5JPHA

Structure of a gnat acetyltransferase sacol1063 from staphylococcus aureus in complex with coa
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
142
structure length
142
Chain Sequence
AMFSKVNNQKMLEDCFYIRKKVFVEEQGIPEESEIDEYESESIHLIGYDNGQPVATARIRPINETTVKIERVAVMKSHRGQGMGRMLMQAVESLAKDEGFYVATMNAQCHAIPFYESLNFKMRGNIFLEEGIEHIEMTKKLT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Acetyltransferase SACOL1063
publication title Insight into the 3D structure and substrate specificity of previously uncharacterized GNAT superfamily acetyltransferases from pathogenic bacteria.
pubmed doi rcsb
source organism Staphylococcus aureus
total genus 38
structure length 142
sequence length 142
chains with identical sequence B, C
ec nomenclature ec 2.3.1.-:
pdb deposition date 2016-05-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13673 Acetyltransf_10 Acetyltransferase (GNAT) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 5jphA00
1KZFA 2B5GB 2J8NA 1K4JA 1QSRA 2Q7BA 3F0AA 2P6GA 3IWGA 2HUZA 3EO4A 3S6HA 5J8FA 4ONUA 1N71A 2K5TA 5F48A 1U6MA 1MJ9A 3SHPA 1L0CA 2Q4YA 2PR1A 1YREA 1S60A 2P0WA 2WPXA 1P0HA 4YRHA 4F6AA 4JD6A 4KOYA 3DR6A 4H89A 3KKWA 5F49A 4QB9A 4CRZB 2WPWA 1I12A 3MGDA 2HQYA 3LD2A 1NE9A 4KVME 2VXKA 3DDDA 4F0YA 1M4DA 3D8PA 2FCKA 5C82A 2J8MA 2G3AA 4I49A 2DXQA 4HNXB 2R98A 2CNSA 3EC4A 1XIXA 2FXFA 1S7LA 1YR0A 5J8CA 4U9YA 2PSWA 4NSQA 3GY9A 3CXQA 4H6ZA 3WR7A 3TO9A 3FIXA 4R57A 2R8VA 3G3SA 1PUAA 3TFYA 1M44A 3EXNA 3FNCA 2CNTA 1CJWA 1IYKA 2Q0YA 3R9EA 3D3SA 4Y49B 2BL1A 3FB3A 4E0AA 3FBUA 2I79A 4PSXA 1Q2CA 1RO5A 2RC4A 1J4JA 4QC6A 4ZBGA 2BUEA 1YVOA 4EVYA 1YX0A 1QSNA 2QECA 3I9SA 2O28A 2ZPAA 5IX3A 2X7BA 2P6FA 1YLEA 2FIAA 1YK3A 1IYLA 4AVCA 4E8OA 3RYOA 4PK2A 3F5BA 3G8WA 4R9MA 2GANA 2G3TA 2OZUA 4OLLA 1SQHA 3V8IA 1V0CA 4RI1A 3SXOA 4PSWA 1QSMA 4UWJA 4ORFA 4AVAA 2PDOA 4FD4A 1S3ZA 1LRZA 2QIRA 4MBUA 2REFA 1NSLA 1ON0A 3VWDA 4NF1A 4B5PB 1KUVA 2B5GA 3S6FA 5F46A 2P6EA 4KORA 3R9GA 1KUYA 4JWPA 2JEVA 1QSOA 2FT0A 3VWEA 1MJAA 2B3VA 5JQ4A 2ZXVA 1KUXA 4B5OA 1XF8A 2AJ6A 2FE7A 3R96A 3T9YA 5DWMA 4CAVA 4MY0A 4JXQA 3TE4A 3D2MA 3OWCA 4QBJA 4K30A 2KCWA 3BLNA 1OZPA 5JPHA 3N7ZA 5DWNA 2Q4VA 4UWIA 4XNHC 3S6GA 3D2PA 1S5KA 2OZGA 4L89A 1QSTA 5ISVA 4YGOA 3EFAA 3E0KA 2PQ8A 4AB7A 5F47A 4KOSA 2JLMA 3W6SA 3P2FA 2C27A 4R87A 4XPDC 4FD7A 4J3GA 2B4DB 2QMLA 2I00A 2R1IA 4MI4A 3I3GA 4CRYB 5EBVA 4E2AA 2R7HA 4L8AA 5KTCA 3R95A 3ZJ0A 4RS2A 4XPLA 1VHSA 4JXRA 3R9FA 4KOTA 5FVJA 4CAWA 2FS5A 3ZZIA 2G0BA 1M4GA 1TIQA 4AG9A 1Z4EA 3FYNA 2B3UA 2F5IA 2H5MA 3S6KA 1R57A 3LODA 1YVKA 4CAXA 4IF5A 2Z10A 2Q44A 1Z9UA 3DSBA 1NMTA 5CNPA 3B8GA 3QAHA 1Y9KA 2HV2A 5KTDA 1P4NA 1I21A 1VKCA 3EY5A 2ARHA 2PR8A 1Z4RA 4KVOE 4KOXA 2ZW5A 3TCVA 3BJ7A 4NEXA 2B4BA 1CM0A 3K9UA 3CXPA 3JVNA 1B6BA 3P2HA 4M85A 2VI7A 4R3LA 5EC4A 2JDCA 5IV0A 2AE6A 3R1KA 4B5PA 2NMTA 1BO4A 4H6UA 2Q04A 2BSWA 5KTAA 4QUSA 2VEZA 4XNHB 4MHDA 4AVBA 2VQYA 2Y0MA 5HMNA 2VZYA 5I0CA 1XMTA 5HH1A 4HNYB 3TO7A 5E96A 4X5KA 4HNWB 3SXNA 5GCNA 4JLYA 4MJ8A 3H4QA 3NE7A 4JJXA 2CNMA 4OAEA 4XPDB 5C88A 1MJBA 1YGHA 3QB8A 3DNSA 4FD6A 3T90A 1RXTA 1S7FA 3GKRA 3TOAA 2CY2A 2PC1A 4QVTA 1BOBA 4M3SA 3DR8A 3FXTA 2VZZA 4LX9A 2EVNA 4KOVA 1S7KA 1Y9WA 2EUIA 3FRMA 2OZHA 4KOWA 1UFHA 4OADA 1M4IA 3PP9A 2FL4A 4NCZA 2A4NA 2ZW4A 2ZW7A 2B4DA 2FSRA 3GYAA 1FY7A 1IIDA 4CS0B 3TT2A 5H86A 4KUAA 4PV6A 3W91A 2ATRA 1WWZA 2OH1A 3CXSA 2PRBA 1Y7RA 4UA3A 2J8RA 2GE3A 1Q2DA 2OU2A 4NXYA 4GS4A 5H84A 3W6XA 4FD5A 4R3KA 2Z0ZA 4II9A 4XPKA 4KUBA 4PK3A 2OB0A 4KLVA 1PU9A 1XE4A 1XEBA 1Q2YA 1MK4A 2JDDA 2REEA 2GIVA 4KOUA 3C26A 2ZW6A 2D4OA 2IL4A 2Z11A 2FIWA 4HKFA 1I1DA 1IICA 4KZTA 3IGRA 4U5YA 4DNCA 3PZJA 2BEIA 3F8KA 4U9ZA 1B87A 4BMHA 4KVXA 1M1DA 2VBQA 1GHEA 4Y49C 3UY5A 4MY3A 4UBRA 4AG7A 1S7NA 1IB1E 2B58A 4YFJA 4IUSA 2D4PA 5IB0A 3PGPA 3TOBA 4LUAA 3TTHA 3TO6A 4KLWA 3BJ8A 1WK4A 3JUWA
chains in the Genus database with same CATH superfamily
4NGTA 3D68A 4KSFA 1KZFA 3WABA 2B5GB 2J8NA 1K4JA 3D7FA 5AG6A 1QSRA 2PJ4A 4LQGA 3HUVA 4C2ZA 2Q7BA 1LOKA 4Q7AA 1YMEA 3PFEA 2C6PA 2J9AA 4OC5A 1ZLIA 3F0AA 2HC9A 5HXDA 2P6GA 2WSAA 3IWGA 4OC2A 5G20A 2HUZA 3EO4A 2EO8A 1PCAA 4OMEA 3S6HA 4AXVA 5J8FA 4IAVA 4GXHA 1ZO0A 3NH5A 1N71A 2K5TA 4ONUA 2I3CA 5F48A 2C6GA 1R43A 1U6MA 1MJ9A 3SHPA 1L0CA 2Q4YA 1DTDA 1Y7EA 2PR1A 1YREA 1S60A 2WYRA 3IJ3A 1QQ9A 2P0WA 5G22A 2WPXA 4A2ZA 4OIWA 3WC5A 1P0HA 4YRHA 4F6AA 1HDQA 4JD6A 3PFOA 4KOYA 1IGBA 4KSAA 2IMOA 3DR6A 1XRYA 2EBJA 3RO0A 3IFEA 3B7IA 3KKWA 4H89A 5F49A 4MHNA 4QB9A 4CRZB 2WPWA 4P4IA 1I12A 3MGDA 2XEJA 1R3NA 2HQYA 3LD2A 1NE9A 4KVME 4OC3A 2VXKA 3RAMA 3DDDA 4F0YA 1M4LA 1M4DA 2C6CA 3D8PA 2FCKA 3FECA 5C82A 1JQGA 2J8MA 5CPAA 3PB4X 2G3AA 4I49A 2AFSA 1Z2LA 2PIYA 2DXQA 2F7VA 3IU2A 3LWUA 4HNXB 4CGMA 2Q4ZA 4DJLA 2R98A 4P4EA 2CNSA 3EC4A 4MCSA 1XIXA 1YLOA 3B35A 3KR4A 4P45A 2FXFA 3VATA 5LYFA 1S7LA 1YR0A 5J8CA 1BPNA 1NSAA 4U9YA 2PSWA 4NSQA 1IU8A 3GY9A 3CXQA 4H6ZA 3WR7A 3TO9A 4B6ZA 4ZY2A 1Y0YA 2PJAA 3FIXA 4R57A 2R8VA 2ZEPA 4A95A 3G3SA 1VHEA 1YQEA 4MFQA 3JTKA 2AFMA 1PUAA 4ZYQA 3L2NA 3TFYA 3B3SA 1M44A 3EXNA 4MFLA 1YSJA 3FNCA 2CNTA 1CJWA 2RFHA 1IYKA 1CPXA 3NFZA 4ZX8A 2Q0YA 4X3RA 3QNVA 3KASA 2PVVA 3A9LA 3R9EA 3D3SA 4Y49B 5K8MA 2FVGA 4CYPA 2BL1A 2IQ6A 3FB3A 4E0AA 2XEIA 3FBUA 2I79A 4PSXA 3KGQA 1Z8WA 5DS0A 1VIXA 1Q2CA 1RO5A 2RC4A 2ZOGA 3V7ZA 1J4JA 4QC6A 4ZBGA 3CPAA 4M6HA 2BUEA 1YVOA 3CPXA 4EVYA 4UFXA 1XOVA 1YX0A 4TNUA 1QSNA 5D8NA 4A33A 1CBXA 2QECA 3I9SA 3JRUA 2Z3PA 4UCMA 2O28A 5ELYA 2ZPAA 4NJRA 3SI2A 5IX3A 2X7BA 2P6FA 3NA6A 1YLEA 1Z8LA 2FIAA 1YK3A 4MFZA 4OC4A 1IYLA 4PPZA 4AVCA 1F57A 5G1ZA 1TF9A 3FJUA 4E8OA 2DEAA 1F2PA 3RYOA 4R6TA 4MCPA 4PK2A 4B11A 3F5BA 3G8WA 3LMSA 4R9MA 1VHOA 1LFWA 3FEEA 3WC7A 2BOAA 2G9DA 2GANA 2G3TA 4M6GA 2OZUA 4F9UA 3CT9A 4OLLA 4UF4A 1SQHA 3V8IA 2AFZA 1V0CA 2GREA 3DLJA 4RI1A 3SXOA 4PSWA 1QSMA 4UWJA 3TC8A 3N5FA 4ORFA 2ODFA 4AVAA 2PDOA 4FD4A 1S3ZA 2DPSA 1LRZA 2PJ5A 2QIRA 4NGMA 4UEFA 4MBUA 1LAPA 2REFA 4HPSA 2Z3LA 1NSLA 1HEEA 1ON0A 2V8DA 3VWDA 8CPAA 4NF1A 1GYTA 1IOFA 1FNOA 4B5PB 3MN8A 4F0XA 1KUVA 2B5GA 4UCNA 3S6FA 2P6EA 5F46A 4KORA 3R9GA 2PJ8A 3WT4A 1KUYA 4JWPA 6CPAA 4PXEA 4JYWA 2JEVA 1QSOA 2ZENA 3SJFA 4H2KA 3RBUA 1XFOA 3KR5A 2FT0A 4NGRA 3VWEA 3WC6A 1MJAA 4IK2A 2B3VA 3BHXA 3PB7X 3KZWA 3FMCA 2AFOA 5JQ4A 2ZXVA 1KUXA 3FF3A 4W9YA 4A32A 4B5OA 1XF8A 4YU9A 2AJ6A 2FE7A 2PCUA 2YNDA 3R96A 5DWMA 3T9YA 3VH9A 4CAVA 1AYEA 4MY0A 4JXQA 3IWEA 7CPAA 3LACA 3TE4A 3D2MA 3OWCA 4QBJA 4K30A 2KCWA 3BLNA 2ZELA 3SJGA 3GLJA 4A38A 3GB0A 3S9NA 1OZPA 5JPHA 3N7ZA 4CAFA 2XEGA 5K8PA 2CTBA 3ISXA 5DWNA 1BPMA 2Q4VA 4NGNA 4UWIA 4XNHC 2EWBA 3S6GA 4CYNA 4KS9A 2PJ2A 4ZY0A 3D2PA 2NSMA 1CP7A 2O4HA 2DPTA 2XEFA 3BXMA 1ZG9A 4P6YA 1TF8A 2Q43A 4EFDA 1S5KA 2OZGA 4Z65A 4L89A 1QSTA 5ISVA 4YGOA 5LYIA 3PBBA 1YW4A 3EFAA 3E0KA 1VGYA 3D7HA 2PQ8A 4R7MA 4AB7A 2HB6A 5F47A 1CX8A 4KOSA 4RUHA 4A39A 2JLMA 2Z3OA 3D4UA 1RTQA 3P2FA 3W6SA 2C27A 2CF4A 4R87A 4C7IA 5BWAB 4XPDC 3IEHA 2JEWA 4FD7A 4NGSA 4X2TA 2POKA 4J3GA 2NYQA 5IB9A 2DF5A 2B4DB 5J1QA 2QMLA 4C7HA 2I00A 2R1IA 1ARLA 4MI4A 2Z3MA 3I3GA 5EMIA 4CRYB 1ZG7A 3KI9A 1AMPA 2PJ0A 4K3NA 5EBVA 4ONWA 4MCRA 4OC1A 4UIBA 4E2AA 1ARMA 2R7HA 3NH8A 4L8AA 2EK8A 3R95A 3ZJ0A 4NFRA 5KTCA 4RS2A 4XPLA 5AG4A 1VHSA 4JXRA 4NJQA 4PXBA 3R9FA 4KOTA 5FVJA 4CAWA 5K8OA 2FS5A 3D67A 3ZZIA 5I4MA 5LRGA 2O53A 2G0BA 4TWEA 5A27A 4A30A 1M4GA 1TIQA 1XMBA 3IIBA 4AG9A 3NE8A 1Z4EA 4JZ0A 5LRJA 3FYNA 2B3UA 2VL1A 2F5IA 4UIAA 2H5MA 3S6KA 1R57A 4M6IA 3KQZA 3LODA 5D29A 4OIDA 1YVKA 4CAXA 4IF5A 2Z10A 2Q44A 2F8HA 1Z9UA 3DSBA 1NMTA 4UCPA 5CNPA 4CGNA 2RB7A 2AFUA 2QYVA 3B8GA 3K2KA 3PB6X 3B3TA 3QAHA 4IHMA 1Y9KA 4A31A 4P44A 2HV2A 2YNCA 4MFKA 5KTDA 1P4NA 1I21A 4DYOA 4B10A 2QJ8A 3PEIA 1VKCA 1TKJA 3CZXA 3EY5A 4NGQA 2ARHA 2CXAA 2GLJA 2PR8A 1Z4RA 5HVHA 2Q51A 4KVOE 4KOXA 2ZW5A 5LRKA 3TCVA 2OR4A 1TKHA 3BJ7A 4NEXA 4Q38A 1JWQA 2B4BA 1CM0A 4WJBA 1CPSA 3K9UA 5HVGA 4UFVA 4FBEA 4R76A 3CXPA 3JVNA 3KHXA 4CGPA 4P10A 4UFWA 4ZY1A 1B6BA 4MFPA 4P4DA 3RZAA 3BI1A 3P2HA 1Y0RA 1CP6A 2VI7A 4M85A 4R3LA 4ZI6A 4FUUA 4PXCA 3TX8A 1X12A 3H5ZA 5EC4A 5CBMA 2JDCA 3IO1A 4FAIA 5IV0A 2AE6A 1FT7A 3R1KA 4B5PA 4OP4A 2NMTA 1BO4A 4H6UA 3MRUA 1QMUA 2ZEGA 1EE3P 5AG5A 1CG2A 2Q04A 2BSWA 2ZEOA 4UEZA 4QUSA 3T8WA 5KTAA 2VEZA 4XNHB 1Z5RA 4MHDA 4EMEA 4AVBA 2VQYA 2Y0MA 3FVLA 4CGOA 5HMNA 2BO9A 4A37A 2VZYA 4C2XA 2AFWA 5I0CA 1XMTA 5HH1A 3PB8X 4HNYB 3TO7A 2ZEHA 2PJCA 5E96A 3FEDA 4X5KA 2YNEA 4OC0A 4HNWB 3SXNA 1IOIA 4FWUA 4UEEA 5GCNA 4JLYA 5A28A 4MJ8A 3B3CA 3H4QA 3NE7A 2V8VA 4JJXA 3NH4A 4B13A 1KWMA 2CNMA 4OAEA 4C2YA 4XPDB 5AGEA 2PRQA 2YGWA 5C88A 4P4BA 1XJOA 4B12A 1MJBA 1YGHA 3QB8A 3DNSA 4A94A 2GU2A 2IJZA 4FD6A 3T90A 4DUKA 1RXTA 1S7FA 4MHPA 3S9MA 3GKRA 1YW6A 2JBKA 3TOAA 3IWWA 1XBUA 3H8EA 3FX6A 2CY2A 1Q7LA 2PC1A 2ZEMA 2V77A 1BOBA 4QVTA 4M3SA 3HLPA 3DR8A 3FXTA 2VZZA 5JH9A 4LX9A 1Z8TA 2EVNA 4KOVA 4BINA 1S7KA 2BCOA 1Y9WA 4MHZA 2ZEEA 2EUIA 2V8HA 3FRMA 3SJEA 3D7DA 2OZHA 4KOWA 2ZOFA 3BI0A 3D66A 5G21A 2AFXA 1UFHA 3FH4A 2CIJA 4OADA 3SJXA 1M4IA 5JM6A 4MRIA 1LCPA 3PP9A 1BLLE 2FL4A 4KSIA 3QAYA 4NCZA 4MCQA 5LYLA 2A4NA 2Z3NA 4CPAA 2ZW4A 2ZW7A 2B4DA 2FSRA 1BAVA 3GYAA 4F8ZA 3GIUA 1FY7A 1IIDA 4CS0B 3GUXA 3SI1A 1ELLP 2GFQA 2Q7SA 4Q36A 3TT2A 5H86A 4KUAA 4PV6A 3W91A 2ATRA 1WWZA 2OH1A 1LAMA 2ZEDA 3CXSA 2PRBA 1Y7RA 3B2YA 4UA3A 2J8RA 2GE3A 3KHZA 2PIZA 1Q2DA 4CGLA 1F2OA 2OU2A 4NXYA 2Z3KA 3D7GA 3DGVA 4GS4A 5H84A 3W6XA 4MXUA 4C68A 4FD5A 4BBHA 5K8NA 4CAEA 3RNZA 4R3KA 3KQXA 2Z0ZA 5HVFA 4II9A 3KL9A 5F09A 4XPKA 4KUBA 2PJ6A 1HDUA 4PK3A 1ZLHA 2OB0A 1PU9A 1XE4A 4KLVA 1XEBA 3PB9X 5LYDA 4OKOA 1Q2YA 3IU1A 1MK4A 2ZEFA 2JDDA 1Z8XA 2REEA 2ANPA 2EK9A 1IY7A 2WUUA 2GIVA 4KOUA 3C26A 2ZW6A 4LQ6A 2D4OA 2IL4A 3K9TA 5AG7A 2OOTA 3ISZA 1ELMP 4RN7A 2Z11A 3B3WA 2FIWA 2PJBA 1TKFA 4HKFA 4ZX9A 3PBEA 1I1DA 1IICA 1H8LA 4O23A 4X8IA 4KZTA 4EWTA 3IGRA 4U5YA 4F9VA 4P4FA 2WZNA 4DNCA 3PZJA 3V38A 4B14A 3H8GA 4MFJA 2BEIA 3F8KA 2JBJA 4U9ZA 3VARA 1B87A 4CYQA 4BMHA 5JGFA 1AUGA 1OBRA 4KVXA 4G1PA 2PJ7A 4PQAA 1ZG8A 1M1DA 2VBQA 2V8GA 3H8FA 3S9LA 3CDXA 4MMOA 2CTCA 1GHEA 4ZGYB 4Y49C 3UY5A 4WWVA 2GLFA 1LANA 4MY3A 4UBRA 1TXRA 4BD9A 4MHYA 4AG7A 2C1CA 1A2ZA 2PJ9A 4R8FA 2PJ1A 1S7NA 4GM5A 1X10A 1PYTB 2ABZA 3IC1A 1UWYA 1IB1E 3I1UA 2QVPA 2PJ3A 3PRTA 2B58A 4YFJA 4NGPA 4CYOA 3SI0A 1DE4C 4IUSA 2D4PA 5IB0A 3PGPA 5THWA 4P4JA 4PXDA 3TOBA 4LUAA 3TTHA 3TO6A 2PE3A 4KLWA 2YNCC 3BJ8A 2PVWA 3B3VA 1WK4A 3JUWA 4YWYA
chains in the Genus database with same CATH topology
4KSFA 1KZFA 2B5GB 2J8NA 1K4JA 5AG6A 1QSRA 4C2ZA 2Q7BA 3F0AA 2P6GA 2WSAA 3IWGA 5G20A 2HUZA 3EO4A 3S6HA 5J8FA 1ZO0A 4ONUA 1N71A 2K5TA 5F48A 1U6MA 1MJ9A 3SHPA 1L0CA 2Q4YA 4BBHA 2PR1A 1YREA 1S60A 5G22A 2P0WA 2WPXA 4A2ZA 1P0HA 4YRHA 4F6AA 4JD6A 4KOYA 4KSAA 3DR6A 4H89A 3KKWA 5F49A 4QB9A 4CRZB 2WPWA 1I12A 3MGDA 2HQYA 3LD2A 1NE9A 4KVME 2VXKA 3DDDA 4F0YA 1M4DA 3D8PA 2FCKA 5C82A 2J8MA 2G3AA 4I49A 2DXQA 3IU2A 4HNXB 4CGMA 2R98A 2CNSA 3EC4A 1XIXA 2FXFA 1S7LA 1YR0A 5J8CA 4U9YA 2PSWA 4NSQA 3GY9A 3CXQA 4H6ZA 3WR7A 3TO9A 3FIXA 4R57A 4A95A 2R8VA 3G3SA 4MFQA 3JTKA 1PUAA 3TFYA 1M44A 3EXNA 4MFLA 3FNCA 2CNTA 1CJWA 1IYKA 2Q0YA 3A9LA 3R9EA 3D3SA 4Y49B 4CYPA 2BL1A 3FB3A 4E0AA 3FBUA 2I79A 4PSXA 1Q2CA 1RO5A 2RC4A 1J4JA 4QC6A 4ZBGA 2BUEA 1YVOA 4EVYA 4UFXA 4A33A 1YX0A 1QSNA 2QECA 3I9SA 2Z3PA 4UCMA 2O28A 2ZPAA 5IX3A 2X7BA 2P6FA 1YLEA 2FIAA 1YK3A 4MFZA 1IYLA 4AVCA 5G1ZA 4E8OA 3RYOA 4PK2A 4B11A 3F5BA 3G8WA 4R9MA 2GANA 2G3TA 2OZUA 4OLLA 1SQHA 3V8IA 1V0CA 4RI1A 3SXOA 4PSWA 1QSMA 4UWJA 4ORFA 4AVAA 2PDOA 4FD4A 1S3ZA 2DPSA 1LRZA 2QIRA 4MBUA 2REFA 2Z3LA 1NSLA 1ON0A 3VWDA 4NF1A 4B5PB 4F0XA 1KUVA 2B5GA 4UCNA 3S6FA 2P6EA 5F46A 4KORA 3R9GA 1KUYA 4JWPA 2JEVA 1QSOA 2FT0A 3VWEA 1MJAA 2B3VA 5JQ4A 2ZXVA 1KUXA 4A32A 4B5OA 1XF8A 2AJ6A 2FE7A 2YNDA 3R96A 3T9YA 5DWMA 4CAVA 4MY0A 4JXQA 3IWEA 3TE4A 3D2MA 3OWCA 4QBJA 4K30A 2KCWA 3BLNA 1OZPA 5JPHA 3N7ZA 4CAFA 5DWNA 2Q4VA 4UWIA 4XNHC 3S6GA 4CYNA 4KS9A 3D2PA 2DPTA 1S5KA 2OZGA 4L89A 1QSTA 5ISVA 4YGOA 3EFAA 3E0KA 2PQ8A 4AB7A 5F47A 4KOSA 2JLMA 2Z3OA 3W6SA 3P2FA 2C27A 4R87A 4C7IA 5BWAB 4XPDC 4FD7A 4J3GA 2B4DB 2QMLA 4C7HA 2I00A 2R1IA 4MI4A 2Z3MA 3I3GA 4CRYB 5EBVA 4E2AA 2R7HA 4L8AA 5KTCA 3R95A 3ZJ0A 4RS2A 4XPLA 5AG4A 1VHSA 4JXRA 3R9FA 4KOTA 5FVJA 4CAWA 2FS5A 3ZZIA 2G0BA 5A27A 4A30A 1M4GA 1TIQA 4AG9A 1Z4EA 3FYNA 2B3UA 2F5IA 2H5MA 3S6KA 1R57A 3LODA 1YVKA 4CAXA 4IF5A 2Z10A 2Q44A 1Z9UA 3DSBA 1NMTA 4UCPA 5CNPA 4CGNA 3B8GA 3QAHA 4A31A 1Y9KA 2HV2A 2YNCA 4MFKA 5KTDA 1P4NA 1I21A 4B10A 1VKCA 3EY5A 2ARHA 2CXAA 2PR8A 1Z4RA 4KVOE 4KOXA 2ZW5A 3TCVA 3BJ7A 4NEXA 4Q38A 2B4BA 1CM0A 3K9UA 4UFVA 3CXPA 3JVNA 4CGPA 4UFWA 1B6BA 4MFPA 3P2HA 4M85A 2VI7A 4R3LA 3H5ZA 5EC4A 2JDCA 5IV0A 2AE6A 3R1KA 4B5PA 2NMTA 1BO4A 4H6UA 5AG5A 2Q04A 2BSWA 5KTAA 4QUSA 2VEZA 4XNHB 4MHDA 4AVBA 2VQYA 2Y0MA 4CGOA 5HMNA 2VZYA 4C2XA 5I0CA 1XMTA 5HH1A 4HNYB 3TO7A 5E96A 4X5KA 2YNEA 4HNWB 3SXNA 5GCNA 4JLYA 5A28A 4MJ8A 3H4QA 3NE7A 4JJXA 4B13A 2CNMA 4OAEA 4C2YA 4XPDB 5AGEA 5C88A 2YGWA 4B12A 1MJBA 1YGHA 3QB8A 3DNSA 4FD6A 3T90A 1RXTA 1S7FA 3GKRA 3TOAA 2CY2A 2PC1A 4QVTA 1BOBA 4M3SA 3DR8A 3FXTA 2VZZA 4LX9A 2EVNA 4KOVA 1S7KA 1Y9WA 2EUIA 3FRMA 2OZHA 4KOWA 5G21A 1UFHA 4OADA 1M4IA 3PP9A 2FL4A 4NCZA 2A4NA 2Z3NA 2ZW4A 2ZW7A 2B4DA 2FSRA 3GYAA 1FY7A 1IIDA 4CS0B 4Q36A 3TT2A 5H86A 4KUAA 4PV6A 3W91A 2ATRA 1WWZA 2OH1A 3CXSA 2PRBA 1Y7RA 4UA3A 2J8RA 2GE3A 1Q2DA 4CGLA 2OU2A 4NXYA 2Z3KA 4GS4A 5H84A 3W6XA 4C68A 4FD5A 4CAEA 4R3KA 2Z0ZA 4II9A 4XPKA 4KUBA 4PK3A 2OB0A 4KLVA 1PU9A 1XE4A 1XEBA 1Q2YA 3IU1A 1MK4A 2JDDA 2REEA 2WUUA 2GIVA 4KOUA 3C26A 2ZW6A 2D4OA 2IL4A 5AG7A 2Z11A 2FIWA 4HKFA 1I1DA 1IICA 4KZTA 3IGRA 4U5YA 4DNCA 3PZJA 4B14A 4MFJA 2BEIA 3F8KA 4U9ZA 1B87A 4CYQA 4BMHA 4KVXA 1M1DA 2VBQA 1GHEA 4ZGYB 4Y49C 3UY5A 4MY3A 4UBRA 4AG7A 1S7NA 1IB1E 2B58A 4YFJA 4CYOA 4IUSA 2D4PA 5IB0A 3PGPA 3TOBA 4LUAA 3TTHA 3TO6A 4KLWA 2YNCC 3BJ8A 1WK4A 3JUWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KZF A;  2B5G B;  2J8N A;  1K4J A;  1QSR A;  2Q7B A;  3F0A A;  2P6G A;  3IWG A;  2HUZ A;  3EO4 A;  3S6H A;  5J8F A;  4ONU A;  1N71 A;  2K5T A;  5F48 A;  1U6M A;  1MJ9 A;  3SHP A;  1L0C A;  2Q4Y A;  2PR1 A;  1YRE A;  1S60 A;  2P0W A;  2WPX A;  1P0H A;  4YRH A;  4F6A A;  4JD6 A;  4KOY A;  3DR6 A;  4H89 A;  3KKW A;  5F49 A;  4QB9 A;  4CRZ B;  2WPW A;  1I12 A;  3MGD A;  2HQY A;  3LD2 A;  1NE9 A;  4KVM E;  2VXK A;  3DDD A;  4F0Y A;  1M4D A;  3D8P A;  2FCK A;  5C82 A;  2J8M A;  2G3A A;  4I49 A;  2DXQ A;  4HNX B;  2R98 A;  2CNS A;  3EC4 A;  1XIX A;  2FXF A;  1S7L A;  1YR0 A;  5J8C A;  4U9Y A;  2PSW A;  4NSQ A;  3GY9 A;  3CXQ A;  4H6Z A;  3WR7 A;  3TO9 A;  3FIX A;  4R57 A;  2R8V A;  3G3S A;  1PUA A;  3TFY A;  1M44 A;  3EXN A;  3FNC A;  2CNT A;  1CJW A;  1IYK A;  2Q0Y A;  3R9E A;  3D3S A;  4Y49 B;  2BL1 A;  3FB3 A;  4E0A A;  3FBU A;  2I79 A;  4PSX A;  1Q2C A;  1RO5 A;  2RC4 A;  1J4J A;  4QC6 A;  4ZBG A;  2BUE A;  1YVO A;  4EVY A;  1YX0 A;  1QSN A;  2QEC A;  3I9S A;  2O28 A;  2ZPA A;  5IX3 A;  2X7B A;  2P6F A;  1YLE A;  2FIA A;  1YK3 A;  1IYL A;  4AVC A;  4E8O A;  3RYO A;  4PK2 A;  3F5B A;  3G8W A;  4R9M A;  2GAN A;  2G3T A;  2OZU A;  4OLL A;  1SQH A;  3V8I A;  1V0C A;  4RI1 A;  3SXO A;  4PSW A;  1QSM A;  4UWJ A;  4ORF A;  4AVA A;  2PDO A;  4FD4 A;  1S3Z A;  1LRZ A;  2QIR A;  4MBU A;  2REF A;  1NSL A;  1ON0 A;  3VWD A;  4NF1 A;  4B5P B;  1KUV A;  2B5G A;  3S6F A;  5F46 A;  2P6E A;  4KOR A;  3R9G A;  1KUY A;  4JWP A;  2JEV A;  1QSO A;  2FT0 A;  3VWE A;  1MJA A;  2B3V A;  5JQ4 A;  2ZXV A;  1KUX A;  4B5O A;  1XF8 A;  2AJ6 A;  2FE7 A;  3R96 A;  3T9Y A;  5DWM A;  4CAV A;  4MY0 A;  4JXQ A;  3TE4 A;  3D2M A;  3OWC A;  4QBJ A;  4K30 A;  2KCW A;  3BLN A;  1OZP A;  5JPH A;  3N7Z A;  5DWN A;  2Q4V A;  4UWI A;  4XNH C;  3S6G A;  3D2P A;  1S5K A;  2OZG A;  4L89 A;  1QST A;  5ISV A;  4YGO A;  3EFA A;  3E0K A;  2PQ8 A;  4AB7 A;  5F47 A;  4KOS A;  2JLM A;  3W6S A;  3P2F A;  2C27 A;  4R87 A;  4XPD C;  4FD7 A;  4J3G A;  2B4D B;  2QML A;  2I00 A;  2R1I A;  4MI4 A;  3I3G A;  4CRY B;  5EBV A;  4E2A A;  2R7H A;  4L8A A;  5KTC A;  3R95 A;  3ZJ0 A;  4RS2 A;  4XPL A;  1VHS A;  4JXR A;  3R9F A;  4KOT A;  5FVJ A;  4CAW A;  2FS5 A;  3ZZI A;  2G0B A;  1M4G A;  1TIQ A;  4AG9 A;  1Z4E A;  3FYN A;  2B3U A;  2F5I A;  2H5M A;  3S6K A;  1R57 A;  3LOD A;  1YVK A;  4CAX A;  4IF5 A;  2Z10 A;  2Q44 A;  1Z9U A;  3DSB A;  1NMT A;  5CNP A;  3B8G A;  3QAH A;  1Y9K A;  2HV2 A;  5KTD A;  1P4N A;  1I21 A;  1VKC A;  3EY5 A;  2ARH A;  2PR8 A;  1Z4R A;  4KVO E;  4KOX A;  2ZW5 A;  3TCV A;  3BJ7 A;  4NEX A;  2B4B A;  1CM0 A;  3K9U A;  3CXP A;  3JVN A;  1B6B A;  3P2H A;  4M85 A;  2VI7 A;  4R3L A;  5EC4 A;  2JDC A;  5IV0 A;  2AE6 A;  3R1K A;  4B5P A;  2NMT A;  1BO4 A;  4H6U A;  2Q04 A;  2BSW A;  5KTA A;  4QUS A;  2VEZ A;  4XNH B;  4MHD A;  4AVB A;  2VQY A;  2Y0M A;  5HMN A;  2VZY A;  5I0C A;  1XMT A;  5HH1 A;  4HNY B;  3TO7 A;  5E96 A;  4X5K A;  4HNW B;  3SXN A;  5GCN A;  4JLY A;  4MJ8 A;  3H4Q A;  3NE7 A;  4JJX A;  2CNM A;  4OAE A;  4XPD B;  5C88 A;  1MJB A;  1YGH A;  3QB8 A;  3DNS A;  4FD6 A;  3T90 A;  1RXT A;  1S7F A;  3GKR A;  3TOA A;  2CY2 A;  2PC1 A;  4QVT A;  1BOB A;  4M3S A;  3DR8 A;  3FXT A;  2VZZ A;  4LX9 A;  2EVN A;  4KOV A;  1S7K A;  1Y9W A;  2EUI A;  3FRM A;  2OZH A;  4KOW A;  1UFH A;  4OAD A;  1M4I A;  3PP9 A;  2FL4 A;  4NCZ A;  2A4N A;  2ZW4 A;  2ZW7 A;  2B4D A;  2FSR A;  3GYA A;  1FY7 A;  1IID A;  4CS0 B;  3TT2 A;  5H86 A;  4KUA A;  4PV6 A;  3W91 A;  2ATR A;  1WWZ A;  2OH1 A;  3CXS A;  2PRB A;  1Y7R A;  4UA3 A;  2J8R A;  2GE3 A;  1Q2D A;  2OU2 A;  4NXY A;  4GS4 A;  5H84 A;  3W6X A;  4FD5 A;  4R3K A;  2Z0Z A;  4II9 A;  4XPK A;  4KUB A;  4PK3 A;  2OB0 A;  4KLV A;  1PU9 A;  1XE4 A;  1XEB A;  1Q2Y A;  1MK4 A;  2JDD A;  2REE A;  2GIV A;  4KOU A;  3C26 A;  2ZW6 A;  2D4O A;  2IL4 A;  2Z11 A;  2FIW A;  4HKF A;  1I1D A;  1IIC A;  4KZT A;  3IGR A;  4U5Y A;  4DNC A;  3PZJ A;  2BEI A;  3F8K A;  4U9Z A;  1B87 A;  4BMH A;  4KVX A;  1M1D A;  2VBQ A;  1GHE A;  4Y49 C;  3UY5 A;  4MY3 A;  4UBR A;  4AG7 A;  1S7N A;  1IB1 E;  2B58 A;  4YFJ A;  4IUS A;  2D4P A;  5IB0 A;  3PGP A;  3TOB A;  4LUA A;  3TTH A;  3TO6 A;  4KLW A;  3BJ8 A;  1WK4 A;  3JUW A; 
#chains in the Genus database with same CATH topology
 4NGT A;  3D68 A;  4KSF A;  1KZF A;  3WAB A;  2B5G B;  2J8N A;  1K4J A;  3D7F A;  5AG6 A;  1QSR A;  2PJ4 A;  4LQG A;  3HUV A;  4C2Z A;  2Q7B A;  1LOK A;  4Q7A A;  1YME A;  3PFE A;  2C6P A;  2J9A A;  4OC5 A;  1ZLI A;  3F0A A;  2HC9 A;  5HXD A;  2P6G A;  2WSA A;  3IWG A;  4OC2 A;  5G20 A;  2HUZ A;  3EO4 A;  2EO8 A;  1PCA A;  4OME A;  3S6H A;  4AXV A;  5J8F A;  4IAV A;  4GXH A;  1ZO0 A;  3NH5 A;  1N71 A;  2K5T A;  4ONU A;  2I3C A;  5F48 A;  2C6G A;  1R43 A;  1U6M A;  1MJ9 A;  3SHP A;  1L0C A;  2Q4Y A;  1DTD A;  1Y7E A;  2PR1 A;  1YRE A;  1S60 A;  2WYR A;  3IJ3 A;  1QQ9 A;  2P0W A;  5G22 A;  2WPX A;  4A2Z A;  4OIW A;  3WC5 A;  1P0H A;  4YRH A;  4F6A A;  1HDQ A;  4JD6 A;  3PFO A;  4KOY A;  1IGB A;  4KSA A;  2IMO A;  3DR6 A;  1XRY A;  2EBJ A;  3RO0 A;  3IFE A;  3B7I A;  3KKW A;  4H89 A;  5F49 A;  4MHN A;  4QB9 A;  4CRZ B;  2WPW A;  4P4I A;  1I12 A;  3MGD A;  2XEJ A;  1R3N A;  2HQY A;  3LD2 A;  1NE9 A;  4KVM E;  4OC3 A;  2VXK A;  3RAM A;  3DDD A;  4F0Y A;  1M4L A;  1M4D A;  2C6C A;  3D8P A;  2FCK A;  3FEC A;  5C82 A;  1JQG A;  2J8M A;  5CPA A;  3PB4 X;  2G3A A;  4I49 A;  2AFS A;  1Z2L A;  2PIY A;  2DXQ A;  2F7V A;  3IU2 A;  3LWU A;  4HNX B;  4CGM A;  2Q4Z A;  4DJL A;  2R98 A;  4P4E A;  2CNS A;  3EC4 A;  4MCS A;  1XIX A;  1YLO A;  3B35 A;  3KR4 A;  4P45 A;  2FXF A;  3VAT A;  5LYF A;  1S7L A;  1YR0 A;  5J8C A;  1BPN A;  1NSA A;  4U9Y A;  2PSW A;  4NSQ A;  1IU8 A;  3GY9 A;  3CXQ A;  4H6Z A;  3WR7 A;  3TO9 A;  4B6Z A;  4ZY2 A;  1Y0Y A;  2PJA A;  3FIX A;  4R57 A;  2R8V A;  2ZEP A;  4A95 A;  3G3S A;  1VHE A;  1YQE A;  4MFQ A;  3JTK A;  2AFM A;  1PUA A;  4ZYQ A;  3L2N A;  3TFY A;  3B3S A;  1M44 A;  3EXN A;  4MFL A;  1YSJ A;  3FNC A;  2CNT A;  1CJW A;  2RFH A;  1IYK A;  1CPX A;  3NFZ A;  4ZX8 A;  2Q0Y A;  4X3R A;  3QNV A;  3KAS A;  2PVV A;  3A9L A;  3R9E A;  3D3S A;  4Y49 B;  5K8M A;  2FVG A;  4CYP A;  2BL1 A;  2IQ6 A;  3FB3 A;  4E0A A;  2XEI A;  3FBU A;  2I79 A;  4PSX A;  3KGQ A;  1Z8W A;  5DS0 A;  1VIX A;  1Q2C A;  1RO5 A;  2RC4 A;  2ZOG A;  3V7Z A;  1J4J A;  4QC6 A;  4ZBG A;  3CPA A;  4M6H A;  2BUE A;  1YVO A;  3CPX A;  4EVY A;  4UFX A;  1XOV A;  1YX0 A;  4TNU A;  1QSN A;  5D8N A;  4A33 A;  1CBX A;  2QEC A;  3I9S A;  3JRU A;  2Z3P A;  4UCM A;  2O28 A;  5ELY A;  2ZPA A;  4NJR A;  3SI2 A;  5IX3 A;  2X7B A;  2P6F A;  3NA6 A;  1YLE A;  1Z8L A;  2FIA A;  1YK3 A;  4MFZ A;  4OC4 A;  1IYL A;  4PPZ A;  4AVC A;  1F57 A;  5G1Z A;  1TF9 A;  3FJU A;  4E8O A;  2DEA A;  1F2P A;  3RYO A;  4R6T A;  4MCP A;  4PK2 A;  4B11 A;  3F5B A;  3G8W A;  3LMS A;  4R9M A;  1VHO A;  1LFW A;  3FEE A;  3WC7 A;  2BOA A;  2G9D A;  2GAN A;  2G3T A;  4M6G A;  2OZU A;  4F9U A;  3CT9 A;  4OLL A;  4UF4 A;  1SQH A;  3V8I A;  2AFZ A;  1V0C A;  2GRE A;  3DLJ A;  4RI1 A;  3SXO A;  4PSW A;  1QSM A;  4UWJ A;  3TC8 A;  3N5F A;  4ORF A;  2ODF A;  4AVA A;  2PDO A;  4FD4 A;  1S3Z A;  2DPS A;  1LRZ A;  2PJ5 A;  2QIR A;  4NGM A;  4UEF A;  4MBU A;  1LAP A;  2REF A;  4HPS A;  2Z3L A;  1NSL A;  1HEE A;  1ON0 A;  2V8D A;  3VWD A;  8CPA A;  4NF1 A;  1GYT A;  1IOF A;  1FNO A;  4B5P B;  3MN8 A;  4F0X A;  1KUV A;  2B5G A;  4UCN A;  3S6F A;  2P6E A;  5F46 A;  4KOR A;  3R9G A;  2PJ8 A;  3WT4 A;  1KUY A;  4JWP A;  6CPA A;  4PXE A;  4JYW A;  2JEV A;  1QSO A;  2ZEN A;  3SJF A;  4H2K A;  3RBU A;  1XFO A;  3KR5 A;  2FT0 A;  4NGR A;  3VWE A;  3WC6 A;  1MJA A;  4IK2 A;  2B3V A;  3BHX A;  3PB7 X;  3KZW A;  3FMC A;  2AFO A;  5JQ4 A;  2ZXV A;  1KUX A;  3FF3 A;  4W9Y A;  4A32 A;  4B5O A;  1XF8 A;  4YU9 A;  2AJ6 A;  2FE7 A;  2PCU A;  2YND A;  3R96 A;  5DWM A;  3T9Y A;  3VH9 A;  4CAV A;  1AYE A;  4MY0 A;  4JXQ A;  3IWE A;  7CPA A;  3LAC A;  3TE4 A;  3D2M A;  3OWC A;  4QBJ A;  4K30 A;  2KCW A;  3BLN A;  2ZEL A;  3SJG A;  3GLJ A;  4A38 A;  3GB0 A;  3S9N A;  1OZP A;  5JPH A;  3N7Z A;  4CAF A;  2XEG A;  5K8P A;  2CTB A;  3ISX A;  5DWN A;  1BPM A;  2Q4V A;  4NGN A;  4UWI A;  4XNH C;  2EWB A;  3S6G A;  4CYN A;  4KS9 A;  2PJ2 A;  4ZY0 A;  3D2P A;  2NSM A;  1CP7 A;  2O4H A;  2DPT A;  2XEF A;  3BXM A;  1ZG9 A;  4P6Y A;  1TF8 A;  2Q43 A;  4EFD A;  1S5K A;  2OZG A;  4Z65 A;  4L89 A;  1QST A;  5ISV A;  4YGO A;  5LYI A;  3PBB A;  1YW4 A;  3EFA A;  3E0K A;  1VGY A;  3D7H A;  2PQ8 A;  4R7M A;  4AB7 A;  2HB6 A;  5F47 A;  1CX8 A;  4KOS A;  4RUH A;  4A39 A;  2JLM A;  2Z3O A;  3D4U A;  1RTQ A;  3P2F A;  3W6S A;  2C27 A;  2CF4 A;  4R87 A;  4C7I A;  5BWA B;  4XPD C;  3IEH A;  2JEW A;  4FD7 A;  4NGS A;  4X2T A;  2POK A;  4J3G A;  2NYQ A;  5IB9 A;  2DF5 A;  2B4D B;  5J1Q A;  2QML A;  4C7H A;  2I00 A;  2R1I A;  1ARL A;  4MI4 A;  2Z3M A;  3I3G A;  5EMI A;  4CRY B;  1ZG7 A;  3KI9 A;  1AMP A;  2PJ0 A;  4K3N A;  5EBV A;  4ONW A;  4MCR A;  4OC1 A;  4UIB A;  4E2A A;  1ARM A;  2R7H A;  3NH8 A;  4L8A A;  2EK8 A;  3R95 A;  3ZJ0 A;  4NFR A;  5KTC A;  4RS2 A;  4XPL A;  5AG4 A;  1VHS A;  4JXR A;  4NJQ A;  4PXB A;  3R9F A;  4KOT A;  5FVJ A;  4CAW A;  5K8O A;  2FS5 A;  3D67 A;  3ZZI A;  5I4M A;  5LRG A;  2O53 A;  2G0B A;  4TWE A;  5A27 A;  4A30 A;  1M4G A;  1TIQ A;  1XMB A;  3IIB A;  4AG9 A;  3NE8 A;  1Z4E A;  4JZ0 A;  5LRJ A;  3FYN A;  2B3U A;  2VL1 A;  2F5I A;  4UIA A;  2H5M A;  3S6K A;  1R57 A;  4M6I A;  3KQZ A;  3LOD A;  5D29 A;  4OID A;  1YVK A;  4CAX A;  4IF5 A;  2Z10 A;  2Q44 A;  2F8H A;  1Z9U A;  3DSB A;  1NMT A;  4UCP A;  5CNP A;  4CGN A;  2RB7 A;  2AFU A;  2QYV A;  3B8G A;  3K2K A;  3PB6 X;  3B3T A;  3QAH A;  4IHM A;  1Y9K A;  4A31 A;  4P44 A;  2HV2 A;  2YNC A;  4MFK A;  5KTD A;  1P4N A;  1I21 A;  4DYO A;  4B10 A;  2QJ8 A;  3PEI A;  1VKC A;  1TKJ A;  3CZX A;  3EY5 A;  4NGQ A;  2ARH A;  2CXA A;  2GLJ A;  2PR8 A;  1Z4R A;  5HVH A;  2Q51 A;  4KVO E;  4KOX A;  2ZW5 A;  5LRK A;  3TCV A;  2OR4 A;  1TKH A;  3BJ7 A;  4NEX A;  4Q38 A;  1JWQ A;  2B4B A;  1CM0 A;  4WJB A;  1CPS A;  3K9U A;  5HVG A;  4UFV A;  4FBE A;  4R76 A;  3CXP A;  3JVN A;  3KHX A;  4CGP A;  4P10 A;  4UFW A;  4ZY1 A;  1B6B A;  4MFP A;  4P4D A;  3RZA A;  3BI1 A;  3P2H A;  1Y0R A;  1CP6 A;  2VI7 A;  4M85 A;  4R3L A;  4ZI6 A;  4FUU A;  4PXC A;  3TX8 A;  1X12 A;  3H5Z A;  5EC4 A;  5CBM A;  2JDC A;  3IO1 A;  4FAI A;  5IV0 A;  2AE6 A;  1FT7 A;  3R1K A;  4B5P A;  4OP4 A;  2NMT A;  1BO4 A;  4H6U A;  3MRU A;  1QMU A;  2ZEG A;  1EE3 P;  5AG5 A;  1CG2 A;  2Q04 A;  2BSW A;  2ZEO A;  4UEZ A;  4QUS A;  3T8W A;  5KTA A;  2VEZ A;  4XNH B;  1Z5R A;  4MHD A;  4EME A;  4AVB A;  2VQY A;  2Y0M A;  3FVL A;  4CGO A;  5HMN A;  2BO9 A;  4A37 A;  2VZY A;  4C2X A;  2AFW A;  5I0C A;  1XMT A;  5HH1 A;  3PB8 X;  4HNY B;  3TO7 A;  2ZEH A;  2PJC A;  5E96 A;  3FED A;  4X5K A;  2YNE A;  4OC0 A;  4HNW B;  3SXN A;  1IOI A;  4FWU A;  4UEE A;  5GCN A;  4JLY A;  5A28 A;  4MJ8 A;  3B3C A;  3H4Q A;  3NE7 A;  2V8V A;  4JJX A;  3NH4 A;  4B13 A;  1KWM A;  2CNM A;  4OAE A;  4C2Y A;  4XPD B;  5AGE A;  2PRQ A;  2YGW A;  5C88 A;  4P4B A;  1XJO A;  4B12 A;  1MJB A;  1YGH A;  3QB8 A;  3DNS A;  4A94 A;  2GU2 A;  2IJZ A;  4FD6 A;  3T90 A;  4DUK A;  1RXT A;  1S7F A;  4MHP A;  3S9M A;  3GKR A;  1YW6 A;  2JBK A;  3TOA A;  3IWW A;  1XBU A;  3H8E A;  3FX6 A;  2CY2 A;  1Q7L A;  2PC1 A;  2ZEM A;  2V77 A;  1BOB A;  4QVT A;  4M3S A;  3HLP A;  3DR8 A;  3FXT A;  2VZZ A;  5JH9 A;  4LX9 A;  1Z8T A;  2EVN A;  4KOV A;  4BIN A;  1S7K A;  2BCO A;  1Y9W A;  4MHZ A;  2ZEE A;  2EUI A;  2V8H A;  3FRM A;  3SJE A;  3D7D A;  2OZH A;  4KOW A;  2ZOF A;  3BI0 A;  3D66 A;  5G21 A;  2AFX A;  1UFH A;  3FH4 A;  2CIJ A;  4OAD A;  3SJX A;  1M4I A;  5JM6 A;  4MRI A;  1LCP A;  3PP9 A;  1BLL E;  2FL4 A;  4KSI A;  3QAY A;  4NCZ A;  4MCQ A;  5LYL A;  2A4N A;  2Z3N A;  4CPA A;  2ZW4 A;  2ZW7 A;  2B4D A;  2FSR A;  1BAV A;  3GYA A;  4F8Z A;  3GIU A;  1FY7 A;  1IID A;  4CS0 B;  3GUX A;  3SI1 A;  1ELL P;  2GFQ A;  2Q7S A;  4Q36 A;  3TT2 A;  5H86 A;  4KUA A;  4PV6 A;  3W91 A;  2ATR A;  1WWZ A;  2OH1 A;  1LAM A;  2ZED A;  3CXS A;  2PRB A;  1Y7R A;  3B2Y A;  4UA3 A;  2J8R A;  2GE3 A;  3KHZ A;  2PIZ A;  1Q2D A;  4CGL A;  1F2O A;  2OU2 A;  4NXY A;  2Z3K A;  3D7G A;  3DGV A;  4GS4 A;  5H84 A;  3W6X A;  4MXU A;  4C68 A;  4FD5 A;  4BBH A;  5K8N A;  4CAE A;  3RNZ A;  4R3K A;  3KQX A;  2Z0Z A;  5HVF A;  4II9 A;  3KL9 A;  5F09 A;  4XPK A;  4KUB A;  2PJ6 A;  1HDU A;  4PK3 A;  1ZLH A;  2OB0 A;  1PU9 A;  1XE4 A;  4KLV A;  1XEB A;  3PB9 X;  5LYD A;  4OKO A;  1Q2Y A;  3IU1 A;  1MK4 A;  2ZEF A;  2JDD A;  1Z8X A;  2REE A;  2ANP A;  2EK9 A;  1IY7 A;  2WUU A;  2GIV A;  4KOU A;  3C26 A;  2ZW6 A;  4LQ6 A;  2D4O A;  2IL4 A;  3K9T A;  5AG7 A;  2OOT A;  3ISZ A;  1ELM P;  4RN7 A;  2Z11 A;  3B3W A;  2FIW A;  2PJB A;  1TKF A;  4HKF A;  4ZX9 A;  3PBE A;  1I1D A;  1IIC A;  1H8L A;  4O23 A;  4X8I A;  4KZT A;  4EWT A;  3IGR A;  4U5Y A;  4F9V A;  4P4F A;  2WZN A;  4DNC A;  3PZJ A;  3V38 A;  4B14 A;  3H8G A;  4MFJ A;  2BEI A;  3F8K A;  2JBJ A;  4U9Z A;  3VAR A;  1B87 A;  4CYQ A;  4BMH A;  5JGF A;  1AUG A;  1OBR A;  4KVX A;  4G1P A;  2PJ7 A;  4PQA A;  1ZG8 A;  1M1D A;  2VBQ A;  2V8G A;  3H8F A;  3S9L A;  3CDX A;  4MMO A;  2CTC A;  1GHE A;  4ZGY B;  4Y49 C;  3UY5 A;  4WWV A;  2GLF A;  1LAN A;  4MY3 A;  4UBR A;  1TXR A;  4BD9 A;  4MHY A;  4AG7 A;  2C1C A;  1A2Z A;  2PJ9 A;  4R8F A;  2PJ1 A;  1S7N A;  4GM5 A;  1X10 A;  1PYT B;  2ABZ A;  3IC1 A;  1UWY A;  1IB1 E;  3I1U A;  2QVP A;  2PJ3 A;  3PRT A;  2B58 A;  4YFJ A;  4NGP A;  4CYO A;  3SI0 A;  1DE4 C;  4IUS A;  2D4P A;  5IB0 A;  3PGP A;  5THW A;  4P4J A;  4PXD A;  3TOB A;  4LUA A;  3TTH A;  3TO6 A;  2PE3 A;  4KLW A;  2YNC C;  3BJ8 A;  2PVW A;  3B3V A;  1WK4 A;  3JUW A;  4YWY A; 
#chains in the Genus database with same CATH homology
 4KSF A;  1KZF A;  2B5G B;  2J8N A;  1K4J A;  5AG6 A;  1QSR A;  4C2Z A;  2Q7B A;  3F0A A;  2P6G A;  2WSA A;  3IWG A;  5G20 A;  2HUZ A;  3EO4 A;  3S6H A;  5J8F A;  1ZO0 A;  4ONU A;  1N71 A;  2K5T A;  5F48 A;  1U6M A;  1MJ9 A;  3SHP A;  1L0C A;  2Q4Y A;  4BBH A;  2PR1 A;  1YRE A;  1S60 A;  5G22 A;  2P0W A;  2WPX A;  4A2Z A;  1P0H A;  4YRH A;  4F6A A;  4JD6 A;  4KOY A;  4KSA A;  3DR6 A;  4H89 A;  3KKW A;  5F49 A;  4QB9 A;  4CRZ B;  2WPW A;  1I12 A;  3MGD A;  2HQY A;  3LD2 A;  1NE9 A;  4KVM E;  2VXK A;  3DDD A;  4F0Y A;  1M4D A;  3D8P A;  2FCK A;  5C82 A;  2J8M A;  2G3A A;  4I49 A;  2DXQ A;  3IU2 A;  4HNX B;  4CGM A;  2R98 A;  2CNS A;  3EC4 A;  1XIX A;  2FXF A;  1S7L A;  1YR0 A;  5J8C A;  4U9Y A;  2PSW A;  4NSQ A;  3GY9 A;  3CXQ A;  4H6Z A;  3WR7 A;  3TO9 A;  3FIX A;  4R57 A;  4A95 A;  2R8V A;  3G3S A;  4MFQ A;  3JTK A;  1PUA A;  3TFY A;  1M44 A;  3EXN A;  4MFL A;  3FNC A;  2CNT A;  1CJW A;  1IYK A;  2Q0Y A;  3A9L A;  3R9E A;  3D3S A;  4Y49 B;  4CYP A;  2BL1 A;  3FB3 A;  4E0A A;  3FBU A;  2I79 A;  4PSX A;  1Q2C A;  1RO5 A;  2RC4 A;  1J4J A;  4QC6 A;  4ZBG A;  2BUE A;  1YVO A;  4EVY A;  4UFX A;  4A33 A;  1YX0 A;  1QSN A;  2QEC A;  3I9S A;  2Z3P A;  4UCM A;  2O28 A;  2ZPA A;  5IX3 A;  2X7B A;  2P6F A;  1YLE A;  2FIA A;  1YK3 A;  4MFZ A;  1IYL A;  4AVC A;  5G1Z A;  4E8O A;  3RYO A;  4PK2 A;  4B11 A;  3F5B A;  3G8W A;  4R9M A;  2GAN A;  2G3T A;  2OZU A;  4OLL A;  1SQH A;  3V8I A;  1V0C A;  4RI1 A;  3SXO A;  4PSW A;  1QSM A;  4UWJ A;  4ORF A;  4AVA A;  2PDO A;  4FD4 A;  1S3Z A;  2DPS A;  1LRZ A;  2QIR A;  4MBU A;  2REF A;  2Z3L A;  1NSL A;  1ON0 A;  3VWD A;  4NF1 A;  4B5P B;  4F0X A;  1KUV A;  2B5G A;  4UCN A;  3S6F A;  2P6E A;  5F46 A;  4KOR A;  3R9G A;  1KUY A;  4JWP A;  2JEV A;  1QSO A;  2FT0 A;  3VWE A;  1MJA A;  2B3V A;  5JQ4 A;  2ZXV A;  1KUX A;  4A32 A;  4B5O A;  1XF8 A;  2AJ6 A;  2FE7 A;  2YND A;  3R96 A;  3T9Y A;  5DWM A;  4CAV A;  4MY0 A;  4JXQ A;  3IWE A;  3TE4 A;  3D2M A;  3OWC A;  4QBJ A;  4K30 A;  2KCW A;  3BLN A;  1OZP A;  5JPH A;  3N7Z A;  4CAF A;  5DWN A;  2Q4V A;  4UWI A;  4XNH C;  3S6G A;  4CYN A;  4KS9 A;  3D2P A;  2DPT A;  1S5K A;  2OZG A;  4L89 A;  1QST A;  5ISV A;  4YGO A;  3EFA A;  3E0K A;  2PQ8 A;  4AB7 A;  5F47 A;  4KOS A;  2JLM A;  2Z3O A;  3W6S A;  3P2F A;  2C27 A;  4R87 A;  4C7I A;  5BWA B;  4XPD C;  4FD7 A;  4J3G A;  2B4D B;  2QML A;  4C7H A;  2I00 A;  2R1I A;  4MI4 A;  2Z3M A;  3I3G A;  4CRY B;  5EBV A;  4E2A A;  2R7H A;  4L8A A;  5KTC A;  3R95 A;  3ZJ0 A;  4RS2 A;  4XPL A;  5AG4 A;  1VHS A;  4JXR A;  3R9F A;  4KOT A;  5FVJ A;  4CAW A;  2FS5 A;  3ZZI A;  2G0B A;  5A27 A;  4A30 A;  1M4G A;  1TIQ A;  4AG9 A;  1Z4E A;  3FYN A;  2B3U A;  2F5I A;  2H5M A;  3S6K A;  1R57 A;  3LOD A;  1YVK A;  4CAX A;  4IF5 A;  2Z10 A;  2Q44 A;  1Z9U A;  3DSB A;  1NMT A;  4UCP A;  5CNP A;  4CGN A;  3B8G A;  3QAH A;  4A31 A;  1Y9K A;  2HV2 A;  2YNC A;  4MFK A;  5KTD A;  1P4N A;  1I21 A;  4B10 A;  1VKC A;  3EY5 A;  2ARH A;  2CXA A;  2PR8 A;  1Z4R A;  4KVO E;  4KOX A;  2ZW5 A;  3TCV A;  3BJ7 A;  4NEX A;  4Q38 A;  2B4B A;  1CM0 A;  3K9U A;  4UFV A;  3CXP A;  3JVN A;  4CGP A;  4UFW A;  1B6B A;  4MFP A;  3P2H A;  4M85 A;  2VI7 A;  4R3L A;  3H5Z A;  5EC4 A;  2JDC A;  5IV0 A;  2AE6 A;  3R1K A;  4B5P A;  2NMT A;  1BO4 A;  4H6U A;  5AG5 A;  2Q04 A;  2BSW A;  5KTA A;  4QUS A;  2VEZ A;  4XNH B;  4MHD A;  4AVB A;  2VQY A;  2Y0M A;  4CGO A;  5HMN A;  2VZY A;  4C2X A;  5I0C A;  1XMT A;  5HH1 A;  4HNY B;  3TO7 A;  5E96 A;  4X5K A;  2YNE A;  4HNW B;  3SXN A;  5GCN A;  4JLY A;  5A28 A;  4MJ8 A;  3H4Q A;  3NE7 A;  4JJX A;  4B13 A;  2CNM A;  4OAE A;  4C2Y A;  4XPD B;  5AGE A;  5C88 A;  2YGW A;  4B12 A;  1MJB A;  1YGH A;  3QB8 A;  3DNS A;  4FD6 A;  3T90 A;  1RXT A;  1S7F A;  3GKR A;  3TOA A;  2CY2 A;  2PC1 A;  4QVT A;  1BOB A;  4M3S A;  3DR8 A;  3FXT A;  2VZZ A;  4LX9 A;  2EVN A;  4KOV A;  1S7K A;  1Y9W A;  2EUI A;  3FRM A;  2OZH A;  4KOW A;  5G21 A;  1UFH A;  4OAD A;  1M4I A;  3PP9 A;  2FL4 A;  4NCZ A;  2A4N A;  2Z3N A;  2ZW4 A;  2ZW7 A;  2B4D A;  2FSR A;  3GYA A;  1FY7 A;  1IID A;  4CS0 B;  4Q36 A;  3TT2 A;  5H86 A;  4KUA A;  4PV6 A;  3W91 A;  2ATR A;  1WWZ A;  2OH1 A;  3CXS A;  2PRB A;  1Y7R A;  4UA3 A;  2J8R A;  2GE3 A;  1Q2D A;  4CGL A;  2OU2 A;  4NXY A;  2Z3K A;  4GS4 A;  5H84 A;  3W6X A;  4C68 A;  4FD5 A;  4CAE A;  4R3K A;  2Z0Z A;  4II9 A;  4XPK A;  4KUB A;  4PK3 A;  2OB0 A;  4KLV A;  1PU9 A;  1XE4 A;  1XEB A;  1Q2Y A;  3IU1 A;  1MK4 A;  2JDD A;  2REE A;  2WUU A;  2GIV A;  4KOU A;  3C26 A;  2ZW6 A;  2D4O A;  2IL4 A;  5AG7 A;  2Z11 A;  2FIW A;  4HKF A;  1I1D A;  1IIC A;  4KZT A;  3IGR A;  4U5Y A;  4DNC A;  3PZJ A;  4B14 A;  4MFJ A;  2BEI A;  3F8K A;  4U9Z A;  1B87 A;  4CYQ A;  4BMH A;  4KVX A;  1M1D A;  2VBQ A;  1GHE A;  4ZGY B;  4Y49 C;  3UY5 A;  4MY3 A;  4UBR A;  4AG7 A;  1S7N A;  1IB1 E;  2B58 A;  4YFJ A;  4CYO A;  4IUS A;  2D4P A;  5IB0 A;  3PGP A;  3TOB A;  4LUA A;  3TTH A;  3TO6 A;  4KLW A;  2YNC C;  3BJ8 A;  1WK4 A;  3JUW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...