4MHZA

Crystal structure of apo-form glutaminyl cyclase from ixodes scapularis in complex with pbd150
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
326
structure length
325
Chain Sequence
LKWPRDLRPLAHHDLLYMGQISEDRGDFNATLRNFLVPRVVGSQKHREVREFIVRSLKDLDWDVEEDCFDGQTPHGIKPFCNVIATLNPSACHRLVLACHYDSLLHKEGTFIGATDSAVPCAQLLYLARSLNGKLQNQKTRGDGLTLQLVFFDGEEAFERWSSHDSLYGSRHLAQKWHEDRTSAERLESCLERSEIANQIDRMEVMVLLDLLGAENPRFYSYFGETQPVYRRLVNIESRLNDAGLMELPRRRRRTNYFSNSSTVGFIEDDHIPFLKRSVPIVHIIPSPFPDVWHTLDDNEQNLHHPTISNLNKIFKAFVSEYLQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glutaminyl cyclase, putative
publication title Structural and functional analyses of a glutaminyl cyclase from Ixodes scapularis reveal metal-independent catalysis and inhibitor binding.
pubmed doi rcsb
source organism Ixodes scapularis
molecule tags Transferase
total genus 110
structure length 325
sequence length 326
ec nomenclature ec 2.3.2.5: Glutaminyl-peptide cyclotransferase.
pdb deposition date 2013-08-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 4mhzA00
4EWTA 4MHNA 5ELYA 3NH4A 1IY7A 3SJEA 4UEFA 1AYEA 2V8HA 3B35A 2FVGA 3PFOA 1ELLP 1CPSA 4JYWA 4MCPA 1HEEA 2PE3A 2PJ8A 3H8EA 5LRJA 4FAIA 2XEFA 1Q7LA 2O53A 1QMUA 1CPXA 3KGQA 3B7IA 1VGYA 2I3CA 3B3WA 4OMEA 4F8ZA 2BCOA 2ZEEA 4MHZA 2PJ5A 2PJ6A 3WT4A 4G1PA 3ISXA 3K2KA 4MMOA 4PPZA 2GREA 5LRGA 5I4MA 2AFWA 4P4JA 5K8PA 2ANPA 2NSMA 2V8GA 4P4FA 3CPXA 4F9VA 5J1QA 4P4EA 3PRTA 5IB9A 4GM5A 4R6TA 3BXMA 1ZLIA 3I1UA 2QVPA 4A37A 4RUHA 3ISZA 4B6ZA 2POKA 2C1CA 3PB9X 4A39A 1CX8A 3B3TA 5LRKA 4TWEA 2NYQA 4JZ0A 2ZEPA 1PCAA 1XFOA 1YLOA 1HDQA 2ZOGA 3PEIA 4ONWA 2AFZA 2PRQA 3BI0A 1ZG8A 1CG2A 5K8MA 1TKFA 4MCQA 2GLFA 2PJBA 1VHEA 4P45A 3D66A 1LAMA 4MRIA 3FX6A 3FH4A 2ZEFA 3KL9A 3CDXA 3SJXA 4FUUA 3JRUA 1LFWA 1UWYA 4R8FA 4ZI6A 5LYFA 3PBBA 4ZX9A 4Z65A 3GB0A 1Y0YA 4O23A 2GU2A 5K8NA 5HVFA 5JM6A 1BPMA 1XRYA 4WJBA 4MHYA 3V7ZA 4P4BA 4ZYQA 1KWMA 2IQ6A 4NGRA 5D8NA 3KQXA 4R76A 3NA6A 2QYVA 2AFXA 3PFEA 2QJ8A 1H8LA 3RZAA 4A94A 1F2OA 3KZWA 4NGSA 1F57A 2GLJA 4P44A 4DJLA 4NJQA 1TKHA 3WABA 3D7GA 4P4DA 1ARLA 3KR4A 3RBUA 4NGTA 5CBMA 4DUKA 3HUVA 5HVHA 3S9MA 4PXBA 1ZG7A 3FJUA 5JGFA 3RAMA 2CF4A 2IJZA 4PXDA 4OKOA 1YW4A 2ZEOA 2ZELA 3NFZA 1YW6A 1Z8LA 4YWYA 5THWA 2XEGA 2HB6A 5HVGA 2Q43A 3KHXA 3D7FA 1XBUA 3FEEA 5D29A 2AFMA 4MCRA 2ZEHA 2F8HA 3B3SA 3FMCA 3WC7A 3SI0A 3SI1A 2C6CA 3D7HA 1TXRA 1BAVA 3KHZA 1HDUA 3SI2A 1RTQA 3D67A 1XJOA 3MRUA 4UIBA 4F9UA 1PYTB 1EE3P 1LANA 3N5FA 5LYIA 1AMPA 2V8VA 1FNOA 4OIWA 8CPAA 2OOTA 1TF9A 4UIAA 4IK2A 4PXEA 3IIBA 3NH5A 4KSIA 6CPAA 3B3VA 3IEHA 4NGNA 2PJ4A 1ZG9A 2PJ1A 3KASA 4K3NA 1CBXA 5F09A 4UF4A 1M4LA 3IFEA 2PCUA 4MCSA 1JQGA 3DLJA 2PJ7A 2BO9A 2PJ3A 4NGMA 1Y0RA 3PB8X 4BD9A 2AFSA 4R7MA 1YSJA 4OC5A 1ARMA 3GUXA 4P4IA 2RB7A 4OC0A 3LWUA 1ELMP 2G9DA 2PJ9A 1F2PA 1LOKA 3S9NA 4X2TA 2WYRA 2V77A 3S9LA 5CPAA 2JBJA 1IGBA 1Z2LA 2Q4ZA 3VATA 3SJGA 2PJAA 2EK8A 3V38A 3HLPA 2PVWA 2PJCA 2F7VA 4NGQA 2PIYA 2O4HA 2OR4A 3TX8A 1DE4C 1ZLHA 3K9TA 4X8IA 2V8DA 4NFRA 3B3CA 3BHXA 1TKJA 2ZENA 3KI9A 5K8OA 3TC8A 3D7DA 4UEEA 5LYLA 5LYDA 1LAPA 2IMOA 3KQZA 4DYOA 1GYTA 2Q51A 3BI1A 1LCPA 4X3RA 1NSAA 5JH9A 2HC9A 2J9AA 4OIDA 4ZY1A 2RFHA 3QNVA 2AFUA 2PVVA 3MN8A 3WC6A 1VIXA 3PB4X 2BOAA 3FVLA 3FEDA 4ZX8A 2JBKA 2EK9A 3VARA 1OBRA 3PB6X 2CTCA 2ZEMA 4A38A 4UEZA 1Y7EA 4OC4A 4PQAA 4MXUA 2ZEGA 1QQ9A 1CP7A 5HXDA 3GLJA 1DTDA 2ZOFA 4FWUA 4H2KA 4CPAA 2VL1A 1CP6A 2AFOA 4NJRA 4OC1A 1R43A 1YMEA 4P6YA 1BPNA 3FF3A 4YU9A 4WWVA 3FECA 2CTBA 4FBEA 3DGVA 1BLLE 3KR5A 3D68A 4IHMA 4OC2A 4EMEA 4IAVA 4OP4A 2WZNA 2XEJA 3NH8A 2CIJA 3IO1A 3CPAA 2ZEDA 2XEIA 4TNUA 3L2NA 2JEWA 4W9YA 2C6GA 3IC1A 3CT9A 1Z5RA 4OC3A 4AXVA 2C6PA 1XMBA 1R3NA 2PJ2A 4Q7AA 3IJ3A 3H8FA 2PIZA 7CPAA 5DS0A 3T8WA 4ZY0A 4NGPA 4P10A 3VH9A 3LMSA 3SJFA 1VHOA 3WC5A 3H8GA 4LQGA 3D4UA 3B2YA 2EWBA 3PB7X 4MHPA 2PJ0A 2ABZA 2DEAA 4ZY2A 3IWWA 4PXCA 4EFDA 1TF8A 1FT7A 3PBEA
chains in the Genus database with same CATH superfamily
4C7IA 1ON0A 3CXQA 5EC4A 3T90A 4CAWA 4Q38A 4C7HA 4EWTA 4KOTA 2G0BA 4F0XA 5BWAB 5FVJA 4MHNA 4R9MA 5ELYA 3NH4A 1IY7A 4LUAA 5F47A 3SJEA 2G3TA 1S3ZA 3TO9A 4UEFA 1AYEA 2ZW5A 2OZGA 1YVKA 2V8HA 3LACA 1I21A 3B35A 3GY9A 4LQ6A 2FVGA 2F5IA 3CXPA 4XPDB 1NSLA 5HH1A 3PFOA 1ELLP 4OLLA 1CPSA 4JYWA 4MCPA 1HEEA 2PE3A 1QSOA 2PC1A 2PJ8A 3H8EA 5LRJA 4XNHB 4FAIA 4UFXA 2XEFA 4IUSA 4KVME 4YFJA 4DNCA 1Q7LA 2O53A 1QMUA 1CPXA 2H5MA 4CGOA 4NF1A 3PP9A 4Q36A 3KGQA 2VEZA 4QC6A 3BJ8A 3B7IA 1VGYA 3TOBA 2GFQA 2I3CA 1B87A 3B3WA 2I79A 5KTDA 4OMEA 4F8ZA 1LRZA 4U9ZA 2BCOA 2ZEEA 1QSNA 3T9YA 4CGNA 2JLMA 4MHZA 2Q44A 4LX9A 2R8VA 2R98A 3D2PA 4L8AA 1QSMA 2PJ5A 2PJ6A 3WT4A 1P0HA 1WK4A 3K9UA 4G1PA 3ISXA 3K2KA 4JLYA 2PR1A 3CXSA 5AG7A 4MMOA 2BEIA 4HNWB 4PPZA 1L0CA 2GREA 5AG4A 4II9A 4U5YA 5LRGA 5I4MA 2AFWA 1YX0A 4P4JA 1X12A 5K8PA 4UA3A 2ANPA 2I00A 5H86A 2R1IA 4E8OA 2NSMA 2OH1A 4OADA 4R3LA 2V8GA 4P4FA 3CPXA 4F9VA 1K4JA 5J1QA 1S5KA 4P4EA 3PRTA 4PK2A 5IB9A 4GM5A 1VKCA 4R6TA 4MI4A 2QECA 3BXMA 4CGMA 1ZLIA 3I1UA 1Q2CA 2QVPA 2Z3NA 4GS4A 5JPHA 4UCNA 4A37A 1KZFA 4RUHA 3ISZA 4B6ZA 2POKA 2C1CA 3IU1A 2FIWA 4QB9A 3SXNA 1Y7RA 3PB9X 4A39A 1Y9WA 1CX8A 3B3TA 4QBJA 4TWEA 5LRKA 2NYQA 4JZ0A 2DPTA 4KUAA 5DWNA 2ZEPA 1PCAA 1XFOA 5JQ4A 2JDCA 1XOVA 1HDQA 1YLOA 2ATRA 2ZOGA 3PEIA 4ONWA 3QAHA 4X5KA 2AFZA 2PRQA 4RN7A 4XPDC 4FD5A 3BI0A 1ZG8A 4UBRA 1CG2A 4AVBA 5K8MA 2BUEA 1TKFA 3GKRA 4MCQA 4XNHC 2GLFA 4F0YA 3FNCA 2PJBA 1VHEA 3DR6A 4KS9A 4UCMA 4B14A 4P45A 2B4BA 3D66A 1LAMA 4M3SA 3V8IA 4MRIA 1U6MA 3FX6A 2DPSA 3FH4A 2YNCC 2ZEFA 3GIUA 2CNTA 4A30A 3KL9A 2BL1A 2Q7BA 3CDXA 2FCKA 4FUUA 3SJXA 4M6IA 3TO6A 5KTAA 3JRUA 1LFWA 1UWYA 4IF5A 4R8FA 4ZI6A 4PSXA 5LYFA 2KCWA 4AVCA 3PBBA 4JXRA 4EVYA 4ZX9A 4Z65A 3GB0A 1Y0YA 3R96A 4O23A 2GIVA 4A2ZA 4B5PA 2GU2A 4A31A 5K8NA 5HVFA 1Z8TA 5JM6A 5G22A 1BPMA 1XRYA 1Y9KA 4MBUA 4WJBA 2X7BA 3DR8A 4MHYA 3EO4A 1IOFA 3V7ZA 2A4NA 4CS0B 4P4BA 4A32A 4ZYQA 3FXTA 4QVTA 2ZW4A 1KWMA 2IQ6A 3E0KA 4NGRA 5D8NA 3KQXA 1Z4EA 3NA6A 4R76A 2QYVA 3S6GA 2WSAA 4HPSA 4XPKA 2AFXA 3PFEA 4F6AA 2QJ8A 1H8LA 4KSAA 4RS2A 2WPXA 4CAFA 3RZAA 4A94A 1F2OA 3KZWA 4ZBGA 1M4GA 3FIXA 5KTCA 5AG5A 2Z3KA 4NGSA 1F57A 2GLJA 4P44A 2ZXVA 4DJLA 1A2ZA 4JJXA 4K30A 4NJQA 1IOIA 1TKHA 2Q0YA 4Y49B 1GHEA 2VBQA 3TTHA 2B3UA 3WABA 4L89A 3D7GA 4P4DA 2BSWA 1ARLA 5A27A 1BOBA 3KR4A 3RBUA 2Z3LA 1B6BA 2AE6A 3EFAA 2AJ6A 2B5GB 4JD6A 5I0CA 4NGTA 2Q04A 5CBMA 4DUKA 1KUVA 1Q2DA 3BJ7A 3IGRA 3HUVA 3JVNA 3S6FA 4C2ZA 3ZZIA 5HVHA 4ORFA 3S9MA 5AGEA 4PXBA 1ZG7A 1XF8A 3FJUA 5JGFA 3EXNA 3RAMA 2DXQA 4KZTA 1M4IA 4AG9A 5AG6A 4NSQA 2REEA 2CF4A 2EUIA 2IJZA 4PXDA 2HQYA 4OKOA 1P4NA 1YW4A 2ZEOA 4E2AA 2ZELA 1FY7A 4MFKA 3QB8A 3NFZA 1YW6A 1Z8LA 2HV2A 4YWYA 4CRZB 4JWPA 2OZUA 5THWA 2XEGA 3JUWA 4MY0A 5F46A 2HB6A 5HVGA 3VWDA 2Q43A 4MJ8A 1I12A 3KHXA 2YNEA 3D7FA 1XBUA 3IU2A 3FEEA 4FD7A 5D29A 2AFMA 2K5TA 3DNSA 3R9EA 4KVXA 4OAEA 4MCRA 2ZEHA 3EC4A 4AG7A 2F8HA 1J4JA 1Q2YA 2VI7A 3B3SA 3W6XA 3FMCA 3WC7A 3SI0A 3SI1A 4I49A 2C6CA 3D7HA 5G1ZA 5IX3A 1TXRA 1BAVA 3KHZA 4BINA 1HDUA 1PU9A 3SI2A 1RTQA 3D67A 2CNMA 1XJOA 3MRUA 4UIBA 2B3VA 3F5BA 4B13A 1PYTB 2WPWA 4F9UA 1MJ9A 1EE3P 1LANA 1CJWA 2Z10A 3N5FA 5LYIA 2G3AA 1AMPA 1YK3A 3H5ZA 2B4DA 1IYKA 2CY2A 2V8VA 1FNOA 1Z8WA 4OIWA 8CPAA 2OOTA 1TF9A 4UIAA 1CM0A 4IK2A 2PRBA 4Y49C 4R3KA 4YGOA 2JDDA 4KSFA 4PXEA 1IIDA 1PUAA 3IIBA 1XEBA 3NH5A 4YRHA 3VWEA 3NE8A 4KSIA 6CPAA 2REFA 3B3VA 1XIXA 1M4DA 2QIRA 3IEHA 2GE3A 2P0WA 4B5OA 2HUZA 4H6UA 3RNZA 2OZHA 3D3SA 3R1KA 4NGNA 2PJ4A 4UFWA 1ZG9A 4UWJA 2RC4A 5HMNA 2PJ1A 3KASA 3F8KA 4E0AA 3TE4A 1XMTA 4K3NA 4MFJA 1CBXA 5F09A 4UF4A 3SXOA 1M4LA 3IFEA 4BBHA 2Z0ZA 5E96A 2PCUA 3P2HA 5C82A 4MCSA 4NCZA 1JQGA 4KLVA 3DLJA 2PJ7A 2PQ8A 4NXYA 4KOUA 2BO9A 2PJ3A 3FBUA 2FSRA 1QSTA 2JEVA 4NGMA 1Y0RA 3PB8X 1SQHA 2AFSA 2R7HA 4BD9A 3C26A 4R7MA 1YSJA 4OC5A 2Z3MA 1ARMA 2DF5A 3GUXA 1R57A 1S60A 2YNCA 2D4PA 4P4IA 2Z3OA 2RB7A 4OC0A 4ZGYB 1V0CA 3LWUA 1ELMP 2G9DA 2PJ9A 3NE7A 4M6HA 1F2PA 1S7KA 4B12A 1BO4A 1NMTA 5F48A 2ODFA 2CNSA 1LOKA 3TFYA 2D4OA 2P6GA 2O28A 3S9NA 2PDOA 3B8GA 2FE7A 4HNXB 4X2TA 3FYNA 4CYOA 2WYRA 2V77A 4CAXA 3S9LA 5CPAA 2JBJA 1IGBA 1Z2LA 2Q4ZA 5IB0A 4PK3A 1WWZA 3VATA 4C68A 2Q4VA 3SJGA 1KUXA 2PJAA 2EK8A 3V38A 1XE4A 3HLPA 2PVWA 2PJCA 2F7VA 4NGQA 3DSBA 2PIYA 2O4HA 3IWGA 5G20A 3MGDA 3BLNA 2QMLA 2Z3PA 3S6KA 2OR4A 1M1DA 2VZYA 4UFVA 3TX8A 1RO5A 1DE4C 3RO0A 3CZXA 4KOVA 1ZLHA 1IICA 4KOWA 1N71A 2Q7SA 3K9TA 1MJAA 2V8DA 4X8IA 2ARHA 3S6HA 4KOSA 4NFRA 4A95A 3B3CA 3JTKA 3BHXA 4JXQA 3I3GA 1TKJA 2ZENA 3SHPA 2YNDA 3KI9A 5K8OA 1TIQA 3TC8A 2P6EA 3D7DA 4NEXA 4UEEA 5G21A 5EMIA 1S7FA 2NMTA 4B5PB 1IU8A 5J8CA 4FD6A 5LYLA 4XPLA 5LYDA 1LAPA 2EO8A 2IMOA 1YVOA 3KQZA 5F49A 2GANA 3IWEA 4BMHA 4HNYB 1X10A 5EBVA 4DYOA 4R87A 1GYTA 2OB0A 2IL4A 2EBJA 3D2MA 1Z8XA 2FL4A 2Q51A 4B10A 4CGLA 3BI1A 4PV6A 1LCPA 4X3RA 4CAEA 4CYNA 1UFHA 4AB7A 4H89A 1NSAA 4CYPA 5JH9A 3OWCA 2HC9A 3UY5A 2J9AA 3LODA 2J8MA 4OIDA 4ZY1A 2RFHA 3QNVA 2AFUA 2PVVA 3MN8A 3WC6A 3R9GA 2PSWA 5J8FA 4GXHA 1VIXA 1JWQA 3PB4X 2BOAA 2J8NA 3FVLA 1M44A 4CYQA 3FEDA 3D8PA 2P6FA 4ZX8A 2JBKA 4RI1A 2EK9A 3VARA 4AVAA 1OBRA 3PB6X 2CTCA 2EVNA 2ZW6A 1RXTA 4CAVA 2ZEMA 4MHDA 2Q4YA 4UEZA 3TT2A 3ZJ0A 4A33A 3DDDA 4MY3A 4A38A 3QAYA 5A28A 1Y7EA 4OC4A 2CXAA 4MFZA 4PQAA 4MXUA 2ZEGA 2FS5A 4R57A 1QQ9A 1CP7A 1S7LA 3GLJA 5HXDA 1DTDA 2ZOFA 4FWUA 1AUGA 4H2KA 3W91A 2VL1A 1CP6A 2AFOA 1YR0A 4NJRA 4OC1A 4CPAA 1R43A 1YMEA 4KLWA 4P6YA 3R9FA 3WR7A 4U9YA 3P2FA 3A9LA 4UWIA 1VHSA 1BPNA 3TO7A 4HKFA 4KVOE 3FF3A 4YU9A 3G3SA 1YLEA 4WWVA 3FB3A 3FECA 5C88A 5H84A 3I9SA 2CTBA 4FBEA 3DGVA 1BLLE 3KR5A 5GCNA 2VQYA 4KOXA 4KORA 1IB1E 1Z4RA 3D68A 4IHMA 4OC2A 4EMEA 4IAVA 3R95A 5ISVA 3EY5A 4OP4A 2FT0A 2WZNA 2XEJA 1MK4A 3NH8A 2CIJA 3IO1A 3CPAA 4J3GA 3GYAA 5CNPA 4FD4A 1ZO0A 2ZEDA 4M85A 2XEIA 1YQEA 4KOYA 4TNUA 3TCVA 2Y0MA 4MFPA 4B11A 3L2NA 2JEWA 4W9YA 4CRYB 2B5GA 2C6GA 1QSRA 1YGHA 3IC1A 3CT9A 3PGPA 4PSWA 3FRMA 3PZJA 2VZZA 4QUSA 1OZPA 1Z5RA 4OC3A 4AXVA 2C6PA 4M6GA 1XMBA 2J8RA 1R3NA 2YGWA 2OU2A 2PJ2A 1IYLA 1KUYA 3G8WA 4KUBA 4Q7AA 2FIAA 3KKWA 1S7NA 3IJ3A 4H6ZA 3H8FA 1I1DA 2PIZA 3LD2A 3N7ZA 7CPAA 5DS0A 3T8WA 3W6SA 3TOAA 4ZY0A 4C2YA 4NGPA 3H4QA 4P10A 2C27A 2PR8A 4MFQA 3VH9A 3LMSA 2ZW7A 3SJFA 1VHOA 1MJBA 3H8GA 3WC5A 4LQGA 5IV0A 2B58A 2VXKA 3B2YA 2EWBA 2B4DB 3D4UA 5DWMA 2FXFA 1Z9UA 3RYOA 4CGPA 3PB7X 1NE9A 4MHPA 4UCPA 2PJ0A 2ABZA 4ONUA 2DEAA 2Z11A 4ZY2A 4MFLA 4C2XA 3F0AA 3IWWA 4PXCA 2ZPAA 4EFDA 1TF8A 2WUUA 1YREA 1FT7A 3PBEA
chains in the Genus database with same CATH topology
4EWTA 4MHNA 5ELYA 3NH4A 1IY7A 3SJEA 4UEFA 1AYEA 2V8HA 3B35A 2FVGA 3PFOA 1ELLP 1CPSA 4JYWA 4MCPA 1HEEA 2PE3A 2PJ8A 3H8EA 5LRJA 4FAIA 2XEFA 1Q7LA 2O53A 1QMUA 1CPXA 3KGQA 3B7IA 1VGYA 2I3CA 3B3WA 4OMEA 4F8ZA 2BCOA 2ZEEA 4MHZA 2PJ5A 2PJ6A 3WT4A 4G1PA 3ISXA 3K2KA 4MMOA 4PPZA 2GREA 5LRGA 5I4MA 2AFWA 4P4JA 5K8PA 2ANPA 2NSMA 2V8GA 4P4FA 3CPXA 4F9VA 5J1QA 4P4EA 3PRTA 5IB9A 4GM5A 4R6TA 3BXMA 1ZLIA 3I1UA 2QVPA 4A37A 4RUHA 3ISZA 4B6ZA 2POKA 2C1CA 3PB9X 4A39A 1CX8A 3B3TA 5LRKA 4TWEA 2NYQA 4JZ0A 2ZEPA 1PCAA 1XFOA 1YLOA 1HDQA 2ZOGA 3PEIA 4ONWA 2AFZA 2PRQA 3BI0A 1ZG8A 1CG2A 5K8MA 1TKFA 4MCQA 2GLFA 2PJBA 1VHEA 4P45A 3D66A 1LAMA 4MRIA 3FX6A 3FH4A 2ZEFA 3KL9A 3CDXA 3SJXA 4FUUA 3JRUA 1LFWA 1UWYA 4R8FA 4ZI6A 5LYFA 3PBBA 4ZX9A 4Z65A 3GB0A 1Y0YA 4O23A 2GU2A 5K8NA 5HVFA 5JM6A 1BPMA 1XRYA 4WJBA 4MHYA 3V7ZA 4P4BA 4ZYQA 1KWMA 2IQ6A 4NGRA 5D8NA 3KQXA 4R76A 3NA6A 2QYVA 2AFXA 3PFEA 2QJ8A 1H8LA 3RZAA 4A94A 1F2OA 3KZWA 4NGSA 1F57A 2GLJA 4P44A 4DJLA 4NJQA 1TKHA 3WABA 3D7GA 4P4DA 1ARLA 3KR4A 3RBUA 4NGTA 5CBMA 4DUKA 3HUVA 5HVHA 3S9MA 4PXBA 1ZG7A 3FJUA 5JGFA 3RAMA 2CF4A 2IJZA 4PXDA 4OKOA 1YW4A 2ZEOA 2ZELA 3NFZA 1YW6A 1Z8LA 4YWYA 5THWA 2XEGA 2HB6A 5HVGA 2Q43A 3KHXA 3D7FA 1XBUA 3FEEA 5D29A 2AFMA 4MCRA 2ZEHA 2F8HA 3B3SA 3FMCA 3WC7A 3SI0A 3SI1A 2C6CA 3D7HA 1TXRA 1BAVA 3KHZA 1HDUA 3SI2A 1RTQA 3D67A 1XJOA 3MRUA 4UIBA 4F9UA 1PYTB 1EE3P 1LANA 3N5FA 5LYIA 1AMPA 2V8VA 1FNOA 4OIWA 8CPAA 2OOTA 1TF9A 4UIAA 4IK2A 4PXEA 3IIBA 3NH5A 4KSIA 6CPAA 3B3VA 3IEHA 4NGNA 2PJ4A 1ZG9A 2PJ1A 3KASA 4K3NA 1CBXA 5F09A 4UF4A 1M4LA 3IFEA 2PCUA 4MCSA 1JQGA 3DLJA 2PJ7A 2BO9A 2PJ3A 4NGMA 1Y0RA 3PB8X 4BD9A 2AFSA 4R7MA 1YSJA 4OC5A 1ARMA 3GUXA 4P4IA 2RB7A 4OC0A 3LWUA 1ELMP 2G9DA 2PJ9A 1F2PA 1LOKA 3S9NA 4X2TA 2WYRA 2V77A 3S9LA 5CPAA 2JBJA 1IGBA 1Z2LA 2Q4ZA 3VATA 3SJGA 2PJAA 2EK8A 3V38A 3HLPA 2PVWA 2PJCA 2F7VA 4NGQA 2PIYA 2O4HA 2OR4A 3TX8A 1DE4C 1ZLHA 3K9TA 4X8IA 2V8DA 4NFRA 3B3CA 3BHXA 1TKJA 2ZENA 3KI9A 5K8OA 3TC8A 3D7DA 4UEEA 5LYLA 5LYDA 1LAPA 2IMOA 3KQZA 4DYOA 1GYTA 2Q51A 3BI1A 1LCPA 4X3RA 1NSAA 5JH9A 2HC9A 2J9AA 4OIDA 4ZY1A 2RFHA 3QNVA 2AFUA 2PVVA 3MN8A 3WC6A 1VIXA 3PB4X 2BOAA 3FVLA 3FEDA 4ZX8A 2JBKA 2EK9A 3VARA 1OBRA 3PB6X 2CTCA 2ZEMA 4A38A 4UEZA 1Y7EA 4OC4A 4PQAA 4MXUA 2ZEGA 1QQ9A 1CP7A 5HXDA 3GLJA 1DTDA 2ZOFA 4FWUA 4H2KA 4CPAA 2VL1A 1CP6A 2AFOA 4NJRA 4OC1A 1R43A 1YMEA 4P6YA 1BPNA 3FF3A 4YU9A 4WWVA 3FECA 2CTBA 4FBEA 3DGVA 1BLLE 3KR5A 3D68A 4IHMA 4OC2A 4EMEA 4IAVA 4OP4A 2WZNA 2XEJA 3NH8A 2CIJA 3IO1A 3CPAA 2ZEDA 2XEIA 4TNUA 3L2NA 2JEWA 4W9YA 2C6GA 3IC1A 3CT9A 1Z5RA 4OC3A 4AXVA 2C6PA 1XMBA 1R3NA 2PJ2A 4Q7AA 3IJ3A 3H8FA 2PIZA 7CPAA 5DS0A 3T8WA 4ZY0A 4NGPA 4P10A 3VH9A 3LMSA 3SJFA 1VHOA 3WC5A 3H8GA 4LQGA 3D4UA 3B2YA 2EWBA 3PB7X 4MHPA 2PJ0A 2ABZA 2DEAA 4ZY2A 3IWWA 4PXCA 4EFDA 1TF8A 1FT7A 3PBEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4EWT A;  4MHN A;  5ELY A;  3NH4 A;  1IY7 A;  3SJE A;  4UEF A;  1AYE A;  2V8H A;  3B35 A;  2FVG A;  3PFO A;  1ELL P;  1CPS A;  4JYW A;  4MCP A;  1HEE A;  2PE3 A;  2PJ8 A;  3H8E A;  5LRJ A;  4FAI A;  2XEF A;  1Q7L A;  2O53 A;  1QMU A;  1CPX A;  3KGQ A;  3B7I A;  1VGY A;  2I3C A;  3B3W A;  4OME A;  4F8Z A;  2BCO A;  2ZEE A;  4MHZ A;  2PJ5 A;  2PJ6 A;  3WT4 A;  4G1P A;  3ISX A;  3K2K A;  4MMO A;  4PPZ A;  2GRE A;  5LRG A;  5I4M A;  2AFW A;  4P4J A;  5K8P A;  2ANP A;  2NSM A;  2V8G A;  4P4F A;  3CPX A;  4F9V A;  5J1Q A;  4P4E A;  3PRT A;  5IB9 A;  4GM5 A;  4R6T A;  3BXM A;  1ZLI A;  3I1U A;  2QVP A;  4A37 A;  4RUH A;  3ISZ A;  4B6Z A;  2POK A;  2C1C A;  3PB9 X;  4A39 A;  1CX8 A;  3B3T A;  5LRK A;  4TWE A;  2NYQ A;  4JZ0 A;  2ZEP A;  1PCA A;  1XFO A;  1YLO A;  1HDQ A;  2ZOG A;  3PEI A;  4ONW A;  2AFZ A;  2PRQ A;  3BI0 A;  1ZG8 A;  1CG2 A;  5K8M A;  1TKF A;  4MCQ A;  2GLF A;  2PJB A;  1VHE A;  4P45 A;  3D66 A;  1LAM A;  4MRI A;  3FX6 A;  3FH4 A;  2ZEF A;  3KL9 A;  3CDX A;  3SJX A;  4FUU A;  3JRU A;  1LFW A;  1UWY A;  4R8F A;  4ZI6 A;  5LYF A;  3PBB A;  4ZX9 A;  4Z65 A;  3GB0 A;  1Y0Y A;  4O23 A;  2GU2 A;  5K8N A;  5HVF A;  5JM6 A;  1BPM A;  1XRY A;  4WJB A;  4MHY A;  3V7Z A;  4P4B A;  4ZYQ A;  1KWM A;  2IQ6 A;  4NGR A;  5D8N A;  3KQX A;  4R76 A;  3NA6 A;  2QYV A;  2AFX A;  3PFE A;  2QJ8 A;  1H8L A;  3RZA A;  4A94 A;  1F2O A;  3KZW A;  4NGS A;  1F57 A;  2GLJ A;  4P44 A;  4DJL A;  4NJQ A;  1TKH A;  3WAB A;  3D7G A;  4P4D A;  1ARL A;  3KR4 A;  3RBU A;  4NGT A;  5CBM A;  4DUK A;  3HUV A;  5HVH A;  3S9M A;  4PXB A;  1ZG7 A;  3FJU A;  5JGF A;  3RAM A;  2CF4 A;  2IJZ A;  4PXD A;  4OKO A;  1YW4 A;  2ZEO A;  2ZEL A;  3NFZ A;  1YW6 A;  1Z8L A;  4YWY A;  5THW A;  2XEG A;  2HB6 A;  5HVG A;  2Q43 A;  3KHX A;  3D7F A;  1XBU A;  3FEE A;  5D29 A;  2AFM A;  4MCR A;  2ZEH A;  2F8H A;  3B3S A;  3FMC A;  3WC7 A;  3SI0 A;  3SI1 A;  2C6C A;  3D7H A;  1TXR A;  1BAV A;  3KHZ A;  1HDU A;  3SI2 A;  1RTQ A;  3D67 A;  1XJO A;  3MRU A;  4UIB A;  4F9U A;  1PYT B;  1EE3 P;  1LAN A;  3N5F A;  5LYI A;  1AMP A;  2V8V A;  1FNO A;  4OIW A;  8CPA A;  2OOT A;  1TF9 A;  4UIA A;  4IK2 A;  4PXE A;  3IIB A;  3NH5 A;  4KSI A;  6CPA A;  3B3V A;  3IEH A;  4NGN A;  2PJ4 A;  1ZG9 A;  2PJ1 A;  3KAS A;  4K3N A;  1CBX A;  5F09 A;  4UF4 A;  1M4L A;  3IFE A;  2PCU A;  4MCS A;  1JQG A;  3DLJ A;  2PJ7 A;  2BO9 A;  2PJ3 A;  4NGM A;  1Y0R A;  3PB8 X;  4BD9 A;  2AFS A;  4R7M A;  1YSJ A;  4OC5 A;  1ARM A;  3GUX A;  4P4I A;  2RB7 A;  4OC0 A;  3LWU A;  1ELM P;  2G9D A;  2PJ9 A;  1F2P A;  1LOK A;  3S9N A;  4X2T A;  2WYR A;  2V77 A;  3S9L A;  5CPA A;  2JBJ A;  1IGB A;  1Z2L A;  2Q4Z A;  3VAT A;  3SJG A;  2PJA A;  2EK8 A;  3V38 A;  3HLP A;  2PVW A;  2PJC A;  2F7V A;  4NGQ A;  2PIY A;  2O4H A;  2OR4 A;  3TX8 A;  1DE4 C;  1ZLH A;  3K9T A;  4X8I A;  2V8D A;  4NFR A;  3B3C A;  3BHX A;  1TKJ A;  2ZEN A;  3KI9 A;  5K8O A;  3TC8 A;  3D7D A;  4UEE A;  5LYL A;  5LYD A;  1LAP A;  2IMO A;  3KQZ A;  4DYO A;  1GYT A;  2Q51 A;  3BI1 A;  1LCP A;  4X3R A;  1NSA A;  5JH9 A;  2HC9 A;  2J9A A;  4OID A;  4ZY1 A;  2RFH A;  3QNV A;  2AFU A;  2PVV A;  3MN8 A;  3WC6 A;  1VIX A;  3PB4 X;  2BOA A;  3FVL A;  3FED A;  4ZX8 A;  2JBK A;  2EK9 A;  3VAR A;  1OBR A;  3PB6 X;  2CTC A;  2ZEM A;  4A38 A;  4UEZ A;  1Y7E A;  4OC4 A;  4PQA A;  4MXU A;  2ZEG A;  1QQ9 A;  1CP7 A;  5HXD A;  3GLJ A;  1DTD A;  2ZOF A;  4FWU A;  4H2K A;  4CPA A;  2VL1 A;  1CP6 A;  2AFO A;  4NJR A;  4OC1 A;  1R43 A;  1YME A;  4P6Y A;  1BPN A;  3FF3 A;  4YU9 A;  4WWV A;  3FEC A;  2CTB A;  4FBE A;  3DGV A;  1BLL E;  3KR5 A;  3D68 A;  4IHM A;  4OC2 A;  4EME A;  4IAV A;  4OP4 A;  2WZN A;  2XEJ A;  3NH8 A;  2CIJ A;  3IO1 A;  3CPA A;  2ZED A;  2XEI A;  4TNU A;  3L2N A;  2JEW A;  4W9Y A;  2C6G A;  3IC1 A;  3CT9 A;  1Z5R A;  4OC3 A;  4AXV A;  2C6P A;  1XMB A;  1R3N A;  2PJ2 A;  4Q7A A;  3IJ3 A;  3H8F A;  2PIZ A;  7CPA A;  5DS0 A;  3T8W A;  4ZY0 A;  4NGP A;  4P10 A;  3VH9 A;  3LMS A;  3SJF A;  1VHO A;  3WC5 A;  3H8G A;  4LQG A;  3D4U A;  3B2Y A;  2EWB A;  3PB7 X;  4MHP A;  2PJ0 A;  2ABZ A;  2DEA A;  4ZY2 A;  3IWW A;  4PXC A;  4EFD A;  1TF8 A;  1FT7 A;  3PBE A; 
#chains in the Genus database with same CATH topology
 4C7I A;  1ON0 A;  3CXQ A;  5EC4 A;  3T90 A;  4CAW A;  4Q38 A;  4C7H A;  4EWT A;  4KOT A;  2G0B A;  4F0X A;  5BWA B;  5FVJ A;  4MHN A;  4R9M A;  5ELY A;  3NH4 A;  1IY7 A;  4LUA A;  5F47 A;  3SJE A;  2G3T A;  1S3Z A;  3TO9 A;  4UEF A;  1AYE A;  2ZW5 A;  2OZG A;  1YVK A;  2V8H A;  3LAC A;  1I21 A;  3B35 A;  3GY9 A;  4LQ6 A;  2FVG A;  2F5I A;  3CXP A;  4XPD B;  1NSL A;  5HH1 A;  3PFO A;  1ELL P;  4OLL A;  1CPS A;  4JYW A;  4MCP A;  1HEE A;  2PE3 A;  1QSO A;  2PC1 A;  2PJ8 A;  3H8E A;  5LRJ A;  4XNH B;  4FAI A;  4UFX A;  2XEF A;  4IUS A;  4KVM E;  4YFJ A;  4DNC A;  1Q7L A;  2O53 A;  1QMU A;  1CPX A;  2H5M A;  4CGO A;  4NF1 A;  3PP9 A;  4Q36 A;  3KGQ A;  2VEZ A;  4QC6 A;  3BJ8 A;  3B7I A;  1VGY A;  3TOB A;  2GFQ A;  2I3C A;  1B87 A;  3B3W A;  2I79 A;  5KTD A;  4OME A;  4F8Z A;  1LRZ A;  4U9Z A;  2BCO A;  2ZEE A;  1QSN A;  3T9Y A;  4CGN A;  2JLM A;  4MHZ A;  2Q44 A;  4LX9 A;  2R8V A;  2R98 A;  3D2P A;  4L8A A;  1QSM A;  2PJ5 A;  2PJ6 A;  3WT4 A;  1P0H A;  1WK4 A;  3K9U A;  4G1P A;  3ISX A;  3K2K A;  4JLY A;  2PR1 A;  3CXS A;  5AG7 A;  4MMO A;  2BEI A;  4HNW B;  4PPZ A;  1L0C A;  2GRE A;  5AG4 A;  4II9 A;  4U5Y A;  5LRG A;  5I4M A;  2AFW A;  1YX0 A;  4P4J A;  1X12 A;  5K8P A;  4UA3 A;  2ANP A;  2I00 A;  5H86 A;  2R1I A;  4E8O A;  2NSM A;  2OH1 A;  4OAD A;  4R3L A;  2V8G A;  4P4F A;  3CPX A;  4F9V A;  1K4J A;  5J1Q A;  1S5K A;  4P4E A;  3PRT A;  4PK2 A;  5IB9 A;  4GM5 A;  1VKC A;  4R6T A;  4MI4 A;  2QEC A;  3BXM A;  4CGM A;  1ZLI A;  3I1U A;  1Q2C A;  2QVP A;  2Z3N A;  4GS4 A;  5JPH A;  4UCN A;  4A37 A;  1KZF A;  4RUH A;  3ISZ A;  4B6Z A;  2POK A;  2C1C A;  3IU1 A;  2FIW A;  4QB9 A;  3SXN A;  1Y7R A;  3PB9 X;  4A39 A;  1Y9W A;  1CX8 A;  3B3T A;  4QBJ A;  4TWE A;  5LRK A;  2NYQ A;  4JZ0 A;  2DPT A;  4KUA A;  5DWN A;  2ZEP A;  1PCA A;  1XFO A;  5JQ4 A;  2JDC A;  1XOV A;  1HDQ A;  1YLO A;  2ATR A;  2ZOG A;  3PEI A;  4ONW A;  3QAH A;  4X5K A;  2AFZ A;  2PRQ A;  4RN7 A;  4XPD C;  4FD5 A;  3BI0 A;  1ZG8 A;  4UBR A;  1CG2 A;  4AVB A;  5K8M A;  2BUE A;  1TKF A;  3GKR A;  4MCQ A;  4XNH C;  2GLF A;  4F0Y A;  3FNC A;  2PJB A;  1VHE A;  3DR6 A;  4KS9 A;  4UCM A;  4B14 A;  4P45 A;  2B4B A;  3D66 A;  1LAM A;  4M3S A;  3V8I A;  4MRI A;  1U6M A;  3FX6 A;  2DPS A;  3FH4 A;  2YNC C;  2ZEF A;  3GIU A;  2CNT A;  4A30 A;  3KL9 A;  2BL1 A;  2Q7B A;  3CDX A;  2FCK A;  4FUU A;  3SJX A;  4M6I A;  3TO6 A;  5KTA A;  3JRU A;  1LFW A;  1UWY A;  4IF5 A;  4R8F A;  4ZI6 A;  4PSX A;  5LYF A;  2KCW A;  4AVC A;  3PBB A;  4JXR A;  4EVY A;  4ZX9 A;  4Z65 A;  3GB0 A;  1Y0Y A;  3R96 A;  4O23 A;  2GIV A;  4A2Z A;  4B5P A;  2GU2 A;  4A31 A;  5K8N A;  5HVF A;  1Z8T A;  5JM6 A;  5G22 A;  1BPM A;  1XRY A;  1Y9K A;  4MBU A;  4WJB A;  2X7B A;  3DR8 A;  4MHY A;  3EO4 A;  1IOF A;  3V7Z A;  2A4N A;  4CS0 B;  4P4B A;  4A32 A;  4ZYQ A;  3FXT A;  4QVT A;  2ZW4 A;  1KWM A;  2IQ6 A;  3E0K A;  4NGR A;  5D8N A;  3KQX A;  1Z4E A;  3NA6 A;  4R76 A;  2QYV A;  3S6G A;  2WSA A;  4HPS A;  4XPK A;  2AFX A;  3PFE A;  4F6A A;  2QJ8 A;  1H8L A;  4KSA A;  4RS2 A;  2WPX A;  4CAF A;  3RZA A;  4A94 A;  1F2O A;  3KZW A;  4ZBG A;  1M4G A;  3FIX A;  5KTC A;  5AG5 A;  2Z3K A;  4NGS A;  1F57 A;  2GLJ A;  4P44 A;  2ZXV A;  4DJL A;  1A2Z A;  4JJX A;  4K30 A;  4NJQ A;  1IOI A;  1TKH A;  2Q0Y A;  4Y49 B;  1GHE A;  2VBQ A;  3TTH A;  2B3U A;  3WAB A;  4L89 A;  3D7G A;  4P4D A;  2BSW A;  1ARL A;  5A27 A;  1BOB A;  3KR4 A;  3RBU A;  2Z3L A;  1B6B A;  2AE6 A;  3EFA A;  2AJ6 A;  2B5G B;  4JD6 A;  5I0C A;  4NGT A;  2Q04 A;  5CBM A;  4DUK A;  1KUV A;  1Q2D A;  3BJ7 A;  3IGR A;  3HUV A;  3JVN A;  3S6F A;  4C2Z A;  3ZZI A;  5HVH A;  4ORF A;  3S9M A;  5AGE A;  4PXB A;  1ZG7 A;  1XF8 A;  3FJU A;  5JGF A;  3EXN A;  3RAM A;  2DXQ A;  4KZT A;  1M4I A;  4AG9 A;  5AG6 A;  4NSQ A;  2REE A;  2CF4 A;  2EUI A;  2IJZ A;  4PXD A;  2HQY A;  4OKO A;  1P4N A;  1YW4 A;  2ZEO A;  4E2A A;  2ZEL A;  1FY7 A;  4MFK A;  3QB8 A;  3NFZ A;  1YW6 A;  1Z8L A;  2HV2 A;  4YWY A;  4CRZ B;  4JWP A;  2OZU A;  5THW A;  2XEG A;  3JUW A;  4MY0 A;  5F46 A;  2HB6 A;  5HVG A;  3VWD A;  2Q43 A;  4MJ8 A;  1I12 A;  3KHX A;  2YNE A;  3D7F A;  1XBU A;  3IU2 A;  3FEE A;  4FD7 A;  5D29 A;  2AFM A;  2K5T A;  3DNS A;  3R9E A;  4KVX A;  4OAE A;  4MCR A;  2ZEH A;  3EC4 A;  4AG7 A;  2F8H A;  1J4J A;  1Q2Y A;  2VI7 A;  3B3S A;  3W6X A;  3FMC A;  3WC7 A;  3SI0 A;  3SI1 A;  4I49 A;  2C6C A;  3D7H A;  5G1Z A;  5IX3 A;  1TXR A;  1BAV A;  3KHZ A;  4BIN A;  1HDU A;  1PU9 A;  3SI2 A;  1RTQ A;  3D67 A;  2CNM A;  1XJO A;  3MRU A;  4UIB A;  2B3V A;  3F5B A;  4B13 A;  1PYT B;  2WPW A;  4F9U A;  1MJ9 A;  1EE3 P;  1LAN A;  1CJW A;  2Z10 A;  3N5F A;  5LYI A;  2G3A A;  1AMP A;  1YK3 A;  3H5Z A;  2B4D A;  1IYK A;  2CY2 A;  2V8V A;  1FNO A;  1Z8W A;  4OIW A;  8CPA A;  2OOT A;  1TF9 A;  4UIA A;  1CM0 A;  4IK2 A;  2PRB A;  4Y49 C;  4R3K A;  4YGO A;  2JDD A;  4KSF A;  4PXE A;  1IID A;  1PUA A;  3IIB A;  1XEB A;  3NH5 A;  4YRH A;  3VWE A;  3NE8 A;  4KSI A;  6CPA A;  2REF A;  3B3V A;  1XIX A;  1M4D A;  2QIR A;  3IEH A;  2GE3 A;  2P0W A;  4B5O A;  2HUZ A;  4H6U A;  3RNZ A;  2OZH A;  3D3S A;  3R1K A;  4NGN A;  2PJ4 A;  4UFW A;  1ZG9 A;  4UWJ A;  2RC4 A;  5HMN A;  2PJ1 A;  3KAS A;  3F8K A;  4E0A A;  3TE4 A;  1XMT A;  4K3N A;  4MFJ A;  1CBX A;  5F09 A;  4UF4 A;  3SXO A;  1M4L A;  3IFE A;  4BBH A;  2Z0Z A;  5E96 A;  2PCU A;  3P2H A;  5C82 A;  4MCS A;  4NCZ A;  1JQG A;  4KLV A;  3DLJ A;  2PJ7 A;  2PQ8 A;  4NXY A;  4KOU A;  2BO9 A;  2PJ3 A;  3FBU A;  2FSR A;  1QST A;  2JEV A;  4NGM A;  1Y0R A;  3PB8 X;  1SQH A;  2AFS A;  2R7H A;  4BD9 A;  3C26 A;  4R7M A;  1YSJ A;  4OC5 A;  2Z3M A;  1ARM A;  2DF5 A;  3GUX A;  1R57 A;  1S60 A;  2YNC A;  2D4P A;  4P4I A;  2Z3O A;  2RB7 A;  4OC0 A;  4ZGY B;  1V0C A;  3LWU A;  1ELM P;  2G9D A;  2PJ9 A;  3NE7 A;  4M6H A;  1F2P A;  1S7K A;  4B12 A;  1BO4 A;  1NMT A;  5F48 A;  2ODF A;  2CNS A;  1LOK A;  3TFY A;  2D4O A;  2P6G A;  2O28 A;  3S9N A;  2PDO A;  3B8G A;  2FE7 A;  4HNX B;  4X2T A;  3FYN A;  4CYO A;  2WYR A;  2V77 A;  4CAX A;  3S9L A;  5CPA A;  2JBJ A;  1IGB A;  1Z2L A;  2Q4Z A;  5IB0 A;  4PK3 A;  1WWZ A;  3VAT A;  4C68 A;  2Q4V A;  3SJG A;  1KUX A;  2PJA A;  2EK8 A;  3V38 A;  1XE4 A;  3HLP A;  2PVW A;  2PJC A;  2F7V A;  4NGQ A;  3DSB A;  2PIY A;  2O4H A;  3IWG A;  5G20 A;  3MGD A;  3BLN A;  2QML A;  2Z3P A;  3S6K A;  2OR4 A;  1M1D A;  2VZY A;  4UFV A;  3TX8 A;  1RO5 A;  1DE4 C;  3RO0 A;  3CZX A;  4KOV A;  1ZLH A;  1IIC A;  4KOW A;  1N71 A;  2Q7S A;  3K9T A;  1MJA A;  2V8D A;  4X8I A;  2ARH A;  3S6H A;  4KOS A;  4NFR A;  4A95 A;  3B3C A;  3JTK A;  3BHX A;  4JXQ A;  3I3G A;  1TKJ A;  2ZEN A;  3SHP A;  2YND A;  3KI9 A;  5K8O A;  1TIQ A;  3TC8 A;  2P6E A;  3D7D A;  4NEX A;  4UEE A;  5G21 A;  5EMI A;  1S7F A;  2NMT A;  4B5P B;  1IU8 A;  5J8C A;  4FD6 A;  5LYL A;  4XPL A;  5LYD A;  1LAP A;  2EO8 A;  2IMO A;  1YVO A;  3KQZ A;  5F49 A;  2GAN A;  3IWE A;  4BMH A;  4HNY B;  1X10 A;  5EBV A;  4DYO A;  4R87 A;  1GYT A;  2OB0 A;  2IL4 A;  2EBJ A;  3D2M A;  1Z8X A;  2FL4 A;  2Q51 A;  4B10 A;  4CGL A;  3BI1 A;  4PV6 A;  1LCP A;  4X3R A;  4CAE A;  4CYN A;  1UFH A;  4AB7 A;  4H89 A;  1NSA A;  4CYP A;  5JH9 A;  3OWC A;  2HC9 A;  3UY5 A;  2J9A A;  3LOD A;  2J8M A;  4OID A;  4ZY1 A;  2RFH A;  3QNV A;  2AFU A;  2PVV A;  3MN8 A;  3WC6 A;  3R9G A;  2PSW A;  5J8F A;  4GXH A;  1VIX A;  1JWQ A;  3PB4 X;  2BOA A;  2J8N A;  3FVL A;  1M44 A;  4CYQ A;  3FED A;  3D8P A;  2P6F A;  4ZX8 A;  2JBK A;  4RI1 A;  2EK9 A;  3VAR A;  4AVA A;  1OBR A;  3PB6 X;  2CTC A;  2EVN A;  2ZW6 A;  1RXT A;  4CAV A;  2ZEM A;  4MHD A;  2Q4Y A;  4UEZ A;  3TT2 A;  3ZJ0 A;  4A33 A;  3DDD A;  4MY3 A;  4A38 A;  3QAY A;  5A28 A;  1Y7E A;  4OC4 A;  2CXA A;  4MFZ A;  4PQA A;  4MXU A;  2ZEG A;  2FS5 A;  4R57 A;  1QQ9 A;  1CP7 A;  1S7L A;  3GLJ A;  5HXD A;  1DTD A;  2ZOF A;  4FWU A;  1AUG A;  4H2K A;  3W91 A;  2VL1 A;  1CP6 A;  2AFO A;  1YR0 A;  4NJR A;  4OC1 A;  4CPA A;  1R43 A;  1YME A;  4KLW A;  4P6Y A;  3R9F A;  3WR7 A;  4U9Y A;  3P2F A;  3A9L A;  4UWI A;  1VHS A;  1BPN A;  3TO7 A;  4HKF A;  4KVO E;  3FF3 A;  4YU9 A;  3G3S A;  1YLE A;  4WWV A;  3FB3 A;  3FEC A;  5C88 A;  5H84 A;  3I9S A;  2CTB A;  4FBE A;  3DGV A;  1BLL E;  3KR5 A;  5GCN A;  2VQY A;  4KOX A;  4KOR A;  1IB1 E;  1Z4R A;  3D68 A;  4IHM A;  4OC2 A;  4EME A;  4IAV A;  3R95 A;  5ISV A;  3EY5 A;  4OP4 A;  2FT0 A;  2WZN A;  2XEJ A;  1MK4 A;  3NH8 A;  2CIJ A;  3IO1 A;  3CPA A;  4J3G A;  3GYA A;  5CNP A;  4FD4 A;  1ZO0 A;  2ZED A;  4M85 A;  2XEI A;  1YQE A;  4KOY A;  4TNU A;  3TCV A;  2Y0M A;  4MFP A;  4B11 A;  3L2N A;  2JEW A;  4W9Y A;  4CRY B;  2B5G A;  2C6G A;  1QSR A;  1YGH A;  3IC1 A;  3CT9 A;  3PGP A;  4PSW A;  3FRM A;  3PZJ A;  2VZZ A;  4QUS A;  1OZP A;  1Z5R A;  4OC3 A;  4AXV A;  2C6P A;  4M6G A;  1XMB A;  2J8R A;  1R3N A;  2YGW A;  2OU2 A;  2PJ2 A;  1IYL A;  1KUY A;  3G8W A;  4KUB A;  4Q7A A;  2FIA A;  3KKW A;  1S7N A;  3IJ3 A;  4H6Z A;  3H8F A;  1I1D A;  2PIZ A;  3LD2 A;  3N7Z A;  7CPA A;  5DS0 A;  3T8W A;  3W6S A;  3TOA A;  4ZY0 A;  4C2Y A;  4NGP A;  3H4Q A;  4P10 A;  2C27 A;  2PR8 A;  4MFQ A;  3VH9 A;  3LMS A;  2ZW7 A;  3SJF A;  1VHO A;  1MJB A;  3H8G A;  3WC5 A;  4LQG A;  5IV0 A;  2B58 A;  2VXK A;  3B2Y A;  2EWB A;  2B4D B;  3D4U A;  5DWM A;  2FXF A;  1Z9U A;  3RYO A;  4CGP A;  3PB7 X;  1NE9 A;  4MHP A;  4UCP A;  2PJ0 A;  2ABZ A;  4ONU A;  2DEA A;  2Z11 A;  4ZY2 A;  4MFL A;  4C2X A;  3F0A A;  3IWW A;  4PXC A;  2ZPA A;  4EFD A;  1TF8 A;  2WUU A;  1YRE A;  1FT7 A;  3PBE A; 
#chains in the Genus database with same CATH homology
 4EWT A;  4MHN A;  5ELY A;  3NH4 A;  1IY7 A;  3SJE A;  4UEF A;  1AYE A;  2V8H A;  3B35 A;  2FVG A;  3PFO A;  1ELL P;  1CPS A;  4JYW A;  4MCP A;  1HEE A;  2PE3 A;  2PJ8 A;  3H8E A;  5LRJ A;  4FAI A;  2XEF A;  1Q7L A;  2O53 A;  1QMU A;  1CPX A;  3KGQ A;  3B7I A;  1VGY A;  2I3C A;  3B3W A;  4OME A;  4F8Z A;  2BCO A;  2ZEE A;  4MHZ A;  2PJ5 A;  2PJ6 A;  3WT4 A;  4G1P A;  3ISX A;  3K2K A;  4MMO A;  4PPZ A;  2GRE A;  5LRG A;  5I4M A;  2AFW A;  4P4J A;  5K8P A;  2ANP A;  2NSM A;  2V8G A;  4P4F A;  3CPX A;  4F9V A;  5J1Q A;  4P4E A;  3PRT A;  5IB9 A;  4GM5 A;  4R6T A;  3BXM A;  1ZLI A;  3I1U A;  2QVP A;  4A37 A;  4RUH A;  3ISZ A;  4B6Z A;  2POK A;  2C1C A;  3PB9 X;  4A39 A;  1CX8 A;  3B3T A;  5LRK A;  4TWE A;  2NYQ A;  4JZ0 A;  2ZEP A;  1PCA A;  1XFO A;  1YLO A;  1HDQ A;  2ZOG A;  3PEI A;  4ONW A;  2AFZ A;  2PRQ A;  3BI0 A;  1ZG8 A;  1CG2 A;  5K8M A;  1TKF A;  4MCQ A;  2GLF A;  2PJB A;  1VHE A;  4P45 A;  3D66 A;  1LAM A;  4MRI A;  3FX6 A;  3FH4 A;  2ZEF A;  3KL9 A;  3CDX A;  3SJX A;  4FUU A;  3JRU A;  1LFW A;  1UWY A;  4R8F A;  4ZI6 A;  5LYF A;  3PBB A;  4ZX9 A;  4Z65 A;  3GB0 A;  1Y0Y A;  4O23 A;  2GU2 A;  5K8N A;  5HVF A;  5JM6 A;  1BPM A;  1XRY A;  4WJB A;  4MHY A;  3V7Z A;  4P4B A;  4ZYQ A;  1KWM A;  2IQ6 A;  4NGR A;  5D8N A;  3KQX A;  4R76 A;  3NA6 A;  2QYV A;  2AFX A;  3PFE A;  2QJ8 A;  1H8L A;  3RZA A;  4A94 A;  1F2O A;  3KZW A;  4NGS A;  1F57 A;  2GLJ A;  4P44 A;  4DJL A;  4NJQ A;  1TKH A;  3WAB A;  3D7G A;  4P4D A;  1ARL A;  3KR4 A;  3RBU A;  4NGT A;  5CBM A;  4DUK A;  3HUV A;  5HVH A;  3S9M A;  4PXB A;  1ZG7 A;  3FJU A;  5JGF A;  3RAM A;  2CF4 A;  2IJZ A;  4PXD A;  4OKO A;  1YW4 A;  2ZEO A;  2ZEL A;  3NFZ A;  1YW6 A;  1Z8L A;  4YWY A;  5THW A;  2XEG A;  2HB6 A;  5HVG A;  2Q43 A;  3KHX A;  3D7F A;  1XBU A;  3FEE A;  5D29 A;  2AFM A;  4MCR A;  2ZEH A;  2F8H A;  3B3S A;  3FMC A;  3WC7 A;  3SI0 A;  3SI1 A;  2C6C A;  3D7H A;  1TXR A;  1BAV A;  3KHZ A;  1HDU A;  3SI2 A;  1RTQ A;  3D67 A;  1XJO A;  3MRU A;  4UIB A;  4F9U A;  1PYT B;  1EE3 P;  1LAN A;  3N5F A;  5LYI A;  1AMP A;  2V8V A;  1FNO A;  4OIW A;  8CPA A;  2OOT A;  1TF9 A;  4UIA A;  4IK2 A;  4PXE A;  3IIB A;  3NH5 A;  4KSI A;  6CPA A;  3B3V A;  3IEH A;  4NGN A;  2PJ4 A;  1ZG9 A;  2PJ1 A;  3KAS A;  4K3N A;  1CBX A;  5F09 A;  4UF4 A;  1M4L A;  3IFE A;  2PCU A;  4MCS A;  1JQG A;  3DLJ A;  2PJ7 A;  2BO9 A;  2PJ3 A;  4NGM A;  1Y0R A;  3PB8 X;  4BD9 A;  2AFS A;  4R7M A;  1YSJ A;  4OC5 A;  1ARM A;  3GUX A;  4P4I A;  2RB7 A;  4OC0 A;  3LWU A;  1ELM P;  2G9D A;  2PJ9 A;  1F2P A;  1LOK A;  3S9N A;  4X2T A;  2WYR A;  2V77 A;  3S9L A;  5CPA A;  2JBJ A;  1IGB A;  1Z2L A;  2Q4Z A;  3VAT A;  3SJG A;  2PJA A;  2EK8 A;  3V38 A;  3HLP A;  2PVW A;  2PJC A;  2F7V A;  4NGQ A;  2PIY A;  2O4H A;  2OR4 A;  3TX8 A;  1DE4 C;  1ZLH A;  3K9T A;  4X8I A;  2V8D A;  4NFR A;  3B3C A;  3BHX A;  1TKJ A;  2ZEN A;  3KI9 A;  5K8O A;  3TC8 A;  3D7D A;  4UEE A;  5LYL A;  5LYD A;  1LAP A;  2IMO A;  3KQZ A;  4DYO A;  1GYT A;  2Q51 A;  3BI1 A;  1LCP A;  4X3R A;  1NSA A;  5JH9 A;  2HC9 A;  2J9A A;  4OID A;  4ZY1 A;  2RFH A;  3QNV A;  2AFU A;  2PVV A;  3MN8 A;  3WC6 A;  1VIX A;  3PB4 X;  2BOA A;  3FVL A;  3FED A;  4ZX8 A;  2JBK A;  2EK9 A;  3VAR A;  1OBR A;  3PB6 X;  2CTC A;  2ZEM A;  4A38 A;  4UEZ A;  1Y7E A;  4OC4 A;  4PQA A;  4MXU A;  2ZEG A;  1QQ9 A;  1CP7 A;  5HXD A;  3GLJ A;  1DTD A;  2ZOF A;  4FWU A;  4H2K A;  4CPA A;  2VL1 A;  1CP6 A;  2AFO A;  4NJR A;  4OC1 A;  1R43 A;  1YME A;  4P6Y A;  1BPN A;  3FF3 A;  4YU9 A;  4WWV A;  3FEC A;  2CTB A;  4FBE A;  3DGV A;  1BLL E;  3KR5 A;  3D68 A;  4IHM A;  4OC2 A;  4EME A;  4IAV A;  4OP4 A;  2WZN A;  2XEJ A;  3NH8 A;  2CIJ A;  3IO1 A;  3CPA A;  2ZED A;  2XEI A;  4TNU A;  3L2N A;  2JEW A;  4W9Y A;  2C6G A;  3IC1 A;  3CT9 A;  1Z5R A;  4OC3 A;  4AXV A;  2C6P A;  1XMB A;  1R3N A;  2PJ2 A;  4Q7A A;  3IJ3 A;  3H8F A;  2PIZ A;  7CPA A;  5DS0 A;  3T8W A;  4ZY0 A;  4NGP A;  4P10 A;  3VH9 A;  3LMS A;  3SJF A;  1VHO A;  3WC5 A;  3H8G A;  4LQG A;  3D4U A;  3B2Y A;  2EWB A;  3PB7 X;  4MHP A;  2PJ0 A;  2ABZ A;  2DEA A;  4ZY2 A;  3IWW A;  4PXC A;  4EFD A;  1TF8 A;  1FT7 A;  3PBE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...