3F0AA

Structure of a putative n-acetyltransferase (ta0374) in complex with acetyl-coa from thermoplasma acidophilum
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
159
structure length
159
Chain Sequence
MSIEIRKLSIEDLETLIEVARESWKWTYAGIYSEEYIESWIREKYSKEKLLNEIVRSQSNLDILFLGAFADSTLIGFIELKIIANKAELLRLYLKPEYTHKKIGKTLLLEAEKIMKKKGILECRLYVHRQNSVGFSFYYKNGFKVEDTDGSDFIMEKKY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords N-ACETYLTRANSFERASE
publication title Crystal structure of the novel PaiA N-acetyltransferase from Thermoplasma acidophilum involved in the negative control of sporulation and degradative enzyme production.
pubmed doi rcsb
source organism Thermoplasma acidophilum
total genus 47
structure length 159
sequence length 159
ec nomenclature ec 2.3.1.57: Diamine N-acetyltransferase.
pdb deposition date 2008-10-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 3f0aA00
4JLYA 1LRZA 5KTAA 1I1DA 2FCKA 1XF8A 4EVYA 2VXKA 3CXSA 3D2PA 5IV0A 3JVNA 4QVTA 2PR1A 3MGDA 2ZW5A 2RC4A 2QMLA 4UWIA 4H6UA 4CAWA 2R1IA 1YREA 4I49A 1KUVA 3V8IA 3D3SA 2BUEA 4M3SA 1M1DA 2B4DB 4PK3A 3QAHA 5I0CA 3I9SA 3TE4A 4E8OA 4J3GA 2REFA 3TCVA 2P6EA 3LD2A 3R9EA 4U5YA 1M4IA 3C26A 1YVOA 2ZXVA 1PUAA 1Q2CA 2G0BA 1Y7RA 1XE4A 3TFYA 1IICA 3OWCA 1SQHA 4KOXA 3S6HA 2D4PA 3T9YA 4FD4A 1ON0A 5EBVA 1MJ9A 4HNWB 4MY3A 4NCZA 1WWZA 1BOBA 3TO6A 4MY0A 1KZFA 3D8PA 2BEIA 2Q4YA 3SXOA 1J4JA 2D4OA 2OZGA 2PSWA 2R98A 3BJ7A 5F46A 5EC4A 4GS4A 4UWJA 3PZJA 5CNPA 2Z0ZA 5F47A 1S5KA 2B58A 4KVOE 4LUAA 1XIXA 3S6KA 1Y9KA 1B87A 3ZJ0A 4CAXA 1IYLA 1FY7A 4BMHA 1R57A 1S7LA 3DR6A 2P0WA 2VEZA 4JXRA 3JUWA 2J8NA 4KOUA 5KTCA 1L0CA 1S7FA 2OZUA 1CM0A 3CXPA 3VWDA 2PRBA 3TT2A 5J8FA 4IUSA 1RXTA 2BSWA 4R87A 5JPHA 5FVJA 3G3SA 5H86A 2HQYA 1MJBA 2OB0A 4MHDA 2JEVA 1TIQA 2Z10A 2ZW4A 1QSRA 4OAEA 2CNTA 4XNHC 4II9A 3PP9A 4CRYB 3W6XA 1YGHA 2J8RA 3TTHA 4XNHB 1Z4RA 2WPWA 5GCNA 2QECA 3R95A 4XPLA 3P2HA 1QSNA 4CS0B 2ATRA 4HNXB 2CY2A 2Y0MA 2AJ6A 2G3TA 3FRMA 2J8MA 3DR8A 1NSLA 2BL1A 2WPXA 4ONUA 5DWMA 2B3UA 2B5GA 5C88A 4QBJA 1YVKA 4KOTA 1YX0A 2K5TA 3EXNA 3FB3A 1I12A 4B5OA 2H5MA 1VHSA 4MI4A 2ARHA 4H6ZA 3IWGA 2Q0YA 3TO9A 3GYAA 4R3KA 4KZTA 2B5GB 1P4NA 4AG7A 1BO4A 1S60A 4KLWA 2EUIA 2F5IA 4PSWA 4NEXA 1M44A 3G8WA 2B3VA 2A4NA 5C82A 4KVXA 3ZZIA 4KOYA 2FSRA 2VZYA 4JJXA 5E96A 3TOAA 3SHPA 4QB9A 3TO7A 4R9MA 2PR8A 4FD6A 2ZW6A 2VQYA 3PGPA 4X5KA 3DSBA 5JQ4A 2Q7BA 3DDDA 2P6FA 3N7ZA 4PV6A 3FBUA 3F0AA 3B8GA 1GHEA 2VZZA 1NMTA 3R96A 2FXFA 2Q04A 2NMTA 5F48A 3UY5A 1YR0A 1VKCA 3FYNA 2GANA 2P6GA 4KORA 2FE7A 1CJWA 3GKRA 4XPKA 1S7NA 2JDDA 3RYOA 5IX3A 2Z11A 1IIDA 3QB8A 4YFJA 1KUYA 4KVME 3FXTA 1Y9WA 2QIRA 4XPDC 2HUZA 2B4BA 3P2FA 1YK3A 4XPDB 4YRHA 2FS5A 2O28A 3T90A 4F6AA 2G3AA 2VI7A 2JDCA 1QSOA 4AB7A 3VWEA 5DWNA 4F0YA 2Q44A 4AG9A 4NSQA 4PSXA 1UFHA 2EVNA 4MBUA 1M4DA 1P0HA 4L8AA 1PU9A 3FIXA 1OZPA 3CXQA 4OADA 4HNYB 4FD5A 3R1KA 1B6BA 3EC4A 2FT0A 1YLEA 3EY5A 2FL4A 4KOWA 4R57A 4U9YA 1QSMA 1K4JA 4IF5A 3IGRA 5F49A 1XEBA 2B4DA 4FD7A 2AE6A 5HH1A 4AVBA 2OU2A 2IL4A 1WK4A 4H89A 4B5PA 1V0CA 2JLMA 3R9GA 4OLLA 4UA3A 3S6FA 1XMTA 5J8CA 5KTDA 4Y49C 1S3ZA 4NF1A 2I79A 1NE9A 3BJ8A 1KUXA 1IB1E 2PQ8A 3F5BA 4Y49B 4L89A 1U6MA 3W6SA 4E0AA 2HV2A 4B5PB 4M85A 4UBRA 2PC1A 4DNCA 2PDOA 3FNCA 4AVCA 3BLNA 1IYKA 1Z4EA 2KCWA 2DXQA 3K9UA 2VBQA 4RS2A 3NE7A 3DNSA 3E0KA 3S6GA 4KLVA 2X7BA 3LODA 4AVAA 2CNSA 4CAVA 3TOBA 2GIVA 4QC6A 2REEA 3I3GA 4NXYA 4ORFA 1Q2YA 5IB0A 4MJ8A 1QSTA 4QUSA 2OH1A 3EFAA 3H4QA 4HKFA 1M4GA 2CNMA 3SXNA 1Q2DA 4PK2A 4KUBA 2R8VA 4R3LA 4K30A 1I21A 3GY9A 2C27A 2FIAA 4JWPA 4KOSA 4KUAA 3W91A 4JD6A 2OZHA 1MK4A 4CRZB 4ZBGA 1RO5A 4JXQA 2Q4VA 3WR7A 5HMNA 2FIWA 4E2AA 5H84A 3EO4A 3F8KA 3KKWA 1MJAA 2R7HA 4RI1A 2GE3A 4KOVA 2ZW7A 4U9ZA 2ZPAA 5ISVA 1S7KA 1Z9UA 4LX9A 3D2MA 2I00A 3R9FA 1N71A 4YGOA
chains in the Genus database with same CATH superfamily
4JLYA 1LRZA 2G9DA 5KTAA 3B3TA 1I1DA 2FCKA 2C6CA 1XF8A 3KR4A 4EVYA 2VXKA 3MRUA 3CXSA 1UWYA 3D2PA 2PCUA 5IV0A 4PXBA 2XEJA 3JVNA 4CGPA 4QVTA 2PR1A 2Q43A 3MGDA 2ZW5A 2RC4A 3FX6A 2QMLA 3IJ3A 2AFOA 4WWVA 4UWIA 3A9LA 4B10A 4C68A 4H6UA 4CAWA 2R1IA 1YREA 5D29A 4OC5A 4X3RA 1F57A 4I49A 1KUVA 3V8IA 4UCPA 1ZG7A 3D3SA 2BUEA 4M3SA 1M1DA 3CPXA 2C1CA 5CPAA 2B4DB 4NGPA 4PK3A 3QAHA 1IOIA 5I0CA 4A30A 3I9SA 4M6GA 3TE4A 3NA6A 3FMCA 4UFXA 4E8OA 4J3GA 1VGYA 4JZ0A 3T8WA 1IU8A 2REFA 4MRIA 4MFZA 3TCVA 3LACA 3SJFA 2P6EA 3LD2A 4CGNA 3R9EA 4ZX9A 5JM6A 4U5YA 1M4IA 3C26A 1X10A 2JBKA 1YVOA 2ZXVA 1BLLE 5AG7A 1PUAA 1Q2CA 1XFOA 4UEZA 4MMOA 2G0BA 1Y7RA 5G21A 1XE4A 3TFYA 1IICA 2GFQA 4A39A 3OWCA 4NGSA 1SQHA 2DPSA 4KOXA 4B11A 2ODFA 3S6HA 2D4PA 2GLFA 3K2KA 2QVPA 3T9YA 4FD4A 1TF9A 4PPZA 2PJ1A 2IQ6A 3KASA 5J1QA 4CYPA 1CPXA 1ON0A 4GXHA 4P45A 1MJ9A 4HNWB 4LQGA 2Z3PA 4TNUA 5EBVA 5K8MA 4MY3A 2ZEMA 4NCZA 1WWZA 1HDQA 1FT7A 3B3WA 3B3VA 4ONWA 3S9MA 1BOBA 3TO6A 2PJCA 4B13A 3HUVA 3SJXA 2ZEFA 2CTBA 4MY0A 1KZFA 1AUGA 2WUUA 3D8PA 2BEIA 4R76A 2Q4YA 4RN7A 3SI2A 3SXOA 4C2XA 1J4JA 4PXEA 2D4OA 2OZGA 2AFWA 2PSWA 2BCOA 2R98A 3BJ7A 5F46A 5EC4A 4GS4A 2C6GA 3MN8A 3IEHA 4UWJA 1YMEA 4ZX8A 3PZJA 2Q51A 5CNPA 2Z0ZA 5F47A 1S5KA 2RFHA 3NFZA 1R3NA 2B58A 3PFOA 4KVOE 4LUAA 1XIXA 3KGQA 5LRJA 3V38A 4ZYQA 3S6KA 1Y9KA 1B87A 3NH8A 3ZJ0A 4CAXA 1ZG9A 1IYLA 2PJ8A 2ZELA 2HB6A 3N5FA 4C7HA 1A2ZA 1TKFA 3TX8A 5A27A 1FY7A 4A33A 4BMHA 1R57A 1DTDA 1S7LA 1YLOA 3PEIA 2EK9A 1VHOA 3DR6A 2NSMA 2P0WA 5JH9A 2VEZA 4JXRA 3JUWA 3CT9A 2J8NA 4KOUA 2O53A 1LAMA 5KTCA 2YGWA 1L0CA 1S7FA 2OZUA 1CM0A 3CXPA 3S9LA 3VWDA 5LRGA 2PRBA 3TT2A 5J8FA 4IUSA 3IU2A 1H8LA 3WC5A 1RXTA 2BSWA 4R87A 2EK8A 5JPHA 1F2OA 5FVJA 3G3SA 5H86A 1HEEA 2HQYA 1MJBA 2OB0A 4MHDA 2JEVA 3QAYA 4EMEA 1TIQA 2Z10A 2ZW4A 1QSRA 4CGOA 4OP4A 4OAEA 4DUKA 2CNTA 6CPAA 4XNHC 3CPAA 4II9A 3PP9A 4CRYB 3W6XA 2ZEPA 1YGHA 3FH4A 2J8RA 1PCAA 4O23A 4UCMA 3TTHA 4XNHB 3PB8X 1Z4RA 2YNEA 2WPWA 5GCNA 5THWA 1LANA 2QECA 3R95A 2ABZA 1Y7EA 2YNCA 4XPLA 1Z8TA 2V8DA 1QSNA 3P2HA 4CS0B 1IY7A 2ATRA 4HNXB 4F0XA 2CY2A 2XEFA 1QMUA 4NFRA 4DJLA 2Y0MA 2AJ6A 2G3TA 3FRMA 2O4HA 2J8MA 4P4JA 3DR8A 4OC1A 2GLJA 2ZEHA 2YNCC 1NSLA 4BD9A 5BWAB 1CP6A 4KSAA 1ZO0A 3PB7X 4MCRA 2JEWA 1F2PA 4K3NA 4UCNA 2BL1A 2ZEEA 3KL9A 2WPXA 2WSAA 4ONUA 1ZLIA 2ZOFA 5DWMA 4R6TA 2B3UA 2B5GA 2CIJA 5K8OA 5C88A 2Z3MA 4Q38A 4QBJA 1YVKA 3PB4X 4KOTA 5CBMA 1YX0A 2K5TA 3EXNA 3BXMA 1GYTA 3FB3A 1I12A 4P4DA 4B5OA 2H5MA 1ELLP 1VHSA 4MI4A 3VH9A 2ARHA 1IGBA 1HDUA 4FUUA 4MFLA 4G1PA 5AG6A 4H6ZA 3IWGA 3IU1A 4OKOA 5G22A 2Q0YA 4EFDA 1XJOA 2F8HA 3GYAA 3TO9A 2I3CA 4R3KA 4KZTA 1BPMA 4P10A 2B5GB 1P4NA 2AFSA 4AG7A 1M4LA 1BO4A 1S60A 4KLWA 4Z65A 5LYLA 2EUIA 2F5IA 2XEIA 4IK2A 5IB9A 4PSWA 4UIAA 4NEXA 1M44A 4ZI6A 3V7ZA 1Z8WA 4MFQA 3G8WA 2RB7A 2B3VA 2A4NA 5C82A 4KVXA 4WJBA 2CXAA 4P6YA 3HLPA 1Y0YA 3ZZIA 1XBUA 4KOYA 3KI9A 2FSRA 2VZYA 4JJXA 5E96A 3H8GA 3TOAA 3GUXA 4FBEA 3SHPA 4LQ6A 4QB9A 3TO7A 2PVVA 3PBBA 1LOKA 4R9MA 2PR8A 4FD6A 2ZW6A 2VQYA 3L2NA 3PGPA 4X5KA 1X12A 4F8ZA 2FVGA 3DSBA 4MHYA 5JQ4A 2Q7BA 4PXCA 3DDDA 3IIBA 2POKA 2P6FA 3N7ZA 4MXUA 4PV6A 3FBUA 4F9VA 1YW4A 3F0AA 3B8GA 1GHEA 5F09A 2ZEDA 1XRYA 2VZZA 4CAFA 1NMTA 3R96A 2FXFA 2Q04A 2EBJA 2NMTA 4P4FA 2BO9A 2PJ6A 3RNZA 5F48A 2PIYA 3H5ZA 4MHZA 3SJGA 3UY5A 3D7GA 5D8NA 4CGMA 1NSAA 1VKCA 1YR0A 4MFKA 4R7MA 3FYNA 3PRTA 2GANA 2PJ0A 5JGFA 2P6GA 4KORA 3PBEA 4YWYA 2FE7A 3H8EA 1CJWA 5AGEA 3ISZA 3GKRA 3WC7A 4BINA 4XPKA 1CX8A 1VIXA 5K8PA 1RTQA 2F7VA 1S7NA 2JDDA 4OC3A 3RYOA 5IX3A 2Z11A 1IIDA 3QB8A 3D7HA 1OBRA 1ARLA 2PJAA 3LMSA 3VATA 3FECA 1KUYA 4KVME 4YFJA 3FXTA 1Y9WA 1DE4C 2QIRA 3KHZA 2V8GA 3DLJA 1YW6A 2PVWA 4XPDC 3FEEA 4A94A 4A95A 5G1ZA 2HUZA 2B4BA 4OIWA 3NE8A 1XMBA 3SJEA 2Z3KA 1CBXA 2GREA 3P2FA 4ZY1A 4B6ZA 3PB9X 3WT4A 1YK3A 4MFPA 4XPDB 3RZAA 4P4IA 4YRHA 3D7FA 4UEEA 2FS5A 2O28A 3T90A 4NGTA 4OIDA 4F6AA 2G3AA 2C6PA 2VI7A 2JDCA 1QSOA 4AB7A 2AFXA 3VWEA 1QQ9A 2BOAA 4MFJA 3IWEA 3WC6A 5DWNA 4F0YA 4OC0A 1AYEA 7CPAA 4P44A 1CG2A 2Q44A 4AG9A 3NH4A 3SI1A 2NYQA 4NSQA 4PSXA 1UFHA 2EVNA 1YQEA 4MBUA 3BI0A 4YU9A 5I4MA 4NGQA 1M4DA 3B3CA 1P0HA 3RAMA 2EO8A 3B2YA 3K9TA 2EWBA 4L8AA 4UIBA 1PU9A 3FIXA 1OZPA 3CXQA 4OADA 5HVFA 4IHMA 1TXRA 4FD5A 4HNYB 3KHXA 3R1KA 1B6BA 3GLJA 3EC4A 1CP7A 3B35A 2FT0A 1XOVA 2J9AA 4GM5A 1YLEA 3EY5A 2FL4A 5HXDA 4KOWA 4NJQA 4R57A 4MCPA 1KWMA 4EWTA 2YNDA 4U9YA 1QSMA 1K4JA 3RBUA 4OC2A 4TWEA 4IF5A 1TF8A 4MCQA 2GU2A 3IGRA 5F49A 3QNVA 3KR5A 2OOTA 8CPAA 1XEBA 1TKJA 1LFWA 2XEGA 2B4DA 4FD7A 2AE6A 5A28A 2AFZA 3FJUA 4CYOA 3IC1A 5HH1A 3IO1A 4AVBA 4MCSA 1Z5RA 2OU2A 2IL4A 1WK4A 2Z3OA 5EMIA 2ZEOA 3BHXA 4H89A 4R8FA 5LYIA 4B5PA 2ZENA 1V0CA 2JLMA 3FEDA 3R9GA 4CGLA 4OLLA 4UA3A 4CPAA 3S6FA 2ANPA 2PJ3A 2OR4A 4A2ZA 4B12A 4NGMA 1XMTA 5G20A 5J8CA 2PJBA 5KTDA 3CZXA 4Y49C 4RUHA 1S3ZA 4NF1A 2I79A 1NE9A 5LYFA 3BJ8A 2Q7SA 3KQXA 1KUXA 1IB1E 2PQ8A 3F5BA 5LRKA 1ZLHA 4Y49B 1VHEA 4L89A 1U6MA 3B3SA 3W6SA 4E0AA 4F9UA 2HV2A 4B5PB 4M85A 4UBRA 2PC1A 4DNCA 2PDOA 3FNCA 4AVCA 2AFMA 3BLNA 4OC4A 3IFEA 1IYKA 1Z4EA 2KCWA 3NH5A 1Q7LA 1JWQA 2DXQA 3K9UA 2Z3LA 2VBQA 1LAPA 4X8IA 3RO0A 4CYNA 2DEAA 2IJZA 1AMPA 3PB6X 3I1UA 4CYQA 4RS2A 4UEFA 2CTCA 4C2YA 4MHPA 3NE7A 2PJ7A 4FAIA 3DNSA 5ELYA 4AXVA 3H8FA 4M6IA 2PJ9A 3E0KA 1Y0RA 3S6GA 4HPSA 1IOFA 4KLVA 2X7BA 3B7IA 3LODA 4AVAA 2CNSA 2WYRA 4CAVA 3TOBA 4A31A 3GIUA 2GIVA 1PYTB 3D68A 4ZY2A 2VL1A 3GB0A 4QC6A 2REEA 2HC9A 3I3GA 4NXYA 3S9NA 4ORFA 1Q2YA 5LYDA 1ELMP 5IB0A 4KS9A 4MJ8A 1QSTA 4OMEA 4UF4A 2IMOA 4QUSA 1BPNA 3D66A 2JBJA 4PXDA 4A32A 2OH1A 2PJ4A 3EFAA 3H4QA 4Q36A 4HKFA 3VARA 1M4GA 2CNMA 1R43A 4UFVA 5AG5A 3SXNA 1Q2DA 4PK2A 3KQZA 4UFWA 3TC8A 2AFUA 4C2ZA 3WABA 4CAEA 4KUBA 2R8VA 3JTKA 1Z2LA 4FWUA 2Q4ZA 2PIZA 3KZWA 4MHNA 3FVLA 4R3LA 5DS0A 3ISXA 1JQGA 3D4UA 4K30A 3D7DA 4P4EA 3PFEA 4ZGYB 1Z8XA 1I21A 1LCPA 2PJ2A 4M6HA 3GY9A 3IWWA 4C7IA 2ZEGA 4A37A 4BBHA 1ZG8A 2C27A 1FNOA 2PRQA 4JYWA 2FIAA 2QYVA 4JWPA 4KOSA 4KUAA 3W91A 4JD6A 2OZHA 1MK4A 4CRZB 3CDXA 4IAVA 4ZBGA 1RO5A 4JXQA 2DF5A 4KSIA 2WZNA 5AG4A 2Q4VA 2V8HA 3WR7A 5HMNA 5K8NA 2FIWA 1EE3P 4B14A 5H84A 4E2AA 2QJ8A 4NJRA 3LWUA 5HVGA 4ZY0A 3JRUA 3EO4A 4W9YA 4DYOA 3F8KA 3KKWA 1MJAA 2R7HA 2ZOGA 2Z3NA 3D67A 4RI1A 5HVHA 2GE3A 1CPSA 4KOVA 1ARMA 1BAVA 1YSJA 2ZW7A 4PQAA 4U9ZA 2ZPAA 4NGRA 5ISVA 2V77A 2PE3A 4X2TA 4NGNA 1S7KA 1Z8LA 4P4BA 1Z9UA 4LX9A 3D2MA 2V8VA 2I00A 3BI1A 2DPTA 3DGVA 2CF4A 3R9FA 4Q7AA 2PJ5A 4H2KA 3FF3A 4A38A 1TKHA 4KSFA 3SI0A 1N71A 4YGOA
chains in the Genus database with same CATH topology
4JLYA 1LRZA 5KTAA 1I1DA 2FCKA 1XF8A 4EVYA 2VXKA 3CXSA 3D2PA 5IV0A 4CGPA 3JVNA 4QVTA 2PR1A 3MGDA 2ZW5A 2RC4A 4B10A 2QMLA 4UWIA 3A9LA 4C68A 4H6UA 4CAWA 2R1IA 1YREA 4I49A 1KUVA 3V8IA 4UCPA 3D3SA 2BUEA 4M3SA 1M1DA 2B4DB 4PK3A 3QAHA 5I0CA 4A30A 3I9SA 3TE4A 4E8OA 4UFXA 4J3GA 2REFA 4MFZA 3TCVA 2P6EA 3LD2A 4CGNA 3R9EA 4U5YA 1M4IA 3C26A 5AG7A 1YVOA 2ZXVA 1PUAA 1Q2CA 2G0BA 1Y7RA 5G21A 1XE4A 3TFYA 1IICA 3OWCA 1SQHA 2DPSA 4KOXA 4B11A 3S6HA 2D4PA 3T9YA 4FD4A 4CYPA 1ON0A 5EBVA 1MJ9A 4HNWB 2Z3PA 4MY3A 4NCZA 1WWZA 1BOBA 3TO6A 4B13A 4MY0A 1KZFA 2WUUA 3D8PA 2BEIA 2Q4YA 3SXOA 4C2XA 1J4JA 2D4OA 2OZGA 2PSWA 2R98A 3BJ7A 5F46A 5EC4A 4GS4A 4UWJA 3PZJA 5CNPA 2Z0ZA 5F47A 1S5KA 2B58A 4KVOE 4LUAA 1XIXA 3S6KA 1Y9KA 1B87A 3ZJ0A 4CAXA 1IYLA 4C7HA 5A27A 1FY7A 4A33A 4BMHA 1R57A 1S7LA 3DR6A 2P0WA 2VEZA 4JXRA 3JUWA 2J8NA 4KOUA 5KTCA 2YGWA 1L0CA 1S7FA 2OZUA 1CM0A 3CXPA 3VWDA 2PRBA 3TT2A 5J8FA 4IUSA 3IU2A 1RXTA 2BSWA 4R87A 5JPHA 5FVJA 3G3SA 5H86A 2HQYA 1MJBA 2OB0A 4MHDA 2JEVA 1TIQA 2Z10A 2ZW4A 1QSRA 4CGOA 4OAEA 2CNTA 4XNHC 4II9A 3PP9A 4CRYB 3W6XA 1YGHA 2J8RA 4UCMA 3TTHA 4XNHB 1Z4RA 2YNEA 2WPWA 5GCNA 2QECA 3R95A 2YNCA 4XPLA 3P2HA 1QSNA 4CS0B 2ATRA 4HNXB 4F0XA 2CY2A 2Y0MA 2AJ6A 2G3TA 3FRMA 2J8MA 3DR8A 2YNCC 1NSLA 5BWAB 4KSAA 1ZO0A 4UCNA 2BL1A 2WPXA 2WSAA 4ONUA 5DWMA 2B3UA 2B5GA 5C88A 2Z3MA 4Q38A 4QBJA 1YVKA 4KOTA 1YX0A 2K5TA 3EXNA 3FB3A 1I12A 4B5OA 2H5MA 1VHSA 4MI4A 2ARHA 4MFLA 5AG6A 4H6ZA 3IWGA 3IU1A 5G22A 2Q0YA 3TO9A 3GYAA 4R3KA 4KZTA 2B5GB 1P4NA 4AG7A 1BO4A 1S60A 4KLWA 2EUIA 2F5IA 4PSWA 4NEXA 1M44A 4MFQA 3G8WA 2B3VA 2A4NA 5C82A 4KVXA 2CXAA 3ZZIA 4KOYA 2FSRA 2VZYA 4JJXA 5E96A 3TOAA 3SHPA 4QB9A 3TO7A 4R9MA 2PR8A 4FD6A 2ZW6A 2VQYA 3PGPA 4X5KA 3DSBA 5JQ4A 2Q7BA 3DDDA 2P6FA 3N7ZA 4PV6A 3FBUA 3F0AA 3B8GA 1GHEA 2VZZA 4CAFA 1NMTA 3R96A 2FXFA 2Q04A 2NMTA 5F48A 4CGMA 3H5ZA 3UY5A 1YR0A 1VKCA 4MFKA 3FYNA 2GANA 2P6GA 4KORA 2FE7A 1CJWA 5AGEA 3GKRA 4XPKA 1S7NA 2JDDA 3RYOA 5IX3A 2Z11A 1IIDA 3QB8A 4YFJA 1KUYA 4KVME 3FXTA 1Y9WA 2QIRA 4XPDC 4A95A 5G1ZA 2HUZA 2B4BA 2Z3KA 3P2FA 1YK3A 4MFPA 4XPDB 4YRHA 2FS5A 2O28A 3T90A 4F6AA 2G3AA 2VI7A 2JDCA 1QSOA 4AB7A 3VWEA 4MFJA 3IWEA 5DWNA 4F0YA 2Q44A 4AG9A 4NSQA 4PSXA 1UFHA 2EVNA 4MBUA 1M4DA 1P0HA 4L8AA 1PU9A 3FIXA 1OZPA 3CXQA 4OADA 4HNYB 4FD5A 3R1KA 1B6BA 3EC4A 2FT0A 1YLEA 3EY5A 2FL4A 4KOWA 4R57A 2YNDA 4U9YA 1QSMA 1K4JA 4IF5A 3IGRA 5F49A 1XEBA 2B4DA 4FD7A 2AE6A 5A28A 4CYOA 5HH1A 4AVBA 2OU2A 2IL4A 1WK4A 2Z3OA 4H89A 4B5PA 1V0CA 2JLMA 3R9GA 4CGLA 4OLLA 4UA3A 3S6FA 4A2ZA 4B12A 1XMTA 5G20A 5J8CA 5KTDA 4Y49C 1S3ZA 4NF1A 2I79A 1NE9A 3BJ8A 1KUXA 1IB1E 2PQ8A 3F5BA 4Y49B 4L89A 1U6MA 3W6SA 4E0AA 2HV2A 4B5PB 4M85A 4UBRA 2PC1A 4DNCA 2PDOA 3FNCA 4AVCA 3BLNA 1IYKA 1Z4EA 2KCWA 2DXQA 3K9UA 2Z3LA 2VBQA 4CYNA 4CYQA 4RS2A 4C2YA 3NE7A 3DNSA 3E0KA 3S6GA 4KLVA 2X7BA 3LODA 4AVAA 2CNSA 4CAVA 3TOBA 4A31A 2GIVA 4QC6A 2REEA 3I3GA 4NXYA 4ORFA 1Q2YA 5IB0A 4KS9A 4MJ8A 1QSTA 4QUSA 4A32A 2OH1A 3EFAA 3H4QA 4Q36A 4HKFA 1M4GA 2CNMA 5AG5A 4UFVA 3SXNA 1Q2DA 4PK2A 4UFWA 4C2ZA 4CAEA 4KUBA 2R8VA 3JTKA 4R3LA 4K30A 4ZGYB 1I21A 3GY9A 4C7IA 4BBHA 2C27A 2FIAA 4JWPA 4KOSA 4KUAA 3W91A 4JD6A 2OZHA 1MK4A 4CRZB 4ZBGA 1RO5A 4JXQA 5AG4A 2Q4VA 3WR7A 5HMNA 2FIWA 4B14A 5H84A 4E2AA 3EO4A 3F8KA 3KKWA 1MJAA 2R7HA 2Z3NA 4RI1A 2GE3A 4KOVA 2ZW7A 4U9ZA 2ZPAA 5ISVA 1S7KA 1Z9UA 4LX9A 3D2MA 2I00A 2DPTA 3R9FA 4KSFA 1N71A 4YGOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JLY A;  1LRZ A;  5KTA A;  1I1D A;  2FCK A;  1XF8 A;  4EVY A;  2VXK A;  3CXS A;  3D2P A;  5IV0 A;  3JVN A;  4QVT A;  2PR1 A;  3MGD A;  2ZW5 A;  2RC4 A;  2QML A;  4UWI A;  4H6U A;  4CAW A;  2R1I A;  1YRE A;  4I49 A;  1KUV A;  3V8I A;  3D3S A;  2BUE A;  4M3S A;  1M1D A;  2B4D B;  4PK3 A;  3QAH A;  5I0C A;  3I9S A;  3TE4 A;  4E8O A;  4J3G A;  2REF A;  3TCV A;  2P6E A;  3LD2 A;  3R9E A;  4U5Y A;  1M4I A;  3C26 A;  1YVO A;  2ZXV A;  1PUA A;  1Q2C A;  2G0B A;  1Y7R A;  1XE4 A;  3TFY A;  1IIC A;  3OWC A;  1SQH A;  4KOX A;  3S6H A;  2D4P A;  3T9Y A;  4FD4 A;  1ON0 A;  5EBV A;  1MJ9 A;  4HNW B;  4MY3 A;  4NCZ A;  1WWZ A;  1BOB A;  3TO6 A;  4MY0 A;  1KZF A;  3D8P A;  2BEI A;  2Q4Y A;  3SXO A;  1J4J A;  2D4O A;  2OZG A;  2PSW A;  2R98 A;  3BJ7 A;  5F46 A;  5EC4 A;  4GS4 A;  4UWJ A;  3PZJ A;  5CNP A;  2Z0Z A;  5F47 A;  1S5K A;  2B58 A;  4KVO E;  4LUA A;  1XIX A;  3S6K A;  1Y9K A;  1B87 A;  3ZJ0 A;  4CAX A;  1IYL A;  1FY7 A;  4BMH A;  1R57 A;  1S7L A;  3DR6 A;  2P0W A;  2VEZ A;  4JXR A;  3JUW A;  2J8N A;  4KOU A;  5KTC A;  1L0C A;  1S7F A;  2OZU A;  1CM0 A;  3CXP A;  3VWD A;  2PRB A;  3TT2 A;  5J8F A;  4IUS A;  1RXT A;  2BSW A;  4R87 A;  5JPH A;  5FVJ A;  3G3S A;  5H86 A;  2HQY A;  1MJB A;  2OB0 A;  4MHD A;  2JEV A;  1TIQ A;  2Z10 A;  2ZW4 A;  1QSR A;  4OAE A;  2CNT A;  4XNH C;  4II9 A;  3PP9 A;  4CRY B;  3W6X A;  1YGH A;  2J8R A;  3TTH A;  4XNH B;  1Z4R A;  2WPW A;  5GCN A;  2QEC A;  3R95 A;  4XPL A;  3P2H A;  1QSN A;  4CS0 B;  2ATR A;  4HNX B;  2CY2 A;  2Y0M A;  2AJ6 A;  2G3T A;  3FRM A;  2J8M A;  3DR8 A;  1NSL A;  2BL1 A;  2WPX A;  4ONU A;  5DWM A;  2B3U A;  2B5G A;  5C88 A;  4QBJ A;  1YVK A;  4KOT A;  1YX0 A;  2K5T A;  3EXN A;  3FB3 A;  1I12 A;  4B5O A;  2H5M A;  1VHS A;  4MI4 A;  2ARH A;  4H6Z A;  3IWG A;  2Q0Y A;  3TO9 A;  3GYA A;  4R3K A;  4KZT A;  2B5G B;  1P4N A;  4AG7 A;  1BO4 A;  1S60 A;  4KLW A;  2EUI A;  2F5I A;  4PSW A;  4NEX A;  1M44 A;  3G8W A;  2B3V A;  2A4N A;  5C82 A;  4KVX A;  3ZZI A;  4KOY A;  2FSR A;  2VZY A;  4JJX A;  5E96 A;  3TOA A;  3SHP A;  4QB9 A;  3TO7 A;  4R9M A;  2PR8 A;  4FD6 A;  2ZW6 A;  2VQY A;  3PGP A;  4X5K A;  3DSB A;  5JQ4 A;  2Q7B A;  3DDD A;  2P6F A;  3N7Z A;  4PV6 A;  3FBU A;  3F0A A;  3B8G A;  1GHE A;  2VZZ A;  1NMT A;  3R96 A;  2FXF A;  2Q04 A;  2NMT A;  5F48 A;  3UY5 A;  1YR0 A;  1VKC A;  3FYN A;  2GAN A;  2P6G A;  4KOR A;  2FE7 A;  1CJW A;  3GKR A;  4XPK A;  1S7N A;  2JDD A;  3RYO A;  5IX3 A;  2Z11 A;  1IID A;  3QB8 A;  4YFJ A;  1KUY A;  4KVM E;  3FXT A;  1Y9W A;  2QIR A;  4XPD C;  2HUZ A;  2B4B A;  3P2F A;  1YK3 A;  4XPD B;  4YRH A;  2FS5 A;  2O28 A;  3T90 A;  4F6A A;  2G3A A;  2VI7 A;  2JDC A;  1QSO A;  4AB7 A;  3VWE A;  5DWN A;  4F0Y A;  2Q44 A;  4AG9 A;  4NSQ A;  4PSX A;  1UFH A;  2EVN A;  4MBU A;  1M4D A;  1P0H A;  4L8A A;  1PU9 A;  3FIX A;  1OZP A;  3CXQ A;  4OAD A;  4HNY B;  4FD5 A;  3R1K A;  1B6B A;  3EC4 A;  2FT0 A;  1YLE A;  3EY5 A;  2FL4 A;  4KOW A;  4R57 A;  4U9Y A;  1QSM A;  1K4J A;  4IF5 A;  3IGR A;  5F49 A;  1XEB A;  2B4D A;  4FD7 A;  2AE6 A;  5HH1 A;  4AVB A;  2OU2 A;  2IL4 A;  1WK4 A;  4H89 A;  4B5P A;  1V0C A;  2JLM A;  3R9G A;  4OLL A;  4UA3 A;  3S6F A;  1XMT A;  5J8C A;  5KTD A;  4Y49 C;  1S3Z A;  4NF1 A;  2I79 A;  1NE9 A;  3BJ8 A;  1KUX A;  1IB1 E;  2PQ8 A;  3F5B A;  4Y49 B;  4L89 A;  1U6M A;  3W6S A;  4E0A A;  2HV2 A;  4B5P B;  4M85 A;  4UBR A;  2PC1 A;  4DNC A;  2PDO A;  3FNC A;  4AVC A;  3BLN A;  1IYK A;  1Z4E A;  2KCW A;  2DXQ A;  3K9U A;  2VBQ A;  4RS2 A;  3NE7 A;  3DNS A;  3E0K A;  3S6G A;  4KLV A;  2X7B A;  3LOD A;  4AVA A;  2CNS A;  4CAV A;  3TOB A;  2GIV A;  4QC6 A;  2REE A;  3I3G A;  4NXY A;  4ORF A;  1Q2Y A;  5IB0 A;  4MJ8 A;  1QST A;  4QUS A;  2OH1 A;  3EFA A;  3H4Q A;  4HKF A;  1M4G A;  2CNM A;  3SXN A;  1Q2D A;  4PK2 A;  4KUB A;  2R8V A;  4R3L A;  4K30 A;  1I21 A;  3GY9 A;  2C27 A;  2FIA A;  4JWP A;  4KOS A;  4KUA A;  3W91 A;  4JD6 A;  2OZH A;  1MK4 A;  4CRZ B;  4ZBG A;  1RO5 A;  4JXQ A;  2Q4V A;  3WR7 A;  5HMN A;  2FIW A;  4E2A A;  5H84 A;  3EO4 A;  3F8K A;  3KKW A;  1MJA A;  2R7H A;  4RI1 A;  2GE3 A;  4KOV A;  2ZW7 A;  4U9Z A;  2ZPA A;  5ISV A;  1S7K A;  1Z9U A;  4LX9 A;  3D2M A;  2I00 A;  3R9F A;  1N71 A;  4YGO A; 
#chains in the Genus database with same CATH topology
 4JLY A;  1LRZ A;  2G9D A;  5KTA A;  3B3T A;  1I1D A;  2FCK A;  2C6C A;  1XF8 A;  3KR4 A;  4EVY A;  2VXK A;  3MRU A;  3CXS A;  1UWY A;  3D2P A;  2PCU A;  5IV0 A;  4PXB A;  2XEJ A;  3JVN A;  4CGP A;  4QVT A;  2PR1 A;  2Q43 A;  3MGD A;  2ZW5 A;  2RC4 A;  3FX6 A;  2QML A;  3IJ3 A;  2AFO A;  4WWV A;  4UWI A;  3A9L A;  4B10 A;  4C68 A;  4H6U A;  4CAW A;  2R1I A;  1YRE A;  5D29 A;  4OC5 A;  4X3R A;  1F57 A;  4I49 A;  1KUV A;  3V8I A;  4UCP A;  1ZG7 A;  3D3S A;  2BUE A;  4M3S A;  1M1D A;  3CPX A;  2C1C A;  5CPA A;  2B4D B;  4NGP A;  4PK3 A;  3QAH A;  1IOI A;  5I0C A;  4A30 A;  3I9S A;  4M6G A;  3TE4 A;  3NA6 A;  3FMC A;  4UFX A;  4E8O A;  4J3G A;  1VGY A;  4JZ0 A;  3T8W A;  1IU8 A;  2REF A;  4MRI A;  4MFZ A;  3TCV A;  3LAC A;  3SJF A;  2P6E A;  3LD2 A;  4CGN A;  3R9E A;  4ZX9 A;  5JM6 A;  4U5Y A;  1M4I A;  3C26 A;  1X10 A;  2JBK A;  1YVO A;  2ZXV A;  1BLL E;  5AG7 A;  1PUA A;  1Q2C A;  1XFO A;  4UEZ A;  4MMO A;  2G0B A;  1Y7R A;  5G21 A;  1XE4 A;  3TFY A;  1IIC A;  2GFQ A;  4A39 A;  3OWC A;  4NGS A;  1SQH A;  2DPS A;  4KOX A;  4B11 A;  2ODF A;  3S6H A;  2D4P A;  2GLF A;  3K2K A;  2QVP A;  3T9Y A;  4FD4 A;  1TF9 A;  4PPZ A;  2PJ1 A;  2IQ6 A;  3KAS A;  5J1Q A;  4CYP A;  1CPX A;  1ON0 A;  4GXH A;  4P45 A;  1MJ9 A;  4HNW B;  4LQG A;  2Z3P A;  4TNU A;  5EBV A;  5K8M A;  4MY3 A;  2ZEM A;  4NCZ A;  1WWZ A;  1HDQ A;  1FT7 A;  3B3W A;  3B3V A;  4ONW A;  3S9M A;  1BOB A;  3TO6 A;  2PJC A;  4B13 A;  3HUV A;  3SJX A;  2ZEF A;  2CTB A;  4MY0 A;  1KZF A;  1AUG A;  2WUU A;  3D8P A;  2BEI A;  4R76 A;  2Q4Y A;  4RN7 A;  3SI2 A;  3SXO A;  4C2X A;  1J4J A;  4PXE A;  2D4O A;  2OZG A;  2AFW A;  2PSW A;  2BCO A;  2R98 A;  3BJ7 A;  5F46 A;  5EC4 A;  4GS4 A;  2C6G A;  3MN8 A;  3IEH A;  4UWJ A;  1YME A;  4ZX8 A;  3PZJ A;  2Q51 A;  5CNP A;  2Z0Z A;  5F47 A;  1S5K A;  2RFH A;  3NFZ A;  1R3N A;  2B58 A;  3PFO A;  4KVO E;  4LUA A;  1XIX A;  3KGQ A;  5LRJ A;  3V38 A;  4ZYQ A;  3S6K A;  1Y9K A;  1B87 A;  3NH8 A;  3ZJ0 A;  4CAX A;  1ZG9 A;  1IYL A;  2PJ8 A;  2ZEL A;  2HB6 A;  3N5F A;  4C7H A;  1A2Z A;  1TKF A;  3TX8 A;  5A27 A;  1FY7 A;  4A33 A;  4BMH A;  1R57 A;  1DTD A;  1S7L A;  1YLO A;  3PEI A;  2EK9 A;  1VHO A;  3DR6 A;  2NSM A;  2P0W A;  5JH9 A;  2VEZ A;  4JXR A;  3JUW A;  3CT9 A;  2J8N A;  4KOU A;  2O53 A;  1LAM A;  5KTC A;  2YGW A;  1L0C A;  1S7F A;  2OZU A;  1CM0 A;  3CXP A;  3S9L A;  3VWD A;  5LRG A;  2PRB A;  3TT2 A;  5J8F A;  4IUS A;  3IU2 A;  1H8L A;  3WC5 A;  1RXT A;  2BSW A;  4R87 A;  2EK8 A;  5JPH A;  1F2O A;  5FVJ A;  3G3S A;  5H86 A;  1HEE A;  2HQY A;  1MJB A;  2OB0 A;  4MHD A;  2JEV A;  3QAY A;  4EME A;  1TIQ A;  2Z10 A;  2ZW4 A;  1QSR A;  4CGO A;  4OP4 A;  4OAE A;  4DUK A;  2CNT A;  6CPA A;  4XNH C;  3CPA A;  4II9 A;  3PP9 A;  4CRY B;  3W6X A;  2ZEP A;  1YGH A;  3FH4 A;  2J8R A;  1PCA A;  4O23 A;  4UCM A;  3TTH A;  4XNH B;  3PB8 X;  1Z4R A;  2YNE A;  2WPW A;  5GCN A;  5THW A;  1LAN A;  2QEC A;  3R95 A;  2ABZ A;  1Y7E A;  2YNC A;  4XPL A;  1Z8T A;  2V8D A;  1QSN A;  3P2H A;  4CS0 B;  1IY7 A;  2ATR A;  4HNX B;  4F0X A;  2CY2 A;  2XEF A;  1QMU A;  4NFR A;  4DJL A;  2Y0M A;  2AJ6 A;  2G3T A;  3FRM A;  2O4H A;  2J8M A;  4P4J A;  3DR8 A;  4OC1 A;  2GLJ A;  2ZEH A;  2YNC C;  1NSL A;  4BD9 A;  5BWA B;  1CP6 A;  4KSA A;  1ZO0 A;  3PB7 X;  4MCR A;  2JEW A;  1F2P A;  4K3N A;  4UCN A;  2BL1 A;  2ZEE A;  3KL9 A;  2WPX A;  2WSA A;  4ONU A;  1ZLI A;  2ZOF A;  5DWM A;  4R6T A;  2B3U A;  2B5G A;  2CIJ A;  5K8O A;  5C88 A;  2Z3M A;  4Q38 A;  4QBJ A;  1YVK A;  3PB4 X;  4KOT A;  5CBM A;  1YX0 A;  2K5T A;  3EXN A;  3BXM A;  1GYT A;  3FB3 A;  1I12 A;  4P4D A;  4B5O A;  2H5M A;  1ELL P;  1VHS A;  4MI4 A;  3VH9 A;  2ARH A;  1IGB A;  1HDU A;  4FUU A;  4MFL A;  4G1P A;  5AG6 A;  4H6Z A;  3IWG A;  3IU1 A;  4OKO A;  5G22 A;  2Q0Y A;  4EFD A;  1XJO A;  2F8H A;  3GYA A;  3TO9 A;  2I3C A;  4R3K A;  4KZT A;  1BPM A;  4P10 A;  2B5G B;  1P4N A;  2AFS A;  4AG7 A;  1M4L A;  1BO4 A;  1S60 A;  4KLW A;  4Z65 A;  5LYL A;  2EUI A;  2F5I A;  2XEI A;  4IK2 A;  5IB9 A;  4PSW A;  4UIA A;  4NEX A;  1M44 A;  4ZI6 A;  3V7Z A;  1Z8W A;  4MFQ A;  3G8W A;  2RB7 A;  2B3V A;  2A4N A;  5C82 A;  4KVX A;  4WJB A;  2CXA A;  4P6Y A;  3HLP A;  1Y0Y A;  3ZZI A;  1XBU A;  4KOY A;  3KI9 A;  2FSR A;  2VZY A;  4JJX A;  5E96 A;  3H8G A;  3TOA A;  3GUX A;  4FBE A;  3SHP A;  4LQ6 A;  4QB9 A;  3TO7 A;  2PVV A;  3PBB A;  1LOK A;  4R9M A;  2PR8 A;  4FD6 A;  2ZW6 A;  2VQY A;  3L2N A;  3PGP A;  4X5K A;  1X12 A;  4F8Z A;  2FVG A;  3DSB A;  4MHY A;  5JQ4 A;  2Q7B A;  4PXC A;  3DDD A;  3IIB A;  2POK A;  2P6F A;  3N7Z A;  4MXU A;  4PV6 A;  3FBU A;  4F9V A;  1YW4 A;  3F0A A;  3B8G A;  1GHE A;  5F09 A;  2ZED A;  1XRY A;  2VZZ A;  4CAF A;  1NMT A;  3R96 A;  2FXF A;  2Q04 A;  2EBJ A;  2NMT A;  4P4F A;  2BO9 A;  2PJ6 A;  3RNZ A;  5F48 A;  2PIY A;  3H5Z A;  4MHZ A;  3SJG A;  3UY5 A;  3D7G A;  5D8N A;  4CGM A;  1NSA A;  1VKC A;  1YR0 A;  4MFK A;  4R7M A;  3FYN A;  3PRT A;  2GAN A;  2PJ0 A;  5JGF A;  2P6G A;  4KOR A;  3PBE A;  4YWY A;  2FE7 A;  3H8E A;  1CJW A;  5AGE A;  3ISZ A;  3GKR A;  3WC7 A;  4BIN A;  4XPK A;  1CX8 A;  1VIX A;  5K8P A;  1RTQ A;  2F7V A;  1S7N A;  2JDD A;  4OC3 A;  3RYO A;  5IX3 A;  2Z11 A;  1IID A;  3QB8 A;  3D7H A;  1OBR A;  1ARL A;  2PJA A;  3LMS A;  3VAT A;  3FEC A;  1KUY A;  4KVM E;  4YFJ A;  3FXT A;  1Y9W A;  1DE4 C;  2QIR A;  3KHZ A;  2V8G A;  3DLJ A;  1YW6 A;  2PVW A;  4XPD C;  3FEE A;  4A94 A;  4A95 A;  5G1Z A;  2HUZ A;  2B4B A;  4OIW A;  3NE8 A;  1XMB A;  3SJE A;  2Z3K A;  1CBX A;  2GRE A;  3P2F A;  4ZY1 A;  4B6Z A;  3PB9 X;  3WT4 A;  1YK3 A;  4MFP A;  4XPD B;  3RZA A;  4P4I A;  4YRH A;  3D7F A;  4UEE A;  2FS5 A;  2O28 A;  3T90 A;  4NGT A;  4OID A;  4F6A A;  2G3A A;  2C6P A;  2VI7 A;  2JDC A;  1QSO A;  4AB7 A;  2AFX A;  3VWE A;  1QQ9 A;  2BOA A;  4MFJ A;  3IWE A;  3WC6 A;  5DWN A;  4F0Y A;  4OC0 A;  1AYE A;  7CPA A;  4P44 A;  1CG2 A;  2Q44 A;  4AG9 A;  3NH4 A;  3SI1 A;  2NYQ A;  4NSQ A;  4PSX A;  1UFH A;  2EVN A;  1YQE A;  4MBU A;  3BI0 A;  4YU9 A;  5I4M A;  4NGQ A;  1M4D A;  3B3C A;  1P0H A;  3RAM A;  2EO8 A;  3B2Y A;  3K9T A;  2EWB A;  4L8A A;  4UIB A;  1PU9 A;  3FIX A;  1OZP A;  3CXQ A;  4OAD A;  5HVF A;  4IHM A;  1TXR A;  4FD5 A;  4HNY B;  3KHX A;  3R1K A;  1B6B A;  3GLJ A;  3EC4 A;  1CP7 A;  3B35 A;  2FT0 A;  1XOV A;  2J9A A;  4GM5 A;  1YLE A;  3EY5 A;  2FL4 A;  5HXD A;  4KOW A;  4NJQ A;  4R57 A;  4MCP A;  1KWM A;  4EWT A;  2YND A;  4U9Y A;  1QSM A;  1K4J A;  3RBU A;  4OC2 A;  4TWE A;  4IF5 A;  1TF8 A;  4MCQ A;  2GU2 A;  3IGR A;  5F49 A;  3QNV A;  3KR5 A;  2OOT A;  8CPA A;  1XEB A;  1TKJ A;  1LFW A;  2XEG A;  2B4D A;  4FD7 A;  2AE6 A;  5A28 A;  2AFZ A;  3FJU A;  4CYO A;  3IC1 A;  5HH1 A;  3IO1 A;  4AVB A;  4MCS A;  1Z5R A;  2OU2 A;  2IL4 A;  1WK4 A;  2Z3O A;  5EMI A;  2ZEO A;  3BHX A;  4H89 A;  4R8F A;  5LYI A;  4B5P A;  2ZEN A;  1V0C A;  2JLM A;  3FED A;  3R9G A;  4CGL A;  4OLL A;  4UA3 A;  4CPA A;  3S6F A;  2ANP A;  2PJ3 A;  2OR4 A;  4A2Z A;  4B12 A;  4NGM A;  1XMT A;  5G20 A;  5J8C A;  2PJB A;  5KTD A;  3CZX A;  4Y49 C;  4RUH A;  1S3Z A;  4NF1 A;  2I79 A;  1NE9 A;  5LYF A;  3BJ8 A;  2Q7S A;  3KQX A;  1KUX A;  1IB1 E;  2PQ8 A;  3F5B A;  5LRK A;  1ZLH A;  4Y49 B;  1VHE A;  4L89 A;  1U6M A;  3B3S A;  3W6S A;  4E0A A;  4F9U A;  2HV2 A;  4B5P B;  4M85 A;  4UBR A;  2PC1 A;  4DNC A;  2PDO A;  3FNC A;  4AVC A;  2AFM A;  3BLN A;  4OC4 A;  3IFE A;  1IYK A;  1Z4E A;  2KCW A;  3NH5 A;  1Q7L A;  1JWQ A;  2DXQ A;  3K9U A;  2Z3L A;  2VBQ A;  1LAP A;  4X8I A;  3RO0 A;  4CYN A;  2DEA A;  2IJZ A;  1AMP A;  3PB6 X;  3I1U A;  4CYQ A;  4RS2 A;  4UEF A;  2CTC A;  4C2Y A;  4MHP A;  3NE7 A;  2PJ7 A;  4FAI A;  3DNS A;  5ELY A;  4AXV A;  3H8F A;  4M6I A;  2PJ9 A;  3E0K A;  1Y0R A;  3S6G A;  4HPS A;  1IOF A;  4KLV A;  2X7B A;  3B7I A;  3LOD A;  4AVA A;  2CNS A;  2WYR A;  4CAV A;  3TOB A;  4A31 A;  3GIU A;  2GIV A;  1PYT B;  3D68 A;  4ZY2 A;  2VL1 A;  3GB0 A;  4QC6 A;  2REE A;  2HC9 A;  3I3G A;  4NXY A;  3S9N A;  4ORF A;  1Q2Y A;  5LYD A;  1ELM P;  5IB0 A;  4KS9 A;  4MJ8 A;  1QST A;  4OME A;  4UF4 A;  2IMO A;  4QUS A;  1BPN A;  3D66 A;  2JBJ A;  4PXD A;  4A32 A;  2OH1 A;  2PJ4 A;  3EFA A;  3H4Q A;  4Q36 A;  4HKF A;  3VAR A;  1M4G A;  2CNM A;  1R43 A;  4UFV A;  5AG5 A;  3SXN A;  1Q2D A;  4PK2 A;  3KQZ A;  4UFW A;  3TC8 A;  2AFU A;  4C2Z A;  3WAB A;  4CAE A;  4KUB A;  2R8V A;  3JTK A;  1Z2L A;  4FWU A;  2Q4Z A;  2PIZ A;  3KZW A;  4MHN A;  3FVL A;  4R3L A;  5DS0 A;  3ISX A;  1JQG A;  3D4U A;  4K30 A;  3D7D A;  4P4E A;  3PFE A;  4ZGY B;  1Z8X A;  1I21 A;  1LCP A;  2PJ2 A;  4M6H A;  3GY9 A;  3IWW A;  4C7I A;  2ZEG A;  4A37 A;  4BBH A;  1ZG8 A;  2C27 A;  1FNO A;  2PRQ A;  4JYW A;  2FIA A;  2QYV A;  4JWP A;  4KOS A;  4KUA A;  3W91 A;  4JD6 A;  2OZH A;  1MK4 A;  4CRZ B;  3CDX A;  4IAV A;  4ZBG A;  1RO5 A;  4JXQ A;  2DF5 A;  4KSI A;  2WZN A;  5AG4 A;  2Q4V A;  2V8H A;  3WR7 A;  5HMN A;  5K8N A;  2FIW A;  1EE3 P;  4B14 A;  5H84 A;  4E2A A;  2QJ8 A;  4NJR A;  3LWU A;  5HVG A;  4ZY0 A;  3JRU A;  3EO4 A;  4W9Y A;  4DYO A;  3F8K A;  3KKW A;  1MJA A;  2R7H A;  2ZOG A;  2Z3N A;  3D67 A;  4RI1 A;  5HVH A;  2GE3 A;  1CPS A;  4KOV A;  1ARM A;  1BAV A;  1YSJ A;  2ZW7 A;  4PQA A;  4U9Z A;  2ZPA A;  4NGR A;  5ISV A;  2V77 A;  2PE3 A;  4X2T A;  4NGN A;  1S7K A;  1Z8L A;  4P4B A;  1Z9U A;  4LX9 A;  3D2M A;  2V8V A;  2I00 A;  3BI1 A;  2DPT A;  3DGV A;  2CF4 A;  3R9F A;  4Q7A A;  2PJ5 A;  4H2K A;  3FF3 A;  4A38 A;  1TKH A;  4KSF A;  3SI0 A;  1N71 A;  4YGO A; 
#chains in the Genus database with same CATH homology
 4JLY A;  1LRZ A;  5KTA A;  1I1D A;  2FCK A;  1XF8 A;  4EVY A;  2VXK A;  3CXS A;  3D2P A;  5IV0 A;  4CGP A;  3JVN A;  4QVT A;  2PR1 A;  3MGD A;  2ZW5 A;  2RC4 A;  4B10 A;  2QML A;  4UWI A;  3A9L A;  4C68 A;  4H6U A;  4CAW A;  2R1I A;  1YRE A;  4I49 A;  1KUV A;  3V8I A;  4UCP A;  3D3S A;  2BUE A;  4M3S A;  1M1D A;  2B4D B;  4PK3 A;  3QAH A;  5I0C A;  4A30 A;  3I9S A;  3TE4 A;  4E8O A;  4UFX A;  4J3G A;  2REF A;  4MFZ A;  3TCV A;  2P6E A;  3LD2 A;  4CGN A;  3R9E A;  4U5Y A;  1M4I A;  3C26 A;  5AG7 A;  1YVO A;  2ZXV A;  1PUA A;  1Q2C A;  2G0B A;  1Y7R A;  5G21 A;  1XE4 A;  3TFY A;  1IIC A;  3OWC A;  1SQH A;  2DPS A;  4KOX A;  4B11 A;  3S6H A;  2D4P A;  3T9Y A;  4FD4 A;  4CYP A;  1ON0 A;  5EBV A;  1MJ9 A;  4HNW B;  2Z3P A;  4MY3 A;  4NCZ A;  1WWZ A;  1BOB A;  3TO6 A;  4B13 A;  4MY0 A;  1KZF A;  2WUU A;  3D8P A;  2BEI A;  2Q4Y A;  3SXO A;  4C2X A;  1J4J A;  2D4O A;  2OZG A;  2PSW A;  2R98 A;  3BJ7 A;  5F46 A;  5EC4 A;  4GS4 A;  4UWJ A;  3PZJ A;  5CNP A;  2Z0Z A;  5F47 A;  1S5K A;  2B58 A;  4KVO E;  4LUA A;  1XIX A;  3S6K A;  1Y9K A;  1B87 A;  3ZJ0 A;  4CAX A;  1IYL A;  4C7H A;  5A27 A;  1FY7 A;  4A33 A;  4BMH A;  1R57 A;  1S7L A;  3DR6 A;  2P0W A;  2VEZ A;  4JXR A;  3JUW A;  2J8N A;  4KOU A;  5KTC A;  2YGW A;  1L0C A;  1S7F A;  2OZU A;  1CM0 A;  3CXP A;  3VWD A;  2PRB A;  3TT2 A;  5J8F A;  4IUS A;  3IU2 A;  1RXT A;  2BSW A;  4R87 A;  5JPH A;  5FVJ A;  3G3S A;  5H86 A;  2HQY A;  1MJB A;  2OB0 A;  4MHD A;  2JEV A;  1TIQ A;  2Z10 A;  2ZW4 A;  1QSR A;  4CGO A;  4OAE A;  2CNT A;  4XNH C;  4II9 A;  3PP9 A;  4CRY B;  3W6X A;  1YGH A;  2J8R A;  4UCM A;  3TTH A;  4XNH B;  1Z4R A;  2YNE A;  2WPW A;  5GCN A;  2QEC A;  3R95 A;  2YNC A;  4XPL A;  3P2H A;  1QSN A;  4CS0 B;  2ATR A;  4HNX B;  4F0X A;  2CY2 A;  2Y0M A;  2AJ6 A;  2G3T A;  3FRM A;  2J8M A;  3DR8 A;  2YNC C;  1NSL A;  5BWA B;  4KSA A;  1ZO0 A;  4UCN A;  2BL1 A;  2WPX A;  2WSA A;  4ONU A;  5DWM A;  2B3U A;  2B5G A;  5C88 A;  2Z3M A;  4Q38 A;  4QBJ A;  1YVK A;  4KOT A;  1YX0 A;  2K5T A;  3EXN A;  3FB3 A;  1I12 A;  4B5O A;  2H5M A;  1VHS A;  4MI4 A;  2ARH A;  4MFL A;  5AG6 A;  4H6Z A;  3IWG A;  3IU1 A;  5G22 A;  2Q0Y A;  3TO9 A;  3GYA A;  4R3K A;  4KZT A;  2B5G B;  1P4N A;  4AG7 A;  1BO4 A;  1S60 A;  4KLW A;  2EUI A;  2F5I A;  4PSW A;  4NEX A;  1M44 A;  4MFQ A;  3G8W A;  2B3V A;  2A4N A;  5C82 A;  4KVX A;  2CXA A;  3ZZI A;  4KOY A;  2FSR A;  2VZY A;  4JJX A;  5E96 A;  3TOA A;  3SHP A;  4QB9 A;  3TO7 A;  4R9M A;  2PR8 A;  4FD6 A;  2ZW6 A;  2VQY A;  3PGP A;  4X5K A;  3DSB A;  5JQ4 A;  2Q7B A;  3DDD A;  2P6F A;  3N7Z A;  4PV6 A;  3FBU A;  3F0A A;  3B8G A;  1GHE A;  2VZZ A;  4CAF A;  1NMT A;  3R96 A;  2FXF A;  2Q04 A;  2NMT A;  5F48 A;  4CGM A;  3H5Z A;  3UY5 A;  1YR0 A;  1VKC A;  4MFK A;  3FYN A;  2GAN A;  2P6G A;  4KOR A;  2FE7 A;  1CJW A;  5AGE A;  3GKR A;  4XPK A;  1S7N A;  2JDD A;  3RYO A;  5IX3 A;  2Z11 A;  1IID A;  3QB8 A;  4YFJ A;  1KUY A;  4KVM E;  3FXT A;  1Y9W A;  2QIR A;  4XPD C;  4A95 A;  5G1Z A;  2HUZ A;  2B4B A;  2Z3K A;  3P2F A;  1YK3 A;  4MFP A;  4XPD B;  4YRH A;  2FS5 A;  2O28 A;  3T90 A;  4F6A A;  2G3A A;  2VI7 A;  2JDC A;  1QSO A;  4AB7 A;  3VWE A;  4MFJ A;  3IWE A;  5DWN A;  4F0Y A;  2Q44 A;  4AG9 A;  4NSQ A;  4PSX A;  1UFH A;  2EVN A;  4MBU A;  1M4D A;  1P0H A;  4L8A A;  1PU9 A;  3FIX A;  1OZP A;  3CXQ A;  4OAD A;  4HNY B;  4FD5 A;  3R1K A;  1B6B A;  3EC4 A;  2FT0 A;  1YLE A;  3EY5 A;  2FL4 A;  4KOW A;  4R57 A;  2YND A;  4U9Y A;  1QSM A;  1K4J A;  4IF5 A;  3IGR A;  5F49 A;  1XEB A;  2B4D A;  4FD7 A;  2AE6 A;  5A28 A;  4CYO A;  5HH1 A;  4AVB A;  2OU2 A;  2IL4 A;  1WK4 A;  2Z3O A;  4H89 A;  4B5P A;  1V0C A;  2JLM A;  3R9G A;  4CGL A;  4OLL A;  4UA3 A;  3S6F A;  4A2Z A;  4B12 A;  1XMT A;  5G20 A;  5J8C A;  5KTD A;  4Y49 C;  1S3Z A;  4NF1 A;  2I79 A;  1NE9 A;  3BJ8 A;  1KUX A;  1IB1 E;  2PQ8 A;  3F5B A;  4Y49 B;  4L89 A;  1U6M A;  3W6S A;  4E0A A;  2HV2 A;  4B5P B;  4M85 A;  4UBR A;  2PC1 A;  4DNC A;  2PDO A;  3FNC A;  4AVC A;  3BLN A;  1IYK A;  1Z4E A;  2KCW A;  2DXQ A;  3K9U A;  2Z3L A;  2VBQ A;  4CYN A;  4CYQ A;  4RS2 A;  4C2Y A;  3NE7 A;  3DNS A;  3E0K A;  3S6G A;  4KLV A;  2X7B A;  3LOD A;  4AVA A;  2CNS A;  4CAV A;  3TOB A;  4A31 A;  2GIV A;  4QC6 A;  2REE A;  3I3G A;  4NXY A;  4ORF A;  1Q2Y A;  5IB0 A;  4KS9 A;  4MJ8 A;  1QST A;  4QUS A;  4A32 A;  2OH1 A;  3EFA A;  3H4Q A;  4Q36 A;  4HKF A;  1M4G A;  2CNM A;  5AG5 A;  4UFV A;  3SXN A;  1Q2D A;  4PK2 A;  4UFW A;  4C2Z A;  4CAE A;  4KUB A;  2R8V A;  3JTK A;  4R3L A;  4K30 A;  4ZGY B;  1I21 A;  3GY9 A;  4C7I A;  4BBH A;  2C27 A;  2FIA A;  4JWP A;  4KOS A;  4KUA A;  3W91 A;  4JD6 A;  2OZH A;  1MK4 A;  4CRZ B;  4ZBG A;  1RO5 A;  4JXQ A;  5AG4 A;  2Q4V A;  3WR7 A;  5HMN A;  2FIW A;  4B14 A;  5H84 A;  4E2A A;  3EO4 A;  3F8K A;  3KKW A;  1MJA A;  2R7H A;  2Z3N A;  4RI1 A;  2GE3 A;  4KOV A;  2ZW7 A;  4U9Z A;  2ZPA A;  5ISV A;  1S7K A;  1Z9U A;  4LX9 A;  3D2M A;  2I00 A;  2DPT A;  3R9F A;  4KSF A;  1N71 A;  4YGO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...