1MJBA 3M7MX 4WJBA 4LF8O 1QVGU 1RM1C 4GKKB 4YRHA 1CPSA 2DYSC 1H8EG 5K1XA 4JASA 2ZE5A 2WLNA 3B09A 1D5NA 4PA7A 1ARLA 1ZLZA 3BA8A 2DYRC 3BABA 2ZW7A 5K8MA 5KAFZ 1SERA 2PZSA 1DTOA 1Z4EA 2POKA 2YNCC 4QPJA 5D8NA 2YDEA 1RP3B 5TISZ 4EVYA 3D7FA 3GB0A 4F6AA 1PPJH 4W4KA 4FK5C 4NXNB 2EK9A 1VF6A 3N2GB 2XEIA 5IWAO 2PQ8A 1J5EO 4KOVA 3ZN1A 4P45A 3L9DA 4A37A 3JD2A 2A3QA 2ZIMA 2BCCH 3OW2U 2F93B 2OCCB 4JI8B 1JWQA 3CRCA 1K9MW 5BMVB 1S5JA 1M1KW 4U7OA 4LFBB 2UXNA 2PI4A 2X6AA 3CPXA 3FEDA 4ICGA 4XPKA 4KL1A 2X7BA 2CTRA 2EIMB 3U11A 2Z3YA 5KHJA 5LGNA 1Z2LA 4AVAA 4QPKA 1GKFA 1IY7A 2JS5A 2ANPA 2PJ4A 1NZ6A 5B1BC 3ZHQA 3OTOO 1BPMA 5GCNA 4IAVA 2QKCA 4NCZA 1W2BU 5ITZB 4LF9B 4J9ZB 2FYUH 1MNGA 1SRYA 3GWKC 2Q0YA 4KUBA 5E96A 4Z1MG 4B3SO 2PC1A 3H1LH 1YTFB 3VQVA 3FNCA 3MGDA 3S6KA 5JCOA 4PQAA 5K1PA 3I56V 3QNEA 4RUFA 2ABZA 3FJUA 5EK0A 1YW4A 3DSBA 4X65O 2YUAA 4I50B 5CBFA 3E8BA 1TAEA 2PJ0A 1XBUA 2A79B 1MG1A 4MMOA 3D2PA 3JALA 5KHKA 5J9PC 4X1YB 4QGPA 4Z2WA 2ETNA 1BO4A 2G3AA 1R6TA 3JCUZ 4CAWA 1M44A 4ZY1A 1HR0B 2BO9A 1SQBH 1XJOA 3JAKA 2V8HA 3HKEA 4C7UA 3G4SV 5E1AC 3ZS8C 3CCRV 2UXXA 2XAQA 3ETQA 3OMIB 4IL6Z 3ZRSA 2B5GA 1NT2B 4CGMA 1XNQO 2JLMA 2B3VA 4LNUB 2LW1A 1IBKO 3R9EA 4CAFA 1XRYA 2UUCO 5FNVB 3L75H 3JD3A 2OCCC 1WNSA 1BPNA 4JJXA 4PDLA 3CD6V 1NTMH 4A2ZA 2WA4A 1VF5B 2HVKC 1UWYA 2Z0ZA 2UXBO 4LH7A 3QAYA 2JK5C 2EIMC 1HNZO 2H8PC 3R96A 5CB4B 3WC6A 2FL4A 3E83A 5LL6Y 4DV1B 4B5OA 4DR1B 2PJ7A 5F2VO 3JSNA 1Y74A 3FD9A 1XL6A 1K4JA 2NSMA 3FAVB 4EB6A 4FLUA 3B4SA 3G6EV 1BCCH 2N74A 3JARB 4PV6A 4R57A 1S7KA 4P6YA 5EBVA 1KP3A 5IJ9B 3P3PA 4O4IA 2AFXA 2FCKA 1O9GA 1VF7A 4GX0A 3FMCA 3I3GA 4DRXB 4E0AA 4BW5A 4QNHB 1H38A 4WFFA 2VZYA 5LYJA 5AG7A 4IHMA 4C7HA 1PNMA 4PHZA 1HNXB 4DV2O 3WC5A 4PA3A 2IL4A 2XAJA 2AFUA 2Q4PA 3WB1A 1CM0A 5C88A 4DV6O 3LDCA 1YJWV 1H2SB 1AROP 2JEUA 1WJZA 2P5OA 1JVMA 2Z10A 2B1IA 4LWSA 3K9SA 1R3LC 4GX2A 4U3JB 4P9OA 1L0NH 4EFBA 2BTOA 5G20A 1YSCA 2Q8VA 1K8AW 2R98A 3KHXA 5CBGA 4K3NA 2QKAA 4DR7O 1RPRA 4TV8A 3RYFB 4A31A 4PDVA 4M3SA 4XNHB 3PZJA 4C2YA 4ZBGA 2PJ6A 1HP8A 1PNLA 4CS4A 2F7VA 3B2YA 3CT9A 5IX3A 2G3TA 1YGHA 4PSXA 3ZJZA 2IJHA 5J1QA 3HPLC 3ABMB 2PJAA 2MK3A 3A0RA 4JI3O 2Q4VA 3PB7X 2VS0A 1PNKA 3IFEA 5HVHA 4I7ZB 3BXMA 1WA8A 4R9MA 3T90A 5LP6C 5KMGB 4CYPA 1EZVH 1Q2DA 4J3GA 1IYLA 2F4VB 2GDSA 2D4OA 2KCWA 3C3SA 4LF6O 3BJ7A 4M6HA 1ZSPA 2PJ5A 2JJ1G 3VARA 3PB9X 2AZ2A 1VQ5V 3KCYA 1F7YA 1OCCB 2HKOA 2FB5A 4G28B 5LA6A 1G1XB 1SQVH 1LCPA 4A30A 2F95B 2UUBB 3E86A 2ZE7A 3ZBHA 4PXEA 1NTZH 3H8FA 4MFJA 2XHBA 2FSRA 4X9QA 5JJEB 5LOVB 2CF4A 4NXMB 2XAHA 4CGPA 1BSMA 4FVMA 1B87A 4DO2A 4DYLA 1EFRG 1JJOA 4DV3O 2RFHA 2YIDA 5H2FZ 1QSOA 3UT5B 1EN5A 3T1HB 4RQEA 2B4BA 1NI8A 1TUBA 3G6BA 2Z3NA 3PRTA 3VBBA 4TUYA 1Q5OA 4J9YB 1JFFB 5IJ0B 5BR8B 2OB0A 4UVAA 3D4UA 3QO7A 4GX1A 1N33O 3H1HH 1VARA 1NVPB 3M99B 4GS4A 4QC6A 4JYAB 3PB6X 4R6ZA 2RNBA 4DV0O 2ZM6B 2REEA 3CMEV 2CTWA 3ABMC 2VBQA 3I9SA 3BFRA 4NFRA 4N23A 3BPZA 1IOFA 1YMEA 4I9QA 3SYOA 3KKYA 3CCQV 4FD5A 4UCUA 5GONB 1Q3EA 5CBMA 3EXAA 1ENVA 1X4TA 1QBZA 1W0JG 2UXDO 4MTOA 1CJWA 1WPBA 3U0ZA 3E22A 4G27B 1I0HA 4HYOA 1RTQA 3P2HA 5KHGA 1WN7A 1N4CA 3DXRB 4XDLA 2AFSA 2WLJA 1K73W 3IJ4A 3CJHA 4HPSA 3PN1A 5KX5A 4P4DA 2Q4YA 1SZTA 2K9PA 1FJGO 2JGDA 2A0LA 4X1KB 2EJ7A 2ZE8A 3LUTB 4O4HB 3NFZA 2E74B 5JH7B 1I94B 5B1AC 1EBOA 3NH8A 4KSFA 3LDDA 1LAMA 2ODFA 2ADQB 1VQPV 4MJ8A 4WWVA 3QF7A 4O23A 1XDCA 3S9MA 1GO3F 1G6UA 1JOYA 1TXRA 4A39A 4JAUA 1N0NA 5EYPB 4EWTA 3ZMZA 4NB5A 4CBCA 1KKDA 1HEEA 5IWAB 1J5EB 3D8CA 4LF7O 1YEWA 4BD9A 4DK1A 2LGQA 3G8WA 4UCMA 4CGNA 5G1ZA 4DJLA 4DK0A 2YNCA 4DV5O 4IIJA 3TTHA 2ZXVA 1NKDA 3FB6C 1RO5A 3IC9A 2WSAA 1E1RG 4OP4A 3S6GA 4MVOA 1BL8A 2XAFA 1FY7A 1YDXA 3BEHA 4PDRA 5K8NA 2Q7EA 3PB8X 4I55B 1Y0YA 1WB8A 2E5LO 1QU7A 2ZEPA 4ZI7B 3OD4A 2YNEA 5A27A 2GUZB 3G3SA 5EC4A 3K57A 2QIRA 3TE4A 1XREA 3SGIA 1XHZA 5IT9N 1R6KA 4LFCB 5CA0A 2BSKB 5BWAB 4X1IB 4MVMA 5LRJA 5D5PA 4JPRA 1VHEA 3IU1A 4RI1A 2R9AA 1P49A 4X65B 4I0XB 5FLXN 5H6QA 1TF8A 1Q2YA 2AE6A 1Z8LA 5K8OA 1UFIA 4F9UA 4C2XA 3P3NA 3QG5A 4B5PA 1O9HA 4UEFA 4J11A 1XNRO 2G9DA 2PJ9A 3IIBA 4J10A 3VH9A 5I4MA 3L70H 4X66B 2QE7G 4LFAB 1XMTA 1TVKB 1WWZA 4CYQA 5CBHA 1ELLP 4LF4B 1IBMO 4B08A 3WU2Z 2A06H 4C68A 3ABKB 5CNPA 2B1GA 4TWKA 1ARMA 2I3CA 4UF4A 1SS3A 4QVTA 2HJFC 5EIBC 4GXHA 4PA6A 2BTQA 3QNVA 2R72A 1M4IA 2QR4A 2VXKA 3CP1A 2UXBB 4Y49C 1Y76B 3L73H 3OMNB 2EZOA 4CS0B 2CTQA 4L8JA 1AP5A 4YY3O 2CNMA 2PE3A 5JQGB 3GYAA 2ZELA 5L3GA 4DR6B 5IYZA 4OMEA 3IC1A 2WLKA 3JAMN 3W7UA 3DR8A 4JF3A 3ZMTA 1H2NA 1VP7A 3GIUA 2CK3G 1JMKC 2QWOB 2ZQMA 4IHJB 2Q5ZA 3RVZA 1I1DA 2XEFA 2ODMA 1T5EA 4ZY2A 3TJTA 4C2ZA 2A7WA 1AILA 3AG3B 3SJCC 3D3QA 2AFMA 1SF9A 1XOUA 1DLBA 4UFZA 5ITZA 2BOAA 3SHPA 3B8MA 4JD6A 4DV2B 2JDIG 3W6SA 3B2EE 5EZYB 4JWPA 1P84F 4I50A 1QMUA 4F6RB 4DV6B 2HUZA 5LXTA 2B9ZA 1ZTEA 2DN9A 3AG1B 1NU1H 1M57C 2J9AA 4LC1A 3EHBB 4DR7B 3ABKC 1BAVA 2Z3LA 5J8CA 2PVVA 2Q0OC 4GKJB 4MT8A 3CRQA 3BRCA 4OC0A 1TKJA 1QR8A 4O2AB 2M7WA 3NE7A 2R1IA 4ONUA 1R3NA 1XEBA 5BXZA 4MHNA 1S7LA 4MCRA 5BY1A 3CRRA 4KOTA 5FNVA 3ZIAG 3E8GA 2R7HA 2FTKA 2G38A 3FXTA 2V1DA 1GAXA 3BI0A 3SPIA 3K58A 1KD1W 4FLTA 3WB2A 4E2LA 2XT9A 2P4KA 4K3AA 2WLIA 4JI6B 1X59A 2ZT9B 3R9GA 2GLJA 3TK1A 1WK4A 1CP7A 4OX9O 1SETA 4IK2A 4B12A 3OFNG 2WLHA 3RYCA 3KZIZ 1VQOV 4UEZA 5CB4A 2JRIA 1OCZC 4P30A 4DXWA 4LF6B 3HKCB 3RVYA 4P4FA 1NH2B 2X0LA 3AG3C 1FXHA 4BBHA 4KSAA 3JCZA 1UPGA 1QSMA 3I5DA 5LP6A 5CPAA 5KAIZ 3AG4B 3H1KH 4PK3A 3JARA 4ZYQA 4O2BA 2GIVA 5G21A 3RW0A 4OC3A 5IJ9A 3HKBB 1QLEB 3W7TA 2REFA 2UXCB 4JXRA 4BW9A 1OCRB 1R57A 4DRXA 3D68A 2VQFO 2DF5A 2PJ1A 2Q9LA 2B58A 1KUXA 4NGMA 1BHBA 3OAAG 2JVDA 4DV3B 1GM7A 3AG1C 5B66Z 5KA6A 3JASB 3R65A 1KC8W 4BMHA 1GMGA 4NSQA 4MW3A 2CNSA 5J2UB 4JI2O 5LYDA 1XMOO 4U3JA 4FZ1A 1BZKA 4MVZA 1AJQA 1F23A 1ZWIC 3CXSA 4O4JB 2F8HA 1TA8A 4MS2A 3RYFA 5LYLA 4DV0B 3I1UA 4R8CA 5CA1B 5L3FA 3FH4A 4B14A 2Z3OA 3ASNB 2EX3A 5A28A 1IXMA 4JI7O 4DUYB 4MXUA 4KOWA 2ATRA 4FLVA 4LX9A 4YJ2A 2PGGA 1M4GA 2UXDB 4MW8A 2VQEO 5LMNO 4B3MO 5IY5C 2V77A 4B3RO 1KP2A 4DR5O 1M4UA 1SQPH 5EBLC 3JD0A 4UCTA 4PI0A 1M93A 3ZMSA 1EE3P 1B04A 2ZXWB 1OCOB 2Z3PA 3UQ8A 2KQXA 3U10A 2VWKA 3HKDB 3AG4C 2XAGA 2N04A 1XI1A 1IXBA 3CDXA 2HR3A 5C8YB 1QLEC 4NJQA 4IGGA 3LDEA 3P2FA 1ON0A 2PRBA 2QSAA 1OCRC 4LBEC 3B7IA 1FT7A 3M8AA 4R6TA 1EM1A 1VQLV 5JWPA 5JQ4A 3KQZA 4PPZA 3D8PA 3K5NA 5DS0A 4PJ0Z 4LF7B 2Q73A 4FLYA 2ATKC 4ONWA 4P44A 3BHPA 3UCSC 1D2DA 4RUHA 1N32B 5LOVA 1FXVA 4R7CA 1XE4A 2QA4V 4DV5B 1L8DA 1NS1A 2PF4E 2DJVA 3AK2A 2IH1C 3EFFK 3OGCC 1US6A 1IGBA 2WPXA 5LBQA 4DR3B 2LJ2A 3RAMA 4BIOA 1EN6A 3CCJV 3UT5A 2FMLA 2YIBA 4JI0B 2PJ3A 4TQFA 3QAHA 4XBFA 2E5LB 1Q43A 1IBLO 4PDMA 4KZTA 3H1IH 3N5FA 4MFZA 3TOBA 3ZMVA 3ETGA 3ASNC 3WG7C 2QJ8A 2ZW5A 3V8IA 1KQSU 1AR1B 1E79G 3T4ZA 4R3KA 3C26A 1QHTA 3IWEA 5CN0A 4FWUA 4PK2A 4H2KA 1NQTA 3CCUV 4X62O 4OLLA 2P7TC 4OC1A 4PXBA 1QCEA 3BAAA 3BY6A 3CCVV 4UBRA 2ZINA 3V38A 2GANA 4AB7A 3T4DA 1RSOA 1OCOC 4UCSA 3BHXA 2DQ0A 3K79A 2QTSA 5LMUO 1FFXB 3GLJA 3H4QA 3TO7A 2YIBD 2F43G 2QEXV 1JQGA 4M85A 2DW4A 4UCNA 3WR7A 2XEGA 3FB7C 2EILB 1XQ8A 1IBMB 3HB3B 3ABLB 2JIZG 1NVPD 4J80A 1PL0A 4DV4O 1OZPA 5DEDA 5KHIA 2PY5A 3BJ8A 4UIBA 3N2KA 4QUSA 2FIWA 5KLVH 4RAIA 2DMXA 5J2TB 2UU9O 2WYRA 3S6HA 4UFWA 4P4EA 4CS3A 2ZEMA 2EK8A 2FXFA 1VQKV 4H0LB 1YX0A 1ORQC 1MOFA 1Z2GA 5EYPA 4LQGA 4F0YA 4U7NA 4NTWA 2MW2B 4CZZA 2ZENA 3BLNA 4JGSA 3JYCA 2NMTA 3S3XA 4YY3B 1Q81W 5JPHA 1X10A 1Q7YW 4BR6A 4M6IA 1N71A 4LF5B 2JJ2G 2ZNJA 2ZEGA 3K0GA 2XTAA 1M4LA 4LR3A 2QYVA 2Z3MA 1YI2V 3B40A 1QSRA 2IJJA 5AG6A 5LHIA 2QM8A 3CXCU 1RPOA 4R76A 3L72H 4TNUA 1AI6A 4PV1B 5EC2C 1Z8XA 2Y69B 3SYQA 4JTDB 1M4DA 1F51A 1S60A 1U96A 1Q2CA 3MAQA 4MRIA 1CPXA 4FD6A 1YF2A 5IDJA 1B06A 4QB9A 5DWMA 4MI4A 2IM9A 2K1EA 5IYCO 5LYFA 2UUAB 4TT3G 3BVOA 2GV9A 3CWBH 1MJAA 3EVKA 3RN4A 1AJNA 1CG2A 1F57A 1YJNV 1FNOA 3OR6C 4KOXA 1S76D 4CGOA 3F5BA 4L8AA 5EIBD 4I0XA 4X2TA 4TSFG 4AQYO 3J7AU 3FF3A 2EILC 3ZHTA 4JV5O 1URFA 3ABLC 1ZUQA 4Q7AA 4YFJA 2IMOA 2X6BA 3D36C 3PBEA 1CX8A 4CYOA 4H37A 1ZLIA 1BGYH 2BUEA 1TVKA 2NNUA 3OEEG 4KVME 4YHHO 1Y7RA 2OH1A 3K59A 4MTFA 2A4NA 3ZMUA 4U9ZA 4CRZB 3B77A 5IYBO 3OE7G 4J7JA 1PM9A 2H3OA 4I4TA 1GM8A 3RYHB 2GREA 2Y0MA 4Q38A 3R9FA 1JR9A 5EMIA 1SA0A 2EZPA 3TXQA 4DR4B 1BE3H 2OZUA 4B11A 2C2AA 2OU2A 4IYIA 4JYYA 5LHGA 5F49A 2P0WA 4FD4A 3HR0A 2F66C 1VQMV 1GH6A 3DR6A 1Y76A 2ZOGA 1Y7EA 4OX9B 2LFRA 4KHPB 3SDLA 3S3WA 1MA1A 4KORA 1IB1E 5JQGA 5B3SB 3B35A 4FFKA 1S72V 4YXWG 3E8FA 1B6BA 2CXAA 4OC4A 2Y0IA 2XUMA 2X6CA 3KR4A 3JD1A 1XMBA 2I00A 2PIYA 4X20A 2D2CB 2FE7A 5IB9A 3ZRVA 5B1NA 1JX9A 4F4LA 2O28A 1VQ9V 4PA9A 2WAMA 1P0HA 1LFWA 1ZAUA 3ZRWB 3FIXA 2VQFB 2R70A 4JI5B 4K30A 3IAYA 4MSWC 1N36O 3RYIA 1AUGA 2VL1A 3IEHA 1MMMA 4JXQA 7CPAA 4ZI6A 2PR1A 3T1YB 4KSIA 2RC4A 4WBNB 3CC4V 3A9LA 2VQYA 5EZYA 4OPHA 2ZW6A 1FXKB 4D7SA 3ML0A 1IVSA 1L0CA 2PYLA 1LRZA 2HB6A 4XNHC 4U3FH 3WB0A 5B1OA 2LQTA 4MCQA 1IX9A 4JI2B 2YI8A 3IWGA 4DUZB 1XMOB 4PD4F 2H94A 1MSWD 1P4RA 1Y4MA 4DV7O 5G22A 4KOSA 3BI1A 3JAWB 2C27A 3SPHA 3J80N 2P6FA 5KHHA 2O53A 4O2AA 4EFDA 1CBXA 2EIKB 1W59A 1K4CC 2F1MA 2P22C 1Y0RA 3RO0A 3S9NA 1GRJA 4MY3A 4YJ3A 2ZIOA 6CPAA 1AR4A 4RUEA 4UVCA 4IYHA 4DR5B 2BEIA 4IUSA 4JZ2A 1HNWO 1PYTB 3ABTA 2QM7A 4LF8B 2WPDG 1ZG9A 1GHEA 1THZA 4GZRB 5DECA 2QWNB 1H8LA 4BIZA 5HFMA 5F09A 3KCXA 1HDJA 3CXHF 4ZHQB 1GK9A 1OCCC 2ITCC 4OPAA 1EN4A 5DWNA 2E75B 4UVBA 4H89A 4AVCA 4CGLA 4XPLA 3OR7C 2JS3A 1B3QA 3SXOA 3JALB 4RO2A 4UB6Z 5IV0A 1P7BA 3EY5A 3AK3A 3HKCA 3JATB 2ITDC 4B7KA 4CH6A 3MRUA 1Q6HA 2CAZC 4WFHA 3EFAA 3GKRA 1B6QA 4GKKO 4GLXA 1IURA 1XILA 4I49A 4JZGA 3IU2A 3HKBA 2B5GB 2GU2A 4C7IA 2ZPAA 5ISVA 4CH5A 1FXKC 2LFSA 2PJCA 4N21A 3ISZA 4NGNA 2GFQA 5HH1A 2Q7GA 3TX8A 2OCHA 3JASA 4NXNO 3QVNA 4PI2A 1VMGA 1MZFA 2JBJA 3R66A 2YNDA 1BT8A 2Z0AA 1OJHA 2JDDA 2BSWA 1K5SA 3AG2B 3OTOB 2J8NA 2AHZA 2RMKB 2ZEEA 4JLYA 4JI8O 2CH7B 3FECA 2PDOA 2EIKC 3L2NA 5DN6G 1Y74B 4XPDB 4O4LB 4B3SB 4B13A 3GUXA 4EB6B 2PI5A 1AJPA 3N27A 4PSWA 4F8ZA 4X62B 3TETA 3TCVA 3CRMA 4LP8A 2N05A 1TF9A 4O4IB 4FLXA 3ZCCA 3SJXA 1I12A 3SYCA 8CPAA 1Q7LA 1NJIW 4ZOLA 5IYDO 3NE8A 4B3TO 4JZ0A 1KKCA 2C6PA 5LYJB 2XASA 5E79Z 4LF9O 2DXQA 1S0VA 2AFWA 4PELA 4P4BA 4OKOA 2IW5A 3LACA 4E8OA 2IJZA 4HKFA 1IOIA 1L1FA 1F2PA 4RQFA 3LD2A 3EXNA 1Q82W 3K9UA 4CH3A 5GTIZ 1Q6UA 1K4DC 4LWSB 1A2ZA 4DV4B 1XNQB 3B8NA 1IBKB 4MHZA 4BINA 2UUCB 2IU3A 4LH6A 3D7DA 1IDSA 3NXSA 4TV8B 1GTOA 2UU9B 4OIDA 4Z1VA 1BLLE 3WFVA 2IJIA 4UA3A 3N2GA 4JI1O 4MBUA 3SYPA 4CC6A 3ZHRA 4JYWA 1XIXA 1QVFU 2C6GA 2QTOA 2CGOA 1SKVA 2WSSG 5GTHZ 1HNZB 3GY9A 1JA8A 5B5EZ 2BCOA 5C82A 1I5YA 1OHHG 3F7VC 4X89A 2J8RA 2CNTA 1JCHA 5BMVA 4PXDA 3KHZA 3AG2C 4MFLA 5LGTA 4X8IA 1MZEA 3KASA 4XPDC 1AI7A 4FJCC 5KTCA 4X64O 3W6XA 3CXQA 1A32A 2WA3A 3FEEA 2EBJA 5C93A 4MVSA 3ZHSA 4J42A 4UCOA 5LYIA 4QJFB 3F5TA 2LP7A 1YSJA 1LR1A 3SYAA 4DR1O 1Z5RA 3IO1A 4OGQB 1P4NA 1S3ZA 2PVWA 4UCPA 1J4JA 1Y9WA 2ZEFA 1ZLHA 4KUMA 4FZ0A 2FVGA 1VIXA 4RWUA 1K92A 3VWEA 5LA6B 5AG5A 4A32A 4K0KO 3NA6A 1V0CA 4UV8A 4J7ZA 4UEEA 4QBJA 5LRKA 4JV5B 2HVJC 1CXZB 2HFEC 3BCCH 1QNMA 4FUUA 2E3CA 4X1YA 1IICA 5JVDB 4HBNA 2KG7B 2B4DB 4UB8Z 3APQA 4HNWB 2QWPB 1K5QA 3FFQA 4TOIA 2AGAA 1HNXO 2EJRA 1U97A 2W6IG 3ABUA 4BAYA 1P7GA 4GYCB 2PUSA 3K03A 3B3TA 1TUBB 2RCVA 3T8WA 4TUYB 1PP9H 4R87A 3SPGA 5D5QA 2Q04A 4NGTA 1H2MA 3EO4A 3D36A 3T2MA 2CDYA 1YTFD 4LNUA 3B3CA 3A8TA 4CC5A 4F9VA 3D3IA 1ZL8B 3CX5F 4JI3B 5KUMA 4Q36A 4CAVA 3QO8A 2HLDG 3NR7A 3MD0A 3VQXA 2AJ6A 4KFMA 2IQ6A 1PU9A 1KUVA 2P6EA 1TUEB 1WPXA 1Z4RA 4EMEA 4MHPA 3MHHC 5HMNA 3SI2A 4F0XA 5LHHA 1KWMA 3PEIA 3H01A 1TGOA 1SQFA 3E22B 3K0DA 4M6GA 3F7YC 3FX7A 4JI4O 4NTXA 3ZHVA 3FAVA 2O4HA 1FFTB 3FYIB 4ZIBA 3CJHB 3TC8A 3ZRXA 3IFXA 4FM0A 1COWG 5KX5B 3ZEDA 1CP6A 4DR2O 2WUUA 1YREA 4MCPA 1XHXA 2ZR2A 4P2ZA 4KVOE 1PCAA 4WF9V 3WABA 3RBZA 1KBHA 1FKAO 3KR5A 1ZG8A 1SC5B 2D4PA 3PB4X 4P10A 2IBZH 5HXDA 5D29A 3SJAC 4CYNA 3LNNA 3W7SA 2DYRB 2ZOFA 2UUBO 2DPSA 1KYOF 5AG4A 4FMTA 4IT5A 4CPAA 1XL4A 2YI9A 2HEPA 3RWRD 1Y67A 4UCRA 3K5OA 1N33B 4J41A 4IIJB 5L3DA 3SI1A 2YXYA 4NF1A 4D7TA 4DYOA 2FT0A 2QVPA 3D3SA 1YVKA 4MY0A 5IE9A 4E2AA 2R9IA 4WFGA 3T1HO 2EULA 4A33A 2GSMB 1JJ2U 1WAZA 2YICA 1YVWA 4Q20A 1IZ3A 2P67A 4A95A 2CE4A 2F23A 5BR8O 1ZO0A 1F4NA 4CH4A 4AHCA 4AILC 3KKWA 3OM3B 2L35A 4KLVA 4FFBB 3F8KA 1HNWB 1V55B 2OWOA 5DM6V 5CA0B 2ZM6O 3DC5A 1MSDA 4AI8A 2ZCEA 4FLWA 1GN2A 4JTCB 4H6ZA 3AG7A 3VQWA 4UFXA 3K06A 5KMGA 4HNYB 1FJGB 4DUKA 3V7ZA 2W6JG 1YZBA 4B5PB 1CPYA 2AHYA 3OUSA 1RFYA 2C6CA 3K3WA 2P6GA 2Q4ZA 3Q4HB 3R95A 1I5XA 3JTKA 2WPWA 1CEZA 1V54B 1W0KG 1M9NA 4ZBMA 1XFOA 4L89A 3QO5A 1S7FA 3CEIA 3TXSA 4MFKA 4UUJC 1R73A 4OC5A 5J8FA 3E0KA 5IB0A 5H6RA 3ZRWA 4B10A 1Z9UA 4UWIA 4QE9A 1I94O 2EBOA 3JSLA 4AG9A 5H86A 2BTQB 1QLNA 2QJ1A 1G4YB 5AGEA 5KA5A 1HW7A 3TGUH 4WBNA 1G8MA 2CTBA 4NGSA 4Z65A 3S9LA 2Q68A 1I21A 2YEVB 1FXKA 3QTCA 3IGRA 2CTPA 4UIAA 1JFFA 2XOKG 3L71H 4GUNA 5IJ0A 4BIUA 2LW7A 4HNXB 3KGQA 5IYZB 1S3JA 1Z8WA 3RT3C 5JJNB 3FB3A 1RXTA 2G0BA 2GTAA 3ASOB 4FM2A 4OXSA 1NSAA 3A2FA 3VOUA 2AW9A 3K08A 4GX5A 4LQ6A 5CMUA 4FAIA 3SJBC 1M5IA 1V55C 3JAWA 5FL7G 4ZGYB 2JGUA 2GTSA 2Y48A 5GONA 2ZKOA 2WLLB 4TWEA 5KTAA 1HWYA 2ZXWC 4NYKA 4FPPA 3A0HZ 4H33A 4B3TB 2J8MA 2QWRB 4E4EA 3K9TA 1XNRB 2CIJA 4YWYA 3UY5A 3JUWA 3VATA 4LFCO 1HDQA 3DXRA 2VWJA 3F0AA 3CC2V 2PIZA 2RJZA 5L3EA 4B6ZA 1Z5WA 1XBLA 1ZX3A 2DE0X 1PL4A 1V54C 3MDSA 4ZHQA 2LO1A 5LXTB 4U9YA 2CY2A 4X1KA 3CHXA 4O4HA 1S5HC 2O57A 5JH7A 1IU8A 1VKCA 1NR7A 2KKWA 3HLPA 1EZJA 3JATA 5GW7A 1VGYA 4OAEA 4MHDA 4X66O 2DWEC 4LFAO 4II9A 3DSQA 2V4DA 1S5LZ 1YITV 4LF4O 1BQZA 4JI1B 4MFQA 2NR5A 3C90A 3ZHUA 2WWWA 1R3KC 2ZEOA 1QQCA 4BWAA 3FYNA 1DGSA 2ADPA 3P30A 1S77D 2XEJA 4HZ3A 1VQ7V 4NXYA 1LANA 2ZD9A 1R1BA 4FBEA 4X3RA 4W4LA 3VWDA 2QMLA 5H9CA 4NTYA 3K5MA 3L74H 1VHSA 4NVPA 1UFHA 4OIWA 1FS0G 3ASOC 4I55A 3TO9A 2RN9A 2WLIB 2CGNA 3KI9A 4X64B 4MFPA 4X88A 4D6TH 4ZI7A 2WZNA 3PBBA 3DC6A 2ZDIC 2I79A 2OT5A 2Q43A 4OC2A 3RYCB 2GUZA 2YXLA 1J95A 1N34O 2CH7A 1WP7A 2P6JA 3W7XA 2V8DA 3RYOA 4DR6O 4I9WA 4LCUC 4TV9B 5ELYA 1KECA 4O4LA 1XUQA 4U5YA 5LRGA 2BSKA 5LP6B 1AYEA 4X1IA 3UM7A 5HVGA 4YU9A 1AMPA 4PXCA 2HV2A 4K0KB 4O2BB 1H2LA 3QB8A 2BE3A 2PRQA 4NR1A 1R3IC 2PSWA 2DQ3A 2AFZA 4MVUA 4RS2A 1YHQV 3CSXA 4MHYA 4QE7A 3CRAA 4OADA 3B3VA 4JAAA 4ORFA 4UV9A 2NN4A 5H84A 3PP9A 2IJKA 1Y9KA 3SJFA 5AG2A 3SXNA 1MK4A 3OEHG 2HHHO 4X8AA 4ZX9A 1NE9A 1HDUA 2YGWA 3CCEV 3SJEA 1VEWA 3CC7V 2EVNA 1SZXA 3FB8C 2Y0PA 4HNAB 4B7EA 3LSSA 2B3UA 4YIOA 4GKJO 1FD9A 2PJ8A 1YW6A 1BMFG 3CCLV 2H5MA 3DNSA 3FVLA 1OV9A 2Z5UA 1Y66A 2V7QG 1KMIZ 1PKXA 2QGNA 4YJ2B 4F6EA 1XMQO 3APOA 4EFEA 1I08A 4MCSA 5FPOA 2Y69C 1LOKA 2C1CA 2D3OW 1QR9A 2LGWA 4G2KA 3ETDA 4WFEA 4XDJA 1OBRA 4JI4B 1XEQA 3CPAA 4CAXA 5KTDA 2NYQA 1NR1A 3C3TA 5BZBA 2YS8A 4MTXA 3CPWU 3UKMA 1JPXA 4JI6O 4IHJA 1YXBA 2AZ0A 2OOTA 4DR2B 3SJGA 3TFYA 3IGAC 2IU0A 5EC1C 3RGBA 2L6LA 4TQDA 4YIPA 1F2OA 4G1PA 3ZJ0A 2GBOA 5F48A 1GYTA 1YLOA 1N0JA 4MTGA 2BOCC 3JD4A 3DLJA 3CYOA 2Q69A 3OGIB 3MHSC 1PUAA 1YLEA 3K9AA 2ILMA 1NBMG 1Q90D 2W0XA 3SI0A 2NLJC 4KXRA 3SR2C 2Y4UA 4F6RA 3D66A 5B1AB 3N7ZA 2FKXA 2UXCO 4GM5A 2BOBC 1YVOA 4W9YA 5EBWC 3G80A 3K5LA 1TKFA 4KUAA 3ZZIA 3GVMA 2DEAA 5JVDA 1VQ8V 3ZN0A 2EWBA 1WP8A 2KG7A 2B4DA 1DF4A 2OTJV 1AVMA 2PJBA 4K8ZA 1XF8A
chains in the Genus database with same CATH topology
3GY9A 4A2ZA 3CXSA 5C82A 2Z0ZA 2J8RA 2CNTA 4MFLA 2R8VA 4B14A 2Z3OA 3R96A 5A28A 4XPDC 2FL4A 4B5OA 1BOBA 4FD7A 4KOWA 2ATRA 5KTCA 4LX9A 3W6XA 1M4GA 3CXQA 1K4JA 4KVXA 4PV6A 4R57A 1S7KA 1P4NA 1S3ZA 5EBVA 4UCPA 1J4JA 3S6FA 1Y9WA 2FCKA 3TT2A 4AG7A 5F46A 1KZFA 2Z3PA 3I3GA 4E0AA 5FVJA 3VWEA 5AG5A 2VZYA 5AG7A 4A32A 1V0CA 3OWCA 4C7HA 2Z11A 3FRMA 3P2FA 4QBJA 1ON0A 2PRBA 4UWJA 2IL4A 1TIQA 1IICA 1CM0A 1M1DA 5C88A 2B4DB 4HNWB 5JQ4A 2ZW4A 2Z10A 3D8PA 5G20A 2R98A 3EC4A 1XE4A 4R87A 4A31A 2Q04A 3EO4A 4M3SA 4XNHB 3PZJA 4C2YA 4KLWA 2WPXA 4ZBGA 2JDCA 4IF5A 4Q36A 3QAHA 4CAVA 5IX3A 2G3TA 1YGHA 1SQHA 3PGPA 2AJ6A 4KZTA 4MFZA 4PSXA 3TOBA 1PU9A 4Y49B 1KUVA 2P6EA 1Z4RA 2Q4VA 2ZW5A 5HMNA 3V8IA 4F0XA 4R3KA 3C26A 3IWEA 2Q44A 4R9MA 3T90A 4PK2A 4CYPA 4DNCA 1Q2DA 4J3GA 4OLLA 1IYLA 3TO6A 4AVBA 2D4OA 4UBRA 2KCWA 2GANA 3BJ7A 4AB7A 2WUUA 1YREA 4X5KA 1IYKA 3TO7A 3H4QA 4M85A 4A30A 4KVOE 3R1KA 4UCNA 4MFJA 3WR7A 2FSRA 2D4PA 4YGOA 4CGPA 1B87A 4CYNA 4KOYA 2DPSA 5AG4A 1OZPA 3BJ8A 4QUSA 1QSOA 2FIWA 2B4BA 3S6HA 4UFWA 4NF1A 4NEXA 3W91A 2Z3NA 2FXFA 1YX0A 3DDDA 2FT0A 3D3SA 4MY0A 1YVKA 4F0YA 4E2AA 2OB0A 1YK3A 4CRYB 4A33A 2OZHA 3BLNA 4GS4A 2NMTA 4QC6A 4A95A 5JPHA 1ZO0A 2REEA 1N71A 2VBQA 4R3LA 3I9SA 3KKWA 3LODA 1NSLA 2Z3MA 4FD5A 1QSRA 4KLVA 3F8KA 5AG6A 1NMTA 2GE3A 1M4DA 4H6ZA 1CJWA 4UFXA 1S60A 1Q2CA 4HNYB 3P2HA 4FD6A 4QB9A 5DWMA 4MI4A 4B5PB 3FBUA 1MJAA 2P6GA 4KOXA 2Q4YA 3R95A 4CGOA 3JTKA 2WPWA 3F5BA 4L8AA 2QECA 4KS9A 2F5IA 4L89A 2K5TA 1S7FA 4KSFA 4H6UA 4MFKA 4MJ8A 4YFJA 5J8FA 3E0KA 5IB0A 4CYOA 4B10A 1Z9UA 4UWIA 3TOAA 2BUEA 2BL1A 4AG9A 4KVME 5H86A 3G8WA 1Y7RA 4UCMA 2OH1A 5G1ZA 4CGNA 1S7NA 2YNCA 2A4NA 5AGEA 3TTHA 2ZXVA 4U9ZA 4CRZB 2FS5A 1QSTA 1I21A 1RO5A 2WSAA 3IGRA 3S6GA 1FY7A 2Y0MA 4Q38A 3R9FA 4HNXB 2OZUA 3D2MA 4B11A 2OU2A 1KUYA 3FB3A 1RXTA 2G0BA 5F49A 2YNEA 5A27A 2P0WA 4FD4A 3CXPA 3G3SA 3DR6A 5EC4A 1S5KA 2QIRA 4ZGYB 3TE4A 4KORA 3B8GA 2HQYA 1IB1E 5KTAA 5BWAB 3IU1A 2EUIA 1B6BA 2CXAA 2J8MA 4RI1A 1MJ9A 2OZGA 3JVNA 4LUAA 3UY5A 2I00A 3JUWA 1Q2YA 2AE6A 2FE7A 4C2XA 4B5PA 1YR0A 3F0AA 2O28A 1P0HA 1IIDA 3FIXA 4U9YA 1XMTA 2CY2A 4K30A 1WWZA 4CYQA 2Z3KA 4JXQA 1VKCA 2PR1A 2RC4A 4OAEA 3A9LA 4MHDA 4C68A 2VQYA 2ZW6A 4II9A 1L0CA 1LRZA 4XNHC 5CNPA 4MFQA 2DPTA 3IWGA 4QVTA 4UFVA 2PR8A 2VI7A 3FYNA 2Q7BA 5F47A 1M4IA 1U6MA 2VXKA 5G22A 4NXYA 4Y49C 2FIAA 4KOSA 4CS0B 3VWDA 2QMLA 2C27A 2P6FA 5I0CA 1QSNA 1VHSA 1UFHA 2VZZA 3T9YA 2CNMA 3TO9A 3GYAA 4MFPA 4MY3A 3H5ZA 2VEZA 2ARHA 2I79A 3DR8A 2BEIA 4IUSA 4KOUA 3RYOA 4CAEA 1GHEA 1I1DA 2JEVA 4U5YA 4C2ZA 1MJBA 5DWNA 2HV2A 4H89A 4AVCA 4CGLA 4XPLA 3SHPA 3QB8A 3SXOA 4YRHA 5IV0A 2PSWA 4JD6A 3EY5A 3W6SA 4RS2A 3EFAA 4JWPA 2ZW7A 3GKRA 4OADA 2HUZA 4I49A 1Z4EA 3IU2A 2YNCC 4ORFA 2B5GB 4EVYA 4C7IA 2ZPAA 4F6AA 5H84A 3PP9A 5ISVA 1Y9KA 2Z3LA 5J8CA 3SXNA 1MK4A 2PQ8A 4KOVA 1NE9A 5HH1A 2YGWA 2EVNA 3NE7A 2R1IA 4ONUA 2B3UA 1XEBA 1S7LA 2YNDA 2H5MA 2JDDA 3DNSA 2BSWA 4KOTA 2J8NA 4XPKA 2R7HA 4JLYA 2X7BA 3FXTA 2PDOA 4XPDB 4AVAA 4B13A 3R9GA 5GCNA 4PSWA 1WK4A 4B12A 4NCZA 3TCVA 4CAXA 5KTDA 5E96A 2Q0YA 4KUBA 2PC1A 3FNCA 3MGDA 3S6KA 1I12A 4BBHA 3TFYA 4KSAA 3DSBA 1QSMA 2DXQA 4E8OA 4PK3A 3ZJ0A 4HKFA 5F48A 2GIVA 5G21A 2REFA 3D2PA 3LD2A 2G3AA 1BO4A 3EXNA 4JXRA 3K9UA 1R57A 1PUAA 1M44A 1YLEA 4CAWA 2B58A 1KUXA 3N7ZA 4BMHA 1YVOA 4NSQA 3ZZIA 4KUAA 2B5GA 2CNSA 4CGMA 2JLMA 2B3VA 3R9EA 2B4DA 4CAFA 4UA3A 4MBUA 1XIXA 4JJXA 1XF8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GY9 A;  3CXS A;  5C82 A;  2Z0Z A;  2J8R A;  2CNT A;  2R8V A;  3R96 A;  4XPD C;  2FL4 A;  4B5O A;  1BOB A;  4FD7 A;  4KOW A;  2ATR A;  5KTC A;  4LX9 A;  3W6X A;  1M4G A;  3CXQ A;  1K4J A;  4KVX A;  4PV6 A;  4R57 A;  1S7K A;  1P4N A;  1S3Z A;  5EBV A;  1J4J A;  3S6F A;  1Y9W A;  2FCK A;  3TT2 A;  4AG7 A;  5F46 A;  1KZF A;  3I3G A;  4E0A A;  5FVJ A;  3VWE A;  2VZY A;  1V0C A;  3OWC A;  2Z11 A;  3FRM A;  3P2F A;  4QBJ A;  1ON0 A;  2PRB A;  4UWJ A;  2IL4 A;  1TIQ A;  1IIC A;  1CM0 A;  1M1D A;  5C88 A;  2B4D B;  4HNW B;  5JQ4 A;  2ZW4 A;  2Z10 A;  3D8P A;  2R98 A;  3EC4 A;  1XE4 A;  4R87 A;  2Q04 A;  3EO4 A;  4M3S A;  4XNH B;  3PZJ A;  4KLW A;  2WPX A;  4ZBG A;  2JDC A;  4IF5 A;  3QAH A;  4CAV A;  5IX3 A;  2G3T A;  1YGH A;  1SQH A;  3PGP A;  2AJ6 A;  4KZT A;  4PSX A;  3TOB A;  1PU9 A;  4Y49 B;  1KUV A;  2P6E A;  1Z4R A;  2Q4V A;  2ZW5 A;  5HMN A;  3V8I A;  4R3K A;  3C26 A;  2Q44 A;  4R9M A;  3T90 A;  4PK2 A;  4DNC A;  1Q2D A;  4J3G A;  4OLL A;  1IYL A;  3TO6 A;  4AVB A;  2D4O A;  4UBR A;  2KCW A;  2GAN A;  3BJ7 A;  4AB7 A;  1YRE A;  4X5K A;  1IYK A;  3TO7 A;  3H4Q A;  4M85 A;  4KVO E;  3R1K A;  3WR7 A;  2FSR A;  2D4P A;  4YGO A;  1B87 A;  4KOY A;  1OZP A;  3BJ8 A;  4QUS A;  1QSO A;  2FIW A;  2B4B A;  3S6H A;  4NF1 A;  4NEX A;  3W91 A;  2FXF A;  1YX0 A;  3DDD A;  2FT0 A;  3D3S A;  4MY0 A;  1YVK A;  4F0Y A;  4E2A A;  2OB0 A;  1YK3 A;  4CRY B;  2OZH A;  3BLN A;  4GS4 A;  2NMT A;  4QC6 A;  5JPH A;  2REE A;  1N71 A;  2VBQ A;  4R3L A;  3I9S A;  3KKW A;  3LOD A;  1NSL A;  4FD5 A;  1QSR A;  4KLV A;  3F8K A;  1NMT A;  2GE3 A;  1M4D A;  4H6Z A;  1CJW A;  1S60 A;  1Q2C A;  4HNY B;  3P2H A;  4FD6 A;  4QB9 A;  5DWM A;  4MI4 A;  4B5P B;  3FBU A;  1MJA A;  2P6G A;  4KOX A;  2Q4Y A;  3R95 A;  2WPW A;  3F5B A;  4L8A A;  2QEC A;  2F5I A;  4L89 A;  2K5T A;  1S7F A;  4H6U A;  4MJ8 A;  4YFJ A;  5J8F A;  3E0K A;  5IB0 A;  1Z9U A;  4UWI A;  3TOA A;  2BUE A;  2BL1 A;  4AG9 A;  4KVM E;  5H86 A;  3G8W A;  1Y7R A;  2OH1 A;  1S7N A;  2A4N A;  3TTH A;  2ZXV A;  4U9Z A;  4CRZ B;  2FS5 A;  1QST A;  1I21 A;  1RO5 A;  3IGR A;  3S6G A;  1FY7 A;  2Y0M A;  3R9F A;  4HNX B;  2OZU A;  3D2M A;  2OU2 A;  1KUY A;  3FB3 A;  1RXT A;  2G0B A;  5F49 A;  2P0W A;  4FD4 A;  3CXP A;  3G3S A;  3DR6 A;  5EC4 A;  1S5K A;  2QIR A;  3TE4 A;  4KOR A;  3B8G A;  2HQY A;  1IB1 E;  5KTA A;  2EUI A;  1B6B A;  4RI1 A;  2J8M A;  1MJ9 A;  2OZG A;  3JVN A;  4LUA A;  3UY5 A;  2I00 A;  3JUW A;  1Q2Y A;  2AE6 A;  2FE7 A;  4B5P A;  1YR0 A;  3F0A A;  2O28 A;  1P0H A;  1IID A;  3FIX A;  4U9Y A;  1XMT A;  2CY2 A;  1XF8 A;  1WWZ A;  4JXQ A;  1VKC A;  2PR1 A;  2RC4 A;  4OAE A;  4MHD A;  2VQY A;  2ZW6 A;  4II9 A;  1L0C A;  1LRZ A;  4XNH C;  5CNP A;  3IWG A;  4QVT A;  2PR8 A;  2VI7 A;  3FYN A;  2Q7B A;  5F47 A;  1M4I A;  1U6M A;  2VXK A;  4NXY A;  4Y49 C;  2FIA A;  4KOS A;  4CS0 B;  3VWD A;  2QML A;  2C27 A;  2P6F A;  5I0C A;  1QSN A;  1VHS A;  1UFH A;  2VZZ A;  3T9Y A;  2CNM A;  3TO9 A;  3GYA A;  4MY3 A;  2VEZ A;  2ARH A;  2I79 A;  3DR8 A;  2BEI A;  4IUS A;  4KOU A;  3RYO A;  1GHE A;  1I1D A;  2JEV A;  4U5Y A;  1MJB A;  5DWN A;  2HV2 A;  4H89 A;  4AVC A;  4XPL A;  3SHP A;  3QB8 A;  3SXO A;  4YRH A;  5IV0 A;  2PSW A;  4JD6 A;  3EY5 A;  3W6S A;  4RS2 A;  3EFA A;  4JWP A;  2ZW7 A;  3GKR A;  4OAD A;  2HUZ A;  4I49 A;  1Z4E A;  4ORF A;  2B5G B;  4EVY A;  2ZPA A;  4F6A A;  5H84 A;  3PP9 A;  5ISV A;  1Y9K A;  5J8C A;  3SXN A;  1MK4 A;  2PQ8 A;  4KOV A;  1NE9 A;  5HH1 A;  2EVN A;  3NE7 A;  2R1I A;  4ONU A;  2B3U A;  1XEB A;  1S7L A;  2H5M A;  2JDD A;  3DNS A;  2BSW A;  4KOT A;  2J8N A;  4XPK A;  2R7H A;  4JLY A;  2X7B A;  3FXT A;  2PDO A;  4XPD B;  4AVA A;  3R9G A;  5GCN A;  4PSW A;  1WK4 A;  4NCZ A;  3TCV A;  4CAX A;  5KTD A;  5E96 A;  2Q0Y A;  4KUB A;  2PC1 A;  3FNC A;  3MGD A;  3S6K A;  1I12 A;  3TFY A;  3DSB A;  1QSM A;  2DXQ A;  4E8O A;  4PK3 A;  3ZJ0 A;  4HKF A;  5F48 A;  2GIV A;  2REF A;  3D2P A;  3LD2 A;  2G3A A;  1BO4 A;  3EXN A;  4JXR A;  3K9U A;  1R57 A;  1PUA A;  1M44 A;  1YLE A;  4CAW A;  2B58 A;  1KUX A;  3N7Z A;  4BMH A;  1YVO A;  4NSQ A;  3ZZI A;  4KUA A;  2B5G A;  2CNS A;  2JLM A;  2B3V A;  3R9E A;  2B4D A;  4UA3 A;  4MBU A;  1XIX A;  4JJX A;  4K30 A; 
#chains in the Genus database with same CATH topology
 3STZ C;  4JI7 B;  3KZW A;  1M56 B;  1K7D A;  3IC7 A;  1GN6 A;  4J7K A;  2R8V A;  4L87 A;  3E35 A;  2VQE B;  5LMN B;  3RBU A;  4B3M B;  2OIE A;  1ZL8 A;  4B3R B;  1JQ0 A;  2YIA A;  4R50 A;  4HAM A;  1V9P A;  3TCU A;  1BOB A;  4KP4 A;  4FD7 A;  2OR4 A;  3ICX A;  5B3S C;  2EIJ B;  3W7W A;  3CB2 A;  2V8V A;  4WCE V;  3FX6 A;  1FPO A;  4A94 A;  4DUY O;  2P90 A;  4KVX A;  3SJQ C;  1RSO B;  4ABM A;  2CTC A;  3S6F A;  2ZNI A;  2Q51 A;  3ZX6 A;  3WT4 A;  2KB1 A;  2HG5 C;  3TT2 A;  4AG7 A;  5F46 A;  1KZF A;  2E76 B;  4NGP A;  5FVJ A;  4ZY0 A;  1R43 A;  5LGU A;  2Y4T A;  2PJ2 A;  3OWC A;  1CP9 A;  1KU9 A;  2W0F C;  3JAK B;  2Z11 A;  3FRM A;  3HKE B;  4QIW F;  3OUF A;  4UWJ A;  2OTL V;  1VF6 C;  4JYB A;  1TIQ A;  2B5U A;  3FKS G;  1LUV A;  1QQ9 A;  2P4V A;  1M1D A;  2ZW4 A;  3N2K B;  4EEQ A;  3SPC A;  1BQ0 A;  2Q7H A;  1AB3 A;  2RB7 A;  3D67 A;  2YC0 A;  2GLF A;  3EC4 A;  3KQX A;  3E89 A;  3UO3 A;  5A9G A;  4A5U B;  1TKH A;  1ROP A;  1BS3 A;  1SQX H;  1IBL B;  2Q67 A;  2EO8 A;  4KLW A;  5J2U A;  2JDC A;  1NH2 D;  4IF5 A;  1N32 O;  2PCU A;  1M56 C;  3F5W C;  1YJ9 V;  2Q7S A;  4O4J A;  1VQ4 V;  4LFB O;  1SQH A;  3PGP A;  2JEW A;  3ETE A;  4DR3 O;  3MN8 A;  3X2Q B;  4Y49 B;  5CA1 A;  1WLE A;  4JI0 O;  1K3E A;  5JCO C;  4JTA B;  1GN4 A;  2EIJ C;  1LUW A;  3E2E A;  2Q44 A;  4FLZ A;  1SQG A;  1R3J C;  4DNC A;  1VQ6 V;  3TO6 A;  4AVB A;  1AP6 A;  5LMU B;  1MAB G;  4RN7 A;  1PV0 A;  3NH5 A;  4FFB A;  2R9R B;  1F4M A;  2EIN B;  2V8G A;  1Q6I A;  4X5K A;  1IYK A;  1DE4 C;  1ZG7 A;  2YSU B;  1K33 A;  2YXH A;  2ZED A;  4UCV A;  3CS5 A;  3HKD A;  5THW A;  1Z8T A;  4FIP C;  3DGV A;  3R1K A;  5C8Y A;  1KUQ A;  4YGO A;  3OT7 A;  3SPJ A;  3VQY A;  3B3W A;  3G71 V;  3IWW A;  3Q4H A;  1HR0 O;  3ISX A;  2ZE6 A;  3AK1 A;  4KOY A;  4P9P A;  1I7F A;  1VQN V;  4PA4 A;  1PD3 A;  3LSU A;  4P4I A;  1DK1 A;  3DGE A;  1M57 B;  2DOS A;  2AXT Z;  4NEX A;  4I5S A;  3W91 A;  4I4T B;  3JRU A;  2QM4 A;  5EBM C;  2XND G;  3DDD A;  1BHA A;  4P4J A;  1SA0 B;  1YK3 A;  4CRY B;  2OZH A;  3H8E A;  3HUV A;  1AR5 A;  1WA8 B;  2HJD A;  1YIJ V;  2HC9 A;  3J81 N;  3X2Q C;  4R3L A;  2YEV A;  4NGQ A;  2P06 A;  3KL9 A;  3LOD A;  3WC7 A;  1NSL A;  3UO2 A;  4DV1 O;  1N34 B;  3H8G A;  1NMT A;  4A38 A;  4LF5 O;  3H1J H;  2AFO A;  2GE3 A;  2KSD A;  5HVF A;  3T1C A;  5K8P A;  2VRZ A;  1SES A;  1ELM P;  3P32 A;  4R7M A;  1WB7 A;  4JAV A;  4X20 B;  5H5N A;  3OMA B;  2ZDI A;  4K35 A;  3FBU A;  4NKG B;  4AQY B;  1OCZ B;  1Z5V A;  2EIN C;  2WLL A;  3AEI A;  5L3C A;  1AI5 A;  4K8X A;  2RQ6 A;  4ASU G;  4WFB V;  3CZX A;  3LSQ A;  1X12 A;  2HP8 A;  1FFX A;  2Q6A A;  3STL C;  2QEC A;  4KS9 A;  3RYI B;  2UUA O;  1SQQ H;  2F5I A;  4DW0 A;  2K5T A;  3RZA A;  3IJ3 A;  1Q8I A;  4H6U A;  4YHH B;  3CMA V;  3I55 V;  4WFA V;  1FAF A;  1K97 A;  3TOA A;  2HHH B;  2BL1 A;  2WLM A;  1Q86 W;  3THO A;  4NJR A;  1KB9 F;  3A0B Z;  1S7N A;  5J2T A;  1N8R W;  3CE2 A;  2FS5 A;  1QST A;  4DW1 A;  4ZKI A;  4XDK A;  4R8F A;  3PFO A;  3BA9 A;  2JEX A;  2GHY A;  1VIB A;  2QKS A;  3O65 A;  3D2M A;  1KUY A;  1XMQ B;  3D7H A;  2ZR3 A;  1LNQ A;  4YJ3 B;  3CXP A;  3GWO A;  5JJJ B;  3D7G A;  1H2G A;  4NGR A;  3RNZ A;  4GCZ A;  2Q0A A;  1UJW B;  4DR4 O;  1S5K A;  4ZX8 A;  5JH9 A;  3OTF A;  3B8G A;  3RFR A;  3CCM V;  2JBK A;  2HQY A;  2CUG A;  3LWU A;  2OIG A;  4H44 B;  1GN3 A;  2EUI A;  2M6Y A;  2IH3 C;  1MJ9 A;  2JGD B;  5IY5 B;  2F4V O;  4KHP O;  2OZG A;  3JVN A;  4LUA A;  4EKW A;  2QDO A;  5JM6 A;  1GM9 A;  3LMS A;  5HFL A;  1RM1 B;  1YR0 A;  4TV9 A;  2DYS B;  1YCI A;  1N36 B;  3LNM B;  1IID A;  4CS2 A;  1OZ0 A;  5KUK A;  3GB7 C;  1R6N A;  3H9V A;  1XOV A;  4MVR A;  2Z3K A;  2ZEH A;  1M90 W;  1DTD A;  1K34 A;  4NXM O;  1E1Q G;  2OYQ A;  4UXN A;  4JI5 O;  1L0L H;  5L3B A;  4DV7 B;  2DPT A;  2DWD C;  2PTM A;  4JYC A;  1H2K A;  3T1Y O;  4UFV A;  2PR8 A;  3O9O A;  2VI7 A;  2Q7B A;  3FYE B;  5F47 A;  1VHO A;  1U6M A;  2X7R B;  5A2Q N;  3KG2 A;  1NTK H;  3E8H A;  4DUZ O;  2FIA A;  3PFE A;  4GT1 A;  3RYH A;  5I0C A;  3K2K A;  4JYA O;  1Y6X A;  1QSN A;  2VZZ A;  4H13 B;  1LAP A;  1D5A A;  3T9Y A;  4HNA A;  3NH4 A;  3B3S A;  3H5Z A;  5JGF A;  2VEZ A;  2ARH A;  3FB5 C;  3K04 A;  1FYJ A;  1DF5 A;  5B1B B;  2PYJ A;  4MVQ A;  3WG7 B;  1H8H G;  3DTU B;  4KOU A;  1AI4 A;  4Q6G A;  3G67 A;  1YQE A;  4CAE A;  3PJS K;  2RDC A;  2QWQ B;  5FPR A;  4AXV A;  4ZOL B;  4FM1 A;  2A9H A;  2JEV A;  5CA3 A;  3CCS V;  1MJB A;  3M7M X;  4WJB A;  4LF8 O;  1QVG U;  1RM1 C;  4GKK B;  4YRH A;  1CPS A;  2DYS C;  1H8E G;  5K1X A;  4JAS A;  2ZE5 A;  2WLN A;  3B09 A;  1D5N A;  4PA7 A;  1ARL A;  1ZLZ A;  3BA8 A;  2DYR C;  3BAB A;  2ZW7 A;  5K8M A;  5KAF Z;  1SER A;  2PZS A;  1DTO A;  1Z4E A;  2POK A;  2YNC C;  4QPJ A;  5D8N A;  2YDE A;  1RP3 B;  5TIS Z;  4EVY A;  3D7F A;  3GB0 A;  4F6A A;  1PPJ H;  4W4K A;  4FK5 C;  4NXN B;  2EK9 A;  1VF6 A;  3N2G B;  2XEI A;  5IWA O;  2PQ8 A;  1J5E O;  4KOV A;  3ZN1 A;  4P45 A;  3L9D A;  4A37 A;  3JD2 A;  2A3Q A;  2ZIM A;  2BCC H;  3OW2 U;  2F93 B;  2OCC B;  4JI8 B;  1JWQ A;  3CRC A;  1K9M W;  5BMV B;  1S5J A;  1M1K W;  4U7O A;  4LFB B;  2UXN A;  2PI4 A;  2X6A A;  3CPX A;  3FED A;  4ICG A;  4XPK A;  4KL1 A;  2X7B A;  2CTR A;  2EIM B;  3U11 A;  2Z3Y A;  5KHJ A;  5LGN A;  1Z2L A;  4AVA A;  4QPK A;  1GKF A;  1IY7 A;  2JS5 A;  2ANP A;  2PJ4 A;  1NZ6 A;  5B1B C;  3ZHQ A;  3OTO O;  1BPM A;  5GCN A;  4IAV A;  2QKC A;  4NCZ A;  1W2B U;  5ITZ B;  4LF9 B;  4J9Z B;  2FYU H;  1MNG A;  1SRY A;  3GWK C;  2Q0Y A;  4KUB A;  5E96 A;  4Z1M G;  4B3S O;  2PC1 A;  3H1L H;  1YTF B;  3VQV A;  3FNC A;  3MGD A;  3S6K A;  5JCO A;  4PQA A;  5K1P A;  3I56 V;  3QNE A;  4RUF A;  2ABZ A;  3FJU A;  5EK0 A;  1YW4 A;  3DSB A;  4X65 O;  2YUA A;  4I50 B;  5CBF A;  3E8B A;  1TAE A;  2PJ0 A;  1XBU A;  2A79 B;  1MG1 A;  4MMO A;  3D2P A;  3JAL A;  5KHK A;  5J9P C;  4X1Y B;  4QGP A;  4Z2W A;  2ETN A;  1BO4 A;  2G3A A;  1R6T A;  3JCU Z;  4CAW A;  1M44 A;  4ZY1 A;  1HR0 B;  2BO9 A;  1SQB H;  1XJO A;  3JAK A;  2V8H A;  3HKE A;  4C7U A;  3G4S V;  5E1A C;  3ZS8 C;  3CCR V;  2UXX A;  2XAQ A;  3ETQ A;  3OMI B;  4IL6 Z;  3ZRS A;  2B5G A;  1NT2 B;  4CGM A;  1XNQ O;  2JLM A;  2B3V A;  4LNU B;  2LW1 A;  1IBK O;  3R9E A;  4CAF A;  1XRY A;  2UUC O;  5FNV B;  3L75 H;  3JD3 A;  2OCC C;  1WNS A;  1BPN A;  4JJX A;  4PDL A;  3CD6 V;  1NTM H;  4A2Z A;  2WA4 A;  1VF5 B;  2HVK C;  1UWY A;  2Z0Z A;  2UXB O;  4LH7 A;  3QAY A;  2JK5 C;  2EIM C;  1HNZ O;  2H8P C;  3R96 A;  5CB4 B;  3WC6 A;  2FL4 A;  3E83 A;  5LL6 Y;  4DV1 B;  4B5O A;  4DR1 B;  2PJ7 A;  5F2V O;  3JSN A;  1Y74 A;  3FD9 A;  1XL6 A;  1K4J A;  2NSM A;  3FAV B;  4EB6 A;  4FLU A;  3B4S A;  3G6E V;  1BCC H;  2N74 A;  3JAR B;  4PV6 A;  4R57 A;  1S7K A;  4P6Y A;  5EBV A;  1KP3 A;  5IJ9 B;  3P3P A;  4O4I A;  2AFX A;  2FCK A;  1O9G A;  1VF7 A;  4GX0 A;  3FMC A;  3I3G A;  4DRX B;  4E0A A;  4BW5 A;  4QNH B;  1H38 A;  4WFF A;  2VZY A;  5LYJ A;  5AG7 A;  4IHM A;  4C7H A;  1PNM A;  4PHZ A;  1HNX B;  4DV2 O;  3WC5 A;  4PA3 A;  2IL4 A;  2XAJ A;  2AFU A;  2Q4P A;  3WB1 A;  1CM0 A;  5C88 A;  4DV6 O;  3LDC A;  1YJW V;  1H2S B;  1ARO P;  2JEU A;  1WJZ A;  2P5O A;  1JVM A;  2Z10 A;  2B1I A;  4LWS A;  3K9S A;  1R3L C;  4GX2 A;  4U3J B;  4P9O A;  1L0N H;  4EFB A;  2BTO A;  5G20 A;  1YSC A;  2Q8V A;  1K8A W;  2R98 A;  3KHX A;  5CBG A;  4K3N A;  2QKA A;  4DR7 O;  1RPR A;  4TV8 A;  3RYF B;  4A31 A;  4PDV A;  4M3S A;  4XNH B;  3PZJ A;  4C2Y A;  4ZBG A;  2PJ6 A;  1HP8 A;  1PNL A;  4CS4 A;  2F7V A;  3B2Y A;  3CT9 A;  5IX3 A;  2G3T A;  1YGH A;  4PSX A;  3ZJZ A;  2IJH A;  5J1Q A;  3HPL C;  3ABM B;  2PJA A;  2MK3 A;  3A0R A;  4JI3 O;  2Q4V A;  3PB7 X;  2VS0 A;  1PNK A;  3IFE A;  5HVH A;  4I7Z B;  3BXM A;  1WA8 A;  4R9M A;  3T90 A;  5LP6 C;  5KMG B;  4CYP A;  1EZV H;  1Q2D A;  4J3G A;  1IYL A;  2F4V B;  2GDS A;  2D4O A;  2KCW A;  3C3S A;  4LF6 O;  3BJ7 A;  4M6H A;  1ZSP A;  2PJ5 A;  2JJ1 G;  3VAR A;  3PB9 X;  2AZ2 A;  1VQ5 V;  3KCY A;  1F7Y A;  1OCC B;  2HKO A;  2FB5 A;  4G28 B;  5LA6 A;  1G1X B;  1SQV H;  1LCP A;  4A30 A;  2F95 B;  2UUB B;  3E86 A;  2ZE7 A;  3ZBH A;  4PXE A;  1NTZ H;  3H8F A;  4MFJ A;  2XHB A;  2FSR A;  4X9Q A;  5JJE B;  5LOV B;  2CF4 A;  4NXM B;  2XAH A;  4CGP A;  1BSM A;  4FVM A;  1B87 A;  4DO2 A;  4DYL A;  1EFR G;  1JJO A;  4DV3 O;  2RFH A;  2YID A;  5H2F Z;  1QSO A;  3UT5 B;  1EN5 A;  3T1H B;  4RQE A;  2B4B A;  1NI8 A;  1TUB A;  3G6B A;  2Z3N A;  3PRT A;  3VBB A;  4TUY A;  1Q5O A;  4J9Y B;  1JFF B;  5IJ0 B;  5BR8 B;  2OB0 A;  4UVA A;  3D4U A;  3QO7 A;  4GX1 A;  1N33 O;  3H1H H;  1VAR A;  1NVP B;  3M99 B;  4GS4 A;  4QC6 A;  4JYA B;  3PB6 X;  4R6Z A;  2RNB A;  4DV0 O;  2ZM6 B;  2REE A;  3CME V;  2CTW A;  3ABM C;  2VBQ A;  3I9S A;  3BFR A;  4NFR A;  4N23 A;  3BPZ A;  1IOF A;  1YME A;  4I9Q A;  3SYO A;  3KKY A;  3CCQ V;  4FD5 A;  4UCU A;  5GON B;  1Q3E A;  5CBM A;  3EXA A;  1ENV A;  1X4T A;  1QBZ A;  1W0J G;  2UXD O;  4MTO A;  1CJW A;  1WPB A;  3U0Z A;  3E22 A;  4G27 B;  1I0H A;  4HYO A;  1RTQ A;  3P2H A;  5KHG A;  1WN7 A;  1N4C A;  3DXR B;  4XDL A;  2AFS A;  2WLJ A;  1K73 W;  3IJ4 A;  3CJH A;  4HPS A;  3PN1 A;  5KX5 A;  4P4D A;  2Q4Y A;  1SZT A;  2K9P A;  1FJG O;  2JGD A;  2A0L A;  4X1K B;  2EJ7 A;  2ZE8 A;  3LUT B;  4O4H B;  3NFZ A;  2E74 B;  5JH7 B;  1I94 B;  5B1A C;  1EBO A;  3NH8 A;  4KSF A;  3LDD A;  1LAM A;  2ODF A;  2ADQ B;  1VQP V;  4MJ8 A;  4WWV A;  3QF7 A;  4O23 A;  1XDC A;  3S9M A;  1GO3 F;  1G6U A;  1JOY A;  1TXR A;  4A39 A;  4JAU A;  1N0N A;  5EYP B;  4EWT A;  3ZMZ A;  4NB5 A;  4CBC A;  1KKD A;  1HEE A;  5IWA B;  1J5E B;  3D8C A;  4LF7 O;  1YEW A;  4BD9 A;  4DK1 A;  2LGQ A;  3G8W A;  4UCM A;  4CGN A;  5G1Z A;  4DJL A;  4DK0 A;  2YNC A;  4DV5 O;  4IIJ A;  3TTH A;  2ZXV A;  1NKD A;  3FB6 C;  1RO5 A;  3IC9 A;  2WSA A;  1E1R G;  4OP4 A;  3S6G A;  4MVO A;  1BL8 A;  2XAF A;  1FY7 A;  1YDX A;  3BEH A;  4PDR A;  5K8N A;  2Q7E A;  3PB8 X;  4I55 B;  1Y0Y A;  1WB8 A;  2E5L O;  1QU7 A;  2ZEP A;  4ZI7 B;  3OD4 A;  2YNE A;  5A27 A;  2GUZ B;  3G3S A;  5EC4 A;  3K57 A;  2QIR A;  3TE4 A;  1XRE A;  3SGI A;  1XHZ A;  5IT9 N;  1R6K A;  4LFC B;  5CA0 A;  2BSK B;  5BWA B;  4X1I B;  4MVM A;  5LRJ A;  5D5P A;  4JPR A;  1VHE A;  3IU1 A;  4RI1 A;  2R9A A;  1P49 A;  4X65 B;  4I0X B;  5FLX N;  5H6Q A;  1TF8 A;  1Q2Y A;  2AE6 A;  1Z8L A;  5K8O A;  1UFI A;  4F9U A;  4C2X A;  3P3N A;  3QG5 A;  4B5P A;  1O9H A;  4UEF A;  4J11 A;  1XNR O;  2G9D A;  2PJ9 A;  3IIB A;  4J10 A;  3VH9 A;  5I4M A;  3L70 H;  4X66 B;  2QE7 G;  4LFA B;  1XMT A;  1TVK B;  1WWZ A;  4CYQ A;  5CBH A;  1ELL P;  4LF4 B;  1IBM O;  4B08 A;  3WU2 Z;  2A06 H;  4C68 A;  3ABK B;  5CNP A;  2B1G A;  4TWK A;  1ARM A;  2I3C A;  4UF4 A;  1SS3 A;  4QVT A;  2HJF C;  5EIB C;  4GXH A;  4PA6 A;  2BTQ A;  3QNV A;  2R72 A;  1M4I A;  2QR4 A;  2VXK A;  3CP1 A;  2UXB B;  4Y49 C;  1Y76 B;  3L73 H;  3OMN B;  2EZO A;  4CS0 B;  2CTQ A;  4L8J A;  1AP5 A;  4YY3 O;  2CNM A;  2PE3 A;  5JQG B;  3GYA A;  2ZEL A;  5L3G A;  4DR6 B;  5IYZ A;  4OME A;  3IC1 A;  2WLK A;  3JAM N;  3W7U A;  3DR8 A;  4JF3 A;  3ZMT A;  1H2N A;  1VP7 A;  3GIU A;  2CK3 G;  1JMK C;  2QWO B;  2ZQM A;  4IHJ B;  2Q5Z A;  3RVZ A;  1I1D A;  2XEF A;  2ODM A;  1T5E A;  4ZY2 A;  3TJT A;  4C2Z A;  2A7W A;  1AIL A;  3AG3 B;  3SJC C;  3D3Q A;  2AFM A;  1SF9 A;  1XOU A;  1DLB A;  4UFZ A;  5ITZ A;  2BOA A;  3SHP A;  3B8M A;  4JD6 A;  4DV2 B;  2JDI G;  3W6S A;  3B2E E;  5EZY B;  4JWP A;  1P84 F;  4I50 A;  1QMU A;  4F6R B;  4DV6 B;  2HUZ A;  5LXT A;  2B9Z A;  1ZTE A;  2DN9 A;  3AG1 B;  1NU1 H;  1M57 C;  2J9A A;  4LC1 A;  3EHB B;  4DR7 B;  3ABK C;  1BAV A;  2Z3L A;  5J8C A;  2PVV A;  2Q0O C;  4GKJ B;  4MT8 A;  3CRQ A;  3BRC A;  4OC0 A;  1TKJ A;  1QR8 A;  4O2A B;  2M7W A;  3NE7 A;  2R1I A;  4ONU A;  1R3N A;  1XEB A;  5BXZ A;  4MHN A;  1S7L A;  4MCR A;  5BY1 A;  3CRR A;  4KOT A;  5FNV A;  3ZIA G;  3E8G A;  2R7H A;  2FTK A;  2G38 A;  3FXT A;  2V1D A;  1GAX A;  3BI0 A;  3SPI A;  3K58 A;  1KD1 W;  4FLT A;  3WB2 A;  4E2L A;  2XT9 A;  2P4K A;  4K3A A;  2WLI A;  4JI6 B;  1X59 A;  2ZT9 B;  3R9G A;  2GLJ A;  3TK1 A;  1WK4 A;  1CP7 A;  4OX9 O;  1SET A;  4IK2 A;  4B12 A;  3OFN G;  2WLH A;  3RYC A;  3KZI Z;  1VQO V;  4UEZ A;  5CB4 A;  2JRI A;  1OCZ C;  4P30 A;  4DXW A;  4LF6 B;  3HKC B;  3RVY A;  4P4F A;  1NH2 B;  2X0L A;  3AG3 C;  1FXH A;  4BBH A;  4KSA A;  3JCZ A;  1UPG A;  1QSM A;  3I5D A;  5LP6 A;  5CPA A;  5KAI Z;  3AG4 B;  3H1K H;  4PK3 A;  3JAR A;  4ZYQ A;  4O2B A;  2GIV A;  5G21 A;  3RW0 A;  4OC3 A;  5IJ9 A;  3HKB B;  1QLE B;  3W7T A;  2REF A;  2UXC B;  4JXR A;  4BW9 A;  1OCR B;  1R57 A;  4DRX A;  3D68 A;  2VQF O;  2DF5 A;  2PJ1 A;  2Q9L A;  2B58 A;  1KUX A;  4NGM A;  1BHB A;  3OAA G;  2JVD A;  4DV3 B;  1GM7 A;  3AG1 C;  5B66 Z;  5KA6 A;  3JAS B;  3R65 A;  1KC8 W;  4BMH A;  1GMG A;  4NSQ A;  4MW3 A;  2CNS A;  5J2U B;  4JI2 O;  5LYD A;  1XMO O;  4U3J A;  4FZ1 A;  1BZK A;  4MVZ A;  1AJQ A;  1F23 A;  1ZWI C;  3CXS A;  4O4J B;  2F8H A;  1TA8 A;  4MS2 A;  3RYF A;  5LYL A;  4DV0 B;  3I1U A;  4R8C A;  5CA1 B;  5L3F A;  3FH4 A;  4B14 A;  2Z3O A;  3ASN B;  2EX3 A;  5A28 A;  1IXM A;  4JI7 O;  4DUY B;  4MXU A;  4KOW A;  2ATR A;  4FLV A;  4LX9 A;  4YJ2 A;  2PGG A;  1M4G A;  2UXD B;  4MW8 A;  2VQE O;  5LMN O;  4B3M O;  5IY5 C;  2V77 A;  4B3R O;  1KP2 A;  4DR5 O;  1M4U A;  1SQP H;  5EBL C;  3JD0 A;  4UCT A;  4PI0 A;  1M93 A;  3ZMS A;  1EE3 P;  1B04 A;  2ZXW B;  1OCO B;  2Z3P A;  3UQ8 A;  2KQX A;  3U10 A;  2VWK A;  3HKD B;  3AG4 C;  2XAG A;  2N04 A;  1XI1 A;  1IXB A;  3CDX A;  2HR3 A;  5C8Y B;  1QLE C;  4NJQ A;  4IGG A;  3LDE A;  3P2F A;  1ON0 A;  2PRB A;  2QSA A;  1OCR C;  4LBE C;  3B7I A;  1FT7 A;  3M8A A;  4R6T A;  1EM1 A;  1VQL V;  5JWP A;  5JQ4 A;  3KQZ A;  4PPZ A;  3D8P A;  3K5N A;  5DS0 A;  4PJ0 Z;  4LF7 B;  2Q73 A;  4FLY A;  2ATK C;  4ONW A;  4P44 A;  3BHP A;  3UCS C;  1D2D A;  4RUH A;  1N32 B;  5LOV A;  1FXV A;  4R7C A;  1XE4 A;  2QA4 V;  4DV5 B;  1L8D A;  1NS1 A;  2PF4 E;  2DJV A;  3AK2 A;  2IH1 C;  3EFF K;  3OGC C;  1US6 A;  1IGB A;  2WPX A;  5LBQ A;  4DR3 B;  2LJ2 A;  3RAM A;  4BIO A;  1EN6 A;  3CCJ V;  3UT5 A;  2FML A;  2YIB A;  4JI0 B;  2PJ3 A;  4TQF A;  3QAH A;  4XBF A;  2E5L B;  1Q43 A;  1IBL O;  4PDM A;  4KZT A;  3H1I H;  3N5F A;  4MFZ A;  3TOB A;  3ZMV A;  3ETG A;  3ASN C;  3WG7 C;  2QJ8 A;  2ZW5 A;  3V8I A;  1KQS U;  1AR1 B;  1E79 G;  3T4Z A;  4R3K A;  3C26 A;  1QHT A;  3IWE A;  5CN0 A;  4FWU A;  4PK2 A;  4H2K A;  1NQT A;  3CCU V;  4X62 O;  4OLL A;  2P7T C;  4OC1 A;  4PXB A;  1QCE A;  3BAA A;  3BY6 A;  3CCV V;  4UBR A;  2ZIN A;  3V38 A;  2GAN A;  4AB7 A;  3T4D A;  1RSO A;  1OCO C;  4UCS A;  3BHX A;  2DQ0 A;  3K79 A;  2QTS A;  5LMU O;  1FFX B;  3GLJ A;  3H4Q A;  3TO7 A;  2YIB D;  2F43 G;  2QEX V;  1JQG A;  4M85 A;  2DW4 A;  4UCN A;  3WR7 A;  2XEG A;  3FB7 C;  2EIL B;  1XQ8 A;  1IBM B;  3HB3 B;  3ABL B;  2JIZ G;  1NVP D;  4J80 A;  1PL0 A;  4DV4 O;  1OZP A;  5DED A;  5KHI A;  2PY5 A;  3BJ8 A;  4UIB A;  3N2K A;  4QUS A;  2FIW A;  5KLV H;  4RAI A;  2DMX A;  5J2T B;  2UU9 O;  2WYR A;  3S6H A;  4UFW A;  4P4E A;  4CS3 A;  2ZEM A;  2EK8 A;  2FXF A;  1VQK V;  4H0L B;  1YX0 A;  1ORQ C;  1MOF A;  1Z2G A;  5EYP A;  4LQG A;  4F0Y A;  4U7N A;  4NTW A;  2MW2 B;  4CZZ A;  2ZEN A;  3BLN A;  4JGS A;  3JYC A;  2NMT A;  3S3X A;  4YY3 B;  1Q81 W;  5JPH A;  1X10 A;  1Q7Y W;  4BR6 A;  4M6I A;  1N71 A;  4LF5 B;  2JJ2 G;  2ZNJ A;  2ZEG A;  3K0G A;  2XTA A;  1M4L A;  4LR3 A;  2QYV A;  2Z3M A;  1YI2 V;  3B40 A;  1QSR A;  2IJJ A;  5AG6 A;  5LHI A;  2QM8 A;  3CXC U;  1RPO A;  4R76 A;  3L72 H;  4TNU A;  1AI6 A;  4PV1 B;  5EC2 C;  1Z8X A;  2Y69 B;  3SYQ A;  4JTD B;  1M4D A;  1F51 A;  1S60 A;  1U96 A;  1Q2C A;  3MAQ A;  4MRI A;  1CPX A;  4FD6 A;  1YF2 A;  5IDJ A;  1B06 A;  4QB9 A;  5DWM A;  4MI4 A;  2IM9 A;  2K1E A;  5IYC O;  5LYF A;  2UUA B;  4TT3 G;  3BVO A;  2GV9 A;  3CWB H;  1MJA A;  3EVK A;  3RN4 A;  1AJN A;  1CG2 A;  1F57 A;  1YJN V;  1FNO A;  3OR6 C;  4KOX A;  1S76 D;  4CGO A;  3F5B A;  4L8A A;  5EIB D;  4I0X A;  4X2T A;  4TSF G;  4AQY O;  3J7A U;  3FF3 A;  2EIL C;  3ZHT A;  4JV5 O;  1URF A;  3ABL C;  1ZUQ A;  4Q7A A;  4YFJ A;  2IMO A;  2X6B A;  3D36 C;  3PBE A;  1CX8 A;  4CYO A;  4H37 A;  1ZLI A;  1BGY H;  2BUE A;  1TVK A;  2NNU A;  3OEE G;  4KVM E;  4YHH O;  1Y7R A;  2OH1 A;  3K59 A;  4MTF A;  2A4N A;  3ZMU A;  4U9Z A;  4CRZ B;  3B77 A;  5IYB O;  3OE7 G;  4J7J A;  1PM9 A;  2H3O A;  4I4T A;  1GM8 A;  3RYH B;  2GRE A;  2Y0M A;  4Q38 A;  3R9F A;  1JR9 A;  5EMI A;  1SA0 A;  2EZP A;  3TXQ A;  4DR4 B;  1BE3 H;  2OZU A;  4B11 A;  2C2A A;  2OU2 A;  4IYI A;  4JYY A;  5LHG A;  5F49 A;  2P0W A;  4FD4 A;  3HR0 A;  2F66 C;  1VQM V;  1GH6 A;  3DR6 A;  1Y76 A;  2ZOG A;  1Y7E A;  4OX9 B;  2LFR A;  4KHP B;  3SDL A;  3S3W A;  1MA1 A;  4KOR A;  1IB1 E;  5JQG A;  5B3S B;  3B35 A;  4FFK A;  1S72 V;  4YXW G;  3E8F A;  1B6B A;  2CXA A;  4OC4 A;  2Y0I A;  2XUM A;  2X6C A;  3KR4 A;  3JD1 A;  1XMB A;  2I00 A;  2PIY A;  4X20 A;  2D2C B;  2FE7 A;  5IB9 A;  3ZRV A;  5B1N A;  1JX9 A;  4F4L A;  2O28 A;  1VQ9 V;  4PA9 A;  2WAM A;  1P0H A;  1LFW A;  1ZAU A;  3ZRW B;  3FIX A;  2VQF B;  2R70 A;  4JI5 B;  4K30 A;  3IAY A;  4MSW C;  1N36 O;  3RYI A;  1AUG A;  2VL1 A;  3IEH A;  1MMM A;  4JXQ A;  7CPA A;  4ZI6 A;  2PR1 A;  3T1Y B;  4KSI A;  2RC4 A;  4WBN B;  3CC4 V;  3A9L A;  2VQY A;  5EZY A;  4OPH A;  2ZW6 A;  1FXK B;  4D7S A;  3ML0 A;  1IVS A;  1L0C A;  2PYL A;  1LRZ A;  2HB6 A;  4XNH C;  4U3F H;  3WB0 A;  5B1O A;  2LQT A;  4MCQ A;  1IX9 A;  4JI2 B;  2YI8 A;  3IWG A;  4DUZ B;  1XMO B;  4PD4 F;  2H94 A;  1MSW D;  1P4R A;  1Y4M A;  4DV7 O;  5G22 A;  4KOS A;  3BI1 A;  3JAW B;  2C27 A;  3SPH A;  3J80 N;  2P6F A;  5KHH A;  2O53 A;  4O2A A;  4EFD A;  1CBX A;  2EIK B;  1W59 A;  1K4C C;  2F1M A;  2P22 C;  1Y0R A;  3RO0 A;  3S9N A;  1GRJ A;  4MY3 A;  4YJ3 A;  2ZIO A;  6CPA A;  1AR4 A;  4RUE A;  4UVC A;  4IYH A;  4DR5 B;  2BEI A;  4IUS A;  4JZ2 A;  1HNW O;  1PYT B;  3ABT A;  2QM7 A;  4LF8 B;  2WPD G;  1ZG9 A;  1GHE A;  1THZ A;  4GZR B;  5DEC A;  2QWN B;  1H8L A;  4BIZ A;  5HFM A;  5F09 A;  3KCX A;  1HDJ A;  3CXH F;  4ZHQ B;  1GK9 A;  1OCC C;  2ITC C;  4OPA A;  1EN4 A;  5DWN A;  2E75 B;  4UVB A;  4H89 A;  4AVC A;  4CGL A;  4XPL A;  3OR7 C;  2JS3 A;  1B3Q A;  3SXO A;  3JAL B;  4RO2 A;  4UB6 Z;  5IV0 A;  1P7B A;  3EY5 A;  3AK3 A;  3HKC A;  3JAT B;  2ITD C;  4B7K A;  4CH6 A;  3MRU A;  1Q6H A;  2CAZ C;  4WFH A;  3EFA A;  3GKR A;  1B6Q A;  4GKK O;  4GLX A;  1IUR A;  1XIL A;  4I49 A;  4JZG A;  3IU2 A;  3HKB A;  2B5G B;  2GU2 A;  4C7I A;  2ZPA A;  5ISV A;  4CH5 A;  1FXK C;  2LFS A;  2PJC A;  4N21 A;  3ISZ A;  4NGN A;  2GFQ A;  5HH1 A;  2Q7G A;  3TX8 A;  2OCH A;  3JAS A;  4NXN O;  3QVN A;  4PI2 A;  1VMG A;  1MZF A;  2JBJ A;  3R66 A;  2YND A;  1BT8 A;  2Z0A A;  1OJH A;  2JDD A;  2BSW A;  1K5S A;  3AG2 B;  3OTO B;  2J8N A;  2AHZ A;  2RMK B;  2ZEE A;  4JLY A;  4JI8 O;  2CH7 B;  3FEC A;  2PDO A;  2EIK C;  3L2N A;  5DN6 G;  1Y74 B;  4XPD B;  4O4L B;  4B3S B;  4B13 A;  3GUX A;  4EB6 B;  2PI5 A;  1AJP A;  3N27 A;  4PSW A;  4F8Z A;  4X62 B;  3TET A;  3TCV A;  3CRM A;  4LP8 A;  2N05 A;  1TF9 A;  4O4I B;  4FLX A;  3ZCC A;  3SJX A;  1I12 A;  3SYC A;  8CPA A;  1Q7L A;  1NJI W;  4ZOL A;  5IYD O;  3NE8 A;  4B3T O;  4JZ0 A;  1KKC A;  2C6P A;  5LYJ B;  2XAS A;  5E79 Z;  4LF9 O;  2DXQ A;  1S0V A;  2AFW A;  4PEL A;  4P4B A;  4OKO A;  2IW5 A;  3LAC A;  4E8O A;  2IJZ A;  4HKF A;  1IOI A;  1L1F A;  1F2P A;  4RQF A;  3LD2 A;  3EXN A;  1Q82 W;  3K9U A;  4CH3 A;  5GTI Z;  1Q6U A;  1K4D C;  4LWS B;  1A2Z A;  4DV4 B;  1XNQ B;  3B8N A;  1IBK B;  4MHZ A;  4BIN A;  2UUC B;  2IU3 A;  4LH6 A;  3D7D A;  1IDS A;  3NXS A;  4TV8 B;  1GTO A;  2UU9 B;  4OID A;  4Z1V A;  1BLL E;  3WFV A;  2IJI A;  4UA3 A;  3N2G A;  4JI1 O;  4MBU A;  3SYP A;  4CC6 A;  3ZHR A;  4JYW A;  1XIX A;  1QVF U;  2C6G A;  2QTO A;  2CGO A;  1SKV A;  2WSS G;  5GTH Z;  1HNZ B;  3GY9 A;  1JA8 A;  5B5E Z;  2BCO A;  5C82 A;  1I5Y A;  1OHH G;  3F7V C;  4X89 A;  2J8R A;  2CNT A;  1JCH A;  5BMV A;  4PXD A;  3KHZ A;  3AG2 C;  4MFL A;  5LGT A;  4X8I A;  1MZE A;  3KAS A;  4XPD C;  1AI7 A;  4FJC C;  5KTC A;  4X64 O;  3W6X A;  3CXQ A;  1A32 A;  2WA3 A;  3FEE A;  2EBJ A;  5C93 A;  4MVS A;  3ZHS A;  4J42 A;  4UCO A;  5LYI A;  4QJF B;  3F5T A;  2LP7 A;  1YSJ A;  1LR1 A;  3SYA A;  4DR1 O;  1Z5R A;  3IO1 A;  4OGQ B;  1P4N A;  1S3Z A;  2PVW A;  4UCP A;  1J4J A;  1Y9W A;  2ZEF A;  1ZLH A;  4KUM A;  4FZ0 A;  2FVG A;  1VIX A;  4RWU A;  1K92 A;  3VWE A;  5LA6 B;  5AG5 A;  4A32 A;  4K0K O;  3NA6 A;  1V0C A;  4UV8 A;  4J7Z A;  4UEE A;  4QBJ A;  5LRK A;  4JV5 B;  2HVJ C;  1CXZ B;  2HFE C;  3BCC H;  1QNM A;  4FUU A;  2E3C A;  4X1Y A;  1IIC A;  5JVD B;  4HBN A;  2KG7 B;  2B4D B;  4UB8 Z;  3APQ A;  4HNW B;  2QWP B;  1K5Q A;  3FFQ A;  4TOI A;  2AGA A;  1HNX O;  2EJR A;  1U97 A;  2W6I G;  3ABU A;  4BAY A;  1P7G A;  4GYC B;  2PUS A;  3K03 A;  3B3T A;  1TUB B;  2RCV A;  3T8W A;  4TUY B;  1PP9 H;  4R87 A;  3SPG A;  5D5Q A;  2Q04 A;  4NGT A;  1H2M A;  3EO4 A;  3D36 A;  3T2M A;  2CDY A;  1YTF D;  4LNU A;  3B3C A;  3A8T A;  4CC5 A;  4F9V A;  3D3I A;  1ZL8 B;  3CX5 F;  4JI3 B;  5KUM A;  4Q36 A;  4CAV A;  3QO8 A;  2HLD G;  3NR7 A;  3MD0 A;  3VQX A;  2AJ6 A;  4KFM A;  2IQ6 A;  1PU9 A;  1KUV A;  2P6E A;  1TUE B;  1WPX A;  1Z4R A;  4EME A;  4MHP A;  3MHH C;  5HMN A;  3SI2 A;  4F0X A;  5LHH A;  1KWM A;  3PEI A;  3H01 A;  1TGO A;  1SQF A;  3E22 B;  3K0D A;  4M6G A;  3F7Y C;  3FX7 A;  4JI4 O;  4NTX A;  3ZHV A;  3FAV A;  2O4H A;  1FFT B;  3FYI B;  4ZIB A;  3CJH B;  3TC8 A;  3ZRX A;  3IFX A;  4FM0 A;  1COW G;  5KX5 B;  3ZED A;  1CP6 A;  4DR2 O;  2WUU A;  1YRE A;  4MCP A;  1XHX A;  2ZR2 A;  4P2Z A;  4KVO E;  1PCA A;  4WF9 V;  3WAB A;  3RBZ A;  1KBH A;  1FKA O;  3KR5 A;  1ZG8 A;  1SC5 B;  2D4P A;  3PB4 X;  4P10 A;  2IBZ H;  5HXD A;  5D29 A;  3SJA C;  4CYN A;  3LNN A;  3W7S A;  2DYR B;  2ZOF A;  2UUB O;  2DPS A;  1KYO F;  5AG4 A;  4FMT A;  4IT5 A;  4CPA A;  1XL4 A;  2YI9 A;  2HEP A;  3RWR D;  1Y67 A;  4UCR A;  3K5O A;  1N33 B;  4J41 A;  4IIJ B;  5L3D A;  3SI1 A;  2YXY A;  4NF1 A;  4D7T A;  4DYO A;  2FT0 A;  2QVP A;  3D3S A;  1YVK A;  4MY0 A;  5IE9 A;  4E2A A;  2R9I A;  4WFG A;  3T1H O;  2EUL A;  4A33 A;  2GSM B;  1JJ2 U;  1WAZ A;  2YIC A;  1YVW A;  4Q20 A;  1IZ3 A;  2P67 A;  4A95 A;  2CE4 A;  2F23 A;  5BR8 O;  1ZO0 A;  1F4N A;  4CH4 A;  4AHC A;  4AIL C;  3KKW A;  3OM3 B;  2L35 A;  4KLV A;  4FFB B;  3F8K A;  1HNW B;  1V55 B;  2OWO A;  5DM6 V;  5CA0 B;  2ZM6 O;  3DC5 A;  1MSD A;  4AI8 A;  2ZCE A;  4FLW A;  1GN2 A;  4JTC B;  4H6Z A;  3AG7 A;  3VQW A;  4UFX A;  3K06 A;  5KMG A;  4HNY B;  1FJG B;  4DUK A;  3V7Z A;  2W6J G;  1YZB A;  4B5P B;  1CPY A;  2AHY A;  3OUS A;  1RFY A;  2C6C A;  3K3W A;  2P6G A;  2Q4Z A;  3Q4H B;  3R95 A;  1I5X A;  3JTK A;  2WPW A;  1CEZ A;  1V54 B;  1W0K G;  1M9N A;  4ZBM A;  1XFO A;  4L89 A;  3QO5 A;  1S7F A;  3CEI A;  3TXS A;  4MFK A;  4UUJ C;  1R73 A;  4OC5 A;  5J8F A;  3E0K A;  5IB0 A;  5H6R A;  3ZRW A;  4B10 A;  1Z9U A;  4UWI A;  4QE9 A;  1I94 O;  2EBO A;  3JSL A;  4AG9 A;  5H86 A;  2BTQ B;  1QLN A;  2QJ1 A;  1G4Y B;  5AGE A;  5KA5 A;  1HW7 A;  3TGU H;  4WBN A;  1G8M A;  2CTB A;  4NGS A;  4Z65 A;  3S9L A;  2Q68 A;  1I21 A;  2YEV B;  1FXK A;  3QTC A;  3IGR A;  2CTP A;  4UIA A;  1JFF A;  2XOK G;  3L71 H;  4GUN A;  5IJ0 A;  4BIU A;  2LW7 A;  4HNX B;  3KGQ A;  5IYZ B;  1S3J A;  1Z8W A;  3RT3 C;  5JJN B;  3FB3 A;  1RXT A;  2G0B A;  2GTA A;  3ASO B;  4FM2 A;  4OXS A;  1NSA A;  3A2F A;  3VOU A;  2AW9 A;  3K08 A;  4GX5 A;  4LQ6 A;  5CMU A;  4FAI A;  3SJB C;  1M5I A;  1V55 C;  3JAW A;  5FL7 G;  4ZGY B;  2JGU A;  2GTS A;  2Y48 A;  5GON A;  2ZKO A;  2WLL B;  4TWE A;  5KTA A;  1HWY A;  2ZXW C;  4NYK A;  4FPP A;  3A0H Z;  4H33 A;  4B3T B;  2J8M A;  2QWR B;  4E4E A;  3K9T A;  1XNR B;  2CIJ A;  4YWY A;  3UY5 A;  3JUW A;  3VAT A;  4LFC O;  1HDQ A;  3DXR A;  2VWJ A;  3F0A A;  3CC2 V;  2PIZ A;  2RJZ A;  5L3E A;  4B6Z A;  1Z5W A;  1XBL A;  1ZX3 A;  2DE0 X;  1PL4 A;  1V54 C;  3MDS A;  4ZHQ A;  2LO1 A;  5LXT B;  4U9Y A;  2CY2 A;  4X1K A;  3CHX A;  4O4H A;  1S5H C;  2O57 A;  5JH7 A;  1IU8 A;  1VKC A;  1NR7 A;  2KKW A;  3HLP A;  1EZJ A;  3JAT A;  5GW7 A;  1VGY A;  4OAE A;  4MHD A;  4X66 O;  2DWE C;  4LFA O;  4II9 A;  3DSQ A;  2V4D A;  1S5L Z;  1YIT V;  4LF4 O;  1BQZ A;  4JI1 B;  4MFQ A;  2NR5 A;  3C90 A;  3ZHU A;  2WWW A;  1R3K C;  2ZEO A;  1QQC A;  4BWA A;  3FYN A;  1DGS A;  2ADP A;  3P30 A;  1S77 D;  2XEJ A;  4HZ3 A;  1VQ7 V;  4NXY A;  1LAN A;  2ZD9 A;  1R1B A;  4FBE A;  4X3R A;  4W4L A;  3VWD A;  2QML A;  5H9C A;  4NTY A;  3K5M A;  3L74 H;  1VHS A;  4NVP A;  1UFH A;  4OIW A;  1FS0 G;  3ASO C;  4I55 A;  3TO9 A;  2RN9 A;  2WLI B;  2CGN A;  3KI9 A;  4X64 B;  4MFP A;  4X88 A;  4D6T H;  4ZI7 A;  2WZN A;  3PBB A;  3DC6 A;  2ZDI C;  2I79 A;  2OT5 A;  2Q43 A;  4OC2 A;  3RYC B;  2GUZ A;  2YXL A;  1J95 A;  1N34 O;  2CH7 A;  1WP7 A;  2P6J A;  3W7X A;  2V8D A;  3RYO A;  4DR6 O;  4I9W A;  4LCU C;  4TV9 B;  5ELY A;  1KEC A;  4O4L A;  1XUQ A;  4U5Y A;  5LRG A;  2BSK A;  5LP6 B;  1AYE A;  4X1I A;  3UM7 A;  5HVG A;  4YU9 A;  1AMP A;  4PXC A;  2HV2 A;  4K0K B;  4O2B B;  1H2L A;  3QB8 A;  2BE3 A;  2PRQ A;  4NR1 A;  1R3I C;  2PSW A;  2DQ3 A;  2AFZ A;  4MVU A;  4RS2 A;  1YHQ V;  3CSX A;  4MHY A;  4QE7 A;  3CRA A;  4OAD A;  3B3V A;  4JAA A;  4ORF A;  4UV9 A;  2NN4 A;  5H84 A;  3PP9 A;  2IJK A;  1Y9K A;  3SJF A;  5AG2 A;  3SXN A;  1MK4 A;  3OEH G;  2HHH O;  4X8A A;  4ZX9 A;  1NE9 A;  1HDU A;  2YGW A;  3CCE V;  3SJE A;  1VEW A;  3CC7 V;  2EVN A;  1SZX A;  3FB8 C;  2Y0P A;  4HNA B;  4B7E A;  3LSS A;  2B3U A;  4YIO A;  4GKJ O;  1FD9 A;  2PJ8 A;  1YW6 A;  1BMF G;  3CCL V;  2H5M A;  3DNS A;  3FVL A;  1OV9 A;  2Z5U A;  1Y66 A;  2V7Q G;  1KMI Z;  1PKX A;  2QGN A;  4YJ2 B;  4F6E A;  1XMQ O;  3APO A;  4EFE A;  1I08 A;  4MCS A;  5FPO A;  2Y69 C;  1LOK A;  2C1C A;  2D3O W;  1QR9 A;  2LGW A;  4G2K A;  3ETD A;  4WFE A;  4XDJ A;  1OBR A;  4JI4 B;  1XEQ A;  3CPA A;  4CAX A;  5KTD A;  2NYQ A;  1NR1 A;  3C3T A;  5BZB A;  2YS8 A;  4MTX A;  3CPW U;  3UKM A;  1JPX A;  4JI6 O;  4IHJ A;  1YXB A;  2AZ0 A;  2OOT A;  4DR2 B;  3SJG A;  3TFY A;  3IGA C;  2IU0 A;  5EC1 C;  3RGB A;  2L6L A;  4TQD A;  4YIP A;  1F2O A;  4G1P A;  3ZJ0 A;  2GBO A;  5F48 A;  1GYT A;  1YLO A;  1N0J A;  4MTG A;  2BOC C;  3JD4 A;  3DLJ A;  3CYO A;  2Q69 A;  3OGI B;  3MHS C;  1PUA A;  1YLE A;  3K9A A;  2ILM A;  1NBM G;  1Q90 D;  2W0X A;  3SI0 A;  2NLJ C;  4KXR A;  3SR2 C;  2Y4U A;  4F6R A;  3D66 A;  5B1A B;  3N7Z A;  2FKX A;  2UXC O;  4GM5 A;  2BOB C;  1YVO A;  4W9Y A;  5EBW C;  3G80 A;  3K5L A;  1TKF A;  4KUA A;  3ZZI A;  3GVM A;  2DEA A;  5JVD A;  1VQ8 V;  3ZN0 A;  2EWB A;  1WP8 A;  2KG7 A;  2B4D A;  1DF4 A;  2OTJ V;  1AVM A;  2PJB A;  4K8Z A;  1XF8 A; 
#chains in the Genus database with same CATH homology
 3GY9 A;  4A2Z A;  3CXS A;  5C82 A;  2Z0Z A;  2J8R A;  2CNT A;  4MFL A;  2R8V A;  4B14 A;  2Z3O A;  3R96 A;  5A28 A;  4XPD C;  2FL4 A;  4B5O A;  1BOB A;  4FD7 A;  4KOW A;  2ATR A;  5KTC A;  4LX9 A;  3W6X A;  1M4G A;  3CXQ A;  1K4J A;  4KVX A;  4PV6 A;  4R57 A;  1S7K A;  1P4N A;  1S3Z A;  5EBV A;  4UCP A;  1J4J A;  3S6F A;  1Y9W A;  2FCK A;  3TT2 A;  4AG7 A;  5F46 A;  1KZF A;  2Z3P A;  3I3G A;  4E0A A;  5FVJ A;  3VWE A;  5AG5 A;  2VZY A;  5AG7 A;  4A32 A;  1V0C A;  3OWC A;  4C7H A;  2Z11 A;  3FRM A;  3P2F A;  4QBJ A;  1ON0 A;  2PRB A;  4UWJ A;  2IL4 A;  1TIQ A;  1IIC A;  1CM0 A;  1M1D A;  5C88 A;  2B4D B;  4HNW B;  5JQ4 A;  2ZW4 A;  2Z10 A;  3D8P A;  5G20 A;  2R98 A;  3EC4 A;  1XE4 A;  4R87 A;  4A31 A;  2Q04 A;  3EO4 A;  4M3S A;  4XNH B;  3PZJ A;  4C2Y A;  4KLW A;  2WPX A;  4ZBG A;  2JDC A;  4IF5 A;  4Q36 A;  3QAH A;  4CAV A;  5IX3 A;  2G3T A;  1YGH A;  1SQH A;  3PGP A;  2AJ6 A;  4KZT A;  4MFZ A;  4PSX A;  3TOB A;  1PU9 A;  4Y49 B;  1KUV A;  2P6E A;  1Z4R A;  2Q4V A;  2ZW5 A;  5HMN A;  3V8I A;  4F0X A;  4R3K A;  3C26 A;  3IWE A;  2Q44 A;  4R9M A;  3T90 A;  4PK2 A;  4CYP A;  4DNC A;  1Q2D A;  4J3G A;  4OLL A;  1IYL A;  3TO6 A;  4AVB A;  2D4O A;  4UBR A;  2KCW A;  2GAN A;  3BJ7 A;  4AB7 A;  2WUU A;  1YRE A;  4X5K A;  1IYK A;  3TO7 A;  3H4Q A;  4M85 A;  4A30 A;  4KVO E;  3R1K A;  4UCN A;  4MFJ A;  3WR7 A;  2FSR A;  2D4P A;  4YGO A;  4CGP A;  1B87 A;  4CYN A;  4KOY A;  2DPS A;  5AG4 A;  1OZP A;  3BJ8 A;  4QUS A;  1QSO A;  2FIW A;  2B4B A;  3S6H A;  4UFW A;  4NF1 A;  4NEX A;  3W91 A;  2Z3N A;  2FXF A;  1YX0 A;  3DDD A;  2FT0 A;  3D3S A;  4MY0 A;  1YVK A;  4F0Y A;  4E2A A;  2OB0 A;  1YK3 A;  4CRY B;  4A33 A;  2OZH A;  3BLN A;  4GS4 A;  2NMT A;  4QC6 A;  4A95 A;  5JPH A;  1ZO0 A;  2REE A;  1N71 A;  2VBQ A;  4R3L A;  3I9S A;  3KKW A;  3LOD A;  1NSL A;  2Z3M A;  4FD5 A;  1QSR A;  4KLV A;  3F8K A;  5AG6 A;  1NMT A;  2GE3 A;  1M4D A;  4H6Z A;  1CJW A;  4UFX A;  1S60 A;  1Q2C A;  4HNY B;  3P2H A;  4FD6 A;  4QB9 A;  5DWM A;  4MI4 A;  4B5P B;  3FBU A;  1MJA A;  2P6G A;  4KOX A;  2Q4Y A;  3R95 A;  4CGO A;  3JTK A;  2WPW A;  3F5B A;  4L8A A;  2QEC A;  4KS9 A;  2F5I A;  4L89 A;  2K5T A;  1S7F A;  4KSF A;  4H6U A;  4MFK A;  4MJ8 A;  4YFJ A;  5J8F A;  3E0K A;  5IB0 A;  4CYO A;  4B10 A;  1Z9U A;  4UWI A;  3TOA A;  2BUE A;  2BL1 A;  4AG9 A;  4KVM E;  5H86 A;  3G8W A;  1Y7R A;  4UCM A;  2OH1 A;  5G1Z A;  4CGN A;  1S7N A;  2YNC A;  2A4N A;  5AGE A;  3TTH A;  2ZXV A;  4U9Z A;  4CRZ B;  2FS5 A;  1QST A;  1I21 A;  1RO5 A;  2WSA A;  3IGR A;  3S6G A;  1FY7 A;  2Y0M A;  4Q38 A;  3R9F A;  4HNX B;  2OZU A;  3D2M A;  4B11 A;  2OU2 A;  1KUY A;  3FB3 A;  1RXT A;  2G0B A;  5F49 A;  2YNE A;  5A27 A;  2P0W A;  4FD4 A;  3CXP A;  3G3S A;  3DR6 A;  5EC4 A;  1S5K A;  2QIR A;  4ZGY B;  3TE4 A;  4KOR A;  3B8G A;  2HQY A;  1IB1 E;  5KTA A;  5BWA B;  3IU1 A;  2EUI A;  1B6B A;  2CXA A;  2J8M A;  4RI1 A;  1MJ9 A;  2OZG A;  3JVN A;  4LUA A;  3UY5 A;  2I00 A;  3JUW A;  1Q2Y A;  2AE6 A;  2FE7 A;  4C2X A;  4B5P A;  1YR0 A;  3F0A A;  2O28 A;  1P0H A;  1IID A;  3FIX A;  4U9Y A;  1XMT A;  2CY2 A;  4K30 A;  1WWZ A;  4CYQ A;  2Z3K A;  4JXQ A;  1VKC A;  2PR1 A;  2RC4 A;  4OAE A;  3A9L A;  4MHD A;  4C68 A;  2VQY A;  2ZW6 A;  4II9 A;  1L0C A;  1LRZ A;  4XNH C;  5CNP A;  4MFQ A;  2DPT A;  3IWG A;  4QVT A;  4UFV A;  2PR8 A;  2VI7 A;  3FYN A;  2Q7B A;  5F47 A;  1M4I A;  1U6M A;  2VXK A;  5G22 A;  4NXY A;  4Y49 C;  2FIA A;  4KOS A;  4CS0 B;  3VWD A;  2QML A;  2C27 A;  2P6F A;  5I0C A;  1QSN A;  1VHS A;  1UFH A;  2VZZ A;  3T9Y A;  2CNM A;  3TO9 A;  3GYA A;  4MFP A;  4MY3 A;  3H5Z A;  2VEZ A;  2ARH A;  2I79 A;  3DR8 A;  2BEI A;  4IUS A;  4KOU A;  3RYO A;  4CAE A;  1GHE A;  1I1D A;  2JEV A;  4U5Y A;  4C2Z A;  1MJB A;  5DWN A;  2HV2 A;  4H89 A;  4AVC A;  4CGL A;  4XPL A;  3SHP A;  3QB8 A;  3SXO A;  4YRH A;  5IV0 A;  2PSW A;  4JD6 A;  3EY5 A;  3W6S A;  4RS2 A;  3EFA A;  4JWP A;  2ZW7 A;  3GKR A;  4OAD A;  2HUZ A;  4I49 A;  1Z4E A;  3IU2 A;  2YNC C;  4ORF A;  2B5G B;  4EVY A;  4C7I A;  2ZPA A;  4F6A A;  5H84 A;  3PP9 A;  5ISV A;  1Y9K A;  2Z3L A;  5J8C A;  3SXN A;  1MK4 A;  2PQ8 A;  4KOV A;  1NE9 A;  5HH1 A;  2YGW A;  2EVN A;  3NE7 A;  2R1I A;  4ONU A;  2B3U A;  1XEB A;  1S7L A;  2YND A;  2H5M A;  2JDD A;  3DNS A;  2BSW A;  4KOT A;  2J8N A;  4XPK A;  2R7H A;  4JLY A;  2X7B A;  3FXT A;  2PDO A;  4XPD B;  4AVA A;  4B13 A;  3R9G A;  5GCN A;  4PSW A;  1WK4 A;  4B12 A;  4NCZ A;  3TCV A;  4CAX A;  5KTD A;  5E96 A;  2Q0Y A;  4KUB A;  2PC1 A;  3FNC A;  3MGD A;  3S6K A;  1I12 A;  4BBH A;  3TFY A;  4KSA A;  3DSB A;  1QSM A;  2DXQ A;  4E8O A;  4PK3 A;  3ZJ0 A;  4HKF A;  5F48 A;  2GIV A;  5G21 A;  2REF A;  3D2P A;  3LD2 A;  2G3A A;  1BO4 A;  3EXN A;  4JXR A;  3K9U A;  1R57 A;  1PUA A;  1M44 A;  1YLE A;  4CAW A;  2B58 A;  1KUX A;  3N7Z A;  4BMH A;  1YVO A;  4NSQ A;  3ZZI A;  4KUA A;  2B5G A;  2CNS A;  4CGM A;  2JLM A;  2B3V A;  3R9E A;  2B4D A;  4CAF A;  4UA3 A;  4MBU A;  1XIX A;  4JJX A;  1XF8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...