3F0AA

Structure of a putative n-acetyltransferase (ta0374) in complex with acetyl-coa from thermoplasma acidophilum
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
159
structure length
159
Chain Sequence
MSIEIRKLSIEDLETLIEVARESWKWTYAGIYSEEYIESWIREKYSKEKLLNEIVRSQSNLDILFLGAFADSTLIGFIELKIIANKAELLRLYLKPEYTHKKIGKTLLLEAEKIMKKKGILECRLYVHRQNSVGFSFYYKNGFKVEDTDGSDFIMEKKY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the novel PaiA N-acetyltransferase from Thermoplasma acidophilum involved in the negative control of sporulation and degradative enzyme production.
pubmed doi rcsb
source organism Thermoplasma acidophilum
molecule tags Transferase
molecule keywords N-ACETYLTRANSFERASE
total genus 47
structure length 159
sequence length 159
ec nomenclature ec 2.3.1.57: Diamine N-acetyltransferase.
pdb deposition date 2008-10-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 3f0aA00
1GHEA 4NSQA 1BOBA 3R95A 1P4NA 1K4JA 4KOUA 2H5MA 3CXQA 4U9YA 2JLMA 2PR8A 2Q04A 5IV0A 4R3KA 2VEZA 4L89A 5IX3A 2G0BA 4L8AA 4PV6A 4UWJA 1ON0A 1XE4A 1U6MA 3S6FA 1M44A 1XEBA 1M4DA 1S7LA 3TOBA 2D4PA 2IL4A 2VZZA 4KVME 4NXYA 4ONUA 4AB7A 3SXNA 3DDDA 2J8RA 3B8GA 1Z4EA 3SHPA 2PSWA 4ZBGA 5F46A 4HKFA 3WR7A 4AVAA 2ZW4A 3D2MA 4H6ZA 4II9A 1Y9WA 4XNHB 1YGHA 2CY2A 5H86A 1NE9A 3VWDA 2JEVA 4AVCA 4NF1A 1B6BA 5C88A 1YREA 2Z10A 3S6GA 3DSBA 1PUAA 4JLYA 4NEXA 3F0AA 1QSRA 2C27A 4CAWA 2ZXVA 5CNPA 4B5PB 2FCKA 3NE7A 2B4DB 3FB3A 4I49A 5I0CA 5C82A 5ISVA 4AVBA 4J3GA 2FSRA 1QSOA 1TIQA 3TE4A 1VHSA 1YLEA 4K30A 1XF8A 4QC6A 3ZZIA 3P2FA 3TO7A 3S6KA 3FNCA 2ZW7A 1J4JA 2D4OA 5DWMA 4FD6A 4JWPA 1FY7A 4PSWA 3TTHA 2J8NA 3R96A 2ZPAA 3UY5A 3E0KA 2KCWA 2O28A 4E2AA 4HNYB 3F5BA 4PSXA 2QIRA 2QECA 2WPXA 4YFJA 1I12A 2OB0A 2B4BA 5GCNA 3R9FA 4ORFA 4UA3A 5FVJA 4Y49C 3S6HA 1IYLA 1S60A 3MGDA 3BJ8A 2WPWA 1IYKA 1P0HA 1WWZA 2VBQA 2R98A 2P0WA 4M85A 2BUEA 3T9YA 4B5OA 1I21A 1VKCA 1YX0A 1IB1E 1OZPA 4KVOE 3TT2A 4QBJA 2PC1A 4XPKA 3T90A 3FIXA 4NCZA 1Q2DA 3OWCA 4E0AA 3PP9A 3G3SA 1QSTA 4JXQA 2Y0MA 5F48A 3P2HA 2AE6A 3IGRA 2HV2A 2REFA 4B5PA 1Y7RA 2ATRA 1I1DA 5H84A 2B4DA 1NMTA 5KTCA 4YRHA 4KZTA 4AG9A 2OU2A 3W91A 1N71A 2PQ8A 3D3SA 4CRZB 3CXPA 3EO4A 2AJ6A 4GS4A 1XMTA 1QSNA 4R3LA 5F47A 4QVTA 3QB8A 4R57A 2ZW5A 3H4QA 2REEA 2CNSA 2FT0A 1YR0A 2OH1A 2JDDA 4KLVA 2P6GA 4PK2A 4F0YA 5JQ4A 3TCVA 1M1DA 4XNHC 2B3UA 5JPHA 2FIWA 3R1KA 4H89A 4JXRA 4KOTA 3KKWA 1KUVA 2B3VA 2EVNA 1NSLA 4UBRA 4F6AA 2VXKA 2JDCA 4EVYA 2Q44A 4IF5A 2GIVA 2ARHA 4OADA 4KOWA 1V0CA 5F49A 2P6FA 4KOYA 4YGOA 1CJWA 2Q7BA 1S3ZA 1LRZA 3W6SA 1Q2YA 1RO5A 4MJ8A 3K9UA 1WK4A 3C26A 3PZJA 3TFYA 4U5YA 5J8FA 4DNCA 5DWNA 5HH1A 4R9MA 2R8VA 1CM0A 4OAEA 4XPLA 3BJ7A 3I3GA 2ZW6A 1KUXA 1S7NA 4KOVA 3RYOA 1KZFA 3V8IA 4HNWB 3DR6A 3GY9A 1Q2CA 3I9SA 1XIXA 2FL4A 5E96A 2RC4A 2G3AA 2R7HA 4JJXA 5J8CA 2P6EA 4IUSA 3EFAA 3EY5A 4OLLA 4CRYB 4FD4A 1MJ9A 2OZGA 1MJAA 2VI7A 2PDOA 4FD5A 3LODA 4XPDC 4FD7A 4KUBA 2FIAA 4HNXB 4JD6A 5HMNA 2Q0YA 4U9ZA 2OZUA 3GYAA 2Z0ZA 2DXQA 2B5GB 3QAHA 3PGPA 3JVNA 2BSWA 1IICA 1MJBA 2B58A 3CXSA 2X7BA 3DR8A 2Z11A 1Z4RA 2CNTA 3JUWA 3FBUA 3D2PA 1B87A 1Z9UA 2VQYA 2Q4VA 1M4GA 2FXFA 2G3TA 4KUAA 4XPDB 3G8WA 4E8OA 1MK4A 2J8MA 1S7KA 1M4IA 2GANA 4LUAA 1IIDA 5IB0A 4MI4A 2CNMA 4UWIA 3R9GA 2A4NA 3FYNA 4CAXA 4MY0A 4BMHA 2B5GA 3IWGA 2BEIA 4AG7A 4H6UA 3F8KA 2HUZA 3GKRA 3D8PA 1BO4A 1YVOA 1S7FA 4MY3A 2PR1A 4CAVA 1YVKA 3SXOA 1UFHA 4QB9A 2NMTA 5EBVA 5EC4A 1QSMA 2VZYA 3TOAA 1KUYA 1Y9KA 2PRBA 4KOSA 4KORA 2EUIA 2K5TA 1YK3A 3EC4A 2I79A 2BL1A 4R87A 3R9EA 1R57A 3ZJ0A 4QUSA 3DNSA 1PU9A 2Q4YA 3FRMA 4CS0B 5KTDA 4MHDA 4KVXA 1RXTA 2GE3A 4M3SA 4LX9A 3TO9A 4RS2A 4X5KA 2R1IA 4RI1A 3EXNA 2OZHA 3N7ZA 3W6XA 2FS5A 2FE7A 2I00A 4MBUA 3TO6A 2F5IA 1S5KA 3FXTA 2QMLA 4KLWA 4PK3A 4KOXA 2HQYA 3BLNA 4Y49B 5KTAA 1L0CA 1SQHA 3VWEA 3LD2A
chains in the Genus database with same CATH superfamily
1GHEA 2C6CA 1BOBA 4NSQA 2GREA 1IOIA 4MHYA 1P4NA 3R95A 3VARA 4ZI6A 1K4JA 4KOUA 4O23A 2H5MA 3CXQA 4MXUA 1CX8A 2GU2A 2HB6A 1YSJA 3JRUA 2Q51A 4U9YA 2JLMA 2PR8A 2Q04A 2XEIA 4ZYQA 5IV0A 4JZ0A 4OMEA 3WABA 1JQGA 4R3KA 5JGFA 4PQAA 2VEZA 4L89A 4PXBA 4B5OA 2G0BA 2CTBA 5IX3A 4L8AA 3PB6X 4ONWA 4PV6A 3PBBA 2EWBA 5G1ZA 3IO1A 5G20A 4X3RA 4KSAA 2IJZA 1YW6A 4UWJA 1LOKA 1UWYA 4EMEA 1ZO0A 2IMOA 1ON0A 4OC0A 1XE4A 1U6MA 1LAPA 2Z3PA 1EE3P 3S6FA 3VH9A 4B12A 1M44A 1XEBA 4MFLA 1M4DA 1S7LA 3L2NA 2D4PA 2IL4A 3TOBA 2Z3OA 4MFPA 3PBEA 2VZZA 4KVME 4NXYA 4F8ZA 2AFWA 4ONUA 3IIBA 4AB7A 1YQEA 3SXNA 3NH4A 3DDDA 2J8RA 2F8HA 3B8GA 1Z4EA 4MFJA 4NJRA 3SHPA 2PSWA 4ZBGA 5F46A 2PIZA 4HKFA 3WR7A 4AVAA 1ELLP 2C6PA 2ZW4A 3D2MA 4G1PA 4CAEA 4H6ZA 4II9A 5A27A 5CBMA 3RZAA 1TKFA 4P4DA 1Y9WA 1IY7A 7CPAA 4DUKA 4XNHB 4MCQA 1YGHA 2CY2A 4C2XA 3N5FA 3IU2A 3KQXA 1NE9A 3B7IA 5H86A 2JEVA 2GLFA 5G21A 3VWDA 4AVCA 2PJBA 4NF1A 1B6BA 2PJAA 4P4JA 5C88A 1YREA 1XRYA 2Z10A 2C6GA 3S6GA 1LAMA 3DSBA 4A37A 1PUAA 1HDUA 2AFOA 1TKHA 4JLYA 4NEXA 5LYIA 3F0AA 2PVWA 1QSRA 1F2OA 2C27A 2ZXVA 5CNPA 4B5PB 3DLJA 4C2ZA 4CAWA 4UEEA 5THWA 1AMPA 1BPNA 2JBJA 2FCKA 3NE7A 2B4DB 3FB3A 4ZGYB 2Q7SA 2NYQA 3H5ZA 3D68A 4I49A 3K2KA 5K8PA 5I0CA 3GB0A 5C82A 5ISVA 4AVBA 4J3GA 4UEZA 2FSRA 2ZEFA 4B10A 1QSOA 1XBUA 2ZOFA 1TIQA 3KZWA 3TE4A 2AFUA 1IU8A 1R43A 1VHSA 1YLEA 1XF8A 4K30A 4K3NA 1VHEA 3BI0A 4QC6A 3ZZIA 3P2FA 3SI1A 4UEFA 3SJEA 5DS0A 3TO7A 3BI1A 4R8FA 4MCPA 3S6KA 1FNOA 3FNCA 2ZW7A 1ZLHA 2PJ9A 2QVPA 1J4JA 2D4OA 5DWMA 4MFQA 4FD6A 4JWPA 4A38A 4BINA 3S9LA 2AFXA 1FY7A 1F2PA 2ZEGA 4PSWA 1TXRA 3TTHA 4FBEA 2J8NA 1TKJA 3R96A 3FX6A 4UCMA 2BOAA 2ZPAA 2ZEPA 3UY5A 1ZLIA 3E0KA 4Q7AA 2KCWA 2O28A 4RN7A 4E2AA 4HNYB 3F5BA 4YWYA 4PSXA 2QIRA 4UCNA 4IHMA 1Z8WA 2QECA 2ABZA 2DPSA 1Z8XA 1Q7LA 2AFMA 2WPXA 4IK2A 5CPAA 2ANPA 4YFJA 3PB4X 1I12A 2OB0A 2B4BA 4OC3A 3PFEA 3H8GA 1A2ZA 2EK8A 3IWEA 4LQ6A 4CYPA 3D7FA 5GCNA 3R9FA 2RFHA 3S9NA 4ORFA 4UA3A 1HDQA 1X12A 4KSIA 5FVJA 1YMEA 4Y49C 2J9AA 3BXMA 3S6HA 1X10A 3WC5A 1IYLA 1S60A 3MGDA 4A94A 3BJ8A 4C7HA 4B13A 2Z3LA 2WPWA 3H8EA 1IYKA 2DEAA 4HPSA 1P0HA 4OIDA 4MRIA 1WWZA 4A32A 1YLOA 2VBQA 2Z3KA 2R98A 4H2KA 3KHZA 2PE3A 2WSAA 3VWEA 2P0WA 3D66A 4M85A 2BUEA 3IWWA 3FECA 1LCPA 4MCSA 4LQGA 1I21A 4OP4A 5D29A 3T9YA 4A39A 1VKCA 1YX0A 3NH8A 1IB1E 1OZPA 4KVOE 3QAYA 3TT2A 4NGRA 1M4LA 4UCPA 4CGLA 4QBJA 2Z3MA 2PC1A 2ZOGA 4XPKA 3JTKA 1CP6A 4MHZA 3T90A 3MRUA 3FIXA 4M6GA 3KL9A 4NCZA 4CGMA 4CYNA 3KGQA 3KR4A 1XOVA 1Q2DA 3OWCA 4E0AA 5JM6A 3V7ZA 3PP9A 3G3SA 2V77A 5ELYA 4F9VA 1QSTA 4MMOA 4OC5A 4JXQA 4R7MA 2Y0MA 2YNCA 5F48A 3IJ3A 4FWUA 3P2HA 3NA6A 3RNZA 2AE6A 3IGRA 1CPXA 2HV2A 2REFA 4B5PA 2F7VA 3PRTA 1Y7RA 2ATRA 2PCUA 3HLPA 3NE8A 1I1DA 1Y0RA 2B4DA 5H84A 4FAIA 5LYLA 4P4FA 3K9TA 1NMTA 4GXHA 5KTCA 5LRJA 4UFWA 2PJ4A 4NGNA 3QNVA 2VL1A 3D7GA 4YRHA 4KZTA 4AG9A 2OU2A 3FEEA 4A31A 2O4HA 5AG6A 3W91A 1N71A 2PQ8A 2YGWA 3D3SA 4CRZB 1AYEA 2Z3NA 3CXPA 4KS9A 1Y7EA 3EO4A 2YNEA 2AJ6A 1ARMA 4GS4A 3WC7A 5AG7A 1XMTA 2ZENA 1QSNA 5HVFA 1ZG7A 1LFWA 2WZNA 3BHXA 4R3LA 5F47A 5AG4A 4QVTA 2PVVA 3QB8A 5EMIA 4R57A 1PYTB 6CPAA 5HVGA 2ZW5A 4TWEA 3PB7X 2QJ8A 2V8HA 3H4QA 2AFSA 2FVGA 3CZXA 3SI2A 2REEA 4B14A 2CNSA 2FT0A 3RAMA 1ELMP 1YR0A 5LYFA 2OH1A 2JDDA 4MHPA 4FUUA 2P6GA 4KLVA 4A33A 2BO9A 2YNDA 4PK2A 5J1QA 4OKOA 4F0YA 5JQ4A 4CAFA 4DYOA 4F0XA 3FMCA 3TCVA 1M1DA 3D7HA 4XNHC 1CBXA 2ZEDA 4R76A 2B3UA 5JPHA 2FIWA 2JBKA 2PJ6A 3R1KA 4H89A 4JXRA 1Z8TA 2WUUA 4KOTA 3HUVA 4WWVA 3KKWA 1KUVA 2B3VA 2EVNA 5LYDA 2Q43A 1NSLA 4UBRA 3VATA 4F6AA 2VXKA 5K8NA 2JDCA 3A9LA 2OOTA 2Q44A 4EVYA 3S9MA 4C2YA 4IF5A 2GIVA 2ARHA 2CIJA 4OADA 3SJFA 4KOWA 3WC6A 4B11A 4UFXA 3NH5A 1V0CA 3I1UA 5F49A 2PJ3A 1FT7A 4PXDA 2P6FA 3B3WA 4KOYA 3LACA 2ZEOA 4YGOA 1CJWA 2Q7BA 3IC1A 1S3ZA 1NSAA 1LRZA 1XFOA 3W6SA 1Q2YA 1RO5A 4MJ8A 4PPZA 4P45A 4PXEA 3K9UA 1WK4A 3C26A 3PZJA 4P6YA 3TFYA 4U5YA 2ZELA 5J8FA 4DNCA 3H8FA 5DWNA 5HH1A 4BBHA 3FJUA 4R9MA 5LRKA 2R8VA 1CM0A 4OAEA 4XPLA 2POKA 2O53A 3BJ7A 2XEGA 3I3GA 3WT4A 2ZW6A 1KUXA 4CGOA 4R6TA 2EBJA 1XMBA 4UIBA 1S7NA 5F09A 4KOVA 2CXAA 4OIWA 3PFOA 3RYOA 1KZFA 3V8IA 1H8LA 5HVHA 1Z5RA 4HNWB 4PXCA 3IEHA 3DR6A 1Z2LA 3GY9A 1Q2CA 3PB9X 5K8MA 3I9SA 1XIXA 2PJ8A 2FL4A 3FH4A 1JWQA 2RC4A 5E96A 4A30A 2G3AA 1VHOA 2R7HA 4JJXA 2OR4A 4MHNA 4P4BA 3RBUA 4RUHA 5J8CA 2P6EA 4WJBA 4IUSA 3EFAA 3D67A 3EY5A 4OLLA 3B3CA 4W9YA 3LMSA 4CRYB 1ARLA 4FD4A 2PJ1A 3B3VA 3DGVA 1MJ9A 4ZX8A 3T8WA 2OZGA 1MJAA 2PJ2A 5IB9A 2VI7A 1LANA 4IAVA 1VIXA 1TF8A 2PDOA 4OC1A 2BCOA 1RTQA 2G9DA 5JH9A 1CP7A 3KI9A 4FD5A 3LODA 4TNUA 4YU9A 4B6ZA 3KASA 2IQ6A 4XPDC 4Q38A 4FD7A 1Z8LA 4MCRA 1KWMA 3SJXA 2GLJA 3LWUA 4KUBA 4M6HA 1CPSA 2FIAA 4HNXB 4JD6A 5HMNA 1YW4A 2Q0YA 4U9ZA 2OZUA 3GYAA 2XEFA 2Z0ZA 3D4UA 4EWTA 2DXQA 3B35A 2C1CA 1IOFA 2B5GB 3QAHA 2BSWA 3JVNA 3PGPA 1IICA 5A28A 1MJBA 1ZG9A 2B58A 3CXSA 2X7BA 3DR8A 1TF9A 2Z11A 4DJLA 1Z4RA 2GFQA 3B3TA 2EK9A 2CNTA 5G22A 3FEDA 3JUWA 4CGNA 3FBUA 3D2PA 1DTDA 1B87A 2XEJA 1Z9UA 4UF4A 2PJCA 2VQYA 3PB8X 2Q4VA 1M4GA 2FXFA 2G3TA 2ODFA 2PJ7A 2Q4ZA 2V8DA 2PJ0A 3B2YA 4KUAA 4UIAA 3KQZA 4XPDB 4CPAA 2AFZA 4KSFA 3G8WA 3NFZA 4E8OA 1MK4A 2J8MA 1S7KA 1M4IA 2GANA 4LUAA 4UFVA 1IIDA 2PJ5A 5IB0A 4MI4A 1QQ9A 2CNMA 2CTCA 4MFZA 5I4MA 4UWIA 3R9GA 2EO8A 1BAVA 1BLLE 4NGQA 2A4NA 3FYNA 4CAXA 4MY0A 4C68A 4JYWA 1BPMA 4NFRA 4EFDA 4BMHA 2B5GA 3IWGA 2BEIA 1OBRA 3MN8A 4H6UA 5D8NA 4AG7A 5K8OA 1AUGA 3F8KA 2HUZA 3GKRA 4Z65A 2DPTA 1BO4A 3D8PA 4CGPA 3TC8A 1YVOA 3GLJA 1IGBA 4P4IA 3RO0A 2RB7A 3CPXA 1S7FA 2HC9A 4GM5A 2PR1A 4MY3A 3PEIA 4CAVA 1VGYA 2YNCC 1YVKA 4P4EA 3B3SA 4MFKA 3CT9A 3SXOA 4NGPA 3GIUA 1UFHA 4QB9A 2NMTA 2PIYA 5EC4A 5EBVA 2NSMA 1QSMA 2VZYA 3D7DA 3IU1A 1KUYA 1ZG8A 2ZEHA 4Q36A 3TOAA 5HXDA 4NGTA 1Y9KA 2PRBA 4KOSA 4CYOA 4M6IA 4NJQA 4KORA 3V38A 2EUIA 2K5TA 1YK3A 1PCAA 4P10A 3EC4A 4P44A 4ZY0A 4CYQA 2I79A 1GYTA 2I3CA 2V8VA 4OC4A 4A95A 4F9UA 2BL1A 4R87A 3R9EA 1R57A 8CPAA 1Y0YA 3ISXA 4A2ZA 3ZJ0A 1QMUA 4ZY1A 2CF4A 3FF3A 4QUSA 1R3NA 3GUXA 4ZX9A 3DNSA 3TX8A 1PU9A 2Q4YA 3FRMA 1XJOA 3SJGA 4CS0B 2PRQA 5KTDA 4MHDA 2WYRA 4X8IA 4KVXA 1RXTA 2GE3A 3FVLA 4C7IA 4M3SA 2DF5A 2V8GA 4LX9A 3TO9A 4BD9A 4RS2A 3CDXA 2R1IA 4X5KA 4AXVA 2ZEMA 4RI1A 3EXNA 2OZHA 3N7ZA 3W6XA 4NGMA 2FS5A 4NGSA 2FE7A 2I00A 4MBUA 3TO6A 3CPAA 3KR5A 5AG5A 2JEWA 5AGEA 4ZY2A 4X2TA 5LRGA 5BWAB 3IFEA 2F5IA 1HEEA 1S5KA 3FXTA 2QMLA 4KLWA 4PK3A 2QYVA 2HQYA 3BLNA 3ISZA 4KOXA 4Y49B 5KTAA 1L0CA 1DE4C 1CG2A 1F57A 1SQHA 3KHXA 4OC2A 2ZEEA 3SI0A 3LD2A
chains in the Genus database with same CATH topology
1GHEA 4NSQA 1BOBA 3R95A 1P4NA 1K4JA 4KOUA 2H5MA 3CXQA 4U9YA 2JLMA 2PR8A 2Q04A 5IV0A 4R3KA 2VEZA 4L89A 5IX3A 2G0BA 4L8AA 4PV6A 5G1ZA 5G20A 4KSAA 4UWJA 1ZO0A 1ON0A 1XE4A 1U6MA 3S6FA 2Z3PA 4B12A 1M44A 1XEBA 4MFLA 1M4DA 1S7LA 3TOBA 2D4PA 2IL4A 2Z3OA 4MFPA 2VZZA 4KVME 4NXYA 4ONUA 4AB7A 3SXNA 3DDDA 2J8RA 3B8GA 1Z4EA 4MFJA 3SHPA 2PSWA 4ZBGA 5F46A 4HKFA 3WR7A 4AVAA 2ZW4A 3D2MA 4CAEA 4H6ZA 4II9A 5A27A 1Y9WA 4XNHB 1YGHA 2CY2A 4C2XA 5H86A 3IU2A 1NE9A 3VWDA 2JEVA 5G21A 4AVCA 4NF1A 1B6BA 5C88A 1YREA 2Z10A 3S6GA 3DSBA 1PUAA 4JLYA 4NEXA 3F0AA 1QSRA 2C27A 4C2ZA 2ZXVA 5CNPA 4B5PB 4CAWA 2FCKA 3NE7A 2B4DB 3FB3A 4ZGYB 3H5ZA 4I49A 5I0CA 5C82A 5ISVA 4AVBA 4J3GA 2FSRA 4B10A 1QSOA 1TIQA 3TE4A 1VHSA 1YLEA 4K30A 1XF8A 4QC6A 3ZZIA 3P2FA 3TO7A 3S6KA 3FNCA 2ZW7A 1J4JA 2D4OA 5DWMA 4MFQA 4FD6A 4JWPA 1FY7A 4PSWA 3TTHA 2J8NA 3R96A 4UCMA 2ZPAA 3UY5A 3E0KA 2KCWA 2O28A 4E2AA 4HNYB 3F5BA 4PSXA 2QIRA 4UCNA 2QECA 2WPXA 2DPSA 4YFJA 1I12A 2OB0A 2B4BA 3IWEA 4CYPA 5GCNA 3R9FA 4ORFA 4UA3A 5FVJA 4Y49C 3S6HA 1IYLA 1S60A 3MGDA 4C7HA 3BJ8A 4B13A 2Z3LA 2WPWA 1IYKA 1P0HA 1WWZA 4A32A 2VBQA 2Z3KA 2R98A 2WSAA 2P0WA 4M85A 2BUEA 3T9YA 4B5OA 1I21A 1VKCA 1YX0A 1IB1E 1OZPA 4KVOE 3TT2A 4UCPA 4CGLA 4QBJA 2Z3MA 2PC1A 4XPKA 3JTKA 3T90A 3FIXA 4NCZA 4CGMA 4CYNA 1Q2DA 3OWCA 4E0AA 3PP9A 3G3SA 1QSTA 4JXQA 2Y0MA 2YNCA 5F48A 3P2HA 2AE6A 3IGRA 2HV2A 2REFA 4B5PA 1Y7RA 2ATRA 1I1DA 5H84A 2B4DA 1NMTA 5KTCA 4UFWA 4YRHA 4KZTA 4AG9A 2OU2A 4A31A 5AG6A 3W91A 1N71A 2PQ8A 2YGWA 3D3SA 4CRZB 2Z3NA 3CXPA 4KS9A 3EO4A 2YNEA 2AJ6A 4GS4A 5AG7A 1XMTA 1QSNA 4R3LA 5F47A 5AG4A 4QVTA 3QB8A 4R57A 2ZW5A 3H4QA 2REEA 4B14A 2CNSA 2FT0A 1YR0A 2OH1A 2JDDA 4KLVA 2P6GA 4A33A 2YNDA 4PK2A 4F0YA 5JQ4A 4CAFA 4F0XA 3TCVA 1M1DA 4XNHC 2B3UA 5JPHA 2FIWA 3R1KA 4H89A 4JXRA 2WUUA 4KOTA 3KKWA 1KUVA 2B3VA 2EVNA 1NSLA 4UBRA 4F6AA 2VXKA 2JDCA 3A9LA 4EVYA 2Q44A 4C2YA 4IF5A 2GIVA 2ARHA 4OADA 4KOWA 4B11A 4UFXA 1V0CA 5F49A 2P6FA 4KOYA 4YGOA 1CJWA 2Q7BA 1S3ZA 1LRZA 3W6SA 1Q2YA 1RO5A 4MJ8A 3K9UA 1WK4A 3C26A 3PZJA 3TFYA 4U5YA 5J8FA 4DNCA 5DWNA 5HH1A 4BBHA 4R9MA 2R8VA 1CM0A 4OAEA 4XPLA 3BJ7A 3I3GA 2ZW6A 1KUXA 4CGOA 1S7NA 4KOVA 2CXAA 3RYOA 1KZFA 3V8IA 4HNWB 3DR6A 3GY9A 1Q2CA 3I9SA 1XIXA 2FL4A 5E96A 2RC4A 4A30A 2G3AA 2R7HA 4JJXA 5J8CA 2P6EA 4IUSA 3EFAA 3EY5A 4OLLA 4CRYB 4FD4A 1MJ9A 2OZGA 1MJAA 2VI7A 2PDOA 4FD5A 3LODA 4XPDC 4Q38A 4FD7A 4KUBA 2FIAA 4HNXB 4JD6A 5HMNA 2Q0YA 4U9ZA 2OZUA 3GYAA 2Z0ZA 2DXQA 2B5GB 3QAHA 3PGPA 3JVNA 2BSWA 1IICA 5A28A 1MJBA 2B58A 3CXSA 2X7BA 3DR8A 2Z11A 1Z4RA 5G22A 2CNTA 3JUWA 4CGNA 3FBUA 3D2PA 1B87A 1Z9UA 2VQYA 2Q4VA 1M4GA 2FXFA 2G3TA 4KUAA 4XPDB 4KSFA 3G8WA 4E8OA 1MK4A 2J8MA 1S7KA 1M4IA 2GANA 4LUAA 4UFVA 1IIDA 5IB0A 4MI4A 2CNMA 4MFZA 4UWIA 3R9GA 2A4NA 3FYNA 4CAXA 4MY0A 4C68A 4BMHA 2B5GA 3IWGA 2BEIA 4AG7A 4H6UA 3F8KA 2HUZA 3GKRA 3D8PA 2DPTA 1BO4A 4CGPA 1YVOA 1S7FA 4MY3A 2PR1A 4CAVA 2YNCC 1YVKA 4MFKA 3SXOA 1UFHA 4QB9A 2NMTA 5EBVA 5EC4A 1QSMA 2VZYA 3IU1A 4Q36A 1KUYA 3TOAA 1Y9KA 2PRBA 4KOSA 4CYOA 4KORA 2EUIA 2K5TA 1YK3A 3EC4A 4CYQA 2I79A 4A95A 2BL1A 4R87A 3R9EA 1R57A 4A2ZA 3ZJ0A 4QUSA 3DNSA 1PU9A 2Q4YA 3FRMA 4CS0B 5KTDA 4MHDA 4KVXA 1RXTA 2GE3A 4C7IA 4M3SA 4LX9A 3TO9A 4RS2A 4X5KA 2R1IA 4RI1A 3EXNA 2OZHA 3N7ZA 3W6XA 2FS5A 2FE7A 2I00A 4MBUA 3TO6A 5AGEA 5AG5A 5BWAB 2F5IA 1S5KA 3FXTA 2QMLA 4KLWA 4PK3A 4KOXA 2HQYA 3BLNA 4Y49B 5KTAA 1L0CA 1SQHA 3VWEA 3LD2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GHE A;  4NSQ A;  1BOB A;  3R95 A;  1P4N A;  1K4J A;  4KOU A;  2H5M A;  3CXQ A;  4U9Y A;  2JLM A;  2PR8 A;  2Q04 A;  5IV0 A;  4R3K A;  2VEZ A;  4L89 A;  5IX3 A;  2G0B A;  4L8A A;  4PV6 A;  4UWJ A;  1ON0 A;  1XE4 A;  1U6M A;  3S6F A;  1M44 A;  1XEB A;  1M4D A;  1S7L A;  3TOB A;  2D4P A;  2IL4 A;  2VZZ A;  4KVM E;  4NXY A;  4ONU A;  4AB7 A;  3SXN A;  3DDD A;  2J8R A;  3B8G A;  1Z4E A;  3SHP A;  2PSW A;  4ZBG A;  5F46 A;  4HKF A;  3WR7 A;  4AVA A;  2ZW4 A;  3D2M A;  4H6Z A;  4II9 A;  1Y9W A;  4XNH B;  1YGH A;  2CY2 A;  5H86 A;  1NE9 A;  3VWD A;  2JEV A;  4AVC A;  4NF1 A;  1B6B A;  5C88 A;  1YRE A;  2Z10 A;  3S6G A;  3DSB A;  1PUA A;  4JLY A;  4NEX A;  3F0A A;  1QSR A;  2C27 A;  4CAW A;  2ZXV A;  5CNP A;  4B5P B;  2FCK A;  3NE7 A;  2B4D B;  3FB3 A;  4I49 A;  5I0C A;  5C82 A;  5ISV A;  4AVB A;  4J3G A;  2FSR A;  1QSO A;  1TIQ A;  3TE4 A;  1VHS A;  1YLE A;  4K30 A;  1XF8 A;  4QC6 A;  3ZZI A;  3P2F A;  3TO7 A;  3S6K A;  3FNC A;  2ZW7 A;  1J4J A;  2D4O A;  5DWM A;  4FD6 A;  4JWP A;  1FY7 A;  4PSW A;  3TTH A;  2J8N A;  3R96 A;  2ZPA A;  3UY5 A;  3E0K A;  2KCW A;  2O28 A;  4E2A A;  4HNY B;  3F5B A;  4PSX A;  2QIR A;  2QEC A;  2WPX A;  4YFJ A;  1I12 A;  2OB0 A;  2B4B A;  5GCN A;  3R9F A;  4ORF A;  4UA3 A;  5FVJ A;  4Y49 C;  3S6H A;  1IYL A;  1S60 A;  3MGD A;  3BJ8 A;  2WPW A;  1IYK A;  1P0H A;  1WWZ A;  2VBQ A;  2R98 A;  2P0W A;  4M85 A;  2BUE A;  3T9Y A;  4B5O A;  1I21 A;  1VKC A;  1YX0 A;  1IB1 E;  1OZP A;  4KVO E;  3TT2 A;  4QBJ A;  2PC1 A;  4XPK A;  3T90 A;  3FIX A;  4NCZ A;  1Q2D A;  3OWC A;  4E0A A;  3PP9 A;  3G3S A;  1QST A;  4JXQ A;  2Y0M A;  5F48 A;  3P2H A;  2AE6 A;  3IGR A;  2HV2 A;  2REF A;  4B5P A;  1Y7R A;  2ATR A;  1I1D A;  5H84 A;  2B4D A;  1NMT A;  5KTC A;  4YRH A;  4KZT A;  4AG9 A;  2OU2 A;  3W91 A;  1N71 A;  2PQ8 A;  3D3S A;  4CRZ B;  3CXP A;  3EO4 A;  2AJ6 A;  4GS4 A;  1XMT A;  1QSN A;  4R3L A;  5F47 A;  4QVT A;  3QB8 A;  4R57 A;  2ZW5 A;  3H4Q A;  2REE A;  2CNS A;  2FT0 A;  1YR0 A;  2OH1 A;  2JDD A;  4KLV A;  2P6G A;  4PK2 A;  4F0Y A;  5JQ4 A;  3TCV A;  1M1D A;  4XNH C;  2B3U A;  5JPH A;  2FIW A;  3R1K A;  4H89 A;  4JXR A;  4KOT A;  3KKW A;  1KUV A;  2B3V A;  2EVN A;  1NSL A;  4UBR A;  4F6A A;  2VXK A;  2JDC A;  4EVY A;  2Q44 A;  4IF5 A;  2GIV A;  2ARH A;  4OAD A;  4KOW A;  1V0C A;  5F49 A;  2P6F A;  4KOY A;  4YGO A;  1CJW A;  2Q7B A;  1S3Z A;  1LRZ A;  3W6S A;  1Q2Y A;  1RO5 A;  4MJ8 A;  3K9U A;  1WK4 A;  3C26 A;  3PZJ A;  3TFY A;  4U5Y A;  5J8F A;  4DNC A;  5DWN A;  5HH1 A;  4R9M A;  2R8V A;  1CM0 A;  4OAE A;  4XPL A;  3BJ7 A;  3I3G A;  2ZW6 A;  1KUX A;  1S7N A;  4KOV A;  3RYO A;  1KZF A;  3V8I A;  4HNW B;  3DR6 A;  3GY9 A;  1Q2C A;  3I9S A;  1XIX A;  2FL4 A;  5E96 A;  2RC4 A;  2G3A A;  2R7H A;  4JJX A;  5J8C A;  2P6E A;  4IUS A;  3EFA A;  3EY5 A;  4OLL A;  4CRY B;  4FD4 A;  1MJ9 A;  2OZG A;  1MJA A;  2VI7 A;  2PDO A;  4FD5 A;  3LOD A;  4XPD C;  4FD7 A;  4KUB A;  2FIA A;  4HNX B;  4JD6 A;  5HMN A;  2Q0Y A;  4U9Z A;  2OZU A;  3GYA A;  2Z0Z A;  2DXQ A;  2B5G B;  3QAH A;  3PGP A;  3JVN A;  2BSW A;  1IIC A;  1MJB A;  2B58 A;  3CXS A;  2X7B A;  3DR8 A;  2Z11 A;  1Z4R A;  2CNT A;  3JUW A;  3FBU A;  3D2P A;  1B87 A;  1Z9U A;  2VQY A;  2Q4V A;  1M4G A;  2FXF A;  2G3T A;  4KUA A;  4XPD B;  3G8W A;  4E8O A;  1MK4 A;  2J8M A;  1S7K A;  1M4I A;  2GAN A;  4LUA A;  1IID A;  5IB0 A;  4MI4 A;  2CNM A;  4UWI A;  3R9G A;  2A4N A;  3FYN A;  4CAX A;  4MY0 A;  4BMH A;  2B5G A;  3IWG A;  2BEI A;  4AG7 A;  4H6U A;  3F8K A;  2HUZ A;  3GKR A;  3D8P A;  1BO4 A;  1YVO A;  1S7F A;  4MY3 A;  2PR1 A;  4CAV A;  1YVK A;  3SXO A;  1UFH A;  4QB9 A;  2NMT A;  5EBV A;  5EC4 A;  1QSM A;  2VZY A;  3TOA A;  1KUY A;  1Y9K A;  2PRB A;  4KOS A;  4KOR A;  2EUI A;  2K5T A;  1YK3 A;  3EC4 A;  2I79 A;  2BL1 A;  4R87 A;  3R9E A;  1R57 A;  3ZJ0 A;  4QUS A;  3DNS A;  1PU9 A;  2Q4Y A;  3FRM A;  4CS0 B;  5KTD A;  4MHD A;  4KVX A;  1RXT A;  2GE3 A;  4M3S A;  4LX9 A;  3TO9 A;  4RS2 A;  4X5K A;  2R1I A;  4RI1 A;  3EXN A;  2OZH A;  3N7Z A;  3W6X A;  2FS5 A;  2FE7 A;  2I00 A;  4MBU A;  3TO6 A;  2F5I A;  1S5K A;  3FXT A;  2QML A;  4KLW A;  4PK3 A;  4KOX A;  2HQY A;  3BLN A;  4Y49 B;  5KTA A;  1L0C A;  1SQH A;  3VWE A;  3LD2 A; 
#chains in the Genus database with same CATH topology
 1GHE A;  2C6C A;  1BOB A;  4NSQ A;  2GRE A;  1IOI A;  4MHY A;  1P4N A;  3R95 A;  3VAR A;  4ZI6 A;  1K4J A;  4KOU A;  4O23 A;  2H5M A;  3CXQ A;  4MXU A;  1CX8 A;  2GU2 A;  2HB6 A;  1YSJ A;  3JRU A;  2Q51 A;  4U9Y A;  2JLM A;  2PR8 A;  2Q04 A;  2XEI A;  4ZYQ A;  5IV0 A;  4JZ0 A;  4OME A;  3WAB A;  1JQG A;  4R3K A;  5JGF A;  4PQA A;  2VEZ A;  4L89 A;  4PXB A;  4B5O A;  2G0B A;  2CTB A;  5IX3 A;  4L8A A;  3PB6 X;  4ONW A;  4PV6 A;  3PBB A;  2EWB A;  5G1Z A;  3IO1 A;  5G20 A;  4X3R A;  4KSA A;  2IJZ A;  1YW6 A;  4UWJ A;  1LOK A;  1UWY A;  4EME A;  1ZO0 A;  2IMO A;  1ON0 A;  4OC0 A;  1XE4 A;  1U6M A;  1LAP A;  2Z3P A;  1EE3 P;  3S6F A;  3VH9 A;  4B12 A;  1M44 A;  1XEB A;  4MFL A;  1M4D A;  1S7L A;  3L2N A;  2D4P A;  2IL4 A;  3TOB A;  2Z3O A;  4MFP A;  3PBE A;  2VZZ A;  4KVM E;  4NXY A;  4F8Z A;  2AFW A;  4ONU A;  3IIB A;  4AB7 A;  1YQE A;  3SXN A;  3NH4 A;  3DDD A;  2J8R A;  2F8H A;  3B8G A;  1Z4E A;  4MFJ A;  4NJR A;  3SHP A;  2PSW A;  4ZBG A;  5F46 A;  2PIZ A;  4HKF A;  3WR7 A;  4AVA A;  1ELL P;  2C6P A;  2ZW4 A;  3D2M A;  4G1P A;  4CAE A;  4H6Z A;  4II9 A;  5A27 A;  5CBM A;  3RZA A;  1TKF A;  4P4D A;  1Y9W A;  1IY7 A;  7CPA A;  4DUK A;  4XNH B;  4MCQ A;  1YGH A;  2CY2 A;  4C2X A;  3N5F A;  3IU2 A;  3KQX A;  1NE9 A;  3B7I A;  5H86 A;  2JEV A;  2GLF A;  5G21 A;  3VWD A;  4AVC A;  2PJB A;  4NF1 A;  1B6B A;  2PJA A;  4P4J A;  5C88 A;  1YRE A;  1XRY A;  2Z10 A;  2C6G A;  3S6G A;  1LAM A;  3DSB A;  4A37 A;  1PUA A;  1HDU A;  2AFO A;  1TKH A;  4JLY A;  4NEX A;  5LYI A;  3F0A A;  2PVW A;  1QSR A;  1F2O A;  2C27 A;  2ZXV A;  5CNP A;  4B5P B;  3DLJ A;  4C2Z A;  4CAW A;  4UEE A;  5THW A;  1AMP A;  1BPN A;  2JBJ A;  2FCK A;  3NE7 A;  2B4D B;  3FB3 A;  4ZGY B;  2Q7S A;  2NYQ A;  3H5Z A;  3D68 A;  4I49 A;  3K2K A;  5K8P A;  5I0C A;  3GB0 A;  5C82 A;  5ISV A;  4AVB A;  4J3G A;  4UEZ A;  2FSR A;  2ZEF A;  4B10 A;  1QSO A;  1XBU A;  2ZOF A;  1TIQ A;  3KZW A;  3TE4 A;  2AFU A;  1IU8 A;  1R43 A;  1VHS A;  1YLE A;  1XF8 A;  4K30 A;  4K3N A;  1VHE A;  3BI0 A;  4QC6 A;  3ZZI A;  3P2F A;  3SI1 A;  4UEF A;  3SJE A;  5DS0 A;  3TO7 A;  3BI1 A;  4R8F A;  4MCP A;  3S6K A;  1FNO A;  3FNC A;  2ZW7 A;  1ZLH A;  2PJ9 A;  2QVP A;  1J4J A;  2D4O A;  5DWM A;  4MFQ A;  4FD6 A;  4JWP A;  4A38 A;  4BIN A;  3S9L A;  2AFX A;  1FY7 A;  1F2P A;  2ZEG A;  4PSW A;  1TXR A;  3TTH A;  4FBE A;  2J8N A;  1TKJ A;  3R96 A;  3FX6 A;  4UCM A;  2BOA A;  2ZPA A;  2ZEP A;  3UY5 A;  1ZLI A;  3E0K A;  4Q7A A;  2KCW A;  2O28 A;  4RN7 A;  4E2A A;  4HNY B;  3F5B A;  4YWY A;  4PSX A;  2QIR A;  4UCN A;  4IHM A;  1Z8W A;  2QEC A;  2ABZ A;  2DPS A;  1Z8X A;  1Q7L A;  2AFM A;  2WPX A;  4IK2 A;  5CPA A;  2ANP A;  4YFJ A;  3PB4 X;  1I12 A;  2OB0 A;  2B4B A;  4OC3 A;  3PFE A;  3H8G A;  1A2Z A;  2EK8 A;  3IWE A;  4LQ6 A;  4CYP A;  3D7F A;  5GCN A;  3R9F A;  2RFH A;  3S9N A;  4ORF A;  4UA3 A;  1HDQ A;  1X12 A;  4KSI A;  5FVJ A;  1YME A;  4Y49 C;  2J9A A;  3BXM A;  3S6H A;  1X10 A;  3WC5 A;  1IYL A;  1S60 A;  3MGD A;  4A94 A;  3BJ8 A;  4C7H A;  4B13 A;  2Z3L A;  2WPW A;  3H8E A;  1IYK A;  2DEA A;  4HPS A;  1P0H A;  4OID A;  4MRI A;  1WWZ A;  4A32 A;  1YLO A;  2VBQ A;  2Z3K A;  2R98 A;  4H2K A;  3KHZ A;  2PE3 A;  2WSA A;  3VWE A;  2P0W A;  3D66 A;  4M85 A;  2BUE A;  3IWW A;  3FEC A;  1LCP A;  4MCS A;  4LQG A;  1I21 A;  4OP4 A;  5D29 A;  3T9Y A;  4A39 A;  1VKC A;  1YX0 A;  3NH8 A;  1IB1 E;  1OZP A;  4KVO E;  3QAY A;  3TT2 A;  4NGR A;  1M4L A;  4UCP A;  4CGL A;  4QBJ A;  2Z3M A;  2PC1 A;  2ZOG A;  4XPK A;  3JTK A;  1CP6 A;  4MHZ A;  3T90 A;  3MRU A;  3FIX A;  4M6G A;  3KL9 A;  4NCZ A;  4CGM A;  4CYN A;  3KGQ A;  3KR4 A;  1XOV A;  1Q2D A;  3OWC A;  4E0A A;  5JM6 A;  3V7Z A;  3PP9 A;  3G3S A;  2V77 A;  5ELY A;  4F9V A;  1QST A;  4MMO A;  4OC5 A;  4JXQ A;  4R7M A;  2Y0M A;  2YNC A;  5F48 A;  3IJ3 A;  4FWU A;  3P2H A;  3NA6 A;  3RNZ A;  2AE6 A;  3IGR A;  1CPX A;  2HV2 A;  2REF A;  4B5P A;  2F7V A;  3PRT A;  1Y7R A;  2ATR A;  2PCU A;  3HLP A;  3NE8 A;  1I1D A;  1Y0R A;  2B4D A;  5H84 A;  4FAI A;  5LYL A;  4P4F A;  3K9T A;  1NMT A;  4GXH A;  5KTC A;  5LRJ A;  4UFW A;  2PJ4 A;  4NGN A;  3QNV A;  2VL1 A;  3D7G A;  4YRH A;  4KZT A;  4AG9 A;  2OU2 A;  3FEE A;  4A31 A;  2O4H A;  5AG6 A;  3W91 A;  1N71 A;  2PQ8 A;  2YGW A;  3D3S A;  4CRZ B;  1AYE A;  2Z3N A;  3CXP A;  4KS9 A;  1Y7E A;  3EO4 A;  2YNE A;  2AJ6 A;  1ARM A;  4GS4 A;  3WC7 A;  5AG7 A;  1XMT A;  2ZEN A;  1QSN A;  5HVF A;  1ZG7 A;  1LFW A;  2WZN A;  3BHX A;  4R3L A;  5F47 A;  5AG4 A;  4QVT A;  2PVV A;  3QB8 A;  5EMI A;  4R57 A;  1PYT B;  6CPA A;  5HVG A;  2ZW5 A;  4TWE A;  3PB7 X;  2QJ8 A;  2V8H A;  3H4Q A;  2AFS A;  2FVG A;  3CZX A;  3SI2 A;  2REE A;  4B14 A;  2CNS A;  2FT0 A;  3RAM A;  1ELM P;  1YR0 A;  5LYF A;  2OH1 A;  2JDD A;  4MHP A;  4FUU A;  2P6G A;  4KLV A;  4A33 A;  2BO9 A;  2YND A;  4PK2 A;  5J1Q A;  4OKO A;  4F0Y A;  5JQ4 A;  4CAF A;  4DYO A;  4F0X A;  3FMC A;  3TCV A;  1M1D A;  3D7H A;  4XNH C;  1CBX A;  2ZED A;  4R76 A;  2B3U A;  5JPH A;  2FIW A;  2JBK A;  2PJ6 A;  3R1K A;  4H89 A;  4JXR A;  1Z8T A;  2WUU A;  4KOT A;  3HUV A;  4WWV A;  3KKW A;  1KUV A;  2B3V A;  2EVN A;  5LYD A;  2Q43 A;  1NSL A;  4UBR A;  3VAT A;  4F6A A;  2VXK A;  5K8N A;  2JDC A;  3A9L A;  2OOT A;  2Q44 A;  4EVY A;  3S9M A;  4C2Y A;  4IF5 A;  2GIV A;  2ARH A;  2CIJ A;  4OAD A;  3SJF A;  4KOW A;  3WC6 A;  4B11 A;  4UFX A;  3NH5 A;  1V0C A;  3I1U A;  5F49 A;  2PJ3 A;  1FT7 A;  4PXD A;  2P6F A;  3B3W A;  4KOY A;  3LAC A;  2ZEO A;  4YGO A;  1CJW A;  2Q7B A;  3IC1 A;  1S3Z A;  1NSA A;  1LRZ A;  1XFO A;  3W6S A;  1Q2Y A;  1RO5 A;  4MJ8 A;  4PPZ A;  4P45 A;  4PXE A;  3K9U A;  1WK4 A;  3C26 A;  3PZJ A;  4P6Y A;  3TFY A;  4U5Y A;  2ZEL A;  5J8F A;  4DNC A;  3H8F A;  5DWN A;  5HH1 A;  4BBH A;  3FJU A;  4R9M A;  5LRK A;  2R8V A;  1CM0 A;  4OAE A;  4XPL A;  2POK A;  2O53 A;  3BJ7 A;  2XEG A;  3I3G A;  3WT4 A;  2ZW6 A;  1KUX A;  4CGO A;  4R6T A;  2EBJ A;  1XMB A;  4UIB A;  1S7N A;  5F09 A;  4KOV A;  2CXA A;  4OIW A;  3PFO A;  3RYO A;  1KZF A;  3V8I A;  1H8L A;  5HVH A;  1Z5R A;  4HNW B;  4PXC A;  3IEH A;  3DR6 A;  1Z2L A;  3GY9 A;  1Q2C A;  3PB9 X;  5K8M A;  3I9S A;  1XIX A;  2PJ8 A;  2FL4 A;  3FH4 A;  1JWQ A;  2RC4 A;  5E96 A;  4A30 A;  2G3A A;  1VHO A;  2R7H A;  4JJX A;  2OR4 A;  4MHN A;  4P4B A;  3RBU A;  4RUH A;  5J8C A;  2P6E A;  4WJB A;  4IUS A;  3EFA A;  3D67 A;  3EY5 A;  4OLL A;  3B3C A;  4W9Y A;  3LMS A;  4CRY B;  1ARL A;  4FD4 A;  2PJ1 A;  3B3V A;  3DGV A;  1MJ9 A;  4ZX8 A;  3T8W A;  2OZG A;  1MJA A;  2PJ2 A;  5IB9 A;  2VI7 A;  1LAN A;  4IAV A;  1VIX A;  1TF8 A;  2PDO A;  4OC1 A;  2BCO A;  1RTQ A;  2G9D A;  5JH9 A;  1CP7 A;  3KI9 A;  4FD5 A;  3LOD A;  4TNU A;  4YU9 A;  4B6Z A;  3KAS A;  2IQ6 A;  4XPD C;  4Q38 A;  4FD7 A;  1Z8L A;  4MCR A;  1KWM A;  3SJX A;  2GLJ A;  3LWU A;  4KUB A;  4M6H A;  1CPS A;  2FIA A;  4HNX B;  4JD6 A;  5HMN A;  1YW4 A;  2Q0Y A;  4U9Z A;  2OZU A;  3GYA A;  2XEF A;  2Z0Z A;  3D4U A;  4EWT A;  2DXQ A;  3B35 A;  2C1C A;  1IOF A;  2B5G B;  3QAH A;  2BSW A;  3JVN A;  3PGP A;  1IIC A;  5A28 A;  1MJB A;  1ZG9 A;  2B58 A;  3CXS A;  2X7B A;  3DR8 A;  1TF9 A;  2Z11 A;  4DJL A;  1Z4R A;  2GFQ A;  3B3T A;  2EK9 A;  2CNT A;  5G22 A;  3FED A;  3JUW A;  4CGN A;  3FBU A;  3D2P A;  1DTD A;  1B87 A;  2XEJ A;  1Z9U A;  4UF4 A;  2PJC A;  2VQY A;  3PB8 X;  2Q4V A;  1M4G A;  2FXF A;  2G3T A;  2ODF A;  2PJ7 A;  2Q4Z A;  2V8D A;  2PJ0 A;  3B2Y A;  4KUA A;  4UIA A;  3KQZ A;  4XPD B;  4CPA A;  2AFZ A;  4KSF A;  3G8W A;  3NFZ A;  4E8O A;  1MK4 A;  2J8M A;  1S7K A;  1M4I A;  2GAN A;  4LUA A;  4UFV A;  1IID A;  2PJ5 A;  5IB0 A;  4MI4 A;  1QQ9 A;  2CNM A;  2CTC A;  4MFZ A;  5I4M A;  4UWI A;  3R9G A;  2EO8 A;  1BAV A;  1BLL E;  4NGQ A;  2A4N A;  3FYN A;  4CAX A;  4MY0 A;  4C68 A;  4JYW A;  1BPM A;  4NFR A;  4EFD A;  4BMH A;  2B5G A;  3IWG A;  2BEI A;  1OBR A;  3MN8 A;  4H6U A;  5D8N A;  4AG7 A;  5K8O A;  1AUG A;  3F8K A;  2HUZ A;  3GKR A;  4Z65 A;  2DPT A;  1BO4 A;  3D8P A;  4CGP A;  3TC8 A;  1YVO A;  3GLJ A;  1IGB A;  4P4I A;  3RO0 A;  2RB7 A;  3CPX A;  1S7F A;  2HC9 A;  4GM5 A;  2PR1 A;  4MY3 A;  3PEI A;  4CAV A;  1VGY A;  2YNC C;  1YVK A;  4P4E A;  3B3S A;  4MFK A;  3CT9 A;  3SXO A;  4NGP A;  3GIU A;  1UFH A;  4QB9 A;  2NMT A;  2PIY A;  5EC4 A;  5EBV A;  2NSM A;  1QSM A;  2VZY A;  3D7D A;  3IU1 A;  1KUY A;  1ZG8 A;  2ZEH A;  4Q36 A;  3TOA A;  5HXD A;  4NGT A;  1Y9K A;  2PRB A;  4KOS A;  4CYO A;  4M6I A;  4NJQ A;  4KOR A;  3V38 A;  2EUI A;  2K5T A;  1YK3 A;  1PCA A;  4P10 A;  3EC4 A;  4P44 A;  4ZY0 A;  4CYQ A;  2I79 A;  1GYT A;  2I3C A;  2V8V A;  4OC4 A;  4A95 A;  4F9U A;  2BL1 A;  4R87 A;  3R9E A;  1R57 A;  8CPA A;  1Y0Y A;  3ISX A;  4A2Z A;  3ZJ0 A;  1QMU A;  4ZY1 A;  2CF4 A;  3FF3 A;  4QUS A;  1R3N A;  3GUX A;  4ZX9 A;  3DNS A;  3TX8 A;  1PU9 A;  2Q4Y A;  3FRM A;  1XJO A;  3SJG A;  4CS0 B;  2PRQ A;  5KTD A;  4MHD A;  2WYR A;  4X8I A;  4KVX A;  1RXT A;  2GE3 A;  3FVL A;  4C7I A;  4M3S A;  2DF5 A;  2V8G A;  4LX9 A;  3TO9 A;  4BD9 A;  4RS2 A;  3CDX A;  2R1I A;  4X5K A;  4AXV A;  2ZEM A;  4RI1 A;  3EXN A;  2OZH A;  3N7Z A;  3W6X A;  4NGM A;  2FS5 A;  4NGS A;  2FE7 A;  2I00 A;  4MBU A;  3TO6 A;  3CPA A;  3KR5 A;  5AG5 A;  2JEW A;  5AGE A;  4ZY2 A;  4X2T A;  5LRG A;  5BWA B;  3IFE A;  2F5I A;  1HEE A;  1S5K A;  3FXT A;  2QML A;  4KLW A;  4PK3 A;  2QYV A;  2HQY A;  3BLN A;  3ISZ A;  4KOX A;  4Y49 B;  5KTA A;  1L0C A;  1DE4 C;  1CG2 A;  1F57 A;  1SQH A;  3KHX A;  4OC2 A;  2ZEE A;  3SI0 A;  3LD2 A; 
#chains in the Genus database with same CATH homology
 1GHE A;  4NSQ A;  1BOB A;  3R95 A;  1P4N A;  1K4J A;  4KOU A;  2H5M A;  3CXQ A;  4U9Y A;  2JLM A;  2PR8 A;  2Q04 A;  5IV0 A;  4R3K A;  2VEZ A;  4L89 A;  5IX3 A;  2G0B A;  4L8A A;  4PV6 A;  5G1Z A;  5G20 A;  4KSA A;  4UWJ A;  1ZO0 A;  1ON0 A;  1XE4 A;  1U6M A;  3S6F A;  2Z3P A;  4B12 A;  1M44 A;  1XEB A;  4MFL A;  1M4D A;  1S7L A;  3TOB A;  2D4P A;  2IL4 A;  2Z3O A;  4MFP A;  2VZZ A;  4KVM E;  4NXY A;  4ONU A;  4AB7 A;  3SXN A;  3DDD A;  2J8R A;  3B8G A;  1Z4E A;  4MFJ A;  3SHP A;  2PSW A;  4ZBG A;  5F46 A;  4HKF A;  3WR7 A;  4AVA A;  2ZW4 A;  3D2M A;  4CAE A;  4H6Z A;  4II9 A;  5A27 A;  1Y9W A;  4XNH B;  1YGH A;  2CY2 A;  4C2X A;  5H86 A;  3IU2 A;  1NE9 A;  3VWD A;  2JEV A;  5G21 A;  4AVC A;  4NF1 A;  1B6B A;  5C88 A;  1YRE A;  2Z10 A;  3S6G A;  3DSB A;  1PUA A;  4JLY A;  4NEX A;  3F0A A;  1QSR A;  2C27 A;  4C2Z A;  2ZXV A;  5CNP A;  4B5P B;  4CAW A;  2FCK A;  3NE7 A;  2B4D B;  3FB3 A;  4ZGY B;  3H5Z A;  4I49 A;  5I0C A;  5C82 A;  5ISV A;  4AVB A;  4J3G A;  2FSR A;  4B10 A;  1QSO A;  1TIQ A;  3TE4 A;  1VHS A;  1YLE A;  4K30 A;  1XF8 A;  4QC6 A;  3ZZI A;  3P2F A;  3TO7 A;  3S6K A;  3FNC A;  2ZW7 A;  1J4J A;  2D4O A;  5DWM A;  4MFQ A;  4FD6 A;  4JWP A;  1FY7 A;  4PSW A;  3TTH A;  2J8N A;  3R96 A;  4UCM A;  2ZPA A;  3UY5 A;  3E0K A;  2KCW A;  2O28 A;  4E2A A;  4HNY B;  3F5B A;  4PSX A;  2QIR A;  4UCN A;  2QEC A;  2WPX A;  2DPS A;  4YFJ A;  1I12 A;  2OB0 A;  2B4B A;  3IWE A;  4CYP A;  5GCN A;  3R9F A;  4ORF A;  4UA3 A;  5FVJ A;  4Y49 C;  3S6H A;  1IYL A;  1S60 A;  3MGD A;  4C7H A;  3BJ8 A;  4B13 A;  2Z3L A;  2WPW A;  1IYK A;  1P0H A;  1WWZ A;  4A32 A;  2VBQ A;  2Z3K A;  2R98 A;  2WSA A;  2P0W A;  4M85 A;  2BUE A;  3T9Y A;  4B5O A;  1I21 A;  1VKC A;  1YX0 A;  1IB1 E;  1OZP A;  4KVO E;  3TT2 A;  4UCP A;  4CGL A;  4QBJ A;  2Z3M A;  2PC1 A;  4XPK A;  3JTK A;  3T90 A;  3FIX A;  4NCZ A;  4CGM A;  4CYN A;  1Q2D A;  3OWC A;  4E0A A;  3PP9 A;  3G3S A;  1QST A;  4JXQ A;  2Y0M A;  2YNC A;  5F48 A;  3P2H A;  2AE6 A;  3IGR A;  2HV2 A;  2REF A;  4B5P A;  1Y7R A;  2ATR A;  1I1D A;  5H84 A;  2B4D A;  1NMT A;  5KTC A;  4UFW A;  4YRH A;  4KZT A;  4AG9 A;  2OU2 A;  4A31 A;  5AG6 A;  3W91 A;  1N71 A;  2PQ8 A;  2YGW A;  3D3S A;  4CRZ B;  2Z3N A;  3CXP A;  4KS9 A;  3EO4 A;  2YNE A;  2AJ6 A;  4GS4 A;  5AG7 A;  1XMT A;  1QSN A;  4R3L A;  5F47 A;  5AG4 A;  4QVT A;  3QB8 A;  4R57 A;  2ZW5 A;  3H4Q A;  2REE A;  4B14 A;  2CNS A;  2FT0 A;  1YR0 A;  2OH1 A;  2JDD A;  4KLV A;  2P6G A;  4A33 A;  2YND A;  4PK2 A;  4F0Y A;  5JQ4 A;  4CAF A;  4F0X A;  3TCV A;  1M1D A;  4XNH C;  2B3U A;  5JPH A;  2FIW A;  3R1K A;  4H89 A;  4JXR A;  2WUU A;  4KOT A;  3KKW A;  1KUV A;  2B3V A;  2EVN A;  1NSL A;  4UBR A;  4F6A A;  2VXK A;  2JDC A;  3A9L A;  4EVY A;  2Q44 A;  4C2Y A;  4IF5 A;  2GIV A;  2ARH A;  4OAD A;  4KOW A;  4B11 A;  4UFX A;  1V0C A;  5F49 A;  2P6F A;  4KOY A;  4YGO A;  1CJW A;  2Q7B A;  1S3Z A;  1LRZ A;  3W6S A;  1Q2Y A;  1RO5 A;  4MJ8 A;  3K9U A;  1WK4 A;  3C26 A;  3PZJ A;  3TFY A;  4U5Y A;  5J8F A;  4DNC A;  5DWN A;  5HH1 A;  4BBH A;  4R9M A;  2R8V A;  1CM0 A;  4OAE A;  4XPL A;  3BJ7 A;  3I3G A;  2ZW6 A;  1KUX A;  4CGO A;  1S7N A;  4KOV A;  2CXA A;  3RYO A;  1KZF A;  3V8I A;  4HNW B;  3DR6 A;  3GY9 A;  1Q2C A;  3I9S A;  1XIX A;  2FL4 A;  5E96 A;  2RC4 A;  4A30 A;  2G3A A;  2R7H A;  4JJX A;  5J8C A;  2P6E A;  4IUS A;  3EFA A;  3EY5 A;  4OLL A;  4CRY B;  4FD4 A;  1MJ9 A;  2OZG A;  1MJA A;  2VI7 A;  2PDO A;  4FD5 A;  3LOD A;  4XPD C;  4Q38 A;  4FD7 A;  4KUB A;  2FIA A;  4HNX B;  4JD6 A;  5HMN A;  2Q0Y A;  4U9Z A;  2OZU A;  3GYA A;  2Z0Z A;  2DXQ A;  2B5G B;  3QAH A;  3PGP A;  3JVN A;  2BSW A;  1IIC A;  5A28 A;  1MJB A;  2B58 A;  3CXS A;  2X7B A;  3DR8 A;  2Z11 A;  1Z4R A;  5G22 A;  2CNT A;  3JUW A;  4CGN A;  3FBU A;  3D2P A;  1B87 A;  1Z9U A;  2VQY A;  2Q4V A;  1M4G A;  2FXF A;  2G3T A;  4KUA A;  4XPD B;  4KSF A;  3G8W A;  4E8O A;  1MK4 A;  2J8M A;  1S7K A;  1M4I A;  2GAN A;  4LUA A;  4UFV A;  1IID A;  5IB0 A;  4MI4 A;  2CNM A;  4MFZ A;  4UWI A;  3R9G A;  2A4N A;  3FYN A;  4CAX A;  4MY0 A;  4C68 A;  4BMH A;  2B5G A;  3IWG A;  2BEI A;  4AG7 A;  4H6U A;  3F8K A;  2HUZ A;  3GKR A;  3D8P A;  2DPT A;  1BO4 A;  4CGP A;  1YVO A;  1S7F A;  4MY3 A;  2PR1 A;  4CAV A;  2YNC C;  1YVK A;  4MFK A;  3SXO A;  1UFH A;  4QB9 A;  2NMT A;  5EBV A;  5EC4 A;  1QSM A;  2VZY A;  3IU1 A;  4Q36 A;  1KUY A;  3TOA A;  1Y9K A;  2PRB A;  4KOS A;  4CYO A;  4KOR A;  2EUI A;  2K5T A;  1YK3 A;  3EC4 A;  4CYQ A;  2I79 A;  4A95 A;  2BL1 A;  4R87 A;  3R9E A;  1R57 A;  4A2Z A;  3ZJ0 A;  4QUS A;  3DNS A;  1PU9 A;  2Q4Y A;  3FRM A;  4CS0 B;  5KTD A;  4MHD A;  4KVX A;  1RXT A;  2GE3 A;  4C7I A;  4M3S A;  4LX9 A;  3TO9 A;  4RS2 A;  4X5K A;  2R1I A;  4RI1 A;  3EXN A;  2OZH A;  3N7Z A;  3W6X A;  2FS5 A;  2FE7 A;  2I00 A;  4MBU A;  3TO6 A;  5AGE A;  5AG5 A;  5BWA B;  2F5I A;  1S5K A;  3FXT A;  2QML A;  4KLW A;  4PK3 A;  4KOX A;  2HQY A;  3BLN A;  4Y49 B;  5KTA A;  1L0C A;  1SQH A;  3VWE A;  3LD2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...