4MHZA

Crystal structure of apo-form glutaminyl cyclase from ixodes scapularis in complex with pbd150
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
326
structure length
325
Chain Sequence
LKWPRDLRPLAHHDLLYMGQISEDRGDFNATLRNFLVPRVVGSQKHREVREFIVRSLKDLDWDVEEDCFDGQTPHGIKPFCNVIATLNPSACHRLVLACHYDSLLHKEGTFIGATDSAVPCAQLLYLARSLNGKLQNQKTRGDGLTLQLVFFDGEEAFERWSSHDSLYGSRHLAQKWHEDRTSAERLESCLERSEIANQIDRMEVMVLLDLLGAENPRFYSYFGETQPVYRRLVNIESRLNDAGLMELPRRRRRTNYFSNSSTVGFIEDDHIPFLKRSVPIVHIIPSPFPDVWHTLDDNEQNLHHPTISNLNKIFKAFVSEYLQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Glutaminyl cyclase, putative
publication title Structural and functional analyses of a glutaminyl cyclase from Ixodes scapularis reveal metal-independent catalysis and inhibitor binding.
pubmed doi rcsb
source organism Ixodes scapularis
total genus 110
structure length 325
sequence length 326
ec nomenclature ec 2.3.2.5: Glutaminyl-peptide cyclotransferase.
pdb deposition date 2013-08-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 4mhzA00
3KASA 2ZEFA 7CPAA 3GB0A 3GLJA 3SJGA 5HXDA 1YW6A 3SI0A 4PXCA 1IGBA 4Q7AA 1F2OA 2PJCA 5I4MA 2QYVA 3DGVA 3S9MA 3FVLA 4OC4A 2O4HA 3NH4A 2PVWA 1ELLP 3D68A 1F57A 1ZG7A 4MCSA 4B6ZA 3PB7X 3KHXA 4K3NA 3FEDA 3BHXA 3H8GA 3I1UA 3D7HA 3FJUA 2PJ6A 3IJ3A 5HVHA 3FF3A 3FH4A 3KR4A 3WT4A 3VATA 3D4UA 2F8HA 3JRUA 3PBBA 4ZY0A 4NGPA 2BO9A 3D7GA 4H2KA 4OP4A 3KHZA 4IK2A 4FUUA 2PJ2A 5F09A 2ZEGA 2ZEPA 3BI0A 3CPXA 2JBKA 4KSIA 5LYDA 5LRKA 5JH9A 2POKA 8CPAA 3VH9A 4FAIA 4PXBA 3H8FA 2AFSA 1ZLIA 4ZY1A 4FWUA 4DJLA 1XBUA 4NGTA 4G1PA 4P10A 2ANPA 3D7FA 1ZG9A 2QJ8A 2ZELA 4P4EA 4UF4A 2V8HA 4UEFA 1CP6A 5LYIA 4YWYA 2AFZA 1TKHA 4P6YA 5K8MA 3IEHA 2IJZA 5LYLA 3SI1A 1TKJA 3QNVA 1Z8LA 1JQGA 1HEEA 2C6CA 4AXVA 3SJXA 3CPAA 1XMBA 4DUKA 2AFXA 2PIZA 4IAVA 4W9YA 2PJ8A 4ONWA 2OR4A 3WABA 1VHEA 3BXMA 4EWTA 3PB8X 2PJAA 3L2NA 2OOTA 4NGMA 1BAVA 3KR5A 5HVFA 1ZG8A 2ZEHA 3KL9A 1LFWA 3TC8A 4MRIA 4R76A 2GLFA 3T8WA 1BLLE 2XEFA 2CF4A 2PIYA 2O53A 2HB6A 1CP7A 3ISXA 1Q7LA 2C1CA 3WC7A 5CPAA 2PJ9A 4NJQA 3B3WA 3FEEA 3B3VA 2V8GA 4A37A 1HDQA 2NSMA 4R6TA 1PCAA 4NJRA 1Y0YA 4RUHA 3B35A 5ELYA 2IQ6A 1CX8A 2WZNA 3D7DA 3RZAA 1XJOA 4O23A 3KQXA 1FNOA 2PJ0A 4ZX9A 2PJ3A 5K8NA 1RTQA 3IC1A 1CPSA 4GM5A 2GREA 3B3TA 1H8LA 2VL1A 2G9DA 1YLOA 3S9LA 3NH5A 3BI1A 5LYFA 4F8ZA 1LANA 4EFDA 1FT7A 1HDUA 2PCUA 1VIXA 1XRYA 1Y7EA 4JZ0A 1NSAA 4MHZA 2PJ4A 3PRTA 2CIJA 5D29A 1EE3P 4PPZA 1R43A 4X3RA 1AMPA 4MMOA 4NGNA 1YMEA 3PFEA 4NGRA 5LRGA 2PJ5A 4F9UA 2XEIA 1DTDA 3RAMA 4Z65A 3CT9A 2RB7A 3NFZA 2DEAA 4NGQA 4CPAA 2Q51A 1VHOA 3PB6X 1ZLHA 2ZENA 4MCQA 3WC5A 2ZEDA 2ZEOA 1DE4C 1QQ9A 1PYTB 3PB9X 1CPXA 1Y0RA 3GUXA 1BPNA 3B7IA 3IWWA 4MHNA 2AFMA 4OIWA 3FECA 3KQZA 2F7VA 1LOKA 4OC3A 3MN8A 5K8PA 3KGQA 4P4BA 1TF8A 1TKFA 2BOAA 4NGSA 1Z5RA 2I3CA 5IB9A 2NYQA 5JM6A 3PEIA 3S9NA 1LCPA 2Q4ZA 4MHYA 3B2YA 2V8VA 4A38A 4OC5A 4R7MA 4WJBA 1CG2A 4TWEA 1TF9A 2CTCA 1ELMP 4P4JA 1BPMA 3TX8A 4ZY2A 6CPAA 3IO1A 2C6GA 3KZWA 3ISZA 2PJ1A 4ZYQA 4DYOA 3SI2A 2GU2A 2ZOFA 2GLJA 3MRUA 3FX6A 3NA6A 3NH8A 3LWUA 4OC0A 5J1QA 1Z2LA 4MHPA 2AFUA 1VGYA 4LQGA 4UEEA 3D67A 2JBJA 4PQAA 4FBEA 3KI9A 4ZX8A 2BCOA 2IMOA 4MCRA 3HUVA 1UWYA 4P4IA 3PBEA 4P4FA 3PFOA 4MCPA 4P44A 3RBUA 2PRQA 3V38A 3LMSA 1LAPA 2V77A 4TNUA 3PB4X 4A39A 3D66A 5JGFA 5LRJA 2C6PA 2QVPA 1KWMA 4OMEA 2PJ7A 4P4DA 2ZOGA 3IFEA 1OBRA 2EWBA 4OKOA 5HVGA 4BD9A 2V8DA 4MXUA 4EMEA 4OC2A 1M4LA 1XFOA 4OC1A 5THWA 5K8OA 1LAMA 1QMUA 3CDXA 3N5FA 2HC9A 2XEGA 3K9TA 1TXRA 2WYRA 4OIDA 2EK9A 4NFRA 3V7ZA 2PJBA 1F2PA 2ABZA 5DS0A 1AYEA 2AFWA 2Q43A 2AFOA 1GYTA 4UEZA 4WWVA 2XEJA 4PXDA 2PVVA 1YSJA 3IIBA 1IY7A 5CBMA 3VARA 3FMCA 4ZI6A 4F9VA 4R8FA 2RFHA 3H8EA 4A94A 3B3SA 2PE3A 4IHMA 2ZEMA 1ARLA 3DLJA 3SJFA 1ARMA 3WC6A 2JEWA 2J9AA 1YW4A 4PXEA 2ZEEA 3K2KA 1CBXA 2CTBA 2FVGA 4P45A 4X8IA 4UIBA 4X2TA 4YU9A 1R3NA 3SJEA 3HLPA 4UIAA 5D8NA 4JYWA 2EK8A 3B3CA
chains in the Genus database with same CATH superfamily
3KASA 4HNYB 2ZEFA 4A33A 4JWPA 4F6AA 4A30A 7CPAA 1S7FA 1X10A 2F5IA 3GB0A 5H86A 5JQ4A 3GLJA 1YVOA 2J8MA 4E2AA 2QIRA 3SJGA 1IU8A 2JDCA 5AGEA 3T9YA 5HXDA 1YW6A 3G8WA 4PXCA 1IGBA 2NMTA 3SI0A 2B5GB 4Q7AA 1F2OA 2R7HA 1WWZA 3D3SA 2JDDA 2ZW5A 1S7NA 2PJCA 1MJBA 3IWEA 1Y7RA 4AG9A 5I4MA 1PU9A 2QYVA 2C27A 3DGVA 4OADA 3ZZIA 2I00A 2Z3NA 3FVLA 3S9MA 4OC4A 2O4HA 3NH4A 2PVWA 4UCMA 1ELLP 3D68A 1F57A 2D4PA 1ZG7A 3CZXA 4KSFA 4MCSA 2OH1A 3DSBA 5F49A 4B6ZA 3DR6A 4XNHC 3PB7X 3KHXA 3W6SA 4K3NA 2P6EA 3FEDA 3BHXA 3H8GA 3I1UA 3C26A 1GHEA 3F0AA 3D7HA 1Z9UA 3FJUA 3LACA 4C2XA 2PJ6A 1S3ZA 2P0WA 3IJ3A 1IIDA 3I9SA 3GY9A 1Z8WA 5G1ZA 3R96A 1IOFA 3B3CA 4A95A 3FIXA 3FF3A 5HVHA 3FH4A 3KR4A 3WT4A 2J8RA 4PK2A 3CXSA 1IYKA 3VATA 3D4UA 4J3GA 5IB0A 2F8HA 3JRUA 3PBBA 3QAHA 4FD6A 1MJAA 4IUSA 4NGPA 4F0XA 4ZY0A 2BO9A 3EC4A 3D7GA 2WSAA 3GIUA 5AG7A 3WR7A 1L0CA 4H2KA 4OP4A 1UFHA 4RI1A 4DNCA 3KHZA 4QUSA 2PR1A 4R9MA 4IK2A 2I79A 4FUUA 2PJ2A 1NMTA 2CXAA 4M85A 5F09A 3BJ7A 4MFKA 4L8AA 4CAVA 2ZEGA 4JXRA 4GS4A 2ZEPA 1JWQA 3TCVA 3BI0A 3CPXA 2JBKA 4KSIA 5LYDA 5LRKA 3V8IA 3H5ZA 3S6GA 4C68A 2HUZA 2PC1A 5JH9A 2POKA 8CPAA 3DR8A 3VH9A 2RC4A 4FAIA 4PXBA 3H8FA 2YNCC 2AFSA 1ZLIA 2OZUA 4ZY1A 4FWUA 4DJLA 1KUVA 1XBUA 4G1PA 4NGTA 4XNHB 4MFZA 1QSTA 2Q0YA 5GCNA 3IU2A 3QAYA 4P10A 2ANPA 3D7FA 4QC6A 3I3GA 5EC4A 1ZG9A 1XOVA 2QJ8A 2ZELA 4P4EA 1ON0A 4UF4A 2V8HA 4UEFA 4B12A 3VWEA 4Q36A 1CP6A 4XPLA 3BJ8A 5LYIA 4B14A 4CRYB 3TE4A 5ISVA 2BL1A 4YWYA 2AFZA 1TKHA 3R9EA 2B5GA 2ATRA 2BEIA 4P6YA 4KVOE 4M3SA 3IEHA 5K8MA 2IJZA 5LYLA 3SI1A 1ZO0A 1CM0A 1TKJA 3QNVA 4HNXB 1Z8LA 1JQGA 2O28A 3DNSA 4JLYA 1HEEA 2C6CA 3JUWA 4KVME 5AG6A 4A31A 4AXVA 3SJXA 3CPAA 5CNPA 1XMBA 2R8VA 2AFXA 4DUKA 2PIZA 3P2HA 4IAVA 4C2ZA 2X7BA 4W9YA 2PJ8A 2Z10A 4ONWA 2OR4A 3RO0A 3WABA 2QECA 1M4GA 2Z3PA 2PRBA 1VHEA 2PSWA 3BXMA 5J8FA 4EWTA 3PB8X 2FIWA 2G3TA 2PJAA 2Z3LA 3L2NA 5HMNA 1S60A 2OOTA 1S7KA 4NGMA 1BAVA 3KR5A 5HVFA 1ZG8A 1LRZA 5IV0A 2ZEHA 1IYLA 3PZJA 4OLLA 3KL9A 5G21A 5I0CA 1LFWA 3S6KA 3TC8A 4B13A 2DF5A 2EUIA 3E0KA 5DWNA 5JPHA 4NEXA 2Z3KA 4MRIA 4R76A 2GLFA 4UFXA 3T8WA 1BLLE 4KLVA 3PP9A 2XEFA 4KS9A 4KOXA 5KTCA 2CF4A 2PIYA 2O53A 2YNEA 3NE8A 3W6XA 2HB6A 1CP7A 3ISXA 1SQHA 1Z8XA 2VQYA 1Q7LA 3ZJ0A 4AVAA 2C1CA 2A4NA 2Q04A 3MGDA 3WC7A 2CY2A 3UY5A 3FNCA 1QSRA 5CPAA 5AG5A 2PJ9A 4FD4A 4NJQA 3A9LA 3B3WA 3FEEA 2DPSA 3B3VA 3JVNA 2REEA 2WUUA 2FIAA 4B10A 5EMIA 2V8GA 4C2YA 4F0YA 4A37A 3G3SA 1HDQA 2NSMA 4KSAA 2P6GA 4R6TA 4BMHA 1PCAA 3D8PA 4NJRA 1Y0YA 4RUHA 2DXQA 3B35A 5ELYA 2IQ6A 2FCKA 2ARHA 1CX8A 2ODFA 2WZNA 5C88A 3D7DA 3RZAA 1I21A 4YRHA 3FB3A 3R95A 1XJOA 4O23A 4QVTA 1YR0A 3KQXA 4CAXA 1FNOA 2PJ0A 4ZX9A 1KZFA 4CGPA 1RXTA 2PJ3A 4IF5A 5K8NA 1YK3A 4NSQA 1RTQA 4B5PB 3IC1A 1CPSA 2ZW6A 4GM5A 2BUEA 2GREA 1QSMA 1XE4A 3B3TA 4R87A 2EO8A 4K30A 1H8LA 4GXHA 2VL1A 4C7IA 2KCWA 4CGLA 3TOBA 2G9DA 1YLOA 3S9LA 3NH5A 4NCZA 4UCNA 4YGOA 4H89A 2OB0A 2EBJA 2CNSA 3BI1A 5LYFA 2H5MA 3F8KA 1WK4A 4F8ZA 4U9ZA 4MBUA 4MFQA 1LANA 1OZPA 4EFDA 1BO4A 1FT7A 1HDUA 2PCUA 1VIXA 2GE3A 2YNDA 4NF1A 4KVXA 4M6GA 1XRYA 1Y7EA 4JZ0A 1NSAA 4MHZA 4EVYA 2Z3OA 2PJ4A 3PRTA 4KZTA 2CIJA 4KOUA 3W91A 5D29A 1EE3P 1XEBA 1YVKA 4PPZA 1M1DA 1R43A 4X3RA 1AMPA 4MMOA 4MY3A 4NGNA 4II9A 2YNCA 2ZW7A 1QSNA 4LUAA 1YMEA 2AJ6A 4BBHA 3D2PA 2VBQA 3PFEA 2JLMA 4NGRA 2PJ5A 5LRGA 4CS0B 3H4QA 4F9UA 1DTDA 2XEIA 2Z3MA 3B8GA 3LD2A 1CJWA 1S7LA 2OZGA 4R3LA 3RAMA 3CT9A 4Z65A 2RB7A 3NFZA 2DEAA 2FS5A 4KUBA 4NGQA 4PSWA 2ZW4A 4CPAA 2J8NA 1FY7A 2Q51A 1VHOA 5HH1A 3S6FA 4A2ZA 1KUYA 3R9GA 3PB6X 2FSRA 1ZLHA 4UWJA 2ZENA 4MCQA 3PGPA 3WC5A 2ZEDA 2PR8A 3SXNA 3TTHA 2ZEOA 1DE4C 4E8OA 5BWAB 3S6HA 1QQ9A 5DWMA 1PYTB 3PB9X 1CPXA 3RNZA 5C82A 4KOTA 3R9FA 2VXKA 1R57A 1Y0RA 2B3UA 2R98A 3GUXA 4MFPA 1BPNA 3B7IA 3DDDA 3IWWA 4ONUA 4R57A 4MHNA 1YX0A 2AFMA 4OIWA 3FECA 3KQZA 2F7VA 1KUXA 1LOKA 4OC3A 3MN8A 4UFVA 5K8PA 2OU2A 1I1DA 3KGQA 4P4BA 2FE7A 2G0BA 4MY0A 2D4OA 1TF8A 1QSOA 1TKFA 1YLEA 4ZGYB 4UWIA 2BOAA 4NGSA 4RN7A 4CYNA 1Z5RA 2I3CA 4JD6A 1B6BA 4I49A 2VZZA 1Q2CA 5IB9A 4AVBA 4B5PA 4UA3A 1Y9KA 1MJ9A 2NYQA 1XMTA 4CAWA 2OZHA 2Q44A 3EO4A 4AVCA 1PUAA 3TOAA 5JM6A 1M4DA 4A32A 3KKWA 3PEIA 4Y49C 3S9NA 4MJ8A 1M4IA 2G3AA 3SXOA 2ZPAA 4FD7A 1LCPA 5F46A 1I12A 2Q4ZA 4HKFA 4MHYA 4U5YA 1Q2DA 2B58A 5EBVA 1M44A 1IICA 1RO5A 2Z0ZA 4AG7A 3B2YA 2Q7SA 2V8VA 4A38A 4OC5A 4R3KA 4R7MA 4WJBA 3FRMA 1CG2A 3BLNA 3F5BA 4TWEA 1TF9A 2CTCA 1ELMP 4U9YA 4H6ZA 4PK3A 4UBRA 4B5OA 2REFA 4P4JA 1BPMA 4CAEA 3TX8A 4ZY2A 6CPAA 3IO1A 4JXQA 2C6GA 2HV2A 2WPXA 4JJXA 3KZWA 3N7ZA 3ISZA 4B11A 2FXFA 4UFWA 1K4JA 2PJ1A 4ZYQA 4CYPA 5F47A 4DYOA 3SI2A 2GU2A 2ZOFA 2Y0MA 2GLJA 3MRUA 3FX6A 2PQ8A 3NA6A 2B4DB 2Q4YA 3NH8A 3LWUA 4OC0A 4CYOA 4OAEA 5J1QA 1YGHA 1Z2LA 4MHPA 2AFUA 1N71A 2DPTA 1VGYA 4LQGA 4RS2A 4UEEA 5FVJA 3D67A 2JBJA 4PQAA 1A2ZA 4FBEA 3KI9A 3NE7A 4HPSA 1U6MA 4ZX8A 1P0HA 4KUAA 1BOBA 4Y49B 2BCOA 5G20A 2IMOA 4MCRA 4QBJA 2IL4A 3R1KA 4FD5A 3HUVA 4Q38A 3VWDA 1UWYA 4P4IA 4C7HA 1Q2YA 3PBEA 3FYNA 4P4FA 3PFOA 4MFLA 4MCPA 4P44A 4XPKA 5E96A 3RBUA 2PRQA 3V38A 3LMSA 1LAPA 4XPDC 4MHDA 2B4BA 2V77A 4KOVA 4KORA 4TNUA 3PB4X 3P2FA 4A39A 2ZXVA 2VI7A 3D66A 5JGFA 5LRJA 5H84A 2C6PA 4CAFA 5KTDA 2QVPA 1KWMA 5AG4A 4OMEA 2PJ7A 4L89A 1XIXA 2ZOGA 4P4DA 3EY5A 3IFEA 4E0AA 1OBRA 1IOIA 2CNTA 2EWBA 4OKOA 4YFJA 4QB9A 5HVGA 2JEVA 4BD9A 4ZBGA 2V8DA 1TIQA 2YGWA 4CGOA 4MXUA 4H6UA 4EMEA 4OC2A 1M4LA 4KOWA 4KOYA 1XFOA 4OC1A 5G22A 5THWA 5K8OA 1Z4RA 3D2MA 1LAMA 1YQEA 1QMUA 1X12A 3EXNA 3CDXA 3N5FA 3TFYA 2HC9A 1Y9WA 4HNWB 2XEGA 3K9TA 1TXRA 4CGMA 2WYRA 2GANA 2P6FA 4OIDA 2EK9A 3EFAA 4MFJA 4NFRA 3CXQA 3TT2A 3V7ZA 1J4JA 1B87A 2PJBA 2BSWA 1F2PA 4KOSA 2ABZA 2Q4VA 3QB8A 5DS0A 1NSLA 4CRZB 4PV6A 1AYEA 3FBUA 1AUGA 5KTAA 2GIVA 4LX9A 4PSXA 2Q7BA 4AB7A 2AFWA 2Q43A 3CXPA 4LQ6A 1Z4EA 4XPDB 2VEZA 2AFOA 2B4DA 1GYTA 1V0CA 4UEZA 3GKRA 4UCPA 4BINA 1P4NA 4WWVA 2XEJA 3RYOA 4PXDA 3SHPA 5A27A 2CNMA 3T90A 2GFQA 2PVVA 1YSJA 3IIBA 1IY7A 5J8CA 3IGRA 1YREA 5CBMA 3VARA 3FMCA 4ZI6A 1VKCA 4F9VA 4R8FA 2RFHA 3H8EA 2FL4A 4MI4A 3OWCA 4A94A 3LODA 4NXYA 2WPWA 3B3SA 2PDOA 1NE9A 2PE3A 2QMLA 3GYAA 2ZEMA 1IB1E 1ARLA 4IHMA 4M6HA 3DLJA 2B3VA 1XF8A 2K5TA 3IWGA 3K9UA 3IU1A 3SJFA 1ARMA 5IX3A 3WC6A 2JEWA 2J9AA 1YW4A 4PXEA 4KLWA 2ZEEA 3K2KA 2FT0A 1CBXA 2CTBA 2FVGA 3JTKA 4P45A 4CGNA 4X8IA 1Z8TA 4M6IA 4UIBA 4CYQA 4X2TA 4YU9A 1R3NA 5F48A 1VHSA 3TO9A 3SJEA 5A28A 3HLPA 3FXTA 1MK4A 4UIAA 5D8NA 2R1IA 4JYWA 2AE6A 4ORFA 3TO6A 2EVNA 4X5KA 1S5KA 2VZYA 3TO7A 2Z11A 2EK8A 2HQYA
chains in the Genus database with same CATH topology
3KASA 2ZEFA 7CPAA 3GB0A 3GLJA 3SJGA 5HXDA 1YW6A 3SI0A 4PXCA 1IGBA 4Q7AA 1F2OA 2PJCA 5I4MA 2QYVA 3DGVA 3S9MA 3FVLA 4OC4A 2O4HA 3NH4A 2PVWA 1ELLP 3D68A 1F57A 1ZG7A 4MCSA 4B6ZA 3PB7X 3KHXA 4K3NA 3FEDA 3BHXA 3H8GA 3I1UA 3D7HA 3FJUA 2PJ6A 3IJ3A 5HVHA 3FF3A 3FH4A 3KR4A 3WT4A 3VATA 3D4UA 2F8HA 3JRUA 3PBBA 4ZY0A 4NGPA 2BO9A 3D7GA 4H2KA 4OP4A 3KHZA 4IK2A 4FUUA 2PJ2A 5F09A 2ZEGA 2ZEPA 3BI0A 3CPXA 2JBKA 4KSIA 5LYDA 5LRKA 5JH9A 2POKA 8CPAA 3VH9A 4FAIA 4PXBA 3H8FA 2AFSA 1ZLIA 4ZY1A 4FWUA 4DJLA 1XBUA 4NGTA 4G1PA 4P10A 2ANPA 3D7FA 1ZG9A 2QJ8A 2ZELA 4P4EA 4UF4A 2V8HA 4UEFA 1CP6A 5LYIA 4YWYA 2AFZA 1TKHA 4P6YA 5K8MA 3IEHA 2IJZA 5LYLA 3SI1A 1TKJA 3QNVA 1Z8LA 1JQGA 1HEEA 2C6CA 4AXVA 3SJXA 3CPAA 1XMBA 4DUKA 2AFXA 2PIZA 4IAVA 4W9YA 2PJ8A 4ONWA 2OR4A 3WABA 1VHEA 3BXMA 4EWTA 3PB8X 2PJAA 3L2NA 2OOTA 4NGMA 1BAVA 3KR5A 5HVFA 1ZG8A 2ZEHA 3KL9A 1LFWA 3TC8A 4MRIA 4R76A 2GLFA 3T8WA 1BLLE 2XEFA 2CF4A 2PIYA 2O53A 2HB6A 1CP7A 3ISXA 1Q7LA 2C1CA 3WC7A 5CPAA 2PJ9A 4NJQA 3B3WA 3FEEA 3B3VA 2V8GA 4A37A 1HDQA 2NSMA 4R6TA 1PCAA 4NJRA 1Y0YA 4RUHA 3B35A 5ELYA 2IQ6A 1CX8A 2WZNA 3D7DA 3RZAA 1XJOA 4O23A 3KQXA 1FNOA 2PJ0A 4ZX9A 2PJ3A 5K8NA 1RTQA 3IC1A 1CPSA 4GM5A 2GREA 3B3TA 1H8LA 2VL1A 2G9DA 1YLOA 3S9LA 3NH5A 3BI1A 5LYFA 4F8ZA 1LANA 4EFDA 1FT7A 1HDUA 2PCUA 1VIXA 1XRYA 1Y7EA 4JZ0A 1NSAA 4MHZA 2PJ4A 3PRTA 2CIJA 5D29A 1EE3P 4PPZA 1R43A 4X3RA 1AMPA 4MMOA 4NGNA 1YMEA 3PFEA 4NGRA 5LRGA 2PJ5A 4F9UA 2XEIA 1DTDA 3RAMA 4Z65A 3CT9A 2RB7A 3NFZA 2DEAA 4NGQA 4CPAA 2Q51A 1VHOA 3PB6X 1ZLHA 2ZENA 4MCQA 3WC5A 2ZEDA 2ZEOA 1DE4C 1QQ9A 1PYTB 3PB9X 1CPXA 1Y0RA 3GUXA 1BPNA 3B7IA 3IWWA 4MHNA 2AFMA 4OIWA 3FECA 3KQZA 2F7VA 1LOKA 4OC3A 3MN8A 5K8PA 3KGQA 4P4BA 1TF8A 1TKFA 2BOAA 4NGSA 1Z5RA 2I3CA 5IB9A 2NYQA 5JM6A 3PEIA 3S9NA 1LCPA 2Q4ZA 4MHYA 3B2YA 2V8VA 4A38A 4OC5A 4R7MA 4WJBA 1CG2A 4TWEA 1TF9A 2CTCA 1ELMP 4P4JA 1BPMA 3TX8A 4ZY2A 6CPAA 3IO1A 2C6GA 3KZWA 3ISZA 2PJ1A 4ZYQA 4DYOA 3SI2A 2GU2A 2ZOFA 2GLJA 3MRUA 3FX6A 3NA6A 3NH8A 3LWUA 4OC0A 5J1QA 1Z2LA 4MHPA 2AFUA 1VGYA 4LQGA 4UEEA 3D67A 2JBJA 4PQAA 4FBEA 3KI9A 4ZX8A 2BCOA 2IMOA 4MCRA 3HUVA 1UWYA 4P4IA 3PBEA 4P4FA 3PFOA 4MCPA 4P44A 3RBUA 2PRQA 3V38A 3LMSA 1LAPA 2V77A 4TNUA 3PB4X 4A39A 3D66A 5JGFA 5LRJA 2C6PA 2QVPA 1KWMA 4OMEA 2PJ7A 4P4DA 2ZOGA 3IFEA 1OBRA 2EWBA 4OKOA 5HVGA 4BD9A 2V8DA 4MXUA 4EMEA 4OC2A 1M4LA 1XFOA 4OC1A 5THWA 5K8OA 1LAMA 1QMUA 3CDXA 3N5FA 2HC9A 2XEGA 3K9TA 1TXRA 2WYRA 4OIDA 2EK9A 4NFRA 3V7ZA 2PJBA 1F2PA 2ABZA 5DS0A 1AYEA 2AFWA 2Q43A 2AFOA 1GYTA 4UEZA 4WWVA 2XEJA 4PXDA 2PVVA 1YSJA 3IIBA 1IY7A 5CBMA 3VARA 3FMCA 4ZI6A 4F9VA 4R8FA 2RFHA 3H8EA 4A94A 3B3SA 2PE3A 4IHMA 2ZEMA 1ARLA 3DLJA 3SJFA 1ARMA 3WC6A 2JEWA 2J9AA 1YW4A 4PXEA 2ZEEA 3K2KA 1CBXA 2CTBA 2FVGA 4P45A 4X8IA 4UIBA 4X2TA 4YU9A 1R3NA 3SJEA 3HLPA 4UIAA 5D8NA 4JYWA 2EK8A 3B3CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KAS A;  2ZEF A;  7CPA A;  3GB0 A;  3GLJ A;  3SJG A;  5HXD A;  1YW6 A;  3SI0 A;  4PXC A;  1IGB A;  4Q7A A;  1F2O A;  2PJC A;  5I4M A;  2QYV A;  3DGV A;  3S9M A;  3FVL A;  4OC4 A;  2O4H A;  3NH4 A;  2PVW A;  1ELL P;  3D68 A;  1F57 A;  1ZG7 A;  4MCS A;  4B6Z A;  3PB7 X;  3KHX A;  4K3N A;  3FED A;  3BHX A;  3H8G A;  3I1U A;  3D7H A;  3FJU A;  2PJ6 A;  3IJ3 A;  5HVH A;  3FF3 A;  3FH4 A;  3KR4 A;  3WT4 A;  3VAT A;  3D4U A;  2F8H A;  3JRU A;  3PBB A;  4ZY0 A;  4NGP A;  2BO9 A;  3D7G A;  4H2K A;  4OP4 A;  3KHZ A;  4IK2 A;  4FUU A;  2PJ2 A;  5F09 A;  2ZEG A;  2ZEP A;  3BI0 A;  3CPX A;  2JBK A;  4KSI A;  5LYD A;  5LRK A;  5JH9 A;  2POK A;  8CPA A;  3VH9 A;  4FAI A;  4PXB A;  3H8F A;  2AFS A;  1ZLI A;  4ZY1 A;  4FWU A;  4DJL A;  1XBU A;  4NGT A;  4G1P A;  4P10 A;  2ANP A;  3D7F A;  1ZG9 A;  2QJ8 A;  2ZEL A;  4P4E A;  4UF4 A;  2V8H A;  4UEF A;  1CP6 A;  5LYI A;  4YWY A;  2AFZ A;  1TKH A;  4P6Y A;  5K8M A;  3IEH A;  2IJZ A;  5LYL A;  3SI1 A;  1TKJ A;  3QNV A;  1Z8L A;  1JQG A;  1HEE A;  2C6C A;  4AXV A;  3SJX A;  3CPA A;  1XMB A;  4DUK A;  2AFX A;  2PIZ A;  4IAV A;  4W9Y A;  2PJ8 A;  4ONW A;  2OR4 A;  3WAB A;  1VHE A;  3BXM A;  4EWT A;  3PB8 X;  2PJA A;  3L2N A;  2OOT A;  4NGM A;  1BAV A;  3KR5 A;  5HVF A;  1ZG8 A;  2ZEH A;  3KL9 A;  1LFW A;  3TC8 A;  4MRI A;  4R76 A;  2GLF A;  3T8W A;  1BLL E;  2XEF A;  2CF4 A;  2PIY A;  2O53 A;  2HB6 A;  1CP7 A;  3ISX A;  1Q7L A;  2C1C A;  3WC7 A;  5CPA A;  2PJ9 A;  4NJQ A;  3B3W A;  3FEE A;  3B3V A;  2V8G A;  4A37 A;  1HDQ A;  2NSM A;  4R6T A;  1PCA A;  4NJR A;  1Y0Y A;  4RUH A;  3B35 A;  5ELY A;  2IQ6 A;  1CX8 A;  2WZN A;  3D7D A;  3RZA A;  1XJO A;  4O23 A;  3KQX A;  1FNO A;  2PJ0 A;  4ZX9 A;  2PJ3 A;  5K8N A;  1RTQ A;  3IC1 A;  1CPS A;  4GM5 A;  2GRE A;  3B3T A;  1H8L A;  2VL1 A;  2G9D A;  1YLO A;  3S9L A;  3NH5 A;  3BI1 A;  5LYF A;  4F8Z A;  1LAN A;  4EFD A;  1FT7 A;  1HDU A;  2PCU A;  1VIX A;  1XRY A;  1Y7E A;  4JZ0 A;  1NSA A;  4MHZ A;  2PJ4 A;  3PRT A;  2CIJ A;  5D29 A;  1EE3 P;  4PPZ A;  1R43 A;  4X3R A;  1AMP A;  4MMO A;  4NGN A;  1YME A;  3PFE A;  4NGR A;  5LRG A;  2PJ5 A;  4F9U A;  2XEI A;  1DTD A;  3RAM A;  4Z65 A;  3CT9 A;  2RB7 A;  3NFZ A;  2DEA A;  4NGQ A;  4CPA A;  2Q51 A;  1VHO A;  3PB6 X;  1ZLH A;  2ZEN A;  4MCQ A;  3WC5 A;  2ZED A;  2ZEO A;  1DE4 C;  1QQ9 A;  1PYT B;  3PB9 X;  1CPX A;  1Y0R A;  3GUX A;  1BPN A;  3B7I A;  3IWW A;  4MHN A;  2AFM A;  4OIW A;  3FEC A;  3KQZ A;  2F7V A;  1LOK A;  4OC3 A;  3MN8 A;  5K8P A;  3KGQ A;  4P4B A;  1TF8 A;  1TKF A;  2BOA A;  4NGS A;  1Z5R A;  2I3C A;  5IB9 A;  2NYQ A;  5JM6 A;  3PEI A;  3S9N A;  1LCP A;  2Q4Z A;  4MHY A;  3B2Y A;  2V8V A;  4A38 A;  4OC5 A;  4R7M A;  4WJB A;  1CG2 A;  4TWE A;  1TF9 A;  2CTC A;  1ELM P;  4P4J A;  1BPM A;  3TX8 A;  4ZY2 A;  6CPA A;  3IO1 A;  2C6G A;  3KZW A;  3ISZ A;  2PJ1 A;  4ZYQ A;  4DYO A;  3SI2 A;  2GU2 A;  2ZOF A;  2GLJ A;  3MRU A;  3FX6 A;  3NA6 A;  3NH8 A;  3LWU A;  4OC0 A;  5J1Q A;  1Z2L A;  4MHP A;  2AFU A;  1VGY A;  4LQG A;  4UEE A;  3D67 A;  2JBJ A;  4PQA A;  4FBE A;  3KI9 A;  4ZX8 A;  2BCO A;  2IMO A;  4MCR A;  3HUV A;  1UWY A;  4P4I A;  3PBE A;  4P4F A;  3PFO A;  4MCP A;  4P44 A;  3RBU A;  2PRQ A;  3V38 A;  3LMS A;  1LAP A;  2V77 A;  4TNU A;  3PB4 X;  4A39 A;  3D66 A;  5JGF A;  5LRJ A;  2C6P A;  2QVP A;  1KWM A;  4OME A;  2PJ7 A;  4P4D A;  2ZOG A;  3IFE A;  1OBR A;  2EWB A;  4OKO A;  5HVG A;  4BD9 A;  2V8D A;  4MXU A;  4EME A;  4OC2 A;  1M4L A;  1XFO A;  4OC1 A;  5THW A;  5K8O A;  1LAM A;  1QMU A;  3CDX A;  3N5F A;  2HC9 A;  2XEG A;  3K9T A;  1TXR A;  2WYR A;  4OID A;  2EK9 A;  4NFR A;  3V7Z A;  2PJB A;  1F2P A;  2ABZ A;  5DS0 A;  1AYE A;  2AFW A;  2Q43 A;  2AFO A;  1GYT A;  4UEZ A;  4WWV A;  2XEJ A;  4PXD A;  2PVV A;  1YSJ A;  3IIB A;  1IY7 A;  5CBM A;  3VAR A;  3FMC A;  4ZI6 A;  4F9V A;  4R8F A;  2RFH A;  3H8E A;  4A94 A;  3B3S A;  2PE3 A;  4IHM A;  2ZEM A;  1ARL A;  3DLJ A;  3SJF A;  1ARM A;  3WC6 A;  2JEW A;  2J9A A;  1YW4 A;  4PXE A;  2ZEE A;  3K2K A;  1CBX A;  2CTB A;  2FVG A;  4P45 A;  4X8I A;  4UIB A;  4X2T A;  4YU9 A;  1R3N A;  3SJE A;  3HLP A;  4UIA A;  5D8N A;  4JYW A;  2EK8 A;  3B3C A; 
#chains in the Genus database with same CATH topology
 3KAS A;  4HNY B;  2ZEF A;  4A33 A;  4JWP A;  4F6A A;  4A30 A;  7CPA A;  1S7F A;  1X10 A;  2F5I A;  3GB0 A;  5H86 A;  5JQ4 A;  3GLJ A;  1YVO A;  2J8M A;  4E2A A;  2QIR A;  3SJG A;  1IU8 A;  2JDC A;  5AGE A;  3T9Y A;  5HXD A;  1YW6 A;  3G8W A;  4PXC A;  1IGB A;  2NMT A;  3SI0 A;  2B5G B;  4Q7A A;  1F2O A;  2R7H A;  1WWZ A;  3D3S A;  2JDD A;  2ZW5 A;  1S7N A;  2PJC A;  1MJB A;  3IWE A;  1Y7R A;  4AG9 A;  5I4M A;  1PU9 A;  2QYV A;  2C27 A;  3DGV A;  4OAD A;  3ZZI A;  2I00 A;  2Z3N A;  3FVL A;  3S9M A;  4OC4 A;  2O4H A;  3NH4 A;  2PVW A;  4UCM A;  1ELL P;  3D68 A;  1F57 A;  2D4P A;  1ZG7 A;  3CZX A;  4KSF A;  4MCS A;  2OH1 A;  3DSB A;  5F49 A;  4B6Z A;  3DR6 A;  4XNH C;  3PB7 X;  3KHX A;  3W6S A;  4K3N A;  2P6E A;  3FED A;  3BHX A;  3H8G A;  3I1U A;  3C26 A;  1GHE A;  3F0A A;  3D7H A;  1Z9U A;  3FJU A;  3LAC A;  4C2X A;  2PJ6 A;  1S3Z A;  2P0W A;  3IJ3 A;  1IID A;  3I9S A;  3GY9 A;  1Z8W A;  5G1Z A;  3R96 A;  1IOF A;  3B3C A;  4A95 A;  3FIX A;  3FF3 A;  5HVH A;  3FH4 A;  3KR4 A;  3WT4 A;  2J8R A;  4PK2 A;  3CXS A;  1IYK A;  3VAT A;  3D4U A;  4J3G A;  5IB0 A;  2F8H A;  3JRU A;  3PBB A;  3QAH A;  4FD6 A;  1MJA A;  4IUS A;  4NGP A;  4F0X A;  4ZY0 A;  2BO9 A;  3EC4 A;  3D7G A;  2WSA A;  3GIU A;  5AG7 A;  3WR7 A;  1L0C A;  4H2K A;  4OP4 A;  1UFH A;  4RI1 A;  4DNC A;  3KHZ A;  4QUS A;  2PR1 A;  4R9M A;  4IK2 A;  2I79 A;  4FUU A;  2PJ2 A;  1NMT A;  2CXA A;  4M85 A;  5F09 A;  3BJ7 A;  4MFK A;  4L8A A;  4CAV A;  2ZEG A;  4JXR A;  4GS4 A;  2ZEP A;  1JWQ A;  3TCV A;  3BI0 A;  3CPX A;  2JBK A;  4KSI A;  5LYD A;  5LRK A;  3V8I A;  3H5Z A;  3S6G A;  4C68 A;  2HUZ A;  2PC1 A;  5JH9 A;  2POK A;  8CPA A;  3DR8 A;  3VH9 A;  2RC4 A;  4FAI A;  4PXB A;  3H8F A;  2YNC C;  2AFS A;  1ZLI A;  2OZU A;  4ZY1 A;  4FWU A;  4DJL A;  1KUV A;  1XBU A;  4G1P A;  4NGT A;  4XNH B;  4MFZ A;  1QST A;  2Q0Y A;  5GCN A;  3IU2 A;  3QAY A;  4P10 A;  2ANP A;  3D7F A;  4QC6 A;  3I3G A;  5EC4 A;  1ZG9 A;  1XOV A;  2QJ8 A;  2ZEL A;  4P4E A;  1ON0 A;  4UF4 A;  2V8H A;  4UEF A;  4B12 A;  3VWE A;  4Q36 A;  1CP6 A;  4XPL A;  3BJ8 A;  5LYI A;  4B14 A;  4CRY B;  3TE4 A;  5ISV A;  2BL1 A;  4YWY A;  2AFZ A;  1TKH A;  3R9E A;  2B5G A;  2ATR A;  2BEI A;  4P6Y A;  4KVO E;  4M3S A;  3IEH A;  5K8M A;  2IJZ A;  5LYL A;  3SI1 A;  1ZO0 A;  1CM0 A;  1TKJ A;  3QNV A;  4HNX B;  1Z8L A;  1JQG A;  2O28 A;  3DNS A;  4JLY A;  1HEE A;  2C6C A;  3JUW A;  4KVM E;  5AG6 A;  4A31 A;  4AXV A;  3SJX A;  3CPA A;  5CNP A;  1XMB A;  2R8V A;  2AFX A;  4DUK A;  2PIZ A;  3P2H A;  4IAV A;  4C2Z A;  2X7B A;  4W9Y A;  2PJ8 A;  2Z10 A;  4ONW A;  2OR4 A;  3RO0 A;  3WAB A;  2QEC A;  1M4G A;  2Z3P A;  2PRB A;  1VHE A;  2PSW A;  3BXM A;  5J8F A;  4EWT A;  3PB8 X;  2FIW A;  2G3T A;  2PJA A;  2Z3L A;  3L2N A;  5HMN A;  1S60 A;  2OOT A;  1S7K A;  4NGM A;  1BAV A;  3KR5 A;  5HVF A;  1ZG8 A;  1LRZ A;  5IV0 A;  2ZEH A;  1IYL A;  3PZJ A;  4OLL A;  3KL9 A;  5G21 A;  5I0C A;  1LFW A;  3S6K A;  3TC8 A;  4B13 A;  2DF5 A;  2EUI A;  3E0K A;  5DWN A;  5JPH A;  4NEX A;  2Z3K A;  4MRI A;  4R76 A;  2GLF A;  4UFX A;  3T8W A;  1BLL E;  4KLV A;  3PP9 A;  2XEF A;  4KS9 A;  4KOX A;  5KTC A;  2CF4 A;  2PIY A;  2O53 A;  2YNE A;  3NE8 A;  3W6X A;  2HB6 A;  1CP7 A;  3ISX A;  1SQH A;  1Z8X A;  2VQY A;  1Q7L A;  3ZJ0 A;  4AVA A;  2C1C A;  2A4N A;  2Q04 A;  3MGD A;  3WC7 A;  2CY2 A;  3UY5 A;  3FNC A;  1QSR A;  5CPA A;  5AG5 A;  2PJ9 A;  4FD4 A;  4NJQ A;  3A9L A;  3B3W A;  3FEE A;  2DPS A;  3B3V A;  3JVN A;  2REE A;  2WUU A;  2FIA A;  4B10 A;  5EMI A;  2V8G A;  4C2Y A;  4F0Y A;  4A37 A;  3G3S A;  1HDQ A;  2NSM A;  4KSA A;  2P6G A;  4R6T A;  4BMH A;  1PCA A;  3D8P A;  4NJR A;  1Y0Y A;  4RUH A;  2DXQ A;  3B35 A;  5ELY A;  2IQ6 A;  2FCK A;  2ARH A;  1CX8 A;  2ODF A;  2WZN A;  5C88 A;  3D7D A;  3RZA A;  1I21 A;  4YRH A;  3FB3 A;  3R95 A;  1XJO A;  4O23 A;  4QVT A;  1YR0 A;  3KQX A;  4CAX A;  1FNO A;  2PJ0 A;  4ZX9 A;  1KZF A;  4CGP A;  1RXT A;  2PJ3 A;  4IF5 A;  5K8N A;  1YK3 A;  4NSQ A;  1RTQ A;  4B5P B;  3IC1 A;  1CPS A;  2ZW6 A;  4GM5 A;  2BUE A;  2GRE A;  1QSM A;  1XE4 A;  3B3T A;  4R87 A;  2EO8 A;  4K30 A;  1H8L A;  4GXH A;  2VL1 A;  4C7I A;  2KCW A;  4CGL A;  3TOB A;  2G9D A;  1YLO A;  3S9L A;  3NH5 A;  4NCZ A;  4UCN A;  4YGO A;  4H89 A;  2OB0 A;  2EBJ A;  2CNS A;  3BI1 A;  5LYF A;  2H5M A;  3F8K A;  1WK4 A;  4F8Z A;  4U9Z A;  4MBU A;  4MFQ A;  1LAN A;  1OZP A;  4EFD A;  1BO4 A;  1FT7 A;  1HDU A;  2PCU A;  1VIX A;  2GE3 A;  2YND A;  4NF1 A;  4KVX A;  4M6G A;  1XRY A;  1Y7E A;  4JZ0 A;  1NSA A;  4MHZ A;  4EVY A;  2Z3O A;  2PJ4 A;  3PRT A;  4KZT A;  2CIJ A;  4KOU A;  3W91 A;  5D29 A;  1EE3 P;  1XEB A;  1YVK A;  4PPZ A;  1M1D A;  1R43 A;  4X3R A;  1AMP A;  4MMO A;  4MY3 A;  4NGN A;  4II9 A;  2YNC A;  2ZW7 A;  1QSN A;  4LUA A;  1YME A;  2AJ6 A;  4BBH A;  3D2P A;  2VBQ A;  3PFE A;  2JLM A;  4NGR A;  2PJ5 A;  5LRG A;  4CS0 B;  3H4Q A;  4F9U A;  1DTD A;  2XEI A;  2Z3M A;  3B8G A;  3LD2 A;  1CJW A;  1S7L A;  2OZG A;  4R3L A;  3RAM A;  3CT9 A;  4Z65 A;  2RB7 A;  3NFZ A;  2DEA A;  2FS5 A;  4KUB A;  4NGQ A;  4PSW A;  2ZW4 A;  4CPA A;  2J8N A;  1FY7 A;  2Q51 A;  1VHO A;  5HH1 A;  3S6F A;  4A2Z A;  1KUY A;  3R9G A;  3PB6 X;  2FSR A;  1ZLH A;  4UWJ A;  2ZEN A;  4MCQ A;  3PGP A;  3WC5 A;  2ZED A;  2PR8 A;  3SXN A;  3TTH A;  2ZEO A;  1DE4 C;  4E8O A;  5BWA B;  3S6H A;  1QQ9 A;  5DWM A;  1PYT B;  3PB9 X;  1CPX A;  3RNZ A;  5C82 A;  4KOT A;  3R9F A;  2VXK A;  1R57 A;  1Y0R A;  2B3U A;  2R98 A;  3GUX A;  4MFP A;  1BPN A;  3B7I A;  3DDD A;  3IWW A;  4ONU A;  4R57 A;  4MHN A;  1YX0 A;  2AFM A;  4OIW A;  3FEC A;  3KQZ A;  2F7V A;  1KUX A;  1LOK A;  4OC3 A;  3MN8 A;  4UFV A;  5K8P A;  2OU2 A;  1I1D A;  3KGQ A;  4P4B A;  2FE7 A;  2G0B A;  4MY0 A;  2D4O A;  1TF8 A;  1QSO A;  1TKF A;  1YLE A;  4ZGY B;  4UWI A;  2BOA A;  4NGS A;  4RN7 A;  4CYN A;  1Z5R A;  2I3C A;  4JD6 A;  1B6B A;  4I49 A;  2VZZ A;  1Q2C A;  5IB9 A;  4AVB A;  4B5P A;  4UA3 A;  1Y9K A;  1MJ9 A;  2NYQ A;  1XMT A;  4CAW A;  2OZH A;  2Q44 A;  3EO4 A;  4AVC A;  1PUA A;  3TOA A;  5JM6 A;  1M4D A;  4A32 A;  3KKW A;  3PEI A;  4Y49 C;  3S9N A;  4MJ8 A;  1M4I A;  2G3A A;  3SXO A;  2ZPA A;  4FD7 A;  1LCP A;  5F46 A;  1I12 A;  2Q4Z A;  4HKF A;  4MHY A;  4U5Y A;  1Q2D A;  2B58 A;  5EBV A;  1M44 A;  1IIC A;  1RO5 A;  2Z0Z A;  4AG7 A;  3B2Y A;  2Q7S A;  2V8V A;  4A38 A;  4OC5 A;  4R3K A;  4R7M A;  4WJB A;  3FRM A;  1CG2 A;  3BLN A;  3F5B A;  4TWE A;  1TF9 A;  2CTC A;  1ELM P;  4U9Y A;  4H6Z A;  4PK3 A;  4UBR A;  4B5O A;  2REF A;  4P4J A;  1BPM A;  4CAE A;  3TX8 A;  4ZY2 A;  6CPA A;  3IO1 A;  4JXQ A;  2C6G A;  2HV2 A;  2WPX A;  4JJX A;  3KZW A;  3N7Z A;  3ISZ A;  4B11 A;  2FXF A;  4UFW A;  1K4J A;  2PJ1 A;  4ZYQ A;  4CYP A;  5F47 A;  4DYO A;  3SI2 A;  2GU2 A;  2ZOF A;  2Y0M A;  2GLJ A;  3MRU A;  3FX6 A;  2PQ8 A;  3NA6 A;  2B4D B;  2Q4Y A;  3NH8 A;  3LWU A;  4OC0 A;  4CYO A;  4OAE A;  5J1Q A;  1YGH A;  1Z2L A;  4MHP A;  2AFU A;  1N71 A;  2DPT A;  1VGY A;  4LQG A;  4RS2 A;  4UEE A;  5FVJ A;  3D67 A;  2JBJ A;  4PQA A;  1A2Z A;  4FBE A;  3KI9 A;  3NE7 A;  4HPS A;  1U6M A;  4ZX8 A;  1P0H A;  4KUA A;  1BOB A;  4Y49 B;  2BCO A;  5G20 A;  2IMO A;  4MCR A;  4QBJ A;  2IL4 A;  3R1K A;  4FD5 A;  3HUV A;  4Q38 A;  3VWD A;  1UWY A;  4P4I A;  4C7H A;  1Q2Y A;  3PBE A;  3FYN A;  4P4F A;  3PFO A;  4MFL A;  4MCP A;  4P44 A;  4XPK A;  5E96 A;  3RBU A;  2PRQ A;  3V38 A;  3LMS A;  1LAP A;  4XPD C;  4MHD A;  2B4B A;  2V77 A;  4KOV A;  4KOR A;  4TNU A;  3PB4 X;  3P2F A;  4A39 A;  2ZXV A;  2VI7 A;  3D66 A;  5JGF A;  5LRJ A;  5H84 A;  2C6P A;  4CAF A;  5KTD A;  2QVP A;  1KWM A;  5AG4 A;  4OME A;  2PJ7 A;  4L89 A;  1XIX A;  2ZOG A;  4P4D A;  3EY5 A;  3IFE A;  4E0A A;  1OBR A;  1IOI A;  2CNT A;  2EWB A;  4OKO A;  4YFJ A;  4QB9 A;  5HVG A;  2JEV A;  4BD9 A;  4ZBG A;  2V8D A;  1TIQ A;  2YGW A;  4CGO A;  4MXU A;  4H6U A;  4EME A;  4OC2 A;  1M4L A;  4KOW A;  4KOY A;  1XFO A;  4OC1 A;  5G22 A;  5THW A;  5K8O A;  1Z4R A;  3D2M A;  1LAM A;  1YQE A;  1QMU A;  1X12 A;  3EXN A;  3CDX A;  3N5F A;  3TFY A;  2HC9 A;  1Y9W A;  4HNW B;  2XEG A;  3K9T A;  1TXR A;  4CGM A;  2WYR A;  2GAN A;  2P6F A;  4OID A;  2EK9 A;  3EFA A;  4MFJ A;  4NFR A;  3CXQ A;  3TT2 A;  3V7Z A;  1J4J A;  1B87 A;  2PJB A;  2BSW A;  1F2P A;  4KOS A;  2ABZ A;  2Q4V A;  3QB8 A;  5DS0 A;  1NSL A;  4CRZ B;  4PV6 A;  1AYE A;  3FBU A;  1AUG A;  5KTA A;  2GIV A;  4LX9 A;  4PSX A;  2Q7B A;  4AB7 A;  2AFW A;  2Q43 A;  3CXP A;  4LQ6 A;  1Z4E A;  4XPD B;  2VEZ A;  2AFO A;  2B4D A;  1GYT A;  1V0C A;  4UEZ A;  3GKR A;  4UCP A;  4BIN A;  1P4N A;  4WWV A;  2XEJ A;  3RYO A;  4PXD A;  3SHP A;  5A27 A;  2CNM A;  3T90 A;  2GFQ A;  2PVV A;  1YSJ A;  3IIB A;  1IY7 A;  5J8C A;  3IGR A;  1YRE A;  5CBM A;  3VAR A;  3FMC A;  4ZI6 A;  1VKC A;  4F9V A;  4R8F A;  2RFH A;  3H8E A;  2FL4 A;  4MI4 A;  3OWC A;  4A94 A;  3LOD A;  4NXY A;  2WPW A;  3B3S A;  2PDO A;  1NE9 A;  2PE3 A;  2QML A;  3GYA A;  2ZEM A;  1IB1 E;  1ARL A;  4IHM A;  4M6H A;  3DLJ A;  2B3V A;  1XF8 A;  2K5T A;  3IWG A;  3K9U A;  3IU1 A;  3SJF A;  1ARM A;  5IX3 A;  3WC6 A;  2JEW A;  2J9A A;  1YW4 A;  4PXE A;  4KLW A;  2ZEE A;  3K2K A;  2FT0 A;  1CBX A;  2CTB A;  2FVG A;  3JTK A;  4P45 A;  4CGN A;  4X8I A;  1Z8T A;  4M6I A;  4UIB A;  4CYQ A;  4X2T A;  4YU9 A;  1R3N A;  5F48 A;  1VHS A;  3TO9 A;  3SJE A;  5A28 A;  3HLP A;  3FXT A;  1MK4 A;  4UIA A;  5D8N A;  2R1I A;  4JYW A;  2AE6 A;  4ORF A;  3TO6 A;  2EVN A;  4X5K A;  1S5K A;  2VZY A;  3TO7 A;  2Z11 A;  2EK8 A;  2HQY A; 
#chains in the Genus database with same CATH homology
 3KAS A;  2ZEF A;  7CPA A;  3GB0 A;  3GLJ A;  3SJG A;  5HXD A;  1YW6 A;  3SI0 A;  4PXC A;  1IGB A;  4Q7A A;  1F2O A;  2PJC A;  5I4M A;  2QYV A;  3DGV A;  3S9M A;  3FVL A;  4OC4 A;  2O4H A;  3NH4 A;  2PVW A;  1ELL P;  3D68 A;  1F57 A;  1ZG7 A;  4MCS A;  4B6Z A;  3PB7 X;  3KHX A;  4K3N A;  3FED A;  3BHX A;  3H8G A;  3I1U A;  3D7H A;  3FJU A;  2PJ6 A;  3IJ3 A;  5HVH A;  3FF3 A;  3FH4 A;  3KR4 A;  3WT4 A;  3VAT A;  3D4U A;  2F8H A;  3JRU A;  3PBB A;  4ZY0 A;  4NGP A;  2BO9 A;  3D7G A;  4H2K A;  4OP4 A;  3KHZ A;  4IK2 A;  4FUU A;  2PJ2 A;  5F09 A;  2ZEG A;  2ZEP A;  3BI0 A;  3CPX A;  2JBK A;  4KSI A;  5LYD A;  5LRK A;  5JH9 A;  2POK A;  8CPA A;  3VH9 A;  4FAI A;  4PXB A;  3H8F A;  2AFS A;  1ZLI A;  4ZY1 A;  4FWU A;  4DJL A;  1XBU A;  4NGT A;  4G1P A;  4P10 A;  2ANP A;  3D7F A;  1ZG9 A;  2QJ8 A;  2ZEL A;  4P4E A;  4UF4 A;  2V8H A;  4UEF A;  1CP6 A;  5LYI A;  4YWY A;  2AFZ A;  1TKH A;  4P6Y A;  5K8M A;  3IEH A;  2IJZ A;  5LYL A;  3SI1 A;  1TKJ A;  3QNV A;  1Z8L A;  1JQG A;  1HEE A;  2C6C A;  4AXV A;  3SJX A;  3CPA A;  1XMB A;  4DUK A;  2AFX A;  2PIZ A;  4IAV A;  4W9Y A;  2PJ8 A;  4ONW A;  2OR4 A;  3WAB A;  1VHE A;  3BXM A;  4EWT A;  3PB8 X;  2PJA A;  3L2N A;  2OOT A;  4NGM A;  1BAV A;  3KR5 A;  5HVF A;  1ZG8 A;  2ZEH A;  3KL9 A;  1LFW A;  3TC8 A;  4MRI A;  4R76 A;  2GLF A;  3T8W A;  1BLL E;  2XEF A;  2CF4 A;  2PIY A;  2O53 A;  2HB6 A;  1CP7 A;  3ISX A;  1Q7L A;  2C1C A;  3WC7 A;  5CPA A;  2PJ9 A;  4NJQ A;  3B3W A;  3FEE A;  3B3V A;  2V8G A;  4A37 A;  1HDQ A;  2NSM A;  4R6T A;  1PCA A;  4NJR A;  1Y0Y A;  4RUH A;  3B35 A;  5ELY A;  2IQ6 A;  1CX8 A;  2WZN A;  3D7D A;  3RZA A;  1XJO A;  4O23 A;  3KQX A;  1FNO A;  2PJ0 A;  4ZX9 A;  2PJ3 A;  5K8N A;  1RTQ A;  3IC1 A;  1CPS A;  4GM5 A;  2GRE A;  3B3T A;  1H8L A;  2VL1 A;  2G9D A;  1YLO A;  3S9L A;  3NH5 A;  3BI1 A;  5LYF A;  4F8Z A;  1LAN A;  4EFD A;  1FT7 A;  1HDU A;  2PCU A;  1VIX A;  1XRY A;  1Y7E A;  4JZ0 A;  1NSA A;  4MHZ A;  2PJ4 A;  3PRT A;  2CIJ A;  5D29 A;  1EE3 P;  4PPZ A;  1R43 A;  4X3R A;  1AMP A;  4MMO A;  4NGN A;  1YME A;  3PFE A;  4NGR A;  5LRG A;  2PJ5 A;  4F9U A;  2XEI A;  1DTD A;  3RAM A;  4Z65 A;  3CT9 A;  2RB7 A;  3NFZ A;  2DEA A;  4NGQ A;  4CPA A;  2Q51 A;  1VHO A;  3PB6 X;  1ZLH A;  2ZEN A;  4MCQ A;  3WC5 A;  2ZED A;  2ZEO A;  1DE4 C;  1QQ9 A;  1PYT B;  3PB9 X;  1CPX A;  1Y0R A;  3GUX A;  1BPN A;  3B7I A;  3IWW A;  4MHN A;  2AFM A;  4OIW A;  3FEC A;  3KQZ A;  2F7V A;  1LOK A;  4OC3 A;  3MN8 A;  5K8P A;  3KGQ A;  4P4B A;  1TF8 A;  1TKF A;  2BOA A;  4NGS A;  1Z5R A;  2I3C A;  5IB9 A;  2NYQ A;  5JM6 A;  3PEI A;  3S9N A;  1LCP A;  2Q4Z A;  4MHY A;  3B2Y A;  2V8V A;  4A38 A;  4OC5 A;  4R7M A;  4WJB A;  1CG2 A;  4TWE A;  1TF9 A;  2CTC A;  1ELM P;  4P4J A;  1BPM A;  3TX8 A;  4ZY2 A;  6CPA A;  3IO1 A;  2C6G A;  3KZW A;  3ISZ A;  2PJ1 A;  4ZYQ A;  4DYO A;  3SI2 A;  2GU2 A;  2ZOF A;  2GLJ A;  3MRU A;  3FX6 A;  3NA6 A;  3NH8 A;  3LWU A;  4OC0 A;  5J1Q A;  1Z2L A;  4MHP A;  2AFU A;  1VGY A;  4LQG A;  4UEE A;  3D67 A;  2JBJ A;  4PQA A;  4FBE A;  3KI9 A;  4ZX8 A;  2BCO A;  2IMO A;  4MCR A;  3HUV A;  1UWY A;  4P4I A;  3PBE A;  4P4F A;  3PFO A;  4MCP A;  4P44 A;  3RBU A;  2PRQ A;  3V38 A;  3LMS A;  1LAP A;  2V77 A;  4TNU A;  3PB4 X;  4A39 A;  3D66 A;  5JGF A;  5LRJ A;  2C6P A;  2QVP A;  1KWM A;  4OME A;  2PJ7 A;  4P4D A;  2ZOG A;  3IFE A;  1OBR A;  2EWB A;  4OKO A;  5HVG A;  4BD9 A;  2V8D A;  4MXU A;  4EME A;  4OC2 A;  1M4L A;  1XFO A;  4OC1 A;  5THW A;  5K8O A;  1LAM A;  1QMU A;  3CDX A;  3N5F A;  2HC9 A;  2XEG A;  3K9T A;  1TXR A;  2WYR A;  4OID A;  2EK9 A;  4NFR A;  3V7Z A;  2PJB A;  1F2P A;  2ABZ A;  5DS0 A;  1AYE A;  2AFW A;  2Q43 A;  2AFO A;  1GYT A;  4UEZ A;  4WWV A;  2XEJ A;  4PXD A;  2PVV A;  1YSJ A;  3IIB A;  1IY7 A;  5CBM A;  3VAR A;  3FMC A;  4ZI6 A;  4F9V A;  4R8F A;  2RFH A;  3H8E A;  4A94 A;  3B3S A;  2PE3 A;  4IHM A;  2ZEM A;  1ARL A;  3DLJ A;  3SJF A;  1ARM A;  3WC6 A;  2JEW A;  2J9A A;  1YW4 A;  4PXE A;  2ZEE A;  3K2K A;  1CBX A;  2CTB A;  2FVG A;  4P45 A;  4X8I A;  4UIB A;  4X2T A;  4YU9 A;  1R3N A;  3SJE A;  3HLP A;  4UIA A;  5D8N A;  4JYW A;  2EK8 A;  3B3C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...