5JPHA

Structure of a gnat acetyltransferase sacol1063 from staphylococcus aureus in complex with coa
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
142
structure length
142
Chain Sequence
AMFSKVNNQKMLEDCFYIRKKVFVEEQGIPEESEIDEYESESIHLIGYDNGQPVATARIRPINETTVKIERVAVMKSHRGQGMGRMLMQAVESLAKDEGFYVATMNAQCHAIPFYESLNFKMRGNIFLEEGIEHIEMTKKLT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Insight into the 3D structure and substrate specificity of previously uncharacterized GNAT superfamily acetyltransferases from pathogenic bacteria.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Transferase
molecule keywords Acetyltransferase SACOL1063
total genus 38
structure length 142
sequence length 142
chains with identical sequence B, C
ec nomenclature ec 2.3.1.-:
pdb deposition date 2016-05-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13673 Acetyltransf_10 Acetyltransferase (GNAT) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 5jphA00
2B4DA 4MY3A 3S6KA 3TO6A 5IX3A 1B6BA 4KOTA 2FL4A 2PR1A 1J4JA 3P2HA 2ZW4A 2VI7A 3G8WA 2X7BA 4KVXA 2PC1A 3PZJA 2ZXVA 4H6ZA 4KLWA 4XNHC 2OZGA 3VWDA 3R9FA 4F0YA 1M4GA 2JDCA 1QSRA 1IYKA 3CXSA 4KORA 3DDDA 5C88A 3QAHA 3D8PA 3F8KA 3JVNA 3LODA 4JWPA 1U6MA 4XPDB 4B5PA 3GY9A 1S7KA 2VZZA 2FCKA 4KOVA 1MJBA 3FYNA 3S6FA 3TOBA 4FD4A 4L89A 4NCZA 2JEVA 3T9YA 1PUAA 4R3LA 3W6SA 1XEBA 1NSLA 1P4NA 2A4NA 1Z4RA 4KOWA 1I1DA 2VQYA 4QB9A 3EY5A 2R1IA 1YVKA 3TTHA 1TIQA 4KUBA 4M3SA 5KTAA 1GHEA 4CAXA 2P6FA 2R98A 4ONUA 3I9SA 3D2PA 1MK4A 3IWGA 2Q4VA 2FE7A 2VBQA 5KTCA 4PK3A 5H86A 4K30A 3SXNA 2OU2A 2P6EA 2G3AA 3SXOA 2B58A 4U5YA 2F5IA 2REFA 2PR8A 4JLYA 1QSTA 4PSWA 3R9EA 2CNSA 5J8CA 2NMTA 1MJAA 3W6XA 4H6UA 1YREA 2CNMA 1I21A 1NE9A 1L0CA 3DR6A 3DSBA 1M4IA 4DNCA 1KUXA 5E96A 2Q44A 1VKCA 3ZJ0A 3R1KA 2KCWA 3V8IA 2G3TA 1K4JA 2QMLA 4R87A 2ATRA 2B4DB 4JJXA 2CY2A 3BJ7A 5H84A 4Y49C 1IB1E 3F5BA 4QC6A 2Y0MA 2I00A 5F46A 4KVME 1S7FA 2AJ6A 2Q7BA 3S6HA 3FNCA 1IYLA 3TCVA 4KOSA 4B5PB 4AVBA 4HNXB 2EVNA 1YGHA 4U9YA 3JUWA 1R57A 2QIRA 4E2AA 3FB3A 4NSQA 2ZW7A 4PV6A 2HUZA 2WPXA 1Q2DA 1P0HA 4YFJA 4LX9A 1XMTA 2CNTA 5FVJA 3RYOA 2PQ8A 2FIWA 2J8MA 1M4DA 4ORFA 1QSNA 2BUEA 2ZPAA 2GE3A 4H89A 3TO7A 2AE6A 2REEA 4QUSA 5JPHA 1OZPA 1XIXA 4B5OA 3B8GA 2P0WA 2C27A 2FXFA 5J8FA 3ZZIA 4E0AA 3QB8A 1M44A 4UBRA 1YVOA 1I12A 3TT2A 4AG7A 4JXRA 5EC4A 3FIXA 4X5KA 3CXPA 4ZBGA 2BEIA 1XE4A 2OZHA 5KTDA 3S6GA 2P6GA 3UY5A 1Y7RA 1S7LA 4Y49B 2ZW6A 2R7HA 4KZTA 4OAEA 5I0CA 4NF1A 1BOBA 4M85A 2IL4A 4FD5A 2VZYA 2FT0A 2VXKA 4E8OA 2PDOA 5GCNA 1WWZA 2HQYA 1WK4A 1LRZA 2QECA 3BLNA 4IF5A 2FS5A 1S7NA 3D2MA 4OLLA 4QVTA 1S5KA 3DR8A 3P2FA 1V0CA 5C82A 3R96A 2Z0ZA 3R9GA 2B5GB 1ON0A 1CJWA 4EVYA 2DXQA 1IICA 3G3SA 4RS2A 4CRYB 3TE4A 2VEZA 5IV0A 1XF8A 3MGDA 1QSMA 5EBVA 1FY7A 1YX0A 2D4PA 2G0BA 1Z4EA 4HNWB 4U9ZA 2WPWA 4MBUA 4GS4A 4YGOA 2GIVA 5DWMA 2B3VA 5IB0A 4AVAA 5F47A 2D4OA 4FD6A 3E0KA 1KUVA 4I49A 5F48A 2GANA 3NE7A 4BMHA 2HV2A 3EC4A 3TO9A 4CS0B 4JD6A 2EUIA 4YRHA 2Z11A 4II9A 1Y9KA 1S3ZA 2ARHA 3PGPA 3LD2A 2OZUA 4CRZB 1Q2CA 1Y9WA 4RI1A 3T90A 3W91A 4HKFA 2JLMA 3GYAA 4XNHB 4XPDC 3EFAA 4UWIA 3FRMA 2BL1A 2O28A 3KKWA 3OWCA 2BSWA 2Q0YA 4XPKA 4CAVA 4KOYA 3WR7A 4IUSA 4R3KA 1Q2YA 4OADA 1KUYA 3C26A 4HNYB 4MHDA 3I3GA 3D3SA 1RXTA 4UA3A 4KLVA 1MJ9A 1YK3A 1S60A 4R9MA 1KZFA 3VWEA 1SQHA 2Q04A 4L8AA 2H5MA 1RO5A 3K9UA 2RC4A 4KOXA 4R57A 1QSOA 4UWJA 4PK2A 3FXTA 4QBJA 2K5TA 2R8VA 3CXQA 1IIDA 3DNSA 4LUAA 2OH1A 2Q4YA 1B87A 2J8NA 5F49A 4AB7A 4KVOE 1VHSA 4NXYA 4JXQA 2FSRA 4MI4A 1UFHA 1N71A 5HH1A 2I79A 5CNPA 2JDDA 3F0AA 3GKRA 4KOUA 3N7ZA 2PRBA 4KUAA 2Z10A 4J3GA 1CM0A 4NEXA 4MY0A 4AG9A 4XPLA 4AVCA 4FD7A 3BJ8A 3H4QA 3TFYA 5DWNA 3EXNA 3IGRA 2J8RA 4PSXA 5ISVA 2FIAA 3R95A 1YR0A 1Z9UA 2B3UA 5JQ4A 2OB0A 1NMTA 1PU9A 3SHPA 3PP9A 2PSWA 3EO4A 2ZW5A 3TOAA 1M1DA 5HMNA 2B5GA 1YLEA 4F6AA 2B4BA 3FBUA 4MJ8A 1BO4A 4CAWA
chains in the Genus database with same CATH superfamily
2PJ7A 3GUXA 4A38A 2B4DA 4MY3A 3S6KA 3TO6A 5IX3A 3D68A 3NH5A 4UEZA 3MN8A 2ZOFA 4UF4A 1QQ9A 4FWUA 4NGQA 1B6BA 5C88A 1AMPA 3NFZA 3IO1A 4KOTA 2FL4A 5THWA 2PR1A 1J4JA 3P2HA 2ZW4A 4OIWA 1F57A 2VI7A 3G8WA 2PJ8A 2X7BA 4KVXA 2PC1A 3S9NA 1Y0RA 2NYQA 3KL9A 3VH9A 4A30A 2ZEGA 3TX8A 5JGFA 3PZJA 2ZXVA 5D8NA 2C6PA 3S9LA 2XEJA 3PBEA 2O4HA 4H6ZA 3KGQA 1YQEA 4KLWA 4Q7AA 4F9UA 4XNHC 4B12A 4CYQA 2OZGA 1R43A 1XFOA 4CAEA 3VWDA 3R9FA 2GFQA 2VL1A 4EMEA 1M4GA 2JDCA 1QSRA 1IYKA 2JBKA 1LAPA 2QYVA 3CXSA 1TXRA 3D8PA 3DDDA 3F8KA 3QAHA 4KORA 4C2YA 4MFJA 4MHZA 3I1UA 3JVNA 3LODA 3IU2A 1U6MA 4JWPA 4XPDB 3V38A 4Q36A 2V8HA 4B5PA 3GY9A 4PPZA 3KQXA 2ZEOA 1S7KA 4B11A 2VZZA 2FCKA 1CG2A 4KOVA 5LYFA 1MJBA 3FYNA 4OMEA 3S6FA 1R3NA 2GU2A 1TF9A 3TOBA 1VGYA 4FD4A 2ZENA 4L89A 4NCZA 2JEVA 3FEEA 3T9YA 1PUAA 1LCPA 4R3LA 3W6SA 1XEBA 2PJ3A 4BBHA 4KSAA 1NSLA 4NGTA 4ZY1A 1P4NA 1IY7A 5HVGA 1XJOA 2A4NA 1X10A 1Z4RA 2Q7SA 3CPAA 3CT9A 3KHXA 4KOWA 1I1DA 4A37A 4LQ6A 5A27A 2PJCA 2VQYA 1AUGA 1ZLIA 4PXEA 4QB9A 4ONWA 3EY5A 1Q7LA 3B35A 4MFKA 4CGLA 4K3NA 2ZEEA 1Z8WA 2R1IA 4A95A 2CXAA 1YVKA 3TTHA 4Z65A 3N5FA 1TIQA 4KUBA 4M3SA 5KTAA 1GHEA 4CAXA 2P6FA 2R98A 3H8GA 3I9SA 4JZ0A 4ONUA 3KASA 2O53A 3D2PA 1MK4A 3IWGA 4GM5A 4CAFA 4FAIA 2JEWA 2Q4VA 2FE7A 2VBQA 5IB9A 5KTCA 4PK3A 5H86A 3D67A 4K30A 3SXNA 2OU2A 2Z3NA 3IJ3A 3KI9A 2PJ1A 2P6EA 2G3AA 3SXOA 2PJ4A 3H8FA 3NE8A 1F2PA 3LWUA 4MFZA 2B58A 4A33A 1UWYA 4U5YA 2F5IA 2CTCA 2REFA 4KSIA 2AFSA 3BHXA 1BPNA 1ZLHA 4DUKA 1CPSA 2PR8A 3NH8A 3PEIA 4JLYA 5AG4A 2AFXA 2AFMA 7CPAA 1QSTA 1DTDA 4PSWA 1OBRA 4LQGA 4P4FA 3CDXA 3PB9X 2POKA 2CNSA 2YNEA 2PJAA 1ZG7A 3R9EA 2NMTA 1MJAA 3W6XA 4ZGYB 4H6UA 5J8CA 1YREA 2CNMA 4OC4A 1I21A 1Z2LA 1NE9A 1L0CA 2Q43A 3DR6A 3DSBA 3KR4A 3PFOA 2PCUA 3FX6A 3NA6A 1M4IA 5ELYA 4A2ZA 4DNCA 4CGPA 4NFRA 1KUXA 5E96A 4OC1A 4ZYQA 4C7IA 2Q44A 1VHOA 3DLJA 1XBUA 1YW4A 3H5ZA 3IU1A 1VKCA 4NJQA 1CX8A 2J9AA 3JTKA 3ZJ0A 3R1KA 5G1ZA 5G22A 1YW6A 2KCWA 3RNZA 3V8IA 2G3TA 3D7FA 5I4MA 1K4JA 4ZY0A 2QMLA 1Y0YA 1KWMA 2ATRA 4R87A 1GYTA 2B4DB 3SJFA 4ZI6A 4JJXA 4R7MA 1ZG8A 2CY2A 3BJ7A 1M4LA 3IEHA 5H84A 4Y49C 1IB1E 3F5BA 4WJBA 4QC6A 2Y0MA 4EWTA 2BO9A 2I00A 5F46A 4DJLA 4CYPA 4KVME 1S7FA 3FEDA 2AJ6A 2Q7BA 4P6YA 3LMSA 3S6HA 3FNCA 4P4IA 1IYLA 4P44A 3KHZA 4KOSA 3TCVA 4B5PB 2FVGA 2ODFA 1HDQA 2PVWA 4HNXB 4AVBA 2EVNA 1VIXA 4F0XA 1YGHA 4UFVA 5EMIA 1LANA 4U9YA 3JUWA 4UIBA 1CP6A 1R57A 4MCPA 2QIRA 1DE4C 4E2AA 3FB3A 4NSQA 2ZW7A 3PB4X 3SJGA 4G1PA 4UFXA 4PV6A 4MFQA 2Q4ZA 2IMOA 1IOIA 3BI1A 4F8ZA 2V8GA 2HUZA 2WPXA 4P4BA 1Q2DA 3SJEA 1P0HA 4YFJA 4Q38A 2Q51A 2DPSA 3QAYA 1NSAA 4LX9A 1XMTA 2CNTA 5FVJA 2WUUA 3RYOA 2PQ8A 2FIWA 3B3CA 2J8MA 4IAVA 3ISZA 1M4DA 4ORFA 4AXVA 1TKJA 1QSNA 2BUEA 4UCNA 3WC5A 1HEEA 2ZPAA 3BXMA 4NGRA 5G21A 2EO8A 8CPAA 4YWYA 2XEFA 4B6ZA 2GE3A 4H89A 3D66A 3TO7A 1Y7EA 2AE6A 1ZO0A 2PJ5A 2REEA 4QUSA 1Z8XA 5A28A 5JPHA 1OZPA 3FVLA 5AG5A 1XIXA 4X8IA 4B5OA 1Z8TA 4PXCA 1XMBA 2BCOA 4H2KA 3B8GA 2P0WA 2C27A 3BI0A 2ZELA 2FXFA 5J8FA 3ZZIA 5HXDA 4E0AA 3QB8A 1M44A 2C6CA 4CGNA 4UBRA 4FBEA 1YVOA 1I12A 3TT2A 4AG7A 4JXRA 5EC4A 4CPAA 2DEAA 4B13A 5LRGA 5LYLA 4ZY2A 2Z3PA 3FIXA 2V8DA 2C1CA 4OP4A 4X5KA 3CXPA 4ZBGA 4MHYA 2BEIA 3HLPA 1XE4A 1VHEA 5CBMA 2EWBA 2OZHA 5G20A 5KTDA 2GREA 2WZNA 4NGNA 4R6TA 2P6GA 3S6GA 3UY5A 4CYNA 3FJUA 1Y7RA 5K8MA 1ARLA 1S7LA 3SI0A 4Y49B 2ZW6A 2R7HA 4RUHA 1CBXA 4KZTA 2RB7A 1RTQA 3QNVA 4OAEA 4MCRA 4X3RA 2WYRA 3SJXA 3IC1A 5I0CA 4NF1A 1BOBA 4M85A 2IL4A 4FD5A 3FF3A 2VZYA 4M6IA 2FT0A 2VXKA 4R76A 3IIBA 4E8OA 1YLOA 2PDOA 1LOKA 3WABA 3HUVA 2EBJA 5GCNA 2V77A 2PIZA 1WWZA 2HQYA 4OC0A 4CYOA 2YNCC 1WK4A 2YGWA 4UEEA 1LRZA 2QECA 4OC5A 3D7GA 3BLNA 3VATA 4IF5A 4CGMA 2GLJA 2ZOGA 2FS5A 1S7NA 3D2MA 3IWWA 4F0YA 4OLLA 4UIAA 3TC8A 4QVTA 2QJ8A 1S5KA 5AG6A 3DR8A 3K9TA 3P2FA 1V0CA 4ZX9A 1BPMA 5C82A 3R96A 2Z0ZA 5LYDA 3VARA 4IHMA 2PIYA 1F2OA 3R9GA 2B5GB 1ON0A 3B2YA 4TNUA 2IQ6A 1CJWA 1FNOA 4EVYA 4W9YA 2DXQA 1ELLP 2PJBA 2PJ6A 4RN7A 2AFUA 1IICA 3G3SA 4P4EA 3H8EA 4RS2A 4CRYB 3TE4A 2VEZA 5IV0A 4NGPA 2V8VA 1XF8A 3MGDA 2YNDA 3D7HA 1QSMA 5EBVA 1FY7A 1YX0A 2D4PA 4MFLA 2G0BA 1ARMA 4A39A 1Z4EA 1IGBA 4HNWB 4U9ZA 2WPWA 4MBUA 1CP7A 4C68A 1PYTB 1XOVA 3GIUA 4GS4A 5BWAB 2CTBA 2ZEHA 4YGOA 3T8WA 2GIVA 3PFEA 4NGSA 2DPTA 2RFHA 5DWMA 2B3VA 5IB0A 5J1QA 4AVAA 5JM6A 3RAMA 5F47A 2D4OA 1CPXA 5JH9A 1TKFA 4FD6A 3E0KA 1KUVA 3KR5A 2YNCA 3KQZA 4KS9A 4MHPA 5K8PA 5HVHA 4I49A 2ANPA 4MXUA 4P4JA 5F48A 2GANA 4MHNA 3SI1A 2HB6A 1JQGA 4P45A 3WC7A 3NE7A 3PB7X 4BMHA 2HV2A 3EC4A 3TO9A 4CS0B 4JD6A 2WSAA 4C2ZA 2EUIA 2PJ0A 4YRHA 2Z11A 3NH4A 4II9A 1Y9KA 4ZX8A 3B3SA 4UCPA 1S3ZA 1EE3P 2ARHA 3PGPA 3LD2A 2OZUA 2XEIA 1IU8A 2CIJA 4CRZB 1Q2CA 1Y9WA 4OIDA 4RI1A 5D29A 3T90A 3W91A 2JLMA 4HKFA 3RBUA 3A9LA 4EFDA 3KZWA 4OC3A 4PQAA 3D4UA 3L2NA 5LRKA 3PB6X 4BD9A 2DF5A 2F8HA 2QVPA 3GYAA 5K8OA 2PJ2A 4XNHB 4XPDC 3EFAA 1TF8A 4NJRA 4UWIA 3FRMA 1XRYA 2I3CA 4MFPA 3GB0A 2AFWA 2BL1A 2O28A 4FUUA 2PVVA 3KKWA 3RO0A 3OWCA 2BSWA 2Q0YA 4XPKA 2XEGA 2EK9A 2PJ9A 4CAVA 4KOYA 4WWVA 3WR7A 4IUSA 4KSFA 4IK2A 4R3KA 1Q2YA 1Z8LA 2IJZA 4MCQA 1KUYA 3C26A 4OADA 4PXDA 4A94A 4HNYB 4MHDA 3I3GA 3D3SA 2OR4A 1RXTA 1ZG9A 2ZEDA 4UA3A 2GLFA 4O23A 4KLVA 1MJ9A 3MRUA 1YK3A 1S60A 4R9MA 1KZFA 3VWEA 1SQHA 2PE3A 2Q04A 3JRUA 3CPXA 4L8AA 2H5MA 1H8LA 3PBBA 5LRJA 3S9MA 1RO5A 2EK8A 2JBJA 1HDUA 3K9UA 2RC4A 4KOXA 2CF4A 4R57A 3PRTA 1QSOA 4UWJA 4PK2A 3FXTA 4CGOA 1Z5RA 4C2XA 4QBJA 2K5TA 2Z3LA 1IOFA 2R8VA 2HC9A 2PRQA 3CXQA 1IIDA 4P4DA 4B14A 3DNSA 2AFZA 4BINA 6CPAA 5DS0A 3WT4A 1YMEA 4LUAA 2OH1A 3B3WA 1ELMP 3B7IA 1X12A 2Q4YA 2C6GA 1A2ZA 1B87A 1BLLE 3SI2A 2F7VA 4C7HA 4DYOA 2J8NA 4GXHA 5F49A 4AB7A 4YU9A 3B3VA 2Z3MA 4KVOE 1LFWA 3FH4A 1VHSA 3FMCA 4NXYA 1LAMA 4JXQA 5CPAA 2FSRA 4MI4A 3FECA 4M6HA 1UFHA 5HVFA 4UEFA 4TWEA 1N71A 1TKHA 5HH1A 2I79A 3V7ZA 5CNPA 4UCMA 2JDDA 3F0AA 3GKRA 4KOUA 3N7ZA 2PRBA 3PB8X 4KUAA 2Z10A 3ISXA 1PCAA 4J3GA 1CM0A 1JWQA 1QMUA 3CZXA 3D7DA 4MCSA 4NEXA 4MY0A 4P10A 4R8FA 2ABZA 3WC6A 2BOAA 1AYEA 2OOTA 4AG9A 1FT7A 4XPLA 4AVCA 1YSJA 4FD7A 5AGEA 3BJ8A 3H4QA 2ZEFA 4F9VA 2Z3KA 3TFYA 5AG7A 5DWNA 4MMOA 3EXNA 4OC2A 3DGVA 5LYIA 3IGRA 4PXBA 2J8RA 4NGMA 2ZEMA 5F09A 4PSXA 5ISVA 3B3TA 2FIAA 4JYWA 3R95A 1BAVA 1YR0A 1Z9UA 3K2KA 4MRIA 2B3UA 5JQ4A 4X2TA 2OB0A 5K8NA 1NMTA 1PU9A 2Z3OA 3GLJA 3SHPA 3PP9A 2PSWA 3EO4A 2ZW5A 3TOAA 1M1DA 4B10A 5HMNA 4A32A 2AFOA 4A31A 3LACA 2B5GA 4UFWA 3RZAA 1YLEA 4M6GA 2B4BA 2G9DA 4F6AA 3FBUA 3IWEA 4MJ8A 4OKOA 1BO4A 4HPSA 2NSMA 4CAWA 2ZEPA 3IFEA
chains in the Genus database with same CATH topology
2B4DA 4MY3A 3S6KA 3TO6A 5IX3A 1B6BA 4KOTA 2FL4A 2PR1A 1J4JA 3P2HA 2ZW4A 2VI7A 3G8WA 2X7BA 4KVXA 2PC1A 4A30A 3PZJA 2ZXVA 4H6ZA 4KLWA 4XNHC 4B12A 4CYQA 2OZGA 4CAEA 3VWDA 3R9FA 4F0YA 1M4GA 2JDCA 1QSRA 1IYKA 3CXSA 4KORA 3DDDA 5C88A 3QAHA 3D8PA 3F8KA 4C2YA 4MFJA 3JVNA 3LODA 3IU2A 1U6MA 4JWPA 4XPDB 4Q36A 4B5PA 3GY9A 1S7KA 4B11A 2VZZA 2FCKA 4KOVA 1MJBA 3FYNA 3S6FA 3TOBA 4FD4A 4L89A 4NCZA 2JEVA 3T9YA 1PUAA 4R3LA 3W6SA 1XEBA 4BBHA 4KSAA 1NSLA 1P4NA 2A4NA 1Z4RA 4KOWA 1I1DA 5A27A 2VQYA 4QB9A 3EY5A 4MFKA 4CGLA 2R1IA 4A95A 2CXAA 1YVKA 3TTHA 1TIQA 4KUBA 4M3SA 5KTAA 1GHEA 4CAXA 2P6FA 2R98A 4ONUA 3I9SA 3D2PA 1MK4A 3IWGA 4CAFA 2Q4VA 2FE7A 2VBQA 5KTCA 4PK3A 5H86A 4K30A 3SXNA 2OU2A 2Z3NA 2P6EA 2G3AA 3SXOA 4MFZA 2B58A 4A33A 4U5YA 2F5IA 2REFA 2PR8A 4JLYA 5AG4A 1QSTA 4PSWA 2YNEA 2CNSA 3R9EA 5J8CA 2NMTA 1MJAA 3W6XA 4ZGYB 4H6UA 1YREA 2CNMA 1I21A 1NE9A 1L0CA 3DR6A 3DSBA 1M4IA 4A2ZA 4DNCA 4CGPA 1KUXA 5E96A 4C7IA 2Q44A 3H5ZA 3IU1A 1VKCA 3ZJ0A 3JTKA 3R1KA 5G1ZA 5G22A 2KCWA 3V8IA 2G3TA 1K4JA 2QMLA 4R87A 2ATRA 2B4DB 4JJXA 2CY2A 3BJ7A 5H84A 4Y49C 1IB1E 3F5BA 4QC6A 2Y0MA 2I00A 5F46A 4CYPA 4KVME 1S7FA 2AJ6A 2Q7BA 3S6HA 3FNCA 1IYLA 3TCVA 4KOSA 4B5PB 4AVBA 4HNXB 2EVNA 4F0XA 1YGHA 4UFVA 4U9YA 3JUWA 1R57A 2QIRA 4E2AA 3FB3A 4NSQA 2ZW7A 4UFXA 4PV6A 4MFQA 2HUZA 2WPXA 1Q2DA 1P0HA 4YFJA 4Q38A 2DPSA 4LX9A 1XMTA 2CNTA 5FVJA 2WUUA 3RYOA 2PQ8A 2FIWA 2J8MA 1M4DA 4ORFA 1QSNA 2BUEA 4UCNA 2ZPAA 5G21A 2GE3A 4H89A 3TO7A 2AE6A 1ZO0A 2REEA 4QUSA 5JPHA 5A28A 1OZPA 5AG5A 1XIXA 4B5OA 3B8GA 2P0WA 2C27A 2FXFA 5J8FA 3ZZIA 4E0AA 3QB8A 1M44A 4CGNA 4UBRA 1YVOA 1I12A 3TT2A 4AG7A 4JXRA 5EC4A 4B13A 2Z3PA 3FIXA 4X5KA 3CXPA 4ZBGA 2BEIA 1XE4A 2OZHA 5G20A 5KTDA 3S6GA 2P6GA 3UY5A 4CYNA 1Y7RA 1S7LA 4Y49B 2ZW6A 2R7HA 4KZTA 4OAEA 5I0CA 4NF1A 1BOBA 4M85A 2IL4A 4FD5A 2VZYA 2FT0A 2VXKA 4E8OA 2PDOA 5GCNA 1WWZA 2HQYA 4CYOA 2YNCC 1WK4A 2YGWA 1LRZA 2QECA 4CGMA 3BLNA 4IF5A 2FS5A 1S7NA 3D2MA 4OLLA 4QVTA 1S5KA 5AG6A 3DR8A 3P2FA 1V0CA 5C82A 3R96A 2Z0ZA 3R9GA 2B5GB 1ON0A 1CJWA 4EVYA 2DXQA 1IICA 3G3SA 4RS2A 4CRYB 3TE4A 2VEZA 5IV0A 1XF8A 3MGDA 2YNDA 1QSMA 5EBVA 1FY7A 1YX0A 2D4PA 4MFLA 2G0BA 1Z4EA 4HNWB 4U9ZA 2WPWA 4MBUA 4C68A 4GS4A 5BWAB 4YGOA 2GIVA 2DPTA 5DWMA 2B3VA 5IB0A 4AVAA 5F47A 2D4OA 4FD6A 3E0KA 1KUVA 4KS9A 2YNCA 4I49A 5F48A 2GANA 3NE7A 4BMHA 2HV2A 3EC4A 3TO9A 4CS0B 4JD6A 2WSAA 4C2ZA 2EUIA 4YRHA 2Z11A 4II9A 1Y9KA 4UCPA 1S3ZA 2ARHA 3PGPA 3LD2A 2OZUA 4CRZB 1Q2CA 1Y9WA 4RI1A 3T90A 3W91A 4HKFA 2JLMA 3A9LA 3GYAA 4XNHB 4XPDC 3EFAA 4UWIA 3FRMA 4MFPA 2BL1A 2O28A 3KKWA 3OWCA 2BSWA 2Q0YA 4XPKA 4CAVA 4KOYA 3WR7A 4IUSA 4KSFA 4R3KA 1Q2YA 1KUYA 3C26A 4OADA 4HNYB 4MHDA 3I3GA 3D3SA 1RXTA 4UA3A 4KLVA 1MJ9A 1YK3A 1S60A 4R9MA 1KZFA 3VWEA 1SQHA 2Q04A 4L8AA 2H5MA 1RO5A 3K9UA 2RC4A 4KOXA 4R57A 1QSOA 4UWJA 4PK2A 3FXTA 4CGOA 4C2XA 4QBJA 2K5TA 2Z3LA 2R8VA 4B14A 3CXQA 1IIDA 3DNSA 4LUAA 2OH1A 2Q4YA 1B87A 4C7HA 2J8NA 5F49A 4AB7A 2Z3MA 4KVOE 1VHSA 4NXYA 4JXQA 2FSRA 4MI4A 1UFHA 1N71A 5HH1A 2I79A 5CNPA 4UCMA 2JDDA 3F0AA 3GKRA 4KOUA 3N7ZA 2PRBA 4KUAA 2Z10A 4J3GA 1CM0A 4NEXA 4MY0A 4AG9A 4XPLA 4AVCA 4FD7A 5AGEA 3BJ8A 3H4QA 3TFYA 2Z3KA 5AG7A 5DWNA 3EXNA 3IGRA 2J8RA 4PSXA 5ISVA 2FIAA 3R95A 1YR0A 1Z9UA 2B3UA 5JQ4A 2OB0A 1NMTA 1PU9A 2Z3OA 3SHPA 3PP9A 2PSWA 3EO4A 2ZW5A 3TOAA 1M1DA 4B10A 5HMNA 4A32A 4A31A 2B5GA 1YLEA 4F6AA 2B4BA 3FBUA 3IWEA 4MJ8A 1BO4A 4UFWA 4CAWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2B4D A;  4MY3 A;  3S6K A;  3TO6 A;  5IX3 A;  1B6B A;  4KOT A;  2FL4 A;  2PR1 A;  1J4J A;  3P2H A;  2ZW4 A;  2VI7 A;  3G8W A;  2X7B A;  4KVX A;  2PC1 A;  3PZJ A;  2ZXV A;  4H6Z A;  4KLW A;  4XNH C;  2OZG A;  3VWD A;  3R9F A;  4F0Y A;  1M4G A;  2JDC A;  1QSR A;  1IYK A;  3CXS A;  4KOR A;  3DDD A;  5C88 A;  3QAH A;  3D8P A;  3F8K A;  3JVN A;  3LOD A;  4JWP A;  1U6M A;  4XPD B;  4B5P A;  3GY9 A;  1S7K A;  2VZZ A;  2FCK A;  4KOV A;  1MJB A;  3FYN A;  3S6F A;  3TOB A;  4FD4 A;  4L89 A;  4NCZ A;  2JEV A;  3T9Y A;  1PUA A;  4R3L A;  3W6S A;  1XEB A;  1NSL A;  1P4N A;  2A4N A;  1Z4R A;  4KOW A;  1I1D A;  2VQY A;  4QB9 A;  3EY5 A;  2R1I A;  1YVK A;  3TTH A;  1TIQ A;  4KUB A;  4M3S A;  5KTA A;  1GHE A;  4CAX A;  2P6F A;  2R98 A;  4ONU A;  3I9S A;  3D2P A;  1MK4 A;  3IWG A;  2Q4V A;  2FE7 A;  2VBQ A;  5KTC A;  4PK3 A;  5H86 A;  4K30 A;  3SXN A;  2OU2 A;  2P6E A;  2G3A A;  3SXO A;  2B58 A;  4U5Y A;  2F5I A;  2REF A;  2PR8 A;  4JLY A;  1QST A;  4PSW A;  3R9E A;  2CNS A;  5J8C A;  2NMT A;  1MJA A;  3W6X A;  4H6U A;  1YRE A;  2CNM A;  1I21 A;  1NE9 A;  1L0C A;  3DR6 A;  3DSB A;  1M4I A;  4DNC A;  1KUX A;  5E96 A;  2Q44 A;  1VKC A;  3ZJ0 A;  3R1K A;  2KCW A;  3V8I A;  2G3T A;  1K4J A;  2QML A;  4R87 A;  2ATR A;  2B4D B;  4JJX A;  2CY2 A;  3BJ7 A;  5H84 A;  4Y49 C;  1IB1 E;  3F5B A;  4QC6 A;  2Y0M A;  2I00 A;  5F46 A;  4KVM E;  1S7F A;  2AJ6 A;  2Q7B A;  3S6H A;  3FNC A;  1IYL A;  3TCV A;  4KOS A;  4B5P B;  4AVB A;  4HNX B;  2EVN A;  1YGH A;  4U9Y A;  3JUW A;  1R57 A;  2QIR A;  4E2A A;  3FB3 A;  4NSQ A;  2ZW7 A;  4PV6 A;  2HUZ A;  2WPX A;  1Q2D A;  1P0H A;  4YFJ A;  4LX9 A;  1XMT A;  2CNT A;  5FVJ A;  3RYO A;  2PQ8 A;  2FIW A;  2J8M A;  1M4D A;  4ORF A;  1QSN A;  2BUE A;  2ZPA A;  2GE3 A;  4H89 A;  3TO7 A;  2AE6 A;  2REE A;  4QUS A;  5JPH A;  1OZP A;  1XIX A;  4B5O A;  3B8G A;  2P0W A;  2C27 A;  2FXF A;  5J8F A;  3ZZI A;  4E0A A;  3QB8 A;  1M44 A;  4UBR A;  1YVO A;  1I12 A;  3TT2 A;  4AG7 A;  4JXR A;  5EC4 A;  3FIX A;  4X5K A;  3CXP A;  4ZBG A;  2BEI A;  1XE4 A;  2OZH A;  5KTD A;  3S6G A;  2P6G A;  3UY5 A;  1Y7R A;  1S7L A;  4Y49 B;  2ZW6 A;  2R7H A;  4KZT A;  4OAE A;  5I0C A;  4NF1 A;  1BOB A;  4M85 A;  2IL4 A;  4FD5 A;  2VZY A;  2FT0 A;  2VXK A;  4E8O A;  2PDO A;  5GCN A;  1WWZ A;  2HQY A;  1WK4 A;  1LRZ A;  2QEC A;  3BLN A;  4IF5 A;  2FS5 A;  1S7N A;  3D2M A;  4OLL A;  4QVT A;  1S5K A;  3DR8 A;  3P2F A;  1V0C A;  5C82 A;  3R96 A;  2Z0Z A;  3R9G A;  2B5G B;  1ON0 A;  1CJW A;  4EVY A;  2DXQ A;  1IIC A;  3G3S A;  4RS2 A;  4CRY B;  3TE4 A;  2VEZ A;  5IV0 A;  1XF8 A;  3MGD A;  1QSM A;  5EBV A;  1FY7 A;  1YX0 A;  2D4P A;  2G0B A;  1Z4E A;  4HNW B;  4U9Z A;  2WPW A;  4MBU A;  4GS4 A;  4YGO A;  2GIV A;  5DWM A;  2B3V A;  5IB0 A;  4AVA A;  5F47 A;  2D4O A;  4FD6 A;  3E0K A;  1KUV A;  4I49 A;  5F48 A;  2GAN A;  3NE7 A;  4BMH A;  2HV2 A;  3EC4 A;  3TO9 A;  4CS0 B;  4JD6 A;  2EUI A;  4YRH A;  2Z11 A;  4II9 A;  1Y9K A;  1S3Z A;  2ARH A;  3PGP A;  3LD2 A;  2OZU A;  4CRZ B;  1Q2C A;  1Y9W A;  4RI1 A;  3T90 A;  3W91 A;  4HKF A;  2JLM A;  3GYA A;  4XNH B;  4XPD C;  3EFA A;  4UWI A;  3FRM A;  2BL1 A;  2O28 A;  3KKW A;  3OWC A;  2BSW A;  2Q0Y A;  4XPK A;  4CAV A;  4KOY A;  3WR7 A;  4IUS A;  4R3K A;  1Q2Y A;  4OAD A;  1KUY A;  3C26 A;  4HNY B;  4MHD A;  3I3G A;  3D3S A;  1RXT A;  4UA3 A;  4KLV A;  1MJ9 A;  1YK3 A;  1S60 A;  4R9M A;  1KZF A;  3VWE A;  1SQH A;  2Q04 A;  4L8A A;  2H5M A;  1RO5 A;  3K9U A;  2RC4 A;  4KOX A;  4R57 A;  1QSO A;  4UWJ A;  4PK2 A;  3FXT A;  4QBJ A;  2K5T A;  2R8V A;  3CXQ A;  1IID A;  3DNS A;  4LUA A;  2OH1 A;  2Q4Y A;  1B87 A;  2J8N A;  5F49 A;  4AB7 A;  4KVO E;  1VHS A;  4NXY A;  4JXQ A;  2FSR A;  4MI4 A;  1UFH A;  1N71 A;  5HH1 A;  2I79 A;  5CNP A;  2JDD A;  3F0A A;  3GKR A;  4KOU A;  3N7Z A;  2PRB A;  4KUA A;  2Z10 A;  4J3G A;  1CM0 A;  4NEX A;  4MY0 A;  4AG9 A;  4XPL A;  4AVC A;  4FD7 A;  3BJ8 A;  3H4Q A;  3TFY A;  5DWN A;  3EXN A;  3IGR A;  2J8R A;  4PSX A;  5ISV A;  2FIA A;  3R95 A;  1YR0 A;  1Z9U A;  2B3U A;  5JQ4 A;  2OB0 A;  1NMT A;  1PU9 A;  3SHP A;  3PP9 A;  2PSW A;  3EO4 A;  2ZW5 A;  3TOA A;  1M1D A;  5HMN A;  2B5G A;  1YLE A;  4F6A A;  2B4B A;  3FBU A;  4MJ8 A;  1BO4 A;  4CAW A; 
#chains in the Genus database with same CATH topology
 2PJ7 A;  3GUX A;  4A38 A;  2B4D A;  4MY3 A;  3S6K A;  3TO6 A;  5IX3 A;  3D68 A;  3NH5 A;  4UEZ A;  3MN8 A;  2ZOF A;  4UF4 A;  1QQ9 A;  4FWU A;  4NGQ A;  1B6B A;  5C88 A;  1AMP A;  3NFZ A;  3IO1 A;  4KOT A;  2FL4 A;  5THW A;  2PR1 A;  1J4J A;  3P2H A;  2ZW4 A;  4OIW A;  1F57 A;  2VI7 A;  3G8W A;  2PJ8 A;  2X7B A;  4KVX A;  2PC1 A;  3S9N A;  1Y0R A;  2NYQ A;  3KL9 A;  3VH9 A;  4A30 A;  2ZEG A;  3TX8 A;  5JGF A;  3PZJ A;  2ZXV A;  5D8N A;  2C6P A;  3S9L A;  2XEJ A;  3PBE A;  2O4H A;  4H6Z A;  3KGQ A;  1YQE A;  4KLW A;  4Q7A A;  4F9U A;  4XNH C;  4B12 A;  4CYQ A;  2OZG A;  1R43 A;  1XFO A;  4CAE A;  3VWD A;  3R9F A;  2GFQ A;  2VL1 A;  4EME A;  1M4G A;  2JDC A;  1QSR A;  1IYK A;  2JBK A;  1LAP A;  2QYV A;  3CXS A;  1TXR A;  3D8P A;  3DDD A;  3F8K A;  3QAH A;  4KOR A;  4C2Y A;  4MFJ A;  4MHZ A;  3I1U A;  3JVN A;  3LOD A;  3IU2 A;  1U6M A;  4JWP A;  4XPD B;  3V38 A;  4Q36 A;  2V8H A;  4B5P A;  3GY9 A;  4PPZ A;  3KQX A;  2ZEO A;  1S7K A;  4B11 A;  2VZZ A;  2FCK A;  1CG2 A;  4KOV A;  5LYF A;  1MJB A;  3FYN A;  4OME A;  3S6F A;  1R3N A;  2GU2 A;  1TF9 A;  3TOB A;  1VGY A;  4FD4 A;  2ZEN A;  4L89 A;  4NCZ A;  2JEV A;  3FEE A;  3T9Y A;  1PUA A;  1LCP A;  4R3L A;  3W6S A;  1XEB A;  2PJ3 A;  4BBH A;  4KSA A;  1NSL A;  4NGT A;  4ZY1 A;  1P4N A;  1IY7 A;  5HVG A;  1XJO A;  2A4N A;  1X10 A;  1Z4R A;  2Q7S A;  3CPA A;  3CT9 A;  3KHX A;  4KOW A;  1I1D A;  4A37 A;  4LQ6 A;  5A27 A;  2PJC A;  2VQY A;  1AUG A;  1ZLI A;  4PXE A;  4QB9 A;  4ONW A;  3EY5 A;  1Q7L A;  3B35 A;  4MFK A;  4CGL A;  4K3N A;  2ZEE A;  1Z8W A;  2R1I A;  4A95 A;  2CXA A;  1YVK A;  3TTH A;  4Z65 A;  3N5F A;  1TIQ A;  4KUB A;  4M3S A;  5KTA A;  1GHE A;  4CAX A;  2P6F A;  2R98 A;  3H8G A;  3I9S A;  4JZ0 A;  4ONU A;  3KAS A;  2O53 A;  3D2P A;  1MK4 A;  3IWG A;  4GM5 A;  4CAF A;  4FAI A;  2JEW A;  2Q4V A;  2FE7 A;  2VBQ A;  5IB9 A;  5KTC A;  4PK3 A;  5H86 A;  3D67 A;  4K30 A;  3SXN A;  2OU2 A;  2Z3N A;  3IJ3 A;  3KI9 A;  2PJ1 A;  2P6E A;  2G3A A;  3SXO A;  2PJ4 A;  3H8F A;  3NE8 A;  1F2P A;  3LWU A;  4MFZ A;  2B58 A;  4A33 A;  1UWY A;  4U5Y A;  2F5I A;  2CTC A;  2REF A;  4KSI A;  2AFS A;  3BHX A;  1BPN A;  1ZLH A;  4DUK A;  1CPS A;  2PR8 A;  3NH8 A;  3PEI A;  4JLY A;  5AG4 A;  2AFX A;  2AFM A;  7CPA A;  1QST A;  1DTD A;  4PSW A;  1OBR A;  4LQG A;  4P4F A;  3CDX A;  3PB9 X;  2POK A;  2CNS A;  2YNE A;  2PJA A;  1ZG7 A;  3R9E A;  2NMT A;  1MJA A;  3W6X A;  4ZGY B;  4H6U A;  5J8C A;  1YRE A;  2CNM A;  4OC4 A;  1I21 A;  1Z2L A;  1NE9 A;  1L0C A;  2Q43 A;  3DR6 A;  3DSB A;  3KR4 A;  3PFO A;  2PCU A;  3FX6 A;  3NA6 A;  1M4I A;  5ELY A;  4A2Z A;  4DNC A;  4CGP A;  4NFR A;  1KUX A;  5E96 A;  4OC1 A;  4ZYQ A;  4C7I A;  2Q44 A;  1VHO A;  3DLJ A;  1XBU A;  1YW4 A;  3H5Z A;  3IU1 A;  1VKC A;  4NJQ A;  1CX8 A;  2J9A A;  3JTK A;  3ZJ0 A;  3R1K A;  5G1Z A;  5G22 A;  1YW6 A;  2KCW A;  3RNZ A;  3V8I A;  2G3T A;  3D7F A;  5I4M A;  1K4J A;  4ZY0 A;  2QML A;  1Y0Y A;  1KWM A;  2ATR A;  4R87 A;  1GYT A;  2B4D B;  3SJF A;  4ZI6 A;  4JJX A;  4R7M A;  1ZG8 A;  2CY2 A;  3BJ7 A;  1M4L A;  3IEH A;  5H84 A;  4Y49 C;  1IB1 E;  3F5B A;  4WJB A;  4QC6 A;  2Y0M A;  4EWT A;  2BO9 A;  2I00 A;  5F46 A;  4DJL A;  4CYP A;  4KVM E;  1S7F A;  3FED A;  2AJ6 A;  2Q7B A;  4P6Y A;  3LMS A;  3S6H A;  3FNC A;  4P4I A;  1IYL A;  4P44 A;  3KHZ A;  4KOS A;  3TCV A;  4B5P B;  2FVG A;  2ODF A;  1HDQ A;  2PVW A;  4HNX B;  4AVB A;  2EVN A;  1VIX A;  4F0X A;  1YGH A;  4UFV A;  5EMI A;  1LAN A;  4U9Y A;  3JUW A;  4UIB A;  1CP6 A;  1R57 A;  4MCP A;  2QIR A;  1DE4 C;  4E2A A;  3FB3 A;  4NSQ A;  2ZW7 A;  3PB4 X;  3SJG A;  4G1P A;  4UFX A;  4PV6 A;  4MFQ A;  2Q4Z A;  2IMO A;  1IOI A;  3BI1 A;  4F8Z A;  2V8G A;  2HUZ A;  2WPX A;  4P4B A;  1Q2D A;  3SJE A;  1P0H A;  4YFJ A;  4Q38 A;  2Q51 A;  2DPS A;  3QAY A;  1NSA A;  4LX9 A;  1XMT A;  2CNT A;  5FVJ A;  2WUU A;  3RYO A;  2PQ8 A;  2FIW A;  3B3C A;  2J8M A;  4IAV A;  3ISZ A;  1M4D A;  4ORF A;  4AXV A;  1TKJ A;  1QSN A;  2BUE A;  4UCN A;  3WC5 A;  1HEE A;  2ZPA A;  3BXM A;  4NGR A;  5G21 A;  2EO8 A;  8CPA A;  4YWY A;  2XEF A;  4B6Z A;  2GE3 A;  4H89 A;  3D66 A;  3TO7 A;  1Y7E A;  2AE6 A;  1ZO0 A;  2PJ5 A;  2REE A;  4QUS A;  1Z8X A;  5A28 A;  5JPH A;  1OZP A;  3FVL A;  5AG5 A;  1XIX A;  4X8I A;  4B5O A;  1Z8T A;  4PXC A;  1XMB A;  2BCO A;  4H2K A;  3B8G A;  2P0W A;  2C27 A;  3BI0 A;  2ZEL A;  2FXF A;  5J8F A;  3ZZI A;  5HXD A;  4E0A A;  3QB8 A;  1M44 A;  2C6C A;  4CGN A;  4UBR A;  4FBE A;  1YVO A;  1I12 A;  3TT2 A;  4AG7 A;  4JXR A;  5EC4 A;  4CPA A;  2DEA A;  4B13 A;  5LRG A;  5LYL A;  4ZY2 A;  2Z3P A;  3FIX A;  2V8D A;  2C1C A;  4OP4 A;  4X5K A;  3CXP A;  4ZBG A;  4MHY A;  2BEI A;  3HLP A;  1XE4 A;  1VHE A;  5CBM A;  2EWB A;  2OZH A;  5G20 A;  5KTD A;  2GRE A;  2WZN A;  4NGN A;  4R6T A;  2P6G A;  3S6G A;  3UY5 A;  4CYN A;  3FJU A;  1Y7R A;  5K8M A;  1ARL A;  1S7L A;  3SI0 A;  4Y49 B;  2ZW6 A;  2R7H A;  4RUH A;  1CBX A;  4KZT A;  2RB7 A;  1RTQ A;  3QNV A;  4OAE A;  4MCR A;  4X3R A;  2WYR A;  3SJX A;  3IC1 A;  5I0C A;  4NF1 A;  1BOB A;  4M85 A;  2IL4 A;  4FD5 A;  3FF3 A;  2VZY A;  4M6I A;  2FT0 A;  2VXK A;  4R76 A;  3IIB A;  4E8O A;  1YLO A;  2PDO A;  1LOK A;  3WAB A;  3HUV A;  2EBJ A;  5GCN A;  2V77 A;  2PIZ A;  1WWZ A;  2HQY A;  4OC0 A;  4CYO A;  2YNC C;  1WK4 A;  2YGW A;  4UEE A;  1LRZ A;  2QEC A;  4OC5 A;  3D7G A;  3BLN A;  3VAT A;  4IF5 A;  4CGM A;  2GLJ A;  2ZOG A;  2FS5 A;  1S7N A;  3D2M A;  3IWW A;  4F0Y A;  4OLL A;  4UIA A;  3TC8 A;  4QVT A;  2QJ8 A;  1S5K A;  5AG6 A;  3DR8 A;  3K9T A;  3P2F A;  1V0C A;  4ZX9 A;  1BPM A;  5C82 A;  3R96 A;  2Z0Z A;  5LYD A;  3VAR A;  4IHM A;  2PIY A;  1F2O A;  3R9G A;  2B5G B;  1ON0 A;  3B2Y A;  4TNU A;  2IQ6 A;  1CJW A;  1FNO A;  4EVY A;  4W9Y A;  2DXQ A;  1ELL P;  2PJB A;  2PJ6 A;  4RN7 A;  2AFU A;  1IIC A;  3G3S A;  4P4E A;  3H8E A;  4RS2 A;  4CRY B;  3TE4 A;  2VEZ A;  5IV0 A;  4NGP A;  2V8V A;  1XF8 A;  3MGD A;  2YND A;  3D7H A;  1QSM A;  5EBV A;  1FY7 A;  1YX0 A;  2D4P A;  4MFL A;  2G0B A;  1ARM A;  4A39 A;  1Z4E A;  1IGB A;  4HNW B;  4U9Z A;  2WPW A;  4MBU A;  1CP7 A;  4C68 A;  1PYT B;  1XOV A;  3GIU A;  4GS4 A;  5BWA B;  2CTB A;  2ZEH A;  4YGO A;  3T8W A;  2GIV A;  3PFE A;  4NGS A;  2DPT A;  2RFH A;  5DWM A;  2B3V A;  5IB0 A;  5J1Q A;  4AVA A;  5JM6 A;  3RAM A;  5F47 A;  2D4O A;  1CPX A;  5JH9 A;  1TKF A;  4FD6 A;  3E0K A;  1KUV A;  3KR5 A;  2YNC A;  3KQZ A;  4KS9 A;  4MHP A;  5K8P A;  5HVH A;  4I49 A;  2ANP A;  4MXU A;  4P4J A;  5F48 A;  2GAN A;  4MHN A;  3SI1 A;  2HB6 A;  1JQG A;  4P45 A;  3WC7 A;  3NE7 A;  3PB7 X;  4BMH A;  2HV2 A;  3EC4 A;  3TO9 A;  4CS0 B;  4JD6 A;  2WSA A;  4C2Z A;  2EUI A;  2PJ0 A;  4YRH A;  2Z11 A;  3NH4 A;  4II9 A;  1Y9K A;  4ZX8 A;  3B3S A;  4UCP A;  1S3Z A;  1EE3 P;  2ARH A;  3PGP A;  3LD2 A;  2OZU A;  2XEI A;  1IU8 A;  2CIJ A;  4CRZ B;  1Q2C A;  1Y9W A;  4OID A;  4RI1 A;  5D29 A;  3T90 A;  3W91 A;  2JLM A;  4HKF A;  3RBU A;  3A9L A;  4EFD A;  3KZW A;  4OC3 A;  4PQA A;  3D4U A;  3L2N A;  5LRK A;  3PB6 X;  4BD9 A;  2DF5 A;  2F8H A;  2QVP A;  3GYA A;  5K8O A;  2PJ2 A;  4XNH B;  4XPD C;  3EFA A;  1TF8 A;  4NJR A;  4UWI A;  3FRM A;  1XRY A;  2I3C A;  4MFP A;  3GB0 A;  2AFW A;  2BL1 A;  2O28 A;  4FUU A;  2PVV A;  3KKW A;  3RO0 A;  3OWC A;  2BSW A;  2Q0Y A;  4XPK A;  2XEG A;  2EK9 A;  2PJ9 A;  4CAV A;  4KOY A;  4WWV A;  3WR7 A;  4IUS A;  4KSF A;  4IK2 A;  4R3K A;  1Q2Y A;  1Z8L A;  2IJZ A;  4MCQ A;  1KUY A;  3C26 A;  4OAD A;  4PXD A;  4A94 A;  4HNY B;  4MHD A;  3I3G A;  3D3S A;  2OR4 A;  1RXT A;  1ZG9 A;  2ZED A;  4UA3 A;  2GLF A;  4O23 A;  4KLV A;  1MJ9 A;  3MRU A;  1YK3 A;  1S60 A;  4R9M A;  1KZF A;  3VWE A;  1SQH A;  2PE3 A;  2Q04 A;  3JRU A;  3CPX A;  4L8A A;  2H5M A;  1H8L A;  3PBB A;  5LRJ A;  3S9M A;  1RO5 A;  2EK8 A;  2JBJ A;  1HDU A;  3K9U A;  2RC4 A;  4KOX A;  2CF4 A;  4R57 A;  3PRT A;  1QSO A;  4UWJ A;  4PK2 A;  3FXT A;  4CGO A;  1Z5R A;  4C2X A;  4QBJ A;  2K5T A;  2Z3L A;  1IOF A;  2R8V A;  2HC9 A;  2PRQ A;  3CXQ A;  1IID A;  4P4D A;  4B14 A;  3DNS A;  2AFZ A;  4BIN A;  6CPA A;  5DS0 A;  3WT4 A;  1YME A;  4LUA A;  2OH1 A;  3B3W A;  1ELM P;  3B7I A;  1X12 A;  2Q4Y A;  2C6G A;  1A2Z A;  1B87 A;  1BLL E;  3SI2 A;  2F7V A;  4C7H A;  4DYO A;  2J8N A;  4GXH A;  5F49 A;  4AB7 A;  4YU9 A;  3B3V A;  2Z3M A;  4KVO E;  1LFW A;  3FH4 A;  1VHS A;  3FMC A;  4NXY A;  1LAM A;  4JXQ A;  5CPA A;  2FSR A;  4MI4 A;  3FEC A;  4M6H A;  1UFH A;  5HVF A;  4UEF A;  4TWE A;  1N71 A;  1TKH A;  5HH1 A;  2I79 A;  3V7Z A;  5CNP A;  4UCM A;  2JDD A;  3F0A A;  3GKR A;  4KOU A;  3N7Z A;  2PRB A;  3PB8 X;  4KUA A;  2Z10 A;  3ISX A;  1PCA A;  4J3G A;  1CM0 A;  1JWQ A;  1QMU A;  3CZX A;  3D7D A;  4MCS A;  4NEX A;  4MY0 A;  4P10 A;  4R8F A;  2ABZ A;  3WC6 A;  2BOA A;  1AYE A;  2OOT A;  4AG9 A;  1FT7 A;  4XPL A;  4AVC A;  1YSJ A;  4FD7 A;  5AGE A;  3BJ8 A;  3H4Q A;  2ZEF A;  4F9V A;  2Z3K A;  3TFY A;  5AG7 A;  5DWN A;  4MMO A;  3EXN A;  4OC2 A;  3DGV A;  5LYI A;  3IGR A;  4PXB A;  2J8R A;  4NGM A;  2ZEM A;  5F09 A;  4PSX A;  5ISV A;  3B3T A;  2FIA A;  4JYW A;  3R95 A;  1BAV A;  1YR0 A;  1Z9U A;  3K2K A;  4MRI A;  2B3U A;  5JQ4 A;  4X2T A;  2OB0 A;  5K8N A;  1NMT A;  1PU9 A;  2Z3O A;  3GLJ A;  3SHP A;  3PP9 A;  2PSW A;  3EO4 A;  2ZW5 A;  3TOA A;  1M1D A;  4B10 A;  5HMN A;  4A32 A;  2AFO A;  4A31 A;  3LAC A;  2B5G A;  4UFW A;  3RZA A;  1YLE A;  4M6G A;  2B4B A;  2G9D A;  4F6A A;  3FBU A;  3IWE A;  4MJ8 A;  4OKO A;  1BO4 A;  4HPS A;  2NSM A;  4CAW A;  2ZEP A;  3IFE A; 
#chains in the Genus database with same CATH homology
 2B4D A;  4MY3 A;  3S6K A;  3TO6 A;  5IX3 A;  1B6B A;  4KOT A;  2FL4 A;  2PR1 A;  1J4J A;  3P2H A;  2ZW4 A;  2VI7 A;  3G8W A;  2X7B A;  4KVX A;  2PC1 A;  4A30 A;  3PZJ A;  2ZXV A;  4H6Z A;  4KLW A;  4XNH C;  4B12 A;  4CYQ A;  2OZG A;  4CAE A;  3VWD A;  3R9F A;  4F0Y A;  1M4G A;  2JDC A;  1QSR A;  1IYK A;  3CXS A;  4KOR A;  3DDD A;  5C88 A;  3QAH A;  3D8P A;  3F8K A;  4C2Y A;  4MFJ A;  3JVN A;  3LOD A;  3IU2 A;  1U6M A;  4JWP A;  4XPD B;  4Q36 A;  4B5P A;  3GY9 A;  1S7K A;  4B11 A;  2VZZ A;  2FCK A;  4KOV A;  1MJB A;  3FYN A;  3S6F A;  3TOB A;  4FD4 A;  4L89 A;  4NCZ A;  2JEV A;  3T9Y A;  1PUA A;  4R3L A;  3W6S A;  1XEB A;  4BBH A;  4KSA A;  1NSL A;  1P4N A;  2A4N A;  1Z4R A;  4KOW A;  1I1D A;  5A27 A;  2VQY A;  4QB9 A;  3EY5 A;  4MFK A;  4CGL A;  2R1I A;  4A95 A;  2CXA A;  1YVK A;  3TTH A;  1TIQ A;  4KUB A;  4M3S A;  5KTA A;  1GHE A;  4CAX A;  2P6F A;  2R98 A;  4ONU A;  3I9S A;  3D2P A;  1MK4 A;  3IWG A;  4CAF A;  2Q4V A;  2FE7 A;  2VBQ A;  5KTC A;  4PK3 A;  5H86 A;  4K30 A;  3SXN A;  2OU2 A;  2Z3N A;  2P6E A;  2G3A A;  3SXO A;  4MFZ A;  2B58 A;  4A33 A;  4U5Y A;  2F5I A;  2REF A;  2PR8 A;  4JLY A;  5AG4 A;  1QST A;  4PSW A;  2YNE A;  2CNS A;  3R9E A;  5J8C A;  2NMT A;  1MJA A;  3W6X A;  4ZGY B;  4H6U A;  1YRE A;  2CNM A;  1I21 A;  1NE9 A;  1L0C A;  3DR6 A;  3DSB A;  1M4I A;  4A2Z A;  4DNC A;  4CGP A;  1KUX A;  5E96 A;  4C7I A;  2Q44 A;  3H5Z A;  3IU1 A;  1VKC A;  3ZJ0 A;  3JTK A;  3R1K A;  5G1Z A;  5G22 A;  2KCW A;  3V8I A;  2G3T A;  1K4J A;  2QML A;  4R87 A;  2ATR A;  2B4D B;  4JJX A;  2CY2 A;  3BJ7 A;  5H84 A;  4Y49 C;  1IB1 E;  3F5B A;  4QC6 A;  2Y0M A;  2I00 A;  5F46 A;  4CYP A;  4KVM E;  1S7F A;  2AJ6 A;  2Q7B A;  3S6H A;  3FNC A;  1IYL A;  3TCV A;  4KOS A;  4B5P B;  4AVB A;  4HNX B;  2EVN A;  4F0X A;  1YGH A;  4UFV A;  4U9Y A;  3JUW A;  1R57 A;  2QIR A;  4E2A A;  3FB3 A;  4NSQ A;  2ZW7 A;  4UFX A;  4PV6 A;  4MFQ A;  2HUZ A;  2WPX A;  1Q2D A;  1P0H A;  4YFJ A;  4Q38 A;  2DPS A;  4LX9 A;  1XMT A;  2CNT A;  5FVJ A;  2WUU A;  3RYO A;  2PQ8 A;  2FIW A;  2J8M A;  1M4D A;  4ORF A;  1QSN A;  2BUE A;  4UCN A;  2ZPA A;  5G21 A;  2GE3 A;  4H89 A;  3TO7 A;  2AE6 A;  1ZO0 A;  2REE A;  4QUS A;  5JPH A;  5A28 A;  1OZP A;  5AG5 A;  1XIX A;  4B5O A;  3B8G A;  2P0W A;  2C27 A;  2FXF A;  5J8F A;  3ZZI A;  4E0A A;  3QB8 A;  1M44 A;  4CGN A;  4UBR A;  1YVO A;  1I12 A;  3TT2 A;  4AG7 A;  4JXR A;  5EC4 A;  4B13 A;  2Z3P A;  3FIX A;  4X5K A;  3CXP A;  4ZBG A;  2BEI A;  1XE4 A;  2OZH A;  5G20 A;  5KTD A;  3S6G A;  2P6G A;  3UY5 A;  4CYN A;  1Y7R A;  1S7L A;  4Y49 B;  2ZW6 A;  2R7H A;  4KZT A;  4OAE A;  5I0C A;  4NF1 A;  1BOB A;  4M85 A;  2IL4 A;  4FD5 A;  2VZY A;  2FT0 A;  2VXK A;  4E8O A;  2PDO A;  5GCN A;  1WWZ A;  2HQY A;  4CYO A;  2YNC C;  1WK4 A;  2YGW A;  1LRZ A;  2QEC A;  4CGM A;  3BLN A;  4IF5 A;  2FS5 A;  1S7N A;  3D2M A;  4OLL A;  4QVT A;  1S5K A;  5AG6 A;  3DR8 A;  3P2F A;  1V0C A;  5C82 A;  3R96 A;  2Z0Z A;  3R9G A;  2B5G B;  1ON0 A;  1CJW A;  4EVY A;  2DXQ A;  1IIC A;  3G3S A;  4RS2 A;  4CRY B;  3TE4 A;  2VEZ A;  5IV0 A;  1XF8 A;  3MGD A;  2YND A;  1QSM A;  5EBV A;  1FY7 A;  1YX0 A;  2D4P A;  4MFL A;  2G0B A;  1Z4E A;  4HNW B;  4U9Z A;  2WPW A;  4MBU A;  4C68 A;  4GS4 A;  5BWA B;  4YGO A;  2GIV A;  2DPT A;  5DWM A;  2B3V A;  5IB0 A;  4AVA A;  5F47 A;  2D4O A;  4FD6 A;  3E0K A;  1KUV A;  4KS9 A;  2YNC A;  4I49 A;  5F48 A;  2GAN A;  3NE7 A;  4BMH A;  2HV2 A;  3EC4 A;  3TO9 A;  4CS0 B;  4JD6 A;  2WSA A;  4C2Z A;  2EUI A;  4YRH A;  2Z11 A;  4II9 A;  1Y9K A;  4UCP A;  1S3Z A;  2ARH A;  3PGP A;  3LD2 A;  2OZU A;  4CRZ B;  1Q2C A;  1Y9W A;  4RI1 A;  3T90 A;  3W91 A;  4HKF A;  2JLM A;  3A9L A;  3GYA A;  4XNH B;  4XPD C;  3EFA A;  4UWI A;  3FRM A;  4MFP A;  2BL1 A;  2O28 A;  3KKW A;  3OWC A;  2BSW A;  2Q0Y A;  4XPK A;  4CAV A;  4KOY A;  3WR7 A;  4IUS A;  4KSF A;  4R3K A;  1Q2Y A;  1KUY A;  3C26 A;  4OAD A;  4HNY B;  4MHD A;  3I3G A;  3D3S A;  1RXT A;  4UA3 A;  4KLV A;  1MJ9 A;  1YK3 A;  1S60 A;  4R9M A;  1KZF A;  3VWE A;  1SQH A;  2Q04 A;  4L8A A;  2H5M A;  1RO5 A;  3K9U A;  2RC4 A;  4KOX A;  4R57 A;  1QSO A;  4UWJ A;  4PK2 A;  3FXT A;  4CGO A;  4C2X A;  4QBJ A;  2K5T A;  2Z3L A;  2R8V A;  4B14 A;  3CXQ A;  1IID A;  3DNS A;  4LUA A;  2OH1 A;  2Q4Y A;  1B87 A;  4C7H A;  2J8N A;  5F49 A;  4AB7 A;  2Z3M A;  4KVO E;  1VHS A;  4NXY A;  4JXQ A;  2FSR A;  4MI4 A;  1UFH A;  1N71 A;  5HH1 A;  2I79 A;  5CNP A;  4UCM A;  2JDD A;  3F0A A;  3GKR A;  4KOU A;  3N7Z A;  2PRB A;  4KUA A;  2Z10 A;  4J3G A;  1CM0 A;  4NEX A;  4MY0 A;  4AG9 A;  4XPL A;  4AVC A;  4FD7 A;  5AGE A;  3BJ8 A;  3H4Q A;  3TFY A;  2Z3K A;  5AG7 A;  5DWN A;  3EXN A;  3IGR A;  2J8R A;  4PSX A;  5ISV A;  2FIA A;  3R95 A;  1YR0 A;  1Z9U A;  2B3U A;  5JQ4 A;  2OB0 A;  1NMT A;  1PU9 A;  2Z3O A;  3SHP A;  3PP9 A;  2PSW A;  3EO4 A;  2ZW5 A;  3TOA A;  1M1D A;  4B10 A;  5HMN A;  4A32 A;  4A31 A;  2B5G A;  1YLE A;  4F6A A;  2B4B A;  3FBU A;  3IWE A;  4MJ8 A;  1BO4 A;  4UFW A;  4CAW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...