3F0AA

Structure of a putative n-acetyltransferase (ta0374) in complex with acetyl-coa from thermoplasma acidophilum
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
159
structure length
159
Chain Sequence
MSIEIRKLSIEDLETLIEVARESWKWTYAGIYSEEYIESWIREKYSKEKLLNEIVRSQSNLDILFLGAFADSTLIGFIELKIIANKAELLRLYLKPEYTHKKIGKTLLLEAEKIMKKKGILECRLYVHRQNSVGFSFYYKNGFKVEDTDGSDFIMEKKY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords N-ACETYLTRANSFERASE
publication title Crystal structure of the novel PaiA N-acetyltransferase from Thermoplasma acidophilum involved in the negative control of sporulation and degradative enzyme production.
pubmed doi rcsb
source organism Thermoplasma acidophilum
molecule tags Transferase
total genus 47
structure length 159
sequence length 159
ec nomenclature ec 2.3.1.57: Diamine N-acetyltransferase.
pdb deposition date 2008-10-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 3f0aA00
3V8IA 3H4QA 2JEVA 3D2MA 3EXNA 4H89A 1QSOA 2R8VA 2BUEA 4KVOE 2OZHA 1IYKA 3SXOA 4CS0B 4FD4A 4LX9A 4AVBA 4E2AA 1K4JA 5C82A 4PSXA 2C27A 1B6BA 4JXQA 3W6XA 4PK3A 2ZW4A 4PV6A 5EBVA 4RI1A 1Q2CA 3NE7A 3SHPA 2NMTA 2P6GA 2OH1A 5IV0A 1WWZA 1YREA 4L89A 5CNPA 4MY3A 2BL1A 3FNCA 2B58A 4KUAA 2EUIA 4B5PB 2ATRA 4KVXA 3DR6A 2ARHA 3B8GA 3K9UA 3TO6A 2FT0A 1I1DA 4JD6A 1RO5A 1I21A 3GY9A 2FSRA 1KZFA 3RYOA 2B4DB 3PGPA 5F49A 1M44A 3E0KA 3CXQA 2ZW7A 4KLWA 2Q7BA 5DWMA 3KKWA 2B4BA 2ZXVA 4ONUA 5F48A 4XNHB 5C88A 3BJ7A 3IGRA 4B5OA 5F46A 2R1IA 2BSWA 5JPHA 2WPXA 4QBJA 2CNTA 3ZZIA 2EVNA 2HV2A 4U9ZA 1KUXA 4CAXA 5KTAA 3TOAA 1BO4A 3TT2A 4II9A 4KOVA 5ISVA 4MI4A 5E96A 3TO7A 3JVNA 4XPKA 2R7HA 1KUYA 3S6GA 1B87A 2QIRA 4B5PA 2DXQA 2PDOA 3R1KA 2G0BA 3TCVA 2K5TA 2Z11A 4CAVA 1BOBA 4MHDA 4ZBGA 2JDDA 2REEA 2D4PA 1MJBA 2QMLA 4NEXA 4GS4A 1Y9WA 3ZJ0A 3W6SA 2ZW6A 2B4DA 1MK4A 1S60A 2OU2A 2QECA 2HUZA 3DR8A 3FIXA 1VKCA 4KOXA 1XMTA 1QSTA 3LD2A 1YX0A 4XNHC 3EC4A 4HNWB 2IL4A 2CNMA 1YVOA 3PZJA 4K30A 2B5GA 3BLNA 1Q2YA 2X7BA 2AE6A 4IUSA 2JDCA 4R9MA 4X5KA 2Y0MA 5DWNA 2VI7A 2Q04A 4KLVA 4MY0A 2CY2A 1M4GA 3EFAA 4E8OA 2PR1A 3VWDA 5I0CA 1M4DA 1KUVA 1IYLA 4H6ZA 2G3TA 1VHSA 4PK2A 3TO9A 2Q4VA 2VEZA 2OZGA 4HNYB 2GANA 4JXRA 4R3LA 2G3AA 4YGOA 4L8AA 4XPLA 1YR0A 1GHEA 5IX3A 1QSMA 3OWCA 4KOTA 3LODA 4Y49B 2Z0ZA 3FRMA 1Q2DA 4JLYA 4EVYA 2OB0A 2A4NA 1NMTA 1XF8A 2P6EA 2OZUA 4NXYA 2Q0YA 3I3GA 4UA3A 2GIVA 1S7KA 1UFHA 2VXKA 3I9SA 3R9FA 4M85A 4CRYB 1IICA 3FBUA 4XPDB 4HNXB 2PRBA 1YVKA 2AJ6A 2B5GB 4OADA 1Z4RA 4NCZA 3FYNA 4E0AA 4AG9A 2VBQA 4JJXA 3WR7A 4KZTA 2PR8A 1Z4EA 2REFA 4MJ8A 4R3KA 4AB7A 5J8CA 1RXTA 1U6MA 5F47A 3EY5A 2I79A 1PU9A 4OAEA 2PQ8A 3F8KA 3BJ8A 2BEIA 2J8MA 4M3SA 2HQYA 1S7NA 2Q44A 4OLLA 1QSRA 1YK3A 4NF1A 4YRHA 5IB0A 5EC4A 4ORFA 4BMHA 2VZYA 5FVJA 2F5IA 4Y49C 3R9GA 1NSLA 5H84A 2Q4YA 4FD5A 1YLEA 1Z9UA 2J8NA 2VZZA 3S6FA 1FY7A 1QSNA 4I49A 1P4NA 4KOYA 2FCKA 1L0CA 1Y9KA 4UBRA 2FE7A 3T90A 1XE4A 1MJ9A 4UWJA 1YGHA 3F0AA 1R57A 3R9EA 3GYAA 2ZW5A 1S3ZA 1CM0A 1M4IA 2B3UA 3UY5A 4XPDC 3VWEA 1ON0A 4F6AA 4QC6A 1XEBA 2B3VA 4U9YA 2FIAA 3CXPA 4HKFA 1J4JA 3JUWA 4PSWA 2PSWA 4JWPA 3DDDA 4R87A 5KTDA 2P0WA 1NE9A 3D3SA 4AG7A 4LUAA 4YFJA 3TFYA 2FL4A 4DNCA 2WPWA 4KORA 4MBUA 1TIQA 3R95A 1WK4A 3R96A 4KOSA 4KVME 5HMNA 4H6UA 3FB3A 4KOWA 3S6KA 4CAWA 1Y7RA 1M1DA 5H86A 4F0YA 5JQ4A 4AVAA 4FD7A 3D2PA 5GCNA 3G3SA 2RC4A 3S6HA 3W91A 4R57A 1S5KA 3P2HA 2VQYA 1OZPA 1N71A 3MGDA 2P6FA 2J8RA 4KUBA 3FXTA 1SQHA 3PP9A 4KOUA 2R98A 4IF5A 2PC1A 4RS2A 1MJAA 3DSBA 1S7LA 1IIDA 2GE3A 3IWGA 3QB8A 3SXNA 2JLMA 3D8PA 5HH1A 1LRZA 4QUSA 1CJWA 2ZPAA 4AVCA 1V0CA 4U5YA 1I12A 2FS5A 2I00A 3QAHA 4QVTA 2FIWA 4CRZB 4J3GA 3EO4A 5KTCA 3P2FA 4QB9A 1PUAA 5J8FA 3GKRA 2D4OA 2Z10A 3DNSA 1IB1E 4UWIA 1S7FA 4NSQA 3TTHA 3N7ZA 3CXSA 2CNSA 3C26A 3G8WA 4FD6A 3T9YA 3TE4A 2KCWA 3F5BA 1P0HA 1XIXA 3TOBA 2H5MA 2O28A 2FXFA
chains in the Genus database with same CATH superfamily
3V8IA 1ZG9A 3H4QA 2JEVA 3D2MA 2PE3A 4CGMA 1R43A 3EXNA 4WWVA 4H89A 1QSOA 2R8VA 4GXHA 2BUEA 4KVOE 2OZHA 3RAMA 5HVHA 1IYKA 3KASA 3SXOA 2O53A 4KS9A 4TWEA 1OBRA 4CS0B 4NJQA 4FD4A 4LX9A 4AVBA 4E2AA 2IQ6A 2GLJA 1K4JA 4RN7A 4ZI6A 4PSXA 4CPAA 5C82A 5A28A 1HDUA 2C27A 1B6BA 2ZENA 3FECA 4O23A 4JXQA 3W6XA 4NGMA 4P6YA 4PK3A 2PJ9A 3D7GA 3T8WA 4BD9A 2ZW4A 4PV6A 5EBVA 4RI1A 1Q2CA 3A9LA 1ZLHA 3LACA 3NE7A 3FF3A 5AG5A 3SHPA 3NA6A 2NMTA 2P6GA 2OH1A 5IV0A 1CG2A 1WWZA 1YREA 3JTKA 2G9DA 4L89A 2ZOFA 5CNPA 2Z3KA 4PXDA 2PJ3A 4MY3A 2BL1A 3FNCA 2Z3OA 3NH8A 3FEEA 2B58A 4KUAA 1Z8TA 2EUIA 2ZEEA 5AG7A 2ATRA 4B5PB 4KVXA 3DR6A 1XBUA 2ARHA 3KHZA 3IWEA 3B8GA 3K9UA 4UCNA 3TO6A 1XOVA 2Q7SA 4UFXA 1FNOA 2FT0A 3I1UA 3WABA 1I1DA 2PJ4A 1RO5A 2Q4ZA 4GM5A 4IK2A 4JD6A 4MCRA 5JM6A 1AYEA 1I21A 2FSRA 3B3CA 3GY9A 1KZFA 3WT4A 4R6TA 3KGQA 2ZEGA 2IMOA 3RYOA 1DTDA 2PJ6A 2B4DB 3PGPA 5I4MA 4C7IA 3D68A 5K8PA 2DPTA 5F49A 1M44A 2Z3LA 3E0KA 3CXQA 1Z5RA 2ZW7A 4KLWA 1TKFA 1Z8WA 2Q7BA 1JQGA 5DWMA 2YGWA 1GYTA 2BCOA 5LYLA 3KKWA 2B4BA 3SJEA 3GLJA 2ZXVA 4ONUA 5F48A 4XNHB 5C88A 3BJ7A 3IGRA 3BI0A 4B5OA 5F46A 2R1IA 2BSWA 4F8ZA 2PIZA 3TC8A 3WC5A 4B12A 2ZEMA 4Q7AA 3ISZA 5JPHA 2WPXA 4QBJA 2CNTA 4R8FA 3BXMA 3ZZIA 3IC1A 2EVNA 4ZYQA 2HV2A 4U9ZA 1KUXA 4ZGYB 4NGTA 4CAXA 4MFJA 4ZY1A 5KTAA 4PPZA 2PJBA 5AG6A 3TOAA 1BO4A 4BINA 4B13A 3TT2A 4II9A 5CPAA 1XRYA 2GLFA 4UEEA 4CAEA 4KOVA 1ZLIA 3B3TA 2GREA 1CPSA 2VL1A 5ISVA 3H5ZA 4MI4A 4MFLA 5E96A 1CP7A 3TO7A 4LQ6A 3JVNA 4NGQA 4P4DA 4XPKA 3NE8A 2R7HA 2Z3PA 4F9VA 1KUYA 3S6GA 4DJLA 2PJ0A 1B87A 4EFDA 2QIRA 4B5PA 2DXQA 2ZEOA 2PDOA 3R1KA 3K2KA 4A33A 2G0BA 3ISXA 5G22A 2CF4A 3IFEA 3TCVA 3CPXA 2K5TA 2XEGA 2Z11A 3KZWA 4CAVA 1BOBA 4PQAA 1F2PA 4MHDA 4ZBGA 2JDDA 2REEA 2D4PA 1MJBA 2QMLA 4NEXA 1F2OA 1KWMA 4GS4A 4A94A 4CGPA 1Y9WA 3ZJ0A 1BPNA 1R3NA 4RUHA 4NGRA 4OC1A 3W6SA 5IB9A 4ZX9A 2ZW6A 1ARMA 4C2ZA 2B4DA 4EMEA 1MK4A 1S60A 2OU2A 2DEAA 2QECA 3RZAA 3S9NA 2HUZA 4G1PA 2Q43A 3DR8A 3FIXA 3PRTA 4P4FA 2FVGA 1VKCA 2ZEHA 4KOXA 1ZO0A 1CP6A 2PVVA 3KI9A 4YU9A 1XMTA 2ZEPA 1QSTA 3PB9X 1AUGA 3LD2A 4OIDA 2AFMA 4FUUA 1YX0A 3IEHA 4XNHC 4MFKA 4X8IA 3IU1A 4WJBA 3EC4A 4HNWB 1TF8A 2IL4A 3IO1A 2CNMA 1TXRA 1YVOA 3D4UA 3FX6A 4M6IA 3KR5A 3PZJA 4K30A 1Q7LA 2B5GA 3BLNA 3B3SA 3FJUA 4KSFA 2JBJA 1H8LA 4R76A 4A32A 2I3CA 5K8MA 3D67A 1Q2YA 2X7BA 4FBEA 2YNDA 2AE6A 2Z3MA 4IUSA 3N5FA 5J1QA 2JDCA 3PFOA 4R9MA 4X5KA 2Y0MA 5DWNA 2VI7A 1YLOA 4CGOA 5JH9A 2JEWA 2EO8A 3KQZA 2Q04A 4ZX8A 4KLVA 4MY0A 4CAFA 2CY2A 1M4GA 3EFAA 3KQXA 2ANPA 1Y0RA 4A38A 4E8OA 2J9AA 4IHMA 2PR1A 3H8GA 3VWDA 5I0CA 2V8GA 1M4DA 1KUVA 1IYLA 4H6ZA 5HVFA 1Z8XA 4NGNA 3SJFA 4M6HA 3S9LA 1ZG8A 2G3TA 1VHSA 4P4IA 4LQGA 4PK2A 3TO9A 2CTCA 3SI1A 4P4BA 5CBMA 2Q4VA 2VEZA 1X12A 2OZGA 2ABZA 2WYRA 4HNYB 2BOAA 2V8HA 2GANA 3SJXA 4FWUA 4JXRA 4R3LA 2G3AA 4UIBA 4YGOA 4L8AA 4XPLA 1YR0A 1GHEA 5IX3A 1QSMA 2NYQA 1ELLP 3OWCA 4KOTA 4C68A 3LODA 5A27A 4Y49B 2Z0ZA 1BLLE 1Z2LA 2OR4A 3FRMA 5LYDA 1Q2DA 4MXUA 5ELYA 1CX8A 1IY7A 4JLYA 4P4JA 4EVYA 2DF5A 2OB0A 2AFXA 4K3NA 2A4NA 4A37A 4PXBA 1BAVA 3IIBA 1NMTA 1XF8A 2P6EA 2OZUA 4NXYA 2Q0YA 3I3GA 4UA3A 2GIVA 4P4EA 4CGNA 3B35A 4MHPA 1S7KA 2V77A 4P45A 3RBUA 1UFHA 2VXKA 3I9SA 3R9FA 3KR4A 4M85A 4CRYB 1IICA 3FBUA 2Q51A 3IWWA 4XPDB 4HNXB 2PRBA 5LYFA 3GB0A 1YVKA 2AJ6A 2B5GB 4OADA 1ELMP 1Z4RA 4NCZA 1PCAA 3MRUA 1YQEA 2PJAA 3FYNA 4AG9A 4E0AA 2VBQA 3PEIA 1VGYA 4OMEA 4P44A 4JJXA 1ZG7A 3WC7A 3MN8A 1ARLA 3WR7A 4B6ZA 4KZTA 3LWUA 3K9TA 2PR8A 4H2KA 3BI1A 1Z4EA 2REFA 4AXVA 1LANA 2JBKA 2CXAA 4C2YA 4MJ8A 1IOFA 5HVGA 3WC6A 1JWQA 4R3KA 1VHEA 4AB7A 1TKJA 5J8CA 1XFOA 1RXTA 1U6MA 5F47A 3CZXA 4MFZA 3EY5A 4DYOA 2I79A 1PU9A 3PB6X 2PQ8A 4JYWA 4OAEA 3F8KA 3BJ8A 4NGSA 2AFOA 2BEIA 2J8MA 5JGFA 4M3SA 2HQYA 1S7NA 2ODFA 3RO0A 1AMPA 2XEIA 4B14A 3NH4A 4R7MA 2Q44A 2ZELA 3IJ3A 2EWBA 4UFVA 1UWYA 3SJGA 2XEJA 1QSRA 2HC9A 3CT9A 4OLLA 5G21A 6CPAA 1YK3A 4NF1A 1HEEA 4YRHA 5IB0A 5EC4A 4ORFA 4UIAA 2VZYA 5FVJA 4BMHA 2F5IA 4Y49C 3R9GA 3FEDA 1LCPA 5H84A 1NSLA 2Q4YA 4FD5A 1YLEA 1Z9UA 2J8NA 1FT7A 2AFWA 2PJ2A 2VZZA 4MFQA 3S6FA 3VARA 1FY7A 1QSNA 4I49A 3JRUA 1HDQA 1Y0YA 2AFUA 1P4NA 2PJ1A 4KOYA 1CPXA 2RB7A 1QQ9A 2FCKA 4MCSA 1L0CA 4M6GA 1Y9KA 2WZNA 2FE7A 4UBRA 3T90A 1XE4A 1MJ9A 1XJOA 4UWJA 2PJ8A 1YGHA 3F0AA 1R57A 4MRIA 3R9EA 3GYAA 5K8NA 2ZW5A 3L2NA 4UCPA 1S3ZA 4UEFA 1CM0A 1M4IA 3PFEA 2B3UA 2CIJA 4XPDC 3UY5A 4OKOA 3VWEA 3VH9A 1VIXA 1ON0A 4F6AA 4QC6A 1XEBA 2B3VA 4U9YA 2FIAA 3TX8A 5BWAB 3CXPA 4HKFA 1J4JA 3JUWA 2OOTA 4PSWA 4TNUA 1IGBA 2PSWA 4Z65A 4JWPA 3DDDA 3PB8X 2PJCA 4R87A 4DUKA 5KTDA 4EWTA 1RTQA 2P0WA 4Q38A 2XEFA 1NE9A 4MCQA 5AGEA 5AG4A 3D3SA 1BPMA 5G20A 4LUAA 4AG7A 3H8EA 3RNZA 4KSAA 4YFJA 3TFYA 2FL4A 4OP4A 3D7FA 4CYPA 4DNCA 2QJ8A 2PIYA 3SI2A 5F09A 3DLJA 4CYQA 2WPWA 4KORA 4OC4A 1F57A 3CDXA 5D29A 3NFZA 2WUUA 4C7HA 4MBUA 4UCMA 4UFWA 3IU2A 3FH4A 1TIQA 5DS0A 4UEZA 4MCPA 3R95A 1A2ZA 1WK4A 4X2TA 2PJ7A 5LYIA 3R96A 2V8DA 4MHYA 4KOSA 4KVME 3BHXA 4X3RA 5HMNA 3QAYA 4A2ZA 1IOIA 4H6UA 1TF9A 3FB3A 4BBHA 4KOWA 3S6KA 2AFZA 3H8FA 3B2YA 2NSMA 4CAWA 1PYTB 1Y7RA 1IU8A 4A30A 2GU2A 2DPSA 1M1DA 2ZOGA 5H86A 1DE4C 5G1ZA 4F0YA 2PCUA 4MFPA 3CPAA 4OC2A 5JQ4A 5K8OA 4AVAA 4FD7A 3D2PA 7CPAA 5GCNA 4OC0A 4ONWA 4NJRA 4OC5A 1LOKA 3G3SA 2AFSA 8CPAA 4OIWA 2RC4A 3PB4X 2PVWA 3S6HA 3KHXA 1X10A 3SI0A 5LRGA 4R57A 3W91A 4CYOA 1YW6A 1S5KA 2F7VA 3PB7X 3P2HA 2VQYA 1M4LA 1N71A 1OZPA 4A39A 3MGDA 2P6FA 2J8RA 4IAVA 4NGPA 1XMBA 4Q36A 4KUBA 4CGLA 4OC3A 3FXTA 1SQHA 4B11A 4CYNA 3PP9A 4KOUA 1NSAA 2CTBA 2EBJA 2EK9A 2R98A 1LAMA 4A95A 4MMOA 3PBEA 1CBXA 3LMSA 2HB6A 3KL9A 4IF5A 2PC1A 2RFHA 5LRKA 5LRJA 4RS2A 2IJZA 5EMIA 3D66A 4P10A 1MJAA 2ZEDA 3DSBA 2Z3NA 2PRQA 1S7LA 3S9MA 1IIDA 3GUXA 2GE3A 2V8VA 3IWGA 4A31A 4F0XA 3QB8A 3SXNA 4W9YA 2C6GA 2POKA 2WSAA 3DGVA 4PXCA 2JLMA 1TKHA 1YMEA 1QMUA 2YNCA 2YNEA 3D8PA 1LRZA 2YNCC 5HH1A 4QUSA 3B3WA 3B7IA 1CJWA 2ZPAA 4MHZA 4AVCA 1V0CA 4U5YA 3B3VA 1I12A 2FS5A 1EE3P 2I00A 3QAHA 4QVTA 2FIWA 4CRZB 2C6PA 4J3GA 3EO4A 5KTCA 2ZEFA 4PXEA 4ZY2A 3P2FA 4QB9A 4F9UA 2O4HA 4KSIA 1PUAA 3V38A 3NH5A 5J8FA 2QYVA 1LAPA 1YSJA 3GKRA 2D4OA 3VATA 2BO9A 2Z10A 1Y7EA 3DNSA 1IB1E 4UF4A 3GIUA 3PBBA 4UWIA 3HUVA 3V7ZA 5HXDA 1S7FA 4NSQA 1VHOA 3TTHA 2PJ5A 3N7ZA 3CXSA 3HLPA 2C6CA 5THWA 2CNSA 2F8HA 1LFWA 4ZY0A 3D7DA 3C26A 4MHNA 3G8WA 4YWYA 4FAIA 4FD6A 4C2XA 2C1CA 3T9YA 3TE4A 2KCWA 3F5BA 1P0HA 4B10A 1XIXA 1Z8LA 3FVLA 2GFQA 4JZ0A 3QNVA 3TOBA 3D7HA 3FMCA 4NFRA 1YW4A 2H5MA 2QVPA 2O28A 5D8NA 4HPSA 2EK8A 2FXFA
chains in the Genus database with same CATH topology
3V8IA 3H4QA 2JEVA 3D2MA 4CGMA 3EXNA 4H89A 1QSOA 2R8VA 2BUEA 4KVOE 2OZHA 1IYKA 3SXOA 4KS9A 4CS0B 4FD4A 4LX9A 4AVBA 4E2AA 1K4JA 5C82A 4PSXA 5A28A 2C27A 1B6BA 4JXQA 3W6XA 4PK3A 2ZW4A 4PV6A 5EBVA 4RI1A 1Q2CA 3A9LA 3NE7A 5AG5A 3SHPA 2NMTA 2P6GA 2OH1A 5IV0A 1WWZA 1YREA 3JTKA 4L89A 5CNPA 2Z3KA 4MY3A 2BL1A 3FNCA 2Z3OA 2B58A 4KUAA 2EUIA 5AG7A 4B5PB 2ATRA 4KVXA 3DR6A 2ARHA 3IWEA 3B8GA 3K9UA 4UCNA 3TO6A 4UFXA 2FT0A 1I1DA 4JD6A 1RO5A 1I21A 3GY9A 2FSRA 1KZFA 3RYOA 2B4DB 3PGPA 4C7IA 2DPTA 5F49A 1M44A 2Z3LA 3E0KA 3CXQA 2ZW7A 4KLWA 2Q7BA 5DWMA 2YGWA 3KKWA 2B4BA 2ZXVA 4ONUA 5F48A 4XNHB 5C88A 3BJ7A 3IGRA 4B5OA 5F46A 2R1IA 2BSWA 4B12A 5JPHA 2WPXA 4QBJA 2CNTA 3ZZIA 2EVNA 2HV2A 4U9ZA 1KUXA 4ZGYB 4CAXA 4MFJA 5KTAA 5AG6A 3TOAA 1BO4A 4B13A 3TT2A 4II9A 4CAEA 4KOVA 5ISVA 3H5ZA 4MI4A 4MFLA 5E96A 3TO7A 3JVNA 4XPKA 2R7HA 2Z3PA 1KUYA 3S6GA 1B87A 2QIRA 4B5PA 2DXQA 2PDOA 3R1KA 4A33A 2G0BA 5G22A 3TCVA 2K5TA 2Z11A 4CAVA 1BOBA 4MHDA 4ZBGA 2JDDA 2REEA 2D4PA 1MJBA 2QMLA 4NEXA 4GS4A 4CGPA 1Y9WA 3ZJ0A 3W6SA 2ZW6A 4C2ZA 2B4DA 1MK4A 1S60A 2OU2A 2QECA 2HUZA 3DR8A 3FIXA 1VKCA 4KOXA 1ZO0A 1XMTA 1QSTA 3LD2A 1YX0A 4XNHC 4MFKA 3IU1A 3EC4A 4HNWB 2IL4A 2CNMA 1YVOA 3PZJA 4K30A 2B5GA 3BLNA 4KSFA 4A32A 1Q2YA 2X7BA 2YNDA 2AE6A 2Z3MA 4IUSA 2JDCA 4R9MA 4X5KA 2Y0MA 5DWNA 2VI7A 4CGOA 2Q04A 4KLVA 4MY0A 4CAFA 2CY2A 1M4GA 3EFAA 4E8OA 2PR1A 3VWDA 5I0CA 1M4DA 4H6ZA 1IYLA 1KUVA 2G3TA 1VHSA 4PK2A 3TO9A 2Q4VA 2VEZA 2OZGA 4HNYB 2GANA 4JXRA 4R3LA 2G3AA 4YGOA 4L8AA 4XPLA 1YR0A 1GHEA 5IX3A 1QSMA 3OWCA 4KOTA 4C68A 3LODA 5A27A 4Y49B 2Z0ZA 3FRMA 1Q2DA 4JLYA 4EVYA 2OB0A 2A4NA 1NMTA 1XF8A 2P6EA 2OZUA 4NXYA 2Q0YA 3I3GA 4UA3A 2GIVA 4CGNA 1S7KA 1UFHA 2VXKA 3I9SA 3R9FA 4M85A 4CRYB 1IICA 3FBUA 4XPDB 4HNXB 2PRBA 1YVKA 2AJ6A 2B5GB 4OADA 1Z4RA 4NCZA 3FYNA 4E0AA 4AG9A 2VBQA 4JJXA 3WR7A 4KZTA 2PR8A 1Z4EA 2REFA 4C2YA 2CXAA 4MJ8A 4R3KA 4AB7A 5J8CA 1RXTA 1U6MA 5F47A 4MFZA 3EY5A 2I79A 1PU9A 4OAEA 2PQ8A 3F8KA 3BJ8A 2BEIA 2J8MA 4M3SA 2HQYA 1S7NA 4B14A 2Q44A 4UFVA 4OLLA 1QSRA 5G21A 1YK3A 4NF1A 4YRHA 5IB0A 5EC4A 4ORFA 4BMHA 2VZYA 5FVJA 2F5IA 4Y49C 3R9GA 1NSLA 5H84A 2Q4YA 4FD5A 1YLEA 1Z9UA 2J8NA 2VZZA 3S6FA 4MFQA 1FY7A 1QSNA 4I49A 1P4NA 4KOYA 2FCKA 1L0CA 1Y9KA 4UBRA 2FE7A 3T90A 1XE4A 1MJ9A 4UWJA 1YGHA 3F0AA 1R57A 3R9EA 3GYAA 2ZW5A 4UCPA 1S3ZA 1CM0A 1M4IA 2B3UA 3UY5A 4XPDC 3VWEA 1ON0A 4F6AA 4QC6A 1XEBA 2B3VA 4U9YA 2FIAA 5BWAB 3CXPA 4HKFA 1J4JA 3JUWA 4PSWA 2PSWA 4JWPA 3DDDA 4R87A 5KTDA 2P0WA 4Q38A 1NE9A 5AGEA 5AG4A 3D3SA 5G20A 4LUAA 4AG7A 4KSAA 4YFJA 3TFYA 2FL4A 4CYPA 4DNCA 4CYQA 2WPWA 4KORA 2WUUA 4C7HA 4MBUA 4UCMA 4UFWA 3IU2A 1TIQA 3R95A 1WK4A 3R96A 4KOSA 4KVME 5HMNA 4A2ZA 4H6UA 3FB3A 4BBHA 4KOWA 3S6KA 4CAWA 1Y7RA 4A30A 2DPSA 1M1DA 5H86A 5G1ZA 4F0YA 4MFPA 5JQ4A 4AVAA 4FD7A 3D2PA 5GCNA 3G3SA 2RC4A 3S6HA 3W91A 4R57A 4CYOA 1S5KA 3P2HA 2VQYA 1OZPA 1N71A 3MGDA 2P6FA 2J8RA 4Q36A 4CGLA 4KUBA 3FXTA 1SQHA 4B11A 4CYNA 3PP9A 4KOUA 2R98A 4A95A 4IF5A 2PC1A 4RS2A 1MJAA 3DSBA 2Z3NA 1S7LA 1IIDA 2GE3A 3IWGA 4A31A 4F0XA 3QB8A 3SXNA 2WSAA 2JLMA 2YNCA 3D8PA 2YNEA 5HH1A 1LRZA 2YNCC 4QUSA 1CJWA 2ZPAA 4AVCA 1V0CA 4U5YA 1I12A 2FS5A 2I00A 3QAHA 4QVTA 2FIWA 4CRZB 4J3GA 3EO4A 5KTCA 3P2FA 4QB9A 1PUAA 5J8FA 3GKRA 2D4OA 2Z10A 3DNSA 1IB1E 4UWIA 1S7FA 4NSQA 3TTHA 3N7ZA 3CXSA 2CNSA 3C26A 3G8WA 4FD6A 4C2XA 3T9YA 3TE4A 2KCWA 3F5BA 1P0HA 4B10A 1XIXA 3TOBA 2H5MA 2O28A 2FXFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3V8I A;  3H4Q A;  2JEV A;  3D2M A;  3EXN A;  4H89 A;  1QSO A;  2R8V A;  2BUE A;  4KVO E;  2OZH A;  1IYK A;  3SXO A;  4CS0 B;  4FD4 A;  4LX9 A;  4AVB A;  4E2A A;  1K4J A;  5C82 A;  4PSX A;  2C27 A;  1B6B A;  4JXQ A;  3W6X A;  4PK3 A;  2ZW4 A;  4PV6 A;  5EBV A;  4RI1 A;  1Q2C A;  3NE7 A;  3SHP A;  2NMT A;  2P6G A;  2OH1 A;  5IV0 A;  1WWZ A;  1YRE A;  4L89 A;  5CNP A;  4MY3 A;  2BL1 A;  3FNC A;  2B58 A;  4KUA A;  2EUI A;  4B5P B;  2ATR A;  4KVX A;  3DR6 A;  2ARH A;  3B8G A;  3K9U A;  3TO6 A;  2FT0 A;  1I1D A;  4JD6 A;  1RO5 A;  1I21 A;  3GY9 A;  2FSR A;  1KZF A;  3RYO A;  2B4D B;  3PGP A;  5F49 A;  1M44 A;  3E0K A;  3CXQ A;  2ZW7 A;  4KLW A;  2Q7B A;  5DWM A;  3KKW A;  2B4B A;  2ZXV A;  4ONU A;  5F48 A;  4XNH B;  5C88 A;  3BJ7 A;  3IGR A;  4B5O A;  5F46 A;  2R1I A;  2BSW A;  5JPH A;  2WPX A;  4QBJ A;  2CNT A;  3ZZI A;  2EVN A;  2HV2 A;  4U9Z A;  1KUX A;  4CAX A;  5KTA A;  3TOA A;  1BO4 A;  3TT2 A;  4II9 A;  4KOV A;  5ISV A;  4MI4 A;  5E96 A;  3TO7 A;  3JVN A;  4XPK A;  2R7H A;  1KUY A;  3S6G A;  1B87 A;  2QIR A;  4B5P A;  2DXQ A;  2PDO A;  3R1K A;  2G0B A;  3TCV A;  2K5T A;  2Z11 A;  4CAV A;  1BOB A;  4MHD A;  4ZBG A;  2JDD A;  2REE A;  2D4P A;  1MJB A;  2QML A;  4NEX A;  4GS4 A;  1Y9W A;  3ZJ0 A;  3W6S A;  2ZW6 A;  2B4D A;  1MK4 A;  1S60 A;  2OU2 A;  2QEC A;  2HUZ A;  3DR8 A;  3FIX A;  1VKC A;  4KOX A;  1XMT A;  1QST A;  3LD2 A;  1YX0 A;  4XNH C;  3EC4 A;  4HNW B;  2IL4 A;  2CNM A;  1YVO A;  3PZJ A;  4K30 A;  2B5G A;  3BLN A;  1Q2Y A;  2X7B A;  2AE6 A;  4IUS A;  2JDC A;  4R9M A;  4X5K A;  2Y0M A;  5DWN A;  2VI7 A;  2Q04 A;  4KLV A;  4MY0 A;  2CY2 A;  1M4G A;  3EFA A;  4E8O A;  2PR1 A;  3VWD A;  5I0C A;  1M4D A;  1KUV A;  1IYL A;  4H6Z A;  2G3T A;  1VHS A;  4PK2 A;  3TO9 A;  2Q4V A;  2VEZ A;  2OZG A;  4HNY B;  2GAN A;  4JXR A;  4R3L A;  2G3A A;  4YGO A;  4L8A A;  4XPL A;  1YR0 A;  1GHE A;  5IX3 A;  1QSM A;  3OWC A;  4KOT A;  3LOD A;  4Y49 B;  2Z0Z A;  3FRM A;  1Q2D A;  4JLY A;  4EVY A;  2OB0 A;  2A4N A;  1NMT A;  1XF8 A;  2P6E A;  2OZU A;  4NXY A;  2Q0Y A;  3I3G A;  4UA3 A;  2GIV A;  1S7K A;  1UFH A;  2VXK A;  3I9S A;  3R9F A;  4M85 A;  4CRY B;  1IIC A;  3FBU A;  4XPD B;  4HNX B;  2PRB A;  1YVK A;  2AJ6 A;  2B5G B;  4OAD A;  1Z4R A;  4NCZ A;  3FYN A;  4E0A A;  4AG9 A;  2VBQ A;  4JJX A;  3WR7 A;  4KZT A;  2PR8 A;  1Z4E A;  2REF A;  4MJ8 A;  4R3K A;  4AB7 A;  5J8C A;  1RXT A;  1U6M A;  5F47 A;  3EY5 A;  2I79 A;  1PU9 A;  4OAE A;  2PQ8 A;  3F8K A;  3BJ8 A;  2BEI A;  2J8M A;  4M3S A;  2HQY A;  1S7N A;  2Q44 A;  4OLL A;  1QSR A;  1YK3 A;  4NF1 A;  4YRH A;  5IB0 A;  5EC4 A;  4ORF A;  4BMH A;  2VZY A;  5FVJ A;  2F5I A;  4Y49 C;  3R9G A;  1NSL A;  5H84 A;  2Q4Y A;  4FD5 A;  1YLE A;  1Z9U A;  2J8N A;  2VZZ A;  3S6F A;  1FY7 A;  1QSN A;  4I49 A;  1P4N A;  4KOY A;  2FCK A;  1L0C A;  1Y9K A;  4UBR A;  2FE7 A;  3T90 A;  1XE4 A;  1MJ9 A;  4UWJ A;  1YGH A;  3F0A A;  1R57 A;  3R9E A;  3GYA A;  2ZW5 A;  1S3Z A;  1CM0 A;  1M4I A;  2B3U A;  3UY5 A;  4XPD C;  3VWE A;  1ON0 A;  4F6A A;  4QC6 A;  1XEB A;  2B3V A;  4U9Y A;  2FIA A;  3CXP A;  4HKF A;  1J4J A;  3JUW A;  4PSW A;  2PSW A;  4JWP A;  3DDD A;  4R87 A;  5KTD A;  2P0W A;  1NE9 A;  3D3S A;  4AG7 A;  4LUA A;  4YFJ A;  3TFY A;  2FL4 A;  4DNC A;  2WPW A;  4KOR A;  4MBU A;  1TIQ A;  3R95 A;  1WK4 A;  3R96 A;  4KOS A;  4KVM E;  5HMN A;  4H6U A;  3FB3 A;  4KOW A;  3S6K A;  4CAW A;  1Y7R A;  1M1D A;  5H86 A;  4F0Y A;  5JQ4 A;  4AVA A;  4FD7 A;  3D2P A;  5GCN A;  3G3S A;  2RC4 A;  3S6H A;  3W91 A;  4R57 A;  1S5K A;  3P2H A;  2VQY A;  1OZP A;  1N71 A;  3MGD A;  2P6F A;  2J8R A;  4KUB A;  3FXT A;  1SQH A;  3PP9 A;  4KOU A;  2R98 A;  4IF5 A;  2PC1 A;  4RS2 A;  1MJA A;  3DSB A;  1S7L A;  1IID A;  2GE3 A;  3IWG A;  3QB8 A;  3SXN A;  2JLM A;  3D8P A;  5HH1 A;  1LRZ A;  4QUS A;  1CJW A;  2ZPA A;  4AVC A;  1V0C A;  4U5Y A;  1I12 A;  2FS5 A;  2I00 A;  3QAH A;  4QVT A;  2FIW A;  4CRZ B;  4J3G A;  3EO4 A;  5KTC A;  3P2F A;  4QB9 A;  1PUA A;  5J8F A;  3GKR A;  2D4O A;  2Z10 A;  3DNS A;  1IB1 E;  4UWI A;  1S7F A;  4NSQ A;  3TTH A;  3N7Z A;  3CXS A;  2CNS A;  3C26 A;  3G8W A;  4FD6 A;  3T9Y A;  3TE4 A;  2KCW A;  3F5B A;  1P0H A;  1XIX A;  3TOB A;  2H5M A;  2O28 A;  2FXF A; 
#chains in the Genus database with same CATH topology
 3V8I A;  1ZG9 A;  3H4Q A;  2JEV A;  3D2M A;  2PE3 A;  4CGM A;  1R43 A;  3EXN A;  4WWV A;  4H89 A;  1QSO A;  2R8V A;  4GXH A;  2BUE A;  4KVO E;  2OZH A;  3RAM A;  5HVH A;  1IYK A;  3KAS A;  3SXO A;  2O53 A;  4KS9 A;  4TWE A;  1OBR A;  4CS0 B;  4NJQ A;  4FD4 A;  4LX9 A;  4AVB A;  4E2A A;  2IQ6 A;  2GLJ A;  1K4J A;  4RN7 A;  4ZI6 A;  4PSX A;  4CPA A;  5C82 A;  5A28 A;  1HDU A;  2C27 A;  1B6B A;  2ZEN A;  3FEC A;  4O23 A;  4JXQ A;  3W6X A;  4NGM A;  4P6Y A;  4PK3 A;  2PJ9 A;  3D7G A;  3T8W A;  4BD9 A;  2ZW4 A;  4PV6 A;  5EBV A;  4RI1 A;  1Q2C A;  3A9L A;  1ZLH A;  3LAC A;  3NE7 A;  3FF3 A;  5AG5 A;  3SHP A;  3NA6 A;  2NMT A;  2P6G A;  2OH1 A;  5IV0 A;  1CG2 A;  1WWZ A;  1YRE A;  3JTK A;  2G9D A;  4L89 A;  2ZOF A;  5CNP A;  2Z3K A;  4PXD A;  2PJ3 A;  4MY3 A;  2BL1 A;  3FNC A;  2Z3O A;  3NH8 A;  3FEE A;  2B58 A;  4KUA A;  1Z8T A;  2EUI A;  2ZEE A;  5AG7 A;  2ATR A;  4B5P B;  4KVX A;  3DR6 A;  1XBU A;  2ARH A;  3KHZ A;  3IWE A;  3B8G A;  3K9U A;  4UCN A;  3TO6 A;  1XOV A;  2Q7S A;  4UFX A;  1FNO A;  2FT0 A;  3I1U A;  3WAB A;  1I1D A;  2PJ4 A;  1RO5 A;  2Q4Z A;  4GM5 A;  4IK2 A;  4JD6 A;  4MCR A;  5JM6 A;  1AYE A;  1I21 A;  2FSR A;  3B3C A;  3GY9 A;  1KZF A;  3WT4 A;  4R6T A;  3KGQ A;  2ZEG A;  2IMO A;  3RYO A;  1DTD A;  2PJ6 A;  2B4D B;  3PGP A;  5I4M A;  4C7I A;  3D68 A;  5K8P A;  2DPT A;  5F49 A;  1M44 A;  2Z3L A;  3E0K A;  3CXQ A;  1Z5R A;  2ZW7 A;  4KLW A;  1TKF A;  1Z8W A;  2Q7B A;  1JQG A;  5DWM A;  2YGW A;  1GYT A;  2BCO A;  5LYL A;  3KKW A;  2B4B A;  3SJE A;  3GLJ A;  2ZXV A;  4ONU A;  5F48 A;  4XNH B;  5C88 A;  3BJ7 A;  3IGR A;  3BI0 A;  4B5O A;  5F46 A;  2R1I A;  2BSW A;  4F8Z A;  2PIZ A;  3TC8 A;  3WC5 A;  4B12 A;  2ZEM A;  4Q7A A;  3ISZ A;  5JPH A;  2WPX A;  4QBJ A;  2CNT A;  4R8F A;  3BXM A;  3ZZI A;  3IC1 A;  2EVN A;  4ZYQ A;  2HV2 A;  4U9Z A;  1KUX A;  4ZGY B;  4NGT A;  4CAX A;  4MFJ A;  4ZY1 A;  5KTA A;  4PPZ A;  2PJB A;  5AG6 A;  3TOA A;  1BO4 A;  4BIN A;  4B13 A;  3TT2 A;  4II9 A;  5CPA A;  1XRY A;  2GLF A;  4UEE A;  4CAE A;  4KOV A;  1ZLI A;  3B3T A;  2GRE A;  1CPS A;  2VL1 A;  5ISV A;  3H5Z A;  4MI4 A;  4MFL A;  5E96 A;  1CP7 A;  3TO7 A;  4LQ6 A;  3JVN A;  4NGQ A;  4P4D A;  4XPK A;  3NE8 A;  2R7H A;  2Z3P A;  4F9V A;  1KUY A;  3S6G A;  4DJL A;  2PJ0 A;  1B87 A;  4EFD A;  2QIR A;  4B5P A;  2DXQ A;  2ZEO A;  2PDO A;  3R1K A;  3K2K A;  4A33 A;  2G0B A;  3ISX A;  5G22 A;  2CF4 A;  3IFE A;  3TCV A;  3CPX A;  2K5T A;  2XEG A;  2Z11 A;  3KZW A;  4CAV A;  1BOB A;  4PQA A;  1F2P A;  4MHD A;  4ZBG A;  2JDD A;  2REE A;  2D4P A;  1MJB A;  2QML A;  4NEX A;  1F2O A;  1KWM A;  4GS4 A;  4A94 A;  4CGP A;  1Y9W A;  3ZJ0 A;  1BPN A;  1R3N A;  4RUH A;  4NGR A;  4OC1 A;  3W6S A;  5IB9 A;  4ZX9 A;  2ZW6 A;  1ARM A;  4C2Z A;  2B4D A;  4EME A;  1MK4 A;  1S60 A;  2OU2 A;  2DEA A;  2QEC A;  3RZA A;  3S9N A;  2HUZ A;  4G1P A;  2Q43 A;  3DR8 A;  3FIX A;  3PRT A;  4P4F A;  2FVG A;  1VKC A;  2ZEH A;  4KOX A;  1ZO0 A;  1CP6 A;  2PVV A;  3KI9 A;  4YU9 A;  1XMT A;  2ZEP A;  1QST A;  3PB9 X;  1AUG A;  3LD2 A;  4OID A;  2AFM A;  4FUU A;  1YX0 A;  3IEH A;  4XNH C;  4MFK A;  4X8I A;  3IU1 A;  4WJB A;  3EC4 A;  4HNW B;  1TF8 A;  2IL4 A;  3IO1 A;  2CNM A;  1TXR A;  1YVO A;  3D4U A;  3FX6 A;  4M6I A;  3KR5 A;  3PZJ A;  4K30 A;  1Q7L A;  2B5G A;  3BLN A;  3B3S A;  3FJU A;  4KSF A;  2JBJ A;  1H8L A;  4R76 A;  4A32 A;  2I3C A;  5K8M A;  3D67 A;  1Q2Y A;  2X7B A;  4FBE A;  2YND A;  2AE6 A;  2Z3M A;  4IUS A;  3N5F A;  5J1Q A;  2JDC A;  3PFO A;  4R9M A;  4X5K A;  2Y0M A;  5DWN A;  2VI7 A;  1YLO A;  4CGO A;  5JH9 A;  2JEW A;  2EO8 A;  3KQZ A;  2Q04 A;  4ZX8 A;  4KLV A;  4MY0 A;  4CAF A;  2CY2 A;  1M4G A;  3EFA A;  3KQX A;  2ANP A;  1Y0R A;  4A38 A;  4E8O A;  2J9A A;  4IHM A;  2PR1 A;  3H8G A;  3VWD A;  5I0C A;  2V8G A;  1M4D A;  1KUV A;  1IYL A;  4H6Z A;  5HVF A;  1Z8X A;  4NGN A;  3SJF A;  4M6H A;  3S9L A;  1ZG8 A;  2G3T A;  1VHS A;  4P4I A;  4LQG A;  4PK2 A;  3TO9 A;  2CTC A;  3SI1 A;  4P4B A;  5CBM A;  2Q4V A;  2VEZ A;  1X12 A;  2OZG A;  2ABZ A;  2WYR A;  4HNY B;  2BOA A;  2V8H A;  2GAN A;  3SJX A;  4FWU A;  4JXR A;  4R3L A;  2G3A A;  4UIB A;  4YGO A;  4L8A A;  4XPL A;  1YR0 A;  1GHE A;  5IX3 A;  1QSM A;  2NYQ A;  1ELL P;  3OWC A;  4KOT A;  4C68 A;  3LOD A;  5A27 A;  4Y49 B;  2Z0Z A;  1BLL E;  1Z2L A;  2OR4 A;  3FRM A;  5LYD A;  1Q2D A;  4MXU A;  5ELY A;  1CX8 A;  1IY7 A;  4JLY A;  4P4J A;  4EVY A;  2DF5 A;  2OB0 A;  2AFX A;  4K3N A;  2A4N A;  4A37 A;  4PXB A;  1BAV A;  3IIB A;  1NMT A;  1XF8 A;  2P6E A;  2OZU A;  4NXY A;  2Q0Y A;  3I3G A;  4UA3 A;  2GIV A;  4P4E A;  4CGN A;  3B35 A;  4MHP A;  1S7K A;  2V77 A;  4P45 A;  3RBU A;  1UFH A;  2VXK A;  3I9S A;  3R9F A;  3KR4 A;  4M85 A;  4CRY B;  1IIC A;  3FBU A;  2Q51 A;  3IWW A;  4XPD B;  4HNX B;  2PRB A;  5LYF A;  3GB0 A;  1YVK A;  2AJ6 A;  2B5G B;  4OAD A;  1ELM P;  1Z4R A;  4NCZ A;  1PCA A;  3MRU A;  1YQE A;  2PJA A;  3FYN A;  4AG9 A;  4E0A A;  2VBQ A;  3PEI A;  1VGY A;  4OME A;  4P44 A;  4JJX A;  1ZG7 A;  3WC7 A;  3MN8 A;  1ARL A;  3WR7 A;  4B6Z A;  4KZT A;  3LWU A;  3K9T A;  2PR8 A;  4H2K A;  3BI1 A;  1Z4E A;  2REF A;  4AXV A;  1LAN A;  2JBK A;  2CXA A;  4C2Y A;  4MJ8 A;  1IOF A;  5HVG A;  3WC6 A;  1JWQ A;  4R3K A;  1VHE A;  4AB7 A;  1TKJ A;  5J8C A;  1XFO A;  1RXT A;  1U6M A;  5F47 A;  3CZX A;  4MFZ A;  3EY5 A;  4DYO A;  2I79 A;  1PU9 A;  3PB6 X;  2PQ8 A;  4JYW A;  4OAE A;  3F8K A;  3BJ8 A;  4NGS A;  2AFO A;  2BEI A;  2J8M A;  5JGF A;  4M3S A;  2HQY A;  1S7N A;  2ODF A;  3RO0 A;  1AMP A;  2XEI A;  4B14 A;  3NH4 A;  4R7M A;  2Q44 A;  2ZEL A;  3IJ3 A;  2EWB A;  4UFV A;  1UWY A;  3SJG A;  2XEJ A;  1QSR A;  2HC9 A;  3CT9 A;  4OLL A;  5G21 A;  6CPA A;  1YK3 A;  4NF1 A;  1HEE A;  4YRH A;  5IB0 A;  5EC4 A;  4ORF A;  4UIA A;  2VZY A;  5FVJ A;  4BMH A;  2F5I A;  4Y49 C;  3R9G A;  3FED A;  1LCP A;  5H84 A;  1NSL A;  2Q4Y A;  4FD5 A;  1YLE A;  1Z9U A;  2J8N A;  1FT7 A;  2AFW A;  2PJ2 A;  2VZZ A;  4MFQ A;  3S6F A;  3VAR A;  1FY7 A;  1QSN A;  4I49 A;  3JRU A;  1HDQ A;  1Y0Y A;  2AFU A;  1P4N A;  2PJ1 A;  4KOY A;  1CPX A;  2RB7 A;  1QQ9 A;  2FCK A;  4MCS A;  1L0C A;  4M6G A;  1Y9K A;  2WZN A;  2FE7 A;  4UBR A;  3T90 A;  1XE4 A;  1MJ9 A;  1XJO A;  4UWJ A;  2PJ8 A;  1YGH A;  3F0A A;  1R57 A;  4MRI A;  3R9E A;  3GYA A;  5K8N A;  2ZW5 A;  3L2N A;  4UCP A;  1S3Z A;  4UEF A;  1CM0 A;  1M4I A;  3PFE A;  2B3U A;  2CIJ A;  4XPD C;  3UY5 A;  4OKO A;  3VWE A;  3VH9 A;  1VIX A;  1ON0 A;  4F6A A;  4QC6 A;  1XEB A;  2B3V A;  4U9Y A;  2FIA A;  3TX8 A;  5BWA B;  3CXP A;  4HKF A;  1J4J A;  3JUW A;  2OOT A;  4PSW A;  4TNU A;  1IGB A;  2PSW A;  4Z65 A;  4JWP A;  3DDD A;  3PB8 X;  2PJC A;  4R87 A;  4DUK A;  5KTD A;  4EWT A;  1RTQ A;  2P0W A;  4Q38 A;  2XEF A;  1NE9 A;  4MCQ A;  5AGE A;  5AG4 A;  3D3S A;  1BPM A;  5G20 A;  4LUA A;  4AG7 A;  3H8E A;  3RNZ A;  4KSA A;  4YFJ A;  3TFY A;  2FL4 A;  4OP4 A;  3D7F A;  4CYP A;  4DNC A;  2QJ8 A;  2PIY A;  3SI2 A;  5F09 A;  3DLJ A;  4CYQ A;  2WPW A;  4KOR A;  4OC4 A;  1F57 A;  3CDX A;  5D29 A;  3NFZ A;  2WUU A;  4C7H A;  4MBU A;  4UCM A;  4UFW A;  3IU2 A;  3FH4 A;  1TIQ A;  5DS0 A;  4UEZ A;  4MCP A;  3R95 A;  1A2Z A;  1WK4 A;  4X2T A;  2PJ7 A;  5LYI A;  3R96 A;  2V8D A;  4MHY A;  4KOS A;  4KVM E;  3BHX A;  4X3R A;  5HMN A;  3QAY A;  4A2Z A;  1IOI A;  4H6U A;  1TF9 A;  3FB3 A;  4BBH A;  4KOW A;  3S6K A;  2AFZ A;  3H8F A;  3B2Y A;  2NSM A;  4CAW A;  1PYT B;  1Y7R A;  1IU8 A;  4A30 A;  2GU2 A;  2DPS A;  1M1D A;  2ZOG A;  5H86 A;  1DE4 C;  5G1Z A;  4F0Y A;  2PCU A;  4MFP A;  3CPA A;  4OC2 A;  5JQ4 A;  5K8O A;  4AVA A;  4FD7 A;  3D2P A;  7CPA A;  5GCN A;  4OC0 A;  4ONW A;  4NJR A;  4OC5 A;  1LOK A;  3G3S A;  2AFS A;  8CPA A;  4OIW A;  2RC4 A;  3PB4 X;  2PVW A;  3S6H A;  3KHX A;  1X10 A;  3SI0 A;  5LRG A;  4R57 A;  3W91 A;  4CYO A;  1YW6 A;  1S5K A;  2F7V A;  3PB7 X;  3P2H A;  2VQY A;  1M4L A;  1N71 A;  1OZP A;  4A39 A;  3MGD A;  2P6F A;  2J8R A;  4IAV A;  4NGP A;  1XMB A;  4Q36 A;  4KUB A;  4CGL A;  4OC3 A;  3FXT A;  1SQH A;  4B11 A;  4CYN A;  3PP9 A;  4KOU A;  1NSA A;  2CTB A;  2EBJ A;  2EK9 A;  2R98 A;  1LAM A;  4A95 A;  4MMO A;  3PBE A;  1CBX A;  3LMS A;  2HB6 A;  3KL9 A;  4IF5 A;  2PC1 A;  2RFH A;  5LRK A;  5LRJ A;  4RS2 A;  2IJZ A;  5EMI A;  3D66 A;  4P10 A;  1MJA A;  2ZED A;  3DSB A;  2Z3N A;  2PRQ A;  1S7L A;  3S9M A;  1IID A;  3GUX A;  2GE3 A;  2V8V A;  3IWG A;  4A31 A;  4F0X A;  3QB8 A;  3SXN A;  4W9Y A;  2C6G A;  2POK A;  2WSA A;  3DGV A;  4PXC A;  2JLM A;  1TKH A;  1YME A;  1QMU A;  2YNC A;  2YNE A;  3D8P A;  1LRZ A;  2YNC C;  5HH1 A;  4QUS A;  3B3W A;  3B7I A;  1CJW A;  2ZPA A;  4MHZ A;  4AVC A;  1V0C A;  4U5Y A;  3B3V A;  1I12 A;  2FS5 A;  1EE3 P;  2I00 A;  3QAH A;  4QVT A;  2FIW A;  4CRZ B;  2C6P A;  4J3G A;  3EO4 A;  5KTC A;  2ZEF A;  4PXE A;  4ZY2 A;  3P2F A;  4QB9 A;  4F9U A;  2O4H A;  4KSI A;  1PUA A;  3V38 A;  3NH5 A;  5J8F A;  2QYV A;  1LAP A;  1YSJ A;  3GKR A;  2D4O A;  3VAT A;  2BO9 A;  2Z10 A;  1Y7E A;  3DNS A;  1IB1 E;  4UF4 A;  3GIU A;  3PBB A;  4UWI A;  3HUV A;  3V7Z A;  5HXD A;  1S7F A;  4NSQ A;  1VHO A;  3TTH A;  2PJ5 A;  3N7Z A;  3CXS A;  3HLP A;  2C6C A;  5THW A;  2CNS A;  2F8H A;  1LFW A;  4ZY0 A;  3D7D A;  3C26 A;  4MHN A;  3G8W A;  4YWY A;  4FAI A;  4FD6 A;  4C2X A;  2C1C A;  3T9Y A;  3TE4 A;  2KCW A;  3F5B A;  1P0H A;  4B10 A;  1XIX A;  1Z8L A;  3FVL A;  2GFQ A;  4JZ0 A;  3QNV A;  3TOB A;  3D7H A;  3FMC A;  4NFR A;  1YW4 A;  2H5M A;  2QVP A;  2O28 A;  5D8N A;  4HPS A;  2EK8 A;  2FXF A; 
#chains in the Genus database with same CATH homology
 3V8I A;  3H4Q A;  2JEV A;  3D2M A;  4CGM A;  3EXN A;  4H89 A;  1QSO A;  2R8V A;  2BUE A;  4KVO E;  2OZH A;  1IYK A;  3SXO A;  4KS9 A;  4CS0 B;  4FD4 A;  4LX9 A;  4AVB A;  4E2A A;  1K4J A;  5C82 A;  4PSX A;  5A28 A;  2C27 A;  1B6B A;  4JXQ A;  3W6X A;  4PK3 A;  2ZW4 A;  4PV6 A;  5EBV A;  4RI1 A;  1Q2C A;  3A9L A;  3NE7 A;  5AG5 A;  3SHP A;  2NMT A;  2P6G A;  2OH1 A;  5IV0 A;  1WWZ A;  1YRE A;  3JTK A;  4L89 A;  5CNP A;  2Z3K A;  4MY3 A;  2BL1 A;  3FNC A;  2Z3O A;  2B58 A;  4KUA A;  2EUI A;  5AG7 A;  4B5P B;  2ATR A;  4KVX A;  3DR6 A;  2ARH A;  3IWE A;  3B8G A;  3K9U A;  4UCN A;  3TO6 A;  4UFX A;  2FT0 A;  1I1D A;  4JD6 A;  1RO5 A;  1I21 A;  3GY9 A;  2FSR A;  1KZF A;  3RYO A;  2B4D B;  3PGP A;  4C7I A;  2DPT A;  5F49 A;  1M44 A;  2Z3L A;  3E0K A;  3CXQ A;  2ZW7 A;  4KLW A;  2Q7B A;  5DWM A;  2YGW A;  3KKW A;  2B4B A;  2ZXV A;  4ONU A;  5F48 A;  4XNH B;  5C88 A;  3BJ7 A;  3IGR A;  4B5O A;  5F46 A;  2R1I A;  2BSW A;  4B12 A;  5JPH A;  2WPX A;  4QBJ A;  2CNT A;  3ZZI A;  2EVN A;  2HV2 A;  4U9Z A;  1KUX A;  4ZGY B;  4CAX A;  4MFJ A;  5KTA A;  5AG6 A;  3TOA A;  1BO4 A;  4B13 A;  3TT2 A;  4II9 A;  4CAE A;  4KOV A;  5ISV A;  3H5Z A;  4MI4 A;  4MFL A;  5E96 A;  3TO7 A;  3JVN A;  4XPK A;  2R7H A;  2Z3P A;  1KUY A;  3S6G A;  1B87 A;  2QIR A;  4B5P A;  2DXQ A;  2PDO A;  3R1K A;  4A33 A;  2G0B A;  5G22 A;  3TCV A;  2K5T A;  2Z11 A;  4CAV A;  1BOB A;  4MHD A;  4ZBG A;  2JDD A;  2REE A;  2D4P A;  1MJB A;  2QML A;  4NEX A;  4GS4 A;  4CGP A;  1Y9W A;  3ZJ0 A;  3W6S A;  2ZW6 A;  4C2Z A;  2B4D A;  1MK4 A;  1S60 A;  2OU2 A;  2QEC A;  2HUZ A;  3DR8 A;  3FIX A;  1VKC A;  4KOX A;  1ZO0 A;  1XMT A;  1QST A;  3LD2 A;  1YX0 A;  4XNH C;  4MFK A;  3IU1 A;  3EC4 A;  4HNW B;  2IL4 A;  2CNM A;  1YVO A;  3PZJ A;  4K30 A;  2B5G A;  3BLN A;  4KSF A;  4A32 A;  1Q2Y A;  2X7B A;  2YND A;  2AE6 A;  2Z3M A;  4IUS A;  2JDC A;  4R9M A;  4X5K A;  2Y0M A;  5DWN A;  2VI7 A;  4CGO A;  2Q04 A;  4KLV A;  4MY0 A;  4CAF A;  2CY2 A;  1M4G A;  3EFA A;  4E8O A;  2PR1 A;  3VWD A;  5I0C A;  1M4D A;  4H6Z A;  1IYL A;  1KUV A;  2G3T A;  1VHS A;  4PK2 A;  3TO9 A;  2Q4V A;  2VEZ A;  2OZG A;  4HNY B;  2GAN A;  4JXR A;  4R3L A;  2G3A A;  4YGO A;  4L8A A;  4XPL A;  1YR0 A;  1GHE A;  5IX3 A;  1QSM A;  3OWC A;  4KOT A;  4C68 A;  3LOD A;  5A27 A;  4Y49 B;  2Z0Z A;  3FRM A;  1Q2D A;  4JLY A;  4EVY A;  2OB0 A;  2A4N A;  1NMT A;  1XF8 A;  2P6E A;  2OZU A;  4NXY A;  2Q0Y A;  3I3G A;  4UA3 A;  2GIV A;  4CGN A;  1S7K A;  1UFH A;  2VXK A;  3I9S A;  3R9F A;  4M85 A;  4CRY B;  1IIC A;  3FBU A;  4XPD B;  4HNX B;  2PRB A;  1YVK A;  2AJ6 A;  2B5G B;  4OAD A;  1Z4R A;  4NCZ A;  3FYN A;  4E0A A;  4AG9 A;  2VBQ A;  4JJX A;  3WR7 A;  4KZT A;  2PR8 A;  1Z4E A;  2REF A;  4C2Y A;  2CXA A;  4MJ8 A;  4R3K A;  4AB7 A;  5J8C A;  1RXT A;  1U6M A;  5F47 A;  4MFZ A;  3EY5 A;  2I79 A;  1PU9 A;  4OAE A;  2PQ8 A;  3F8K A;  3BJ8 A;  2BEI A;  2J8M A;  4M3S A;  2HQY A;  1S7N A;  4B14 A;  2Q44 A;  4UFV A;  4OLL A;  1QSR A;  5G21 A;  1YK3 A;  4NF1 A;  4YRH A;  5IB0 A;  5EC4 A;  4ORF A;  4BMH A;  2VZY A;  5FVJ A;  2F5I A;  4Y49 C;  3R9G A;  1NSL A;  5H84 A;  2Q4Y A;  4FD5 A;  1YLE A;  1Z9U A;  2J8N A;  2VZZ A;  3S6F A;  4MFQ A;  1FY7 A;  1QSN A;  4I49 A;  1P4N A;  4KOY A;  2FCK A;  1L0C A;  1Y9K A;  4UBR A;  2FE7 A;  3T90 A;  1XE4 A;  1MJ9 A;  4UWJ A;  1YGH A;  3F0A A;  1R57 A;  3R9E A;  3GYA A;  2ZW5 A;  4UCP A;  1S3Z A;  1CM0 A;  1M4I A;  2B3U A;  3UY5 A;  4XPD C;  3VWE A;  1ON0 A;  4F6A A;  4QC6 A;  1XEB A;  2B3V A;  4U9Y A;  2FIA A;  5BWA B;  3CXP A;  4HKF A;  1J4J A;  3JUW A;  4PSW A;  2PSW A;  4JWP A;  3DDD A;  4R87 A;  5KTD A;  2P0W A;  4Q38 A;  1NE9 A;  5AGE A;  5AG4 A;  3D3S A;  5G20 A;  4LUA A;  4AG7 A;  4KSA A;  4YFJ A;  3TFY A;  2FL4 A;  4CYP A;  4DNC A;  4CYQ A;  2WPW A;  4KOR A;  2WUU A;  4C7H A;  4MBU A;  4UCM A;  4UFW A;  3IU2 A;  1TIQ A;  3R95 A;  1WK4 A;  3R96 A;  4KOS A;  4KVM E;  5HMN A;  4A2Z A;  4H6U A;  3FB3 A;  4BBH A;  4KOW A;  3S6K A;  4CAW A;  1Y7R A;  4A30 A;  2DPS A;  1M1D A;  5H86 A;  5G1Z A;  4F0Y A;  4MFP A;  5JQ4 A;  4AVA A;  4FD7 A;  3D2P A;  5GCN A;  3G3S A;  2RC4 A;  3S6H A;  3W91 A;  4R57 A;  4CYO A;  1S5K A;  3P2H A;  2VQY A;  1OZP A;  1N71 A;  3MGD A;  2P6F A;  2J8R A;  4Q36 A;  4CGL A;  4KUB A;  3FXT A;  1SQH A;  4B11 A;  4CYN A;  3PP9 A;  4KOU A;  2R98 A;  4A95 A;  4IF5 A;  2PC1 A;  4RS2 A;  1MJA A;  3DSB A;  2Z3N A;  1S7L A;  1IID A;  2GE3 A;  3IWG A;  4A31 A;  4F0X A;  3QB8 A;  3SXN A;  2WSA A;  2JLM A;  2YNC A;  3D8P A;  2YNE A;  5HH1 A;  1LRZ A;  2YNC C;  4QUS A;  1CJW A;  2ZPA A;  4AVC A;  1V0C A;  4U5Y A;  1I12 A;  2FS5 A;  2I00 A;  3QAH A;  4QVT A;  2FIW A;  4CRZ B;  4J3G A;  3EO4 A;  5KTC A;  3P2F A;  4QB9 A;  1PUA A;  5J8F A;  3GKR A;  2D4O A;  2Z10 A;  3DNS A;  1IB1 E;  4UWI A;  1S7F A;  4NSQ A;  3TTH A;  3N7Z A;  3CXS A;  2CNS A;  3C26 A;  3G8W A;  4FD6 A;  4C2X A;  3T9Y A;  3TE4 A;  2KCW A;  3F5B A;  1P0H A;  4B10 A;  1XIX A;  3TOB A;  2H5M A;  2O28 A;  2FXF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...