4MHZA

Crystal structure of apo-form glutaminyl cyclase from ixodes scapularis in complex with pbd150
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
326
structure length
325
Chain Sequence
b'LKWPRDLRPLAHHDLLYMGQISEDRGDFNATLRNFLVPRVVGSQKHREVREFIVRSLKDLDWDVEEDCFDGQTPHGIKPFCNVIATLNPSACHRLVLACHYDSLLHKEGTFIGATDSAVPCAQLLYLARSLNGKLQNQKTRGDGLTLQLVFFDGEEAFERWSSHDSLYGSRHLAQKWHEDRTSAERLESCLERSEIANQIDRMEVMVLLDLLGAENPRFYSYFGETQPVYRRLVNIESRLNDAGLMELPRRRRRTNYFSNSSTVGFIEDDHIPFLKRSVPIVHIIPSPFPDVWHTLDDNEQNLHHPTISNLNKIFKAFVSEYLQL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glutaminyl cyclase, putative
publication title Structural and functional analyses of a glutaminyl cyclase from Ixodes scapularis reveal metal-independent catalysis and inhibitor binding.
pubmed doi rcsb
source organism Ixodes scapularis
molecule tags Transferase
total genus 110
structure length 325
sequence length 326
ec nomenclature ec 2.3.2.5: Glutaminyl-peptide cyclotransferase.
pdb deposition date 2013-08-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 4mhzA00
5HVFA 4R7MA 1R43A 4YWYA 3D7FA 3D67A 5LYFA 2PVVA 3PB8X 3B3TA 4G1PA 3HLPA 3PRTA 4Q7AA 4KSIA 1EE3P 4OC2A 5DS0A 3CPAA 1AYEA 2VL1A 3PB7X 4P10A 1HDQA 2PJ4A 3KQXA 4YU9A 2ZOFA 4R76A 2IQ6A 4MRIA 4FBEA 1GYTA 1VHOA 5LRJA 2PJAA 4MCSA 4DJLA 1XJOA 1BLLE 1RTQA 1TXRA 4MMOA 5J1QA 3NA6A 7CPAA 1TF8A 4X2TA 3FEEA 3BXMA 4PXCA 1Y0YA 1PYTB 3DLJA 3GLJA 3V38A 5D29A 3D68A 2AFOA 3SI1A 2CIJA 3FX6A 5F09A 1OBRA 3FH4A 1TF9A 1QMUA 3B3WA 4IK2A 2IMOA 8CPAA 1UWYA 3KZWA 2PJ7A 1XRYA 3KHXA 1LOKA 2V8GA 3H8GA 1M4LA 2C6PA 1Z5RA 1ZLIA 3V7ZA 2O53A 3JRUA 1Z8LA 2PJ6A 5K8PA 2ABZA 2F7VA 2C1CA 1VGYA 3B7IA 2I3CA 1FT7A 2RB7A 3TX8A 4ZX8A 4P44A 3KL9A 2PJ3A 2ZEOA 3IO1A 2ZEHA 2QJ8A 2FVGA 4NGTA 3PBBA 2PJ5A 2PJ0A 2OR4A 2XEGA 1Z2LA 2AFWA 1CG2A 2PJ1A 3KGQA 3BI0A 4K3NA 2ZEGA 4UIAA 2BOAA 3KI9A 3VH9A 2J9AA 4TWEA 3PFOA 3ISZA 4P4IA 4P4EA 2AFSA 4EMEA 2O4HA 2Q4ZA 2PJ2A 4H2KA 4NGPA 4OC5A 4F9VA 1ZLHA 1DTDA 5LYIA 2PVWA 1TKFA 3KR4A 4P45A 5ELYA 2QYVA 3QNVA 1FNOA 4F8ZA 3BHXA 3WC5A 1LFWA 1XBUA 3WC7A 2V8HA 3IFEA 3RAMA 1YMEA 2XEFA 2ZELA 1IGBA 4B6ZA 2CTBA 3TC8A 1F2PA 2BO9A 4A37A 4RUHA 4ZY1A 1ARLA 4MCPA 4NGSA 2PRQA 3FVLA 3K9TA 5CBMA 3H8EA 2ZEPA 1ARMA 3D66A 4R8FA 1YLOA 4PQAA 4F9UA 3WT4A 4OC4A 2DEAA 4P6YA 4CPAA 3RZAA 3PFEA 3GB0A 1KWMA 4OKOA 3WC6A 1VHEA 3FECA 1CPXA 4P4JA 3KR5A 3S9NA 4IAVA 4NGRA 1LANA 4A39A 1HEEA 4EFDA 4ZYQA 1LAMA 6CPAA 3D7GA 4OC0A 2PIZA 3B2YA 5CPAA 4MCRA 3IIBA 3K2KA 5HVGA 1LAPA 2POKA 1F2OA 3NH4A 4UEFA 4OC3A 2ANPA 2AFMA 2GLFA 2JEWA 4A38A 3RBUA 3VATA 3NFZA 2HC9A 2ZEEA 4JYWA 1DE4C 2ZEMA 1YSJA 4PXDA 4EWTA 2GU2A 2PE3A 3I1UA 4MHYA 4NJRA 4OP4A 4AXVA 5K8OA 4NGQA 1TKHA 4MXUA 2EK9A 1Q7LA 3PB9X 3S9MA 3LWUA 3CDXA 1F57A 3D7HA 4FUUA 3CPXA 2RFHA 3N5FA 5JGFA 2PJCA 4DUKA 3KHZA 2WZNA 5JM6A 5K8MA 1XFOA 1H8LA 3IJ3A 4FAIA 5HXDA 2Q51A 1BPNA 2WYRA 1TKJA 3SJGA 3PEIA 1R3NA 2ZEDA 3B3SA 2PCUA 2AFZA 3KQZA 1AMPA 4GM5A 4X3RA 3MN8A 5JH9A 1IY7A 4P4BA 1ZG7A 4UEZA 1ELLP 4NGMA 4ZY0A 4P4FA 3IEHA 4PPZA 2QVPA 2AFXA 1CPSA 2GLJA 3NH5A 3D7DA 4UF4A 4NFRA 4MHPA 3FMCA 4JZ0A 2V8VA 4PXBA 3FEDA 2HB6A 5LYLA 3BI1A 4NGNA 3PB4X 1ZG9A 4MCQA 4LQGA 1CX8A 3H8FA 1ZG8A 5IB9A 2JBJA 4MHZA 3VARA 4PXEA 2EWBA 2Q43A 2G9DA 3CT9A 2C6CA 1ELMP 3HUVA 5LRKA 4OIWA 2JBKA 4ZI6A 2GREA 1YW4A 5LRGA 5THWA 3KASA 4WJBA 3ISXA 2PJBA 3GUXA 3SI0A 1CBXA 2ZENA 2PIYA 4O23A 5HVHA 2CF4A 3LMSA 2OOTA 3T8WA 3FF3A 2PJ8A 1JQGA 5I4MA 1LCPA 3B35A 2C6GA 3B3CA 4W9YA 4BD9A 2CTCA 3DGVA 4Z65A 1CP6A 1QQ9A 5K8NA 1Y7EA 2F8HA 2IJZA 2XEJA 2ZEFA 1YW6A 4FWUA 3SI2A 1HDUA 4TNUA 4A94A 4OMEA 3PB6X 4P4DA 3S9LA 3L2NA 1PCAA 4IHMA 4WWVA 3MRUA 4OIDA 1Y0RA 3IC1A 4DYOA 3WABA 3FJUA 3SJEA 2V8DA 1BAVA 3IWWA 4MHNA 3B3VA 3PBEA 4NJQA 5LYDA 3NH8A 1VIXA 2ZOGA 2AFUA 3SJXA 1CP7A 4ZY2A 2V77A 4ONWA 3D4UA 4ZX9A 2EK8A 1XMBA 4UIBA 2XEIA 1BPMA 3SJFA 2NSMA 5D8NA 4R6TA 2BCOA 4OC1A 4UEEA 1NSAA 2NYQA 4X8IA 2PJ9A
chains in the Genus database with same CATH superfamily
5HVFA 2BUEA 4R7MA 4AG9A 1R43A 1YGHA 2Z3LA 2Q7BA 4YWYA 2JLMA 5JQ4A 4CGOA 1XOVA 3D7FA 3R95A 3D67A 4MBUA 4A95A 2JDCA 4BBHA 5LYFA 4M6GA 2PVVA 3PB8X 3B3TA 4JXQA 4G1PA 4MHDA 3HLPA 3PRTA 4Q7AA 4C2ZA 1QSMA 4KSIA 1EE3P 4OC2A 5DS0A 3TT2A 4RI1A 3CPAA 4M85A 2QIRA 1A2ZA 2GE3A 1AYEA 1YVKA 4NSQA 2EUIA 2VL1A 4H89A 3PB7X 1AUGA 2CNMA 4P10A 1HDQA 4AG7A 4BMHA 3F8KA 3TCVA 5C88A 2PJ4A 3KQXA 4YU9A 2ZOFA 1JWQA 4KOSA 4R76A 2Z0ZA 1Y7RA 1YREA 2IQ6A 1XMTA 4KUBA 4MRIA 4FBEA 4CS0B 3R96A 2AJ6A 3D2PA 1GYTA 3I3GA 2P6GA 1I21A 4L8AA 3GIUA 2CXAA 1B87A 1Z9UA 1VHOA 2FS5A 5LRJA 2PJAA 5ISVA 2B3UA 4MCSA 3A9LA 4DJLA 1Z4EA 1MJBA 3SXOA 3NE8A 4CYNA 1BLLE 1XJOA 4PK3A 1RTQA 1TXRA 4MMOA 2Y0MA 5J1QA 1IOFA 3NA6A 5DWMA 1J4JA 1XF8A 7CPAA 1TF8A 4X2TA 4H6UA 3FEEA 3BXMA 3JVNA 3R1KA 4PXCA 2OZGA 1Y0YA 4MFKA 4E0AA 1PYTB 3DLJA 3GLJA 2ZXVA 2Q0YA 1I12A 3CZXA 2Z10A 1PUAA 3V38A 4XPKA 5D29A 3UY5A 5KTAA 3D68A 4R9MA 2AFOA 4R87A 4OAEA 3SI1A 2CIJA 3FX6A 4KOYA 4Y49B 3S6FA 1OBRA 3FH4A 1TF9A 1QMUA 3TTHA 4ZGYB 5F09A 3B3WA 1P0HA 2IMOA 3DNSA 4IK2A 8CPAA 4FD7A 5KTDA 1UWYA 2REFA 3KZWA 2I79A 2PJ7A 5KTCA 1XRYA 3KHXA 1LOKA 1Y9KA 3EO4A 2V8GA 4KVXA 5EMIA 3H8GA 1M4GA 2JEVA 5G22A 5G1ZA 1M4LA 2C6PA 1SQHA 1Z5RA 4KUAA 1ZLIA 3V7ZA 1YK3A 2O53A 3GKRA 2P6FA 3JRUA 1Z8LA 2PJ6A 2Q7SA 5K8PA 3N7ZA 5EBVA 4UFWA 2ABZA 2F7VA 2C1CA 4KVOE 2EO8A 2KCWA 3IGRA 4LQ6A 4RS2A 2RC4A 4X5KA 2FXFA 1VGYA 4XNHC 4PSWA 1K4JA 1M4DA 1Q2YA 3IU1A 3B7IA 2VI7A 2I3CA 1FT7A 2RB7A 1S60A 3DR8A 1UFHA 5DWNA 3TX8A 4IUSA 4ZX8A 4CYQA 4U5YA 4Q38A 3B8GA 1XE4A 4CGPA 5IB0A 1X12A 3P2HA 1CJWA 4P44A 2ODFA 3T9YA 4ZBGA 1QSTA 3KL9A 2PJ3A 3BLNA 4BINA 2O28A 2DF5A 2ZEOA 3IO1A 2ZEHA 3LD2A 2CY2A 2QJ8A 2FVGA 2WPXA 2PR8A 4PK2A 1NSLA 3K9UA 1S5KA 4NGTA 4UCPA 3PBBA 2PSWA 2PJ5A 3CXPA 2PJ0A 2OR4A 2ARHA 2XEGA 1PU9A 1IIDA 1VKCA 1Z2LA 2AFWA 3D3SA 1IYKA 1CG2A 1BO4A 1NE9A 3H5ZA 2PJ1A 5HMNA 2VZZA 3KGQA 4KORA 1LRZA 4FD5A 1Z8XA 3BI0A 3VWDA 4K3NA 1V0CA 2ZEGA 4KOXA 4OADA 4UIAA 2BOAA 4EVYA 3F0AA 3KI9A 3VH9A 2J9AA 4TWEA 4QB9A 1YR0A 3PFOA 3ISZA 4P4IA 3CXQA 4UCNA 4P4EA 2AFSA 4EMEA 2O4HA 2Q4ZA 1S7LA 4C2YA 2PJ2A 4H2KA 4NGPA 4OC5A 4F9VA 1ZLHA 1DTDA 5LYIA 2PVWA 1TKFA 3KR4A 4QC6A 4U9ZA 4P45A 3KKWA 5ELYA 1QSOA 2QYVA 4CGMA 3QNVA 1FNOA 4B13A 3BHXA 4F8ZA 3WC5A 3W91A 1LFWA 1XBUA 4HPSA 3G8WA 1XIXA 3WC7A 4CAFA 4E2AA 4PSXA 2V8HA 1Q2CA 1Y9WA 2GANA 2EBJA 1M4IA 4IF5A 3IFEA 4CAWA 3EXNA 3RAMA 1YMEA 2XEFA 4MY0A 2ZELA 1TIQA 1IGBA 4XNHB 4B6ZA 2CTBA 3TC8A 2G3TA 1CM0A 2BEIA 2D4PA 2G0BA 3H4QA 2DPSA 4OLLA 1IB1E 1F2PA 1N71A 2BO9A 4A37A 2Z3PA 1XEBA 3QAYA 4RUHA 2OH1A 3S6HA 2WPWA 1ARLA 4MCPA 4NGSA 4ZY1A 2PRQA 2EVNA 2B5GA 3FVLA 3K9TA 4DNCA 5CBMA 3E0KA 2CNTA 3TFYA 2REEA 1QSNA 3H8EA 2ZEPA 2ZW4A 4JWPA 3QAHA 1ARMA 3D66A 4R8FA 4CRYB 1YLOA 4YGOA 1S3ZA 3G3SA 4PQAA 2YGWA 4CGNA 4F9UA 3WT4A 4OC4A 5AG7A 1RO5A 2A4NA 1YQEA 2DEAA 4UWIA 4F0XA 4PV6A 4P6YA 4B11A 2GIVA 4U9YA 5AG4A 3WR7A 4YFJA 2YNCA 4CPAA 4CAXA 1OZPA 4QVTA 3RZAA 3PFEA 3GB0A 2YNDA 1KWMA 4OKOA 1Z8TA 2FSRA 3WC6A 1VHEA 3FECA 1L0CA 1S7NA 1CPXA 4MFJA 4P4JA 3KR5A 5FVJA 4IAVA 5H84A 4C7IA 3S9NA 2Q44A 1FY7A 4JXRA 2I00A 1NMTA 5G20A 4NGRA 1LANA 4AVBA 3W6SA 4A39A 1HEEA 4EFDA 4ZYQA 4A30A 1IOIA 1LAMA 4KLVA 6CPAA 4B5PB 3FBUA 3D7GA 4OC0A 3PGPA 2F5IA 2PIZA 3B2YA 3GY9A 5CPAA 4MCRA 4KOWA 3IIBA 4M3SA 3K2KA 5HVGA 1LAPA 2POKA 1F2OA 3NH4A 2FL4A 4UCMA 4UEFA 2J8NA 2K5TA 4OC3A 2ANPA 2AFMA 3MGDA 4B12A 4B5PA 2GLFA 2JEWA 5BWAB 4KOUA 4JLYA 4A38A 2YNCC 3RBUA 1GHEA 4H6ZA 3VATA 2Z3MA 3NFZA 4MFPA 2HC9A 5J8CA 3V8IA 2ZEEA 3FIXA 3JTKA 4JYWA 1DE4C 1KUXA 2VBQA 2ZEMA 1YSJA 2ZW6A 4HKFA 2GU2A 2PE3A 2R7HA 3I1UA 4NCZA 4PXDA 4EWTA 4MHYA 4II9A 4RN7A 4NJRA 5H86A 3RYOA 2FCKA 4OP4A 4AXVA 4MI4A 5K8OA 2HQYA 4NGQA 3NE7A 1TKHA 1P4NA 1MK4A 2AE6A 4MXUA 3IU2A 2EK9A 1Q7LA 3PB9X 3S9MA 3VWEA 1KZFA 3SHPA 3LWUA 2YNEA 1WWZA 4B14A 4UFVA 4HNWB 2PR1A 3CDXA 3FYNA 3FXTA 4CYPA 1F57A 3D7HA 3OWCA 4FUUA 2C27A 3CPXA 2RFHA 3N5FA 3TOAA 4CAEA 5JGFA 2PJCA 4K30A 2HUZA 4CYOA 3TO9A 4UBRA 2PDOA 4DUKA 5A28A 3BJ7A 3KHZA 2WZNA 5F46A 5JM6A 5GCNA 5K8MA 5F48A 3FNCA 1M1DA 2FT0A 4Q36A 1XFOA 1H8LA 2R1IA 3C26A 3IJ3A 4NXYA 4FAIA 5HXDA 2Q51A 1BPNA 3SXNA 2OZHA 2P6EA 2WYRA 4AVCA 4B5OA 1TKJA 3SJGA 2VEZA 3PEIA 4C68A 2GFQA 3D2MA 1VHSA 1R3NA 2ZEDA 2PC1A 4CRZB 4QUSA 3B3SA 2PCUA 2AFZA 3JUWA 1AMPA 3KQZA 4GM5A 3S6GA 4X3RA 3MN8A 4HNXB 2OZUA 4UFXA 4XPLA 5JH9A 1S7KA 1IY7A 1IYLA 4P4BA 2DPTA 1ZG7A 1M44A 4UEZA 1ELLP 4NGMA 2B5GB 2FIAA 3TO7A 1YVOA 4ZY0A 1KUYA 4P4FA 2R98A 3IEHA 4PPZA 2QVPA 4YRHA 4R3LA 2AFXA 3PZJA 1CPSA 2GLJA 3NH5A 3D7DA 4KSFA 2Q4VA 4UF4A 4NFRA 4C2XA 2ZPAA 4KLWA 2VZYA 4MHPA 3FMCA 5HH1A 4JZ0A 2V8VA 4PXBA 4XPDC 1S7FA 4KOVA 1YX0A 4A32A 4J3GA 1KUVA 3EC4A 4MFLA 3FEDA 3FRMA 3TE4A 4F0YA 2PRBA 3IWGA 2HB6A 4R57A 5LYLA 1BOBA 1U6MA 3BI1A 4NGNA 2D4OA 3PB4X 2WSAA 1ZG9A 4MCQA 3D8PA 4LQGA 3CXSA 1CX8A 1ZG8A 3H8FA 4KVME 4JD6A 5IB9A 2JBJA 4HNYB 4MHZA 3VARA 4PXEA 4E8OA 4UA3A 2EWBA 3T90A 2Q43A 2G9DA 3CT9A 4AVAA 4JJXA 2BL1A 1I1DA 2C6CA 2Z3NA 4KOTA 1ELMP 2FE7A 3HUVA 2Z3OA 5LRKA 4GXHA 4OIWA 2JBKA 5AG6A 2GREA 4ZI6A 1YW4A 5LRGA 3I9SA 4FD4A 3EFAA 4MJ8A 5THWA 2X7BA 2J8RA 2FIWA 3KASA 1R57A 4WJBA 2Q4YA 4A33A 3ISXA 3R9GA 2PJBA 2Z11A 1Z8WA 2NMTA 4AB7A 5G21A 1QSRA 3GUXA 3SI0A 4KZTA 4ONUA 1CBXA 2ZENA 3DR6A 4KSAA 2PIYA 3TO6A 3BJ8A 4CGLA 4O23A 3P2FA 5HVHA 5IV0A 2CF4A 3LMSA 1B6BA 2OOTA 3T8WA 1YLEA 3ZJ0A 3FF3A 2PJ8A 3PP9A 3RNZA 5EC4A 5I0CA 1JQGA 2Z3KA 5AGEA 5I4MA 1LCPA 2B4BA 2B58A 3B35A 4I49A 2C6GA 3B3CA 4W9YA 3IWEA 2HV2A 2CNSA 4BD9A 4B10A 2CTCA 2B3VA 2ZW7A 3DGVA 4Z65A 4M6IA 1CP6A 1QQ9A 4F6AA 5K8NA 3LODA 1Y7EA 2ZW5A 5CNPA 2F8HA 4MFQA 2J8MA 4R3KA 2IJZA 2XEJA 2BSWA 2ZEFA 2QMLA 5F49A 1YW6A 3GYAA 4FWUA 3SI2A 2QECA 2OU2A 1WK4A 1ZO0A 2OB0A 2VQYA 1HDUA 4GS4A 3QB8A 4UWJA 4TNUA 4A94A 5IX3A 4OMEA 3PB6X 4P4DA 3S6KA 2DXQA 3S9LA 3L2NA 2B4DB 1PCAA 4IHMA 2ATRA 4WWVA 3R9FA 4QBJA 4XPDB 2H5MA 2VXKA 3DSBA 3MRUA 4KS9A 4OIDA 1Y0RA 1Q2DA 2WUUA 1RXTA 3FB3A 3TOBA 3F5BA 2G3AA 3IC1A 4NEXA 4NF1A 5JPHA 4DYOA 3WABA 1X10A 4L89A 3ZZIA 3FJUA 3SJEA 2V8DA 4CAVA 1BAVA 5A27A 1MJAA 3IWWA 4MHNA 2R8VA 2B4DA 3B3VA 3PBEA 4NJQA 5LYDA 3NH8A 3R9EA 4C7HA 1VIXA 2P0WA 2ZOGA 4A2ZA 2AFUA 3SJXA 1Z4RA 1CP7A 4M6HA 5AG5A 2JDDA 2V77A 4LX9A 4ZY2A 1MJ9A 4LUAA 1ON0A 1IU8A 3D4UA 4MFZA 4ONWA 4ZX9A 5F47A 1IICA 2EK8A 1XMBA 4Y49C 5C82A 4UIBA 4FD6A 3LACA 3DDDA 2XEIA 2PQ8A 1BPMA 3EY5A 2NSMA 3SJFA 3RO0A 5D8NA 2Q04A 4R6TA 3W6XA 2BCOA 4OC1A 4UEEA 4ORFA 5J8FA 4A31A 4MY3A 1NSAA 5E96A 2NYQA 4X8IA 2PJ9A 2IL4A
chains in the Genus database with same CATH topology
5HVFA 4R7MA 1R43A 4YWYA 3D7FA 3D67A 5LYFA 2PVVA 3PB8X 3B3TA 4G1PA 3HLPA 3PRTA 4Q7AA 4KSIA 1EE3P 4OC2A 5DS0A 3CPAA 1AYEA 2VL1A 3PB7X 4P10A 1HDQA 2PJ4A 3KQXA 4YU9A 2ZOFA 4R76A 2IQ6A 4MRIA 4FBEA 1GYTA 1VHOA 5LRJA 2PJAA 4MCSA 4DJLA 1XJOA 1BLLE 1RTQA 1TXRA 4MMOA 5J1QA 3NA6A 7CPAA 1TF8A 4X2TA 3FEEA 3BXMA 4PXCA 1Y0YA 1PYTB 3DLJA 3GLJA 3V38A 5D29A 3D68A 2AFOA 3SI1A 2CIJA 3FX6A 5F09A 1OBRA 3FH4A 1TF9A 1QMUA 3B3WA 4IK2A 2IMOA 8CPAA 1UWYA 3KZWA 2PJ7A 1XRYA 3KHXA 1LOKA 2V8GA 3H8GA 1M4LA 2C6PA 1Z5RA 1ZLIA 3V7ZA 2O53A 3JRUA 1Z8LA 2PJ6A 5K8PA 2ABZA 2F7VA 2C1CA 1VGYA 3B7IA 2I3CA 1FT7A 2RB7A 3TX8A 4ZX8A 4P44A 3KL9A 2PJ3A 2ZEOA 3IO1A 2ZEHA 2QJ8A 2FVGA 4NGTA 3PBBA 2PJ5A 2PJ0A 2OR4A 2XEGA 1Z2LA 2AFWA 1CG2A 2PJ1A 3KGQA 3BI0A 4K3NA 2ZEGA 4UIAA 2BOAA 3KI9A 3VH9A 2J9AA 4TWEA 3PFOA 3ISZA 4P4IA 4P4EA 2AFSA 4EMEA 2O4HA 2Q4ZA 2PJ2A 4H2KA 4NGPA 4OC5A 4F9VA 1ZLHA 1DTDA 5LYIA 2PVWA 1TKFA 3KR4A 4P45A 5ELYA 2QYVA 3QNVA 1FNOA 4F8ZA 3BHXA 3WC5A 1LFWA 1XBUA 3WC7A 2V8HA 3IFEA 3RAMA 1YMEA 2XEFA 2ZELA 1IGBA 4B6ZA 2CTBA 3TC8A 1F2PA 2BO9A 4A37A 4RUHA 4ZY1A 1ARLA 4MCPA 4NGSA 2PRQA 3FVLA 3K9TA 5CBMA 3H8EA 2ZEPA 1ARMA 3D66A 4R8FA 1YLOA 4PQAA 4F9UA 3WT4A 4OC4A 2DEAA 4P6YA 4CPAA 3RZAA 3PFEA 3GB0A 1KWMA 4OKOA 3WC6A 1VHEA 3FECA 1CPXA 4P4JA 3KR5A 3S9NA 4IAVA 4NGRA 1LANA 4A39A 1HEEA 4EFDA 4ZYQA 1LAMA 6CPAA 3D7GA 4OC0A 2PIZA 3B2YA 5CPAA 4MCRA 3IIBA 3K2KA 5HVGA 1LAPA 2POKA 1F2OA 3NH4A 4UEFA 4OC3A 2ANPA 2AFMA 2GLFA 2JEWA 4A38A 3RBUA 3VATA 3NFZA 2HC9A 2ZEEA 4JYWA 1DE4C 2ZEMA 1YSJA 4PXDA 4EWTA 2GU2A 2PE3A 3I1UA 4MHYA 4NJRA 4OP4A 4AXVA 5K8OA 4NGQA 1TKHA 4MXUA 2EK9A 1Q7LA 3PB9X 3S9MA 3LWUA 3CDXA 1F57A 3D7HA 4FUUA 3CPXA 2RFHA 3N5FA 5JGFA 2PJCA 4DUKA 3KHZA 2WZNA 5JM6A 5K8MA 1XFOA 1H8LA 3IJ3A 4FAIA 5HXDA 2Q51A 1BPNA 2WYRA 1TKJA 3SJGA 3PEIA 1R3NA 2ZEDA 3B3SA 2PCUA 2AFZA 3KQZA 1AMPA 4GM5A 4X3RA 3MN8A 5JH9A 1IY7A 4P4BA 1ZG7A 4UEZA 1ELLP 4NGMA 4ZY0A 4P4FA 3IEHA 4PPZA 2QVPA 2AFXA 1CPSA 2GLJA 3NH5A 3D7DA 4UF4A 4NFRA 4MHPA 3FMCA 4JZ0A 2V8VA 4PXBA 3FEDA 2HB6A 5LYLA 3BI1A 4NGNA 3PB4X 1ZG9A 4MCQA 4LQGA 1CX8A 3H8FA 1ZG8A 5IB9A 2JBJA 4MHZA 3VARA 4PXEA 2EWBA 2Q43A 2G9DA 3CT9A 2C6CA 1ELMP 3HUVA 5LRKA 4OIWA 2JBKA 4ZI6A 2GREA 1YW4A 5LRGA 5THWA 3KASA 4WJBA 3ISXA 2PJBA 3GUXA 3SI0A 1CBXA 2ZENA 2PIYA 4O23A 5HVHA 2CF4A 3LMSA 2OOTA 3T8WA 3FF3A 2PJ8A 1JQGA 5I4MA 1LCPA 3B35A 2C6GA 3B3CA 4W9YA 4BD9A 2CTCA 3DGVA 4Z65A 1CP6A 1QQ9A 5K8NA 1Y7EA 2F8HA 2IJZA 2XEJA 2ZEFA 1YW6A 4FWUA 3SI2A 1HDUA 4TNUA 4A94A 4OMEA 3PB6X 4P4DA 3S9LA 3L2NA 1PCAA 4IHMA 4WWVA 3MRUA 4OIDA 1Y0RA 3IC1A 4DYOA 3WABA 3FJUA 3SJEA 2V8DA 1BAVA 3IWWA 4MHNA 3B3VA 3PBEA 4NJQA 5LYDA 3NH8A 1VIXA 2ZOGA 2AFUA 3SJXA 1CP7A 4ZY2A 2V77A 4ONWA 3D4UA 4ZX9A 2EK8A 1XMBA 4UIBA 2XEIA 1BPMA 3SJFA 2NSMA 5D8NA 4R6TA 2BCOA 4OC1A 4UEEA 1NSAA 2NYQA 4X8IA 2PJ9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HVF A;  4R7M A;  1R43 A;  4YWY A;  3D7F A;  3D67 A;  5LYF A;  2PVV A;  3PB8 X;  3B3T A;  4G1P A;  3HLP A;  3PRT A;  4Q7A A;  4KSI A;  1EE3 P;  4OC2 A;  5DS0 A;  3CPA A;  1AYE A;  2VL1 A;  3PB7 X;  4P10 A;  1HDQ A;  2PJ4 A;  3KQX A;  4YU9 A;  2ZOF A;  4R76 A;  2IQ6 A;  4MRI A;  4FBE A;  1GYT A;  1VHO A;  5LRJ A;  2PJA A;  4MCS A;  4DJL A;  1XJO A;  1BLL E;  1RTQ A;  1TXR A;  4MMO A;  5J1Q A;  3NA6 A;  7CPA A;  1TF8 A;  4X2T A;  3FEE A;  3BXM A;  4PXC A;  1Y0Y A;  1PYT B;  3DLJ A;  3GLJ A;  3V38 A;  5D29 A;  3D68 A;  2AFO A;  3SI1 A;  2CIJ A;  3FX6 A;  5F09 A;  1OBR A;  3FH4 A;  1TF9 A;  1QMU A;  3B3W A;  4IK2 A;  2IMO A;  8CPA A;  1UWY A;  3KZW A;  2PJ7 A;  1XRY A;  3KHX A;  1LOK A;  2V8G A;  3H8G A;  1M4L A;  2C6P A;  1Z5R A;  1ZLI A;  3V7Z A;  2O53 A;  3JRU A;  1Z8L A;  2PJ6 A;  5K8P A;  2ABZ A;  2F7V A;  2C1C A;  1VGY A;  3B7I A;  2I3C A;  1FT7 A;  2RB7 A;  3TX8 A;  4ZX8 A;  4P44 A;  3KL9 A;  2PJ3 A;  2ZEO A;  3IO1 A;  2ZEH A;  2QJ8 A;  2FVG A;  4NGT A;  3PBB A;  2PJ5 A;  2PJ0 A;  2OR4 A;  2XEG A;  1Z2L A;  2AFW A;  1CG2 A;  2PJ1 A;  3KGQ A;  3BI0 A;  4K3N A;  2ZEG A;  4UIA A;  2BOA A;  3KI9 A;  3VH9 A;  2J9A A;  4TWE A;  3PFO A;  3ISZ A;  4P4I A;  4P4E A;  2AFS A;  4EME A;  2O4H A;  2Q4Z A;  2PJ2 A;  4H2K A;  4NGP A;  4OC5 A;  4F9V A;  1ZLH A;  1DTD A;  5LYI A;  2PVW A;  1TKF A;  3KR4 A;  4P45 A;  5ELY A;  2QYV A;  3QNV A;  1FNO A;  4F8Z A;  3BHX A;  3WC5 A;  1LFW A;  1XBU A;  3WC7 A;  2V8H A;  3IFE A;  3RAM A;  1YME A;  2XEF A;  2ZEL A;  1IGB A;  4B6Z A;  2CTB A;  3TC8 A;  1F2P A;  2BO9 A;  4A37 A;  4RUH A;  4ZY1 A;  1ARL A;  4MCP A;  4NGS A;  2PRQ A;  3FVL A;  3K9T A;  5CBM A;  3H8E A;  2ZEP A;  1ARM A;  3D66 A;  4R8F A;  1YLO A;  4PQA A;  4F9U A;  3WT4 A;  4OC4 A;  2DEA A;  4P6Y A;  4CPA A;  3RZA A;  3PFE A;  3GB0 A;  1KWM A;  4OKO A;  3WC6 A;  1VHE A;  3FEC A;  1CPX A;  4P4J A;  3KR5 A;  3S9N A;  4IAV A;  4NGR A;  1LAN A;  4A39 A;  1HEE A;  4EFD A;  4ZYQ A;  1LAM A;  6CPA A;  3D7G A;  4OC0 A;  2PIZ A;  3B2Y A;  5CPA A;  4MCR A;  3IIB A;  3K2K A;  5HVG A;  1LAP A;  2POK A;  1F2O A;  3NH4 A;  4UEF A;  4OC3 A;  2ANP A;  2AFM A;  2GLF A;  2JEW A;  4A38 A;  3RBU A;  3VAT A;  3NFZ A;  2HC9 A;  2ZEE A;  4JYW A;  1DE4 C;  2ZEM A;  1YSJ A;  4PXD A;  4EWT A;  2GU2 A;  2PE3 A;  3I1U A;  4MHY A;  4NJR A;  4OP4 A;  4AXV A;  5K8O A;  4NGQ A;  1TKH A;  4MXU A;  2EK9 A;  1Q7L A;  3PB9 X;  3S9M A;  3LWU A;  3CDX A;  1F57 A;  3D7H A;  4FUU A;  3CPX A;  2RFH A;  3N5F A;  5JGF A;  2PJC A;  4DUK A;  3KHZ A;  2WZN A;  5JM6 A;  5K8M A;  1XFO A;  1H8L A;  3IJ3 A;  4FAI A;  5HXD A;  2Q51 A;  1BPN A;  2WYR A;  1TKJ A;  3SJG A;  3PEI A;  1R3N A;  2ZED A;  3B3S A;  2PCU A;  2AFZ A;  3KQZ A;  1AMP A;  4GM5 A;  4X3R A;  3MN8 A;  5JH9 A;  1IY7 A;  4P4B A;  1ZG7 A;  4UEZ A;  1ELL P;  4NGM A;  4ZY0 A;  4P4F A;  3IEH A;  4PPZ A;  2QVP A;  2AFX A;  1CPS A;  2GLJ A;  3NH5 A;  3D7D A;  4UF4 A;  4NFR A;  4MHP A;  3FMC A;  4JZ0 A;  2V8V A;  4PXB A;  3FED A;  2HB6 A;  5LYL A;  3BI1 A;  4NGN A;  3PB4 X;  1ZG9 A;  4MCQ A;  4LQG A;  1CX8 A;  3H8F A;  1ZG8 A;  5IB9 A;  2JBJ A;  4MHZ A;  3VAR A;  4PXE A;  2EWB A;  2Q43 A;  2G9D A;  3CT9 A;  2C6C A;  1ELM P;  3HUV A;  5LRK A;  4OIW A;  2JBK A;  4ZI6 A;  2GRE A;  1YW4 A;  5LRG A;  5THW A;  3KAS A;  4WJB A;  3ISX A;  2PJB A;  3GUX A;  3SI0 A;  1CBX A;  2ZEN A;  2PIY A;  4O23 A;  5HVH A;  2CF4 A;  3LMS A;  2OOT A;  3T8W A;  3FF3 A;  2PJ8 A;  1JQG A;  5I4M A;  1LCP A;  3B35 A;  2C6G A;  3B3C A;  4W9Y A;  4BD9 A;  2CTC A;  3DGV A;  4Z65 A;  1CP6 A;  1QQ9 A;  5K8N A;  1Y7E A;  2F8H A;  2IJZ A;  2XEJ A;  2ZEF A;  1YW6 A;  4FWU A;  3SI2 A;  1HDU A;  4TNU A;  4A94 A;  4OME A;  3PB6 X;  4P4D A;  3S9L A;  3L2N A;  1PCA A;  4IHM A;  4WWV A;  3MRU A;  4OID A;  1Y0R A;  3IC1 A;  4DYO A;  3WAB A;  3FJU A;  3SJE A;  2V8D A;  1BAV A;  3IWW A;  4MHN A;  3B3V A;  3PBE A;  4NJQ A;  5LYD A;  3NH8 A;  1VIX A;  2ZOG A;  2AFU A;  3SJX A;  1CP7 A;  4ZY2 A;  2V77 A;  4ONW A;  3D4U A;  4ZX9 A;  2EK8 A;  1XMB A;  4UIB A;  2XEI A;  1BPM A;  3SJF A;  2NSM A;  5D8N A;  4R6T A;  2BCO A;  4OC1 A;  4UEE A;  1NSA A;  2NYQ A;  4X8I A;  2PJ9 A; 
#chains in the Genus database with same CATH topology
 5HVF A;  2BUE A;  4R7M A;  4AG9 A;  1R43 A;  1YGH A;  2Z3L A;  2Q7B A;  4YWY A;  2JLM A;  5JQ4 A;  4CGO A;  1XOV A;  3D7F A;  3R95 A;  3D67 A;  4MBU A;  4A95 A;  2JDC A;  4BBH A;  5LYF A;  4M6G A;  2PVV A;  3PB8 X;  3B3T A;  4JXQ A;  4G1P A;  4MHD A;  3HLP A;  3PRT A;  4Q7A A;  4C2Z A;  1QSM A;  4KSI A;  1EE3 P;  4OC2 A;  5DS0 A;  3TT2 A;  4RI1 A;  3CPA A;  4M85 A;  2QIR A;  1A2Z A;  2GE3 A;  1AYE A;  1YVK A;  4NSQ A;  2EUI A;  2VL1 A;  4H89 A;  3PB7 X;  1AUG A;  2CNM A;  4P10 A;  1HDQ A;  4AG7 A;  4BMH A;  3F8K A;  3TCV A;  5C88 A;  2PJ4 A;  3KQX A;  4YU9 A;  2ZOF A;  1JWQ A;  4KOS A;  4R76 A;  2Z0Z A;  1Y7R A;  1YRE A;  2IQ6 A;  1XMT A;  4KUB A;  4MRI A;  4FBE A;  4CS0 B;  3R96 A;  2AJ6 A;  3D2P A;  1GYT A;  3I3G A;  2P6G A;  1I21 A;  4L8A A;  3GIU A;  2CXA A;  1B87 A;  1Z9U A;  1VHO A;  2FS5 A;  5LRJ A;  2PJA A;  5ISV A;  2B3U A;  4MCS A;  3A9L A;  4DJL A;  1Z4E A;  1MJB A;  3SXO A;  3NE8 A;  4CYN A;  1BLL E;  1XJO A;  4PK3 A;  1RTQ A;  1TXR A;  4MMO A;  2Y0M A;  5J1Q A;  1IOF A;  3NA6 A;  5DWM A;  1J4J A;  1XF8 A;  7CPA A;  1TF8 A;  4X2T A;  4H6U A;  3FEE A;  3BXM A;  3JVN A;  3R1K A;  4PXC A;  2OZG A;  1Y0Y A;  4MFK A;  4E0A A;  1PYT B;  3DLJ A;  3GLJ A;  2ZXV A;  2Q0Y A;  1I12 A;  3CZX A;  2Z10 A;  1PUA A;  3V38 A;  4XPK A;  5D29 A;  3UY5 A;  5KTA A;  3D68 A;  4R9M A;  2AFO A;  4R87 A;  4OAE A;  3SI1 A;  2CIJ A;  3FX6 A;  4KOY A;  4Y49 B;  3S6F A;  1OBR A;  3FH4 A;  1TF9 A;  1QMU A;  3TTH A;  4ZGY B;  5F09 A;  3B3W A;  1P0H A;  2IMO A;  3DNS A;  4IK2 A;  8CPA A;  4FD7 A;  5KTD A;  1UWY A;  2REF A;  3KZW A;  2I79 A;  2PJ7 A;  5KTC A;  1XRY A;  3KHX A;  1LOK A;  1Y9K A;  3EO4 A;  2V8G A;  4KVX A;  5EMI A;  3H8G A;  1M4G A;  2JEV A;  5G22 A;  5G1Z A;  1M4L A;  2C6P A;  1SQH A;  1Z5R A;  4KUA A;  1ZLI A;  3V7Z A;  1YK3 A;  2O53 A;  3GKR A;  2P6F A;  3JRU A;  1Z8L A;  2PJ6 A;  2Q7S A;  5K8P A;  3N7Z A;  5EBV A;  4UFW A;  2ABZ A;  2F7V A;  2C1C A;  4KVO E;  2EO8 A;  2KCW A;  3IGR A;  4LQ6 A;  4RS2 A;  2RC4 A;  4X5K A;  2FXF A;  1VGY A;  4XNH C;  4PSW A;  1K4J A;  1M4D A;  1Q2Y A;  3IU1 A;  3B7I A;  2VI7 A;  2I3C A;  1FT7 A;  2RB7 A;  1S60 A;  3DR8 A;  1UFH A;  5DWN A;  3TX8 A;  4IUS A;  4ZX8 A;  4CYQ A;  4U5Y A;  4Q38 A;  3B8G A;  1XE4 A;  4CGP A;  5IB0 A;  1X12 A;  3P2H A;  1CJW A;  4P44 A;  2ODF A;  3T9Y A;  4ZBG A;  1QST A;  3KL9 A;  2PJ3 A;  3BLN A;  4BIN A;  2O28 A;  2DF5 A;  2ZEO A;  3IO1 A;  2ZEH A;  3LD2 A;  2CY2 A;  2QJ8 A;  2FVG A;  2WPX A;  2PR8 A;  4PK2 A;  1NSL A;  3K9U A;  1S5K A;  4NGT A;  4UCP A;  3PBB A;  2PSW A;  2PJ5 A;  3CXP A;  2PJ0 A;  2OR4 A;  2ARH A;  2XEG A;  1PU9 A;  1IID A;  1VKC A;  1Z2L A;  2AFW A;  3D3S A;  1IYK A;  1CG2 A;  1BO4 A;  1NE9 A;  3H5Z A;  2PJ1 A;  5HMN A;  2VZZ A;  3KGQ A;  4KOR A;  1LRZ A;  4FD5 A;  1Z8X A;  3BI0 A;  3VWD A;  4K3N A;  1V0C A;  2ZEG A;  4KOX A;  4OAD A;  4UIA A;  2BOA A;  4EVY A;  3F0A A;  3KI9 A;  3VH9 A;  2J9A A;  4TWE A;  4QB9 A;  1YR0 A;  3PFO A;  3ISZ A;  4P4I A;  3CXQ A;  4UCN A;  4P4E A;  2AFS A;  4EME A;  2O4H A;  2Q4Z A;  1S7L A;  4C2Y A;  2PJ2 A;  4H2K A;  4NGP A;  4OC5 A;  4F9V A;  1ZLH A;  1DTD A;  5LYI A;  2PVW A;  1TKF A;  3KR4 A;  4QC6 A;  4U9Z A;  4P45 A;  3KKW A;  5ELY A;  1QSO A;  2QYV A;  4CGM A;  3QNV A;  1FNO A;  4B13 A;  3BHX A;  4F8Z A;  3WC5 A;  3W91 A;  1LFW A;  1XBU A;  4HPS A;  3G8W A;  1XIX A;  3WC7 A;  4CAF A;  4E2A A;  4PSX A;  2V8H A;  1Q2C A;  1Y9W A;  2GAN A;  2EBJ A;  1M4I A;  4IF5 A;  3IFE A;  4CAW A;  3EXN A;  3RAM A;  1YME A;  2XEF A;  4MY0 A;  2ZEL A;  1TIQ A;  1IGB A;  4XNH B;  4B6Z A;  2CTB A;  3TC8 A;  2G3T A;  1CM0 A;  2BEI A;  2D4P A;  2G0B A;  3H4Q A;  2DPS A;  4OLL A;  1IB1 E;  1F2P A;  1N71 A;  2BO9 A;  4A37 A;  2Z3P A;  1XEB A;  3QAY A;  4RUH A;  2OH1 A;  3S6H A;  2WPW A;  1ARL A;  4MCP A;  4NGS A;  4ZY1 A;  2PRQ A;  2EVN A;  2B5G A;  3FVL A;  3K9T A;  4DNC A;  5CBM A;  3E0K A;  2CNT A;  3TFY A;  2REE A;  1QSN A;  3H8E A;  2ZEP A;  2ZW4 A;  4JWP A;  3QAH A;  1ARM A;  3D66 A;  4R8F A;  4CRY B;  1YLO A;  4YGO A;  1S3Z A;  3G3S A;  4PQA A;  2YGW A;  4CGN A;  4F9U A;  3WT4 A;  4OC4 A;  5AG7 A;  1RO5 A;  2A4N A;  1YQE A;  2DEA A;  4UWI A;  4F0X A;  4PV6 A;  4P6Y A;  4B11 A;  2GIV A;  4U9Y A;  5AG4 A;  3WR7 A;  4YFJ A;  2YNC A;  4CPA A;  4CAX A;  1OZP A;  4QVT A;  3RZA A;  3PFE A;  3GB0 A;  2YND A;  1KWM A;  4OKO A;  1Z8T A;  2FSR A;  3WC6 A;  1VHE A;  3FEC A;  1L0C A;  1S7N A;  1CPX A;  4MFJ A;  4P4J A;  3KR5 A;  5FVJ A;  4IAV A;  5H84 A;  4C7I A;  3S9N A;  2Q44 A;  1FY7 A;  4JXR A;  2I00 A;  1NMT A;  5G20 A;  4NGR A;  1LAN A;  4AVB A;  3W6S A;  4A39 A;  1HEE A;  4EFD A;  4ZYQ A;  4A30 A;  1IOI A;  1LAM A;  4KLV A;  6CPA A;  4B5P B;  3FBU A;  3D7G A;  4OC0 A;  3PGP A;  2F5I A;  2PIZ A;  3B2Y A;  3GY9 A;  5CPA A;  4MCR A;  4KOW A;  3IIB A;  4M3S A;  3K2K A;  5HVG A;  1LAP A;  2POK A;  1F2O A;  3NH4 A;  2FL4 A;  4UCM A;  4UEF A;  2J8N A;  2K5T A;  4OC3 A;  2ANP A;  2AFM A;  3MGD A;  4B12 A;  4B5P A;  2GLF A;  2JEW A;  5BWA B;  4KOU A;  4JLY A;  4A38 A;  2YNC C;  3RBU A;  1GHE A;  4H6Z A;  3VAT A;  2Z3M A;  3NFZ A;  4MFP A;  2HC9 A;  5J8C A;  3V8I A;  2ZEE A;  3FIX A;  3JTK A;  4JYW A;  1DE4 C;  1KUX A;  2VBQ A;  2ZEM A;  1YSJ A;  2ZW6 A;  4HKF A;  2GU2 A;  2PE3 A;  2R7H A;  3I1U A;  4NCZ A;  4PXD A;  4EWT A;  4MHY A;  4II9 A;  4RN7 A;  4NJR A;  5H86 A;  3RYO A;  2FCK A;  4OP4 A;  4AXV A;  4MI4 A;  5K8O A;  2HQY A;  4NGQ A;  3NE7 A;  1TKH A;  1P4N A;  1MK4 A;  2AE6 A;  4MXU A;  3IU2 A;  2EK9 A;  1Q7L A;  3PB9 X;  3S9M A;  3VWE A;  1KZF A;  3SHP A;  3LWU A;  2YNE A;  1WWZ A;  4B14 A;  4UFV A;  4HNW B;  2PR1 A;  3CDX A;  3FYN A;  3FXT A;  4CYP A;  1F57 A;  3D7H A;  3OWC A;  4FUU A;  2C27 A;  3CPX A;  2RFH A;  3N5F A;  3TOA A;  4CAE A;  5JGF A;  2PJC A;  4K30 A;  2HUZ A;  4CYO A;  3TO9 A;  4UBR A;  2PDO A;  4DUK A;  5A28 A;  3BJ7 A;  3KHZ A;  2WZN A;  5F46 A;  5JM6 A;  5GCN A;  5K8M A;  5F48 A;  3FNC A;  1M1D A;  2FT0 A;  4Q36 A;  1XFO A;  1H8L A;  2R1I A;  3C26 A;  3IJ3 A;  4NXY A;  4FAI A;  5HXD A;  2Q51 A;  1BPN A;  3SXN A;  2OZH A;  2P6E A;  2WYR A;  4AVC A;  4B5O A;  1TKJ A;  3SJG A;  2VEZ A;  3PEI A;  4C68 A;  2GFQ A;  3D2M A;  1VHS A;  1R3N A;  2ZED A;  2PC1 A;  4CRZ B;  4QUS A;  3B3S A;  2PCU A;  2AFZ A;  3JUW A;  1AMP A;  3KQZ A;  4GM5 A;  3S6G A;  4X3R A;  3MN8 A;  4HNX B;  2OZU A;  4UFX A;  4XPL A;  5JH9 A;  1S7K A;  1IY7 A;  1IYL A;  4P4B A;  2DPT A;  1ZG7 A;  1M44 A;  4UEZ A;  1ELL P;  4NGM A;  2B5G B;  2FIA A;  3TO7 A;  1YVO A;  4ZY0 A;  1KUY A;  4P4F A;  2R98 A;  3IEH A;  4PPZ A;  2QVP A;  4YRH A;  4R3L A;  2AFX A;  3PZJ A;  1CPS A;  2GLJ A;  3NH5 A;  3D7D A;  4KSF A;  2Q4V A;  4UF4 A;  4NFR A;  4C2X A;  2ZPA A;  4KLW A;  2VZY A;  4MHP A;  3FMC A;  5HH1 A;  4JZ0 A;  2V8V A;  4PXB A;  4XPD C;  1S7F A;  4KOV A;  1YX0 A;  4A32 A;  4J3G A;  1KUV A;  3EC4 A;  4MFL A;  3FED A;  3FRM A;  3TE4 A;  4F0Y A;  2PRB A;  3IWG A;  2HB6 A;  4R57 A;  5LYL A;  1BOB A;  1U6M A;  3BI1 A;  4NGN A;  2D4O A;  3PB4 X;  2WSA A;  1ZG9 A;  4MCQ A;  3D8P A;  4LQG A;  3CXS A;  1CX8 A;  1ZG8 A;  3H8F A;  4KVM E;  4JD6 A;  5IB9 A;  2JBJ A;  4HNY B;  4MHZ A;  3VAR A;  4PXE A;  4E8O A;  4UA3 A;  2EWB A;  3T90 A;  2Q43 A;  2G9D A;  3CT9 A;  4AVA A;  4JJX A;  2BL1 A;  1I1D A;  2C6C A;  2Z3N A;  4KOT A;  1ELM P;  2FE7 A;  3HUV A;  2Z3O A;  5LRK A;  4GXH A;  4OIW A;  2JBK A;  5AG6 A;  2GRE A;  4ZI6 A;  1YW4 A;  5LRG A;  3I9S A;  4FD4 A;  3EFA A;  4MJ8 A;  5THW A;  2X7B A;  2J8R A;  2FIW A;  3KAS A;  1R57 A;  4WJB A;  2Q4Y A;  4A33 A;  3ISX A;  3R9G A;  2PJB A;  2Z11 A;  1Z8W A;  2NMT A;  4AB7 A;  5G21 A;  1QSR A;  3GUX A;  3SI0 A;  4KZT A;  4ONU A;  1CBX A;  2ZEN A;  3DR6 A;  4KSA A;  2PIY A;  3TO6 A;  3BJ8 A;  4CGL A;  4O23 A;  3P2F A;  5HVH A;  5IV0 A;  2CF4 A;  3LMS A;  1B6B A;  2OOT A;  3T8W A;  1YLE A;  3ZJ0 A;  3FF3 A;  2PJ8 A;  3PP9 A;  3RNZ A;  5EC4 A;  5I0C A;  1JQG A;  2Z3K A;  5AGE A;  5I4M A;  1LCP A;  2B4B A;  2B58 A;  3B35 A;  4I49 A;  2C6G A;  3B3C A;  4W9Y A;  3IWE A;  2HV2 A;  2CNS A;  4BD9 A;  4B10 A;  2CTC A;  2B3V A;  2ZW7 A;  3DGV A;  4Z65 A;  4M6I A;  1CP6 A;  1QQ9 A;  4F6A A;  5K8N A;  3LOD A;  1Y7E A;  2ZW5 A;  5CNP A;  2F8H A;  4MFQ A;  2J8M A;  4R3K A;  2IJZ A;  2XEJ A;  2BSW A;  2ZEF A;  2QML A;  5F49 A;  1YW6 A;  3GYA A;  4FWU A;  3SI2 A;  2QEC A;  2OU2 A;  1WK4 A;  1ZO0 A;  2OB0 A;  2VQY A;  1HDU A;  4GS4 A;  3QB8 A;  4UWJ A;  4TNU A;  4A94 A;  5IX3 A;  4OME A;  3PB6 X;  4P4D A;  3S6K A;  2DXQ A;  3S9L A;  3L2N A;  2B4D B;  1PCA A;  4IHM A;  2ATR A;  4WWV A;  3R9F A;  4QBJ A;  4XPD B;  2H5M A;  2VXK A;  3DSB A;  3MRU A;  4KS9 A;  4OID A;  1Y0R A;  1Q2D A;  2WUU A;  1RXT A;  3FB3 A;  3TOB A;  3F5B A;  2G3A A;  3IC1 A;  4NEX A;  4NF1 A;  5JPH A;  4DYO A;  3WAB A;  1X10 A;  4L89 A;  3ZZI A;  3FJU A;  3SJE A;  2V8D A;  4CAV A;  1BAV A;  5A27 A;  1MJA A;  3IWW A;  4MHN A;  2R8V A;  2B4D A;  3B3V A;  3PBE A;  4NJQ A;  5LYD A;  3NH8 A;  3R9E A;  4C7H A;  1VIX A;  2P0W A;  2ZOG A;  4A2Z A;  2AFU A;  3SJX A;  1Z4R A;  1CP7 A;  4M6H A;  5AG5 A;  2JDD A;  2V77 A;  4LX9 A;  4ZY2 A;  1MJ9 A;  4LUA A;  1ON0 A;  1IU8 A;  3D4U A;  4MFZ A;  4ONW A;  4ZX9 A;  5F47 A;  1IIC A;  2EK8 A;  1XMB A;  4Y49 C;  5C82 A;  4UIB A;  4FD6 A;  3LAC A;  3DDD A;  2XEI A;  2PQ8 A;  1BPM A;  3EY5 A;  2NSM A;  3SJF A;  3RO0 A;  5D8N A;  2Q04 A;  4R6T A;  3W6X A;  2BCO A;  4OC1 A;  4UEE A;  4ORF A;  5J8F A;  4A31 A;  4MY3 A;  1NSA A;  5E96 A;  2NYQ A;  4X8I A;  2PJ9 A;  2IL4 A; 
#chains in the Genus database with same CATH homology
 5HVF A;  4R7M A;  1R43 A;  4YWY A;  3D7F A;  3D67 A;  5LYF A;  2PVV A;  3PB8 X;  3B3T A;  4G1P A;  3HLP A;  3PRT A;  4Q7A A;  4KSI A;  1EE3 P;  4OC2 A;  5DS0 A;  3CPA A;  1AYE A;  2VL1 A;  3PB7 X;  4P10 A;  1HDQ A;  2PJ4 A;  3KQX A;  4YU9 A;  2ZOF A;  4R76 A;  2IQ6 A;  4MRI A;  4FBE A;  1GYT A;  1VHO A;  5LRJ A;  2PJA A;  4MCS A;  4DJL A;  1XJO A;  1BLL E;  1RTQ A;  1TXR A;  4MMO A;  5J1Q A;  3NA6 A;  7CPA A;  1TF8 A;  4X2T A;  3FEE A;  3BXM A;  4PXC A;  1Y0Y A;  1PYT B;  3DLJ A;  3GLJ A;  3V38 A;  5D29 A;  3D68 A;  2AFO A;  3SI1 A;  2CIJ A;  3FX6 A;  5F09 A;  1OBR A;  3FH4 A;  1TF9 A;  1QMU A;  3B3W A;  4IK2 A;  2IMO A;  8CPA A;  1UWY A;  3KZW A;  2PJ7 A;  1XRY A;  3KHX A;  1LOK A;  2V8G A;  3H8G A;  1M4L A;  2C6P A;  1Z5R A;  1ZLI A;  3V7Z A;  2O53 A;  3JRU A;  1Z8L A;  2PJ6 A;  5K8P A;  2ABZ A;  2F7V A;  2C1C A;  1VGY A;  3B7I A;  2I3C A;  1FT7 A;  2RB7 A;  3TX8 A;  4ZX8 A;  4P44 A;  3KL9 A;  2PJ3 A;  2ZEO A;  3IO1 A;  2ZEH A;  2QJ8 A;  2FVG A;  4NGT A;  3PBB A;  2PJ5 A;  2PJ0 A;  2OR4 A;  2XEG A;  1Z2L A;  2AFW A;  1CG2 A;  2PJ1 A;  3KGQ A;  3BI0 A;  4K3N A;  2ZEG A;  4UIA A;  2BOA A;  3KI9 A;  3VH9 A;  2J9A A;  4TWE A;  3PFO A;  3ISZ A;  4P4I A;  4P4E A;  2AFS A;  4EME A;  2O4H A;  2Q4Z A;  2PJ2 A;  4H2K A;  4NGP A;  4OC5 A;  4F9V A;  1ZLH A;  1DTD A;  5LYI A;  2PVW A;  1TKF A;  3KR4 A;  4P45 A;  5ELY A;  2QYV A;  3QNV A;  1FNO A;  4F8Z A;  3BHX A;  3WC5 A;  1LFW A;  1XBU A;  3WC7 A;  2V8H A;  3IFE A;  3RAM A;  1YME A;  2XEF A;  2ZEL A;  1IGB A;  4B6Z A;  2CTB A;  3TC8 A;  1F2P A;  2BO9 A;  4A37 A;  4RUH A;  4ZY1 A;  1ARL A;  4MCP A;  4NGS A;  2PRQ A;  3FVL A;  3K9T A;  5CBM A;  3H8E A;  2ZEP A;  1ARM A;  3D66 A;  4R8F A;  1YLO A;  4PQA A;  4F9U A;  3WT4 A;  4OC4 A;  2DEA A;  4P6Y A;  4CPA A;  3RZA A;  3PFE A;  3GB0 A;  1KWM A;  4OKO A;  3WC6 A;  1VHE A;  3FEC A;  1CPX A;  4P4J A;  3KR5 A;  3S9N A;  4IAV A;  4NGR A;  1LAN A;  4A39 A;  1HEE A;  4EFD A;  4ZYQ A;  1LAM A;  6CPA A;  3D7G A;  4OC0 A;  2PIZ A;  3B2Y A;  5CPA A;  4MCR A;  3IIB A;  3K2K A;  5HVG A;  1LAP A;  2POK A;  1F2O A;  3NH4 A;  4UEF A;  4OC3 A;  2ANP A;  2AFM A;  2GLF A;  2JEW A;  4A38 A;  3RBU A;  3VAT A;  3NFZ A;  2HC9 A;  2ZEE A;  4JYW A;  1DE4 C;  2ZEM A;  1YSJ A;  4PXD A;  4EWT A;  2GU2 A;  2PE3 A;  3I1U A;  4MHY A;  4NJR A;  4OP4 A;  4AXV A;  5K8O A;  4NGQ A;  1TKH A;  4MXU A;  2EK9 A;  1Q7L A;  3PB9 X;  3S9M A;  3LWU A;  3CDX A;  1F57 A;  3D7H A;  4FUU A;  3CPX A;  2RFH A;  3N5F A;  5JGF A;  2PJC A;  4DUK A;  3KHZ A;  2WZN A;  5JM6 A;  5K8M A;  1XFO A;  1H8L A;  3IJ3 A;  4FAI A;  5HXD A;  2Q51 A;  1BPN A;  2WYR A;  1TKJ A;  3SJG A;  3PEI A;  1R3N A;  2ZED A;  3B3S A;  2PCU A;  2AFZ A;  3KQZ A;  1AMP A;  4GM5 A;  4X3R A;  3MN8 A;  5JH9 A;  1IY7 A;  4P4B A;  1ZG7 A;  4UEZ A;  1ELL P;  4NGM A;  4ZY0 A;  4P4F A;  3IEH A;  4PPZ A;  2QVP A;  2AFX A;  1CPS A;  2GLJ A;  3NH5 A;  3D7D A;  4UF4 A;  4NFR A;  4MHP A;  3FMC A;  4JZ0 A;  2V8V A;  4PXB A;  3FED A;  2HB6 A;  5LYL A;  3BI1 A;  4NGN A;  3PB4 X;  1ZG9 A;  4MCQ A;  4LQG A;  1CX8 A;  3H8F A;  1ZG8 A;  5IB9 A;  2JBJ A;  4MHZ A;  3VAR A;  4PXE A;  2EWB A;  2Q43 A;  2G9D A;  3CT9 A;  2C6C A;  1ELM P;  3HUV A;  5LRK A;  4OIW A;  2JBK A;  4ZI6 A;  2GRE A;  1YW4 A;  5LRG A;  5THW A;  3KAS A;  4WJB A;  3ISX A;  2PJB A;  3GUX A;  3SI0 A;  1CBX A;  2ZEN A;  2PIY A;  4O23 A;  5HVH A;  2CF4 A;  3LMS A;  2OOT A;  3T8W A;  3FF3 A;  2PJ8 A;  1JQG A;  5I4M A;  1LCP A;  3B35 A;  2C6G A;  3B3C A;  4W9Y A;  4BD9 A;  2CTC A;  3DGV A;  4Z65 A;  1CP6 A;  1QQ9 A;  5K8N A;  1Y7E A;  2F8H A;  2IJZ A;  2XEJ A;  2ZEF A;  1YW6 A;  4FWU A;  3SI2 A;  1HDU A;  4TNU A;  4A94 A;  4OME A;  3PB6 X;  4P4D A;  3S9L A;  3L2N A;  1PCA A;  4IHM A;  4WWV A;  3MRU A;  4OID A;  1Y0R A;  3IC1 A;  4DYO A;  3WAB A;  3FJU A;  3SJE A;  2V8D A;  1BAV A;  3IWW A;  4MHN A;  3B3V A;  3PBE A;  4NJQ A;  5LYD A;  3NH8 A;  1VIX A;  2ZOG A;  2AFU A;  3SJX A;  1CP7 A;  4ZY2 A;  2V77 A;  4ONW A;  3D4U A;  4ZX9 A;  2EK8 A;  1XMB A;  4UIB A;  2XEI A;  1BPM A;  3SJF A;  2NSM A;  5D8N A;  4R6T A;  2BCO A;  4OC1 A;  4UEE A;  1NSA A;  2NYQ A;  4X8I A;  2PJ9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...