4MHZA

Crystal structure of apo-form glutaminyl cyclase from ixodes scapularis in complex with pbd150
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
326
structure length
325
Chain Sequence
LKWPRDLRPLAHHDLLYMGQISEDRGDFNATLRNFLVPRVVGSQKHREVREFIVRSLKDLDWDVEEDCFDGQTPHGIKPFCNVIATLNPSACHRLVLACHYDSLLHKEGTFIGATDSAVPCAQLLYLARSLNGKLQNQKTRGDGLTLQLVFFDGEEAFERWSSHDSLYGSRHLAQKWHEDRTSAERLESCLERSEIANQIDRMEVMVLLDLLGAENPRFYSYFGETQPVYRRLVNIESRLNDAGLMELPRRRRRTNYFSNSSTVGFIEDDHIPFLKRSVPIVHIIPSPFPDVWHTLDDNEQNLHHPTISNLNKIFKAFVSEYLQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glutaminyl cyclase, putative
publication title Structural and functional analyses of a glutaminyl cyclase from Ixodes scapularis reveal metal-independent catalysis and inhibitor binding.
pubmed doi rcsb
source organism Ixodes scapularis
molecule tags Transferase
total genus 110
structure length 325
sequence length 326
ec nomenclature ec 2.3.2.5: Glutaminyl-peptide cyclotransferase.
pdb deposition date 2013-08-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 4mhzA00
2GREA 1PCAA 2IQ6A 3MN8A 3HLPA 3CDXA 1QMUA 3V7ZA 2HC9A 4YWYA 3FEEA 1LAPA 4YU9A 4OC0A 4P44A 1IY7A 3PB9X 1DE4C 4P4IA 4NFRA 1CBXA 2ZEFA 3NA6A 3B3WA 2V77A 3L2NA 3B3SA 2PJ2A 2O4HA 1M4LA 4TNUA 3B3TA 3BHXA 4OC3A 4NGPA 1XRYA 4UIBA 1F2PA 3PBBA 2JEWA 4NGNA 2BO9A 3S9MA 4BD9A 2BOAA 5DS0A 2ZEOA 3FEDA 1Y0YA 4MHNA 5LRKA 3D68A 1TKJA 2I3CA 4NGRA 4UF4A 5HXDA 3H8FA 2OR4A 2WYRA 1TKFA 1VIXA 3LWUA 4O23A 4DJLA 2QYVA 4GM5A 2PJ0A 4IK2A 3SI2A 1QQ9A 3V38A 3NH5A 2PVWA 3PFOA 4R8FA 3IEHA 2PJ4A 4MCPA 1FT7A 2XEIA 4K3NA 1IGBA 4P45A 2AFUA 4NJRA 4OC1A 1JQGA 2Q4ZA 3HUVA 4A38A 2PJAA 3VATA 3KR4A 4IHMA 2ZEEA 3SJFA 1ARMA 2QJ8A 2CTCA 2PJ3A 3BI0A 6CPAA 1ZG8A 3PB7X 5CPAA 4PXCA 5LYIA 1TF8A 1LOKA 2PJ7A 2XEFA 5JGFA 1HDUA 1CPXA 4F8ZA 2GLFA 1PYTB 4PXBA 2IMOA 2EK8A 3PB8X 3SJGA 2G9DA 1TKHA 1BPNA 4B6ZA 3PBEA 3KGQA 2C1CA 1LAMA 3FVLA 1AMPA 2EK9A 3ISZA 2V8VA 4DYOA 1TF9A 4FBEA 5LYFA 4ZYQA 2V8DA 5D29A 3KASA 2BCOA 3D7HA 3CT9A 1VGYA 3KQZA 4UEZA 3CPXA 4R7MA 4NJQA 4ZI6A 2Q43A 4MCQA 1Y0RA 3N5FA 4OKOA 3KL9A 3H8EA 2XEJA 3SJXA 3KHZA 1R3NA 1Y7EA 2ANPA 4ONWA 4KSIA 4MHZA 2F7VA 1Z5RA 4F9VA 2PJCA 1ZLIA 1TXRA 2HB6A 2PVVA 2ZOGA 3TX8A 4ZY2A 3LMSA 3FECA 3D7DA 4Q7AA 3BXMA 3WC5A 4EWTA 4ZX9A 3NH8A 4H2KA 4EMEA 3SJEA 2GLJA 5K8MA 2AFZA 3VH9A 1BAVA 1YMEA 1XBUA 1LFWA 2QVPA 2PJ5A 4JZ0A 3RZAA 4MRIA 1LCPA 1ZLHA 1EE3P 4IAVA 2CTBA 2ZENA 4JYWA 3IWWA 2F8HA 4WWVA 3NH4A 4NGQA 4PXEA 3VARA 1CG2A 3D7FA 3IFEA 2DEAA 4OC2A 1Q7LA 2ZEPA 1XJOA 5IB9A 2VL1A 4NGMA 3IJ3A 3GUXA 3S9NA 1ELMP 2AFWA 3FH4A 4P4DA 1VHEA 4MXUA 1YW4A 2NYQA 2PJ8A 4OC4A 4Z65A 1H8LA 3D4UA 4MHPA 4MCSA 1DTDA 1VHOA 4MCRA 2C6PA 3B7IA 3MRUA 3DGVA 2XEGA 4UEFA 4ZY0A 2O53A 2PJBA 3PB4X 1BLLE 4PQAA 3WC7A 4EFDA 1CP6A 2ZOFA 5THWA 1CX8A 1CPSA 1OBRA 2OOTA 2AFMA 4MMOA 2C6GA 4ZX8A 2PJ1A 2RFHA 1RTQA 1ZG7A 4P4JA 4FWUA 5HVFA 3D67A 4OP4A 2Q51A 2V8GA 1YW6A 2ZEMA 5JM6A 4P4EA 1AYEA 2AFXA 4F9UA 2PJ9A 5D8NA 1ARLA 3TC8A 1YSJA 1KWMA 2JBJA 1F57A 3RAMA 5CBMA 4CPAA 2POKA 3KZWA 3PRTA 3T8WA 2JBKA 1NSAA 4A39A 3KQXA 4UEEA 5ELYA 3FMCA 2PJ6A 4OIWA 4G1PA 3B3VA 3NFZA 5HVHA 3FX6A 5F09A 2FVGA 4P10A 2PRQA 4AXVA 2PE3A 5LRGA 3PEIA 1FNOA 2CIJA 1YLOA 2WZNA 3IC1A 3DLJA 3D66A 1UWYA 3K2KA 4RUHA 3ISXA 5K8NA 1GYTA 3WABA 2C6CA 4P4BA 4X8IA 3I1UA 4FAIA 5LYLA 3S9LA 2V8HA 4NGSA 1Z8LA 2GU2A 3SI1A 3FJUA 3PFEA 4NGTA 3B35A 2ZEHA 4PPZA 3H8GA 1HDQA 4P4FA 3RBUA 3KHXA 1R43A 2AFSA 4A37A 5LRJA 3WT4A 2PIYA 1XMBA 2J9AA 4ZY1A 4MHYA 1LANA 2NSMA 5K8OA 4W9YA 3FF3A 2AFOA 1CP7A 2CF4A 1ELLP 2ABZA 4PXDA 4OIDA 2IJZA 4WJBA 3B3CA 5LYDA 5J1QA 4X2TA 4UIAA 2EWBA 3KR5A 5HVGA 3WC6A 3JRUA 1ZG9A 4DUKA 2PCUA 5I4MA 8CPAA 3D7GA 2RB7A 2ZELA 3PB6X 3BI1A 3SI0A 3KI9A 3CPAA 4P6YA 3K9TA 5K8PA 1BPMA 1HEEA 3IIBA 7CPAA 4X3RA 3QNVA 4R6TA 1Z2LA 3GLJA 4OC5A 4FUUA 2ZEGA 3B2YA 4OMEA 1XFOA 4A94A 4R76A 3IO1A 2PIZA 3GB0A 2ZEDA 4LQGA 5JH9A 1F2OA 4TWEA
chains in the Genus database with same CATH superfamily
5GCNA 4B11A 1GHEA 3H5ZA 2GREA 1PCAA 2IQ6A 3MN8A 3HLPA 1Q2DA 3CDXA 1QMUA 3V7ZA 2YNDA 4M6HA 2HC9A 4H6UA 4YWYA 3FEEA 1LAPA 5G20A 1XMTA 1XOVA 5A27A 4YU9A 4II9A 4FD6A 3TCVA 2Z0ZA 2CNSA 4OC0A 4P44A 1L0CA 1IY7A 3PB9X 4MFZA 1DE4C 4P4IA 4NFRA 1CBXA 2ZEFA 3NA6A 4JJXA 2PR8A 3B3WA 3TO7A 2V77A 3L2NA 1YVKA 1LRZA 3S6HA 4AG7A 4CYQA 1A2ZA 4LQ6A 3B3SA 3RYOA 3FXTA 2PJ2A 2O4HA 2ZXVA 2B4DA 3EFAA 3PP9A 5ISVA 2OZGA 1M4LA 4TNUA 4F0YA 3B3TA 3BHXA 4XNHB 5F49A 4UFXA 4F6AA 4OC3A 1IIDA 4NGPA 1XRYA 3T9YA 1Z8WA 2RC4A 1M1DA 2OZHA 4UIBA 1F2PA 3PBBA 1BO4A 1YGHA 2JEWA 4NF1A 2JLMA 2BO9A 4NGNA 3S9MA 4BD9A 4MFJA 2Q0YA 2BOAA 4L8AA 5DS0A 4XNHC 2ZEOA 3JVNA 1NMTA 3TFYA 3R9EA 3FEDA 1ON0A 1R57A 4OAEA 1Y0YA 1Y9KA 4CYPA 4MHNA 5AGEA 3D68A 5LRKA 1YLEA 1Y7RA 4OADA 5DWNA 1RXTA 3VWDA 1TKJA 2I3CA 4NGRA 4CAEA 4UF4A 2ARHA 1VKCA 4K30A 5HXDA 3H8FA 2OR4A 2WYRA 3I3GA 1TKFA 1VIXA 3LWUA 4O23A 1YX0A 4DJLA 4U5YA 1NE9A 2QYVA 4GM5A 3T90A 3TO9A 3F8KA 2EBJA 3DR8A 2PJ0A 3FYNA 4IK2A 4JLYA 4XPKA 3SI2A 1IYLA 1QQ9A 3NH5A 1S7FA 2PVWA 3PFOA 4R8FA 3V38A 5KTAA 3IEHA 2X7BA 4FD5A 2PJ4A 4J3GA 4MCPA 4KVME 1X12A 1YR0A 1Z9UA 2FS5A 2Q7SA 1FT7A 2XEIA 2FT0A 4CAWA 4R9MA 5J8CA 2BL1A 3SXNA 4BMHA 4K3NA 3TOAA 4UFWA 1IGBA 4P45A 2AFUA 4NJRA 4XPDB 3IGRA 4IUSA 4OC1A 1JQGA 2Q4ZA 3HUVA 3SHPA 4A38A 3CXSA 1SQHA 2B4DB 2PJAA 2CNMA 2A4NA 3KR4A 4IHMA 4UBRA 3VATA 1QSNA 2ZEEA 1CJWA 1ARMA 4Y49C 3SJFA 2QJ8A 2CTCA 2PJ3A 4MFPA 5F47A 1KUXA 3BI0A 6CPAA 4KUAA 4I49A 3RNZA 1AUGA 1XIXA 1ZG8A 3PB7X 4XPDC 5CPAA 4PXCA 5LYIA 4C68A 4CS0B 1TF8A 1XE4A 2DPTA 1LOKA 2YNCA 3KKWA 2PJ7A 2XEFA 4CAFA 1M44A 5C88A 5JGFA 1HDUA 1CPXA 1IB1E 4R87A 5AG5A 2HV2A 4F8ZA 2GLFA 2PSWA 1PYTB 4PXBA 4MJ8A 2IMOA 2EK8A 3FRMA 3PB8X 4UWIA 2F5IA 3SJGA 2D4OA 2G9DA 1TKHA 1BPNA 4B6ZA 3PBEA 3KGQA 4QVTA 2C1CA 4KOSA 4KUBA 1LAMA 3FVLA 4CGPA 1AMPA 1S7NA 2CY2A 1XF8A 2BUEA 2EK9A 3ISZA 3A9LA 1YVOA 2V8VA 4DYOA 4HNWB 1TF9A 1I21A 4FBEA 2VXKA 3S6FA 5LYFA 4ZYQA 2QIRA 2V8DA 5D29A 3TO6A 3KASA 1M4IA 2BCOA 3D7HA 3CT9A 3DSBA 1VGYA 4X5KA 3KQZA 1TIQA 3MGDA 4A30A 4UEZA 4B12A 3D3SA 3R96A 1I12A 2NMTA 3CPXA 3FNCA 4R7MA 3G8WA 4QBJA 4ZGYB 4YGOA 4NJQA 4ZI6A 3GY9A 1X10A 2Q43A 4MCQA 5C82A 1Y0RA 3N5FA 4OKOA 4CAXA 2Z11A 2Q04A 4AVAA 3BLNA 3KL9A 2B4BA 3H8EA 3GYAA 5IB0A 5J8FA 2DPSA 4NSQA 2XEJA 4KOUA 3SJXA 2FIWA 1R3NA 1Y7EA 3KHZA 2ANPA 3QAHA 4NEXA 4PK2A 5F46A 3B8GA 4ONWA 4KSIA 1NSLA 4MHZA 2F7VA 1Z5RA 4F9VA 4KS9A 2B3UA 2PJCA 1ZLIA 2VZYA 1TXRA 3TE4A 2HB6A 2PVVA 2ZOGA 3TX8A 4ZY2A 1J4JA 3H4QA 3LMSA 3FECA 1XEBA 2YNCC 3D7DA 4AVBA 4LX9A 2OH1A 4Q7AA 3NE7A 3BXMA 3W6SA 4PV6A 3TTHA 1KZFA 4M6IA 4HNYB 3S6KA 3WC5A 4KOWA 2G3AA 3N7ZA 4EWTA 1RO5A 4KVXA 3BJ7A 3NH8A 4ZX9A 2K5TA 3NE8A 4H2KA 4EMEA 3DDDA 4CYOA 5IX3A 5BWAB 3SJEA 2GLJA 4CAVA 5K8MA 2AFZA 3P2HA 3VH9A 1BAVA 1MK4A 1YMEA 1XBUA 3IU1A 2REFA 4PK3A 1IICA 1LFWA 2FIAA 2QVPA 5EC4A 4JXQA 1Z4RA 2BEIA 2PJ5A 4M85A 4B5PA 2ODFA 4MBUA 2GIVA 4JZ0A 3RZAA 4H6ZA 4MRIA 5AG7A 5JPHA 1LCPA 5KTCA 1ZLHA 1EE3P 4IAVA 2CTBA 2KCWA 2ZENA 4JYWA 4B10A 3IWEA 3IWWA 2ZW7A 2I00A 2ZW6A 5JH9A 4UA3A 2HQYA 4MFKA 2F8HA 3V8IA 4WWVA 3NH4A 4NGQA 4PXEA 3VARA 1CG2A 3D7FA 4ONUA 3IFEA 3QB8A 2DEAA 4OC2A 1Q7LA 2OB0A 2ZEPA 4R3KA 4YFJA 1XJOA 4B13A 2VL1A 5E96A 3R9FA 4NGMA 5IB9A 1U6MA 3IJ3A 1S7KA 3GUXA 4UWJA 3S9NA 4UCMA 4AVCA 2GANA 1ELMP 2AFWA 4LUAA 3FH4A 3G3SA 1MJBA 4P4DA 2B58A 1VHEA 4CRYB 4MXUA 1YW4A 2NYQA 2PJ8A 3FB3A 1Q2YA 4OC4A 4Z65A 4MHDA 1H8LA 3D4UA 1M4DA 2J8NA 2WUUA 4MHPA 4MCSA 1DTDA 1VHOA 5HH1A 1B6BA 2P0WA 4YRHA 4MCRA 1Y9WA 2ATRA 2C6PA 3B7IA 3MRUA 2FL4A 3EO4A 3GIUA 4EVYA 3DGVA 2Q7BA 2YNEA 2XEGA 4UEFA 5EBVA 2O53A 2OZUA 2DXQA 4QB9A 4ZY0A 2PJBA 3CZXA 2VQYA 3PB4X 1BLLE 4PQAA 3I9SA 3WC7A 4EFDA 2Y0MA 1CP6A 1IU8A 1Z8XA 5EMIA 2ZOFA 5THWA 1CX8A 3F5BA 3ZJ0A 4C2XA 2ZPAA 2Z3KA 1KUYA 3R95A 1MJAA 2BSWA 1IYKA 1CPSA 4HNXB 4MY3A 1OBRA 2OOTA 2AFMA 2FE7A 4B5PB 4MMOA 2C6GA 3JUWA 1PUAA 2Z3OA 1QSRA 2QMLA 3EY5A 4U9YA 4ZX8A 2PJ1A 2RFHA 2R8VA 4C2ZA 1RTQA 2J8MA 1ZG7A 4IF5A 4XPLA 2AJ6A 4P4JA 3SXOA 4JWPA 2P6EA 3TT2A 2WPXA 4FWUA 4PSWA 5HVFA 3D67A 5HMNA 4OP4A 4KOXA 2Q51A 2V8GA 2FXFA 2PDOA 1YW6A 4MY0A 2ZEMA 1YREA 5JQ4A 4NCZA 2Z10A 5JM6A 4P4EA 1AYEA 1WWZA 2AFXA 4R57A 4E0AA 3D2MA 3EXNA 4FD4A 2Q44A 2PJ9A 5D8NA 4F9UA 1ARLA 3TC8A 2HUZA 1YSJA 2VBQA 4ORFA 1QSOA 4KOVA 2H5MA 1KWMA 2PR1A 1K4JA 3CXQA 2PQ8A 1I1DA 4MFQA 1S7LA 3RO0A 5AG6A 4CGNA 2Z3NA 4PSXA 1BOBA 2EO8A 2Z3LA 2JBJA 3TOBA 1F57A 3LD2A 3RAMA 1Z4EA 2ZW4A 5CBMA 4CPAA 3CXPA 1B87A 2POKA 3KZWA 1PU9A 2P6GA 3PRTA 2JBKA 3C26A 5G22A 3LACA 4KLWA 5H84A 1NSAA 3T8WA 3ZZIA 4A39A 3KQXA 4UEEA 4HPSA 2C27A 3FMCA 2R1IA 4QUSA 3IWGA 5ELYA 2PJ6A 4OIWA 3D8PA 4G1PA 3B3VA 1KUVA 3NFZA 2R7HA 5HVHA 4NXYA 2Q4YA 4UCPA 2R98A 2QECA 3FX6A 5F09A 2FVGA 2OU2A 2PRQA 4JD6A 4P10A 1S3ZA 4AXVA 4MFLA 2DF5A 2PE3A 5LRGA 3PEIA 1VHSA 4A33A 1FNOA 3DR6A 4KSFA 2CIJA 4HKFA 1IOFA 1QSMA 1YLOA 2WZNA 3IC1A 3DLJA 3D66A 1QSTA 1UWYA 3JTKA 3K2KA 4R3LA 3ISXA 4RN7A 4RUHA 5I0CA 2O28A 4KLVA 5K8NA 1GYTA 1ZO0A 2VEZA 2CNTA 3WABA 1UFHA 4UFVA 2C6CA 2PRBA 4KSAA 4P4BA 3R9GA 1MJ9A 1JWQA 4X8IA 4B5OA 3I1UA 1OZPA 2EVNA 5DWMA 4FAIA 5LYLA 3S9LA 2B5GA 2V8HA 4JXRA 4NGSA 4M3SA 2YGWA 4CYNA 4DNCA 1Z8LA 2GU2A 3SI1A 3FBUA 2I79A 3FJUA 1S5KA 2GFQA 3PFEA 4FD7A 4BINA 4NGTA 3B35A 5FVJA 2ZEHA 2WSAA 4PPZA 3H8GA 1IOIA 4F0XA 4E2AA 1HDQA 2Z3PA 4P4FA 5F48A 3RBUA 3KHXA 1R43A 1FY7A 4QC6A 2AFSA 4A37A 3S6GA 2J8RA 4C7HA 4BBHA 5IV0A 4KORA 5LRJA 3WT4A 2PIYA 5G21A 1XMBA 2AE6A 4Q38A 4B14A 2JDCA 2J9AA 2D4PA 1Z8TA 4RI1A 4ZY1A 4MHYA 1LANA 4AG9A 2NSMA 1YK3A 5K8OA 2GE3A 2FSRA 3FIXA 5CNPA 2REEA 2IL4A 4CRZB 4W9YA 4KVOE 3FF3A 3W91A 5AG4A 2Q4VA 2AFOA 1CP7A 2CXAA 2CF4A 4Y49B 1ELLP 2ABZA 3W6XA 5A28A 1P0HA 4AB7A 4PXDA 1V0CA 4OIDA 2IJZA 4WJBA 3B3CA 5LYDA 5J1QA 4L89A 4X2TA 3DNSA 4A31A 3D2PA 3F0AA 5G1ZA 4UIAA 4CGOA 1M4GA 2EWBA 3KR5A 5HVGA 3WC6A 3JRUA 3QAYA 4E8OA 4GXHA 1ZG9A 3R1KA 4DUKA 2PCUA 4A32A 5I4MA 4C2YA 1S60A 8CPAA 3D7GA 2Z3MA 2EUIA 2RB7A 2ZELA 1CM0A 3PGPA 4KOTA 3PB6X 3VWEA 3BI1A 3SI0A 4MI4A 4A2ZA 3KI9A 3OWCA 3E0KA 3EC4A 4H89A 2B5GB 3CPAA 4P6YA 3PZJA 5H86A 3K9TA 4RS2A 5K8PA 1BPMA 5KTDA 1HEEA 3IIBA 4KZTA 4CGMA 7CPAA 2VZZA 3BJ8A 1YQEA 2P6FA 4X3RA 3QNVA 4U9ZA 2VI7A 4C7IA 2WPWA 4R6TA 3IU2A 1Z2LA 3K9UA 4KOYA 3GLJA 4OC5A 4M6GA 3UY5A 4FUUA 2ZEGA 3B2YA 3GKRA 3LODA 1P4NA 4GS4A 2ZW5A 4OMEA 1XFOA 2FCKA 4A94A 4UCNA 4A95A 2JEVA 4R76A 4CGLA 3P2FA 3IO1A 2PIZA 1Q2CA 4OLLA 2PC1A 3GB0A 4Q36A 2ZEDA 3WR7A 4ZBGA 1N71A 2G3TA 2JDDA 1WK4A 4LQGA 2B3VA 2G0BA 1F2OA 4TWEA
chains in the Genus database with same CATH topology
2GREA 1PCAA 2IQ6A 3MN8A 3HLPA 3CDXA 1QMUA 3V7ZA 2HC9A 4YWYA 3FEEA 1LAPA 4YU9A 4OC0A 4P44A 1IY7A 3PB9X 1DE4C 4P4IA 4NFRA 1CBXA 2ZEFA 3NA6A 3B3WA 2V77A 3L2NA 3B3SA 2PJ2A 2O4HA 1M4LA 4TNUA 3B3TA 3BHXA 4OC3A 4NGPA 1XRYA 4UIBA 1F2PA 3PBBA 2JEWA 4NGNA 2BO9A 3S9MA 4BD9A 2BOAA 5DS0A 2ZEOA 3FEDA 1Y0YA 4MHNA 5LRKA 3D68A 1TKJA 2I3CA 4NGRA 4UF4A 5HXDA 3H8FA 2OR4A 2WYRA 1TKFA 1VIXA 3LWUA 4O23A 4DJLA 2QYVA 4GM5A 2PJ0A 4IK2A 3SI2A 1QQ9A 3V38A 3NH5A 2PVWA 3PFOA 4R8FA 3IEHA 2PJ4A 4MCPA 1FT7A 2XEIA 4K3NA 1IGBA 4P45A 2AFUA 4NJRA 4OC1A 1JQGA 2Q4ZA 3HUVA 4A38A 2PJAA 3VATA 3KR4A 4IHMA 2ZEEA 3SJFA 1ARMA 2QJ8A 2CTCA 2PJ3A 3BI0A 6CPAA 1ZG8A 3PB7X 5CPAA 4PXCA 5LYIA 1TF8A 1LOKA 2PJ7A 2XEFA 5JGFA 1HDUA 1CPXA 4F8ZA 2GLFA 1PYTB 4PXBA 2IMOA 2EK8A 3PB8X 3SJGA 2G9DA 1TKHA 1BPNA 4B6ZA 3PBEA 3KGQA 2C1CA 1LAMA 3FVLA 1AMPA 2EK9A 3ISZA 2V8VA 4DYOA 1TF9A 4FBEA 5LYFA 4ZYQA 2V8DA 5D29A 3KASA 2BCOA 3D7HA 3CT9A 1VGYA 3KQZA 4UEZA 3CPXA 4R7MA 4NJQA 4ZI6A 2Q43A 4MCQA 1Y0RA 3N5FA 4OKOA 3KL9A 3H8EA 2XEJA 3SJXA 3KHZA 1R3NA 1Y7EA 2ANPA 4ONWA 4KSIA 4MHZA 2F7VA 1Z5RA 4F9VA 2PJCA 1ZLIA 1TXRA 2HB6A 2PVVA 2ZOGA 3TX8A 4ZY2A 3LMSA 3FECA 3D7DA 4Q7AA 3BXMA 3WC5A 4EWTA 4ZX9A 3NH8A 4H2KA 4EMEA 3SJEA 2GLJA 5K8MA 2AFZA 3VH9A 1BAVA 1YMEA 1XBUA 1LFWA 2QVPA 2PJ5A 4JZ0A 3RZAA 4MRIA 1LCPA 1ZLHA 1EE3P 4IAVA 2CTBA 2ZENA 4JYWA 3IWWA 2F8HA 4WWVA 3NH4A 4NGQA 4PXEA 3VARA 1CG2A 3D7FA 3IFEA 2DEAA 4OC2A 1Q7LA 2ZEPA 1XJOA 5IB9A 2VL1A 4NGMA 3IJ3A 3GUXA 3S9NA 1ELMP 2AFWA 3FH4A 4P4DA 1VHEA 4MXUA 1YW4A 2NYQA 2PJ8A 4OC4A 4Z65A 1H8LA 3D4UA 4MHPA 4MCSA 1DTDA 1VHOA 4MCRA 2C6PA 3B7IA 3MRUA 3DGVA 2XEGA 4UEFA 4ZY0A 2O53A 2PJBA 3PB4X 1BLLE 4PQAA 3WC7A 4EFDA 1CP6A 2ZOFA 5THWA 1CX8A 1CPSA 1OBRA 2OOTA 2AFMA 4MMOA 2C6GA 4ZX8A 2PJ1A 2RFHA 1RTQA 1ZG7A 4P4JA 4FWUA 5HVFA 3D67A 4OP4A 2Q51A 2V8GA 1YW6A 2ZEMA 5JM6A 4P4EA 1AYEA 2AFXA 4F9UA 2PJ9A 5D8NA 1ARLA 3TC8A 1YSJA 1KWMA 2JBJA 1F57A 3RAMA 5CBMA 4CPAA 2POKA 3KZWA 3PRTA 3T8WA 2JBKA 1NSAA 4A39A 3KQXA 4UEEA 5ELYA 3FMCA 2PJ6A 4OIWA 4G1PA 3B3VA 3NFZA 5HVHA 3FX6A 5F09A 2FVGA 4P10A 2PRQA 4AXVA 2PE3A 5LRGA 3PEIA 1FNOA 2CIJA 1YLOA 2WZNA 3IC1A 3DLJA 3D66A 1UWYA 3K2KA 4RUHA 3ISXA 5K8NA 1GYTA 3WABA 2C6CA 4P4BA 4X8IA 3I1UA 4FAIA 5LYLA 3S9LA 2V8HA 4NGSA 1Z8LA 2GU2A 3SI1A 3FJUA 3PFEA 4NGTA 3B35A 2ZEHA 4PPZA 3H8GA 1HDQA 4P4FA 3RBUA 3KHXA 1R43A 2AFSA 4A37A 5LRJA 3WT4A 2PIYA 1XMBA 2J9AA 4ZY1A 4MHYA 1LANA 2NSMA 5K8OA 4W9YA 3FF3A 2AFOA 1CP7A 2CF4A 1ELLP 2ABZA 4PXDA 4OIDA 2IJZA 4WJBA 3B3CA 5LYDA 5J1QA 4X2TA 4UIAA 2EWBA 3KR5A 5HVGA 3WC6A 3JRUA 1ZG9A 4DUKA 2PCUA 5I4MA 8CPAA 3D7GA 2RB7A 2ZELA 3PB6X 3BI1A 3SI0A 3KI9A 3CPAA 4P6YA 3K9TA 5K8PA 1BPMA 1HEEA 3IIBA 7CPAA 4X3RA 3QNVA 4R6TA 1Z2LA 3GLJA 4OC5A 4FUUA 2ZEGA 3B2YA 4OMEA 1XFOA 4A94A 4R76A 3IO1A 2PIZA 3GB0A 2ZEDA 4LQGA 5JH9A 1F2OA 4TWEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GRE A;  1PCA A;  2IQ6 A;  3MN8 A;  3HLP A;  3CDX A;  1QMU A;  3V7Z A;  2HC9 A;  4YWY A;  3FEE A;  1LAP A;  4YU9 A;  4OC0 A;  4P44 A;  1IY7 A;  3PB9 X;  1DE4 C;  4P4I A;  4NFR A;  1CBX A;  2ZEF A;  3NA6 A;  3B3W A;  2V77 A;  3L2N A;  3B3S A;  2PJ2 A;  2O4H A;  1M4L A;  4TNU A;  3B3T A;  3BHX A;  4OC3 A;  4NGP A;  1XRY A;  4UIB A;  1F2P A;  3PBB A;  2JEW A;  4NGN A;  2BO9 A;  3S9M A;  4BD9 A;  2BOA A;  5DS0 A;  2ZEO A;  3FED A;  1Y0Y A;  4MHN A;  5LRK A;  3D68 A;  1TKJ A;  2I3C A;  4NGR A;  4UF4 A;  5HXD A;  3H8F A;  2OR4 A;  2WYR A;  1TKF A;  1VIX A;  3LWU A;  4O23 A;  4DJL A;  2QYV A;  4GM5 A;  2PJ0 A;  4IK2 A;  3SI2 A;  1QQ9 A;  3V38 A;  3NH5 A;  2PVW A;  3PFO A;  4R8F A;  3IEH A;  2PJ4 A;  4MCP A;  1FT7 A;  2XEI A;  4K3N A;  1IGB A;  4P45 A;  2AFU A;  4NJR A;  4OC1 A;  1JQG A;  2Q4Z A;  3HUV A;  4A38 A;  2PJA A;  3VAT A;  3KR4 A;  4IHM A;  2ZEE A;  3SJF A;  1ARM A;  2QJ8 A;  2CTC A;  2PJ3 A;  3BI0 A;  6CPA A;  1ZG8 A;  3PB7 X;  5CPA A;  4PXC A;  5LYI A;  1TF8 A;  1LOK A;  2PJ7 A;  2XEF A;  5JGF A;  1HDU A;  1CPX A;  4F8Z A;  2GLF A;  1PYT B;  4PXB A;  2IMO A;  2EK8 A;  3PB8 X;  3SJG A;  2G9D A;  1TKH A;  1BPN A;  4B6Z A;  3PBE A;  3KGQ A;  2C1C A;  1LAM A;  3FVL A;  1AMP A;  2EK9 A;  3ISZ A;  2V8V A;  4DYO A;  1TF9 A;  4FBE A;  5LYF A;  4ZYQ A;  2V8D A;  5D29 A;  3KAS A;  2BCO A;  3D7H A;  3CT9 A;  1VGY A;  3KQZ A;  4UEZ A;  3CPX A;  4R7M A;  4NJQ A;  4ZI6 A;  2Q43 A;  4MCQ A;  1Y0R A;  3N5F A;  4OKO A;  3KL9 A;  3H8E A;  2XEJ A;  3SJX A;  3KHZ A;  1R3N A;  1Y7E A;  2ANP A;  4ONW A;  4KSI A;  4MHZ A;  2F7V A;  1Z5R A;  4F9V A;  2PJC A;  1ZLI A;  1TXR A;  2HB6 A;  2PVV A;  2ZOG A;  3TX8 A;  4ZY2 A;  3LMS A;  3FEC A;  3D7D A;  4Q7A A;  3BXM A;  3WC5 A;  4EWT A;  4ZX9 A;  3NH8 A;  4H2K A;  4EME A;  3SJE A;  2GLJ A;  5K8M A;  2AFZ A;  3VH9 A;  1BAV A;  1YME A;  1XBU A;  1LFW A;  2QVP A;  2PJ5 A;  4JZ0 A;  3RZA A;  4MRI A;  1LCP A;  1ZLH A;  1EE3 P;  4IAV A;  2CTB A;  2ZEN A;  4JYW A;  3IWW A;  2F8H A;  4WWV A;  3NH4 A;  4NGQ A;  4PXE A;  3VAR A;  1CG2 A;  3D7F A;  3IFE A;  2DEA A;  4OC2 A;  1Q7L A;  2ZEP A;  1XJO A;  5IB9 A;  2VL1 A;  4NGM A;  3IJ3 A;  3GUX A;  3S9N A;  1ELM P;  2AFW A;  3FH4 A;  4P4D A;  1VHE A;  4MXU A;  1YW4 A;  2NYQ A;  2PJ8 A;  4OC4 A;  4Z65 A;  1H8L A;  3D4U A;  4MHP A;  4MCS A;  1DTD A;  1VHO A;  4MCR A;  2C6P A;  3B7I A;  3MRU A;  3DGV A;  2XEG A;  4UEF A;  4ZY0 A;  2O53 A;  2PJB A;  3PB4 X;  1BLL E;  4PQA A;  3WC7 A;  4EFD A;  1CP6 A;  2ZOF A;  5THW A;  1CX8 A;  1CPS A;  1OBR A;  2OOT A;  2AFM A;  4MMO A;  2C6G A;  4ZX8 A;  2PJ1 A;  2RFH A;  1RTQ A;  1ZG7 A;  4P4J A;  4FWU A;  5HVF A;  3D67 A;  4OP4 A;  2Q51 A;  2V8G A;  1YW6 A;  2ZEM A;  5JM6 A;  4P4E A;  1AYE A;  2AFX A;  4F9U A;  2PJ9 A;  5D8N A;  1ARL A;  3TC8 A;  1YSJ A;  1KWM A;  2JBJ A;  1F57 A;  3RAM A;  5CBM A;  4CPA A;  2POK A;  3KZW A;  3PRT A;  3T8W A;  2JBK A;  1NSA A;  4A39 A;  3KQX A;  4UEE A;  5ELY A;  3FMC A;  2PJ6 A;  4OIW A;  4G1P A;  3B3V A;  3NFZ A;  5HVH A;  3FX6 A;  5F09 A;  2FVG A;  4P10 A;  2PRQ A;  4AXV A;  2PE3 A;  5LRG A;  3PEI A;  1FNO A;  2CIJ A;  1YLO A;  2WZN A;  3IC1 A;  3DLJ A;  3D66 A;  1UWY A;  3K2K A;  4RUH A;  3ISX A;  5K8N A;  1GYT A;  3WAB A;  2C6C A;  4P4B A;  4X8I A;  3I1U A;  4FAI A;  5LYL A;  3S9L A;  2V8H A;  4NGS A;  1Z8L A;  2GU2 A;  3SI1 A;  3FJU A;  3PFE A;  4NGT A;  3B35 A;  2ZEH A;  4PPZ A;  3H8G A;  1HDQ A;  4P4F A;  3RBU A;  3KHX A;  1R43 A;  2AFS A;  4A37 A;  5LRJ A;  3WT4 A;  2PIY A;  1XMB A;  2J9A A;  4ZY1 A;  4MHY A;  1LAN A;  2NSM A;  5K8O A;  4W9Y A;  3FF3 A;  2AFO A;  1CP7 A;  2CF4 A;  1ELL P;  2ABZ A;  4PXD A;  4OID A;  2IJZ A;  4WJB A;  3B3C A;  5LYD A;  5J1Q A;  4X2T A;  4UIA A;  2EWB A;  3KR5 A;  5HVG A;  3WC6 A;  3JRU A;  1ZG9 A;  4DUK A;  2PCU A;  5I4M A;  8CPA A;  3D7G A;  2RB7 A;  2ZEL A;  3PB6 X;  3BI1 A;  3SI0 A;  3KI9 A;  3CPA A;  4P6Y A;  3K9T A;  5K8P A;  1BPM A;  1HEE A;  3IIB A;  7CPA A;  4X3R A;  3QNV A;  4R6T A;  1Z2L A;  3GLJ A;  4OC5 A;  4FUU A;  2ZEG A;  3B2Y A;  4OME A;  1XFO A;  4A94 A;  4R76 A;  3IO1 A;  2PIZ A;  3GB0 A;  2ZED A;  4LQG A;  5JH9 A;  1F2O A;  4TWE A; 
#chains in the Genus database with same CATH topology
 5GCN A;  4B11 A;  1GHE A;  3H5Z A;  2GRE A;  1PCA A;  2IQ6 A;  3MN8 A;  3HLP A;  1Q2D A;  3CDX A;  1QMU A;  3V7Z A;  2YND A;  4M6H A;  2HC9 A;  4H6U A;  4YWY A;  3FEE A;  1LAP A;  5G20 A;  1XMT A;  1XOV A;  5A27 A;  4YU9 A;  4II9 A;  4FD6 A;  3TCV A;  2Z0Z A;  2CNS A;  4OC0 A;  4P44 A;  1L0C A;  1IY7 A;  3PB9 X;  4MFZ A;  1DE4 C;  4P4I A;  4NFR A;  1CBX A;  2ZEF A;  3NA6 A;  4JJX A;  2PR8 A;  3B3W A;  3TO7 A;  2V77 A;  3L2N A;  1YVK A;  1LRZ A;  3S6H A;  4AG7 A;  4CYQ A;  1A2Z A;  4LQ6 A;  3B3S A;  3RYO A;  3FXT A;  2PJ2 A;  2O4H A;  2ZXV A;  2B4D A;  3EFA A;  3PP9 A;  5ISV A;  2OZG A;  1M4L A;  4TNU A;  4F0Y A;  3B3T A;  3BHX A;  4XNH B;  5F49 A;  4UFX A;  4F6A A;  4OC3 A;  1IID A;  4NGP A;  1XRY A;  3T9Y A;  1Z8W A;  2RC4 A;  1M1D A;  2OZH A;  4UIB A;  1F2P A;  3PBB A;  1BO4 A;  1YGH A;  2JEW A;  4NF1 A;  2JLM A;  2BO9 A;  4NGN A;  3S9M A;  4BD9 A;  4MFJ A;  2Q0Y A;  2BOA A;  4L8A A;  5DS0 A;  4XNH C;  2ZEO A;  3JVN A;  1NMT A;  3TFY A;  3R9E A;  3FED A;  1ON0 A;  1R57 A;  4OAE A;  1Y0Y A;  1Y9K A;  4CYP A;  4MHN A;  5AGE A;  3D68 A;  5LRK A;  1YLE A;  1Y7R A;  4OAD A;  5DWN A;  1RXT A;  3VWD A;  1TKJ A;  2I3C A;  4NGR A;  4CAE A;  4UF4 A;  2ARH A;  1VKC A;  4K30 A;  5HXD A;  3H8F A;  2OR4 A;  2WYR A;  3I3G A;  1TKF A;  1VIX A;  3LWU A;  4O23 A;  1YX0 A;  4DJL A;  4U5Y A;  1NE9 A;  2QYV A;  4GM5 A;  3T90 A;  3TO9 A;  3F8K A;  2EBJ A;  3DR8 A;  2PJ0 A;  3FYN A;  4IK2 A;  4JLY A;  4XPK A;  3SI2 A;  1IYL A;  1QQ9 A;  3NH5 A;  1S7F A;  2PVW A;  3PFO A;  4R8F A;  3V38 A;  5KTA A;  3IEH A;  2X7B A;  4FD5 A;  2PJ4 A;  4J3G A;  4MCP A;  4KVM E;  1X12 A;  1YR0 A;  1Z9U A;  2FS5 A;  2Q7S A;  1FT7 A;  2XEI A;  2FT0 A;  4CAW A;  4R9M A;  5J8C A;  2BL1 A;  3SXN A;  4BMH A;  4K3N A;  3TOA A;  4UFW A;  1IGB A;  4P45 A;  2AFU A;  4NJR A;  4XPD B;  3IGR A;  4IUS A;  4OC1 A;  1JQG A;  2Q4Z A;  3HUV A;  3SHP A;  4A38 A;  3CXS A;  1SQH A;  2B4D B;  2PJA A;  2CNM A;  2A4N A;  3KR4 A;  4IHM A;  4UBR A;  3VAT A;  1QSN A;  2ZEE A;  1CJW A;  1ARM A;  4Y49 C;  3SJF A;  2QJ8 A;  2CTC A;  2PJ3 A;  4MFP A;  5F47 A;  1KUX A;  3BI0 A;  6CPA A;  4KUA A;  4I49 A;  3RNZ A;  1AUG A;  1XIX A;  1ZG8 A;  3PB7 X;  4XPD C;  5CPA A;  4PXC A;  5LYI A;  4C68 A;  4CS0 B;  1TF8 A;  1XE4 A;  2DPT A;  1LOK A;  2YNC A;  3KKW A;  2PJ7 A;  2XEF A;  4CAF A;  1M44 A;  5C88 A;  5JGF A;  1HDU A;  1CPX A;  1IB1 E;  4R87 A;  5AG5 A;  2HV2 A;  4F8Z A;  2GLF A;  2PSW A;  1PYT B;  4PXB A;  4MJ8 A;  2IMO A;  2EK8 A;  3FRM A;  3PB8 X;  4UWI A;  2F5I A;  3SJG A;  2D4O A;  2G9D A;  1TKH A;  1BPN A;  4B6Z A;  3PBE A;  3KGQ A;  4QVT A;  2C1C A;  4KOS A;  4KUB A;  1LAM A;  3FVL A;  4CGP A;  1AMP A;  1S7N A;  2CY2 A;  1XF8 A;  2BUE A;  2EK9 A;  3ISZ A;  3A9L A;  1YVO A;  2V8V A;  4DYO A;  4HNW B;  1TF9 A;  1I21 A;  4FBE A;  2VXK A;  3S6F A;  5LYF A;  4ZYQ A;  2QIR A;  2V8D A;  5D29 A;  3TO6 A;  3KAS A;  1M4I A;  2BCO A;  3D7H A;  3CT9 A;  3DSB A;  1VGY A;  4X5K A;  3KQZ A;  1TIQ A;  3MGD A;  4A30 A;  4UEZ A;  4B12 A;  3D3S A;  3R96 A;  1I12 A;  2NMT A;  3CPX A;  3FNC A;  4R7M A;  3G8W A;  4QBJ A;  4ZGY B;  4YGO A;  4NJQ A;  4ZI6 A;  3GY9 A;  1X10 A;  2Q43 A;  4MCQ A;  5C82 A;  1Y0R A;  3N5F A;  4OKO A;  4CAX A;  2Z11 A;  2Q04 A;  4AVA A;  3BLN A;  3KL9 A;  2B4B A;  3H8E A;  3GYA A;  5IB0 A;  5J8F A;  2DPS A;  4NSQ A;  2XEJ A;  4KOU A;  3SJX A;  2FIW A;  1R3N A;  1Y7E A;  3KHZ A;  2ANP A;  3QAH A;  4NEX A;  4PK2 A;  5F46 A;  3B8G A;  4ONW A;  4KSI A;  1NSL A;  4MHZ A;  2F7V A;  1Z5R A;  4F9V A;  4KS9 A;  2B3U A;  2PJC A;  1ZLI A;  2VZY A;  1TXR A;  3TE4 A;  2HB6 A;  2PVV A;  2ZOG A;  3TX8 A;  4ZY2 A;  1J4J A;  3H4Q A;  3LMS A;  3FEC A;  1XEB A;  2YNC C;  3D7D A;  4AVB A;  4LX9 A;  2OH1 A;  4Q7A A;  3NE7 A;  3BXM A;  3W6S A;  4PV6 A;  3TTH A;  1KZF A;  4M6I A;  4HNY B;  3S6K A;  3WC5 A;  4KOW A;  2G3A A;  3N7Z A;  4EWT A;  1RO5 A;  4KVX A;  3BJ7 A;  3NH8 A;  4ZX9 A;  2K5T A;  3NE8 A;  4H2K A;  4EME A;  3DDD A;  4CYO A;  5IX3 A;  5BWA B;  3SJE A;  2GLJ A;  4CAV A;  5K8M A;  2AFZ A;  3P2H A;  3VH9 A;  1BAV A;  1MK4 A;  1YME A;  1XBU A;  3IU1 A;  2REF A;  4PK3 A;  1IIC A;  1LFW A;  2FIA A;  2QVP A;  5EC4 A;  4JXQ A;  1Z4R A;  2BEI A;  2PJ5 A;  4M85 A;  4B5P A;  2ODF A;  4MBU A;  2GIV A;  4JZ0 A;  3RZA A;  4H6Z A;  4MRI A;  5AG7 A;  5JPH A;  1LCP A;  5KTC A;  1ZLH A;  1EE3 P;  4IAV A;  2CTB A;  2KCW A;  2ZEN A;  4JYW A;  4B10 A;  3IWE A;  3IWW A;  2ZW7 A;  2I00 A;  2ZW6 A;  5JH9 A;  4UA3 A;  2HQY A;  4MFK A;  2F8H A;  3V8I A;  4WWV A;  3NH4 A;  4NGQ A;  4PXE A;  3VAR A;  1CG2 A;  3D7F A;  4ONU A;  3IFE A;  3QB8 A;  2DEA A;  4OC2 A;  1Q7L A;  2OB0 A;  2ZEP A;  4R3K A;  4YFJ A;  1XJO A;  4B13 A;  2VL1 A;  5E96 A;  3R9F A;  4NGM A;  5IB9 A;  1U6M A;  3IJ3 A;  1S7K A;  3GUX A;  4UWJ A;  3S9N A;  4UCM A;  4AVC A;  2GAN A;  1ELM P;  2AFW A;  4LUA A;  3FH4 A;  3G3S A;  1MJB A;  4P4D A;  2B58 A;  1VHE A;  4CRY B;  4MXU A;  1YW4 A;  2NYQ A;  2PJ8 A;  3FB3 A;  1Q2Y A;  4OC4 A;  4Z65 A;  4MHD A;  1H8L A;  3D4U A;  1M4D A;  2J8N A;  2WUU A;  4MHP A;  4MCS A;  1DTD A;  1VHO A;  5HH1 A;  1B6B A;  2P0W A;  4YRH A;  4MCR A;  1Y9W A;  2ATR A;  2C6P A;  3B7I A;  3MRU A;  2FL4 A;  3EO4 A;  3GIU A;  4EVY A;  3DGV A;  2Q7B A;  2YNE A;  2XEG A;  4UEF A;  5EBV A;  2O53 A;  2OZU A;  2DXQ A;  4QB9 A;  4ZY0 A;  2PJB A;  3CZX A;  2VQY A;  3PB4 X;  1BLL E;  4PQA A;  3I9S A;  3WC7 A;  4EFD A;  2Y0M A;  1CP6 A;  1IU8 A;  1Z8X A;  5EMI A;  2ZOF A;  5THW A;  1CX8 A;  3F5B A;  3ZJ0 A;  4C2X A;  2ZPA A;  2Z3K A;  1KUY A;  3R95 A;  1MJA A;  2BSW A;  1IYK A;  1CPS A;  4HNX B;  4MY3 A;  1OBR A;  2OOT A;  2AFM A;  2FE7 A;  4B5P B;  4MMO A;  2C6G A;  3JUW A;  1PUA A;  2Z3O A;  1QSR A;  2QML A;  3EY5 A;  4U9Y A;  4ZX8 A;  2PJ1 A;  2RFH A;  2R8V A;  4C2Z A;  1RTQ A;  2J8M A;  1ZG7 A;  4IF5 A;  4XPL A;  2AJ6 A;  4P4J A;  3SXO A;  4JWP A;  2P6E A;  3TT2 A;  2WPX A;  4FWU A;  4PSW A;  5HVF A;  3D67 A;  5HMN A;  4OP4 A;  4KOX A;  2Q51 A;  2V8G A;  2FXF A;  2PDO A;  1YW6 A;  4MY0 A;  2ZEM A;  1YRE A;  5JQ4 A;  4NCZ A;  2Z10 A;  5JM6 A;  4P4E A;  1AYE A;  1WWZ A;  2AFX A;  4R57 A;  4E0A A;  3D2M A;  3EXN A;  4FD4 A;  2Q44 A;  2PJ9 A;  5D8N A;  4F9U A;  1ARL A;  3TC8 A;  2HUZ A;  1YSJ A;  2VBQ A;  4ORF A;  1QSO A;  4KOV A;  2H5M A;  1KWM A;  2PR1 A;  1K4J A;  3CXQ A;  2PQ8 A;  1I1D A;  4MFQ A;  1S7L A;  3RO0 A;  5AG6 A;  4CGN A;  2Z3N A;  4PSX A;  1BOB A;  2EO8 A;  2Z3L A;  2JBJ A;  3TOB A;  1F57 A;  3LD2 A;  3RAM A;  1Z4E A;  2ZW4 A;  5CBM A;  4CPA A;  3CXP A;  1B87 A;  2POK A;  3KZW A;  1PU9 A;  2P6G A;  3PRT A;  2JBK A;  3C26 A;  5G22 A;  3LAC A;  4KLW A;  5H84 A;  1NSA A;  3T8W A;  3ZZI A;  4A39 A;  3KQX A;  4UEE A;  4HPS A;  2C27 A;  3FMC A;  2R1I A;  4QUS A;  3IWG A;  5ELY A;  2PJ6 A;  4OIW A;  3D8P A;  4G1P A;  3B3V A;  1KUV A;  3NFZ A;  2R7H A;  5HVH A;  4NXY A;  2Q4Y A;  4UCP A;  2R98 A;  2QEC A;  3FX6 A;  5F09 A;  2FVG A;  2OU2 A;  2PRQ A;  4JD6 A;  4P10 A;  1S3Z A;  4AXV A;  4MFL A;  2DF5 A;  2PE3 A;  5LRG A;  3PEI A;  1VHS A;  4A33 A;  1FNO A;  3DR6 A;  4KSF A;  2CIJ A;  4HKF A;  1IOF A;  1QSM A;  1YLO A;  2WZN A;  3IC1 A;  3DLJ A;  3D66 A;  1QST A;  1UWY A;  3JTK A;  3K2K A;  4R3L A;  3ISX A;  4RN7 A;  4RUH A;  5I0C A;  2O28 A;  4KLV A;  5K8N A;  1GYT A;  1ZO0 A;  2VEZ A;  2CNT A;  3WAB A;  1UFH A;  4UFV A;  2C6C A;  2PRB A;  4KSA A;  4P4B A;  3R9G A;  1MJ9 A;  1JWQ A;  4X8I A;  4B5O A;  3I1U A;  1OZP A;  2EVN A;  5DWM A;  4FAI A;  5LYL A;  3S9L A;  2B5G A;  2V8H A;  4JXR A;  4NGS A;  4M3S A;  2YGW A;  4CYN A;  4DNC A;  1Z8L A;  2GU2 A;  3SI1 A;  3FBU A;  2I79 A;  3FJU A;  1S5K A;  2GFQ A;  3PFE A;  4FD7 A;  4BIN A;  4NGT A;  3B35 A;  5FVJ A;  2ZEH A;  2WSA A;  4PPZ A;  3H8G A;  1IOI A;  4F0X A;  4E2A A;  1HDQ A;  2Z3P A;  4P4F A;  5F48 A;  3RBU A;  3KHX A;  1R43 A;  1FY7 A;  4QC6 A;  2AFS A;  4A37 A;  3S6G A;  2J8R A;  4C7H A;  4BBH A;  5IV0 A;  4KOR A;  5LRJ A;  3WT4 A;  2PIY A;  5G21 A;  1XMB A;  2AE6 A;  4Q38 A;  4B14 A;  2JDC A;  2J9A A;  2D4P A;  1Z8T A;  4RI1 A;  4ZY1 A;  4MHY A;  1LAN A;  4AG9 A;  2NSM A;  1YK3 A;  5K8O A;  2GE3 A;  2FSR A;  3FIX A;  5CNP A;  2REE A;  2IL4 A;  4CRZ B;  4W9Y A;  4KVO E;  3FF3 A;  3W91 A;  5AG4 A;  2Q4V A;  2AFO A;  1CP7 A;  2CXA A;  2CF4 A;  4Y49 B;  1ELL P;  2ABZ A;  3W6X A;  5A28 A;  1P0H A;  4AB7 A;  4PXD A;  1V0C A;  4OID A;  2IJZ A;  4WJB A;  3B3C A;  5LYD A;  5J1Q A;  4L89 A;  4X2T A;  3DNS A;  4A31 A;  3D2P A;  3F0A A;  5G1Z A;  4UIA A;  4CGO A;  1M4G A;  2EWB A;  3KR5 A;  5HVG A;  3WC6 A;  3JRU A;  3QAY A;  4E8O A;  4GXH A;  1ZG9 A;  3R1K A;  4DUK A;  2PCU A;  4A32 A;  5I4M A;  4C2Y A;  1S60 A;  8CPA A;  3D7G A;  2Z3M A;  2EUI A;  2RB7 A;  2ZEL A;  1CM0 A;  3PGP A;  4KOT A;  3PB6 X;  3VWE A;  3BI1 A;  3SI0 A;  4MI4 A;  4A2Z A;  3KI9 A;  3OWC A;  3E0K A;  3EC4 A;  4H89 A;  2B5G B;  3CPA A;  4P6Y A;  3PZJ A;  5H86 A;  3K9T A;  4RS2 A;  5K8P A;  1BPM A;  5KTD A;  1HEE A;  3IIB A;  4KZT A;  4CGM A;  7CPA A;  2VZZ A;  3BJ8 A;  1YQE A;  2P6F A;  4X3R A;  3QNV A;  4U9Z A;  2VI7 A;  4C7I A;  2WPW A;  4R6T A;  3IU2 A;  1Z2L A;  3K9U A;  4KOY A;  3GLJ A;  4OC5 A;  4M6G A;  3UY5 A;  4FUU A;  2ZEG A;  3B2Y A;  3GKR A;  3LOD A;  1P4N A;  4GS4 A;  2ZW5 A;  4OME A;  1XFO A;  2FCK A;  4A94 A;  4UCN A;  4A95 A;  2JEV A;  4R76 A;  4CGL A;  3P2F A;  3IO1 A;  2PIZ A;  1Q2C A;  4OLL A;  2PC1 A;  3GB0 A;  4Q36 A;  2ZED A;  3WR7 A;  4ZBG A;  1N71 A;  2G3T A;  2JDD A;  1WK4 A;  4LQG A;  2B3V A;  2G0B A;  1F2O A;  4TWE A; 
#chains in the Genus database with same CATH homology
 2GRE A;  1PCA A;  2IQ6 A;  3MN8 A;  3HLP A;  3CDX A;  1QMU A;  3V7Z A;  2HC9 A;  4YWY A;  3FEE A;  1LAP A;  4YU9 A;  4OC0 A;  4P44 A;  1IY7 A;  3PB9 X;  1DE4 C;  4P4I A;  4NFR A;  1CBX A;  2ZEF A;  3NA6 A;  3B3W A;  2V77 A;  3L2N A;  3B3S A;  2PJ2 A;  2O4H A;  1M4L A;  4TNU A;  3B3T A;  3BHX A;  4OC3 A;  4NGP A;  1XRY A;  4UIB A;  1F2P A;  3PBB A;  2JEW A;  4NGN A;  2BO9 A;  3S9M A;  4BD9 A;  2BOA A;  5DS0 A;  2ZEO A;  3FED A;  1Y0Y A;  4MHN A;  5LRK A;  3D68 A;  1TKJ A;  2I3C A;  4NGR A;  4UF4 A;  5HXD A;  3H8F A;  2OR4 A;  2WYR A;  1TKF A;  1VIX A;  3LWU A;  4O23 A;  4DJL A;  2QYV A;  4GM5 A;  2PJ0 A;  4IK2 A;  3SI2 A;  1QQ9 A;  3V38 A;  3NH5 A;  2PVW A;  3PFO A;  4R8F A;  3IEH A;  2PJ4 A;  4MCP A;  1FT7 A;  2XEI A;  4K3N A;  1IGB A;  4P45 A;  2AFU A;  4NJR A;  4OC1 A;  1JQG A;  2Q4Z A;  3HUV A;  4A38 A;  2PJA A;  3VAT A;  3KR4 A;  4IHM A;  2ZEE A;  3SJF A;  1ARM A;  2QJ8 A;  2CTC A;  2PJ3 A;  3BI0 A;  6CPA A;  1ZG8 A;  3PB7 X;  5CPA A;  4PXC A;  5LYI A;  1TF8 A;  1LOK A;  2PJ7 A;  2XEF A;  5JGF A;  1HDU A;  1CPX A;  4F8Z A;  2GLF A;  1PYT B;  4PXB A;  2IMO A;  2EK8 A;  3PB8 X;  3SJG A;  2G9D A;  1TKH A;  1BPN A;  4B6Z A;  3PBE A;  3KGQ A;  2C1C A;  1LAM A;  3FVL A;  1AMP A;  2EK9 A;  3ISZ A;  2V8V A;  4DYO A;  1TF9 A;  4FBE A;  5LYF A;  4ZYQ A;  2V8D A;  5D29 A;  3KAS A;  2BCO A;  3D7H A;  3CT9 A;  1VGY A;  3KQZ A;  4UEZ A;  3CPX A;  4R7M A;  4NJQ A;  4ZI6 A;  2Q43 A;  4MCQ A;  1Y0R A;  3N5F A;  4OKO A;  3KL9 A;  3H8E A;  2XEJ A;  3SJX A;  3KHZ A;  1R3N A;  1Y7E A;  2ANP A;  4ONW A;  4KSI A;  4MHZ A;  2F7V A;  1Z5R A;  4F9V A;  2PJC A;  1ZLI A;  1TXR A;  2HB6 A;  2PVV A;  2ZOG A;  3TX8 A;  4ZY2 A;  3LMS A;  3FEC A;  3D7D A;  4Q7A A;  3BXM A;  3WC5 A;  4EWT A;  4ZX9 A;  3NH8 A;  4H2K A;  4EME A;  3SJE A;  2GLJ A;  5K8M A;  2AFZ A;  3VH9 A;  1BAV A;  1YME A;  1XBU A;  1LFW A;  2QVP A;  2PJ5 A;  4JZ0 A;  3RZA A;  4MRI A;  1LCP A;  1ZLH A;  1EE3 P;  4IAV A;  2CTB A;  2ZEN A;  4JYW A;  3IWW A;  2F8H A;  4WWV A;  3NH4 A;  4NGQ A;  4PXE A;  3VAR A;  1CG2 A;  3D7F A;  3IFE A;  2DEA A;  4OC2 A;  1Q7L A;  2ZEP A;  1XJO A;  5IB9 A;  2VL1 A;  4NGM A;  3IJ3 A;  3GUX A;  3S9N A;  1ELM P;  2AFW A;  3FH4 A;  4P4D A;  1VHE A;  4MXU A;  1YW4 A;  2NYQ A;  2PJ8 A;  4OC4 A;  4Z65 A;  1H8L A;  3D4U A;  4MHP A;  4MCS A;  1DTD A;  1VHO A;  4MCR A;  2C6P A;  3B7I A;  3MRU A;  3DGV A;  2XEG A;  4UEF A;  4ZY0 A;  2O53 A;  2PJB A;  3PB4 X;  1BLL E;  4PQA A;  3WC7 A;  4EFD A;  1CP6 A;  2ZOF A;  5THW A;  1CX8 A;  1CPS A;  1OBR A;  2OOT A;  2AFM A;  4MMO A;  2C6G A;  4ZX8 A;  2PJ1 A;  2RFH A;  1RTQ A;  1ZG7 A;  4P4J A;  4FWU A;  5HVF A;  3D67 A;  4OP4 A;  2Q51 A;  2V8G A;  1YW6 A;  2ZEM A;  5JM6 A;  4P4E A;  1AYE A;  2AFX A;  4F9U A;  2PJ9 A;  5D8N A;  1ARL A;  3TC8 A;  1YSJ A;  1KWM A;  2JBJ A;  1F57 A;  3RAM A;  5CBM A;  4CPA A;  2POK A;  3KZW A;  3PRT A;  3T8W A;  2JBK A;  1NSA A;  4A39 A;  3KQX A;  4UEE A;  5ELY A;  3FMC A;  2PJ6 A;  4OIW A;  4G1P A;  3B3V A;  3NFZ A;  5HVH A;  3FX6 A;  5F09 A;  2FVG A;  4P10 A;  2PRQ A;  4AXV A;  2PE3 A;  5LRG A;  3PEI A;  1FNO A;  2CIJ A;  1YLO A;  2WZN A;  3IC1 A;  3DLJ A;  3D66 A;  1UWY A;  3K2K A;  4RUH A;  3ISX A;  5K8N A;  1GYT A;  3WAB A;  2C6C A;  4P4B A;  4X8I A;  3I1U A;  4FAI A;  5LYL A;  3S9L A;  2V8H A;  4NGS A;  1Z8L A;  2GU2 A;  3SI1 A;  3FJU A;  3PFE A;  4NGT A;  3B35 A;  2ZEH A;  4PPZ A;  3H8G A;  1HDQ A;  4P4F A;  3RBU A;  3KHX A;  1R43 A;  2AFS A;  4A37 A;  5LRJ A;  3WT4 A;  2PIY A;  1XMB A;  2J9A A;  4ZY1 A;  4MHY A;  1LAN A;  2NSM A;  5K8O A;  4W9Y A;  3FF3 A;  2AFO A;  1CP7 A;  2CF4 A;  1ELL P;  2ABZ A;  4PXD A;  4OID A;  2IJZ A;  4WJB A;  3B3C A;  5LYD A;  5J1Q A;  4X2T A;  4UIA A;  2EWB A;  3KR5 A;  5HVG A;  3WC6 A;  3JRU A;  1ZG9 A;  4DUK A;  2PCU A;  5I4M A;  8CPA A;  3D7G A;  2RB7 A;  2ZEL A;  3PB6 X;  3BI1 A;  3SI0 A;  3KI9 A;  3CPA A;  4P6Y A;  3K9T A;  5K8P A;  1BPM A;  1HEE A;  3IIB A;  7CPA A;  4X3R A;  3QNV A;  4R6T A;  1Z2L A;  3GLJ A;  4OC5 A;  4FUU A;  2ZEG A;  3B2Y A;  4OME A;  1XFO A;  4A94 A;  4R76 A;  3IO1 A;  2PIZ A;  3GB0 A;  2ZED A;  4LQG A;  5JH9 A;  1F2O A;  4TWE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...